2PTUA

Structure of nk cell receptor 2b4 (cd244)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Natural killer cell receptor 2B4
publication title Structure of natural killer receptor 2B4 bound to CD48 reveals basis for heterophilic recognition in signaling lymphocyte activation molecule family.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11465 Receptor_2B4 Natural killer cell receptor 2B4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ptuA00
4X7DC 2BFVL 3QRFM 2WBJC 5DZOA 3HC3H 1QSFE 3IETA 5JOEA 1UWGL 4P9HH 1MCCA 5TGBA 4P3CL 5LKNA 3IKCA 3DV4B 1DQLL 3IDGA 2WZPD 1N7ML 2GJZA 1KIUA 5FGBA 4G8EB 3ROOB 2EYTA 3BT2H 3V52L 1AQKL 3VXMB 4P99A 3IFLL 3KGRA 2BVPA 2NNAA 1H5BC 3Q5YA 5ESAA 5J6GA 4M3KB 5IW3A 2Q87A 5ILTH 1BQLL 3GSUA 4M03A 5T3XD 3MX0A 5CGTA 4MAUL 3VH8A 2DTML 4GAFB 4F7MA 4U1GB 5M7QA 5TDOA 2NY6B 1J18A 3JTSA 1FGNH 3K80A 3ILQC 2XT1B 4KRMB 1P7QD 5T3ZL 1S7SA 1WBXB 2JCCB 5E2TL 1IGML 2F54B 5C08A 4HIEA 1N6QH 1DBAH 4FZ8L 3NIDE 4JQVA 1YEKH 1T0MA 2XRAH 3ESUF 3GMOB 3TA3C 2DQIL 1A0QH 3NA9L 3GSRB 2HN7A 1FIGH 2VLKA 3QDME 4GOSA 4JGJA 3TT3L 1XGQA 4N68A 1OTTD 2R0WL 5H2BB 2EYSB 4J6RH 4Z95H 1C1EL 4NO3A 1RJLB 1EIBA 4OB5H 1Q9WA 4XNUH 1OT2A 2H2PC 3VGEA 3Q0HA 2HFFA 1T3FA 2W0FB 4JQIH 1TVDA 2GYSA 5IVNA 5E8NA 5E8PA 1KLUB 3VMOA 1NGQL 4YAQB 1JFQH 4HJ0C 4ZTPL 3ARYA 5E5MA 1A02N 1MI5A 1RJYB 4U33A 4UIKL 3GIVB 4JFPB 4PJ7A 4YHIA 4BQ8A 2ED8A 3WKNA 4QF1A 4G6KH 5FUZL 2ZNWA 1U93B 4PB0L 2DS4A 4PJ5D 1RUAH 4ZS7H 1VGEL 3LEVL 4U2YA 1AO7B 5J0BA 4OZIF 2F5AL 1UACH 1OWWA 2HVJA 4OUUB 4UQ2A 2HJKA 2EDJA 2W65A 1KFAL 3MLWH 4EBQH 1FVCB 2XNAB 1TVBB 1YC7A 5FO8B 1FCCA 1T66D 3BP6B 4QCIA 3C8DA 3NGBB 5FA3A 3V6OE 2QQKL 3ZSTA 5GRYA 2FD6L 3W5MA 3P4LA 1HHJA 1TLKA 2R4SL 2Q76A 4PIRF 5IBTH 1XF5A 5T33L 4K7PX 4KDTA 3VGDA 4EDXB 3EGSB 3GI8H 1RPQA 4RWHA 3T2NL 4M4PA 4F80A 4JAMA 2HLAA 4TVPE 1FRGL 3BHBA 2NLJA 4JRYD 3W0WD 4XCCH 2HTLD 5LXGL 2DQCL 2ED9A 2ARJQ 4OCSH 5AEAA 4Z0BH 1MQKH 1MWAH 3P3YA 2WP3O 3D1MC 1HILA 3VH8G 4WJ5B 1IGJB 1J5OH 5CD5D 5CKGA 1H3PL 3BH9B 3SCMC 3C9NB 3PIQB 1T80A 5EULV 3BZFB 3SDCB 3NIGE 3GB7A 5AWNH 5IEKA 1F3JA 5IQ9B 1IEAA 3OKEA 1K8DA 5EIQA 1ND0A 3PNWA 4BK5A 2V5MA 5C0GA 2HJFB 3D85D 5F8RC 3HPJA 3HE7D 4AEEA 1DCLA 2C3VA 3WV0A 2RAMA 3ARDA 1H8OA 1K5NA 1QR1A 1JYWA 15C8L 1LQSR 1PY4A 3MV9B 4P5KB 3RZCA 2A77L 4WHYH 4PRHD 4Z7VB 3KLAB 2IGFL 5HPOA 1T7ZA 5IFAL 1E0OB 1FG9C 1RV6X 3KPQA 3MTRA 3E3QE 4MNQD 2MPAH 1YECH 3H9YA 2IQ9L 3QYCA 1BLNB 4U1NA 2MTPA 4L5FL 3RU8L 5ITFB 2VLJD 4J3XA 4IRSA 3TZVB 3QH3A 3KYKL 2Z8VC 2AEPL 4YBLB 3MMEA 3OJDB 3VFGH 4LCIH 3OZ9L 1GZQA 2HG5A 2VDNH 3QIUA 3RNKA 3MLUH 5J11B 1KCSL 4MSWA 1T4KB 1ORQA 2DQJH 3OKOB 1T03L 2F19H 2YN3A 3DGGA 3VD5A 1BAFH 4DW2L 5IJVA 4YXLH 5KZCD 1E4KA 1BGXH 1OAUL 3EYQD 3KPOA 1LO3L 3VFOB 2APBA 3S36X 5DSCB 3UJIL 1K4CA 2FBJH 4YBQD 1F4XH 2KUTA 1KNOA 3EJZC 2VQTA 3L3GB 3R8BB 2JTDA 4NNPH 3TVMC 1G7HA 3QFJB 5DMKB 1BJ1H 4P5TB 3SGKA 4A2LA 4RDQG 3VXME 2VSDA 3C5JA 3CAFA 4IDLA 5C0CD 1AY1H 3QAZB 2NXZD 3IAPA 1MIEL 3ME0A 4NT6B 5DMGC 4JG1L 4LLVB 1RZKL 4NQTA 1IGTB 5JPNB 3MLVL 4NQCA 3X12A 4P2OC 4NFBA 3DRQA 4H20L 4X6CB 4X4YA 2EDWA 4L29B 4XPGL 1SJHA 2AJYH 4V1DB 4M1GL 4WTWA 4KZDH 2PYFA 3KPNB 3O8XD 1FAIH 4FQCL 5ISZA 4M1CD 1J05B 5DK2B 5H94B 2VL5A 5MEQB 5IJKC 4AT6A 1Q94B 3JV0A 1E6JH 3F5WA 2C7UA 3HI6L 2LTQC 4LGRB 3X11A 3BQUD 1V3MA 4QHMA 3LY6A 2G9HB 4KTDH 3V0VB 2NMSA 1YY9C 3ARBD 4PJDB 1CE6B 2OM5A 1QQDB 3MGTB 1C7TA 2XZAL 3T3ME 3A6BH 2AK4A 4N0CD 5L2JA 3UTSB 4LOUD 3LHPH 2H26A 3FQXA 5KSVA 3UTTB 1BVLA 1U8JB 3TN0C 4RA3A 2EXWD 4PS4H 1A1NA 4KRPD 2ZOLB 5I0DA 4IDJH 3PP3K 1I7ZA 3HA0A 5JW4M 4GXVH 1IKNA 3EIFA 3VD7A 1I3RB 3BX7C 1XCTB 4XNYL 2AJVL 2OTWB 5HBBA 4HS6A 3MLYL 5DQ9B 1KXVC 1AFVL 1JJUA 4QRTA 1KTKE 4PJEA 5B8CC 4HKJA 3FFCA 3RWIB 1MJ8L 2ZUXA 4DUWA 1TITA 5D7KE 1U8HA 3WIIH 4XCYA 3CDFA 2FJHA 2QQNL 5T5FL 3L3HB 4O58L 5JQ6H 4QRRD 4ZUUB 3F65A 3MUJA 3QEHB 5EBLA 2XTJD 4QOKE 4KUZL 5JXEC 3DRTA 5C2UB 5GZOC 4R4NC 3IRZA 3VFMB 1T83A 4D9LH 4U6VH 3H2WA 2I60L 1MLBA 4GW1A 4FQHA 1S5IH 4P57A 2PUQT 4HIXH 1DVFC 4Y1AD 3QXAB 2NY4B 4D0BA 1KC5H 5DTFB 4XGZB 2F9BT 1PG7H 3Q3GA 3NABH 4PJXF 2G75B 3NACL 5C0BD 4ETYA 3U0WH 3AFLA 5KJRH 4WUUB 2MCPL 3LKQB 4OZGF 4B50A 1LO4H 4RA0C 4OQ1A 5GGUA 5D7SH 2CDFB 1OP3K 2HT2C 4HK3N 3UTPD 1B4JL 4HBQA 3U4EB 1M05B 2OCFD 4W6WB 5F1OB 2WNGA 5E1AA 4TTGA 5C8JA 3N0PB 5ESVA 1MJ7L 5CJOH 5I16A 3JUZA 4KTEL 3QIWC 3L3DB 4RGNE 2W9DL 4DCQB 4HG4J 4JFQB 1Q9LB 5DJAA 4UIMA 3BYTA 4NFDA 3MLTA 5DRWB 1F11A 5IB4B 2PCPA 2YZ1A 2JIXD 1URLA 4WWKA 5AAMA 4XCFH 1IBGL 4D2NA 2D4DA 2CLZA 2ZUSA 5I1EH 4TULL 3V0WL 1JMXA 4RX4D 4MQTB 1YN7B 3C6LB 2OP4L 1CK0L 1T1YB 4HS3A 4CDHA 2P5WD 3QJHA 2D7TH 2PO6B 2P4AB 1T2JA 3WNOA 4I0KA 2A2QT 3ZL4L 4TOYH 1MVUB 1GGIH 3MROB 4W70A 4JR9L 3MV9E 2NX5B 4XTRC 5EU5A 3MNVA 3TC9A 3VXQA 4KFZC 3LV3B 1P7KB 2DD8H 5JLZA 2H6PA 4HLZH 1DANU 1RU9H 3ARGC 1S9YA 1R3KB 1BJMA 1NBVL 4HSQA 3GJFK 3T65A 1VFOA 4NQEE 3CIQA 1U8OA 2ESVA 3LS4L 2XA3A 3U7WL 1LK3L 1BBJA 2R1WB 4P2RE 4MVBD 3TF7C 2IAMB 5I73B 1T0NB 2F58L 2VISA 1AJ7H 1T2XA 4PREB 5F7HA 2FHCA 1KIPB 3DVNB 4GFTB 3SDAC 3DX8A 4Y4FC 4RIRA 4XX1G 5JW3H 3HG1E 