2PTUA

Structure of nk cell receptor 2b4 (cd244)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Natural killer cell receptor 2B4
publication title Structure of natural killer receptor 2B4 bound to CD48 reveals basis for heterophilic recognition in signaling lymphocyte activation molecule family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11465 Receptor_2B4 Natural killer cell receptor 2B4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ptuA00
4F8TA 2DAVA 2E27H 1NGWA 2Y36L 3RKDC 3QUML 2IFFH 4F9PC 4KK8C 1FFOA 1VGEH 4FG6C 2ADFL 4JFHE 4KUCD 4Y4FB 5DD5L 3ULVL 3B8YA 1I8KB 1G7LB 4P46B 3EOBB 1ZEAL 4LHQB 4OF8A 4PG9A 2BOBA 3A0OA 2OJZH 3C8DA 4MHHG 3OKOB 2NY4D 4O2FA 3BISA 4OSUH 5TF1H 2OJEA 2Z91A 1NFKA 5D1QD 2JKXA 4X83A 3DTXA 4KH2A 1WWBX 1BOYA 3TH3T 3KJ6L 1P2CA 3WNPA 4NQSA 4FQXA 3LKSA 3TO4C 4PLNC 1U0QA 4OJFH 4P9HH 2DOCA 3OZ9L 1AE6L 1IQDB 4UIKH 1BJ8A 5D7SH 5IVXE 1KIQB 2ATPA 1BBDL 2BXYA 3MRIB 3RRQA 1JUFB 1IM9D 3U0PA 4X99A 3VXME 1T83C 3P2TA 3R8BB 3NCBB 5F3BB 3QFJE 5MEOB 1QACA 1X4ZA 5IW6B 3D9AH 4P4RA 4XPHH 1NAKH 2FL5A 2H9GA 2OTUA 2BNQD 4BFIA 1G1CA 1UM4L 1MCFA 4LSUL 4NFBA 1E4WL 4I3GA 3PHOA 4XP4H 3FB8A 1CLYH 1MELA 1VPOL 2XKNA 3D85D 3O3AA 1UB6A 1T6WA 2DM2A 1WWCA 3OJVC 1BEYH 4JO2L 4U1IA 4XX1E 1MLCB 4U05A 4NCC2 2F58L 1EJOH 4HH9B 5DO2D 1OWRM 2GY5A 2NY3B 2P47B 3P0YH 2DM7A 5CGTA 4LGSB 1J1XH 1NMCC 1A0QH 4OGXH 4ZXBB 3MLRL 1OARL 5IWLA 3M07A 1HNGA 4HZAA 4OZGB 1B9ZA 2R15A 1ZV5A 1T66C 2XNAA 3O2VH 1XIWB 3VD9A 3SDCA 4Y5VA 3Q3GA 2BVUA 1X5FA 2NY2B 5FAAA 4G8EA 4HT1L 3C08H 5LAXB 1OAQH 5I2IA 4KUZH 2FATL 3KG5A 4O58H 4HX1B 5HHOE 2CJUH 2YRZA 3ABZA 3OR6B 4M62L 2C3GA 1ROWA 3OX8A 2EDOA 3MNZA 4QRQB 3UJTL 1ORSB 2G5RA 4M93B 5F9JA 3UPAA 2VO5A 4AQ1B 5DEZA 3STLA 3RWIA 3O11B 1A7QH 1CD8A 3DBXB 1F58H 3FCTA 4J6RH 1HQRB 1NFDE 1JNHB 5HDLA 1SY6H 3ZHLA 1K5NA 3DXAA 3RWGB 3WL9B 1AC0A 3KHOA 4HZLA 3TBTA 3ET9F 1TENA 2VDLL 2ZOLA 5F9DC 5DURD 1JNNL 1T7WA 1F45A 4L3AA 2EDEA 2NY7H 1T5XB 2XWTB 5F1NB 5C0CD 1RIVL 2OS7A 3CDCA 3ULUC 5SV4A 4PG2A 2GUOB 2LE9A 1T1XB 3N1MC 2NY1D 2X4NA 1HXYA 4MLIA 2C1OA 3O2DL 2OMBA 1F90H 2OR9L 2DF3A 1FO0H 4EQ3A 1C08A 4LVNC 3BQUA 4GAJL 3O8XC 4LVHB 4FABH 2AV1B 2LU3A 3IFPA 4PJ7B 1DN0A 2BXZA 4PLOB 4BSJA 3BPNB 2GSGB 1RHHB 4G5ZH 3MRJB 3S6CA 3T0WA 3DXAE 5L9DL 5LBSL 3QJHB 2C4FT 1FFQA 5F6IC 4TVSa 2CDGA 2NY6D 5D93B 3ZKXB 4MA8L 4LQFH 3LN9A 4D94A 1IGJA 1N2RA 4UTBL 1H5BB 3WXVH 5ETUB 4YAQA 5LCVH 3P4OA 3OHXA 4LNRB 5IBTH 2R4SL 4YHZH 5L2JA 4JANB 1P7QA 5BMFH 3DECA 4OIIL 5GRXG 1LQSR 2IANA 3UAJC 4UUJA 4JB9L 1KF9B 43C9B 2Q1EA 2W9EH 3B2UD 5J12B 3PDGA 4OM0L 3OB0K 1OAZH 2J88H 4D9RD 3OSKA 4OQTA 3G04A 4ODHH 5IB2A 3WFZA 3ARFB 1EO8L 4NHCL 5MEQA 4PRAA 4RWHA 5DMJB 1AP2A 1ERNA 4F7TB 1II4E 2V17H 1FPTH 1T03H 4Z7VA 1QLEL 3RIAK 2F19L 1MHEA 3QIBD 1A6TA 3WV0A 3OR7A 1F42A 2V2TB 3NZ8B 4IS6B 1ZANL 1E27B 5K9OB 3QEGL 3UXFA 3HI5L 3LKOB 3MYZA 1RK0B 2VUYA 5E5MA 1ZT4B 4G7YH 1HIMH 4E41D 5C0GA 2NY4C 5EU4A 2OM5A 2C1PA 1NUNB 5D1QC 4I4WB 4GW4B 3BDYL 1A2YA 3QCVH 4QGYA 4I0CC 5GGQH 1NC2B 3TT1H 4M8VA 3HN3A 1BD2B 4GSDL 2NXYD 3CFJA 5E2VH 4ODUA 2AQ3A 2BFVL 4UNVA 1R5WB 5HGGS 1KB9J 3MTRA 1YEHL 5DJDB 5B8CB 3RVTD 1I75A 3M8OH 3H8NA 2R29L 2YD7A 1S9VA 5D5MB 4MQ7B 3WLWD 4RGOH 2OK0L 4GKNA 3G6DL 1RZJC 2Q86A 2DWDB 3DIFB 3FO2A 4F3FB 3D69B 4I5BB 1WZLA 3G6JF 1J0IA 4UDUA 4P4KD 5KANI 4WFGE 3AS0A 5BRZA 4E0RB 5B39G 2OZ4H 3DARA 5HYQB 4WO4D 3K2MC 3C2AL 5KN5A 1GPOH 3NAAL 1QSFB 2P49B 3V5DB 4JFDB 3L5WA 3QQ9D 3ARSA 5CGYD 4LCWA 2R2EA 1NGQH 1KT2A 3OGOE 4C55A 2A73B 1JWSB 2ADFH 1VADB 2NYYD 3RPKA 3SKNB 1I1AB 4NN5B 4N0RA 5EBWA 4M5YL 1F11B 1ZEAH 2VWEE 1YQVH 3OKNB 3T2NL 5TE6L 5I1CH 3HE7B 3KJ6H 3LEYL 1IVLA 1FZOB 1ZOXA 3EDEA 1RUPH 4NP4L 5IJKA 5I74B 5BRZE 2XG4A 3N06B 4PRBB 1U95A 3FTGB 3D2UA 3AUVA 5H2BB 2JCCB 1FSKC 5C0AD 5EIIA 2I9LA 5I8KL 1L7TH 5JDSA 3QXDB 3SJVD 3MCLL 3U36A 3D39E 1CE1L 1CLZH 3DRQB 4KRMB 3S5LB 4PGBB 4LCIH 4YHOH 3VFTB 4APQA 1A6AA 4LCWE 3FT3B 1KIPB 2GTWB 4UDTA 3TH2T 4LSUH 2W0KA 1E4WH 2H26A 3OKDB 1AD0B 1UWXK 5GGUA 4P5TB 1OOAA 4WU7B 2V5SA 3UTSB 1XCQB 1FFNB 4RFEA 1KPUA 1CL7L 3QWOB 2HLAA 4PJFB 5FYLL 3KPLA 3NCYP 2F58H 1BOGA 5IESL 5B38G 4Y16B 3WFBL 2GSIA 4W6WB 5KG9A 4ISVA 1I1RA 2JE8A 2Q7YA 3O45A 1ZS8B 4N5UA 4N8CL 3GHEL 1QG3A 3PL6D 5GRVL 1FGNH 2QHRL 1OARH 3HI6H 4L9LA 2VXQL 4F33A 5F88A 1CLCA 4JPKH 4LDEB 1YPZA 4PY7A 1CG9B 1UB5A 1QSEA 4PY8I 5J8OA 1TNNA 3GB7B 2GJZA 2DKUA 2FATH 1I3GH 4OLZH 4QRPA 4OKVB 3BHBA 1NL0L 3FB7B 1O5DT 5IROC 1S9YA 3HZVA 5ICXA 3UJTH 1OP9A 2YA2A 3SKUD 3L7EB 1CFNA 4NSKA 4MNHA 5C08A 2CIIA 3I9GL 1ZWIA 3IKCA 2WP3O 1V3KA 1WQVT 3HAEB 2HT4D 2QSQA 2WBWB 5HGDA 3WNOA 3O8XB 3B2UC 2OSLA 4DKEH 4Z7WA 4PJDA 2R8SL 4QHMB 1R0AH 1SEBB 3RDTD 1MH5A 1D5BA 3ZL4H 2ZUUA 3KPSD 3GSRA 3HMWH 5CP7B 1F3JA 5CZVH 1YPZE 2PR4H 5HXMA 4J8RA 3CC5A 5EU5A 4QCIB 4FS0A 4YR6B 5JQHC 4U6VH 1ES0A 2O5YH 3WNNA 5EUKA 4XCNB 4XBPB 5CHNA 3HG1B 1UJ3B 3QIBC 3VFMB 5KSBA 3AREB 3FMGH 4HXAL 4GAJH 5C0BD 5TH2B 3ZDXF 2EDNA 1Y18B 3PQYA 1U6AL 2VLJA 1F13A 4JZOA 5C08E 3KYOB 5FM5O 1IJ9A 4KJPD 1HH6A 5E2TH 4DAGL 4RBPK 2MCG1 2APXA 3ZDYF 1R3HB 1M4KA 1YYMH 4NUJA 3DVGA 1RMFL 5HVHC 