3HB3D

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hb3D00
4FTVA 4KK5C 1KN2H 2X7LA 5F7UA 5EU7C 5SWSB 2P1YA 5GHWH 3CFBA 2AV7B 3VA2C 5EWIL 4WFFD 1T6VN 2I27N 4WO4C 1REIA 5IESH 4HGMA 1IFHH 3FB5A 2DQFB 4JY6A 3C87A 5D7IA 3L7FB 4OUOA 4HK3N 1UVQB 3TJHC 1F3DJ 3UXFA 3GRWL 2EECA 4HT1L 3MGAA 4NQSB 1IAIL 1GCFA 1YEJL 3MOBH 4O02L 4G7VH 3U0PB 3GMPA 3W11D 1E4WL 5E2VL 4GW4A 4R90H 3SY0B 1ACYH 3K1DA 1WAAF 3NIDE 3WO3B 1LDSA 5I8KL 2HT4C 2EDWA 2EEDA 2J12B 3NZHH 3C08L 4G8GE 1NCTA 1RY7B 4QCIB 5MENB 4MDJA 1CGYA 4IRJB 3BH8A 3IAPA 1FNSH 4BKLA 1MIMH 4JM4L 1AFVH 1F02I 3TCLB 3KYAA 5BMFH 1XF2A 5BO1L 3U2SA 1AO7A 1JHLH 4D3CH 5F3HA 2YN5A 1DANU 3O4LE 3O11A 5D7JC 2Q8AH 4G9FA 4TUKH 1S3KH 1YEHL 3SKOA 2RIKA 3G6JB 1H5BA 1MRDL 5CCKL 5CBEA 1TETL 1FDLH 2LU4A 3F7VB 2VIRB 4JVPA 2N1KA 5EIQA 1GGUA 5IBLD 1N0LA 1QHPA 1JCKA 2IF7A 3VWJB 5C0CD 1FLRH 2HKHH 4YIQB 3DBXA 3QDGA 5BZWB 3U0WH 2EDTA 4NNYB 1U92A 5JMRA 3WXWH 1RUKH 1B2WH 3INUH 5DJ2B 3ZE0F 1FG2A 4XNMA 3MRDA 1T22A 2PO6C 4X6EA 3ZMRA 4JANB 4OF0A 3CLEL 1D5IL 1HH9A 3MRBB 3RX7A 3HE7B 4UIKL 5EDXA 4IRZH 5HD8D 3L5WA 4KRNA 4YBLC 3BUYA 2ATPA 3VFMB 2YZ8A 2AJZB 4HIXH 3GSWB 4XHJD 1S7XA 3O9WC 4PLJC 5LGHL 3STLA 2VKXA 3K80A 3RNQB 5IB1B 1PG7W 4YJZL 4LAQH 1Q8MA 1W72H 3H8NA 4AT6A 2HFEA 12E8H 3A6CL 2QQNH 2W9DL 4L3CB 3RGVB 1ZHBB 3SGDI 4N0UA 1BBDH 3R8QA 3QXVA 3MRLB 3SE9L 5IB3B 5F9OH 5I18H 5FK9B 1YY9C 5IMKA 3LRHA 2IAND 1YEIH 2VXSL 3AM8A 1FVEA 4WHYH 3TJEH 1RZKH 1S9YA 4ZOAA 3S3SA 4X5LA 5EIVA 1S9WA 5J6HB 1CK0L 5EZOL 4HJGA 2QHLA 4NNXA 4RISH 2CRYA 1UWEH 2NYYD 1YQVH 2AJ3B 5DD3H 3VD7A 2YWYA 4XMLL 4WVRA 1ZHNB 2E8YA 5GSVB 4QHKJ 2R29H 4MJIE 4EQ2A 4AH2B 5C0FB 1BQHB 4GAYA 1XH3A 1ZA3A 4HGKC 4POUB 3STZB 3FN0H 4LASL 3KYNA 1ETZA 2ATKA 5IHBA 5GJSL 2I07B 2OQJA 5FA4A 5C0EA 1S7WA 4Q6IC 3RNKB 1NAMB 2RAMA 1IM3B 4YEFA 1A7OL 4KDTA 1Z9LA 2YN3A 3KXFE 4JDTL 3IRZA 2DM2A 2R8SL 3QUXB 2XTJC 3BH9A 4O4YH 3D39B 5A3IC 5FFLA 1NBQA 1VACA 3QWQB 3S97C 3UDWC 4PGJA 2QQQA 3IGAA 3MRGB 4YHOH 1NAKH 3N50A 4PV9B 2W0LA 2W0KA 5FYLD 2HN7B 3WKNA 3ULUL 3MZTA 1IBGL 3V79C 2FGWH 2JF1A 3BP5B 1DDHB 43C9A 2QR0A 2HFTA 2B4CL 5DJXB 4KMLB 5K9JL 1ZWIB 4O5LL 5EZIL 2ARJA 2UZIH 4ZFOB 3NFPA 4BQ8A 1IKNA 1U6AL 3W5MA 4P2OD 4LNVA 2HG5B 3W81A 4LDEB 5DTFB 1A5FH 3ZKMC 2E7MA 1U2HA 1JZ7A 3HC3L 3HZKB 3BN9C 