3OAYH 4MWFA 3AUVA 4NRZA 1IL1B 1HCVA 2EDFA 2WBJD 4X7FC 1D5IL 4PJ9C 4X83A 3MOQA 5K9QG 3T4AB 1NJ9B 3MODL 3DV4A 5F1SA 5T1KB 3JUYA 3B2VL 1CIDA 1Q72H 2RB8A 3MCKB 4G8EA 4WCYH 3RX7A 4EI6B 3ROOA 4P0DA 4Y16B 3FJTA 1RVFH 5F7FA 3C09C 4M6OH 1UQSB 4NZUL 1FVDA 4POUB 3F7QA 5A40E 2R2HA 3QFJE 3WL9B 2B4CH 3IDMB 1T21B 1VA9A 3QWQB 2D7PA 4ERSH 5C0RH 1CDJA 1OGAD 1NKRA 1RY7B 3EO1B 1WBXA 2JCCA 2F54A 3R4DA 4Y4HB 4YZFF 4Z7UF 3OV6A 3KXFB 4JZNA 3GMOA 2B8OT 3KPSE 4V1DE 2Y7QB 1P5UA 1Q1JH 1L0YA 4POYA 1L7IH 3GSRA 1OTUD 1YZZA 4IMLB 5SWSB 3MUGB 5IT2H 4HF5H 1VKXB 5DURD 2EYSA 5SWZB 1WAAF 5C0AD 3V9FA 1RJLA 4G42B 1MLCB 5F1NB 1SYVB 1UM6L 4P23B 1N3NB 5DC0A 3G6JB 4S1DC 2H2PD 3NFNB 5E1HB 3WFEL 2W0FA 3ZKMC 1KLUA 3DNKA 5D1ZA 4YAQA 1GZPA 3PWPE 5CEZE 1RJYA 3GIVA 4YR6B 4JFPA 5ID0B 2FBOJ 5CSZA 2Y07L 5GGQH 3X3FL 1AO7A 1EEZB 3I6KB 1U36A 5IBUB 2JJSC 4UT6H 2NTFB 4AG4H 25C8H 2ZUQB 4NKIH 4OUUA 4WGVB 3CCHB 3OG4B 2VE6B 3NCYP 1FVCA 2XNAA 1TVBA 5FO8A 1AKJB 1CFVH 1TETL 3O6FB 3BP6A 3GHBL 4OGXL 1WT5A 2FCBA 2ILLA 2V9QA 4EZMA 1MHEB 1I1YA 3SN6N 4OD1L 4C4KT 3LS5L 1MJUL 4EDXA 3EGSA 3S35L 4J3VA 4XPTH 1YEIL 4PP1D 3FOLB 5CCKH 3RIAK 2FJGB 4ODHL 3TO4B 1Z5LB 2DN7A 5DEZA 4GLRH 3HUJE 2DMBA 4KVNL 5GS2D 5LVEA 1C5BL 5EA0L 3CJJA 3WFBH 4WJ5A 4KK6C 1XIWB 3BH9A 1KN2L 3C9NA 3PIQA 3SCMD 5KVEH 5FXCH 3NZ8B 1JF6A 3BZFA 5EZJB 2CGRH 3SDCA 4NBYB 4KDWA 1OAZH 5IQ9A 2WW8A 5HHPB 5BV7B 2XWTB 1FO0L 3MOBH 3U83A 3VWJD 1W72B 2HJFA 3S96A 2VSCA 1FL6B 4DZ8B 4KQ3L 5I8CA 3BKJL 3QQ3B 1CFSB 3B9AA 3QG6A 4XRCB 1MREL 2DQUL 4P5KA 1W8NA 4XVTL 2ITCB 2Y06H 4Z7VA 3KLAA 2COQA 4WGWB 3P30H 3FMGH 1LE5B 4GSDH 2NX5E 2HFTA 2ZSWB 1BLNA 1HZHH 1OSZB 4M48H 1T6WA 5DK0B 3BXNB 5GGTH 3PGDB 5ITFA 1AQDB 1FNEB 1KJ3L 3TZVA 1QNZL 3VDAA 1IAIH 5ACMA 2I07B 4IRJD 4PJAE 3HFMH 2R1XB 3IYLW 3QI9C 3PF2A 1NGYB 3TH3T 2VLRD 3B9VA 4XHQA 2FSEA 4HCRL 3IVKB 1PQZB 1VERA 1WITA 3MREB 4M5ZH 2CRYA 4QTIH 3IDNB 1WIUA 1W8OA 4XBEL 4JFOB 4L9DA 4PJBB 4NSKA 1T4KA 3B2UC 1FNSL 3N1MC 4KUCD 2ATKB 3OKOA 2XY1A 5A2FA 1ZKAA 3VFOA 5DSCA 1KLGB 4Q6IC 3SDXE 3WD5L 4N9GA 5IWLC 4R96B 3ZHDA 5KW9L 2IANE 3EJZD 4F7TA 4Z8FH 1R3HB 4N8PA 5M94B 2EXYD 4DJMA 3Q1SL 5EOQL 2NXYD 5DMKA 4P5TA 5EBGA 3WNPA 2YXFA 3KR3H 3PDOB 3WSQL 2XA8H 4U1MB 1NC2B 4K3EH 4NT6A 1MFEL 1XGRB 4LLVA 2V2XB 5JPNA 1IGTA 1NCTA 2BY1A 5F93C 3TBSB 2AGJL 3BZDA 4OF5A 2QKIB 4G5ZH 2X9XA 4P2OD 5TDNB 3BGFB 4X6CA 4L29A 1EHLH 4L3ED 5IB3A 4FXGA 2JF1A 1ZEAL 5L6YL 1GYAA 5CD3B 3KPNA 3ES6B 1NUNB 1ZXQA 4OQTL 5E2UL 4YXHL 4OT1H 1J05A 4GG6E 5DK2A 1WQVT 5B39B 4L8SC 1Q94A 4ZPVB 3W39B 5FK9B 1NCNA 4G9FB 4M7ZB 1PY9A 5D93B 2G9HA 5CUSL 1YN6B 1J0YA 4PJDA 1CE6A 1YY9D 2SEBB 1QQDA 3MGTA 4ODTH 2WINB 3CH1B 1FBIH 1QBBA 1YEEL 5L2KD 1B90A 2VC2L 5E8EB 3UTTA 1U8JA 2BXYA 2D31B 4BYHA 3TN0D 1YMHB 1JNLL 5HGDB 5IQ7L 2DQDL 5IFHL 3UCRA 2HLFC 2ZOLA 3UEZA 5JIHA 2Q8BL 5DJZB 2J5LC 1I3RA 1FZJB 1GRWA 4LSRH 5BRZB 3BI9X 3W2DL 5ADOH 4HFWB 2JKXA 1XF1A 2OTWA 4QRUB 3RRQA 1LP9F 3CX5J 5ITBH 4AYFA 5HVHB 5DQ9A 2EC8A 4LSVH 3BRGC 2DYPA 2QSQA 2DM7A 4IIQA 4XAWL 4M61B 5I71B 5C3LD 2E8YA 1V3LA 3RWIA 1WUNT 4OV5B 5EUOF 3OR6B 3ISWA 5FF6B 3L3HA 1JPFA 1D6VH 3QUZC 4ZUUA 4H88L 4OFVA 1FV1B 3RFZC 3U2SB 3SY0B 1Z9MA 1YEHH 5GZOD 1J10A 3VFMA 2AEQH 4R4ND 3TYFB 4TSCL 5C0DA 5DC9B 1DTUA 2WP3T 1DVFD 3QXAA 3HE7B 3EYVB 2IFFL 5DTFA 4DK3A 4XGZA 3NPSC 1EHAA 2D03H 3IDUA 3NCJL 1NLBH 3SDYL 4WUUA 1UJ3C 3LKQA 1FNFA 1Z0MA 4LHJB 2GW5A 4F9PA 4X9HA 1YNKH 1CGSL 4Q9QL 1T04B 3U4EA 1M05A 5TQ0L 4JN1L 2FATH 4XWGL 2DQTH 4U1KB 4PJHE 1Z9LA 4P4KD 4RMWA 4OGAC 3L3DA 4IMKA 3BGMB 2OL3B 4QXGH 4M62L 4EIZC 1Q9LA 1A7BA 1EHXA 5DRWA 3BMVA 4D0DB 5IB4A 5D1XC 4AK1A 1II4E 4RSVA 4JM2B 4ZFOB 3VRIB 3R06B 6FABH 3U30B 1YN7A 1G0XA 1KENH 3FFDB 3C6LA 4NC2B 3TP4A 5HYJE 2Z31B 1T1YA 2FNBA 5KZCB 3FN9A 3SEPA 3LMJL 1A6TB 3S5LB 1TZIB 1FSKB 2PO6A 3KPRD 1KT2B 4M7JL 3HAEB 1MVUA 1NBZA 4WFHD 2X4NB 2EDTA 2R56H 4BELD 2O5XL 2CJUL 5JO5B 2H8PB 3LV3A 4XTRD 1P7KA 1KULA 3OG6B 4P2YA 4RAVB 4YHZL 1R3KA 2WANA 3T08A 3T0VA 3FB5B 4P46D 3T2OA 4EKXA 3FO9B 2VQ1B 1WTGT 1KCVL 3O3BB 3DI2B 5I1KL 2VXSH 2NY5L 2R1WA 3D6GA 5T3XE 2IAMA 4HKXB 1T1ZB 1T0NA 5EWIL 5EU7C 3VDBA 4PREA 1MFDH 3C8KB 1OWRM 3CLFL 1AGBB 1KIPA 3DVNA 3O45B 4OBRA 5BO1L 4LP4A 4I4WB 5F72S 4PRPD 4Y4FD 4RMUA 5A2LH 5D96C 1CGVA 1X5AA 3O8XB 4GLRI 4WI4A 5JTWA 5KTEH 2IALB 2BCKA 1IE5A 3T4AA 4JVUA 3I84A 4JQXA 1NJ9A 1A14H 5DT1L 1HXMB 5DUMH 2A6IB 2B7DT 2R2EB 5T1KA 2OZ4L 4NJ9H 2IH1B 5F7NC 3GK8L 5EORH 5I74C 5FHBH 3MOAL 5FHAL 3ZTJG 3MCKA 2VAAB 4Y4KB 1CDGA 4Y16A 4JN2B 5C0NC 2XZQH 3VGBA 1UQSA 3CZJA 3M45A 5GRZA 1HDMB 3WL9A 2E6PA 2ARWA 2AJXL 3IDMA 3WMSA 1T21A 1ODAA 5LGHL 4LQFH 4HWUA 3V6FA 5CFHA 2ADFL 4K3JH 3X3GL 1D5XB 2QADD 3A6CH 4DVRL 3I6LD 2RHEA 3EO1A 2I9LB 3RUGE 4Y0GA 4Y4HA 1ADQA 3Q48A 5BW7C 4QHKI 3CK0L 3KXFA 4PJ5E 5EO9B 2Y7QA 4LPWA 4LARL 2Z9TA 4IMLA 5SWSA 2JJTC 3OQ3B 3MUGA 4XP6H 3ZE2E 4QRRB 5I8KL 2QSCH 1VKXA 1KB9K 2BSTB 4FFZL 5SWZA 3GSNB 2XTJB 3V8CA 1IAII 1K2DB 4HMCA 4G42A 1DQML 1MLCA 5D5MB 3WUZA 1T5XB 1SYVA 4NQVB 3WIHA 3AB0C 4ZPTB 1OOAA 4JDTH 5AAWA 1KCUH 5GZNC 1N3NA 1B0GB 2K7PA 3G6JA 3NFNA 5MEPB 4S1DD 4Q9RL 3ZKMD 1ZHLB 5GHWH 4OLWL 3AROA 3MCLL 