3B9KD 4X6DA 4HIHB 4Z7WE 4PJDE 4YZFE 3EUUA 4JFOB 2ZJSH 3MA9H 3MV8A 4GKZB 4U6HA 4UTBH 1H0DA 2DRUA 3FRPG 1OD9A 4MAUH 4NZDA 2NXYC 2EO1A 3QXUA 2X4QB 2VZUA 1B0GB 3ARYA 2NTFB 2XG5A 5FK9B 1S8DA 2G60H 2A0LD 1F4XH 5DJXA 1ZA3B 3QHFL 4XP9H 3RVTC 4LSPL 4D0BB 2A6DA 3NTCL 3SDXB 1R3KB 3WLWC 5HPOA 3KAAA 1EXUA 2AEQH 1K9TA 2VLJE 3DGGB 5DC9B 1T4KA 5DSCB 1QQDB 3MJ9A 4DOHB 4FXGA 4IRJA 2OTWB 4BSVA 3CVIH 1CVRA 4FQXD 4PLKD 2B1HL 4WHTB 3RIFF 2ILLA 3JBG7 3RJQB 3RA7L 3IETA 1JGEB 4M7LT 4WO4C 1A4JA 4HV8B 1QLEH 1OM3L 4ZFOB 3LS5L 1NAMB 3ES6A 5J13B 1TVDA 4JFEA 4JN2A 3QQ9C 1UVQA 3MV8E 2CKBB 4K23H 5GGVL 5DJ0B 3AB0B 5CGYC 3ECBA 3RWHB 1WC7A 4X5XB 1IM9B 3MRCA 5F7EL 3ZDZF 4XMPL 2NYYC 2OTPA 1WF5A 5CJQL 1DUZA 2R69H 5CMAA 4FA8A 1FGVL 2P5WA 5GGTH 3SEPA 4WJ5A 5D2LB 5FYKU 4QNPE 2YWZA 4DGVH 3FAWA 3Q1SH 2BNQB 4U49A 3I6KB 5L2KD 4X0KB 5DZLA 2WUBL 1GIGH 3QHZL 3PNWA 5CD3B 1FRGL 1U3HD 3MRBB 2HWZL 4N9GB 3U48A 1I9RL 1TMCB 4QHUA 1YEHH 3CVHA 1HYRC 3L3OB 1V7NL 1BJMA 4WV1B 2R29H 1SJVA 1INEH 3FONA 2OK0H 1M6OA 4HUMB 3SDCD 2EDJA 1K4DB 1XF1A 4M6OH 8FABB 2ERJC 1CIDA 2P5WE 3P4NA 4OBRA 4RFOL 4KJWD 2B1AL 3IJYA 1HILB 4BH8A 5F7YC 4WUUB 1YC8A 3AU1B 2YPKB 3K2UH 5FGSA 1INDH 3MJGX 4EOWL 3IXTA 4LK4A 4BJLA 4HUVA 4IEFB 4D9QD 4X4MA 3FO1A 2XOTA 4HS3A 4M61B 4Q7DA 4KVNL 1FSKB 4KAQH 3Q6FB 1BM3L 5EZIH 2RBLA 1PQZA 3W2DL 3MLXH 3ZTNL 3FZUD 4PJCB 2AXFA 1AFVL 4Y4KC 1IEAB 4CDHA 1AKJD 2BHZA 3GSQA 4QHLA 2YPLA 3U83A 1MLBB 1ZLVH 4CVWA 2I27N 2QBWA 4O2EA 1FN4B 1MFAH 4OCSL 4JRYB 3VWKA 1Q1JH 3V52L 1AXIB 2NY5C 5SX4H 2P5EE 5IB3B 5DURB 1MCPH 4PTUA 4EI6B 3G9AB 1DQDH 3PHSA 4AEIL 3RHWF 4NP4H 4OZHF 3CFIC 5C0CB 2R39A 4MX7A 2J12B 5D7LA 2AI0H 4NKOA 2NY1B 3LEVH 4F7CA 1ZTXH 2IQ9L 1T0PB 1UT9A 5I8KH 4B41A 3BQUD 4HS6B 3MCLH 1HKFA 2YWYA 5AWNH 2HT4C 5FUOL 1EMTH 1A02N 2D9QB 1XR9A 1XGPB 1ACZA 3N1GC 3BW9B 4H0IA 4L3EB 2DLHA 4PJ8A 4PJAB 3VXNB 3RDTC 2AJ3A 1RUAL 4YEEA 1INQB 1QRKA 1TETL 3RGVA 5T3ZH 3JTSB 4R7NB 5ABDE 3DI3B 2YPLE 5IGXL 3FFCE 1QBML 5DWUL 3RWFA 1E6JH 5MEPA 2B0SL 1UWEH 1MUJA 1JK8B 4GXVL 2NY6B 1CL7H 4U1KB 4TVPE 4PB9L 5FYLH 1YNKL 4Q6IB 5C0EB 5IESH 3C5ZA 3GJFB 3WFBH 5JORA 3BGFB 4P2OD 3LS4L 5D96B 5AG8A 3EYQD 1UGNA 3UPRA 2BRRL 2IAND 5GGSB 5D7LE 4LLDA 1BZ9B 1FORL 1RK1A 2PKDA 4KTEL 4HIXL 3AS1A 5E8OB 1GJIA 3VXSD 1A7RL 2EXWD 3CZFB 3DX8B 4XMKH 1A9BB 2DTMH 5DDHB 4TSCL 4DCQB 4LVEA 3O3EB 3X3FL 3B9KC 1R3LB 2BY3A 4RNRB 3GSUB 1LE5B 1CT8B 3U79A 3TBWA 4K7FB 3ZYIA 2W65B 4FQ2L 2YPVL 1IFHL 3LQAL 3VXUA 4GLRI 5AD0A 5JPNA 2AJVL 5LGHL 1DE4A 1XH3B 5JXAL 1A3RL 2R0WH 2XN9E 1JNJA 5IHBA 5IMKA 3QIWA 3MBED 1UC6A 2A0LC 2A1WH 4WI2A 4OF5A 1S9KC 2DS4A 2VAJA 3MLSL 4DUWA 5HYEA 2OCFD 3TWCL 2PYEA 4XVUD 2XV6B 4M48L 1FP5A 4S1DD 3CGTA 3ZT5A 3BUYA 5D7IB 4E41B 3BEWA 2VE6A 3S88H 2DQTL 1PY4A 1WGOA 4LLQA 3D3VA 3BZEA 4JRXA 3L3KB 2X10A 2XA8L 1FJ1A 4M7KL 2JJSA 3QI9A 1YDPB 1AD9A 5I8OL 2VITA 1A6UH 5KSAC 3OG4B 4NKMB 4P9HC 2W92A 4PJBF 3ZMRA 3UC0L 4HBQA 4JQIL 2BOCB 1U6AH 4HMDA 3CCHA 2W59A 3JWDC 1L0YA 5HGAA 1CU4L 2ZPKL 1EEUA 3DO7B 4XNUL 3VE0B 4UINL 1RZKL 4K71C 3VRIA 4U0QB 4ETQB 1JWUB 3JXAA 1RMFH 2PYEE 4W4OC 5EPMA 5I1KL 4ODWB 4EZMA 3C5JA 2NR6C 1YNTB 4BUHA 4PY8J 4LIQE 2V9QA 4P4KB 1NFIB 3GSNL 4MD5A 2VQ1B 1PGRB 1KB5A 5ESAB 5TE4L 1U3HC 2ITDA 1OY3B 2FSEA 3G5ZA 1C1EL 4OGYH 3LKPB 2XTJD 4HCRH 1QEWA 4J3VA 4QTHA 4R7DB 4LSPH 4RIRA 4O51A 1TQCB 2VQTA 3SKOA 2IPTL 4EI5A 2GCYB 4OLUL 5FYJE 4GJTB 3VD4A 2JELH 4CJ0A 3VFNB 1HCFX 3ULVD 4WWKD 1PYWB 4XWGH 2ADIB 3NABL 3MREA 2EYRB 4KJWC 4MAYD 5HGHA 5D1XA 4WEBL 1I9JH 4QRTB 4YHNB 4NZTH 3V6FB 4IIQC 4PJ5E 1OGAA 3D2UD 1KN4L 3GMRB 3BGMB 1XGUB 2ADGB 5F97E 5CP3H 5GGVH 1FNGA 2XQBL 3SO3C 3LH2H 4KXZH 4QGTA 3OPZH 4FTVA 1I3VA 3E8UL 4U1NA 4DZBA 2IGFH 3FZUC 5CJQH 3WMSA 4LCCB 1RV6X 1FGVH 2YD3A 4APQD 4K7PY 4RDQF 3EO0B 2NQCA 2D31A 2DMKA 3CMOL 4ZFFB 3B5GA 1TQBB 4JCLA 1MNUH 4ZAKA 2GT9A 2D0GA 2W9DL 3MCKA 5GGRA 3TZVA 3TFKD 4P2CG 4RWYL 4RZCB 4I48B 2VDQL 5T33H 1NANH 4Q0XH 3EKCA 3TVMA 3VG0H 3GMQA 4R90L 5IQ9A 5J6HB 4LBEA 1VFBB 1KJ2L 1AGCB 2HWZH 1J88A 5IJVA 1I9RH 3WN5A 3MNWA 1EHNA 1MRDH 4OV6F 4JFQA 1OGAE 3SDYL 3ZO0A 2H45A 3SBWC 5F7MC 3PL6B 2ITCB 1AGBB 4FTVE 4MD4B 4ODXB 5HSFA 1QSED 2NNAB 5AYQA 5T1DL 4DGYH 4HKXA 2NXZD 5IMMB 3BXNA 4Z95L 1QPXA 4U1SA 2B1AH 3MLUL 4LLVA 4QRPD 5F96H 3UZEA 4XNYH 2R1XA 3BP7A 4GRWE 4EOWH 1Y6MR 1N4XL 4BQCA 1C16B 4CADA 4B5EA 1BBJA 3N1QC 4P2OC 2WM0A 4KVNH 3U4AA 1CVSC 4RX4A 3O6KL 2VDML 4PREA 4P23D 2QKIB 3EDKA 1HSAB 2EXWC 4PV9A 1FC1A 1Q72H 2D03H 4ZFGL 4PJHB 3RDTB 3V52H 3KPSB 1A21A 1F3DJ 5HHNB 3UYPA 2HFFB 4PJIF 3CX2A 3W5MA 3QWRA 5IBUB 4AEIH 3HRPA 3I6GA 4LF3A 2FHBA 2K7QA 5I1EL 2D7PA 3IJHA 4OCWL 3SE4C 2IQ9H 4FQQA 3U4EB 2EKSB 4O02H 1NEUA 5F8QC 3MBEC 5I19L 2HYMA 5D9SB 2QTEA 2BHYA 3PQYD 5JDJA 2AQ1A 5C0BB 3IDMB 4XVUC 3C9NB 5FUCC 1TJGL 3BP6A 2ICEA 3P40A 4S1DC 1RUAH 3PP4H 1HXMB 2VC2L 2ZKHH 3MNVB 3VDBA 1BJ1H 5IGXH 4LLWB 2GJ6A 2HFGL 4GXVH 2P42B 2C5DC 1GGIL 4PB9H 5BZWB 3NCJH 3PE9A 5IW1A 2CGRH 5C86A 3MROB 3DMMB 3VXMB 1T5WA 3GI9H 5IV2A 3EYUH 4L4JA 3EDFA 1NGWB 3MGTA 4ODTL 3S35H 1FORH 2FO1A 1JHLL 1J5OL 3QHTC 1FFOB 2WBKA 1HSBA 4HIXH 3RVXD 1WT5A 4LRIC 5EC2A 5AZEL 3U0WL 3QBTB 