3CH1A 2ARWA 2PW1B 1IRAY 2GK0B 5TDOB 1WICA 3JV0A 5DXWA 4U6VL 4R4FL 1IKFL 2BFVH 2NY5H 3MLUH 3MGTA 4K8RD 3RKDC 1WGOA 1W0VB 3NCJH 3BPOB 2AK1H 1A6UH 2A6KA 3ZKSD 1E4XL 2MWCA 1T5XB 4PD4J 3FQXA 4XXCA 1BHGA 2F74B 4R0LC 5EBWB 3I6LD 3MA7B 3ZDXF 2R56L 5F7WC 3WIFA 3UC0L 4XCFH 3QO1B 3C2AL 4PJHA 1U3HB 1LK2B 5HGBA 2EDKA 3WFHB 2H2SC 5KVGH 3JTTA 3V4PH 1G9EA 1E6JH 4UMGA 1DVFC 2NY1C 4G8EB 1ZGLP 3CCHB 3HG1B 1KB9K 4I2XE 2A77H 5CZKA 3SDXB 4JFQB 1NFDE 1D9KD 3ARED 5HYQA 3D25A 2LTQC 2VL5A 2EKJA 2VXUL 5KVDH 1Z9OA 4JR9L 4E41A 5CZXC 5FGCE 4EEEA 2EIZA 3QDJA 5I17B 5IFJA 1DUZA 3D85D 2NTSP 2VZVA 5BJTB 4UINH 4KJPD 2WNGA 5IT2L 5EU7E 2QADB 2D7PA 1I1FA 1T1ZA 3MRNA 2EIDA 3I6KB 1KN2L 3TC9A 4YDKH 3OGCA 4JQXC 4X8JA 2OR7A 3BWAA 3IDGA 4JHWH 4H26A 4LVEA 4PGZA 5JHDD 1TCRA 1CDUA 1ZANH 2HYMA 4UV4H 4JB9H 5DVMA 3CZFA 4OFDA 5GGTA 4P99A 1WIPA 1FORL 4WW1B 3KLHC 3HNSH 4NQEE 1S7VB 3UJTL 3MUGB 2CDFA 4XPHH 3FTGB 3WS6A 3QQ4B 1MHCA 1MQ8A 3H0TB 1HHIA 1FE8H 1OB1A 1KXTB 3NIDF 1T66D 4JFPB 3HB3D 2ED8A 1A7PL 2YOCA 3MO1B 3QT2A 1EO8H 4OKVA 5EG6C 2B5IC 1QUNA 2D7QA 4XHQA 1AGFA 3CSYB 4PJFF 3K81A 1ACYL 2R2BA 3SDAB 4Y16D 3M45A 5DRXA 2V7NA 3ARDD 4Y4HD 5ISZD 4L5FL 1EGJH 1Q0YH 3E2HC 3QHZL 3OGOE 4PPTA 5IP4A 4ESKA 4L1DA 4CKVX 3VDBA 3O41A 3QFDB 4MAYB 3U0TA 4L9DA 4LSPL 2CD0A 1F3JB 4ZO8A 4KV5E 1IQWH 4G42A 3SDYH 1IM9B 1JUFB 3RWEB 1AD9B 2H41A 1YEKL 2ICEA 3BIKA 5I9QB 4M6MH 3MFGB 2X89A 3HNTL 4MNGA 4DGYL 1FP5A 4RWYL 4M6NL 4JO4L 3TZVC 2V2XB 3AREA 3D0LA 4X9IA 4WTZA 4ERSL 4P9MH 3ZT5A 3L7EB 5K59F 1K2DA 5I73C 5FEBA 2VLLA 4QXWA 4NKQB 4Z7VB 4IRSA 5F7LB 2VLRA 4QOKE 3LAFA 4FFZL 1CIDA 4HFUH 1CT8A 1YDPA 3LKPA 5C2BL 3R06A 2NLJB 3ARPA 5I19H 5CJ5A 3VXQA 5DGRA 2FO1A 3CVIH 3HR6A 3T0ED 3TO2B 1GVIA 3BZEB 3MODL 1JF1A 2UUDH 2YD1A 1JZ2A 2QL1A 3D18B 3RQ3A 1EMTH 1KCKA 5IWLA 5HHQA 4KUZH 1ES0B 4QHUB 3MGOA 5E70A 1WJ3A 2NY3D 1ONQA 4IOIB 1KUMA 4LSVL 1A7BA 4KQ3L 1RUMH 1EGJA 3N1GC 3H3BC 3CFCH 3BE1L 3NCFB 1TVBB 3V7AG 4HK3J 4GBXC 4D0CB 4WGVB 3O45A 3GJFB 4WUUA 1PLGH 2WLYA 4PP2A 3GKWL 2AK4B 4Y4HA 4LVOB 1X5IA 4X6FB 2D4DA 12E8L 3IS1X 1SBSH 5DC9B 1BBDL 2ID5A 1D5XA 3BGFB 5DO2C 3T09A 1LP9A 4F2MA 4YHZL 3C60D 2XG4A 3GIVB 5T5FL 2BOBB 2F54B 5D6CB 5DJ8B 4N0CC 4X6CF 1NGPH 4GQPH 3IFNL 4OD2B 4YPJA 1UWXK 4RMSA 3QH3A 4C56A 2HVKB 1UJ3B 3DO7A 4QF1B 4JM2D 