5C0BB 3PL6D 4MQ7A 4YR6A 5JHLL 4LAQL 5CLWA 3P73B 4UTBH 4O02H 1KCKA 4BK4A 2VUOA 4P3WA 4JRYE 3W0WE 1WV7T 4RAHA 5D7JC 1EEZA 4C59B 4JFFB 2RIKA 2NTFA 4OTXH 3BKCL 3LKPB 5EIIA 2FECI 4OCXH 3CCHA 4OI8A 1I7UB 1JNHA 4JZOB 4F15B 1U9KA 5F71A 1PZUB 2VE6A 1IZJA 3RBSA 1SM3H 3RA7H 4HPYL 4AEHH 3MBXH 1IGIL 2EZ0D 3O6FA 5TF1H 1FZOB 4ODSL 4Z7WE 3IXAA 4MA8L 2JJVA 1Z6JT 2BZDA 1MHEA 4K94H 5IB5B 2DQGH 3MLRL 4HIJA 1TTFA 3HB3C 1L0QA 2P5WB 1EVUA 1YPZB 3QZWB 3DYOA 3DMMC 5BS0A 3FOLA 5KANG 5EZIL 2VDLH 4FN0A 4U6XB 2FJGA 2ICWB 2XQYK 1J0JA 3TO4A 1Z5LA 3ELAT 4PD4J 4PRHE 2HRLA 2IBZX 4S1SH 1Q0XH 3CFEB 4GMSH 3L95B 4H0IA 4MNQE 1XIWA 4I0PD 4KK6D 3BE1H 3EHBC 3S37L 1KIQA 3NZ8A 5EZJA 1DBJL 1DZBA 3MO1B 2VLJE 5I1GL 4L8DB 3G5XB 1Y6NR 2HMID 3QXTA 4HG4K 1KN4H 5HHXH 5C6WH 1TQBB 5HHPA 1K6QH 1WFNA 3D5OF 4NIKB 3TCXA 2XWTA 4PFEA 4X4XA 4P9HL 4QY8A 1W72A 4GAGH 1FL6A 4K3GA 5FCSH 1U41A 1CFSA 4XRCA 5IVXB 3BT2L 1FNGA 3FT3B 2ITCA 4W68A 3EJJX 5IROA 4PLKD 1F4WH 1CD1B 4GBXA 3O6MH 4LSQL 1BFOA 1H5BB 2ZSWA 1DFBL 3QPXH 1OSZA 3H42H 1ETZB 3BXNA 3PGDA 4WUKH 1FGNL 1AQDA 1FNEA 3C5ZD 2HJLB 5HYFA 3N06B 5C0CE 1IKFL 1G9MC 2NY0B 5JIKA 1MH5B 2R1XA 1IGYB 4S1QH 2AK1H 1N6QL 1DBAL 4XH2B 1NGYA 4BZYA 3QI9D 2AERT 2XRAL 4RAUB 5HDBE 2VZUA 3IVKA 3RGVC 5IBUG 3MREA 5DVLA 4AQ1B 2NZIA 3IDNA 1H8NA 3LZFH 4JFOA 4PJBA 3WFCH 4ZAKC 1JTOA 2X1XR 3TA3B 4OCWH 4J6RL 5CIPA 4Z95L 4LSUH 1CLZH 4Y19D 4EUPG 4XCEB 3DUSB 4HUVA 5D7IB 4UINL 1A64A 5GRXG 5T1LD 4XNUL 3L5IA 4ODVH 5DURB 4YFEA 3IFPA 4KV5E 4R96A 3QISA 5BVPH 1KJ2B 2YBRB 4NOFA 3P0VH 1R3HA 1YQVH 1J7VR 5CMAB 3OL2A 4FQXC 2E7HA 4FQ1H 1IFHH 2BDNH 4MHHG 4OCRL 3PDOA 4WI2A 4N5UA 4G6KL 2A6DB 4U1MA 2HWZH 2AV7B 1NC2A 2NZ9D 1RUAL 1XGRA 4ZS7L 2V2XA 5DWUL 3TBSA 3UJJH 3G5YB 5TDNA 5BZDB 4KKLD 4MCZA 3BJLA 3MLWL 4JANB 2W1NA 4EBQL 5CD3A 3ES6A 1XEDA 4JFHE 1QHOA 4Y5XA 4MJID 5B39A 2MMXA 5CZKA 1F3RB 4HXBH 4X7TA 5FK9A 4NZDA 3BIBX 1FPTH 4G9FA 1FLRH 2QHRL 4M7LH 4D9QD 1YN6A 3GSVB 4QRRE 2P45B 4PBXA 4WEMB 2SEBA 1N2RB 3DSFL 2WINA 3CH1A 1X9QA 4W81A 2BXZA 2X70A 4HV8B 3FN0H 3GBNH 4N0FB 3OAUH 5D2NC 3QR2A 5D5ME 2VN4A 5K9QI 2PF6A 5E8EA 4X8JB 3CXHK 4LGSB 4Y1AE 4XCCL 3WXVL 3TBWB 2D31A 3WS3B 3TWCH 1YMHA 5HGDA 1AC0A 4OCSL 2X4QB 3QDGD 4Z0BL 1EHNA 1MQKL 2YMXH 2HLFD 1MWAL 1YEGH 3VXOB 5H37H 5C0BE 1X3DA 5DJZA 5CZXC 1FZJA 1CT8B 5BRZA 1J5OL 1IC5H 3ECBA 4HFWA 1EZVX 4QRUA 3DO3A 4RFEA 1ZHKB 2CXKA 3UTPE 2XZCH 5T1MA 4M61A 5AWNL 1E6OH 1OTSC 5EZOH 4L8BB 4G8IB 3OR6A 1LGVA 3SCMB 3BISA 2V7HB 2LAAA 3NCCB 4U1HB 4NRYA 3QUMB 2ICCA 4PYHA 4S11A 1UKQA 5IBLC 3U2SA 3SY0A 5FDWB 2A0LD 1EUTA 3Q5TA 3TYFA 1K4DB 5IV2A 5KOVC 2OJEB 3NCYS 3EYVA 4I3RH 3QUYC 1O5DT 4ZQKB 2P5WE 5J89A 4FQ2H 2CKNA 3QHTC 5L8KB 2D0FA 2PTUA 1GCFA 2ORBH 4LSPH 2H32A 1G6VK 1KSRA 1T04A 3A6OA 3BVNB 3VD4A 2ICEB 4U1KA 3ALPA 3ZDXE 3NIDF 3MNZB 4P48A 4JE4B 2VDNL 2Q8AH 3BGMA 3KG5A 3MLUL 3W11D 1IAMA 2RJMA 4HD9A 4D0DA 1EJ6A 5CP3H 2CR3A 2FX8L 4AENB 1UWEH 2DQJL 2VLRB 1OP5K 4ZG1A 1J1OH 2F19L 1NBYB 1BAFL 4JM2A 4CU6A 4YXLL 4GKNB 4XWOD 2VDRH 1BGXL 4ZFOA 3VRIA 3R06A 3ZKQD 5I0ZA 3B6SB 3FFDA 5C0JB 1V7MH 1JHLH 2FBJL 2Z31A 1F4XL 2DM4A 2P8MB 1A6TA 3NMEA 1TZIA 1KT2A 4DGVH 1EGJA 3WE6B 5E7BA 2CIKB 2X4NA 5IVXE 4HT1H 4I0CC 1U8PA 1XR9A 4HUMB 1AY1L 4RAVA 2ZSVB 2WWMC 3FQNB 3TVMB 1IT9H 1H3GA 4F3FB 3FB5A 3JWNC 2D0GA 3FO9A 2VQ1A 3O3BA 3DX6B 3K4DA 4JGMA 3BZ4B 2A1WH 2AJYL 1T1ZA 3RPIB 2X40A 3LEYH 1FAIL 3O45A 1FFQA 2Y6SC 4BSJA 4I4WA 1ZT7B 1OGAE 5GS3A 4L3EB 3SBWC 1E6JL 3K8LA 3OR7B 2KZWA 4KTDL 5C7XH 4G9DB 3ZTJH 4WO4C 1HXMA 2LTQB 2A6IA 1PX3A 3CFCH 3A6BL 2R2EA 4KVCL 3FKUS 2IH1A 3LHPL 5CZVH 2VAAA 3BWUC 5CEXB 3VRJB 2BNRB 3T3PF 3U82B 4Y4KA 5C0AE 3DOSA 5FGCB 4JN2A 5DEGB 5FV2A 5C0ND 4IDJL 1RZFH 1S7XB 1HDMA 3BZEB 4X5XA 1YJDH 4I77H 3UO1H 3IJYB 4LVHB 1D5XA 3NIGF 3VXUD 2QQLH 4YDVB 3DO7B 2I9LA 1T22B 5KVFH 3WIIL 4N0UB 2AQ2A 1L7TH 1T89A 5JQ6L 1FYTB 3L1OH 3KAAA 5EO9A 4ZS6C 5B8CB 3ZKXC 5KSBA 4I8DA 4O51B 4X6BB 4D9LL 1S5IL 5FO7B 3ULVH 2BSTA 4HIXL 4LVNC 3GSNA 1KC5L 1K2DA 4B53A 4RMSA 5DA0B 3UYRH 2XXMB 3NABL 4ZPTA 3U0WL 4CKVX 1DVFB 4P9MH 5KJRL 5CILH 5GZND 1LO4L 4S10A 5MEPA 4JZJC 1INEL 3U4BH 1OPGL 4L4TB 3S3PA 1TQCC 1ZHLA 3HI1B 1DBMH 2DQFB 4NQXB 2ZZUT 1XR8A 3MC0A 3P73A 4AJ0A 5HGHB 2AV1B 3ORJA 5CJOL 4X5WB 1S9WB 1JGVH 5D7JD 4JFFA 4IOFC 1UZ8B 3F7VB 5HGAB 2VH5H 3LKPA 1CU4H 1EUUA 4UNTA 3MRFB 1I7UA 3PGFH 4JZOA 3QIWB 1N4XH 4XCFL 3UC0H 5I1EL 4S2SB 4FMFA 1LO2H 1I4FB 4ZUVB 4UV4L 1I9IH 4ELMA 4PR5A 1R5VB 4I1NB 5IESH 2XTLA 5T1DH 5LG1A 1CXIA 3GO1H 4TOYL 1GGIL 3H9ZA 5DC4B 3V6ZB 4Z6AT 1YPZA 3MA7B 3QZWA 1FFPA 1TPXC 2X4PB 3LVEA 2ICWA 4JB9H 4WTZA 2J2ZA 4ZOAA 3CFEA 3ARGB 4BH7B 5CBEA 3L95A 3QWRA 5L8LB 2IWGA 3O81A 1AJ7L 2EECA 4U0RC 1CE1H 4F7PB 1DLHB 4FQIH 4IOIB 1IQDB 2R0KH 3LKSB 2B1AH 1ZLWH 3EHBD 2EE9A 3MO1A 5JW3L 4L8DA 3G5XA 4PJGB 3STZB 5FAAA 4TUOB 2PTVA 5J13C 1QA9B 3SDAB 2BVYA 2WK2A 3QB7C 2VLRE 2HKHL 4KKAD 4UT7H 2AABH 1V7NH 3T3MF 1B88A 1M7XA 1ULVA 4Q9CA 3WIHH 2EC9T 5E99L 1ZA6B 4PJ9B 5J56B 1Q72L 4WCYL 1JIBA 2OJZL 1B6DA 3FT3A 4JFDB 3RVXC 1EO7A 4HUWA 4IRSC 3ZDYF 1P69B 4NN5C 2WQRA 3HE6D 2B4CL 3BESR 2CUIA 1N5AB 4ERSL 4LIQH 2GHWB 4GKZB 4B7LA 3S88L 2PW2B 2BVQB 