1A7RH 4XXDA 2X1XR 1IGFH 3WXWL 2UZIL 4K94C 3FOLB 1W72A 2BOBB 4PG9B 5B22A 1QUNA 4N0UE 4IRJD 4O2FB 3CXDL 4D0CA 5DVOA 2Z91B 5KSVA 2BY1A 3DTXB 1WTLA 3TCXA 4WGWB 1DUYA 4FQ2H 4RAHA 5H35A 1P2CB 4NQSB 1DDHA 2YPVH 3HNVH 4FQXB 1IFHH 3LKSB 5A43C 3LQAH 1T1WB 2GJ6E 4JFED 4OTXL 5AZ2L 2GY7B 1Z3GL 4F37F 3IDUA 1GC1C 2ATPB 2XTJC 3U0PB 3EGSA 4X99B 3TWCH 1EA9C 2FJGA 1U42A 1HI6A 1J7VR 4X6BA 4M48H 1T7ZA 3EZJB 3W0WA 4P4RB 2FL5B 2H9GB 4K71B 1IEBA 1EGJL 2QQLH 4BFIB 4WWKC 2K1MA 4NKIH 3PHOB 4OLWH 3FB8B 1JZ5A 2XKNB 4LHUA 4MAYC 2FB4L 1BQHA 3O3AB 2HVJA 2FH8A 1UB6B 3G6AA 5DK0A 5SX5H 4M7KH 4E42A 2EECA 4U1IB 3CLEL 2C26A 2Q8BL 3C09C 4AG4H 4DN4L 4GUPA 4WTZG 3VXRE 5DVKA 4TSAL 4LEXL 3UTTA 2D7NA 1XCTB 1CU4H 5E8EA 2H32H 4TOYL 4YHMH 2ZSWA 3LZFL 3BPLB 4MJIE 2J7LA 2XNAB 4QEGA 5CUSH 3HRZA 4ZSOA 3SDCB 3QDGE 4Y5VB 5I1KH 2I24N 3Q3GB 5D1ZA 3GK8H 2CR3A 3O4LA 3TFKC 2AEIT 4G8EB 2C4XA 2HLFC 4NWUH 5I2IB 3DX9A 1KUMA 2XY1A 2W60A 4NOFA 3CH1A 1KJVA 5KSUA 4IIQB 4YUEL 5EBLA 1IAKA 2BSED 2G75A 3MNZB 4Q9BA 1W8NA 4F58L 5F9JB 3STLB 3SO3B 3RWIB 4LPCA 1XAUA 3FCTB 5E5UB 4WI7A 4JDZA 4XAWH 2IPTH 3MLVL 2H3NA 3ZKMD 1K5NB 3IU4L 4G6JL 4ENED 4HZLB 1DFBL 3TBTB 3MACH 2O5XL 3VWKD 2K3TA 2ZOLB 3NABH 1MY5A 4XMLL 3DUUA 4D8PA 3RX5A 5DUBA 3R8QA 3WJJA 4ZSOE 3PGCA 4WDIA 4WFHE 1EDQA 1TZIA 1KCSH 4JAMA 5KS9A 4MVBD 1CDIA 3S7GA 2X4NB 1HXYB 2XQBH 2AJXH 1I8LC 5CD5C 4KTDL 5DUPH 5FGCE 5GGSY 4CMHB 4I13B 1KYOK 1C08B 4WCYH 3BQUB 4JDTH 4YHKH 4P23C 2BMKA 5DD0H 3N85L 3IFPB 5C07D 3H0TA 1DN0B 5K9KB 4CN6A 3CMOH 3NZHH 4N68A 3QIUA 5D7JA 3LVEA 3RGVD 5ISZA 2UYLB 1CD0A 3ZE1F 3H3PL 3KPMA 1KXVC 1OWWA 2W1NA 2CDGB 3RNKA 1SY6A 2XACC 5JOEA 5ERWA 4XCYA 1IGJB 4R90H 3C5ZD 1N2RB 4D9LL 4YAQB 3RX8A 1PW3A 4H1LH 2BNRA 2LV4A 3P4OB 1AHWC 3OHXB 4TUKL 2VKXA 5KS9E 4P2OB 5L2JB 2IFGA 4QKXB 5IBLD 5JUEL 4GG8A 4JREB 5F3HA 2IANB 5SWSA 5CJ8A 1LO3H 4UUJB 2GYSA 3VFRA 2DQGL 1X5ZA 4LU5H 4QRRD 4IDJL 3EJZD 4HH8A 3THMH 2KDGA 3U1SL 4RGMC 1YN7A 3MBXL 3G04B 1IGTA 5IB2B 1NDMA 3BESR 1FO0A 3O3BA 5FCUL 3T04D 3TN0A 3WBDA 1EUTA 5FHBH 1H8OA 1AR1D 1PFCA 5ISZE 5K93A 3U6RA 5MEQB 1WZ1H 4PRAB 4JPVL 3VXUD 1N4XH 5GS0L 1AP2B 3F6IA 4CU8A 4Z7VB 3INUH 5T1KA 2Q8AL 1MHEB 2A6KA 2VDMH 4FFYH 1A6TB 2J3SA 1EFXA 3OR7B 2BNRE 4YWGL 1ZXQA 4GMSH 4UB0H 2XZQH 3R06A 2QQQA 4HS8L 1ZHKA 4KKBD 5E5MB 5SWSE 2FX8L 2PXYA 2GW5A 1FDLL 2XXCB 1NBVL 3L5IA 3P73A 4KK6D 5C0GB 5I1DA 4U6YA 5EU4B 3S37H 5LVEA 2C1PB 1U8OA 4LHJB 1U92A 3D3VD 1PX3A 4JRXD 4NFCA 4N8VA 1TZHA 4ORGA 3GSXA 2DQDL 5BVPL 1VACA 5JTWA 1NMBH 3SE9L 3CFJB 2DDQH 1OSPL 4ODUB 4ODSH 5IR1A 1VENA 4M3JA 5CJOL 2P1YA 1P4IH 1CE6A 4NBYB 1ORQA 3IGAA 3BYYA 3RZWA 5I1LA 1S9VB 3P77A 3QCTL 3B9DA 2X1PA 5C0DA 1DSFH 4GKNB 5C6WH 5LG1A 4S1RL 2Q86B 3FO2B 3QDME 4UDUB 4DW2L 1MQ8A 5DGQA 1GGIH 1R6VA 1RHFA 3BZFA 3CX5J 2J5LC 2V6HA 4X6EA 5C6PB 3P4MA 5FF6A 5ICYA 5KN5B 2CIKA 1SEQH 3O0RL 2VDPL 2EYSA 1EO5A 3TESA 3OF6A 3QUXA 4Z8FH 1ACYH 1QVOB 4LCWB 2XTJB 1RIHL 2R2EB 5AZEH 1KT2B 4EI5D 1UACL 5EBWB 4LGPB 2UZIH 4XAKE 1GGBL 3B2VL 3FQUA 5T1LD 3MV7D 2WBJC 1IARB 1EBPA 4MZ3A 3VGDA 4HG4J 5D1XD 1IC7H 3UPCA 1JJUA 2AK4D 2PW2A 2GITA 3FN0H 2HN7A 5E2UH 4DQOH 2NZIA 1U95B 3D2UB 2PCPB 3A6CL 1UYWL 2G2RA 5F7KC 3M17A 1U8PA 5EIIB 4PJ9A 2I9LB 4U0RC 1Z5LA 3VFPA 2LTQB 5JDSB 5CS7A 3BP4A 1S7RA 3U36B 3ZKMC 3IDYB 1MWAH 5I16A 1KCUH 1ZLUH 1U8KA 4APQB 4ENEC 1A6AB 4NDMA 1DN2A 2DLFH 3WSQL 4UDTB 3VWKC 1WZMA 4GW1A 1JGLL 2ICWI 1U58A 1C5BL 3EFFA 3B9EA 2HT2D 5FM5M 2FB4H 5GGUB 1EGJA 3PDDA 4XWOD 4RFEB 1KPUB 3W11D 1CGSH 5IVOA 4MVBC 5INDA 3CLEH 5D5MF 3KPLB 5LWYH 2Q8BH 4HIIA 2OXGA 2GSIB 5KG9B 1B90A 3K74B 3TIEA 5J89A 4DK3A 2Q7YB 3O45B 3PG2A 4LEXH 5GRJL 5MERA 2I07A 4ZS7H 2AEPL 1CDUA 4LGRB 3PV6A 4GOSA 5HHVL 4TOYH 4L9LB 3LZFH 3N1FC 4NPYA 4F33B 1T21B 5F88B 2HKFL 3QEQD 4CGTA 1YPZB 2DWEA 1UB5B 1S7VA 1QSEB 4EN3D 2ZG3A 5I6XB 2NXZB 1L7IH 2ZUQC 2GJZB 3O9WC 4W4NA 1DBAH 2G9HA 4QRPB 3BHBB 3W9DB 1A5FH 5DRZA 2YD8A 2LU7A 1S9YB 3HZVB 5ICXB 4GG6A 4PYHA 4RX4D 5C08B 3SE3A 4D3CH 1ZWIB 1PVHA 4RA0C 3IKCB 5IBLC 1ZVYA 3MLVH 4PTTA 2CRMA 1JTOA 3CFKA 5HGDB 3EJZC 4P23B 2OSLB 4X6FA 2Z4QA 3TBYA 4PJDB 2VZ3A 4YDJB 2JCCF 1MH5B 5FYJU 4M03A 4XMLH 1BVLA 2DQIH 4Z76A 3GSRB 2KQNA 2X4RB 1F3JB 7FABL 3QWRD 5DJYA 1AR1C 2ESVD 4J8RB 2EDLA 2DQJL 4K7PX 3CC5B 5DZNA 5EU5B 3D0LB 4YBHA 4H0HB 5DI8A 1ES0B 1G7JA 5EUKB 1WBYB 3QG6A 1HINL 1ZLVK 5CHNB 4C56D 1A8JH 5GZOD 3HNTH 5KSBB 1MAML 2HH0H 4I18C 2KZWA 1F2XK 3PQYB 4GG6E 2VLJB 3EHBD 4JZOB 2W0FA 1QBAA 4KRPC 4LLAA 4PJFF 5IFHL 1IAIL 4M1DL 2IAMA 1HH6B 2E9BA 4ELKA 3VU2A 4KK6C 4X4XA 5FM4A 1R5IA 2VIRA 4NUJB 3H3PH 4X6DB 4JO3L 3SO5A 1SHMA 4ZUTA 2MJWA 1OF2A 2AV7A 3OXRA 1IC4H 4TSBH 5TPWL 1T1YA 3WKML 4QHNA 5FGBC 3RWDA 3V6OC 5IK3A 5T3XL 3MV8B 4PJXF 4HWZB 1OAYL 4U6HB 1H0DB 3C8HA 4OCMC 4P2RA 3CDYA 4XCCL 5F7UA 5FOBA 2QADD 4JKKA 4OLXL 1S8DB 4GBXD 1F3RB 1FH5H 1YZZA 5DJXB 4M4RA 5DD6A 1UZ6E 4H1LG 5EO9A 3T65B 1G6RH 1UJTA 2A6DB 4IDJH 3ZE2F 1EXUB 4IRSC 1T4KB 4F15C 2F53D 4KI5F 1L0XA 4FXGB 4IRJB 4OAWA 4BSVB 4GMTH 4V1DA 5BCAA 5ACLA 4OGZA 1BREA 3OKEA 5GS0H 1X4YA 3CU1A 4XPTL 2FX9L 3IETB 1ZT7B 1A4JB 5ESVA 3ES6B 1OHQA 4JFEB 3HZMA 4JN2B 4NQXA 4DTGH 1UVQB 5DJ2A 