3HB3D

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hb3D00
5J1SC 4KJPD 2HRPL 5DJDA 4X0KA 1HHGA 3EOAB 4PRBA 5GSVA 4CJ0A 5DD1L 1Y0LA 5ELIA 1VGKA 3O9WD 5ITBL 5E00B 1JNLL 4U2YA 1HHJB 2VDQH 5DFVC 1K85A 5BZDB 5CGYD 1I3VA 5LBSH 1JZ6A 1MCQA 5C7XL 2I9LA 4CVWA 4MDIB 3QEUA 3JWOL 3I75A 2Z8VC 2GUOA 2F5BL 2GAZA 4X4XA 2CH8A 1AGEA 1U8PA 3OXSB 1ZT1A 5ADPL 4WUUD 3EJYC 1NLDL 5EC1A 3MLXL 1VFUA 1VFOA 2YWYA 1CXIA 3DUUA 4GS7C 4TVPE 3CVIH 5LCVH 3RDTA 3SO3C 5T3XE 4XVTL 2ADGA 2NZ9D 3FFDA 4O4YH 4JO4L 3TO4A 5ITFA 5GGVY 3X3GL 3WFZA 3CDFA 1UWGL 1OQOA 5E56A 3TYGH 3IAQA 1MJUH 3UTTD 3VD3A 2YBRA 1WV7T 3U4BL 1JF6A 1IEAA 1G7QB 3IB4A 1BECA 2X7LB 1YNTA 5F3HB 2IH1A 1KPVB 2FWOB 4TUJA 2IAMC 1KLUA 3SCMD 1QEWB 3IS0X 2G75B 3BWUC 2XY2A 2P5ED 2BRRL 4KHTH 3T3PF 3PWLA 4QTIL 1IMHC 2EXWC 2MQ3A 4X80H 2WM0A 5L2JB 3QEQB 2DLFH 2VDRH 1P4IL 1W0YT 4L4TA 1YC8A 4UQ2A 4DGVL 4Z0XA 3G5XB 5IESL 4JDVB 2ZUTA 1NL0H 1TTFA 2PO6A 3LEVL 3QDJA 5JA9A 1HQRB 1QFUH 2EXYD 3JUYA 3MUGB 1CLOH 4ETQA 1LDPL 4NN7C 4DGIL 1KB5L 5E7FA 1ORQB 2W59A 3ISWA 1PSKL 3C60D 5GS3A 5EU6B 5FOJA 2DLGA 2GYSA 4N8VA 3L5IA 1MAJA 1KGCE 4LLYB 3TT3L 3FRPA 4J3XA 3ZKNC 4LPYA 5FKAB 3BRFA 3R0MA 5IVXB 1BIHA 1EZVY 3DIFB 4MMXC 1OM3H 2JLLA 4NHCH 4NCC1 1UZ6F 3GI8H 5IT2H 1OAZL 3VI4E 1URLA 1S7SA 1Q94B 4RRPG 2MHAB 2Z92B 4N8PA 1YPZB 4GAGH 3MLVH 4HUXB 2DM7A 3FQUA 4NN5B 5D8JH 3NIGF 2APXA 5C0RH 1HEZA 2DKUA 2V6HA 2VLLB 4JQVA 3ARUA 3VG0H 1C5DB 3B9KB 4HHAA 2BRQA 1HXMA 2X9XA 5DJCA 1MVUB 1ZHBB 2OP4H 3LMJH 1IAII 5JTWA 4R7NA 4AZ8A 1FSKB 3IKCA 3MLUL 2Y7QB 3V4VL 2Q76A 2VABA 1J1XL 1IC5L 2XIDA 3B8YA 1UJ3C 4FZ8H 3H7LA 3VDCA 1IAOA 4P2CG 3GMOB 3FAXA 2OZ4H 3QI9C 2DMKA 4WJ5B 4Y5XC 3IF1B 3PHOB 1ZTXH 4HS3A 4OLZL 1SJXA 1QSFA 4M43L 4AH2A 1FL6B 1R24B 4ONHA 5DD0L 3ILPB 2WLYA 3WIHA 1YNLH 5F1NB 5I16B 4ZUWA 2Y23A 3IJYB 4WTWA 4NKDB 3RWHA 5LVEA 4KQ3L 3TM6A 2AEQL 1WK0A 5J56B 4GFTB 5DEFA 4ZQKB 4F7MB 2MCPL 1PLGH 1P7KB 3NAAL 3P9MB 3O2DL 3QIBD 4LEXL 3HS0B 4MQTB 3SJVE 4NM8H 4F15B 1U8MA 3QQNA 1VFMA 5A2JH 5F9OL 4N0FA 3UJTH 2BVYA 2NTSP 2O5YL 3T3PE 2NNAA 3H2WA 4TPRH 2D31B 3OF6D 5H35B 1RUAH 2OS7A 4XCEB 4G8IB 4QRPA 1HHHA 4Y19B 3NA9H 4BUHA 1RPQA 3MRKB 3ZT6A 5IIEA 4TUKH 2VC2H 2AERT 3GSNB 4OAWA 1FFPB 4OCXL 2J88L 4K55A 3O3AB 4WI7A 4FHBD 4DW2L 3U36B 2VLJB 1QSEA 4TTDC 1CGYA 3D18B 4LBEB 2YA0A 1BGXH 1WIOA 2ZPKH 3RDTC 1QUNA 3ZMRA 1ZHLA 1IL1A 1D5XB 3TO4C 1D6EA 2DQHH 2XZQL 5B3JF 4RMTA 1GYAA 4LSVH 1NC4B 4C83B 2DD8H 1NUGA 1WFOA 1K6QH 1QFWM 3L7EA 1ZLVK 3W0WB 4BFBD 2FR4A 1OP3H 1RJZB 1IBGH 4MWFB 3VRJA 3G6JA 5CBEB 4CL7A 1GVIA 3P4MA 4JHAH 4ERSH 3U0TB 1NCBH 4HH9A 3EW3B 1S9KC 1C1EL 5DMKB 2BCKA 2OTWA 2XTJD 3WLBB 4JY5H 2QSCH 2FJHB 3OKOA 1L7TL 3NIGE 4XBPB 3MFGB 4FABL 3UPAA 5IBUG 3MFFB 5GGRB 43C9B 2JB6B 1MIEH 4XNMB 1DN0B 1I8KA 1M1SA 1N64L 1RURH 5IB4B 5L6YL 5ACZA 1M7XA 1Y18B 4LVHC 3KPSD 5J1AA 1NUNB 5T3ZL 1MCKA 1N4XH 5DGRA 1AQDA 4WEUD 1JPST 4HS8H 2EDHA 4NQXB 3EYQD 4P4KB 4PGCB 1PBYA 1N5AA 3QBTB 2PO6C 5F7YC 5I2IB 4JFZL 1BJ1J 2DTSA 4XH2B 5FGCE 4J8RA 1S8DA 2IBZY 1L7IL 3PDDA 4RAVB 5C0CD 1MCDA 1OSPH 3VI3F 1G9NH 1O7SA 4QRRD 4ELKB 1DSFL 4KTEH 4KY1L 3X14A 2WMPA 2YUWA 2ED8A 3DJ9A 4W6XB 1A1OB 3PF2A 2R1YB 5GGSA 1MFDL 5D9SA 4XHJC 1QR1A 4FQ2L 4BSWA 5E2UL 4LFHD 3P9WB 4P3WA 3EAKA 1FG2A 1W72A 1KNOA 2OTPA 1KEML 3VXRA 4PR5A 1OVZA 4BZ1H 1F45A 4IIQA 4WU7A 5FGCB 4JQVC 1HSAA 3HNTL 1U6AL 2DMBA 1C5CL 1HSBA 3TWCL 1YMMD 1N0LA 1GIGL 3C5JA 1D6VL 1MRDH 2DKSA 3PXJA 4EN3A 3IFOB 1FZMA 3OX8A 1FNGA 1JGDA 2MQCA 2Z35A 4HJJL 5GGUB 4KU1A 1A4JA 2DM4A 5EU4A 4ONOA 4AEHH 1O0VA 4N0YL 3FTGA 4DGYH 4GSDL 4ODVL 2HH0L 4XX1G 5I74B 1A6VH 2EICA 5JIPA 4UUJA 1LP9F 3PWPA 1BJ8A 3B3IB 3H3PH 3Q1SH 3ULVD 1BZ9A 2XQBH 4R90H 1I1AD 5HGAA 1U8OA 4KRPD 3MA7B 3V8CA 2I07A 3QULA 2HMIC 4RISL 5HJ3A 3GMPA 3UBXB 4WFFD 4ZTPL 1CDJA 2NY5C 3WXVH 2IALA 4DUWA 1PJ9A 3VGEA 1XIWD 2XNAB 1XGQA 1CFQB 1UH3A 2R2CA 1A8JH 3TBYB 5MHSE 4MS8C 1RMFL 1YY8B 4E41A 3VFMA 1AR2A 1T03H 4NKOB 4NC2B 1VGEH 4TSAL 4XPHH 1P7QD 1UM4L 5BV7B 4CNIB 4BA8A 4GW5B 1C8PA 1TCRA 2L7JA 4F7CB 4OLYH 5AUMA 5E8NB 5DXWA 3RY6A 3LH2L 3O4LA 2A6IA 1CS6A 3IDXH 1XZ0A 3MCG1 1F4YH 2EH7L 2W07A 1HI6A 3KPMB 5FECB 3QAZC 3NTCH 4Z7UF 4NKMA 3M45A 5ID0A 1EHXA 4RWHA 1P2CB 4JPKH 5CCKH 3P30H 4R4NC 3EYFB 4LASL 4FNLL 5EU7E 1MWAB 1S5IH 1FNHA 1MCPL 2Z91B 4PJXE 1MF2L 3KPRD 5J6HB 3GEWB 1XF4B 2CLZA 2GT9B 3GJEB 2CDEA 1G9MH 1KIQA 2R2HA 2WIMA 5HYSB 3LIZH 3KPLA 3QDGD 3BP5B 4MJ4A 2VDML 4ODHH 2BSRB 3C5SB 3DETD 2BY3A 3NCJH 3BPNC 3LV3A 4LCWE 4K23H 3WFCH 1KTDB 2IPUK 4NWTL 3GNMH 4LEOB 4U1HB 1J18A 2FGWL 4HIHB 3UDWA 2W0KA 2EDNA 2Y6SC 4JO3H 3NFNB 1V3JA 2HJLB 3GSVA 1UM6L 4NO2B 3UZQA 5IFHL 2X1WL 2VITB 3U7AA 1FGNH 5D2LB 1E4WL 2DS4A 3TO2B 5F6IB 2V2WB 1ZSDB 4PRID 3KGRA 4PJXB 5E8DL 1T5XB 5ANMA 4HKXA 2NY5L 4YHML 3IJHB 2MNUA 3CXHJ 4I5BB 1T4KB 3FQWA 1D9KD 3AMLA 1N6UA 3FN3A 5B38A 5HHME 1M71B 1T2QL 4P2YA 3EOBA 5C07B 2OX5A 2NQCA 4LLVB 4MJ5A 2EKJA 4XC1L 2F54A 2ICEB 3LS5H 4WGWB 5ILTL 5IMKA 3OAUH 1UXSA 1IQDB 4ZMAT 4ZUTB 2YD5A 5F7EH 1MJJB 4Y4HA 1U58A 1T1XA 3S96B 1EJOH 1K8IB 4QTHB 4P2RE 2E9IA 3E6FB 2OJZH 2R0KL 1LP9E 