3FT2B 3C87A 3QPQC 4IJ3C 1JRHH 2NY2C 2HJLA 1UB6B 5KOMC 4DKFL 5C71A 1ZSDA 1MH5A 3ZYOA 4ZFGH 1IGYA 4XH2A 5E00B 1CR9H 3LOWA 3D3VD 4DQOH 1TTUA 1T1WA 1Q1JL 1P53A 3D0VB 1L7IL 4OZFG 4L3EE 4FQQA 2JB5H 4HF5L 4YDLC 2W0KA 3TA3A 3OPZL 3CU7A 3T04D 2O26U 4XCEA 5J57B 5D7IA 1RHHA 1BP3B 2X4TA 4X4ME 1U2CA 1ACYH 4C54A 4KGJA 4PLNC 1NMAL 2AJ3B 5HYIA 2YBRA 5CMAA 5A16B 3DLQR 2Z91B 2VO5A 2DKSA 4HJJH 1FGVH 4KI5F 4DGYH 7CGTA 3GBMH 1PD6A 4J1UB 2PW1B 1XGUB 2AS5M 2A6DA 5L2KE 2KL6A 2YD2A 5GGQL 2AV7A 1I8MA 4WTZG 1XMWA 1Y6KR 4KXZH 3W81A 4NZRL 3G5YA 4UT6L 4AG4L 3OMZA 25C8L 4NKIL 4CMMA 2J6EA 4UUJB 4PJ8C 1DQQB 3PABB 4JANA 4OF3A 5FB8A 5BV7H 1CFVL 2D0HA 1NANH 2C5DC 3VD9A 1ZS8B 1W72H 4EI5D 3RY4A 3VFUB 5E6IC 8FABB 4DUXA 1IM9D 1HOCB 3GSVA 4LLUB 3P4OB 3WEXB 3TNMB 1N64H 1N2RA 3GMPB 4PGJA 4HV8A 2A38A 1IKNC 4N0FA 4XPTL 2FYYB 1U91B 4Z7VF 4C56D 3VFRB 5CJ8A 3LSOB 5CCKL 4NZTL 4H8WH 4X8JA 3SJVD 5FGRA 1IAKB 3B83A 3PV6B 2X4QA 1UXWB 5JW4R 5T3XH 1OAKH 3VXOA 4BSWB 2HVKB 4YHKH 3H6JA 3MRBB 3D0LB 1BIIB 4WI7A 1CT8A 3WFBL 1X4YA 5CZXD 1GL4B 4E0RB 5KVEL 4N5ED 1ZHKA 4GRWB 2CGRL 4FTVD 1OAZL 3V7MA 4L8BA 4G8IA 5HXMA 4KWUA 2V7HA 3BAEH 1PJ9A 4U1HA 3KLHC 3CVHL 3MOBL 1TNNA 5FDWA 5IBLD 1NSNL 2P8LA 5EU6B 3RVWC 1FN4B 1K4DA 2XKNB 2OJEA 3PWNA 4HEME 2E7MA 5DJ8B 3QUYD 3P30L 1A7NL 1TENA 1TDQA 4IBLT 1U8QA 1EBAA 3FMGL 5KSUB 4GXUN 1KCLA 1HQRB 4ZQKA 4NKDB 2P8PB 3HRZB 3KPRE 1JVKA 1HZHL 2APWA 4WFHE 1MCWW 4M48L 1MCKA 5GGTL 2OR9H 1VPOH 3BVNA 4MJ4A 4YWGH 2PXYC 3NN8B 5I8OH 2ICEA 5JDJA 2A6JB 2Y23A 4WWKC 4X6CF 4XP9H 4OZIE 4YIQB 3MNZA 4LAJH 5E4EC 1ZOXA 3ARED 4ZO8A 3QEGH 4M5ZL 5ANME 1CYGA 3CFKB 4WEBH 1AH1A 3QI9B 4AENA 4HWNA 2WQ8A 1O7VA 2WAHA 1UA6L 1NBYA 2BSRB 3HI5H 2C4XA 4K2UL 3VG9C 3KPPB 3S37X 3B6SA 3QEUB 4PRPE 5C0JA 4MXWH 2F53B 4H5SB 4PJDF 2IQAA 1A7PH 4Z7OF 4F2MA 2DM3A 4WFFD 1NUGA 2NY7L 1LEKB 4MNGB 3WE6A 2VLLB 4BFEA 2VLMD 3MZGB 2CIKA 3N1FC 3BEWA 3LCYA 1T7XA 3KR3L 1D9KB 4OV6F 4TUKH 4HC1A 2XA8L 3O3AA 2ZSVA 3TVMA 4F3FA 2XWJB 4LLDB 3IGAB 35C8H 4NBXB 1MJJA 4G5ZL 3DX6A 3P0YH 1C7SA 1UXSA 1QSEB 4NQDD 5KANI 3TPUB 1EHLL 3BZ4A 3RPIA 3T1WA 2Z8SA 4J3UA 3QT2A 2J88H 4HKBB 4Q6YA 4OT1L 1ZT7A 1RUMH 2V7NB 3I6LE 4QLRA 3OR7A 5L9DH 4K94C 1OF2B 4MJIB 4G9DA 2P46B 1GVIA 4L8SB 1CDUA 5IJKA 3REWA 4WO4D 3REVA 4ODTL 1TXKA 1FBIL 2VXVH 5CEXA 3U48A 1KOAA 4JLRB 3SQBA 3VRJA 2BNRA 2D3VA 5TDPB 3ZSSA 5DEGA 5ADPH 2X9WA 1LE9B 1S7XA 2VZTA 4G43A 1NCBL 4JY6B 3BZEA 5ADOL 2GAZA 5C08D 5JIPA 5ITBL 3IJYA 4LSVL 2OL3H 1N0LA 2QBWA 5BMFH 1CFNA 3CC5B 4YDVA 2VLKD 4KJQC 2IPUK 1T22A 2UWEA 2PR4H 4PRIE 5A43C 1CLOL 4OZHB 1FYTA 1NUDA 1JWUB 5KSAC 5B8CA 3RWGB 3T1FA 3QHZH 4ZS6D 4XPHH 4UOW1 4O51A 3D2UB 3ALWA 4X6BA 2AEQL 4AY0A 3S3JA 5FO7A 1PZ5B 4J12A 3QUZB 3ULVF 1EGJH 2LV4A 5D1ZC 5JXEA 5FYKU 3HAEH 3O3EB 1MI5D 1WWCA 2D03L 2HFGH 1NLBL 1FFRA 1CXEA 4L9LB 1YNKL 4L4TA 4IHOB 3RDTA 3HI1A 4NQXA 5HY9B 4HFUL 4DTGH 1UJ3B 5A1AA 1HINH 1PKQE 2FATL 2DQTL 5HGHA 2PKDA 4BZ2H 2APFA 2AV1A 3BKYH 3I50H 5IHUL 3LQZB 4X5WA 5CLTA 2HP4A 1S9WA 4LSTH 3GJFB 1L6XA 4QO1A 5HGAA 1WT5C 5DEFB 3MRFA 3WJLA 2EICA 3TYGH 3QIWA 3ULUC 1RJCA 2W38A 1JPGA 2W59A 1Z9SA 1LWRA 4S2SA 4ZOCA 5D1QA 3U1SH 1I4FA 1RFDH 1KENL 1HKLL 5D1XB 1VEMA 1BQHG 1R5VA 2FX9H 4KXZI 1SYSB 3S6CA 4H26B 3PQYA 1QLRB 1UKTA 1GSMA 2KPNA 5FM8A 3LB6C 3N50A 2R56L 4I48B 3V6ZA 4DFHA 3MA7A 3ABZA 3L7EB 1Y6MR 2X4PA 1CLYH 4HPOH 1NANI 3L3KB 5HHMD 1HYSC 3WCYA 1XT5A 3SDCC 2VXSL 4BH7A 3ARGA 2EIDA 5I18H 1A1MB 1NGXB 3GZKA 4FMKA 3OAYK 1MFDL 2CUMA 1DLHA 4OIAA 4IOIA 3ARFA 3LKSA 4XZUB 3PG2A 3DVGB 3AC0A 3FQRB 1JGEB 4PJGA 4K9EH 1NAKH 3U0PB 3STZA 4TUOA 4A6YB 1ZVHA 5JNYB 2IMMA 3TT1H 2DMCA 4JPKH 5KTEL 1MF2H 1QA9A 3SDAA 1BVKB 3RWDB 1A9BB 3CLEH 3GSNH 3RZCD 1A14L 5D96B 4NC0B 1AXIB 2D7NA 1MELA 5DUML 4FZEH 4TVPL 5EORL 3TIDB 1TNMA 1ZA6A 2CLVB 4PJ9A 5FHBL 3O6KL 5C1MB 1IC1A 5C0IB 3G6JF 3MYZA 4JFDA 2Q6WB 4Y19E 1IARB 2XZQL 3RVXD 4PJXE 3TZVC 1S5HB 3CDGA 5I74B 1KV3A 4IRSD 4GRMB 1KACB 1N5AA 3NOIA 3HRPA 1EA9C 2BJMH 2PW2A 3IAQA 4B5EA 3FT2A 3QIUD 4K3JL 5C09A 3A6CL 3QPQD 1UB6A 3GMMB 2NY2D 4G6FD 4U7MA 4I9WD 1JBJA 2CH8A 1HNFA 4GRLC 4NHCH 3D9AH 5E00A 3RX8A 1RZIB 4NC1E 4KROC 3D0VA 4RMTA 4R6UA 1AP2B 1H3TA 3MLXH 1JCKA 3BYYA 2QSCL 2X4OB 3VRLE 1WK0A 4U6HB 2AJUH 4PLJC 2M2DA 2BP3A 4MJIE 4JDTL 5DHVB 1NQBA 3CSGA 1QFPA 1GGBH 3JWDC 3L9RB 2NY1C 4JFZH 5D6CB 1CXKA 5GHWL 5A16A 2KKQA 2Z91A 4U0QB 1QD0A 2VDOL 1DQTA 2IPKB 4NQCD 2NCMA 1X5IA 5GQBA 2Q7NA 4GAYB 4MXQD 5EDXA 4J1UA 4O02L 2PW1A 1XGUA 3AM8A 4X6DB 2IADB 2MQ0A 2N4IA 3L5JA 4QXUH 3MRJB 5JA9A 5ISZD 3EDEA 3QDGE 4TQEH 4OTXL 3RPKA 1T5WB 4OCXL 4R8WH 1BWWA 2VZ3A 1AXSB 3DX9B 3QDJB 1DQQA 3PABA 5D7JB 4RNRB 3ETBF 1OB1B 4AEHL 3MBXL 3V5HB 3PHOB 4PBVC 4K23H 3JWOH 4GW5B 2W0LA 3EZJB 1NFDB 2AK4D 2P48B 3CSPA 4LEXH 8FABA 5E2WH 3BUYB 4OLXH 1HOCA 2DQGL 5GSRB 2H3NB 4LLUA 4U1JB 3P4OA 4ZOBA 3WEXA 3TNMA 1E4XH 1HE7A 5HGGS 4YGAB 2FYYA 1U91A 4GKOA 4YUEH 3LSOA 4DUVA 1I1FB 1IAKA 3DUUB 3MJ8B 5IW1A 1YMMB 3RKDC 2ARJB 1UXWA 4IIQC 4S1SL 3DMMB 4BSWA 2GJ6B 2HVKA 1PG7X 4GMSL 1RMFH 1JGUH 1A21A 1YYMH 2YPKB 3D0LA 1BIIA 3MRBA 3FFCD 4HUNB 1QO3B 3VXRB 1OHQA 4E0RA 1M4KA 1DEEB 5DMJB 3BWAB 1YEDA 