1X9QA 4M7ZC 4FRWA 4P2RE 1AO7D 4JQXC 5T5FL 2E9WA 5C0RL 1MOEA 3ECBB 1P5UA 2APVA 2NTSP 3MRCB 4EI5C 5KVEL 4PJGA 1DUZB 3W0WD 1GZQA 2MPAL 1MFNA 2FX8H 4OFPA 1CD1A 4WJ5B 4FMKA 4NM8L 5IFAL 1RZ8A 3QRFM 4RMTA 4TQEL 2BJML 3EYSH 4XTRD 3E3QC 4LHUD 1KENL 4J3SA 5D1XC 5HHMD 1F4AA 3P9MA 2OQJA 1K3IA 1JPTH 1KTLA 3ETBF 4ODVL 5CZXD 5FKPA 2VDNL 3K4ZA 3QRGH 4V1DE 3PNWB 3HS0A 4L9DA 3WFCL 4D2NA 4EUPB 1J8KA 4GO6B 4WTWA 1UZ8A 3UTTD 3VGGA 1XR8A 2X40A 4DKAA 1NGXA 4QHUB 3CVHB 1MI5A 4DEPB 4GRMA 3T0EC 5MHSE 4JGMA 4M6AA 5DA0B 3B5TA 4GAGL 3AY4A 1UQSA 3QCUH 4S1RH 5HDBF 4PJGE 3O4LD 4DW2H 5GISL 3P4NB 2HT2C 4XWOC 3IJYB 4J23A 4ODBD 4BH8B 3NA9L 4UZGA 3W11C 5GGTA 3T3PE 1N6QL 3SDXF 5FO9B 1Q94A 2X89D 1N26A 3P4LA 2VDPH 1JMZA 4PRPA 1S7UA 4HJJH 5DMGD 4JG0L 3STBA 4OZFH 1NCDL 4HUVB 4WUKL 4KXZI 3FO1B 4HS3B 5J4MA 2E6PA 4JZJC 1B6DA 1RIHH 5C09D 1NCWL 1PQZB 1DLHA 1JIBA 2AXFB 5E6ZA 5DFTA 4KC3B 1JV5A 1GGBH 3MXVH 1MJ8L 4QHLB 1MI5E 2YPLB 2BY0A 4J7RA 3V0VA 4TUJA 3BE1H 4O2EB 1QA9A 1X3DA 3QSKB 3VWKB 4EN3C 4OFYA 3IFLH 1U8NA 5H94A 2XZCH 4PTUB 4NN7C 2WINA 4X7DC 3MLYL 5JQ6L 2FNBA 5K9QI 2GJJA 2N56A 3NIGF 3VGEA 5JOFA 3G5XA 5C8JA 4MX7B 5JXED 5D7LB 3LB6D 1RQ5A 3NN8A 1UYWH 4NKOB 3KXFA 3O6MH 3QFDA 4F7CB 2R0KH 1P84K 4GRLA 2ICWA 4PRPE 3MCG1 3TNNA 1QRNA 1CDYA 1KLGA 3HUJE 2NLJA 1XR9B 2L4OA 3D87B 2C9AA 2J8UA 4AL8L 3IAQA 4PJ8B 3WSQH 5E8NA 3KPRA 2AJ3B 3RGVB 1MCOL 4FQJH 2WW8A 3U30B 4Z7OF 3RWFB 2VR9A 1AXTL 3D5OF 5MEPB 4LNVA 1MUJB 4MLSA 1UWGL 3T77A 2FYYA 4NO0A 5HDQL 3C5ZB 3TV3L 5JORB 5ADPH 4JFYA 4I8DA 1PZ5A 5GRJH 1PZUB 1WFOA 2AEPH 5GS1C 3FO9A 5HHVH 4LLDB 4OFIA 1K4CA 3KXFE 1RK1B 5DQDH 3EHBC 1VSCA 4M6ML 2DD8H 5CEZH 3X11A 4QRRB 3KR3H 2ZWLT 2IADB 4N0YH 5CINL 2B2XH 2J8UE 1XZ0A 4RDQG 3WIIL 2YD5A 3KPRE 3TBWB 3DLQR 4LAQL 3VFSA 1RUQH 3MO1A 1DQQA 3VXUB 5C3LD 3KDMB 5AD0B 1EO7A 5JPNB 4XNXL 1F4WL 2QADC 4K7PL 4GBXC 5IMKB 1EFXD 3QIWB 4YBLC 2Z9TA 2NY0D 5FKAA 5IHZA 1ADQL 5DRNA 1CD9B 2PXYD 4HSQA 4HJ0D 3DVNA 3I50H 3BUYB 1MCWM 4JPWH 3BEWB 1G0XA 3BO8A 2VE6B 1TJIL 2OP4L 2MTPA 2AGJL 5C0FA 1FBIL 2W91A 3C5SA 2FEDD 4PD4K 2ICWJ 4LLQB 3D3VB 1S9WB 1VA9A 2RR3A 4JRXB 3T2PA 5C6TL 3BPOB 1FJ1B 3G5YB 4QY8A 4PJAF 1I1CA 32C2A 1EAPA 4QXWA 5B4MC 4PRHA 3QI9B 1AD9B 4U3HA 4PS4L 2VITB 1DQML 3LQAC 1ZLSL 3WUWG 6FABH 3CCHB 5T3ZE 2DLGA 1IAIH 4XGZA 5HGAB 5CIPA 2AABH 3VRIB 2HFEA 1G0YR 4FQCH 1AQKL 3TC9A 1ETZA 1G7PB 1DBML 5EPMB 4DKFL 3NCYS 4XTRC 3PHQA 2JB6A 5TPWH 4QRSA 4ZUVA 4S0SD 3T3MF 4MD5B 1P9MC 5CZXC 1CICC 1OAYH 1PEZA 1TXKA 3QZWA 4ETYA 1A3LL 3Q5YA 1KB5B 4IRZH 2ITDB 5LGJA 2FSEB 3H42L 3G5ZB 1AIFA 3SQBA 3KYKL 1BF8A 1GAFL 5EZOL 3F58L 1BQSA 1K85A 5K9JL 1QEWB 4CVUA 4PRHE 4QTHB 4M7ZB 7CGTA 4RIRB 4O51B 3SKOB 1N5YH 4IMKA 4EI5B 1NCCL 1KXQE 3CH8A 3BD5A 4CAGA 1F4HA 3NOIA 4XVTL 1RZKC 1HQ4A 1OSZA 4L8CA 1IGYA 3MREB 1DBKL 4QTIH 4G6FD 5HGHB 2CLVA 3TEUA 5D1XB 5FFLA 3D48R 4XPTH 2FX9H 2J4WL 1GOGA 4NQDD 5EC1A 1YMHA 2VDRH 1OGAB 1MIML 5DMGC 4MJ6A 5D7IF 3VH8A 1YEGH 4PJ9D 1FNGB 1F00I 3G6JB 4LASH 2AJSH 5T5FH 3ZSSA 5C0RH 3UJJL 2JTDA 3DPBA 1CCZA 4U1NB 3ARXA 4DZBB 1S7XA 1KJ3H 1F2QA 4EXKA 2VXSH 4XCFH 5IFAH 2D31B 4TQEH 4LDOB 4ZAKB 1FE8L 1WEJL 2GT9B 3BIKA 4GRWB 3V0WL 3MCKB 5GGRB 3TZVB 3WJJC 1F97A 1G6VK 4FNLH 3GM8A 3T08A 5E9DD 1D3CA 3GMQB 5CLWA 3IB4A 5J56B 4MNQD 5JXEC 5LQBL 1PLGH 2ZZUT 3LB6C 5IQ9B 4LBEB 1EV2E 3IAPA 5D71L 5IJVB 3WN5B 3IVKA 4JFQB 4KJYA 4LARL 3GRWA 2X4UA 2Y1VA 3S8WA 1T2QH 5D2NA 5DF0A 4JZJB 4DUXA 2P44B 4KKCD 1Q0YL 1M1SA 1LVEA 1BMGA 3PGDA 3RIFK 1YEIL 4PLJC 5CP3A 4HXBH 2NW3A 2D7TL 4TTDD 4HKXB 1KGCE 4X9FA 5GISH 3T8XA 3FJTA 4R26L 1S3KH 1T89C 3BXNB 4YDVA 2R0ZH 4U1SB 4OKDA 4LLVB 4M00A 2V5YA 1Y6KR 3NA9H 5HYIA 3MLTA 1U8JB 4NN7B 5ALCL 1FVCB 2R1XB 2FECL 5JNYA 4PGCA 4CADB 1W2KT 1BBJB 4JGUA 4EBQL 2YKLH 3CK0L 2COQA 4OZFG 4KK9C 4P57B 3HMXH 1QNZH 1CF8H 4PREB 3C60D 3KNBA 4UT6L 1MJ8H 4PV9B 3G5VA 2NX5A 4WW2F 3FO0L 5I0DA 3HI1A 4O5LH 1S7QA 1TIUA 1CFVL 3BKCL 4P2QA 3CFEA 4RMVA 5JQ6H 2XPGA 2ESVB 4LF3B 3I6GB 4HPYL 4FQIL 4JEGB 3WDJA 4G8GD 3IJHB 4MXVE 4Y0GA 4NNYA 1RIUL 1UCBH 4FQQB 5DMKA 3RAJL 5LXGH 4C56B 2NY0C 5D7KD 2ZUYA 1D7FA 5DK2A 5IFJA 4PRID 4AL8H 3BP6B 1CS6A 2ICEB 2AVGA 4PUBL 1A7OL 5E8DL 1IL1A 1UXSB 5I73B 4NO3A 1MREL 3HC0A 2FEDC 1QPPA 2NX5E 3CNKA 1A6WL 5D70L 3BSZL 1OTSD 4P2RD 5DJAB 5IW1B 3EW3B 1GHFL 3UYOD 4OCNC 3QJFA 4U2YA 1S5HA 4K3EL 1T5WB 5IV2B 3IDNA 2DL2A 4R97B 3MGTB 1T7XA 3HFMH 4GBXB 4ERSH 1L0QA 1HSBB 3SGJC 5EC2B 1IM3A 2EKJA 2XY2A 4XXDB 3STZA 3RL1B 5DHXB 4YXHH 1TVBA 5KTEH 4I1NB 1Y0LA 4Q2ZA 3NCCB 5CINH 3RHWK 1W72B 1FYTE 1BQLL 2VXVL 1RZGA 4W6YB 5KSVB 5E6YA 4ELMA 1YY8A 3WIIH 3RWCA 2JJTA 1JI2A 5H35B 3SDAA 1DDHB 1IC5H 3MYJA 4JR9L 2YOCA 1MCBA 3NGBC 1SJEA 1I9IH 1LWRA 1MAKA 3E6HA 1F4WH 4AEHL 4PJHF 1JPSH 4OZ4A 3HC3H 2DTSA 4HLJA 3BKYL 4OB5L 4AIOA 2Z8VC 3EGSB 3LN4A 1UKSA 3EJYC 1ADQH 2FJGB 1HI6B 5HPMB 2BK8A 4PJXA 4Y4HA 4X6BB 4DGIL 3UX9B 5JHDE 3W0WB 2F74A 4ZTOL 4NQEA 4XPAH 3LRHA 4MB3A 2GEEA 3CUPA 4HF5L 4LHUB 3N9GH 1KN2L 3LOWA 5HHMB 1BQHB 1DANU 3G6AB 5DK0B 3HAEH 4E42B 2QSTA 2Z0BA 3JWOL 4Y2DD 2P45B 2EH7L 4OFDA 4F57L 4ZMAT 4PJ9C 4GUPB 3EFDL 4O9HH 1MI5D 3UTTB 4C57C 5ID1A 4R96A 4PD4J 4UBDD 