1JNHA 1NC2D 4O58H 2EIBA 3CFKB 5FUZL 4NO0B 5MENE 2D03L 3E8UL 2YWZA 1GZQB 5L2KB 2BC4B 1TENA 3MLRL 4LKCA 4ZDHB 5CGMA 4A6YH 1Q9OB 3I9GL 4OCNC 3T0EA 1MCWW 1I9IH 5D1QD 2Y5TA 5TQ0H 2R23B 2AJZB 1UQSB 5HHMB 4PJ7A 4IOSD 3WHE0 2G60L 3RWDA 2VXQL 3BOVA 3P0GB 1SY6A 4PJBF 3WD5H 2P7TA 4IIQC 5A1AA 3SE3C 1IGMH 1QP1A 3QCTH 3ARTA 4MLSA 3K3QA 1X5XA 2DM3A 4PJCA 5E9DB 3T8XA 5BVPL 4KKLC 3TESA 4NQCA 3PIQB 3NCYP 4EN3C 2IH3B 4P2RB 5CZVL 1OTUD 4RGMC 1LP9B 3TN0A 2OBGA 3L95A 4NQVA 2E7CA 5HPOA 1S7TB 2GJ6A 5MENB 2FL5A 4NNYA 3SKMA 3SE8H 2FX7L 1R5WA 1NGPL 1Q9LA 3D39B 4OGAD 1WZMA 3MR9B 1N6VA 4K2UL 5HHPB 1DN2A 5EB9A 5GS1B 2AVGA 4CVZB 1KELH 5ESAA 1K8DB 1QFPA 4M7ZB 1T22B 3EDJA 1WAAE 2PYEE 3MGAA 4HJ0C 2X4QA 3V95A 2VIRA 1ZE3C 3EHBC 4XP9H 3DGCR 5D70H 3QPXL 4G6AC 1ITCA 3CFJB 4P48A 3GDBA 2HFGH 5GJSH 5DRXA 4FFZL 3KS0H 3MCLL 1XGPB 3TPUA 3MRMB 2DYPD 1IM9A 4K8RD 3F7VA 4CKVX 4JG1H 1JYVA 5IQ9A 1U3HA 2VRAA 5FYKL 3RY6C 4GXVL 5IFJA 1ADQA 4OKVA 1KB5B 2VZUA 3P11H 4PRPD 4XNXH 3REWB 1I7TB 1L0XA 1YQVH 2W0PA 3TC9A 1W72L 1ZV5A 3MV9B 2VSDA 5DEGA 3WXWL 4QWWD 1CL7H 2NZIA 4Z8FH 5JIIA 3I2CL 4U0RC 4RSVA 4K3JH 1FL5B 3MOAH 5ECJE 1A3LL 2KL6A 3BYYA 3Q3GA 1A6ZB 2QHRL 3Q2CA 4DCQA 4M03A 4D9RD 1D7FA 1LO3H 4OF5A 1Q0YL 4PJ8A 3ALXA 5F7FA 2W38A 1OSZB 1FFOB 5EU3A 3TFKC 3U9PH 1UWXH 2HA1A 4KTDL 2ATKA 4UT6L 4NC1E 4GS7B 3SO3B 2HTKD 3PDOB 4HFUL 5FYJH 4AMKH 4PBVC 5D93C 1YEDA 4DVRL 3UDWC 2J6EA 4C56D 5C86A 5D7JA 1JZ4A 4JKPH 1QKZH 2ZSVB 4P46A 4WWKD 1WZKA 4ZUVB 1JGEA 4LLDB 1JPSH 2DQFB 4PJBE 2DL9A 4LVOC 1FAIH 2AXJA 3OB8A 4QRTA 2IAMB 3D6GA 1AP2B 1UKTA 1A7QL 3WFDH 3GRWH 3IFNH 4TVPH 3GHBL 1A7PH 3VXUA 5F70A 5KSVB 5T3XH 4S1DC 1EXUB 3JWNC 4NZTL 5B39G 1BP3B 3OR7A 4MJIB 2QR0A 3O2WL 2D7TL 1KCUL 5JW4Q 4YDJA 4F7TB 1I7UB 3DBXB 1AKJA 1BQUA 5BQ7B 2FLBT 3LSOB 4NN7B 3TV3L 5C6WH 4U4BA 2KQMA 2DQUH 1AGCA 1MJ8H 1NAKH 2A9NH 2YMXH 5CJQH 4LAQH 4UI2A 4X99A 2Z31D 3BEWA 1HDMA 1B6UA 3QO1A 3VFTB 4YGAB 4P9HH 5I71C 3ES6B 4PJBB 2NCMA 3VWJA 2PW2B 2QTEA 3MA9L 3QZWB 1XF5A 3W11D 1RZFL 4U6HB 1R5IA 4V1DA 3IETB 5C08D 3CMOH 5INDA 4CADB 5JUEL 1DBKH 1YDPA 5IB2A 4KROD 4IMLA 4Z95L 1CICC 3T0EC 3ZDYE 4M5YH 5F96L 3MZTA 4R0LA 3UTSA 1JGUL 4GQ9H 1RZ8A 2FJFA 3K8KA 5DQ9B 1NGWA 1CDHA 1D5MB 3QEGL 3D0VB 1FCCA 3U7WL 2W0FA 3DVGA 3HI6L 4YUEH 1KCRL 4Z77B 3A0OA 4TRPL 3EDKA 1OPGH 3BX7C 5DR5H 1RK1A 1VPOH 3MUY1 4C57C 3TN0C 4PJHA 4UQ3A 1MH5A 1YYMH 2YN3A 4U31A 5T3ZE 1EUUA 4RZCB 3S36H 4QXWA 5KS9B 1UJ3B 4YHNB 1AR1D 3QDHA 4WUKH 3BUYA 3CH1A 3SDCA 3FONA 3QI9B 1MEXH 2OCFD 2E8ZA 4RDQF 3CIQA 3RL1A 3SQOL 4Y5XB 3DO7B 2V2XA 5DK0A 1RD6A 1MCSA 4JFFB 5FYKU 2VE6A 3ZHDA 2G5BA 3RVUD 3FL7A 4KDVA 4U1NB 4Q74A 5C9JB 1QLEL 2VO5A 5GRJL 2R29L 1SJHB 4RNRB 5DMYA 3D3VD 3BHBA 1CT8B 4UTBL 1LO2H 3VE0B 1QFOA 4X6DA 5KSBB 1B0RA 4FRWA 4MMZC 2F5AH 2R0WH 3QFDB 1CD9B 1U3HC 1F6AB 2ZWLT 3SDDA 1RIVL 4XPBH 3EYVB 1LE9A 2H1PL 4PJAF 3FO9B 4XMKH 1NBYB 2C7UB 1ZMYA 4ODTH 1SYSA 3I6GB 1V3LA 4HUMB 3C6LA 2R69H 1FLRH 5C0BA 1GZPB 4UNVA 3MYJB 1CD8A 3KS0J 4XCNB 4PPTA 2APBA 1KXTB 4QT5A 1DEDA 1LQSR 2DWEA 5DJDB 1FN4A 4X0KB 1HHGB 1BIIA 4PRBB 1S7RA 1SY6L 5GSVB 4WO4A 1Y0LB 4L9LA 1AGDA 4KK5D 3RX5A 6FABL 1BOGB 43CAA 4GAFB 2HTLC 3KPOA 3O6FA 3GIVA 3MBED 4HWZA 3QEUB 3I75B 4PJ8C 5FO7A 2GUOB 5CHNA 1KN4H 2GAZB 4UINH 4X4XB 3HI5H 1U8PB 1ZT1B 1ZWIA 5EC1B 1V7NH 1F4XH 2CLVA 4NT6A 3DUUB 4L4TE 3RDTB 2BJMH 2I26N 2AGJL 3FFDB 3LAFA 4KK9C 5ITFB 3TO4B 3BVNA 4G8GA 2CIKA 4HIEB 3TCLA 3VDAA 2UY7A 4NJ9H 2Y25A 3HNSH 5D7JC 1V3KA 1S9XA 3TNNA 3VW3L 4P46C 1YEKL 2AK4D 2YBRB 2YRZA 3AXLA 5A3IC 3TBWA 4OZFG 4KUZH 4F9PC 4NZUL 1FZOA 1KXQE 4OF0A 2YD8A 2EDKA 2EYRA 1YNTB 1DANU 5IKCA 2IH1B 4Q58C 4TUJB 4O9HL 3SGEI 3BGFC 3T2NL 1Q9KA 1N6QH 3LQMA 3PWLB 3B6SA 1U0QA 4N1EA 2V5RA 4LVHB 5BJTA 5MEOA 4L4TB 4UQ2B 3VXQA 4Z0XB 2PO6B 1NLBL 5IJVA 3QDJB 4WU5B 2J4WH 3MJ7A 4V2CB 4I0PD 1RZJC 5DUPL 4N8VB 2NYYD 3TJEL 1J0JA 1NMCC 4NUGH 4ZUSA 4NM4H 2CKBL 3VWJC 2ENSA 3ZTNL 2YUVA 2CDFA 4N8CL 1NMAH 4M7JL 5EWIH 5K9KA 4PRHA 2BVTA 4AENA 4NHUA 4PYGA 1CIUA 4N90D 3QRGL 4E5XA 1S7SB 4R0LC 3WKNA 1I9RL 3VXSD 2CGRH 1TIUA 1UCBL 3FQUB 3QPQD 4QHKI 2HT2D 3NH7L 2OL3A 4LSPH 1HEZB 1QSFE 1EMTH 4EI5A 4HHAB 1M05A 1HXMB 8FABA 3OKKA 5DJCB 1KYOK 4PJAE 2X41A 3BWAA 3GJFH 4NUJA 4R7NB 5D1XD 3IKCB 1JWUA 1OL0A 4HKZA 2Q76B 5KTEL 5HGBA 2J6EL 2AJXH 2VABB 4UB0L 4MNQA 4ONGH 1OT1A 4OCRH 5D96C 2C1PA 3QCUH 4F58H 5LWYL 1PGRB 4KK8D 1IAOB 4AK1A 2V5MA 4LOUD 4M7KL 4I3GA 4M6AA 3V9FA 7FABH 2PTVA 3NCBB 4HS3B 3ZSTA 3QUMH 5HYJD 3CK0L 1QSFB 3N1QC 3BSZL 3QHFH 4JG0L 2F74A 4QNPF 5EZLA 4AT6A 4X6CF 4ONHB 4WI5A 4QRPE 4J7RA 1JTPA 2NY3C 2K7QA 4ZUWB 2OSLA 2Y07H 4JB9L 4FXGA 4XNUL 1S9WA 5FUCC 3FQTA 5MP6L 1INEH 1CN4A 1RZJL 3AU1A 5GSRA 5C3LD 1BM3L 5JHDE 4WI4A 4NPYA 3SDDC 2D7NA 1T7VA 1S78C 3LN5A 5DEFB 2FATL 1AHWA 4YDIH 1DR9A 3MLWL 4KJYA 3C6LC 1FRGL 2K1MA 3SDXA 1U8MB 4H8WH 1AH1A 4HFWA 3CFDA 3AAZA 4M48H 1H15A 2RIKA 1RZGA 3BIKA 5D72L 3FOLA 4OI9A 2NNAB 4AEEA 5A2KH 3QAZB 4WO4C 4L9LC 4QRPB 1EHAA 1HHHB 4XVUD 3RWEA 4R4BA 2AJSH 3T0WA 3O6FC 4ONFH 5IIEB 3O45A 2EDJA 2P49B 4JM2A 5DD5H 4Y4KA 5I1LA 4NNPH 1PX4A 1OARL 1QSEB 