1QPXA 2BERA 4WWID 1F8TH 3WUWB 4LPUA 4K07A 2O5YH 3KS0J 5HHXL 2CKBA 4Z7UE 5ELIA 5CINH 1OGTB 4ZUSB 4PJBF 1K6QL 4Z7NE 5ESQB 5DRZB 4XAKD 1JNJA 2OMNA 5EU6A 4N8VB 1FN4A 4KK8D 5DO2D 5GSVB 2XKNA 2BSED 5K9OB 5DRXA 1KJ2H 2P1YA 3GSWB 3PDGA 5DJ8A 1G7JB 5KSUA 1S9XB 1MRDH 1UWXH 4TSAH 1HQRA 4NKDA 1F4WL 2P8PA 3HRZA 1WF5A 3O6ML 1YJDC 1BBDH 4YBHA 5EN2B 3GSOB 4IMKC 3QPXL 1ZGLM 3B9EA 1KB5B 3EFDH 5EOTA 2J6EH 5HI4D 1I75A 2A6JA 2X5PA 4UOJA 2GUOB 4S1QL 3VFVB 2AK1L 4WWKD 3VFPB 1U92B 1I7TB 4RQQB 2G5RA 3K46A 1CTOA 3CFKA 3ZE2F 4TN9A 3DX7B 3D3VB 1F13A 3G9VA 4M00A 4WW2F 3WFCL 5DJ0B 1BWMA 1OM3H 2BSRA 4EIGB 1FJ1B 3RGVB 5EU7E 1KEGH 1A6UH 1DQJB 1CZ8L 5JXAL 5IB1B 4ODUB 1OL0A 1T2QH 3KPPA 3QEUA 2F53A 4H5SA 4ODVL 1VESA 4ZAKB 2UYLA 4MLSA 5BVPL 1G6RB 1LEKA 4E41A 5DD0L 4MNGA 5BQ7B 3P0VL 3PV7A 1YQVL 3ZT6A 4YNYA 5ID1B 1D5BB 4LPXA 4QNPF 5FGSA 1E4JA 1UH2A 1IFHL 2ESVD 4FQ1L 2DIAA 4S0TD 1D9KA 1MIMH 3K74B 4M6MH 1UADC 5FFLA 3GJEB 2IAMC 3B3IB 4HDIB 4GQ9H 5E8OB 3TBYB 2E6QA 2H41A 2HWZL 1RHFA 5JHDB 1R24B 3I9GH 3LN4B 2XWJA 4FQXB 3IGAA 5BZWA 4ONFL 4JFEB 5GS2H 3ZDZF 1QSEA 3TPUA 4BA8A 3VDCA 4W4OC 3G6AB 3PWUB 4HKBA 1GC1H 4YC2C 4JQXC 5I1LB 3QUMH 1FE8H 3VXUE 4Z7WF 4HXBL 1G9NC 4I13B 1FPTL 1FLRL 4LKCA 4M7LL 1OF2A 4L8SA 1I9RH 3KYMB 2JB6B 4NOBA 4ZXBC 1TVHB 4RBPH 2ZCKL 3QCUH 1O0VA 3GKZA 4N9OB 2YN5A 3OAUL 4RMRA 1IM9B 1XFPA 5CJXA 4JLRA 5JW5B 4E42B 5H35A 5TDPA 1NCWH 3TWCL 4XXDB 4C56B 5F3BA 3K1DA 1YEGL 5D7LB 4P49A 4XP1H 5KAQG 1LE9A 3C6SB 4JY6A 1IC5L 2F54D 1KTDA 1C5DB 3UX9B 2FEEI 1BQSA 3O2DA 4Y5VC 3QUKB 3CC5A 1AE6H 1E6OL 4KJQD 4F57H 1D5MB 4HZAA 4G7YL 5D6DC 4OZHA 1JWUA 3RWGA 2P49B 5JZ7C 2JK5B 1FDLH 3D2UA 1MCPH 5F7KC 3KNBB 1UKSA 3CSBA 5HTSA 1PZ5A 3QUZA 5INCB 5TE4H 4I3RL 5D1ZD 3O3EA 4XPFH 2X1OA 1WEJH 5DYOA 4HC1H 3DTXB 3H9HB 3LQAL 4FQ2L 4G6AC 4L9LA 1SJXA 3VXSB 4AMKH 2ORBL 4LSPL 1AO7D 3CPLB 4X98A 5FUCC 4BH8B 1UJ3A 3KLSA 3HC4H 3DYMA 2ITDB 4FG6C 1YNLH 4M8QB 5HDBF 2PYEB 3GJFA 1QFWM 2UY7A 4YFLI 5GS0L 4D9RD 5BJTB 3IDIB 3BN3B 5DEFA 2Z4QB 3RKPA 1BF2A 2ICWI 2Z0BA 1J1OL 4PTUB 5ALBH 3ULUD 4F7EB 2YUVA 3P9MB 5F7WC 3ARPA 2DQHH 1U95B 5D1XA 1JHLL 1ZHBA 4JFXB 5FO9B 4KV5F 5B3NA 2B20A 3INUH 4QXTB 5T5NG 4U49A 4DGVL 1SYSA 4H26A 1S7VB 4FOMA 3SGEH 2VDPH 4HT1L 2BNQE 3STBA 3BD5A 4I48A 1PEWA 1VCAA 4NO0B 1W0WA 5B22A 2AQ3A 4JRWA 4MJ6B 1WC7B 1HI6B 3L7EA 2ZOKB 4XB8A 3VFTA 3I2CH 1IT9L 3L3KA 1DANT 1P4BL 3MA9H 5GRUH 3SKOB 4RWYH 3NIFE 3PGCA 3SDCD 2EH7H 3BMWA 4RFOH 1RULH 4KK9D 3BW9B 2A1WL 1A1MA 1I1AC 1BZ9B 1NGXA 4KH2A 4Y8AA 4Y7MA 1CF8H 1LP9E 2MSPA 5JOPD 3LEYL 1E4XI 3T0WA 5BV7C 3AS0A 3VG0H 4XZUA 3K4ZA 4GO6B 3DVGA 4NQDB 5D8JL 4L4VB 3FQRA 1JGEA 5MEOB 2OR8A 4XMKH 3GFUA 5FYKH 3MZTA 4A6YA 2R8SH 2VWEC 5C7XL 1BVKA 3RWDA 1A9BA 4LRIA 2NW3A 3OB0H 4XP5H 3EO9H 5IROC 5D5MF 3TIDA 1A3RH 2CLVA 4GBXC 4JO3H 4LNRB 5CZVL 1C5CL 1GGCH 2BVPB 2NNAB 4WO4B 5ESAB 1CQYA 4PJCB 4D3CH 5C0IA 4Q0XH 2Q6WA 3TCLA 4XVUC 4YDIH 3TZVD 1ZMYA 3VH8B 3D87B 3G6DH 3L5XH 5TDOB 4I77L 2RBLA 3WKMH 3UO1L 3SE9H 1I9EA 3WIFA 5I6XC 3BDYH 4U3HA 2QJDA 4LDOB 2QQLL 1BZ7B 3GMMA 5AUMB 5C08B 3GGWB 5KVFL 5EIVA 1L7TL 1NDGB 2DB8A 1BEYH 3L1OL 4ZDHB 4LLWB 4HLJA 4KROD 3R1GL 1UZ6F 1AP2A 4PJIA 3SQOL 2RCSH 4MQXD 5FUOH 1IC7H 3EYSL 3ULVL 2X4OA 4HGMA 4U6HA 3ZKXB 3UYRL 1NEUA 4XPBL 4P5TD 4PLJD 2J8HA 1WVZA 4P9ML 5CILL 4LVNB 3P4MB 3L9RA 4YFLF 4L3CB 5D6CA 2BHYA 4F37F 3U4BL 3ZE1F 3MACH 1DBML 2LVCA 4PJ7B 2HFEB 2IPKA 4YHYC 4PG9B 4GAYA 4NP4H 3U9UB 3BGFC 4JZJB 4C56E 1IILE 4X6DA 4FP8L 4ENEC 2IADA 5D2NE 1TQCB 3SJVE 4AEIL 2ZG3A 3ILPB 3MRJA 4IS6B 1CGXA 2HVJB 5FM5M 4Y5XC 1J9CT 4CDGC 2VH5L 1UVQB 1CU4L 1DBBH 1GAFH 1T5WA 2ZUWA 1AXSA 1MCDA 3DX9A 3PGFL 3DETD 3QDJA 1N4XL 2QL1A 1ZLUH 1RZJC 1I3GH 3UC0L 3TJHC 1JZ5A 3PHOA 2MHAA 1LO2L 2WIMA 4QCIB 4GW5A 1I9IL 2E6JA 3EJYD 4FTVE 3IAGC 1NFDA 3RP1A 4D8PB 2YD8A 5IESL 1HHJB 5T1DL 4KKCC 2Q76B 1GXEA 3GO1L 4LHUB 1B3JA 3BUYA 3UTTD 1XF5B 3JVGA 1T7YA 2H3NA 5GSRA 4U1JA 5IVXF 5I1DB 4ZYKB 3U9PH 1A6WH 4JFYB 1RZ7H 3NCFB 4G3YH 3MFGB 2MQCA 2NLJB 4OLZH 3CZFA 3PP4H 3QUXC 2FJFB 1I1FA 3DUUA 1X5LA 3MJ8A 3OBAA 4JB9L 1YMMA 3DROB 2ARJA 3RKDD 1TPXB 2DYPD 2ZP0T 3M8OH 3DMMA 2GJ6A 5HHMB 5EO1A 3LRHA 2XICA 4QXWA 2YPKA 5DD5H 1PAMA 1IVLA 1QO3A 3VXRA 4ZUTB 1CE1L 1U3HC 4RZCB 5C92A 2R0KL 3TH4T 5TE7H 3CX2A 5TE6H 2WUCL 5IB2B 2AW2A 3OKEB 5DF0A 1FH5H 4QHUB 3TFKC 4R2GC 4ZUSA 5C0GB 5AD0B 5ESQA 2YKLH 2Z93B 3WNLA 2NY4D 2QHLA 4UT7L 4OF8A 5DRZA 2AABL 5DI8B 5D7IF 3QDHA 5F6IC 5J13B 4N8VA 4EVNA 1ZV5A 2ZUTA 1LILA 4KGLA 4WUUD 5GSVA 1S7WB 2HTKC 5JUEH 5K9OA 1QYGH 1JI1A 5D2LB 2XN9B 3GSWA 3S4SA 3T09A 1A9EB 2BSSA 1S9XA 2I26N 3SE3C 1BOGA 4WFFE 3EOTH 5F6HJ 2AEWA 4XP4H 4U1NB 5LGKA 2UV3A 2VAJA 3DIFB 5EN2A 3GSOA 5DRNA 2VLME 4IRSB 2HKFH 4ONOA 1JRHL 1KB5A 5KN5A 3IDYC 4C83B 1A6ZB 4ZFGL 1GZQB 2GUOA 3VFVA 2FB4L 1X5XA 4JM2C 1CR9L 3VFPA 1U92A 4RQQA 1EEQA 4DQOL 2NY2B 4G6FB 5CGYC 1BFVH 2XQBH 4MSWB 4LLQB 3F7RA 3NTCH 3C6LD 3R0NA 4ORZC 1SVZA 5LWYH 1CN4A 3OKYA 3D3VA 2JB5L 1FSKC 3ULVD 3MLSH 5DJ0A 2PO6D 4I3SH 2WMPA 1FJ1A 3RGVA 3U46B 1IEBB 1DQJA 2YPLB 3HS0B 2I5YH 1ACYL 2RFXB 4ZAKA 4YDLB 3VMPA 4YHNA 4NWTH 1G6RA 1G7HB 3VI3E 5BQ7A 3FQTB 5ID1A 1D5BA 1ZHNB 