2FIRT 4XI5C 3QUZC 5E8EB 5IVXF 2F8XC 1U2HA 3KYAA 2ZSWB 1Z9SA 1BFOA 5C0ND 3P3YA 1RUMH 3R1GH 3HRZB 4ZSOB 3NVQA 1MCKA 3O4LB 2M26A 4Y19A 3C8KA 4YK4B 4NQEE 3DX9B 2CO7B 1BGXL 2W60B 5DJ8A 3MLZL 1KSRA 2UUDK 3CH1B 1KJVB 5KSUB 3KLAA 3H42H 4G9DA 1IAKB 4X98A 5EBLB 2G75B 3KYKH 1GAFH 2ZCLL 3GSNB 3F7QA 3W9EA 1UM5L 1GGTA 2IPKA 4JDZB 5DS8A 1KBGH 3V8OA 2H3NB 4WVRA 3WIHL 4KKCC 2V9RA 35C8H 1PY9A 1J18A 5DLML 1WICA 4TTDC 3LEXA 3RI5F 3SE8L 1F8TL 3EO9H 3DUUB 5E1AA 1BJ1J 2CLRA 2VR4A 4ALAL 4D8PB 5HGBA 5BS0D 2H32A 5DUBB 4GXUM 5L88H 3PGCB 5JMRA 1FLRH 1XGYL 4FQHA 4WDIB 5AG9A 1TZIB 2IMMA 4LPWA 5KS9B 1F4YL 1JRHL 3MJ7A 3NCFB 2EEDA 3OQ3B 5KVDH 1QFHA 4XCEA 4TNWK 1JF5A 1IILE 2R2HA 1P6AB 4BELD 5HBBA 1QRND 4XP1H 4Y4FD 5DRXA 4Z0XA 5SWZA 3C60C 1B0RA 2V7NA 4EJ1C 2BMKB 5F7NC 4QWWD 4BH7A 4PP1D 1G84A 1MFDH 2Y5EA 1PKQE 2Q76A 5D7JB 4ZD3H 3Q5TA 2MCPL 5ISZB 1FE8H 4LL9A 4Y5XA 1OB1B 1NFDF 5I18L 3A6BL 5EU6A 1NEZA 1NAMH 2MQ3A 1JRHI 1HHIA 3KPMB 2CKBH 3AMLA 5A2IH 4G9FA 5E6IA 3VI3E 1SM3H 2EZ0C 3RNKB 2MKLC 1SMAA 4NO0D 4XCYB 1N0XL 2E5EA 1FNHA 1T80A 1X4XA 5LQBH 2J6EL 1ZLUK 1BFVH 1G7MA 2V2XA 4WWID 1WLHA 1WIUA 2ZCKH 5D71H 2BNRB 3U4BH 5F21B 1WBXA 4KZEL 3QPXL 1E6OL 4GG8B 5F3HB 5CBAA 2XYCA 5SWSB 5T5NF 1RZJH 3DVIA 1KEML 1KJ2B 1FVEA 1GZPA 3VFRB 3DOSA 1MCRA 4OZHB 4M1GL 2DI8A 4K3GA 4YXKL 4N90D 1OAKH 5SWZE 5GSRA 3RWEA 1QFUL 1YN7B 3QH3A 4YHPA 5DHYA 4KDVA 2LVCA 4R26H 1IGTB 1JZ3A 1NDMB 3MLWL 2VZOA 2BSTA 3O3BB 1FO0B 4HWUA 1MIEH 4Q9QH 3TN0B 3FN3A 4WHCA 3VRLE 2IBBA 5EU6E 3U6RB 1OTSC 3ARGA 2GKIA 4NJAL 5ICZA 2NY3D 4OCXL 1C5DA 4G9FE 4EBQH 5AYUH 4HKZA 3FQWA 3ULSA 1IKFL 1C7SA 1U41A 4ZXBD 2A6KB 4RFNC 2EC8A 2VRAA 4XP5H 1EFXB 4KGJA 4HFUH 1DQJA 1HHKA 2NY0B 1WIOA 5IQ7H 3JV6A 4HBCH 1RJYA 3R06B 4NGHL 1ZHKB 2DYPA 3LHPH 2VB5A 4KHTH 2PXYB 3P73B 5I1DB 4U6YB 4YC2C 1J1PL 4LCUA 3SDDA 1CFVH 1U8OB 3F12B 1U92B 3LN5A 4N8VB 3V9FA 1YEDB 3VA2C 4ORGB 3GSXB 4XNQA 3RUGA 1VACB 5FCSH 1DCLA 3DSNA 2X09A 2PO6A 5GS0C 2ZUWA 3V95A 3RAJH 5IR1B 4XNZC 1IC1A 4PB0L 4BK5A 4L4TA 1CE6B 4HUUB 3TA3C 1ORQB 1OTTD 2GAZA 4XPBL 5C3TA 2Q7NA 3IGAB 1B2WH 1T0NA 4ZOEA 5I1LB 3P77B 3V79C 4AH2B 5C0DB 1QHPA 2R4RL 1JGVH 4UIMA 4GS7B 2AP2A 3CMGA 3ARDA 1A6WH 3BZFB 2P8LA 3PWVA 4X6EB 4Q97A 3P4MB 4AIZA 4Y2DC 2BHUA 4YH6A 5ICYB 5DFWH 3SQOH 3K80A 5EOCL 1MEXL 2EYSB 5T3XD 1RY7B 1GVIA 2D4FA 1W8OA 3S5LG 2Y6SD 2LU4A 5DD3L 2GFBA 3P0VL 1IAOB 3EYVA 2EDFA 4UBDC 5TQ2L 2VN7A 1QFWM 2X4OB 3EOTH 5L7XL 3AY4C 5C0NC 1YN6A 4L4TE 3FQUB 3QEUA 4JJHA 2VLLA 2DLTA 4NQCE 1I85C 5DUMH 3BZ4A 4PBXA 5GGRY 4TPRL 2EDTA 2DJSA 4L8SA 1RPQA 2QQNH 5J3HD 4PIRF 4UV4L 5GJTH 4I2XE 2PW2B 4P3DA 3ARWA 1QR4A 2GITB 4LSRL 3VW3L 4AMKL 2HN7B 4RGNE 3NH7L 3M17B 4QOKA 1U8PB 4KKLD 3BKYH 1T7VA 4OB5H 5C92A 4PJ9B 1Z5LB 3VFPB 1GOFA 1OW0A 1VGKA 3BP4B 1KGCD 4FP8L 4QF1A 2Y06L 3F8UB 5I16B 3NIDE 2VDKL 1WCBA 2EH8H 5T1MA 3O4OB 4OLEA 1U8KB 4CN1A 3ARFD 4NDMB 1BAFH 4ZTOH 4KMTL 4NQTA 1CK0H 3L6FB 2GIYA 4GW1B 1S7WA 2WUCL 1U58B 4HF5H 2EC9U 5JPMA 1CWVA 5DRWA 4NN6B 3T2QA 3BN9C 2VLKD 4CW1B 5INDB 1CBVL 1UM6L 3RY6A 4LKXA 4HLZG 3SKJL 3RTQA 4ZUWA 4HIIB 4F57H 3HAEG 4B0MM 3FB6A 4I3SH 4QLRA 4CBPA 4UILL 5MERB 2I07B 2RIKA 3PV6B 4Y4FC 3IFNH 2E8YA 4P46C 1MCJA 4QOKE 4QWWC 4UMGA 4NPYB 4PP1C 3IDIA 4XXCA 1LP9E 5HDOA 1M05A 4ONGL 4EVNA 5I66B 1WWWX 3EYFA 2FBOJ 1S7VB 3CXHK 2PW1B 3GUTA 1NC2D 2X70A 4ZTPL 5GS2D 1RI8A 2G9HB 1MWAA 2QQKL 3MV01 5DRZB 1VEMA 3RZCA 4PJBE 4QYOA 2FD6L 4GG6B 3TJHD 4P9MH 1IT9H 2F54A 1DBBH 1YEFL 5CCKH 1A7NL 4MXWH 3WIHH 4PTTB 3CFKB 4DUVA 2ORBL 4FQLL 5DLMH 4X6FB 2Z4QB 3TBYB 4KMLB 1KV3A 4UOW1 5I30L 1U3ZA 1BVLB 3QDHA 4P2QD 3O6FA 4Z76B 2UVFA 1MHCA 1VFUA 1I1YB 1I4FA 3T0AA 1HDMA 2D4DA 4HPOL 5JOPE 3WD5L 4KZDH 3BAEL 4KV5E 5DI8B 1JGUH 2NY3C 4JY5H 1G7JB 5AEAA 3QG6B 3P11L 4M43H 4PV8A 1NGPH 5I71B 4ZXBC 1KCVL 2I26N 4RMQA 1ZA6A 1P4LA 2ZUXA 4OCRL 3KPPA 3UP1A 1XIWC 2F54E 3Q6GH 4ELKB 4OD3L 2MCPH 2NY2C 3MRKA 1QFPA 4X4XB 3SCMA 1MQKL 1R5IB 2VIRB 1YMME 3A6BH 3HE7D 2VN4A 1U36A 3KYNA 1A14L 1YJDL 5DT1H 4ONHA 4ZUTB 4G8FA 1OF2B 2AV7B 4C59B 3OXRB 1CIUA 1E4KC 4NCDA 1T1YB 4XPFL 3QXVA 1N0XH 4QHNB 3RWDB 5IK3B 5D6DA 2J6EH 3GSWA 1DLFH 1D6VL 1MHPL 2FJHB 4P2RB 1YPZF 4N1CA 4P0DA 5DR5L 5FA3B 5FOBB 5CKAA 4Z77A 4R4NC 3HZYA 1E6OH 1QP1A 5D72L 5DD6B 1HH9B 5EA0H 5EO9B 4LQ1A 4KMQA 4DVRL 4H88H 1OTTC 1NLBH 1X5GA 4M1GH 1FNEA 5EO0A 3UCRA 4AEEA 1DL7L 1F6AA 1KIRA 5BVJB 1I8MA 3LD8B 4UQ3A 1YEJL 3CDGA 4KHXH 3KPQA 5DVLA 2F5AH 2R0LL 4P5TD 2YK1L 1R5VA 4KPHH 4OAWB 4YC2B 4V1DB 3D18A 3VFGH 4U1MA 4N8PA 5KW9L 4OI9A 1RURL 3HNSH 4LP5A 1TPXB 4Y16D 1MF2L 2DQCL 3MUGA 4K2UH 4NJAH 2ED8A 4Z7WF 4OCXH 2LAGB 4PJDF 3T0XA 4YZFF 5ESVB 3UBXI 3OAUL 4HAFA 3HZMB 5DJ2B 2X1QA 4I77H 2JB5L 2L0DA 4LVHC 2Z8RA 1X5KA 3E6FA 1GSMA 4Y4HD 3TGXA 1Z0NA 4PJGB 1GZQB 3RIAF 1I8IA 1CD1B 2VABA 3DX7A 3NACH 1Y6NR 4NQED 4CJ1A 2DQEL 1CQKA 3DURA 5IMOA 1OAUH 1RZ8B 4ZO9A 5D93C 5KVGL 1JNLL 4HHAA 3UO1L 3ZKXC 2XTLA 2FR4B 1G6RA 3P30H 3WHE1 1AGEB 3P9MB 5J3HC 2OQJB 1KTLB 3RJDA 4JFXA 5FKPB 2MMXA 1A7PH 1XF5A 5GXBB 3AVEA 3HS0B 1IEHA 4Y2DB 1UZ8B 1CXFA 1XR8B 4Z7UA 4ZFZA 3V6ZA 1NGXB 5FYKE 1SBSH 1MI5B 4XPBH 5J12C 5TQ0L 4GRMB 2WIIA 5IKCA 2VXUL 3WCYA 