5C0ND 2ADIA 5E2VH 2H2SD 2XG5A 4FQXA 2EDYA 4JFHE 1KN2L 4JQIH 4OIIH 1ZHLB 3VFPA 1IL1B 1S9VB 3BPNB 1D6EB 3VXMA 4XXCA 5CIPH 1OGAA 2ORBH 5F7DB 3L7EB 4JZOB 1X5KA 5E4EC 2FR4B 4UIKL 1KLGA 1IGCH 1L9NA 3G6JB 4YHOH 3G5ZA 3P4MB 2J2ZA 4YX2H 4HH9B 2BCKB 2WV3A 3QEQD 4WI6A 2VLRE 2Q87A 3OKOB 5FYKE 3RZWA 1TZGH 4XPFH 1DQDL 2X4SA 4JDTL 4QRQA 3NFPA 4R4FH 4K94H 1I8KB 3WNOA 3JVGA 5ACZB 3SKUD 3SE9L 5J1AB 1OAUH 1CG9A 5EU6D 2HKHL 1OD7A 3DLQR 1AQDB 2WQ8A 3VXRE 2IADA 2Q1EA 4OZFH 1GC1C 5IROA 5I1JL 1N5AB 5KW9H 5FA4B 1PW3A 4HULB 5FXCH 5AZEH 4J8RB 1S8DB 5FK9A 2FEEL 2FSEA 3C08L 4LAJH 1A64A 3S34H 2F19L 1ND0A 1RHFA 1U8LA 4MXVF 4LMQI 3RL2A 5LGJA 4YFLI 3LKOA 3O6LL 4HAFA 3X14B 3RU8L 1A0QL 4MX7A 4Z7NF 1AXTH 1J88A 3DYOA 4XGZB 5AYUL 5EIQA 1T0PB 5GGSB 4Z7OE 4JO1H 5D9SB 4QNPE 4X8XA 3MJ9H 1NCCH 1QR1B 4BSWB 4KRLB 2UV3A 3B9KD 3BEVA 1RJYA 1UM5H 4X6CE 3THML 1FG2B 1W72B 1KNOB 1JNJA 1FVCA 4S2SA 1IGIL 3P73A 4I4WA 1I3GL 4CMHC 1Z0NA 3VXRB 4PR5B 2R8SH 1CZ8H 4RGOL 4FQ1L 4IIQB 4WU7B 4ZS7L 4HUNB 3EDEA 4EI5C 1HSAB 3UTOA 3FN9A 4HUUA 4HUVA 1FQ9C 2EIDA 1HSBB 2GIYA 2FZ3A 1HINL 3C5JB 2EC9T 3CFIC 3TA3A 4OD3H 1WEJL 4EN3B 4OCSL 3PV7A 2D0HA 1FZMB 3NABH 3OX8B 2HN7A 1JGDB 4RGMB 4X7DC 1G7HA 1T0MB 2Z35B 1J8HA 4H20L 4NZJA 5EU4B 5TPWL 1B88A 2F15A 5T1DL 1F5WA 1B2WL 3FTGB 4OF3A 1X5AA 1WTLA 4TNWK 2Q8AL 4UUJB 2QQQA 5I8KL 3PWPB 2GW5A 3SGKA 2FX8H 1HYSD 1BZ9B 2J12B 2JK5B 5HGAB 1U8OB 2IFFL 2W9DH 4YDVA 3WDHA 2I07B 2AXFA 3QULB 4AL8H 3MRHA 1CE6B 2HLAA 5HJ3B 2QQKH 4FOMA 3GMPB 1GC1L 5DC4B 5E5UB 1AC0A 3GSOA 2IALB 2DBJA 5GRVL 4WHDA 1H3GA 1XGQB 1HCVA 1XH3A 3EDDA 4LHUA 4K7PH 1K3IA 2D7OA 4EBQH 4E41B 3VFMB 1WWBX 1A6UL 1F6FB 4NNXA 5CD3A 3IXAA 2BVQA 3OG6B 5CJ8A 1AHWC 1OTTC 4D0CA 1TCRB 4P23A 3P4NA 4H1LA 1MREH 5AUMB 1MHEB 3O4LB 4ZOCA 1ZLWH 2FB4H 1XZ0B 4Y19D 3TJHC 3OGCB 4OCYH 4N0CC 2XKUA 4EUPG 1H3UA 1HI6B 3IDNA 5K9QG 2HKFH 2VLJD 5EBGA 1G7LA 4H5SA 5IGXH 1RUKH 4ODXA 4NKMB 2OL3L 5ID0B 4U0RB 3WO4C 3AS1A 4LCCA 3QDMA 3DVFA 1S7XA 5EN2A 1RK0A 4HGWA 4HJGA 4JM2C 1K2DB 2VZ3A 1FLTX 3IDMA 3KLHD 2ZUWA 1ACYH 2CLZB 1NC4D 3CLEL 1H3WM 3UROR 2CDEB 3W0WD 4CDGC 1KIQB 2R2HB 4PGEA 1YEIL 1MPAH 2UVEA 1NCAL 3KPLB 1ETZA 4FQXC 4K8RH 2FBJL 4KI5C 4OZHA 3HR5A 4Z7NE 1ZT7A 1YEJL 5F89A 3LV3B 3PQYA 4X7FC 4XXCC 1HOCA 3CFBA 4ZO6A 2XXCB 2CR6A 5ERWA 3ARWA 4NZDA 4ZFFA 5D93B 5I76A 1EFXA 3HAEG 2W60A 3U1SL 1QBLL 3E0GA 1I4FA 3GSVB 5IVZA 3IRZA 1TJIH 5DJ8A 5HHVH 3PHQA 4XPGH 5DSCA 2M26A 4LVOB 1EEZA 4P4KD 5IB5A 2E5EA 4YLQT 2B2XH 4HG4J 3QQ9D 3IFPA 5I1KH 5ANMB 4HKXB 2B1HL 3JVGC 3FQWB 4JFDE 5JOEA 4FXLA 1R3KA 4LARL 4J1UA 3BH8A 5B38B 2DQCH 3PL6D 4DAGL 3EOBB 5IROC 1X9QA 4K3DH 2F54B 1CDUA 1JWMB 2ZNWA 2XA3A 1QPXA 4DVBA 5IMKB 5BO1L 3KR3L 4PJIA 3NOIA 3PNWA 3R1GH 1U58B 4K9EH 1T1XB 4NQCE 5EZIL 4BSVA 1KIRA 3V6OA 2F8VA 1CD1A 2VXTL 1F58H 5FGSA 1JNHB 1B3JA 5I71B 1FORL 1AY1H 2CUHA 2VDLL 1T7XA 4PBWD 2MCG1 5HI3D 2V7NA 2N4IA 4KZDL 4LKCB 3R4DA 1RUPH 2DQGL 2AW2A 3D25A 1CICB 3T0EB 1V7ML 1JNNL 2Y5TB 4RDQG 5DGQA 3OKEA 2K9UA 5E2TH 1KOAA 1Z3GH 4PJ7B 1BVLA 2VDPL 3OXRA 3RWDB 3N1GC 4OB5H 2P7TB 3L5XH 4JLRA 3HC4H 4PJGA 4XWOC 3TEUA 35C8H 5KZCB 1IKFL 4LKXA 3TP4A 5GS0H 2Z8WC 1QZ1A 4PJCB 3T8XB 3C6SA 2DI7A 4WV1A 4UTAH 3O6MH 4DN3L 4NQCB 3TA3C 1BF2A 1OAKL 4XAWL 1MQKL 4PRDB 3TN0B 3L95B 1A02N 4GBXA 2FL5B 4NNYB 3SKMB 3VA6A 5EOTB 3MYZA 2XA8H 1IRAY 1R5WB 4MHHI 5SWQA 3TZVA 1AD0A 3QHTC 1Q9LB 5K9OA 5B3NA 4XC3H 4M3JA 3B83A 5DHXB 2NLJA 1BHGA 4HAGA 2BFVL 5ESAB 1IEHA 3I50L 1ZAGA 3SGKC 5GGVL 1CF8H 4OT1H 1UWEL 1ZVSA 2DMCA 4R8WL 3TLRA 4Y7MA 2X4QB 5DJAA 2VIRB 3R8BB 4CAGA 1CLZH 4Z5RA 1UACH 3P4OB 2B0SL 2DQEL 5BRZA 3LB6D 1T04A 5KVEL 1WVZA 5DRXB 5BS0A 4K7PY 2DTML 3HMWH 2OZ4A 1T3FA 2CR3A 3NACH 4DTGH 4XPTL 1IE5A 1IAIH 2JB5L 5JO5A 1F11B 5CEZD 1X3DA 3TPUB 1CGSL 3DVIA 3GBML 1IM9B 3UJJH 3F7VB 3L3GB 4YHZL 1FIEA 1WISA 1ZEAH 2EKSA 1U3HB 5IQ9B 1N5YH 4P23C 4U6VH 5C09A 2KUTA 4O5LL 5IFJB 3ZKMC 4OKVB 5IHUL 3OL2A 4MB4A 4G42A 5EDXA 1A5FL 4LCUA 1BQHG 4FQCH 5CJBA 2AJYL 2CKBB 4XP6H 4JHZA 3OG4B 2NW3A 2I5YH 3SPVB 1EGJH 4LCCC 2FO4A 3NIFE 4HIXL 4M6ML 3ARFA 1MCIA 4XI5D 3Q3GB 4DKFL 1DQLL 1RSFA 1V5JA 3KYAA 3BGMA 1BX2B 4DCQB 1SEBB 1J1OL 2ZUQC 4QHMA 4PJ8B 3ILQC 2EIZA 1KJMA 1RU9H 4EUPH 4LSUL 5EU3B 1S5HA 1KJVA 2ATKB 4NQDE 3VXUE 3QNXA 5DEZA 4I18A 2VXUL 5DT1L 1U9KA 5IF0A 4ODWB 1OTSD 1FHGA 1HN1A 3MV01 4X5WA 5CSGA 3VFSA 4MJ6A 5FCSH 4LSQH 5I1GH 4JM4L 3TPKA 4HGKC 5D7JB 4P46B 4P9ML 1LO4L 2D4FA 3HC0A 1WWAX 1JGEB 1KENL 2O5XH 4F57L 4HWUA 5SWZD 5C07D 4KDWA 1NCWH 4YE4L 2GJJA 4Q2ZA 4QRTB 4V1DE 3OKNA 2NY1D 2J8UF 3FT2A 3FQNA 3BGFB 1QFWL 4FN0A 3VRLF 4GG6F 3MRQA 4FQLH 3GMMA 4G43A 4NQDB 3GMLA 3UTSE 4TYUA 3VXUB 2M1KA 5TGBB 5F88A 1PZUB 4C54A 3OR7B 3ZE1F 1E4XL 2QR0B 4Y1AD 4NO0D 4X7SL 1QQDA 4ORGA 5L2KD 4YDJB 5GJTH 1AKJB 5FO8A 3AREA 3RVXC 1MAKA 1AGCB 2D0GA 5EOQL 4A2LA 3V6OC 2VQUA 5K93A 4X99B 1QSZA 3BEWB 5DO2C 1HDMB 3QO1B 4PJHE 1DFBH 5HHMD 1NMCB 3FMGH 4HMEA 4LSRH 3VWJB 4CU6A 1XF5B 4G7YH 1VHPA 4JRXE 4MD0A 4RGNE 1R5IB 2VJXA 4V1DB 3RWIA 1MY5A 3JXAA 1KSRA 1ZLUH 5INDB 1GOHA 4XTRD 1YDPB 5IB2B 4L1HA 4IMLB 5E9DD 3QXDA 4G3YL 