4HJJL 3W5NA 4DGYL 3GBML 3GJEA 2FHFA 2GSGB 3B3IA 4HDIA 5E8OA 3TBYA 2IAMD 3GNMH 3VFNA 5JHDA 2YSSA 1R24A 3LN4A 4FQXA 1RK1B 2V6HA 4JFEA 5IFJB 4GRWH 1IM3B 2NTSP 1VACB 1JF1A 5TQ2H 3SGEI 3QO0B 4KKBC 5ISZB 1BFTA 3RNQB 2CKBH 4E5XB 2FO4B 3G6AA 5C08E 2W92A 2XZZA 4AL8H 3F5WB 4EN3C 5DD1H 1W72L 4PJ8B 4QHMB 1KUMA 4HWBL 2VJXA 2VLKE 5T1KD 4WFED 1X5KA 1XZ0B 1IQWH 4UBDC 1S7RB 4CGTA 1ZT1A 4KQ4H 3KYMA 4Y16D 2JB6A 4OBSA 2AK4B 4K8RC 1TVHA 3MPCA 3FQUB 4FNLH 5E6IB 4N8VG 2Z92B 4H8WL 5JW5A 2CDGB 1A1NB 4E42A 4KY1H 4XXDA 3S4SG 3VGGA 1WCQA 5MI0C 5T3XL 1OAKL 5D7LA 1MI5E 4YHKL 3C6SA 3EYOB 1CVRA 2Q86B 5F96H 4MA7H 4Y4HD 2JE8A 1C5DA 3FOMB 3KXFD 4PJEB 2CO7B 4HKJB 3QUKA 1OAYL 4K9EC 3GSXB 1T1XA 2CRIA 4I18B 4KPHH 5SWSD 4JPVL 1CBVH 5DJDB 1D5MA 5F7EL 3V8OA 1G7MB 3C60A 5EBLB 5SWZD 3FL7A 4WI9A 4Z77B 2JK5A 4PP2A 4GW1B 5MHSD 3WFZA 3KNBA 4KUCF 4Y2DC 3JV4B 3R8QA 2FLBT 5EOCH 5INCA 2BVOB 1FP5A 5E08H 2BX5A 2I25N 1QEWB 1JZ4A 1QFWL 3DTXA 3H9HA 5JIIA 4G6AD 3BOVA 3VXSA 3WLWC 3IDXH 5B38B 4JKPH 2OR9L 5E1AB 4BH8A 5I17B 5ESVB 4YWGL 5CJBA 5H8DA 1N5YH 2BY2A 2FH8A 4XP9L 2ITDA 3RWJB 4M8QA 3PP3H 4U4BA 3WHE0 2PYEA 4UIMB 3FO1A 3QEGL 3MV01 2ZNXA 3N1GC 3RVVD 1FCGA 4ZSOB 2PXYB 5BCAA 5BJTA 3IDIA 2FLRT 5DQJB 4WWKB 4WEBL 5HHOA 5E4EB 4PTUA 3F6LA 3P9MA 4JHWL 2E27H 4GG8B 1MVFA 3FTGA 3QJHB 4MXWL 5DFTA 2GK2A 2YWYA 2FEDD 1A7PL 1MRFL 4JFXA 5DMIH 1CL7H 5FO9A 4QXTA 2X1QA 3EDKA 5BS0D 3VG9B 3LPWA 2AI0H 5C3TA 1S7VA 3RL1B 5JORB 3MNVB 3TO4D 4CADB 4NO0A 4MJ6A 4TUKL 1WC7A 1HI6A 2ZOKA 4HEPG 2ZKHH 3OGCB 3OKNB 3PHSA 2ESVB 3QO1B 2BY0A 35C8L 1AGEB 5AG9A 3SKOA 4TTDC 3QQ4A 2HRPH 1BBJB 1X6LA 1ED3B 3O2DH 1OP3H 2MNUA 5F7LB 3BW9A 3U7YH 3MFFB 1NGPH 1TQBC 1NMBL 4QEGA 2J88L 2DAVA 3HR5B 2LU4A 3JWOC 2VNCA 4NQDA 4L4VA 4MWFB 1RUML 4OD3H 4ZODA 3NAAH 4MX7B 4NRZB 5MEOA 1NCAL 5EBWB 1SVCP 1QBLH 3O4LA 5L9DL 4QWWC 2X2YA 1FFOB 2W0PA 2ZPKH 1F02I 4ODXB 3SBWA 3GMRB 1INDH 1MCLA 1RZGB 3BIAX 3E3QC 1F6AB 4X9GA 2Q20A 4KK5D 4LNRA 2VXVL 4GBXD 3VA2C 4WO4A 3OF6A 4PJCA 4HWEL 1EO5A 3ZZ1A 1FVDB 2IH3B 5ADPL 1OSPL 2R2HB 3H7LA 4XVUD 5MP6L 5MENB 3QULB 3H3BC 5L0QC 2NY0C 5TF0A 2L7UA 3Q2CA 2A73A 3P0GB 2OL3L 4NQCE 3GJFH 5BMFL 4CN1A 1BZ7A 3BD4A 2DICA 5AUMA 3GGWA 4OJFH 1GOHA 3S8WA 4JZNB 2PR4L 3WO3B 1QSZA 1NDGA 4ZDHA 4LLWA 1S3KH 1YNTB 5ISZE 3FHQA 2JELH 4XPHL 5C6TL 5J1SC 3EDJA 2YZ8A 4N0RA 5LQBH 4HMDA 5KSAB 3NCMA 2Y9RT 4P3CH 1NAMB 4MAYB 1DQLH 3MBEA 4U2ZA 2HFGL 2YD6A 1KG0B 3AMKA 1BX2A 2AK4E 3P4MA 5D1ZB 1GZPB 3GHEH 4L3CA 1JZ2A 3IFLH 1NC2D 2V2TB 3N1QC 3WDIA 3V4VL 4ODBD 2HFEA 2V5YA 2BY3A 2ENYA 1UEMA 4PG9A 5CSZB 5E5RB 1R5IA 3EKCA 3U9UA 4JZJA 4BZ2L 3BKYL 3I50L 4NO5B 4DKDC 3AAZB 3QNYB 4ENED 3AXLB 2L7JA 1CI5A 3ILPA 4IS6A 4LSTL 2X41A 1UC6A 5J6HB 4CRPA 1UVQA 5T3ZH 1EVTC 4PJEE 3FFCE 3TYGL 4PJGF 4A6YH 4G9FD 3F58L 3TJHD 3NA9H 3U1SL 3VE0B 3GUTB 1RFDL 1HXYB 1P4IH 2FX9L 3UROR 1ERNA 4D8PA 5HYJD 1FC2D 1I1YB 1FO0A 4LHUA 4KKCD 1NKOA 2DOCA 5I1DA 4XAKE 4ZYKA 4JFYA 2FX7H 5K59E 4Z9KB 3MRKB 3B9KB 2OTUB 3MV8B 1CLYL 5HHNB 4EXPX 4HPOL 3T3PE 4RGMC 4R3SB 5F9OH 5BRZD 2FJFA 4ZTPH 1PYWA 2E9IA 3DROA 3UMTA 1N8ZB 5CSGA 4PLOB 3EO0B 5I18L 5FUZH 5HI3C 1OLLA 3U7AA 1D6EB 4ZUTA 1GC1C 2BOCB 4RZCA 5IUSA 1JV5B 3P9LB 4HS8L 1QLFB 4S1RH 3LD8C 2X4SA 4L8CB 4JJHA 5DJ6B 5IB2A 1AR2A 2IPTL 1NAKL 2YC1A 4F8QA 1KTLB 2DM2A 4YPGB 4QHUA 3TT1L 4JPKL 2VIRA 1MF2L 4HCRA 5HD8C 3TFKD 5AD0A 1U2HA 3S96B 2YRZA 2Z93A 3SPVB 2AKRB 4M02A 5I8CB 5DI8A 3QG6B 4FZEL 2LVEA 2FEEL 3RI5F 2FD6H 2ZJSH 3FCTB 4HUKB 5DHVH 5KS9B 1S7WA 3CFIC 4YHLH 3CXDH 3WS6A 2HTKD 5D2LA 2XN9A 3QQNA 5T33H 4PG2A 1A9EA 4G6ML 2ICES 1MY5A 2CPCA 3T2NH 1TZHB 4CAGA 1FRGH 4RGNC 5LXGH 3DIFA 1HKFA 2WUBH 1S7UB 4U3CA 2BJML 2Z8RA 4QGTA 2EDXA 2ESVE 4Y88A 3TV3H 4OSUL 4C83A 5I19L 1A6ZA 3I02A 1DQDL 3OAZH 1KJVB 1NEZB 5SWQB 2FSEB 3D9AL 4NHCL 4JM2D 5HSFA 2XQYG 3MRGB 5CGYD 5F9WC 4LLQA 4NSKB 4M5YH 4GRLB 3MLXL 2Z31D 4KROB 4PRDB 4LF3B 2JLLA 2H45A 3U46A 1IEBA 1VHPA 2AJUL 2YPLA 3BP5B 3BPOC 3HS0A 2AAVA 2AVGA 4N9GB 1J87A 2RFXA 3D39A 4F7TB 3FONA 1QZ1A 15C8H 4LHUG 4JFZL 3ZKND 2I27N 3FQTA 1ZHNA 4OF7A 3THMH 5FKPA 5C07B 1SMAA 1A7RL 2GSGA 1FQ9C 3LEXB 2NY1B 3QHFH 1SBSL 2BK8A 4CU8A 2IEPA 2IQ9H 4QXUL 4L5FH 1CL7I 3UTZB 4N1CA 4XI5C 1RK1A 4TQEL 5EZLB 2P24B 4GJTB 5IFJA 5IB3B 1IM3A 4YLQT 1VACA 4FXGB 4GRWF 4R8WL 4HKZB 2A83B 3QO0A 1CGYA 2JCCE 3RNQA 4E5XA 2F54E 1S7QA 1CIUA 2FO4A 2Q3AA 4KKBD 4J3OC 3HMXH 1KB9J 5B21A 4K23L 3K2UH 4MB3A 1KCSH 2YD7A 4PJ8A 3QRGH 2DQEH 1XZ0A 1S7RA 4LEXL 3PHQB 5E2WL 4OLXL 2B2XH 1BQUA 4R0LC 5E4IA 3MJ7B 4Y4KD 1GOFA 1E4XL 1PEZA 3FQUA 3FB8B 1CWVA 5E6IA 4YUEL 2Z92A 2CDGA 4LCYB 4OGYH 3X13A 4Y2OA 3LAFA 3QXVA 4LVHC 4PGDB 4G7VH 1CQKA 3ZDYE 3H3PH 4X8XA 4BQ9A 12E8H 1KB5H 3VU2A 3WHE1 1GPOL 1JGUL 1YYML 3EYOA 1QRKA 2R39A 5I1AA 2Q86A 5EU3B 4P2QB 2DYPB 2R2CA 3FOMA 4IIQB 5F9JB 2P5EB 1F8TL 1AO7E 3HPLB 3QDMD 4XHJC 1CD8A 2O5YL 4U6YB 1G9MH 4LLMA 4XPGH 1UENA 3CNKA 3GSXA 4I18A 4PRIA 4M1GH 4R7NB 3U4AA 5DJDA 5CINL 1JPFB 4W6YB 2N7AA 3UPRA 5ECJE 1G7MA 3LRSB 2NW2B 4KHXH 4UDUB 4Z77A 3HI6H 4D9RE 2P7TA 4MB4A 5C0DB 1H8SA 4NM4L 4AIZA 3JV4A 4QRPB 3C2SA 5IR1B 1QRNB 3ULUE 3KYNB 3T0BA 1G6RH 1KJ2L 2BVOA 3RDTC 