25C8H 3WDIA 4L8DB 3IRPX 4QYOA 1OAYH 4OI7A 5HHNA 5F9WB 1LE9B 3GK8L 5F6HJ 4KZDH 3O2WL 3VG0L 4LLAA 4DK3A 4L9LA 3B2VH 3EO9L 5SWSA 2AV7A 4LEOA 1KEMH 2C4FT 5HXMA 3VGBA 2C3XA 3S37L 5BVPH 4ISVB 2DQFA 1HZHH 1PKOA 6FABH 4WU5B 5DJ6B 3L7FA 1UVQA 2MPAH 1CIUA 3R1GH 5I76B 2YZ1A 1AGCB 5AD0A 2FEDC 4PG9B 4ONGL 3KJ6H 5DLMH 3L1OL 2C1OB 3U0PA 4QRRD 1KXVC 3KPMB 5F71A 5IBUG 4ZNCD 3CVHB 5C0ND 3ROOB 3SY0A 3N1QC 1EHLL 5IBTL 4HULB 5C0IB 3B5TA 1XGYL 5KSVB 4PJCA 4QHNA 4QCIA 5MENA 1CL7H 4IRJA 5GPRA 4ODXB 1EJOH 4QXGH 1BM3H 3TCLA 2ZCHL 4Z95H 1SM3H 4JFZL 3QUKB 4PJEA 1JGDB 5FYLL 5IQ7H 3ZTNL 2IQAB 1V05A 5JXEC 5C6TL 2UZIL 5J3HC 3JV6B 2R0KH 1TQBC 1KC5L 2XNAA 4TRPH 4DAGL 2R69L 5B4MD 4JM2A 5HHXH 4FQIH 1N3NB 1CD0A 5GZOC 3F7VA 5JOPE 2CDGB 5F8QC 3VWJA 4PRIB 4NQDE 4JAMB 2J4WL 3WFZA 2NXZD 5BZWA 5GGTL 4XNQB 4PV8B 3PJSB 5FM5M 1X3DA 2CRMA 2NY5L 3O81A 3KPPA 2WIIB 1PKQE 4M7KL 2VXVL 4KTEH 1WEJL 2PCPA 4NC0B 4JANA 5FM5O 2Y9RT 3WLBA 5A40E 3LN5B 3FT4B 2E7CA 4YK4C 3PWPE 3HE7A 4XMPH 3ULUE 1MFBL 4CJ1A 4JN1L 1TJIL 4BFBD 1HHGA 2NY2B 2DTSA 4WI4A 4C83B 5GIRA 3VFMA 4ZFFB 1MY5A 5EUOB 3E3QE 4FQCL 3WFDL 1DBKH 3GSWA 3RI5F 1UC6A 3P30L 4RDQG 4PLKD 1DQLL 4QRRA 2WQRA 3HE6B 3C5JB 5IB1A 3TNMB 3MRQB 4RMRA 5E4EB 4KROB 3TN0B 1QA9B 2YKLL 4KKBD 1NMAH 5B8CC 4NRYB 5KS9E 4CN4A 3KGRA 1T03L 4L3CA 5EZLB 3RGVA 2L7UA 1YNLL 4DZBA 1WFTA 3MRLA 5IB3A 4FTVE 1B4RA 1FC1A 1ZV5A 4XC3L 5KVDL 1I7UA 3RIAK 4MHHI 3JWDL 3W9EA 3LKRB 2NQCA 2PXYD 1CLYL 2JJTC 3BPNC 2FBJL 1A2YB 2ITDB 3ZSSA 3V0AC 2HWZL 3DSNA 5D7IE 3ZTJG 1NCWH 4DQOL 3KPQB 5J6HA 2EDNA 4YXHH 1YJDH 2VLME 2AJSH 2XWBA 4YLQT 2H8PB 1IC7H 3TO4D 5HI3D 5GRUL 4K3HA 3I9GL 5CS7A 3VFVB 1ZHNA 5GSVA 5LJYH 4JO2L 2H1PH 4XI5C 4Z7WF 5E6ID 1NSNL 1FE8L 4JFED 1BF2A 4AH2A 1QFPA 5C0FA 1BQHA 2Y5TA 5TGBB 3D87B 3STZA 1PZ5B 2A6IB 1HQRA 1OAXL 1FFRA 2ILLA 4WO4D 2I07A 1JGEB 4LGPB 1MAML 4KV5F 3RNKA 1CFVH 2AJUL 4Z5RB 2V9RA 5CHNA 1AO7E 4CMHC 1IM3A 3KWWB 5CD3B 1MJUL 3SO5A 4HJJL 4G9FE 3OWEA 3AS0A 1KLGB 3QUXA 3TJHD 2ZJSH 4HGWA 1NGWA 3D39A 3MR9A 1OM3L 3SBWA 4Z7OE 4ZFZB 1NL0L 3RWDB 3R4DA 1ZT7B 3SDYL 4UQ3A 5C0BB 4PV9A 5F9JA 2XTLA 2PNDA 1AXTH 2YUXA 3MRPB 5JA8B 4ZSOA 1A0QH 3QDGE 4IRSC 1I1RA 3HMWL 2HT4D 4K94H 4WFFE 4MB4A 3EO0B 3WV0A 4EOWH 5AUMB 5IM7B 2R4RH 4YO0B 4NN5C 2FGZA 5DHVB 3PDGA 5HDOA 4DZ8B 4ZFOA 