4ENED 4R0LB 3H3BC 4TNVF 5ACLA 3UTSB 4YXKH 2HLFC 2DAVA 1RZ8B 1CFSA 2FJFB 3M8OH 5LQBL 1NGWB 4AEIL 3VWKA 5DWUL 4OZIA 5MEND 3DVGB 4YEFA 3H0TA 1JPGA 4WV1C 3D39D 2ICWA 3LQAH 5CEYA 1P5UA 4NCC2 1NMBH 1RK1B 2VDQL 5LBSL 4PJHB 2YZ1A 4UQ3B 5EFIA 4HT1H 4GBXC 3BW9A 1MH5B 1AE6H 5FUCE 3T0BA 3TZVC 3O2VH 5F7HA 4X6DE 2DQDH 5C0EA 2FNBA 2EO9A 5D96B 3O3DA 1MSPA 3BUYB 2GCYA 3CH1B 5LCVL 3CVIL 3FONB 3ZYIA 4X4YA 2AS5M 4O4YL 4GH7B 2PKDA 5C0BE 2JJSA 4AG4H 2LVCA 3RL1B 1TJHH 5D5MA 3WL9A 4RRPA 3TYGL 2V2XB 5I1CH 2ZP0T 5DK0B 1MJUL 3BESR 4L4VA 4F7PA 2ITCA 4JKKA 2RQ8A 4YFLF 2VAJA 1MVFA 2VE6B 3G04A 2G5BB 4QOKE 4ZS6D 1FIGH 2ESVE 2NY3B 1S7VB 3BHBB 4C58B 2FH8A 5I1EH 5IB3A 1TLKA 4QCIA 4X6DB 1A1NA 1C7SA 1B0RB 4KHTL 2IEPA 5HPMA 3MV9D 4X80L 2XQYK 4XCFH 3SDDB 1UZ8A 4PTTA 2DLFL 1BREA 2VDRL 1LE9B 5F9AC 1SYSB 1FJ1A 3MRGA 4JPVH 1NL0L 1JFQH 3C6LB 4XMLH 5C0BB 2VR9A 3QNYA 2ZCHH 4MB5A 1IC1A 1QFUL 4LCIH 3S37X 1CLOL 3UEZA 1E4JA 1G0YR 2J8UE 3PXHA 1OAQH 3RKPA 5KSAA 2RJMA 3K0WA 4QT5B 2DWEB 2EDWA 1MHPH 1FN4B 3VRLE 4GG6E 1BIIB 4WO4B 4L9LB 3EJYD 1NEUA 5TE4H 3ARFC 3WV0A 4CN6A 3KPOB 3O6FB 1OM3L 4NHCL 3GIVB 1MI5A 3GI8L 3LY6A 3T65A 1DLHA 1SMOA 1DQTA 4QLRA 5FO7B 1NKOA 5IT2L 3QSKB 1BD2E 2UZXB 4MXWH 5C0AA 2ZOKB 1ZWIB 4M6OH 3WFHA 4GAGL 2CLVB 5LGHH 3MLVL 4NT6B 4I18C 5D8JL 1HHKA 5C0RL 1XF1A 3SGDH 1T1ZA 3U30C 3VG0L 5KG9A 2BDNH 3DSFH 3BVNB 4G8GB 3RJQB 2CIKB 4PD4K 3TCLB 2J8UB 5E4EB 3H42H 2OP4L 3LMJL 2UUDK 4U1IA 2IAMD 3TNNB 1G6VK 3B2UC 1MFCH 1I1CA 4NGHH 4POZC 3AXLB 3TBWB 2EXWD 2PYFA 5JXAH 1FZOB 3W39B 3JV6A 2D7PA 1EFQA 1HKLH 5IKCB 4HMCA 4DKEH 5JR1H 3MLYH 4FZ8L 4FQJH 4MJID 2ZCLH 1RJLA 2GY7B 1Q9KB 2OZ4L 3BISA 3B6SB 2NXYC 1IAIM 4WVRA 4GKZA 4RMWA 3FT4A 5BJTB 5MEOB 4P2QE 1ZTXL 3VXQB 1D5IH 1P53A 4NRYA 5IJVB 1I1RA 3AREC 1U8QA 3MJ7B 4NQEA 1YNLL 1HK6A 3D9AH 2VNCA 4HK3N 3V6BR 4PRAA 4ZUSB 3M07A 3OB0K 3RQ3A 2CDFB 4NO3A 1NANI 5K9KB 4LMQE 1IZJA 1PLGL 2E7LA 4PRHB 2A38A 5KJRH 2X89A 4NHUB 4AENB 2WSKA 3CUPA 1FE8H 4E5XB 3OBAA 3GSQB 3QP3A 1F3RB 4NM8L 1WZ1H 1G9NC 3HB3D 4CMHB 3VWKC 5D6DA 3JBG7 2DIJA 2OL3B 3UJTL 1CCZA 4TPRL 5B22A 4EI5B 1M05B 1RUAL 2YEZA 3LCYA 1ZS8A 3OKKB 1XGUB 4PG9A 1CDCA 3BWAB 2Q86A 3NA9L 4NUJB 4A6YA 4R6UA 4ODBD 4TUKL 1JWUB 2VC2L 4HKZB 5HGBB 4MD4A 4MNQB 3OKYA 2C1PB 3ARZA 2Z0BA 5TE6H 1U8KA 4JFFD 1BGXL 3RY4A 3V6FA 1RAMA 4RWYH 5JDSA 2ZPKL 4HPYH 2X4PA 1OW0A 2HJKA 5F1KC 5DJ2A 3S5LG 2DQHL 1JGVH 2JJSC 4OGYH 4LSVL 2J3SA 3OGOE 2DD8L 3T0AA 1K6QL 3AS2A 1DQQA 1IBGL 1RIHH 3PE9A 5T3ZD 2F74B 4TULH 4C4KO 1EHLH 4JHAL 5EZLB 3WNMA 4DWHA 2FYYA 4LLUA 4ERSL 2JJVA 4AT6B 1NCBL 1JRHH 2ZG3A 4RX4D 4TSBH 1L0YA 3V52H 3WS3A 4JY5L 1CI5A 2QSCL 2ICCA 2OSLB 3V4UH 4FXGB 4YR6A 1S9WB 1MIEL 1RURL 3FQTB 1VKXA 1CVSC 5GSRB 3AU1B 3VD4A 4NPYB 3LN5B 4OLVH 5INCA 1N4XL 1AHWB 4HS8L 4TUOA 3MPCA 2DQJH 4KJYB 2NX5D 3SDXB 1SEQH 5CLWA 4N9OB 2F58H 3VXME 1QOKA 1IKNA 4HFWB 1OGAE 1TVDA 5IFAH 3CFDB 3AAZB 1H15B 2ED7A 1RZGB 2BNQE 3BIKB 5KSAC 1OSPL 1WFTA 2V2TA 1G9NL 3H8NA 1EAPA 4KTEL 4TTDD 1RJCA 3MLTB 3WO4B 4PB0H 1AO7A 5E94A 3RWEB 1F6LL 4R4BB 2DJUA 4IRSA 1CVRA 3RDTD 3ZLQC 3O45B 4JM2B 5F9JA 3TO4D 5I1LB 3RUGF 2WUCH 3V0WH 1A9EA 3CU1A 2ADIB 5FYLE 3S7GA 4FQXB 4BZ1L 4PY8I 1T7YA 2HVJA 2R39A 3VXMB 5ABDE 3F62A 5CINH 3OJDA 1OGAB 4O51A 2ARJQ 4FMKA 1KLGB 5F6HJ 4J4PA 1MRDL 4KKBD 3G5ZB 1G9MC 4LPXA 3W82A 2DWDA 5E5MA 4YHIA 5SWSE 4AEHL 4ZFOA 1OD9A 3O6KH 2BOCA 4APQD 2X4SB 2NY6C 2PO6D 1A7OH 4QRQB 3NFPB 1VENA 2UZYB 2AXHA 3QDJD 3QQ4A 4ETYA 4DGYL 5DD6A 1E28A 1ZK9A 3I3EA 3DROA 3WYRA 4FA8A 1A6VL 3MODH 4JGJA 4IRJA 1CG9B 1GHFH 2XZCH 3CNKA 1H5BA 4YZFF 3H3PL 3Q1SL 2XQBL 2DF3A 4R90L 4HXBH 1J0KA 3OKLB 3ALPA 4OLXH 2OR9H 4WW2A 4XAKE 3RFZC 2FWOA 2YD6A 5FK9B 4X98A 2JF1A 2MSPA 1P69B 2FSEB 3DXAA 4K3GA 4XHJD 4ZD3H 3WXVL 2G75A 1ND0B 1U8LB 3N1FC 1QLRA 1UKSA 3GRWA 3RL2B 5LGJB 4WRLA 3LKOB 1RUQH 1Q8MA 4N9GA 5K59F 1J8HE 1RUMH 4MX7B 3N50A 1T03L 1VGEL 4XPHL 3EGSA 3DOSA 4HZLA 2E7LC 1MFBH 4X6FB 4CU8A 4L29A 3BEVB 1RJYB 4OLYL 4KFZC 2AJUH 3IDXL 1FVCB 4KK6C 4S2SB 3P73B 3I6LE 4I4WB 3GGWA 4LLAA 4OF8A 4D94A 5D6DC 4OM0H 1F4YL 3HZMA 3OKMA 2OJEA 3NTCL 3DIFA 4HUUB 4HUVB 3ARVA 5CCKL 4JPKL 2FZ3B 4YEEA 2JE8A 3P30L 1X7QA 3TA3B 4GKOA 3N1MC 1S5IL 5FIEA 2HN7B 3SE4A 2XXMB 1G7HB 2P8MA 3SCMA 4D0DA 1J8HB 3RPKA 1I9EA 1G9ML 2X40A 1QSFD 3LIZL 1BEYH 1PQZA 3ZKXC 4J6RH 5GPRA 3IVKA 3NZ8A 2HMID 4ODHL 3V4PH 1OW0C 2PCPB 5C6PB 3NCJL 1CK0H 3WFCL 4K23L 1U95A 3CH8A 4KV5E 1F00I 3A6OA 4QRUA 4BFIA 3GNML 2C4XA 4X4ME 5GZOC 1A3RH 4OFYA 5C0GB 3RUGE 4YDVB 3QQ3A 5I17A 3K1KC 4MS8D 4JVUA 4JO3L 4KTYA 3MRHB 2HLAB 2PETA 2Z4QA 1FGNL 3GSOB 3HMXH 2MWCA 1OWRM 3U46A 1XH3B 4LHUB 1T7ZA 3SY0A 4MNGE 1JZ2A 1J7VR 4HS6A 1CL7I 4OQTH 2V17H 1ZLSH 4NNXB 3IXAB 1SBBA 3V5KA 1AFVH 2BVQB 1U42A 1JJUA 3RVVC 4D0CB 4P23B 3P4NB 4H1LB 3MV11 1EIBA 3LS5L 5F1NA 5I16A 1TITA 1IKNC 3OAUL 5T5NF 2DL2A 3I3DA 5JZ7C 2ICES 5F7EL 2R2EA 3IDNB 1EJOL 1GGIH 3CFCH 1G7LB 1HH9A 1QSED 2OJZL 3H9HA 4H5SB 4KXZH 4ODXB 4O58L 3P9MA 3ZT7A 4LCCB 1L6ZA 4CMMA 1S7XB 1N59A 2JTDA 4IRSC 1RK0B 4HGWB 4HJGB 5EN2B 1FBIH 1NKRA 3IDMB 3TH2T 2RGSA 1IZKA 3DX6A 3DGGA 