3UJTH 2XZAH 2X7LB 3O2VH 5I9QC 1MRDL 4TSAL 1QEWA 2DWEA 3L5WB 5F6HI 4NN7C 1BBDL 1F3DJ 1C16B 4MYWB 3ZYIA 2G60H 1MFNA 2C1PB 2VOTA 5B38A 3FAXA 4KI5E 3WLWD 5BOPA 2OXHA 4JFFD 5I17A 3IJSA 3EFDL 3WJLC 3SKJH 4XNYH 2R29L 2AJVH 3RWJA 3MLYH 1XF4B 2MWCA 3FRPA 5D1QC 5K9JH 3G9AB 4ZSOA 2PXYA 5DQJA 2AEIT 4R26H 4C55A 3VRLF 2KDGA 1OM3L 2VZVA 1A6UL 5E7FA 4H25B 4GG8A 1T2QL 3MV11 3F62A 3S3SA 3UZEA 4U6TA 3RWHB 1NBZB 3LN5B 5JORA 3KJ6H 3RL1A 4CADA 2Y36H 1D5ZA 1DSFH 1A3QA 4Z7VE 5TH2B 3RTQC 1GIGH 1AIFB 4GQ9L 5FYLH 2BHZA 4FFYH 3QWRD 3OGCA 3OKNA 3QNZB 3I9GL 3QO1A 3ARFC 3J8F7 1AGEA 4TTDD 1ED3A 5D70H 3RL2B 5FYJU 3ESVF 3ZTNH 4RISH 1AHWC 3MFFA 1EEYB 1OQXA 4HUUB 5C2BH 3D25B 3HR5A 3VD3A 2C3HA 3QUML 3TEUA 4MX7A 1FE8L 4OZHF 5F7MC 2VXUH 5EBWA 3C8HA 2VXTH 2BCKB 1B0RB 1FFOA 4YC2B 1G9EA 4QWWD 1LVEA 4ODXA 3GMRA 1PG7W 1CK0H 1RZGA 2R0LH 4PY8J 3OJ2C 1F6AA 3QCUL 3WN5C 4B7IA 5EPMB 1TJIH 4MA3B 2YPVH 4ZXBB 4LL9A 2C4FU 2AXGB 2IH3A 4OZGA 3RVUC 1XGPA 1CICC 5MENA 4XP1L 3QULA 4J7RA 1JGLH 2NY0D 3V6FB 2YD1A 4YX2H 4JPIB 4BSVB 5B38G 1HSAB 1W0VB 4LP5A 1A6AB 3ILQD 1WLHA 5DDHA 5EO0B 2IC2A 3UAJC 1LO5B 1AE6L 4IOSD 4ALAH 4F57L 4X6CE 4ZFFB 1A4KA 4JG0H 4Z7NF 5IKCB 1Q9OB 4G80A 4Y5VB 3TA3D 3FRPG 4BFIA 3BJ91 1YNTA 4L4JA 1WFOA 1FDLL 1E4WH 4WY7H 1MCPL 4FQPA 4GW4A 3D69A 3E2HC 5LGJB 1LD9B 1VFMA 1BJ8A 5KSAA 5TE4L 2ADGB 3CXHJ 1NAMA 1P7HL 4PJDE 4MAYA 4XPFL 4Z7OE 2DLIA 4MQSB 1WEJL 1OAXH 3AM8C 3B2VH 3QCVL 1KG0A 1QACA 4HC1L 3UTSE 2V2TA 4HJ0D 1N6VA 3UTTE 1J11A 1ZTXH 4MQ7B 2X42A 1F5WA 4NZUH 3VW3L 1PKOA 1DUYB 5IG7A 2JJUA 3MJ9H 4NO5A 5DD3H 3AAZA 3QNYA 3AXLA 3IRPX 5EIIB 3UYPA 5J6HA 1I8LA 1YYLH 1TCRA 1JNHB 1CXFA 3DXAB 2DWDB 2J8UB 2FZ3B 5ALBL 4QTHB 4EUPB 4EQ3A 2D2OA 4JKMA 3VE0A 3GUTA 2DQHL 1HXYA 3IXAB 2DTSA 3INUL 2R1YB 3WJJC 1D7FA 4JJ5B 5L7XL 2Y25A 4HIJB 4M93C 5HHQB 1PSKL 32C2B 5BS0B 3OTTA 4JKLA 4M1DL 6CGTA 3MRKA 3B9KA 1MUJB 2OTUA 3MV8A 5IMOB 3I2CL 5HHNA 3WFEH 2J8OA 1JHKL 4WUUE 4R3SA 3MA9L 5GRUL 1JPSH 1RJZB 3T0EA 2IBZY 1N8ZA 1KXTB 3EO0A 2X44D 1RULL 4JRXB 5D7KD 2Y07H 1NCDH 1D6EA 1CF8L 1S78C 2BOCA 3CMOH 3K81A 1KIQB 3T2QA 4LMQI 5GXBB 3VG0L 1JV5A 3P9LA 1QLFA 1J8HB 2D7OA 4L8CA 1J88A 1M1SA 5DJ6A 1ORSA 4XMKL 4ZO6A 1I1AB 1KTLA 4YPGA 1NMCB 3NFSH 5IF0B 4DZBB 4ELKB 4X4XB 5HD8D 4QY8B 3SPVA 2AKRA 1O7SA 3V4UL 4XP5L 3EO9L 4M6NL 1MHPH 3OX8B 5HYSG 1WAAA 2VB5A 1A3RL 4JO3L 1J0HA 1FNGB 1M7DB 3FCTA 1GGCL 4XMLH 3ULVE 3H9SA 5KS9A 3CGTA 4TRPH 5KBNC 4D3CL 4OD1H 4Q0XL 3UBXB 2MFNA 3LS5H 3ARXA 4YDIL 3S35H 2UUDK 4GBXB 1BFOB 1TZHA 3G6DL 4KDVA 5D72L 4FFWC 4HIIB 1FAKT 4PGBB 2X09A 4X6DF 3TGXA 1F45A 1S7UA 2PTTB 4TNWF 1C5BH 3UYOD 3L5HA 1QUNA 1KJVA 1NEZA 2CK0H 5SWQA 5I6XB 1KN2H 1BEYL 4D94A 2GY7B 1UM4L 3MRGA 5FCUH 4GRLA 2RCSL 4OF6A 1UFUA 4PV9B 5CIPB 2HH0H 4KJWC 4PRDA 4WIQA 4LF3A 5F7UA 4HUVB 1NFDF 4TSBH 4XNMB 1HHGA 3BP5A 5JW4Q 3IFPB 1D9KC 3BKJH 5M95B 1QVOA 4WFEE 1A6VL 2VZOA 3TVMD 3QEQB 3HR6A 3MACL 3B5GA 4NP4L 4PJFB 5C07A 3UDWC 4K71B 4MMZC 3LEXA 4HWZA 1R0AL 5DMGD 3OKMB 3RJDA 1HCFX 2RR3A 5GIRA 4XC1L 3E1F1 1MWAA 4YHYB 3UTZA 1BD2B 3HG1D 1QNZH 4MCZB 4XI5D 5EZLA 2P24A 5GRJH 1X44A 1DBBL 1GAFL 1CTNA 2YR3A 3SO5A 3GRWA 1EFXB 4HKZA 2A83A 1OD7A 4UV7L 3ZYZA 1I3GL 4Y5XB 4HCRH 3KXFE 1P9MA 1MFAL 4EDWH 4LCWB 4X7TB 5SX5K 1FNSH 1OTTC 1EJOH 1FC1A 4EOWH 3O11B 4DFIA 5SWSE 4MLIA 5CJXC 5HPMB 3PWLB 1DUZB 3CVHB 3PHQA 1NL0H 1MAJA 3HTLX 2BNRD 2J1KA 3MJ7A 4L1DA 5SWZE 1JNNH 1EO8L 2X70B 1PW3A 2Q3ZA 3NA4A 3U9PL 1A6WL 3T4YB 3FB8A 2DIBA 3WD5H 2FWOB 4E9LA 5MHSE 2XFXB 2R2BB 4OLZL 4OFPA 3PP4L 3G6JE 4LCYA 4YHMH 4Z76B 2G2RB 2XG4A 4PGDA 2O5ZH 3NIFF 2VR4A 4QHNA 4UNVA 1WISA 3ECBB 4LPCA 3QUXB 5DD5L 3DV6B 5KVDH 4RFEB 5EU3A 4P2QA 1EZVY 1E28A 2ADIB 4LIQE 3T2PA 5T1MB 5F9JA 3ZT7A 2P5EA 1FYTD 3HPLA 5TE6L 4JPWL 4U6YA 5FYKD 1YDPB 4XHJD 3MV7B 3KPLB 4I2XB 2R4RL 1FH5L 1ZEAH 4R7NA 1U3HB 5E9DA 1NEZG 4NRYB 2YKLL 3LRSA 3M1BB 2NW2A 2AJZB 5JXED 4UDUA 5DFWH 4PGCA 1T20B 3VGHA 4R2GB 5IV2B 4O2FB 2L4OA 4QRPA 4BUHA 5IR1A 1QRNA 4L9LC 5JUEL 1EBPA 3KYNA 1QYGL 4R90H 5CEZD 4XBPB 2OXGA 4L4TD 3RDTD 1HHHB 4ZNEA 2X7LA 5F6IB 1WZMA 1F6LL 3CFDB 3L5WA 1YEEH 4MCYB 3SE8L 3QFDB 3EOTL 1C16A 4XP4L 5BS0E 2HT2D 2H32B 2C1PA 1LDPL 2HKFL 5LCVH 2Q8BH 3PWJB 2AP2A 5CD5C 1PLGH 3DJ9A 3QIWD 1XF4A 3N9GL 3IDYB 1BFVL 2XQBL 5D1QD 3NTCL 4O9HH 5FA4B 5LWYL 1H3UA 2UZIH 3MLSL 4M8VA 3O6LH 3IXTA 3PQYD 4H25A 4OZ4A 1WZKA 3RWHA 2I5YL 2EDBA 3GI9L 3LN5A 4NWTL 1HK6A 5GGVH 3RWEB 4C57C 2IFFH 3FB6B 5F7YC 1BFSA 1U8PB 1XR9B 2ZUUA 1VENA 5TH2A 3HZYB 2GFBA 5J8OA 3ARGD 1JWMB 1AIFA 1S7TB 2YK1L 1MCHA 3GNML 4WHYG 3QNZA 4PUBL 1CGWA 1WWBX 2IG2H 2EKJA 3ARFD 1LO0H 3RL2A 5F89B 4EEEA 2OLDA 1F4YH 1X6NA 2FRGP 5F3HB 3BSZH 5TQ2L 1EEYA 1HHIB 3FHAA 4HUUA 3D25A 1P4LB 3SDAD 4AL8L 3IU4H 4LRIC 4BKLB 5EUOA 5DD1L 1JYXA 4R4FH 3QXDB 3BPNC 4W4OA 4PJBE 1IQWL 1B0RA 1X5HA 3MQIA 4PJ9D 4RBPK 3ZT5A 2D9QB 3EYQC 4ORGA 2EEBA 4KQ4L 4EN3B 2WV3A 5CEYA 3BFOA 5I2IB 1OP5H 4JFDD 43C9B 2OI9C 4FNLL 3GBLA 1CDIA 3LMJH 1GGYA 5EPMA 4MA3A 1IJ9A 2X1WL 4KY1L 3V2AR 4ZXBA 1AC6A 1GH7A 2AXGA 5C09D 5L88H 3MRRB 2NXZC 1TTGA 3OXRB 4YHZH 4X5XB 2X1PA 2X9YA 5GRWA 5HVFB 1ES0A 3KJ4B 4MA7L 2NY3C 4JPIA 1NC4B 5MI0B 