1AQKL 4NKMB 4M1CC 4P3CH 2BERA 1QKZL 1HKLL 2EH7H 1J5OH 2NY4B 2YK1L 5IWLC 3QXDB 5D7JD 2HG5A 2DKSA 3TO4A 4RGMB 2VUOA 2OI9B 2VERN 1YNKH 3HZKA 4AMKH 2YA1A 2ORBH 2PW1A 2GK0A 2C1PA 3CZJA 1MHPH 2IH1A 5DMJB 4KVCL 5E6IA 1J1XL 3QSKB 5E56A 1W0VA 4FN0A 2WSKA 2FH6A 1DBJL 1JNJA 4JPKH 4HS6A 3WO4B 5FYKD 2VDRH 3RL1A 3C9NB 1T5XA 4MNQD 5IB2A 1JGLH 2PO6D 3AS3A 1J1OL 1ZTXH 2F74A 5EBWA 3MA7A 4OQ1A 4JDZB 1RK1A 4KKAC 5EORL 5L6YL 2ZSWA 1U3HA 4XB7A 5ALBL 2GITB 5JIHA 3FN9A 2H45A 2XWTA 1WZ1L 1QZ1A 4G8EA 2XZAL 2VQTA 3CCHA 3HG1A 2X4SB 4OCYL 1DSFH 3SDXA 5J9PB 4X99B 4JFQA 1ZLVH 3OV6A 2VXTH 5FKPA 5C0CE 1YMMD 1JPFB 3HN3A 1N8ZA 25C8L 4OM1L 3RU8H 1FZKA 4N1CA 5E8OB 3UZQA 4C57C 3A67L 1OAYL 3NA9H 2Y36H 2JIXD 5FIEA 1NMBH 4KJQC 4NZRH 4KZDL 1C5BH 5BJTA 3ARUA 4RNRB 3NFSH 3CXHK 4RMUA 5FM4A 3G5ZA 7FABL 4LSQH 1A3RL 3VWKB 1DTUA 5IBUB 2BCKB 1NLBH 3F65A 1LEGB 4DK6A 3VJ6B 4CW1B 1SMOA 3WNPA 1G1CA 1WCBB 2VWEC 2EXYC 3GEWB 2X6MA 3AMLA 5DT1L 1JK8A 1IARB 4XP9L 2YUVA 3FTGA 4KGLA 5FHAL 2X70A 3QQ4A 3H0TA 3R1GL 4G80A 4D0BA 4XBEL 4JFPA 2C3WA 2MQ3A 4K3GA 1RAMA 4POZD 3NN8B 3MO1A 3EBAA 3QWOB 2CUHA 3MV9B 4JCLA 3QDHA 3WNMA 4NQCB 4OFYD 1INEH 5A2LH 1PBYA 2AKRB 2B1AH 1UA6L 2J1KA 3UJJL 5HHOB 1G7LA 4IRJC 2F5BH 3V95A 3PGCB 4PJAB 1T4KB 3LRSA 4DJMA 3HI6H 5KZCD 1A6AB 3EFFB 3L5XH 1UFUA 3IU3B 3QFDA 4PREB 2OXHA 2FHBA 3BMWA 4MAYA 4WUKL 5TE7H 4ELMF 3GJFH 5ICZB 4OZGB 4D8PA 1F3JA 4RIRB 1DEDA 5FB8A 1IC1A 1OLZA 1IM9A 1JUFA 4RA0C 5H35B 4NM8L 2IAMD 3RWEA 4BK5A 2ERJB 2ZKHH 1G7JB 5A3ID 3THML 5L8LB 4YHIA 5F7HA 1P4IH 4PYHA 1SQ2N 2P5ED 2DAVA 4XMKL 2V2XA 5C08D 3VWJC 1RURL 2CLVB 3L7EA 3QIWB 3QEGH 3NPSC 1EHAA 1AGBB 1I8KB 2JIXA 1XIWB 3QUZB 3PWJB 4HJ0C 4N0RA 4Z7VA 5I30H 5F96L 4LL9A 3W39B 3AB0B 3S88L 3BT2H 3DARA 4U1HB 1FFPB 4QGTA 1IC5H 2ZUTA 3MCLH 4MA1C 1X5YA 4PRHB 2E9JA 3TV3H 3BDYH 3MRKB 2DQJH 4R4NC 3ARSA 4QHUA 5D93C 3PUCA 4IOIA 4HPYL 1GIGH 1GAFH 4KHXL 5KS9F 3FFDA 3HR5B 5I1KH 1I3VA 2E7BA 4M7JH 1F3RB 3S3PA 2W60B 5E7FA 3RVXC 1TVBA 3IDNB 3QYCA 1F8TL 4HLJA 1FVDB 4D0CA 4ODBD 1MRCH 3L3DB 3RGVC 2AQ3A 3LVEA 4OD1H 4MA7L 3RKDD 4E41E 4NC2B 2V17H 5F97E 2AK4A 5ECJE 5JMOC 4EKXA 4WCYL 3RZWA 4JLRB 4RGNB 3Q6GH 4ODHL 1Z3GL 5D70L 2WIMA 3CVHH 1I9EA 4AY0A 1OP5K 2JJVA 3BW9A 3MUY1 5HVFB 3Q5TA 3GIVA 4X7DC 5TQ2H 2BOBA 4ZO9A 3BRDA 1RIUH 