4KDTA 4A6YL 2ZUQB 2B20A 3WNKA 1I9IL 4OSUH 5TQ0L 3EOTH 2XACC 4PGEB 3FQRB 3S3JA 1ETZB 2Y6SD 4X6BA 5T1KA 1BQLH 3U48A 4OZHB 5DLMH 1LMKA 3HR5B 3WD5L 5K59E 1ZT7B 5BOZG 1IGML 5F89B 3QCTL 2LTQB 1HOCB 3CFBB 3B2VH 3L3KA 5DK2A 5C71A 5ERWB 5DQJA 4D3CH 1FNSH 4ZFFB 4G6KH 1S7WB 1NGYA 4J4PC 4PJIE 5I76B 1JMXA 1EFXB 1U8IA 1HZHH 2W60B 1ACZA 4QKXB 1I4FB 5AAWA 5F72S 2GKIA 5IVZB 3QUXA 5J13C 3CFEA 1FG9C 3SE8L 5DJ8B 3PHQB 3SJVA 3FB5A 3MRFB 4HWBH 5D1ZC 2R4RH 5KOMC 5DSCB 2EDQA 1EEZB 4FQPA 3LZFH 5IB5B 4G9FA 2N56A 1U8HA 3IFPB 1QRNE 4XCYA 4IEFB 4C59B 4ZAKC 1EK3A 1KELL 1RJZA 3ETBF 1M7IA 5DTFA 1E27A 1R3KB 4ISVA 4IRJC 1CFVH 4LRIA 4J1UB 1EEYA 1H5BC 3KWWB 4NOBA 3VFUA 4WEMB 2HFEA 1T20A 4WW2C 4XP9L 5D70L 1JK8A 3V5HA 4DVBB 1OP5K 4ZPVA 5GGRA 4PJIB 1W2KT 2HFGL 3PNWB 1DN0A 5GJSL 4IOIA 1KIRB 1BJMA 4BSVB 1CD1B 1U3JA 1QA9A 5IMOA 1B6DA 2VUYA 2BHYA 4PGCA 5I73C 2EDXA 2V7NB 4JG1L 4E0RA 3LPWA 4DZBA 4M62H 1YJDH 3PGFH 4KKCC 3FCTA 4UT7H 3D25B 5EA0H 4KKLD 3OKEB 3P11L 3SGEH 4XNXL 3LPFA 3SDAA 2HG5A 1SHMA 1YQVL 4EN3D 1RQ5A 1BVLB 4M8QA 1WJ3A 3OXRB 4GUPA 3X11A 4R2GD 3MRRA 4IOFD 3NBNA 4P9HC 4JLRB 4PJGB 5GRVK 2E27H 4H0HB 2H26A 4LKXB 2XZAH 2HVKA 1CL7L 4Z8FL 3NGBC 5B39A 3C6SB 4ELMF 1KJ2H 4WV1B 4K3JL 2VUOA 4TNVK 3MOAL 3DUSA 3LKQA 3IU3A 2D0FA 4Q7DA 1VDGA 1T1WA 3SE4C 1CQKA 3SCMC 1EO5A 1NBZA 4JQXA 2WANA 2OTUA 4WY7H 4GBXB 3NCEB 5C0IA 3PWPD 5D7SH 1LO3L 5SWQB 4U33A 1EEQA 3TZVB 1AD0B 3HCVA 3LKSA 4NWUH 1F3DH 4RAUA 1EJ6A 3U9PL 1UA6H 4LPCA 3S4SB 4ZFOL 4G6AD 2R15A 5C09E 3CX5J 2NLJB 5FYJL 3GJFA 4AMKL 2W91A 4WI3A 3LQZA 4NC0B 5DJAB 2YPLE 4E41D 2QSQA 4JKPL 4LQ1A 5EOCJ 1QKZL 4Z5RB 5EC2A 1GRWA 3WEXB 5BRZB 1T04B 1JPSL 3FFCA 5BS0B 4GG8A 4U1SB 1FAIL 1T3FB 3RY5A 3RWJA 3VFNA 3O4LD 2X42A 3L5JA 5JO5B 4ZNEA 1BAFH 1QTYT 1KACB 2HT4D 1QSVA 5IM7A 3WFDL 3GRWL 4MA3A 4PGDA 3IFNL 3QUMA 5D7LA 4TVPL 2EKSB 2I27N 1A7PL 2X5PA 5H8DA 5T3XL 3HZKA 3UAJC 5C09B 3CD4A 2AQ1A 2F53E 3KPQA 2W0LA 2XWJA 2QSTA 2XNAA 4G42B 5JLZA 4YIQA 1QACA 3RNQA 5JOPD 4S1SH 4LCUB 2FIRT 3LRSA 2YPLB 5AAMA 3WHXA 1UFUA 3GIZH 5CJQL 2YMXL 2DQUL 1MJ8L 1NAKL 2A9NL 3EJJX 2KBGA 4NKOA 4LAQL 2GK2A 4N5UA 2NW3B 3FZUC 4P9HL 5T1MA 3TFKD 1HWHB 3ARFB 4RBPK 4BKLA 1A7NH 3BGMB 3CMOL 4KDTC 5IVOA 1DBKL 4QHMB 1BOYA 4E9LA 4M5YL 2EIZB 2QQNH 1KJMB 5FECA 4GQ9L 1S5HB 1KJVB 2ADFH 3QNXB 3HHRB 4I18B 1IT9H 3V7AG 1MWAA 4X5WB 3U30B 1BPVA 4YUEL 4MJ6B 5EBLA 1CGUA 3IAPA 1OPGL 2GTWA 5DR5L 5T33H 1XF4A 1HH6A 5JHLH 1VPOL 3QFJA 2DM2A 3QUXC 3HC0B 1NGZA 1UEYA 1YYML 2CRMA 2DKMA 4S1DD 3KDMA 3S36L 2F54D 1BVZA 5TJWK 3MV8E 3OKNB 1MQ8A 4WUKL 2VLKE 4YFEA 5JW4R 5CIPA 3JWDH 3FT2B 1QR4A 3FQNB 4ELME 1TXKA 1MEXL 3PGDA 3MRQB 2NXYB 3GMMB 3PP4L 4G43B 4Y4HD 3GMLB 3NFNA 2VZ1A 5D2NE 4LPUA 5GRWA 5F93C 4XB7A 4F33A 2I9TA 5FUOH 2BHZA 1QQDB 2KPNA 3MV7E 4ORGB 3MACH 5FO8B 3AREB 5M94B 5KOVC 2WNGA 4JN1H 25C8H 3G9AB 5IW6B 1U93A 3T0ED 2WW8A 15C8H 5E6IA 1LO2L 5L9DL 4LCWA 4OZFA 2F5AL 2R0WL 4MD0B 4NCDA 5IR1A 4LGRB 4XPBL 3RWIB 5KZCD 3HPJA 4XMKL 1F02I 5J7CC 4LVNC 4ODTL 4P57A 3QXDB 3RA7H 1MJJA 3KPNA 2R69L 1FLRL 3SDAC 1RFDH 4NQCD 1CFSB 1RIUH 3ARGD 3VWKB 3NPSC 4OZIB 1W8OA 2GJ6D 3ZKQD 4L4VE 5HTSA 3MV7B 2BC4A 3M1BB 1JYNA 5DVMA 4ZDHA 2ICWB 2B8OT 3MJ9A 5CEYB 5FYJU 1FDLH 3O2DH 5ALCH 4XBEH 4UILH 4JQXC 5M95B 3PHSA 1KV3A 3OAYK 1U36A 3BW9B 3STLA 3DX8A 2YA2A 4Z7VF 2D7QA 1KN4L 1KYOJ 4MAYA 4UINL 3ZE0F 3HI5L 1NUDA 3O3DB 2J1KA 1V7NL 1F4XL 2GCYB 2H8PA 3K46A 4H25A 2BJML 4X4YB 5KN5A 1WWCA 3ZO0A 1LP9A 2Z93A 3ULSA 1H9VA 5D5MB 5JPNA 1YNKH 4MQ7A 1S7TA 3K4ZA 5GS2D 4ZO7A 2CSPA 3HNSL 4NJ9L 2OK0H 4L4VB 1PEZA 5HDQH 5ICZA 3S35X 4F7PB 4MHHG 3G04B 3K2UH 4I77H 1JTTA 1F3DJ 3CX2A 5JQ6H 4KUZL 1U3HD 2H2PC 2Q3ZA 5LXGH 4P4RB 3E2HC 4OGXH 5CSZA 1MCHA 1T22A 4QCIB 1N6QL 1A1NB 4I2XE 4JCLA 5HPMB 5HGHA 4WNQA 4PTTB 5GRZA 5C0AE 1ZA3B 1FJ1B 3MRGB 3HG1E 1DLFH 3HZYB 5HGGS 3QNYB 1IQWH 4PLKC 3MNVA 2XPGA 4G7VH 5DUBA 2J4WL 5FV2A 2HTLD 3G6DH 5KSAB 1HILA 5EBMA 4PJ8D 1YEHH 4Z7UA 2IGFH 4NUGL 4NM4L 2X44D 4CVXA 4POYA 4OTXH 1KB5A 1UYWH 1NMAL 5EWIL 4H8WC 4U6XA 1MI5B 4I2XB 4KK9D 1HCFX 1PG7W 1DLHB 2PYEA 4JFEA 4PP2A 4OFVA 3DI3B 5H94A 4OIAA 5C0AB 2WQRA 3WFHB 5D7JD 1PEWA 2CGRL 4P46D 3RX8A 4PJ5A 4LSPL 1OY3B 1HHKB 3ULUF 1PD6A 4UDTA 3RGHA 2YPKB 1EMTL 5KG9B 1A6ZA 5BW7A 3IJSB 4YO0A 1XIWC 5K33A 4M9OA 4U1IB 4U1KA 3JTTA 3OAZK 1L0QA 1NAMH 3QDAA 5EG6C 4HIJA 2AJXL 2DYPA 2PYFB 3GKWH 3JV6B 4ONGL 2R0LH 4OCRL 3QCUL 4F58L 1J05B 1ZHNA 2NY6B 1RJLB 3INUH 5TE7H 1T6WA 3LN4B 5FYLH 1AKJD 1R5VA 3GK8H 4GKZB 7FABL 5IW1A 2ZSVA 5T5FH 3IU4H 1ITBB 4RMQA 3P4LA 2P8LB 4ZUVA 4X7TA 1KT2A 1VADA 3QUML 2DDQH 3QHFL 4NRYB 1F90H 3IGAA 2VR5A 4LPWA 3ZE0E 3VWJD 4FQQA 3HRPA 4HBQA 4F80A 1A9BA 2ZJSH 2R0ZH 4OZGF 4V1DD 1U8QB 4NQEB 1H0DB 4K94C 2ED9A 1NFDF 5JDJA 2AV7A 3U0PA 2Y07L 5DRZA 3D69B 5E6IC 3UTSD 1I8MB 3P77A 1INEL 3DMMD 1FZKA 3DUHA 4OBSA 4NO3B 3ARRA 4WW2F 2EDBA 1LK3H 1PZ5A 2CMRH 3IT8D 5AG8A 4YDIL 3CUPB 3DBXA 4MA1C 5IBUB 5BXFA 4CRPA 3KPPA 4H8WL 1G7PA 3VFTA 4M48L 3MLZH 4PJBA 4KRNA 3MCKA 1ZS8B 3PP3H 4PG9B 3EYSH 3KXFA 2Q86B 4A6YB 2AJSL 4ONFL 3RVTC 3SDCD 5C70A 4JFOA 1JV5A 5DD5L 4MD4B 4NNPL 