2YXFA 3O3DA 3FB5A 3ARFC 1FVDB 2MFNA 3GKZA 3MOBL 1UQSB 1NLDL 4MA1B 3JTTA 1FNFA 4Y19D 3QDJA 5E2WL 5MENE 1C5CH 1HNFA 4QNPF 3DETD 1SYSA 1IMHC 1IGIH 1NC4A 1Q94B 3HG1D 1ZE3C 3I75A 4PRPB 1S7UB 1J1OH 3JV4A 4PJEA 4HWBA 2WQ8A 2R1YA 4OIAA 2YD4A 5DD3H 1N3NA 3P0VH 5A2LH 2HFTA 5GS3A 4N1HB 2QR0A 4OZIA 4IMLA 2WAHA 4I9WE 4MYWB 1DLHB 4OFKA 1I7UA 2A9NH 3OJ2C 3A67H 1VCAA 3UJIL 5L7XH 4Z7UE 1JV5B 3VXPA 3V0VB 1PEWA 1EEYA 3HPJA 4TUJB 3FQTA 4EDWL 5I1HH 3HKFA 3X12A 1QA9B 4LAJH 5FHAL 5EU7C 4QXUL 1U8NB 5CILL 4JM2A 5F9WB 1IGCL 2X9XA 4UV4H 1FNSL 5IVXA 2WINB 3GHBL 3MJ8A 5BS0B 3T2OA 2H6PA 1EAJA 3CJJA 5DHVA 5JOFB 3G5XB 5C8JB 4Z6AT 3I6LE 1S9XA 1EEZA 1EX0A 2YMXL 3L3JA 3NN8B 2WLYA 3IDJA 3AXLA 3KXFB 3QFJA 1WBZA 4AEFA 5CFHA 3TJHC 5B8CC 3ARBA 4N0CD 4XP6L 2ICWB 3HLAA 4YE4L 3TNNB 4FP8H 4LSTH 4FXLA 4PJEE 3U7WH 5M7QA 1QRNB 4J3OC 5DVMA 1H9VA 1KLGB 2NLJB 3L95A 4KKAD 4BYHA 2J8UB 1JTTA 4OZIE 5E8NB 1RVFH 1REIA 3KPRB 1MVUA 4R0LA 2VMFA 2CUMA 2UY6A 4G7VL 1NCBL 2JIXA 3FT4A 4JKPL 1FC2D 2YEZA 5HVGB 2VUOA 5IEKA 4X7SL 5EWIL 1UM6H 5HHPA 2FIKA 2MHAA 4AENA 3L5JA 3T77B 4NO0B 1DVFA 3GIZL 4GAYA 3JWDH 3N50A 2IH1A 4JFYB 4MXQD 3ZKNC 4JY4A 4UILH 2CUIA 4K3DL 1I7ZA 3FO9B 3BJ91 1I1AC 4NN5C 4UV7L 1B88A 3SY0A 5E4EB 3X11B 2DBJA 2IF7A 2MQ0A 2Z31A 4G6ML 4XZUA 3HE7C 4KKNA 2HTKD 3LPWA 1N5AA 5HHOA 5I15H 3L3GA 1HN1A 3OKOA 3V2AR 2AJYL 5C7XH 1XZ0B 3AM8A 4GKSA 4X7FC 2XRAH 3ORJA 5I74C 3VFSB 3ARGD 5EOCJ 3MO1B 1DQQB 4JQVC 4LSVL 3BKJL 1VESA 1NFDA 3KPNB 2FD6H 2A9MH 4M5ZL 4HW6A 5I17A 1QFWI 3PWPA 5IB1A 5FKAB 1A7NH 1T3FA 2GTZA 2XWBA 5I75C 5IHZB 4L5FL 3MV9A 5DRNB 2DYPD 4AK1A 1S7TA 3DVNB 5KOMC 3SDDD 4P5TC 2EE6A 3BO8B 4PGEA 3DV6A 5C0FB 4HPOH 3P9LA 4WUUD 3C5SB 25C8L 2X6MA 5CJBA 5GZND 1ZHLA 4Y16C 2B4CH 5TGBA 43CAA 1MFCH 2WWKT 3QG7L 1T1ZA 4LKCA 3S36X 3BYTA 4XPGH 4QY8B 3VFOB 1EAPB 3MRLB 3P11H 5I1JH 3I3BA 4R6UA 5FECB 4XC3L 4L8DA 2R56H 2FX7H 4OCRH 3S34L 4MDJA 3ZE0E 1FLTX 2FJFA 5ESQA 1LMKA 4XGZB 5CIPB 4HK3N 4UTAH 1TCRA 3PWPE 2OI9B 4JRYD 1RZ7H 2VLME 2EE9A 1MQKH 3V5KA 1ETZB 4R2GD 1L9MA 3MV9E 5BV7L 1X5XA 3VFUA 4OF7A 4QO1A 1LEIA 3U7YL 3PHQB 4P49A 2JB6B 4FFZH 5FXCH 4HQQH 1IBGH 4QRSB 4ZUVB 4OT1L 5A1AA 4J4PA 4Z18A 1PX4A 2OLDA 1D6VH 4OD2A 3QZWB 1V05A 3OXSA 4WW1A 5BJTA 4OCYL 4P5KA 4KI5C 5LGJB 5ALBL 1S5IL 5CEZE 1AIFB 3MOAL 2LFGA 2P8PA 5BW7A 5DMIL 3MFGB 4L3ED 1FL6A 3ZLQC 2ENSA 2I5YH 5D6CA 5F7DB 4YHLL 3ZE1E 1QSZA 4X7EC 3UBXA 3RP1A 1U93B 3JVGC 5GIRA 2WIMA 1OSZB 4L8CB 1IGYB 1FAIH 4OZGE 1JMXA 3QB7C 4J3UA 5B21A 2QSVA 4UAOB 3AS2A 2RHEA 5I1IH 3GMNA 4F7PA 3PIQA 1XF3A 5HYSA 5EC1B 1UJ3C 4GW5A 1YMHB 3UYRH 2XI9A 3GNMH 3FT2A 2BP3A 3AREC 4MJ6B 1J86A 3VH8B 5JZ7D 3WJLA 1K8DA 3B4NA 4KQ4L 3E1F1 5DQJA 4OQTH 4NO5A 1OCWL 2O5ZH 2CRYA 1MFEL 2HVKA 3MJ9L 1S7XB 3WNMA 3UDWA 3N1PC 1AJ7L 5FB8A 5J1AA 4NT6A 1JNLH 1TDQA 4HIEA 3C6LA 3MRJA 3HC4L 2DBLL 1LNUA 4HC1A 3BIKB 2CK2A 4HWEH 3O41B 3V4VH 3QPQD 2WANA 4NRXA 4NBZB 4WIQA 2FZ3A 3H9HA 1JZ8A 3RTQD 2VLKB 1FG2A 5E94B 1H5BA 2VXTH 2AJUL 3HE6A 4JCMA 3IVKB 1EPFA 1UEYA 4K8RL 4KJYB 5FV1L 3T1FA 1MPAL 4JN1L 5D2NB 3LSOA 2VH5L 4UT9L 4KKAC 1V7ML 3TO2A 5GSVA 4C54A 3MOBH 3MQIA 3PGDB 1JYXA 2NW3B 5IBUG 5E2WH 3OTTA 1F6LL 3WYRA 2A77H 4YDVB 2AS5M 4PJ7E 3U9UA 3Q48A 5JHLL 5CSZA 5K59E 5BO1L 3MLTB 4CDGC 15C8H 2O26U 3TYGH 3CVHL 3KHQA 5J13C 1HKLL 5JNYB 4JJ5A 4PGCB 1AI1H 4F7TA 4I0PA 1ZVHA 1FZJA 3MZGB 3AB0C 4OM1H 1QSVA 1H3UA 5D8JL 2BVPA 4K94H 1R3IH 1UA6H 1LK3L 3ROLB 2V5RA 5EDXA 3ESUF 4BZ1L 5K9OA 3KNBB 5IOPA 4QT5A 3RL2A 3LKOA 3G5VB 4TRPL 2NX5B 1HE7A 2HTKC 5FHAH 3O6FD 3GBNH 3HI1B 4QXUH 1HWGB 1S7QB 5FOJA 4A6YH 4ZS6D 1MCSA 4P2QB 3CFEB 4GW4A 5KJRL 1GC1H 2XPGB 3EDJA 1RD6A 1J8HA 3ARGC 2FRGP 4YX2L 4OF6A 1PG7L 3QUYA 1T0MA 4NJ9L 5CJ5A 4KJQD 5DO2C 1TCMA 3D39A 2Y36H 4NNYB 1N8ZA 3VDAA 3QUMH 5DMKB 1EZVY 4GRWF 4MNGB 1DEEA 4WV1C 4LSQL 4YE4H 4TVPL 5C2BL 3ULVH 5DD5H 5IFJB 4F9PA 1H3XA 4L3CA 5HVFB 2DKMA 5JR1L 4WI8A 3OKLA 1IL1B 5EN2A 2PETA 3HMXA 5IW3A 4NO3B 3HC0B 5JIKA 5HTSA 4X7SH 3OZ9H 1AE6H 4Y7MA 4PGJA 4CMMA 3GIZH 4ZNEA 5CZKA 1G7IA 1BBDH 3TO4A 3QJFB 1QSFA 1J8HE 4M9PA 5E8PA 3L5XL 5EU7E 1S5HB 3RWJA 3V5DA 3IDNB 4JFDA 2ZCHL 1BD2E 1QR1A 3U0TB 2ZOKA 4MJ5A 5J11B 1IM3B 5I75B 3STZB 2IQAA 1T83A 1BLNA 1TVBB 1UM4H 3UTPD 4Q2ZB 1VPOH 4PPTA 2DLEA 1RZGB 1A6ZA 3H2WA 1Z9LA 4ELMB 1YY8B 3K46A 5E7FA 4POUB 5D5ME 2YA1A 3RWCB 4M02A 4MA7L 2YUZA 3MJ6A 4JO2H 3T1WA 4J12A 2AKRB 3MYJB 1YEKL 1JE6A 5EUOA 2NY1C 5FYKD 1SJEB 2IMNA 3MRPA 3E6HB 5C0JA 4LLUB 3LMJL 4OZ4B 4KQ3L 4PRNA 4ZNEE 3MLRH 4IJ3C 4NNPL 1GRWA 1I7RA 1QBLL 1YECL 4LPVA 3S36L 4RRPA 1QSFE 1BF2A 4JFDE 1FYHB 4PJXB 4Y4HB 1Z2KA 3W81A 2B20A 4PR5A 3DRQA 3X13A 4PGBA 3H3KA 1X5JA 2F74B 5T5NG 4HT1H 2GTWA 2K9UA 4NQEB 4X6CA 2NY6C 3ALPA 3CUPB 1CGTA 2DKSA 5I8EA 4Q6IC 5H37G 1OPGL 2LVEA 4M62H 3UTSA 3QG7H 2IG2L 3BGFC 4CKVX 4ZUUA 4NQVA 5D96C 1MCHA 3E2HB 1OP3K 1MJJA 3NFSL 5JZ7C 3X3GL 5F7HA 5EUOE 4LIQL 3SGDH 3S34H 5ID1B 4S1SL 5CBEA 1JFQL 4R96B 4Y1AD 5CGMA 5L0QC 4P5MA 2EDDA 4ACPA 1BFOB 5IEHA 2VDLH 1BVZA 1JNNH 4HKBB 3QDJD 2AXGA 2GI7A 4Y19B 4H25A 5TDPA 1RIVH 4ZOCA 4OT1H 3C8KB 3BRFA 3QPQC 5FYJL 4X6CE 5DJ8B 4OKVA 1HWHB 3BIBX 1B4JL 4DWHA 3KLAB 4X98B 