2F54A 3L3OB 2FDBP 3LPWA 2VN4A 5D6CA 3S36L 4R7NB 5DJ8A 2IAMA 1LE5B 1HHHA 4OD2A 4U49A 4FQXD 3TA3D 2HVKA 1MF2L 1UJ3A 3OMZA 4QF1A 2Q87A 3RHWK 5C08A 1G1YA 5KSAB 4L8DA 1VFMA 1U8MA 3LKSB 3S96B 4KI5D 1CE1L 1MAKA 2FX7L 2PF6A 2VDQL 1RUPL 4KK8C 2VZTA 2AJVH 4P2QB 5KANG 4OGAC 5BOZG 2RJMA 5CZXD 4PRAA 2BNRB 1Q9KA 2Q8BL 2WUCL 4TUOB 4H88L 4Y8AA 3TBTB 1PG7X 1QNZL 4X5XA 5T33L 1YPZB 1UM6L 2VSCA 4ISVA 3FQRA 4LSUL 4NDMA 4XNZC 2I5YH 1D5MB 3O6KL 1JWMB 5DJ6A 3PNWA 1DBML 3I6LE 5EB9A 5EFIA 4TYUA 4TULL 4PJXF 2XKNB 4KTDL 4IMKA 3QUXC 4WY7H 3QFJD 3NIFE 4WV1A 1KJ3H 3KLHD 1AGCA 3N1PC 4MYWB 2IADB 3VFGL 5IB5A 4QRPB 4PG9A 2PTTB 1OF2B 5C0JB 1QYGL 3ZDYF 4XNXH 3OAUH 5FKAB 4XPGH 4XX1G 5F7FA 1N7MH 4OI8A 3ARWA 1NCDH 3PDOA 5F21B 1E4JA 5C0IA 4PB0L 4X98A 5KSVA 1YJDC 1CG9B 4OLUH 3O0RL 2VLRE 2R39A 4ODXA 2DQUH 4NHCH 4OFIA 1G7PA 3T65B 1TTUA 3RUGF 4XPFL 1TPXB 5ID1A 3QUKA 1JN6B 1JGDA 4ODSH 2IQAA 5C0DA 4G5ZH 5EU4B 4FMFA 4ODTH 4A2MA 3U6RB 2FX8L 5IVZB 5IROA 1MCPL 3ULSB 3AC0A 3JV6A 4FQXA 3TA3A 5DMKB 3U9PH 1KIQA 4HD9A 1LD9B 1VEOA 3WXVH 1N3NA 3L6FB 4PTUA 2VITB 4LCWD 2ORBL 4JAMA 3BPOC 4FNLH 1OP9A 1IEBA 2DIBA 4XNQA 5DJYA 3PJSA 1IGMH 1MFAH 3IF1A 2WIIA 5GS2H 3QUML 1PGRB 2RFXB 3MMEB 4LIQH 4ODVH 3P73B 4NFBA 3BP7B 4IHOB 4YGVA 3IDMB 1JPTL 5F1IA 1HHJA 1LP9E 1GPOL 4JY5L 1CICB 1BOGB 5I15H 4X4MA 2FBOJ 2DYPB 5LWYL 4HQQH 4OKDA 4C83A 1I8IB 4M1DL 4K94C 3C5JA 5ITFB 3TNMA 3V6BR 4ZNEA 2E7LA 3KPRB 2BZDA 5GZND 1QA9A 5IEHB 3MLRL 3HUJB 4DFHA 4NRYA 1OTUD 1M7IA 1FFQA 4EDWH 2W65A 5EZLA 3BP6B 5HVWA 1MCCA 2QADC 5SWSE 1G84A 4YUEL 1DP0A 3TEUA 2BNQD 1FN4A 3LKRA 4JRXB 1UZ6E 3QDMB 2YRPA 1NMBL 1A2YA 4XP6L 2Y4SA 4FQ1H 4H20L 3T0EE 3ZO0A 4GXVL 1UB6A 3NABH 3V0WH 4LLWB 4EI6A 1AD0B 1CZ8L 1GGBL 1ZLUH 1QLEH 3X13B 1RIVL 4LSQL 4UTAL 4G3YH 3TBSB 4GMSH 4DKFH 2XQYG 4OSUL 2X1WL 4U6XB 3K4DA 1UT9A 4N0CD 3BFOA 3T2PA 3V9FA 4Y1AB 2YEZB 2FEEI 5DHVH 3C8KA 1FYTB 3VFPB 4OGXL 5JW4M 1MNUH 2BSRA 3WIIL 1EO5A 1T7XA 2DQEL 3SDAC 2D31B 1N59B 5TGBA 1PZ5A 3OKOB 2A6IA 4WHTB 4PJCE 5MENE 3T0XA 4PY8J 3P4OB 4L8BB 1MFCL 2Q3AA 2XFXB 4IIQA 4RFEB 1JGEA 3AU1B 2YMXL 1Q9LB 1ZEAH 3KWWA 4X7TB 2BMKB 4PJEE 5CD3A 4OZIB 2BXYA 4M1GL 1KELH 2VDPH 2GY7B 4PJ9D 3PGFH 3L5XL 1U58B 4GKZB 5C9JB 3EYUL 5I9QC 2J8HA 4Y5YB 1VPOH 4RAUA 2JB5L 4YEEA 1T0NA 3SKJH 2FD6L 4ZFZA 3EYSL 