5ICYA 4MAYC 4J3OC 4BUGA 3D0VA 4K7PX 1YN7A 1I9JH 5E2VL 4FFWC 3ZKXB 3V6FB 4JQIL 4IM8A 5JDSB 4LIQE 4QXGH 4OIIL 4U3XA 2CIIA 4J3WA 1WBXA 4UV7H 5I19H 1N3NA 2X4PB 2HJKB 1SYVB 4J3TA 5DJ2B 5T5NG 5LKNA 1P6FA 2ORBL 2NY3D 1JZ8A 3SBWA 2C3VB 4YWGH 1IGCL 2HYMA 4OKDA 4YHOL 1RZKH 3BZFA 2BMKA 5FGRA 2FYYB 4OCWL 4YX2L 1VB9A 2V5YA 4JHBA 1E6JL 4W68A 3SDDD 3BAEL 1S9YA 1S78D 1MAMH 3GFUA 1TZGL 3ULUE 4XPFL 4EDWH 4YR6B 3C6LD 5C0BD 2G9HA 4R4FL 1BLNA 3EJZD 2FHFA 4K94L 5CP7B 1VKXB 4PLJD 3TGXA 5HHOA 5HI5C 1GGCH 3GSXA 2AKRA 5K9JH 1OAUL 5INCB 4TUOB 3OZ9H 4NFBA 5F1SA 4WO4D 3BIAX 5KW9L 5AZEL 1T0NA 2ARJA 4JHWH 3O6FD 3WIHH 4DKAA 1VFAB 1EDQA 3C2SA 2N7AA 5DMJB 2I25N 3S34L 3W9DA 4NOFA 2V2TB 3PWVB 1EAPB 3FO0H 4G6FB 2EDFA 4PUBH 1AXTL 1AO7B 5E94B 3LDBC 4IRSB 1D3CA 4JO1L 1J87A 3MJ9L 1NCCL 1GZPA 5F9JB 5FYJE 4R26H 1UM5L 4QGTA 4OZGE 4G8GD 5J0BA 2L7UA 1A9EB 1WZLA 4XPAH 1CR9H 1NFDE 1Z9SA 4G6JH 2UVFA 2OMNA 2R8SL 1CZ8L 4KUCD 1FNAA 2HVJB 1X4XA 3HLAA 1BOGA 4HCRH 1EGJA 4OIBA 3GSWA 5BW7C 3OJDB 4JRWA 1NCNA 4O51B 1IC4H 3IAGC 3DXAE 4OD3L 4EOWH 3NABL 4EUPA 5J13B 4MCZA 2DWDB 4K8RC 4FQIH 5E5MB 4YHIB 4ZFOB 5D1ZB 2BOCB 4S1QH 4WUUE 2ARWA 5JMRA 3RI5F 1BBDH 3BD4A 4HIEA 4A2MA 3QQ4B 2H6PA 5DD6B 1E28B 3DROB 4ZAKB 2VQ1A 4NRZA 4H26A 4QY8A 1II4E 4IRJB 1H5BB 4HKJA 1J0YA 5J89A 2FX8L 4OLWH 4GMSH 1BVKA 4F7EB 5DHVH 2A74A 5D7IF 1MCWM 2W9DL 1BJ1H 1QYGH 1T2JA 3LN9A 4WW2B 5AZ2H 3VGAC 4AL8L 2X4NA 2QQKL 4X98B 1F2QA 4K2UH 2PW1B 3DXAB 4OF7A 2P45B 3N1PC 5J4MA 4PRHD 3PDGA 5E2WH 2P43B 1NBQA 4H88H 1QLRB 3RPIA 5B8CA 4P2OD 4K7PL 4EBQL 2XTLA 3HAEA 4NC1C 4N9GB 1FPTH 2P8PA 1X5IA 4Q6IA 4WUUB 2ERJC 3EO9H 5I73B 3EGSB 2BP3A 4HZLB 4GKNA 5J3HC 3CXHK 4EI5D 4L29B 4WU5A 1OP3K 1MREL 2HFTA 2HTKC 3WNPA 4R96A 4ODUA 2VSCA 2FB4L 4K9EC 1YA5A 2ADJA 3GGWB 1JHTA 4PS4H 3WSQH 3GMRA 4OCYL 3WUWG 4KKAC 5FOBA 4F37K 2BY1A 2HKFL 3MTRA 3PABA 3HZMB 3OKMB 4MNQD 2OJEB 5CD5C 4P49A 5IGXL 1RUKL 4Q9QH 3NGBB 4JGUA 4U3CA 1FGVH 2BY2A 3D85A 3BQUA 1X7QB 1Q9WA 3TBSA 4HIIA 3SCMB 2P8MB 4D0DB 3T2OA 3LRGA 1ACYL 2LABA 1PX3A 4M7LT 3VXPA 3F6LA 4RMVA 1PQZB 1MPAL 4K8RL 5GS0C 4YDLC 3MLPA 1UC6A 1LHZA 1XFPA 3D2UA 3NZ8B 3IVKB 2FECI 3ABZA 4I9WD 3OPZH 4ZO9A 1U95B 2FD6H 4NBZB 5E1AA 3V6ZA 1ZGLA 3OV6A 4YHPB 4QRUB 5FM8A 3Q6FA 4BFIB 3SBWC 2QHRH 2GQHA 4HDIA 3QQ3B 3S6CA 5I17B 5IBLC 3ROLB 2Z4QB 1TJIL 1M7DA 5HHVL 1OTTD 2XRAH 1JZ3A 4XPGL 2WP3O 1K3ZA 3TBVA 3U46B 1AGBA 3SY0B 4KROC 2B2XL 2CDGA 4HS6B 3RIAF 5I1KL 4KAQH 3VFRA 2YRPA 3TJHD 3E3QE 4PJEF 4NDMA 4XBGA 3V5KB 4N0CD 1B4JH 2DQCL 3GM0A 2G2RA 4PJAA 4J3VA 2PXYA 4K3DL 4XVJH 4ACPA 4CGTA 1YEEH 1XCQA 4F3FA 1U8JA 1QLFA 4ZOAA 3BDBA 5ADOH 5AEAA 1NEZG 4JM2D 5K9QI 3R1GL 2R2EB 4K9EL 5D1XA 4Y4KD 4QO1A 3O3EA 2QSVA 1R0AH 1HH9B 3H9HB 2YXMA 1F58L 2UWEF 2GSGA 3CPLA 4Y0GA 3SKJH 1AY1L 1J0HA 4CMMB 4FQXD 1N59B 3Q6GH 4GAJH 4KI5D 3L9RA 4L8BA 2AV1A 1QBAA 2EE2A 1RUPL 4G9FE 3DX6B 4WHTA 3DGGB 3DWTA 1T80A 1WICA 5E2TL 1Z3GL 3MNWA 2GK0A 4X6BB 5T1KB 1SQ2N 2XICA 4OB5L 2IQAA 3LEYH 4M5ZH 3L5XL 3HC4L 35C8L 4MQXC 5GS0L 3L3KB 2CUMA 5DK2B 2PUQT 5DQJB 1I3RA 5BOPA 1NGYB 3BJ91 4UTAL 5HY9A 2VDKH 3O6ML 5IOPA 2VWEC 5JHDA 1U8IB 1G1CA 3ULVF 1BQHA 3QUXB 1IAKB 3CFEB 4ALAH 1V3MA 4U1LA 2XA8L 4WHCA 3SJVB 3FB5B 1F13A 1IGFH 1MIMH 1S9VA 2DJSA 4GOSA 3QUKA 4G9FB 3P0VH 1U8HB 3GI9H 4XC3L 5F7DA 2CK0H 4KMTH 4JZOA 4XCYB 4RA3A 5I8CA 1UZ6E 1M7IB 5DTFB 1E27B 4ISVB 1BFTA 1EEYB 4PJ9A 5JNYA 3VFUB 1CF8L 4OT1L 4U49A 2HFEB 4L8CA 1T20B 4PV8B 2WWMC 1RI8A 1JK8B 2H9GA 3HI1A 3V5HB 1CLZL 1GPOH 4ZPVB 1UACL 4B7IA 3ARDA 2LU4A 5B8CC 3HMWL 3PWJA 4IOIB 4NP4H 3NACL 4DTGL 1IAIL 1QA9B 4PJDF 1VCAA 2KKQA 3BN3B 5IMOB 1I8IA 1EVUA 4Q6IC 3UJJL 5IQ7H 5DMIH 3KPSE 1ZEAL 5FA4A 4E0RB 1N5YL 4XWOD 1TJGH 5HVWA 4DZBB 3EYUH 4U6VL 5J11C 3FN0H 3FCTB 3P0YH 4LVNB 2ID5A 4K3HA 4LGPB 3SDAB 4HZAA 2HG5B 4I3RH 1P84J 3QYCA 3TA3D 4M8QB 4GUPB 3X11B 3MRRB 2VLRA 4FQCL 1YUHA 3NPSB 4XGZA 1UXWA 2H26B 4QRRE 2HVKB 4PJEE 3B5TA 4XP6L 3QH3A 5IHBA 5B39B 1AQKH 2I5YL 5GGSY 1EGJL 3BQUC 4OFKA 3DUSB 3LKQB 1Z0MA 3FFCE 3IU3B 4YDKH 2FO1A 1T1WB 4MXQC 3BP6A 3WDJA 1NBZB 4WHYG 1EAJA 4WFED 2OTUB 4XRCA 5BCAA 5C0IB 4ZNEE 3RWGA 4Z7WF 4R9HA 1RU9L 3HCVB 3SE3A 3LKSB 1I7ZB 4RAUB 5D7LE 4OJFH 1Z9MA 2UWEE 5A2FA 1NANH 3LQAC 3GJFB 1ZGLP 5TF0A 2FH6A 1T0MA 5EZJA 4I1NB 3EZ8A 4YNYA 3LQZB 4LSQL 4LHUD 1YMME 3MJ8A 5I1GL 1IVLA 4QRRB 3G5VA 2OLDA 3N85H 1DUZA 5EC2B 1YYLH 5I75C 3ZSSA 5KVDH 5BVJA 1BZQK 2O26U 4X6CA 2DRUA 3Q5YA 3FFCB 2O5XL 1XCTA 2IMNA 3W81A 4GG8B 4P23D 3E2HB 1NCWL 1U41A 3RWJB 3VFNB 2EECA 4JEGB 1SVCP 4MD5A 4XCCH 3ORJA 5IM7B 2JK5A 4MA3B 4PGDB 3QUMB 4FQLL 5D7LB 1FNEA 3BKCH 5I30H 3HKFA 4CN4A 1CE6A 3N9GH 3RWCA 3HZKB 4JAMA 3KPQB 2PXYC 4FP8H 3U6RA 4G6MH 3MSPA 5F6HI 4D0BA 2XWJB 2NY4C 3F7RA 3QDMD 1DTUA 1U8NA 5JLZB 1TTUA 3L1OH 4YIQB 3RNQB 5B3JE 5GJTL 4WFFE 3LRSB 3MRNB 3WHXB 5D1XC 5CLTA 4LDOB 4U6YA 3AROA 4IMKA 3ILQD 3QFJE 4UT9H 5D7KD 1G7IA 1DFBL 3SGDI 5T1MB 5JA8B 3FMGL 4LSRL 2J7LA 1C08A 4FFVC 3V2AR 4KK8C 1MHEA 4BKLB 4G7YL 4V2BA 4P5MA 3PQYD 3ALWA 3OGCA 3MBXH 2GITA 1ADQH 4ZSOE 4CDHA 1J5OH 1WWWX 2DQIH 3BZDA 4YXKL 1EFXD 3BMWA 1DDHA 