4G9DB 1G0DA 3O2DH 4JFHD 3F6LA 2OR9H 3UTSE 3F7VA 3JWOC 3L7EA 4K55A 5DMIH 2V9TA 3BKML 4MHHI 3W9EB 2IPKB 3J8F7 4J3XA 5DS8B 1WAAA 4YO0A 1U3JA 1JGDA 5JIPA 5L9DH 5F71A 5LBSH 3PWJA 3LEXB 4JPIA 1KB5L 1ZT1A 3MGOA 3CPLA 4MA8H 4F2MA 2HT3D 5E1AB 2CLRB 3OMZA 5HGBB 5EZLA 2H32B 5TDOA 1P1ZA 4DFIA 4FQHB 5JA8B 3DMMD 3VXMD 1CFQA 2D9CA 5K33A 3MJ7B 4XHQA 2R4SH 2QSCL 3QFJD 2P7TB 3DUSA 4KQ4H 3ARBD 4OIIH 2D7MA 3GJFK 4XBPA 4XCEB 4LSDA 3ZYZA 3H7BA 2R2HB 3MJ9H 4JB9H 3ULUE 5DRXB 4Z0XB 3ZE2E 1BIHA 5HJ3A 1B0RB 5F7WC 4OM0H 4BH7B 1AJ7H 4BSWA 3VXMA 4K07A 2VDOL 4NWTL 2AK1L 1E4XL 2Q76B 1WAAE 3QR2A 1EO8H 4NHCH 4Y5XB 2JIXD 4P4KC 3BPCA 4G42A 1NPUA 1HHIB 1MFBL 4G9FB 5E6IB 4RA3A 3QNXA 2BX5A 2Q87A 1QKZL 1DVFD 1MAJA 2F19H 3LPGA 1JN6A 4KJQC 1N64L 1G7MB 2CK0L 2V2XB 3GO1L 2VLRA 1K2DA 1R24A 2NW2A 1XMWA 1PAMA 2YZ1A 1WBXB 5FK9A 4WEUD 1TQCC 1ZANH 4EQ2A 3DWTA 5KOVC 1E4XI 3QEGH 2PN5A 3HI5H 1ZA3A 1TFHA 2VKWA 2ZNXA 1FVEB 4U1HA 1GZPB 5CJXA 1V7MH 1CN4A 1FL5A 4JDVA 2YUVA 4JE4B 5GSRB 5HHOD 3RWEB 3QH3B 2ADJA 4YHPB 4F80A 3MA7A 3BDYH 3GBML 4ZPVA 1FL3A 3ROOA 4Z0BL 1DTUA 4EUPH 1LO0L 1AY1L 2XA3A 5GRUL 5TE7L 2EDXA 3CFCL 5D1QA 4GSDH 1CQYA 3PWNA 4POZD 1J05A 3ARGB 2AW2A 4WW2C 5ICZB 1KACB 2BFVH 1C5DB 2D0HA 4HKZB 3FQWB 3ULSB 4ZFOA 1JL8A 2B7DT 4K9EL 2ED9A 4LCCC 2YBRA 4K3JL 1LK3H 3MV9D 2VLRE 1DQJB 1V3LA 4BZ1H 4RAVA 3JV6B 2FDBP 2P5EA 5KS9F 1TQBC 3G6DH 2DYPB 2GQHA 4Z7NE 5D2LA 1Q9WA 4RCAA 4LCUB 4ZQKA 3SDDB 2VZSA 4YBQD 4S1QL 4YLQT 5I1GL 5A40E 4YDIL 1MJ7L 3C2AH 1RJCA 3NAAH 3D85A 4XNQB 3RUGB 2V7HA 1L9NA 5EZJA 4DVBA 2BC4A 1VHPA 5FDWA 1EIBA 2PO6B 3WFEL 3L5HA 4TYUA 2P48B 4LFHD 3GBLA 2Q3ZA 2X1WL 3PL6C 5IVNA 5EOTB 4C83A 4L4TB 3DXAD 1Q9LA 2GAZB 4M5YH 3U46A 4KY1L 1T0NB 3T2NH 3FFCA 5TE6H 1HZHL 4FZEL 2LAAA 2P8MA 2PYFA 5JW4R 1VFAA 2QL1A 4UIMB 3LEYH 4R2GB 3B43A 3ARDB 1I3UA 4JLRA 3WLBA 5D2LE 4UT7L 4ZYKA 1G9EA 5E99L 5A16A 2P8LB 3PWVB 2BNQE 4AIZB 4JGJA 4XVJL 2E7CA 3S4SB 1CDBA 2HG5A 1WJ3A 1NGZA 5F9OL 2Y5TA 3WO4C 1QLRA 3L9RA 1CE1H 3EYVB 4IJ3B 1XGRA 4HUWA 4QXGL 1MCQA 2X4PA 1EVTC 1H8SA 2R9HD 3QEUB 2VLLB 3LCYA 2F15A 1KCRL 5DYOA 4WI9A 3BZ4B 1OLLA 2QLVB 1FN4A 2EIDA 4MA7H 5CAYB 2XN9A 5F1IA 1FFPA 4AQOA 4P3DB 1WFNA 4PGDA 4XVSL 2G5BA 1WFUA 3CSYB 2FGWL 4YDLB 2O93L 3SGKA 4N8CH 3GHEH 2VZ1A 1P7QD 2C3WA 3QNZA 1SYVA 4KQ3H 4QOKB 3MODL 3U9PL 2QHRH 5JW3L 1QBLH 1Q0XL 1W72L 3MV11 2VXQH 5B3JE 1VGKB 3REVB 4KJPC 5L0QB 3L1OL 2C3XA 4QF1B 2BDNL 4NUGL 4F7MA 1WCBB 5T1MB 4KGLA 4FFVD 2MOVA 2E7LC 4PJCE 1S7WB 1CFTA 1T22A 5IT2L 3D25A 5DRWB 1OPGH 3PP3H 5HI3D 1NL0H 5LKNA 2Y23A 2V5TA 3DMMC 2X4SA 3BWAA 3CSPA 4D0DA 4LKXB 1KCLA 1KTDA 3AS3A 1D5MA 2W07A 3RTQB 3I9GH 4ZUWB 3X3GH 3ARBC 3FB6B 5IROA 2X9YA 1FCGA 1XF4A 3VJ6A 3TPUA 1OD7A 5C0CE 2Y7QB 3MPCA 2E27L 2B8OT 3IRPX 4BZ2L 4LSSL 2XZAL 4WFGD 2R8SH 1VGEL 3IDIB 1NH6A 2AQ2A 1M05B 5J9PA 4R0LC 5CEYA 3DX8A 4EVNB 4MCZB 1A9BA 3EYFB 5ANMB 3GUTB 4FQXC 4PLKC 4OSUL 5TF1L 4HGWA 1CT8A 2H8PA 1X5YA 1MWAB 4EEEA 1S78D 4AM0B 1B4JH 4I0PD 3RZCB 4QYOB 3VGHA 4OJFL 3QQNA 4HXAH 4U7SA 1ZK9A 4UIKL 2F54B 1KIUA 4BA8A 3QIBA 3B6SA 3GKWL 4DAGH 4E9LA 3DROA 3ISWA 4Q9CA 2YS4A 5FGRA 5E95B 1UG9A 3KLHD 3RVWD 4NC1C 3D9AL 1B4RA 1KB5H 4PJ5A 4XPHL 1NAKL 5ID0A 5BRZD 1LE9A 1UH4A 4ZNCD 3O6FB 5EIQA 1MHCB 4M7LL 1I4FB 1BIIB 1J8HD 1HDMB 1OT1A 4XP4L 1AH1A 5F1KC 1CLYL 4POZC 3WIFA 2DLIA 3MLPA 3QUYD 4D9RE 3X14A 3D39D 1BEYL 4B7LA 4PV8B 1OTUD 4LCWD 3QHFH 1EJOL 5A2KH 4YQXL 2Y25A 4MA3A 1DANT 1I7TB 1HOCA 1ZA6B 3ARPA 1P4LB 3NTCH 3P0YL 5IWLC 3MRMA 3RKDD 3BPLC 2Z93A 3A6OA 3KPPB 3DX6A 2C3VA 3SDCC 4Y5VC 1YQ2A 3VE0A 4H5SA 3MRKB 4NO2A 3SCMB 4R4FL 1WVZA 2VAAA 5CEXA 3O2VL 2OL3A 4YBQC 1PDKA 2B1HH 5C1MB 5IB4B 4YFLI 1F3DH 3KPOA 3KWWA 4G8FB 3RA7H 4Z7QE 4G80A 1BECA 1OM3H 5D7IE 3RNQB 1VKXA 4E41E 3LS5H 1TVHA 3GSWB 4KUZL 3TO4D 4N0FB 2CJUL 4WW2B 1X5LA 4WO4A 3V0AC 4NNXB 2B4CC 4Z77B 2FEEI 5F7EH 3C2SA 4XMPH 5HHQB 3GFUA 4LLYA 4GRWH 1F58L 5EO0B 4J6RL 1FNEB 4X5LA 1F6AB 1KIRB 4NRYA 1I8MB 4UQ3B 1SY6L 3CDGB 3KPQB 3RU8L 4X8JA 4GG6F 1CXIA 3WHXA 1KNOA 3VFNA 3IS0X 2ADIA 2A74A 3CFCH 3D18B 2WUBH 4PG2C 5ADOL 4U1MB 3QHZH 4EUPG 4M8QA 1FRGH 1YJDC 4QRTA 3MUGB 3L7FA 4X7TA 2QEJA 4CMHC 4XBEL 3IS1X 5KANG 4K9EH 4CU7A 3BQUC 1V7NH 4K3JH 4MDIB 1UADC 4ZOAA 1Z6JT 5C0AA 5EG6C 3E6FB 1F90L 4X8XA 1FO0L 2XT1B 3SJVA 2R9HC 2E7HA 1PG7W 1I8IB 1UZ6F 3DX7B 3VD7A 1GL4B 1CDGA 1T66D 3DURB 5IMOB 4HHAB 4RFOH 2WLZA 3VGAB 1G6RB 3MRFA 1MHHA 2BRQA 3IDGA 1U8QA 4JFXB 1QO3A 4LQFL 1XF5B 4U6XB 3ZHDA 5C08D 4Z78A 3EYQC 2RB8A 1BM3H 4JREC 3SPVA 3WXVL 3LKNA 3W2DH 2R2CA 3ZTNH 4ZFZB 3V6ZB 4Z7UB 1AFVH 5HVWA 3WO4B 4YHZL 1H15A 5BMFL 3PUCA 4KY1H 4Y1AB 2WIIB 5IKCB 4FZEH 2KQMA 4L4VA 3NFPA 3FB5B 2JJWA 4Y4KA 4FFVC 5C0AE 3ARZA 4OCSH 4HJGA 3SJVE 1OAZL 2CXGA 3QDJB 4ODHL 5IMMA 4UT7H 5JO5A 1B0WA 2IH3B 5E99H 1SYSB 3LIZL 3DNKA 5KBNC 4FQPA 3ULUD 1QZ1A 3I75B 4X9HA 5ITFA 4Q9RL 4JVPA 3JV4B 3U7AA 1X6LA 4PJEB 2V17L 5F9OH 1FPTL 2R1YB 4HDIA 1T03L 1N3NB 2VLJD 5FUOH 2APTA 2QR0B 4N0UA 1I7UB 2OBGA 1SQ2N 1UXWA 2VYRE 3VXPB 1TETH 4LMQI 1HSAA 1EEYB 3HPJB 3FQTB 3OAYH 2APFA 1CYGA 3X12B 4G7YL 5DWUH 1QBMH 1VB9A 1HIML 3JV0A 4L4VE 2B0SH 1FIGL 4JHWL 3MV8D 4JM2B 1YNKH 