5AG9A 4J3TA 4QHKI 4R2GD 5E94A 1KJMA 4NZTL 5C0BA 4ENED 4TNVF 4G6FB 2R9HD 3X12B 3WHE0 3MBXH 1P4IL 3LKOB 4I3RL 4PRPB 3I85A 4L4TB 1C5CL 1KLUA 2ADFL 3MNWB 1C7SA 4MJ6B 2CR6A 3O8XB 1BEYH 3LPFA 1DBAL 3DYPA 1IGYB 3TFKD 5AUMA 1QD0A 5LGJB 5E00B 5IM7A 1UZ8A 2V5TA 3H7BA 4YO0A 1E4KA 5DHVA 1F4YL 4PJHF 3RWJA 4KVNH 2JELL 3QUYB 5GRVL 2ADJA 1EEUA 4NKMA 2NTFA 2GK2A 3UAJD 5BZDB 1A7QL 1RZIA 3QI9C 3QIBD 1G9MH 4DVRH 3QXDA 4JFFD 2XA3A 5JXED 2DQCL 2ZCKH 3QXAB 1VGEL 5T3XH 4EIZC 2F53B 4DCQB 5J3HD 1MCIA 3K7UA 4TSBH 4PJBB 4JFDD 2IFFL 4QRRE 3BDYL 1S7SB 3O3UN 2DQJL 4AENB 5LCVH 5DD5H 1CTNA 4OF7A 1S78D 4I18A 1XF1A 2OSLA 1HEZA 4KK9D 1M7DA 1G7IB 1PX4A 5BXFA 4XPAH 3C9NA 1FFNB 2F19L 4XPBL 2MMXA 1XGPB 2Z8RA 3KHOA 1OTTC 4S1QH 5FYKU 2ZCLL 2VC2H 4HS8H 1ZSDB 1PQZB 4P5MB 4JDZA 3QPQD 5JIIA 2ZG2A 2UVEA 4M02A 1P9MA 4PJ9A 1HN1A 2NX5B 4JO1L 2W59A 4LSRL 4N5UA 4BSVB 5I66B 1RIUL 4S1RH 4N8VG 4WEBL 1IMHC 2X4SA 5GRJL 1NBVH 2APXA 5IEKB 2IMMA 5J9PA 1B6DA 3WD5L 3WKMH 3UTZB 4YWGH 5BRZB 3ZKQD 2VH5H 4F7CB 3J8F7 3QRGH 3LEYL 1JPFA 1TXKA 2CIKA 1P7QD 1HXMB 1ZT4B 2E6QA 1GOGA 5E8OA 4HAGA 4YZFF 4UBDD 1AJ7L 2EDJA 5HTSA 4YQXL 2EYTB 1AE6L 2DWEB 1A3LL 4F80A 2Z35B 3ZSTA 1FGVL 3CFKA 1S7TB 2BCKA 4P46B 4K9EL 3VU2A 1LEGA 4Y4KD 2Z31B 1MWAL 1WCBA 4JFFA 1L9MA 4HHAB 1D6VL 3DX7A 3EUUA 1XT5A 2FO4A 5MI0B 5LQBL 3MRMA 3NN8A 2PR4H 3OXSB 1CLZL 2JK5B 3QWOA 4YR6B 2VN7A 1NC4A 4GRLB 3D9AL 4NQCA 4XWOC 4ZSOE 3OAUL 4LF3B 5CZVH 1CGSH 5HGGS 3U7YL 4OGZA 3PGCA 3CSBA 4TSAL 1T4KA 5L2KD 5ALCL 3S35H 1VCAA 5E2UH 5EBMB 4MS8C 1EH9A 1A6AA 1NMCC 1R24B 1F3DH 3EFFA 3G9VA 3ZTJH 4PREA 5CJXA 1VEPA 2ZUYA 2A1WH 3QA3A 4RIRA 1YYMH 5D1QD 4XVUC 4JFHE 3FCTB 2XZCH 5H35A 2VDNL 1LEKB 3KPSD 4YXLH 1XCTB 1YEEH 3Q1SH 3JBG7 1B0GB 5L88L 1G7JA 3RI5K 5IG7B 3DMMC 1C12A 5D7LD 4UNVA 3IFLL 1KT2B 1K9TA 5KG9A 3IKKA 4WFHD 4X4YB 5I1AB 4GW5B 2CLVA 3QIWA 1A7NH 1GGIL 2E9IA 3MLTA 3LKQB 4F7EB 1RZ8B 2BHYA 3AFLA 3DVNA 5BV7C 2EDHA 4PLOB 5F89B 4GG6A 1I8KA 4DTGH 1XIWA 3QUZA 3RPKA 2EO1A 4O9HH 1KB5L 5FECA 2KUTA 4AIOA 4U1HA 4H5SA 4OCRL 1FFPA 4AJ0A 3FFCB 4Y5XC 5KSBF 1E6OL 4XCCL 2A83B 2NY2C 3E8UH 2VNCA 4M6OH 4LCCB 5K9OB 5AZ2H 1HYSD 3MRKA 2MTPA 3ECBB 2MCG1 4OLYL 3HE6C 4HKBB 3WFEL 4LARH 4Y2DB 3OTTA 2BRRH 5E4EC 3IAQA 5L7XH 3HG1E 3TN0C 4KPHL 1BJ1H 1I1AD 5B3JE 3IDNA 3SDXE 3FL7A 