3M8OL 2GI7A 1DQMH 3RHWK 4PJDE 5KSUA 4LQFH 5HYFA 4ZXBA 4LSTH 5EBLB 1K2DA 3PG2A 2GTWB 3LQAL 2KDGA 1HH6B 1NMBL 1XIWB 2JELH 5JOFA 3L3JA 3QFJB 5FHAH 2SEBA 4YXLH 3VI3E 1UCTA 1NGZB 4HT1L 4TOYH 3KPRE 1AE6L 2P42B 4XP5H 1J1PH 3D48R 3O2VL 5IP4A 2DQDL 3KDMB 4WI8A 4IBLT 3O11A 4OM1H 5CIPB 5F97E 1A4KA 1Z9OA 1HNFA 3ARBA 3PGDB 2DLEA 2CQVA 5AWNH 1AI1H 1CGWA 4PJ9C 4AG4L 3EO0A 1TJHL 5I8OH 5I1CL 2BK8A 4Z7WE 4F33B 2I9TB 1KEGH 4YHKH 4B0MM 3QR2A 5A16B 4DUXA 4M6NH 3ARDC 4L3AA 5TF1H 1FIGL 4EIZC 4PRIE 2XWTB 4ZFGH 1U93B 1UWXK 4RMRA 5I1EL 1KC5H 1JF1B 5E6IB 5CEXA 3OHXA 4OFPA 3ZYOA 4LCWB 3GB7A 1JWMA 4OZFB 5HI4C 4XCFL 5IR1B 3C5ZA 2C3GA 3HPJB 1BFVH 3LKRB 3IRPX 4JPVL 4GW4B 4P57B 4MA1B 5F9WC 1G9EA 1JFQL 3KPNB 4XMLL 3BJLA 2ZCHL 2RCSH 4LCIL 1KIUA 5KVMC 3UCRA 8CGTA 3UTPD 1GGYA 2A6DA 2YPVH 2L4OA 4HWEH 4Z7WB 1YN6A 5HD8C 1I7RB 1OAQL 2Y72A 4KGLA 4M7LH 4UNTA 1MHPL 1TFHA 4LLMA 3TZVD 2V5SA 4GJTB 4JFDA 5TE4L 3VDBA 5JW4M 4GMTH 1CICA 3STLB 3DX8B 4UV4H 1JRHI 4MAYB 5C0DB 3KLSA 5FHBH 4MXWL 2B4CH 4M6OL 3KVQA 5LGHL 4WTXA 2W65A 2D4DA 1YECH 2H8PB 4DKDC 1NCDH 1TCMA 4H25B 1CTOA 5BRZD 5KN5B 2BDNL 3I3BA 2Z93B 3DSFL 4PRDA 3ULSB 3FO1A 5FM5M 3WHE1 3A67H 5BS0D 1OAYH 5JPNB 4WHYH 4MQ7B 5E95B 3H42L 5EOTA 5ICZB 3ZYJA 3G08A 3NPZB 1MFCL 5EPMA 4NGHL 3SEPA 3DNKA 4UOW0 5JXAL 4Z7UE 5DRNA 5EO9A 1HKLL 5C09D 4DKEL 5JR1L 4BH7A 1JVKA 2AABH 3MLYL 1GAFH 5FGBA 5CSZB 4FQJL 2ZCLL 1Z5LA 3F12A 1T66C 3FB6A 2AI0H 3L3HA 4JFEE 1A2YA 1V8HA 5HGHB 5JXEA 2A77H 4WNQB 3K2MC 4LIQH 2YRLA 4OGZA 5ACMA 4HK0A 3P4OA 4EJ1C 5C0FA 1D5IL 4WFHE 4PJ5E 3MNVB 4Y4FA 3HMXA 3ARFD 2XPGB 4KH2A 5DUBB 3S5LA 1F11A 2EC9U 4M1CC 5A2LH 3MUHL 1HILB 5EBMB 4IMKC 1AJ7H 4OQTA 2LV4A 3L3GA 3D9AL 2EDTA 4Z7UB 4Z76A 3BXNA 5DQDH 4JPWL 3MXWH 3ULUH 4I8DA 3MRIA 2WP3T 3S8WA 4CVXB 3LDBB 4EDXA 2AP2A 4U6XB 5ISZA 5KJRL 1YMHA 3FKUS 3QWRA 2PYEB 4JFEB 1FE8L 4PP2B 3FOMA 5H94B 5HBBA 5JPMB 3K74B 1WZ1L 2CKBA 2XKNA 4XP1H 4WIQA 1DVFA 4BQ8A 3B2UD 5TDOA 4POZD 3SPVA 4PJ5B 4UDTB 3RKDC 5KVGH 4ZXBC 2CO7B 1GSMA 4QHNA 2EIEA 4YO0B 3WS6A 1BX2A 1SEBA 2CLRA 2VXVH 4B50A 1D5BA 2ZUVA 2A83A 4U1KB 3RNKA 1IILE 2EZ0D 3HE6A 3JTTB 3BKMH 4HIJB 3NVQA 2DYPB 3V0AC 3RAJH 4Q9CA 4ODWA 1FL3A 1PKQE 2B39A 2Y06H 5CJOH 5TE6L 1ZHNB 4LDLB 5FDWA 4RWYL 5L8KB 1ZT4A 3ARBC 1S7UA 1KF9B 4HPYL 1QNZH 3KYKH 1R5VB 4UBDC 3V0VA 3ARED 1JGVL 3CGTA 4OGYL 5IW1B 4QF1A 4X7TB 1KT2B 1VADB 4F9PA 4GRWH 4C56E 1RIHL 3QUZA 32C2A 4TULL 3IGAB 1CBVH 1PVHA 3RI5K 1EHLL 4H0IA 4HWBA 3VGAB 4FQQB 1JTOA 1A9BB 1JRHL 4TSBL 3V52L 2IF7A 4MCYA 2Q20A 3KXFE 2AV7B 3U0PB 3V4UL 5DRZB 4NQDA 1PFCA 5TGBA 3P77B 1ODAA 3TCXA 1FZKB 4YHLH 5E08H 1PKQB 2AEPH 3VWKD 2ERJB 3C5ZC 4OLVL 4PJFA 1PZ5B 1TMCB 2AAVA 4WFGD 1FZJA 1TZHA 1FH5H 2DQJL 5FF6A 5BXFB 1XMWA 1SEQL 1X6NA 5J6GA 2F58L 3KPPB 2I60H 2X6MA 4WEBH 5IFAL 1G7PB 4DK6A 2LU3A 3UPCA 3MCKB 5EU5B 1RHHA 1IJ9A 1U91A 3B43A 1X5FA 3QO0A 4PB0L 3KXFB 4OV5A 3VFOA 4PY7B 3OR6A 3OWEA 3NA4A 3QQ9C 4N0RA 4JFOB 4FFYH 5C08E 3BRDA 1JV5B 2QBWA 2YK1H 4L3EA 2YSSA 4XHQA 2WUCL 3ROOA 3GM8A 2NW2A 5ICYB 3V0WL 2C1OA 2CD0A 5HHOE 1YN7B 3PL6C 3ZE2F 4BZ2H 3S9DB 2UYLA 1JHKH 4L4VD 4F9LA 4DZ8A 1CFNB 4YDLB 4KVNH 1KUMA 4FZEH 2CIIB 1WBXB 1UEMA 4JREC 1PAMA 1KJ2A 1N3NB 1LE5A 4LFHG 4QHUA 4NQTA 5CILH 3WUZA 5CINL 2PTTA 2FBOJ 4CN1A 1F4WH 1ZOXA 2BSTA 1EX0A 4JRXA 1H8OA 3BZFB 2BMKB 4XP4H 2HP4A 1FFNB 5EBWA 1S9YB 5HI3C 1P6AB 3RVWC 3ZL4H 2FHCA 3UBXI 5E6YA 3IFLH 3O6KL 1YEGH 1BBJA 5FGBC 1P7HL 1A7OL 4KROB 3RGVA 2G9HB 3SKOA 1BLNB 3NN8A 4LSSH 5HHOB 3GSXB 4KXZI 1MFEH 5JXEC 1TQCC 3MODL 2AKRB 1GHFL 2XZCL 5IBTH 5KSAD 3ARPA 1Y6NR 4HXBL 1CU4H 4JFYA 3GJFK 3H3KA 4OLXL 1MJ7H 4W6WB 2OR9L 3C8KA 4U7SA 4Y4FC 3RWFA 3I84A 1S7VA 4HUKB 4M8VA 1T0NB 2ARJB 1OHQA 2F9BT 4K07A 4ZD3L 3VGHA 3W9DB 1MI5D 5TH2B 2VWEE 3DHJA 3D3VE 1G0XA 4U7KA 1RUQL 1CXEA 3T0VA 5C0AD 1CQYA 1RUML 4ORZC 5DFWH 3QT2A 2YC1A 3U9UA 1MFBL 5JIHA 4EXPX 4EQ3A 3JV5A 3BIBX 3BZ4A 2AJUL 1JWSA 3ET9F 4AM0B 3PUCA 4QOKA 3L7FB 1DVFC 4B7LA 4HUWA 4OM0L 2ESVA 1X5GA 3HLAB 3GSWB 1HIMH 3UYRH 4NZRH 1FYTA 5F1OB 3WS6C 5HVHC 5CZKA 4J2XA 5LAXA 2IANA 5AD0A 1NJ9A 2NY6D 5TQ2H 2NR6C 3HE6C 1IGTA 1VSCA 5F9DC 1I1YA 2ZOKA 4EUPB 4MCZB 5I15H 2X4TA 5GRXG 1U2HA 1U3ZA 4POUB 1HQ4B 2P44B 4UU9A 1BEYL 4P59H 4J6RL 4QRSA 4GT7A 2H6PB 4YQXH 2J8UA 3V4PL 2JCCF 1CK0L 2VQ1B 4NRZB 4H26B 4QY8B 4NQED 4GG6A 4YBQC 1KJ3H 4HKJB 4M93C 1BVKB 3WFBH 2A74B 4WCYH 1A3RL 2W9EH 3W39A 3QUZC 5FV1L 3C8HA 2AK4E 2RFXA 2NPLX 2X4NB 2WINA 3RTQA 3ZE2E 4OUOA 1A6WH 3Q5OA 4PB9H 1INDH 3VH8G 1OT2A 1BD2A 2X89D 3HMXL 3RPIB 5B8CB 3HFMH 5DVLA 2E6QA 2RB8A 1WIUA 3WFEH 1NDGA 3QIWA 3HAEB 1E6OH 4OD1H 2EE3A 2JIXA 2P8PB 4OQTL 1FYHB 2V17L 4Q6IB 1OB1A 1ZLSL 4HG4K 1EV2E 1AFVL 3GMQA 3ZTJG 4GKNB 4F2MA 5J11B 3GHEH 4M02A 1F8TH 4RIRA 2XV6B 4R96B 4ODUB 3TYFA 1N2RB 5TDPA 4KJQC 5JQHC 2ADJB 3QUYA 1JHTB 2OR7A 4X83A 5CUSH 3GMRB 1F4HA 2Q8BH 4YBLC 5FOBB 5ESVB 4JZNA 1GGIL 1LNUA 3PABB 5J57B 3CFCL 3T0DA 3D85B 3BQUB 4HD9A 3JTSB 4O2CA 3UYPA 1Q9WB 2CRZA 2NY7H 3GSQA 3HA0A 3TBSB 3LS4L 4HIIB 2NY1C 4LGSB 1FBIL 1B0GA 4HW6A 1FNFA 4P2QA 3WIIH 4N90E 3KYMA 3HC3H 4AJ0A 5KAQG 1CLYH 