1KB9K 4ZO6A 5IVXB 3MJ8B 1S78C 4PJGF 4XVSH 5ENWA 2H6PB 2FGWH 5DHVB 1J10A 1J0JA 4I0PC 4JFPA 3LS4H 4UNUA 1S9XB 1EEZB 3L3JB 4HEPG 5DFVD 3IDJB 2BRRH 2WSKA 3AXLB 3QFJB 1EFQA 1SVCP 1WBZB 3T3PF 1NUFA 3ARBB 3HLAB 3I2CL 2W0LA 4KTEH 5D9SA 2KL6A 1LHZA 3L1OH 3UAJD 1YUHA 4NUGH 4HKJA 3L95B 4TSCH 1P7KA 3X3FH 3KLHC 2F9BT 5TJWK 1MVUB 4R0LB 2OJEB 1JZ4A 1N0LA 4RGOL 2BVOA 3FL7A 4U2ZA 2JIXB 3FT4B 2YEZB 4MWFA 1NBQA 3B9KA 5IEKB 3VXRA 2CDEA 3HZKA 3OV6A 2XWJA 3QUYC 2MHAB 2AJVH 5LGHH 4AENB 5JXAH 5HD8D 1A3RH 5JW4M 1DVFB 1P53A 4GAYB 4WEMB 5B39A 2IH1B 3WDHA 1OTUC 1GPOL 2YD6A 4JY4B 3MLSH 4BK4A 4MJIA 4Z9KB 1CR9L 1I7ZB 5DQ9A 4BZ2H 4LSSH 5DGRA 2EDRA 2XZAH 2P5WD 3QDGA 3SY0B 3O3UN 4X7CC 1NGQL 3BUTA 1TTUA 4K8RD 3HTLX 2OTUB 5H8DA 3ULVC 2Z31B 4XZUB 3FOLA 1N5AB 3HUJF 4MQXD 1YQVL 2DQTH 3L3GB 5C0BE 5HHOB 1NGYA 4HUXA 3OG6B 4GKSB 5I1CL 4IOIA 2XA8H 3DHMA 2NMSA 5IJKC 1P5VA 3G08A 4OBSA 5F8RC 1Q9OA 5I8OH 1W0WA 1T1WA 1RUPL 4AIXA 1ZLWH 1NDGA 1NFDB 3NIFE 2LTQC 3VA6A 3UC0H 4JQIH 5I17B 3HA0A 3PWPB 3IDYC 1N59A 1A7BA 1KCKA 2ZPKH 5IB1B 1T3FB 2GTZB 2XWBB 3GKWH 4XNUH 4APQC 2P5ED 1RZKH 4UINH 3VWJA 5KSAA 1L7TL 3MV9B 1BX2A 1CLOL 1E0OB 4NHUA 3UZVB 1CLZL 1S7TB 1KULA 4LCIL 4JFZL 3CIQA 4YHOL 3RY4A 1FZMA 3GGWA 4PGEB 3DV6B 4M7LH 3GSNH 3P9LB 4W4OA 4TULL 3IDXL 1KPVA 2OR7A 2FLBT 5TE4H 1ZHLB 5L2KA 5TGBB 43CAB 4OI8A 1T1ZB 3OKMA 4LKCB 2J8UF 3S97C 1C1EH 3OX8B 2ARJA 2ZSVA 1ITBB 2EC9T 3SN6N 2Q20A 1U3HA 1W0VA 5EBGA 4YQXH 2DJ4A 3K4AA 4LDLB 4PGZA 3T0VA 4L9LC 3VFWA 5B38A 4L8DB 4MDJB 1UH2A 4OLUH 2EIZA 1XCTA 2FJFB 3DXAB 2YPLD 2EO9A 5ESQB 1ZKAA 1H8NA 3FFCD 1FGNL 1Z0MA 1TCRB 5DEGA 3HI6L 3B5HA 1CDJA 3BEVA 4TVPD 4R4FH 5I6XC 3V5KB 3I3EA 2NXZC 2ICCA 4JPKL 3C6SA 2APWA 3VFUB 1NQBA 1LEIB 2W0PA 4WEBH 3GMMA 2UWEA 4BQ9A 5D7LD 2CH8A 1KN4H 4OD2B 1I3GL 4OLZL 2ID5A 2ZG2A 3OXSB 4WW1B 5BJTB 2GK0A 3ME0A 2HJFA 4NC1E 4P5KB 5TFSL 3HR6A 4IIQA 5SV3A 1BVKA 2YRPA 4Y89A 2C1OB 4WENB 5L2KE 4WI6A 1IE5A 1U8LA 3E8UH 2P8PB 1E4JA 1RFDL 1YEEL 1FL6B 3LAFA 4PJ8D 4M1CD 5D6CB 3FQRA 1G7HA 2GHWB 3RU8H 1YY9D 1AKJA 2W9DH 4DKEL 3DO3A 3UBXB 4ORZC 4RWYH 5GIRB 1CFBA 1R0AL 2VDQH 4KDTA 5ADOH 3ZL4L 2XN9D 5BV7C 3HMWL 3IYLW 5CZVL 1P69B 2PR4L 2IBZY 3GMNB 4F7PB 3PIQB 1XF3B 1KJ2H 5HYSB 4XBEH 4GW5B 2UWEE 3FT2B 3ESVF 4U6VL 5EU3A 3ARUA 2B39A 2O5YL 3SDYH 1K8DB 1KC5L 3SGDI 1P7QB 5DQJB 4NO5B 3P0GB 2HVKB 4W68A 3FQNA 3FMGL 2BSSA 5T1DH 3SBWA 4D9QE 3P9WB 5FB8B 5J1AB 4NT6B 5E2TL 5CSGA 5K9KA 4HIEB 4Z95H 3C6LB 3MLUH 1LNUB 2UYLA 1YYML 2VOTA 4P59L 8CGTA 3UTZA 4NRXB 3BMVA 4IOFD 2FZ3B 3H9HB 4G8IA 1JZ7A 1X5IA 2ZJSL 1C12A 1FG2B 3MA9L 4EDXA 3QIWD 5DFVC 3S96A 4NKQB 4MAUL 3O6KH 4R8WL 3HE6B 5E7BA 3FRPA 3RVXC 2PYED 4P2OA 1KTRL 3T1FB 2G60L 3LSOB 1F4XL 1FZKA 2M1KA 1QYGL 3LKQA 3BP5A 1GGUA 3KVQA 3QDMA 4XP9L 5JLZA 3TO2B 3LQMA 1OQXA 5GSVB 4ZFGH 4IRJC 1Q9KA 3VXSA 2HA1A 2ARJQ 2AEQL 1A2YB 1XFPA 2YA0A 3BVNA 3U9UB 5CSZB 5I1EH 1KOAA 3LIZH 3CVIL 4LLMA 3QI9D 4OCWH 4M6NL 5HD8C 4NKDA 2R23A 3B83A 4JJ5B 4Q9RH 3RFZC 4I0PB 5I19H 5FYJD 1FZJB 3PJSA 2BVPB 1A1NA 1LILA 3OBAA 4K23L 3SE4A 4X80L 1TJGH 5CJXC 3MBEA 1NMAL 2UUDH 1A9EA 3HR5A 4K8RC 4LP4A 5IOPB 4QT5B 3RL2B 2VC2H 2R69L 2X4TA 4PJ5D 2IANE 5GGTL 3WS3A 4MQXC 2HFGH 1FIGH 4JHWH 2WK2A 4BUGA 4DGVL 5BRZB 3Q1SL 3VXSE 1J8HB 3BH9A 3IFOA 2PTVA 3QUYB 1T0MB 4CVZA 1GIGL 3L5WB 4HD9A 3D39B 4ODTH 1W0YT 3SGEH 1N8ZB 4DEPC 1JHLH 1J5OH 1LEKA 3I2CH 1DEEB 4OCLC 3U0WH 1ND0A 3F7PC 4LMQE 1HEZA 3MC0A 4Z7VE 3S3JA 3WXWH 4L3CB 4G6KL 3DJ9A 2E6JA 4LRIA 4Q6YA 3CXDH 1LK2A 1INEL 3OKLB 3PXJA 5EN2B 3S98A 5JW4N 1UENA 4M6OL 1KG0A 2XFXA 5IMLA 3MRRA 3IAGC 5FUCE 1OGAD 5B3NA 3QUKA 3MMEA 4OTXH 5F1OB 5AZ2H 4CMMB 1Z3GH 3K2UL 3BH8A 2ED7A 1G7IB 1INDL 3TO4B 1YA5A 4YNYA 5E8PB 4FTVD 3RWJB 1CR9H 4A6YA 3K0WA 1OQOA 3J7HA 4PRDA 1QR1B 4MXVF 2ZOKB 4MJ5B 2OZ4A 4KAQL 4IOSD 1QVOA 5EZIL 3MLXL 1EGJH 1WITA 2IQAB 1BLNB 4ZAKD 4LHUG 4WU5A 3TZVD 3QUMA 2H26B 1BQHG 3EYOA 1A6ZB 1RJZA 1QHOA 1MFAL 4WWKA 1Q1JL 3TVMD 1A4KA 3B9VA 2YD1A 4H26A 1MCPL 2HLAB 3B3IA 1IGML 4MAYA 5EUOB 1BOGB 1DQDL 4DN4H 3MRPB 4ISVB 1GYAA 3UROR 5C0JB 4TSAH 3ILQD 4JRWA 2AI0L 2PCPA 4WRLA 3ZTJH 4PRNB 3LEVL 1I7RB 1ZTXL 3ALWA 2OYPA 4PJ8C 4M1CC 1CLOH 2RFXA 1NMCB 4LOUD 5AWNL 1EMTL 4PR5B 4PY7B 3RGVC 5KAQF 3X13B 2EEBA 5SX4I 5D4QA 4JFZH 1YY9C 2CPCA 3U30C 2XTJE 1DJSA 4X6CB 3WFDL 4U3XA 2VISA 4TULH 3IDXH 5T3ZL 5I8EB 1IQWL 1DQTA 3C5ZC 4YUEH 1E6JL 1UWEL 3SGKC 4ZUUB 3ULVE 4NQVB 4F58H 1CFNB 4NSKB 4MNHB 1MJJB 2A2QT 2CIIB 4CL7A 1M71A 3JWNC 3DHJA 5DD1L 5CBEB 3IU4H 4G6JH 4P5MB 1ZGLM 4L4VD 4Z7WB 3QP3A 1DFBH 4Y4KD 2O5XH 5IEHB 1T21A 5BOPA 3CFBA 3GM0A 1D5BB 4YJZL 2BVQA 4XMKL 1ONQA 2DTML 2AXGB 1CL7I 2ARWA 2FHFA 4H25B 5TDPB 2WP3T 1JPGA 3RX7A 5BV7B 4IOFC 5TFSH 3W9DA 3S35X 4KTDH 3QIWC 1FQ9C 2WMPA 3KS0H 3F7VB 4ELMF 1RFDH 2DQFA 1YEEH 2R0WL 3WDIA 1I8LA 5JW5A 3VXOA 3N85H 2A1WL 4YIQA 4KKBC 4LVNB 4XNMA 4YO0B 2KZ1B 4P23A 1ZSDA 1JGDB 2D7QA 3DVGB 3PWJB 5M95B 2GJ6D 4YDJA 4JPIB 1ZT1B 1KYOJ 5AAWA 3MGOB 3CPLB 4MQTB 2Z92A 4F2MB 1KFAL 2X4RA 1ZGLP 3BPOC 3S88L 5EZLB 5TDOB 1P1ZB 4JY6A 2JJSC 4D9LH 3QI9C 1QSEE 3QWQB 5F6IB 3O2WL 3D0LA 4LVOC 1CFQB 2HTLD 4TUKH 1WBYA 3DUSB 1KC5H 4M3KB 5JUEH 4QRPE