4PJ5B 4YHLL 1FVDA 2A74B 4FFYH 5IB4A 3HZYB 1F2XK 4NO0B 5T1KD 1MCEA 3GMMB 2LFGA 1P53A 3ESVF 2W9EL 5L2KA 3V5DB 1RZ7L 5IV2B 3BIAX 4AIXA 3VW3H 3GSQB 2VXQH 1QBLL 3KYOB 2VMFA 3IFPB 3GM8A 2YUZA 1NEZA 5FA3B 2EKSB 5D1QA 3D69B 4KKLD 4Z0XB 5JLZB 2CGRH 2FECI 3MROB 5CIPB 3VFSB 3O2VL 1LE5A 2ED9A 2VSDA 5E8PB 1LHZA 4F3FB 2DM7A 4A6YB 2ICWB 5J13C 2DLGA 2UWEA 3WFCH 1T1XA 5KSAA 4GMSL 1CD9B 1P84K 1KEGH 3LKSA 1CF8L 3S96A 4RWHA 1VKXA 1NCCL 4N5ED 3CNKA 4LHQB 4LAJH 2CRZA 2Z93B 4U1SA 5T3ZD 2V7HB 4UNTA 2BNRA 1YN6B 1YMHB 4TUOA 4BK4A 2DDQL 2DQDL 5JPMB 1A22B 2CKNA 3T3MF 4MDIB 1T04B 2M1KA 4I0PD 2AW2A 1D5MA 2HLFD 3SDCB 4B53A 4RMVA 4R6UA 5FYJU 3G6JF 5JOFA 2XKNA 4QXUH 5BOPA 4HC1H 5I8OH 3X3FL 1G9NH 3M17B 4QRPA 2PTTA 3LDBB 3CXHJ 3U4BH 1PSKL 4GKNB 5C0JA 1RIHL 4O58H 2AJYL 1BVKB 3MOAH 1I1AA 4HEPG 5F6HI 1L6XA 5I0ZA 1RZFH 3W2DL 3IXTB 5DK3A 5T1KA 1WFOA 1LO4L 1ZLSH 4ZTPH 3VFOB 5F7NC 5EU6D 4Z7VE 1IT9L 2ITCB 1V7NH 3LQAL 5EZJB 2CK0L 4WW2B 1IAOB 3H42L 4LCIH 4MD5A 3T65A 2VL4A 1BEYL 4RA3A 1JN6A 1DEEB 1TQCB 2NY4C 3U6RA 3EGSB 5IVZA 1QRNB 3GUTB 4FXGB 3ULSA 1AH1A 4RGMC 5DMKA 4DGVL 4TSCL 4LLYB 5DEZA 1GOFA 1LD9A 2DI9A 5DMGD 4ZAKD 3LS4H 1RHHA 3L6FA 4WHDA 2VITA 3QISA 4N9GB 3IB4A 1LILA 4RFOH 2OK0L 3O2DH 3WO4C 3W0WB 1DL7H 5LCVL 4ZXBD 1Y0LB 2CO6B 1YN7B 2CJUL 5IIEB 4HC1A 2RFXA 3MMEA 2C4FU 5M7QA 3BZDA 1CLCA 3P73A 4I0PA 4N8VB 3BP7A 1P69B 4IHOA 3IDMA 4Y19B 5KAQF 3EOAB 4XNUL 5IK3B 4HIIB 5JO5A 2KBGA 5DD1H 2DYPA 1EPFA 4ZOCA 1A9EB 2F54E 4YX2H 2HJKA 4C4KT 2J88H 4Q9RL 4Q6YA 5KSUA 1BFVL 1DQJB 5ITFA 2DTML 1IGFH 5C08E 1TITA 1F4WH 4HBCH 3EHBD 1UWGH 4YDLB 3CUPB 4POYA 4NUGH 3ARZA 1FNGA 4K7PH 2IH3B 2Q7YA 3P4NB 1NFIB 3UTTD 5JUEH 3GB7B 4LMQI 3BP6A 2P48B 2NW2A 4HFWA 4HSQA 4WI8A 1PEWA 3O6MH 4JRXA 3MLXL 3VWKC 1T5WA 3EYQC 1Q9OB 3NTCH 4R7DA 5C0AD 1UYWL 5MHSE 2R23A 1K3ZA 5JW4R 5KTEH 3X13A 4CRPA 1S8DB 4WDIB 1TVHA 5E2WL 4GLRI 1AXSB 1DZBA 4ZAKA 4PJ7A 2YEZA 1AKJB 5D6DA 3GSOB 3WFBH 3FRUB 1R5IB 1C8PA 4P4RB 3MLWH 5FCUH 4DGIH 5J12B 2EE2A 2A9MH 4PBWD 1A6WL 2FB4L 4ZXBA 4LNRB 5DMIH 2D31A 3OKOA 4WHTA 1IGIH 1C5DB 3EYVA 4OGAD 2IC2A 4P57A 5HDBF 4OJFH 3P4OA 4L8BA 2FYYB 1MFNA 4RFEA 1JZ4A 1HHKB 3O4LB 2ADGB 4E42B 2LV4A 1M1SA 3ZYOA 4X7TA 4OZIA 2BMKA 5E2UL 1WWWX 4LPXA 1K8IB 3DETC 2M26A 3VI4F 2DQIH 2Z8VC 4Y5YA 1NUNB 1X6LA 