2GK0B 4BSVA 1HSAA 5ENWB 1KCVH 1JZ6A 1W0VA 4GS7B 1A6AA 5EO0A 1ZVSB 5JA8B 1LO5A 4KPHL 5FV1L 3UAJD 3M17A 4ZFFA 4UILH 4M1CC 5IKCA 3QDMB 1Q9OA 4Y5VA 3OJVC 5KSBB 1EXUB 4YHOH 3JZ7A 5D6DA 5LGJA 1LD9A 3IT8D 1R3IH 5EOCL 4G9FE 4LPTA 2ADGA 4X99B 4MD5B 3CFBB 5I76B 5E08L 4N0CC 4Y2DB 3LH2H 3UZQA 5TFSL 4XVSH 4NUGH 1K85A 5FYJH 1PFCA 2DBLL 4XBGB 4QNPE 4DWHA 3IDXL 4LBEB 1C08B 1XR8B 2ZWLT 4WHCA 2B5IB 1N5YL 1DUYA 2AJXH 2VXQL 4X9FA 4H0HB 3CSYB 4NDMB 5LGHH 5E0QA 3ZE0E 3BUTA 5BRZE 1LMKA 4OZFB 3ZDZE 3L3JB 3RX5A 4JKWA 3MRCB 3DXAA 2DWDA 2J8UA 2XPGB 4HXAH 5GGRB 2FZ3A 5A2JH 3CK0H 4QTHA 4EUPA 3JVGC 2VITB 4LCUB 4ELMB 3AGVA 2E27L 3OXSB 4PR5B 3LQMA 1CFQB 5DMIL 5DR5H 2AJSH 2R1YA 4X80H 1MCIA 5EUKA 3VI3F 2IPUG 4JJ5A 1ZLVK 3O3DB 2AI0L 5E8DL 2GKIA 5HHQA 1B2WL 1FFPB 32C2A 3K1KC 3WDHA 1MUJA 5IMOA 3WBDA 1H3WM 2ZKHL 1HIMH 1KELH 4OLWH 1NFKA 3EW3B 5GGVY 2HRPL 1RJZA 5CBEB 4LAQH 1SEBB 4JRXA 3U7YL 5JQHC 1NGPL 4LQ1A 1S78D 4MD4B 1J8HA 4OD3L 1L9NA 1JZ8A 3AU1B 1I1AA 1S8DB 4YH6A 1QBLL 1WWAX 3HC3L 3IFNH 5EU6D 5IF0A 4DZBA 4ELKA 1BM3H 1BJ1J 3DGCR 1INDL 4Z78B 4PY8I 4ODSH 3BDXA 3SGJA 2EE3A 1NAMH 2GIYA 3OX8A 3H8NA 5F9DC 4NO2B 2F74A 2V9TA 1BVZA 3NFPB 4LASH 1UCBH 1NFIB 1M7DA 4RCAA 4HUWB 5ILTL 1M6OB 3IB4A 3UBXA 1HQ4B 1UH3A 4PJ7F 1ZLSH 3QP3A 5CS7A 1RZKC 5FM4A 1GGUA 4HIIA 4PGBA 3OKLA 3VWKB 4DKEH 2EE6A 2UY6A 2PTTA 4MVBC 5L0QB 4JO1H 3K4AA 3KHQA 1BIHA 3UZVB 1ZSDB 2XWBB 2RGSA 1JGDA 5DVMA 1YEKL 4G8GA 1A0QL 1T1WB 4WV1C 5HVGB 1P5VA 1FIGL 1P6AB 1X5ZA 1JF5A 3GSQA 1MEXH 1KYOJ 3B2UD 4FQQB 2F53D 2YUWA 3Q6GH 3BRDA 3ULUH 4PV9A 4L3AA 3VGAC 5LQBL 2V9RA 4KJWD 2W60B 1RHHB 1FYHB 4E41D 2X4TB 3RHWF 4XNMA 4OB5L 5EFIA 5CKAA 4XNQB 1WFTA 4HK3J 4RDQF 1Z3GH 1WBYA 1D9KD 4WRLA 5GRVL 3V95A 4JQIL 2FIKB 2EIBA 1JFQL 3GHEL 3CDCA 4JCMA 3QEQA 4ZTOH 1AGDA 4PJFA 4PGZA 1KTRL 4LSQH 1QSED 3C5SA 1I8MB 5ICYB 1UGNA 3OKMA 3V79C 4Q97A 1DFBH 2VDQH 3LPFA 1UACL 4I3GA 3H7BB 1ZLUK 4CMMB 1BD2A 1FNLA 3S98A 1FFNB 5DMYA 1Q0YH 1IKFH 1EFXA 4DN4H 4A6YL 5FB8B 2VKWA 2Y72A 4WI3A 1OTUC 5DJCB 2EDKA 1UT9A 4LCWA 1I9JH 2HYMA 5LBSH 1P4IL 4X7EC 1N0XH 5KSBE 1MRCH 3O11A 4A2MA 5HPMA 1Z9OA 2DJSA 3PWLA 1DUZA 3CVHA 4XMPH 5IBTL 1EEUA 2XTJE 4UINH 4YDKH 3GI8L 2WWKO 5D2LF 3T4YA 2GEEA 2FX7L 3SKUD 2FWOA 5DVKA 2XFXA 3MXVH 2R2BA 4KMQA 4F9LC 3FB7B 5HHVH 5F9OL 4LFHD 4NRXB 2DJUA 1G1YA 4YEEA 3CMGA 2CUHA 4Z76A 2G2RA 3UBXG 4LVOB 5L8JB 2GSIB 4XNZC 4OCRH 1DL7H 4RGMB 4J8RB 3QUXA 3DV6A 5DWUH 5GGTA 4PYGA 2ADIA 5SX4H 1X5YA 3C60C 2ZCLH 4S1RL 3MRMB 3ZHKA 4JFFE 4APQB 1YDPA 3MV7A 3JSSA 3KPLA 4I2XA 4MS8C 3CVIH 3D2UD 2FGWH 1U3HA 4QOKB 1U3JA 1KPRB 3RI5K 5IHZB 3LD8B 2GTZA 3UXFA 3QUZD 3M1BA 2AJZA 1PBYA 1UZ6E 2P8LB 1QR4A 1T20A 4X6FB 4ELME 1J12A 4O2FA 3BDBA 2QHRH 2ZJSL 3PWNB 4YHLL 3CXDL 1U8QB 1XF3B 4Y8DC 4XBPA 3DSFH 1Z2KA 1HHHA 3J7HA 4JY4B 4U31A 1OT1A 3CFDA 1G7PB 2MPAL 4LHQB 4MCYA 4PP1C 3LN9A 3QFDA 1YPZE 4DEPB 1YECL 3JWDH 4N90D 2QV2A 3NBNA 3ZE1E 3WXVH 1A47A 4U05A 4O2CB 2WUBL 3SE3A 3OKKB 3U36B 1J8KA 3PWJA 3TV3L 2QR0B 2O61A 1YQ2A 3N85H 4RGNB 3VFGL 4LCIL 3GRWH 1F90H 4OGAD 5IGXH 4CVXB 1T7VA 3S9DB 4M5YL 2GI7A 5FA4A 5D1XD 5IP4A 3PWVB 3VWJC 1IAIM 5AG8A 5F9WB 5I75C 3EYUH 5FOJA 2DLEA 2H2SC 2IQAB 1RD6A 2VR5A 4F2MB 5F7DB 3QJFB 3BIKB 1ROWA 4NNPL 3RWEA 2IBBA 3BEWB 2ERJC 3BPOB 3FB6A 3QIBC 1HH9B 1CGTA 3THML 3EZ8A 1UH4A 1FHGA 3O3AB 1U3ZA 3HZYA 4NQEB 1JWMA 1S7TA 3QHFL 2E7LA 5I30H 4LCCC 1Z0NA 1SQ2N 4P2RB 1MJJB 4Y5YC 3BH8B 5DHYB 3ET9F 1UXSB 1EH9A 4IRJC 3H0TB 5T3ZD 5A3IC 1X5GA 4PJEF 5F89A 4KZDL 1AD9B 3TBTB 5F3HA 1HHIA 3HG1B 4YK4C 3HMXL 1P4LA 4GMTH 4BKLA 3K2UL 4QYOB 1BQHB 3P2TA 5C0FA 1A7OH 1QSFA 3QRGL 3QXDA 4MDJB 2FX8H 3QWOA 2DQEL 3NH7H 5J12C 3REWB 2B2XL 3REVB 4EN3A 4J2XA 4OI9A 2V17H 5I2IA 5K33A 43C9A 3QA3B 5D7IE 1K8IB 1MY7A 4NWUH 3ZKSD 5K59F 2A9MH 4PS4L 4R0LB 2EXYC 2NXYC 4OGYL 3GMLB 1J0KA 1WSST 4G7VL 5ACZA 3H3PL 4GXVL 3MRRA 4GUPA 12E8L 1KB5L 4G43B 3BPCB 3OXRA 2GAZB 4JHBA 4N1HB 2DJ4A 4GH7B 3FRUB 5K9KB 1NC4A 2GK0A 2NY3D 5E2VH 1C12B 5ENWA 1CFNB 1VDGA 2CIIB 1R3JB 4CN4A 4LLYA 1G9ML 1ZVSA 2UWEB 3KPTA 5IK3B 3KPSB 5EC1B 2BMKB 3SKNA 3QDMA 1MHCA 2E5EA 5K93A 3T1FB 1T6VN 4KHXL 4TNVF 4U6VL 1EXUA 3MBEC 3NVQA 4M9PA 3SKMA 1K3ZA 1WCBA 3Q5OA 1G6RL 3QSKB 4X99A 4MD5A 1PG7L 3CFBA 1XH3B 3UJTL 5I76A 3O2VL 4KVCH 4Y2DA 4NYLB 5FECB 2B39A 3PWPB 4ZOEA 3P9WB 5D7SL 3CFJB 4M43H 3RDTB 2G60L 2KZ1B 4XBGA 1RURH 3F8UB 4LBEA 1C08A 5I9QB 1WZ1H 2IMNA 4KHTH 4NN7B 3Q6FB 5DZNA 3SKJL 4ZFZA 1IAOB 3CSYA 4NDMA 3ZO0A 3QDJD 4JFHD 4LU5H 4OZFA 4JCLA 5K9JL 3L3JA 1R6VA 3MRCA 4R26L 1LEIB 2VABB 1I85A 2XPGA 4PPTA 5GGRA 2X89A 1JPGB 2EIZB 5D1QB 3EUUA 2NQCA 1OD9A 2VITA 4LCUA 4QHKJ 1WJ3A 3V6OA 3OXSA 4WNQB 1G1CA 5IW6B 1CFQA 2D7TL 5J1TC 1G9NH 1IGCH 3PQYB 1XF2A 2MOVA 1TFHA 3O3DA 3HN3A 3KJ6L 3HB3D 1YMMD 2DD8L 2Y36L 1DSFL 1IZKA 1ZT4B 2LE9A 1RU9L 3DMMD 1GIGL 1MCNA 2GJ6D 5FYLL 1INEH 4FFYL 3HUJB 5ACLA 1OPGH 2ZG2A 3VXRD 1CDCA 4NJAH 3AMLA 3RTQB 5D70L 1SEBA 3MRDB 3ZTNL 4RISL 4P4KC 4HH9B 2JCCF 4YXKH 3ARFB 1ADQH 2ID5A 4OFIA 1CDHA 4NKOB 5C2BL 4JO2H 2GTWB 4MD4A 4X7SH 2D7MA 4P2CG 1AHWB 2VXUL 2W07A 3AU1A 1S8DA 4YDJA 3AY4A 2VXTL 3WXWH 5F9AC 1KLFA 3STLB 1B6UA 4UT9H 3WS6C 4Z78A