3QWQB 3VXPB 4OSUL 3EOTL 3VXSE 4F9LC 5GXBB 1BQLL 1XGUA 3D2UB 5DLML 5SX5H 1P9MA 4FTVA 5E1AB 3B2VL 2WLZA 3A6CH 3TH4T 3V6ZB 1ZGLB 3Q6FB 4D3CL 1FNSL 2ZUUA 4G6KL 5L0QC 4HDIB 1HZHL 4RGNC 5FB8A 2DBLH 1Q1JH 1BWWA 5I75B 3L3IA 1M7DB 1P5VA 1KPUA 4HWBL 3RVVD 2R4RL 4QGYA 3TBVB 1SM3H 1AGBB 2Y9RT 3D87B 3LZFL 5IVXF 5EO0A 2X4RA 3RGVC 2CDGB 4KGJA 4M4RA 3VFRB 4NSKA 4AIZA 4NDMB 4XBGB 4XB8A 1CFVL 3X3FH 1I3UA 1YPZF 2G2RB 4PJAB 2B7DT 3ARSA 1WITA 1LDSA 1QG3A 2PXYB 4G6FD 4BQ6A 3C2AH 1XCQB 5JW5A 1AO7D 4F3FB 2NY4B 1U8JB 5CZXC 1ORSA 4O2EA 5CAYB 4IRSD 1QLFB 3SGJA 4OF6A 2QADC 4Y88A 4XVSH 5D1XB 4UAOC 2JCCE 3O3EB 2DICA 1SJEA 3KJ4C 2GSGB 3CPLB 4Y8AA 3F8UB 2UZIH 4M3KB 4M00A 5FO9A 3CCHB 1HXYA 3RZCA 3L9RB 3S98A 4L8BB 1DL7H 4QHLA 2AV1B 5D6CA 4M62L 1YJDL 3PGFL 4WHTB 2R1XA 2YD1A 3WLWC 4UT7L 3DX7A 3VI4F 5EA0L 3ULVH 3BT2H 4J4PD 3MNWB 2GK0B 3C9NA 3NFSH 3SDYH 1MCJA 1JI1A 2IQAB 5ICXA 3MLTA 3DHMA 5GIRA 2E27L 1HWGB 2XZAL 5DHYA 6CGTA 5IW3A 4I3SH 1I3RB 5DC9B 3MRJA 1KJ2L 1H3XA 5HY9B 5IOPB 5JHDB 5FYJD 1RV6X 4Q0XH 2E7BA 1BQHB 2QQLH 4WY7L 2NY2C 4IRJD 5D7SL 4U1LB 1T21A 1ZLWK 1QBMH 3BKYH 3VMNA 4NWUL 3QUKB 1DBAH 1UA6L 2NX5A 3CLFH 2BNQA 5I8CB 5DS8A 3DXAD 2V7HB 3WN5A 2V9TA 4FS0A 4PJ9B 5JNYB 4NBXB 2E6PA 3ME0A 1NAMA 3HUJA 4DQOH 1KG0A 4TVPD 4L8CB 3JV4A 1R3IH 1Y6MR 1WBYB 5T3XD 3RTQC 2H9GB 3HI1B 1S7QA 2VZTA 1EUTA 4IS6A 3ARDB 3QEQE 5I1AA 3JWDC 3EYOA 1S3KH 4M1DH 3PWJB 4KKCD 1FC2D 2AJVH 3QIWC 1VFBA 2VLME 4N1CA 1BAFL 1EA9C 1I8IB 3OKLA 5EU6E 5I0ZA 3WNNA 4QXTA 1J86A 1DQJA 1B9ZA 1IC7H 5F9WB 1FVEA 4BQBA 3QUYC 5MI0C 4L5FH 3KLDA 2PN5A 1OWWA 5DZNA 5IVXE 4S1SL 5SWSA 1A14H 2VLRB 1YUHB 3GIZL 3LHPH 1UXWB 4JPIB 4PG2C 1MCOH 3QH3B 3ZTJH 4X6FA 1YPZE 4APQA 3TIEA 1RVFH 2AK1H 2ZOLA 3BP6B 4S11A 3AUVA 1A7NL 1L6XA 2O5ZH 4XRCB 1QD0A 4NJAH 3RWGB 1KGCD 4BQ9A 2QQNL 4M4PA 3L3DA 4OFYD 5HHNA 1G6RH 2B1AH 2ADFL 3O41B 3CU7A 3CDYA 1P9MC 4TSCH 1IT9L 2C3WA 4JN2A 1NUFA 4S0TD 1SBSH 5EZJB 4YNYB 2AXGA 3MJ8B 5T33L 3QXVA 5JHLL 5HHQA 3VJ6A 3G5VB 3U7YH 1ZANH 1H3PH 1DUZB 2PR4H 2YD9A 5BVJB 4X6CB 1XCTB 3QXAA 2PCPA 2BVPA 2E9WA 3UAJD 4MD5B 1MCEA 4TQEH 3JWDL 1I1FA 1C16B 3FO2A 1IFHH 5C0GA 4YC2C 3HB3C 3UP1A 1FNEB 4ZPTA 4XZUB 3RWCB 2IPKA 4JAMB 2BHUA 3U6RB 3SN6N 3FZUD 4D0BB 2E8YA 5FUOL 1U8NB 3MACL 4GLRI 3SGJC 2EDRA 4DFHA 3ZHKA 3EBAA 1KCVH 3CAFA 3OQ3B 4EQ2A 4JN1L 1B4RA 4U6YB 25C8L 2V9QA 3NZHH 1G7IB 4QEGA 2IQ9H 15C8L 4MA8H 3QA3A 1BZ7B 1C08B 2H41A 5T1KD 3RZCC 4G8EA 4P5MB 3C87A 3GBNH 1X5JA 4AEFA 1N7MH 4MNHA 4X4MA 1LK2B 2GITB 3RUGA 3RA7L 2XN9A 1KIPB 4X5XA 2ITDA 4Y19E 1RFDL 3FHQA 1MLBA 2VN7A 4JRYA 3F5WA 1DDHB 1MHCA 1RIUL 1UVQA 5HGDA 3QUXD 5KSUB 4D8PA 2VLJE 3SJVD 4ZXBB 4MNGA 3HE7A 2NY0C 4G9FD 4GKSA 2IPTH 5JOFB 3LD8C 3BFOA 1FDLL 3L3JB 5ALCL 4XBEL 2APWA 4EVNA 2DJ4A 2SEBB 4B53A 4IRZH 3HPLA 4UILL 4MA7H 3FQRA 4MXVE 3W0WE 3AC0A 1QBBA 4HCRA 1SMAA 3O11B 5L7XH 1A4KB 1S7WA 1C5BH 3ARBB 2HWZH 5F7KC 3SOBH 2BX5A 3VRIA 3WN5C 4FMFA 3D5OF 3EO0B 1YNKL 2CJUH 2HT3C 4MZ2A 1UGNA 2OK0L 4B5EA 5HDQL 5GHWH 3MRFA 3N0PB 2GSIA 3K2UL 4I77L 1CE1H 1XGTA 5JQ6L 3TBTA 3S37H 5LXGL 5HVGB 1QRKA 1TETH 4RFOH 4OGXL 3QNZA 3X13A 3MQIA 1CD0A 1EZVX 3KWWA 3SDAD 1DBJH 5CEXB 3OHXB 4HKBA 4U3HA 3GB7B 5DHVA 3C5ZB 3QG7H 2ZKHH 3BE1H 5A2IH 2P48B 4LHJB 1EO8H 1DLFL 3U0WH 2H32H 2AEWA 2BVOB 1IQWL 3MUZ1 4Z0BH 2C3XA 2CO6B 4G7VL 3IXTA 2VKWA 2A6DB 4KKBC 1MRFH 3G6DL 5E99H 1NGQH 1YN6B 3DYMA 3QJFA 4PP1C 1FO0H 4LLMB 4PJFF 1YEHL 1QRNA 2IGFL 3CXDL 5EZOH 4LL9A 4APQC 2BSSB 1OGTA 4JFDB 5D2LF 1X44A 3T4YA 4GRLA 1MNUH 4OTXL 3B4NA 1UYWL 4GRMA 2QHLA 5DUMH 3IS1X 4PJXF 2D2OA 3LVEA 4KC3B 3MJGX 3LKNA 3PL6B 4JANA 4HLJA 4LF3A 1OP9A 2W65B 5F71A 1Q0XH 2Y5EA 3CVHH 3UMTA 5DYOA 4JREB 1W0WA 2A6JB 3FFCD 2H2PD 3V8OA 2ZCKH 1JZ5A 5JW4N 3FO1B 3BMVA 1GJIA 2HJFA 2YUXA 5IG7B 3BPOC 1XGRA 3K8MA 3G08B 4P99A 5FFLA 5EPMB 5ESQA 5GZNC 2Z9TA 2EDLA 1NAML 1ZLUK 4DUVA 5D7LD 3I85A 5DRNB 3GKWL 3S4SA 3DX9A 4Y2DA 5I6XC 5EO9B 2E6JA 4NYLA 2R0LL 4YXHH 4BH7B 2EDEA 1H3TA 1FV1A 1Z5LB 3INUL 4PLKD 3F12B 5ISZE 4ZODA 3FB6B 5TE7L 4U0QB 5FYLL 3L3HB 1A2YB 3MXVH 3GK8L 1TQCB 5T5FL 1RZKC 4Y16A 4HK0B 3IU4L 3WEXA 5C0FB 2DDQL 2XYCA 3L5HA 1CDGA 1F90L 2D9CA 4U1SA 5T1LA 3LKPA 4Y4FB 3ZDXF 2ZJSL 2R0ZL 3S5LB 1KULA 1IEBA 5CEZE 4Z76B 3BXNB 3DTXA 3MRIB 4EDXB 5E8OB 5FCUH 1NFKA 1LK3L 4LCYA 5DA0B 2CMRL 2A6KA 5ISZB 1KCLA 1YMHB 5MHSD 2YPLA 3FOMB 1T2XA 2XKNB 3Q5TA 2IPUG 3QFJD 1DVFB 5TDOB 3MLZL 3QWOB 4J12A 1MFAH 3HE7C 4QHNB 1LO5A 5HVHB 2CLRB 1D5BB 3LEXA 2A83B 3EYSL 3RNKB 1G7MA 3HE6B 5KVFH 2H3NA 5J8OA 3UO1H 2A0LC 5C0JA 2F53A 2AJ3A 4QXUH 1ZLVH 4HC1H 1BF8A 5HDLA 2ZUSA 2LTQC 2GTZA 1FL3B 1I9JL 2R56H 5FDWB 2E7MA 4PJFE 4MQSB 1ZT4B 2A1WH 4QXGL 4YPGA 2P5WA 1S7UB 5I19L 4UV7L 5D2LE 3V0VB 1AXSA 5EUOF 4LDEB 4M93B 2IBZX 4QF1B 1WAAF 4YWGL 2RR3A 3NIDF 5JIKA 5E6ID 3QUZB 32C2B 2YKLH 2Q3AA 3DURA 1RZKL 4X8JA 2CRYA 4LCWD 3LRHA 2Q6WA 5HVFB 1GGUA 3T2PA 5SWZE 5C07E 4MCYB 5C2UB 1MAML 3HNVH 3OKDB 4EDWL 3AS3A 1NH6A 1RULH 4F8TA 4L3EE 4X9BA 5E5RB 5CJXA 2R9HC 1GGCL 3V79C 3L3OA 1F97A 5K9JL 3TT1H 3IDGB 4PJFB 3RX7A 1FZJB 3OZ9L 4PRNA 1TZHB 5EORH 5FF6B 1LGVA 1WGOA 4Y1AE