1F11B 2A1WL 3RJQB 2O5ZL 3BKJH 4C4KO 3GSNB 3IJYB 1INDH 2WK2A 3F58H 3QIWC 5HHPB 3X12A 4KI5E 4RBPK 3G5VB 5EO1B 1XIWC 1GHFH 1N5AB 1CGUA 3MNWA 4Z7NE 3O8XA 5EPMB 3AB0C 3HMXA 3ORJA 4K23H 4XCEA 4LLDA 5F93C 1FL3A 2YWZA 4M9PA 1A4JB 3K1KC 2OZ4H 3FRPG 4ZD3H 3DVFA 2P8PB 1DANT 1KENL 2IPUK 5CWSB 5C0AA 3QUYA 1KCUH 1CFNB 5BZDA 2XT1B 3FONB 2MFNA 3PV7A 2XI9A 4X4ME 4M61A 1H3WM 3QFJE 4R8WL 2GTZA 3CDFA 3QXAA 4S1DC 1N5YL 1FZOB 2MHAB 4P9HL 3AS2A 4AENA 3PQYD 2VZUA 4ZNEE 3FO0L 3X14A 1TCMA 4Y5VA 5E1AB 4EN3D 2BOCB 2UY6A 5K9KA 1U8OA 1W0WB 2F8OA 5DR5H 2EDDA 1G7IA 2WZPD 1DQDH 5DMYA 2O5YL 4NKIH 5ADOH 4NIKB 3PABB 4RGNC 4FFYL 5E9DD 3DRTB 2ZPKL 1FFNA 4RMWA 3MSPA 2VLKB 2NNAA 1RK0B 3P4LA 4TQEH 4I1NB 2Y06H 3REWB 1ZSDA 4F37K 1PQZA 4P5MA 4F57H 3CX5K 3C5ZB 5CUSH 4F33B 3ZLQC 4OLZH 1PX3A 1HNFA 4LQFH 4ETQB 4LSSL 4R4BB 5TE4H 4APQB 4FABH 5I66A 3EDFA 2WBKA 5KSAC 3V6ZA 4V2BA 5D2LB 5IEKA 4MJIB 5IKCA 1EV2E 4KJYA 3UTZA 2BP3A 5BRZA 2OZ4A 1PG7L 4LDLB 1HXMA 3G5YB 5SWZA 4HX1B 4LKXB 3U9UB 4OZFA 3QR2A 5I1GH 3ZL4H 3MLYL 1MCWW 2EYTA 2VYRE 3LB6C 4M93B 2DWEA 4MVBC 1BJMA 5I1DB 3KXFB 4MB5A 5T1DL 2WWKT 5EO0B 2SEBA 4P46A 4TVPH 4KK6C 4CVWA 1QVOB 1N6QH 1K8DB 3SO3B 2BDNL 1K6QH 2X1PA 3ZE1F 3LRGA 2XPGA 4UOW0 1RQ5A 5T3ZL 5J57B 2XV6B 4CVXA 1KCVH 3PQYA 4ONFH 2VR5A 5ENWB 2WUBH 3HPLB 5C0BE 3OXSA 4Z77A 4EN3A 1CGTA 4YR6A 3TBVA 4GRLA 3OB0H 4NM4H 4JO3L 5C0GB 1W2KT 5D7SL 1PD6A 4X4XB 4E0RB 3SPVB 4G6JL 1P4BL 1Z0MA 4FFVD 4NJAH 4YDVB 1ZLSL 2BNQE 4IDJL 3UZVB 3B9KB 1FRGH 2YRLA 5EBMA 1TPXC 2XICA 3RTQD 1YEFL 3F6IA 3PWNB 1R24A 2BJML 5HGHB 1A14H 1FLTX 3QEHB 2DLTA 3V7AE 3U7WL 1U93B 4TTDC 1UQSB 1V7MH 5CJOL 3FCTA 3OJVC 3NACL 4PRNB 1MJJB 1LEKA 4Q2ZB 3SGJC 1B0GA 4HEME 3UYOD 4GSDL 1SJVA 4TPRH 3FB6B 1KT2A 5I1IH 1C08B 4X4YA 5I1AA 4GW5A 5CIPH 2DIAA 1RZ8A 3H9SD 4A6YH 1KG0B 4X6BA 4X6DB 3IJSB 4XC1L 1JP5A 5D72L 3ARBD 1XR8A 4HKZB 4Z76B 2OL3B 1G9NC 1SJHB 2Y1VA 5DZNA 1P5UA 1EZVY 3L3IB 3N85L 3NH7H 4FZEL 4WNQB 3CJJA 3FFCA 3P0GB 4HAFA 4J6RH 2R2HA 1CICC 2JB6B 4OD3H 1FZJB 3FQUB 5T1MA 1XGTA 4PJ8B 1OSPL 4K3DH 1GZPB 5F1OB 1H3PL 3DHJA 5K9OA 5HVHB 3QI9D 2C3VB 4AL8H 4G6KL 4HKBA 1T3FB 4I2XB 3VXMB 4Y2DA 3OKLB 3VH8G 1NFDB 4HUXB 1J0YA 1HOCB 3BEVB 2Q7NA 3RA7H 4P23B 4OTXH 2ZZUT 4M43H 4PJ5A 5FGCB 3BO8B 2A74A 1YECH 4ZFGH 1B0RB 3HZYA 1OVZA 4NO0A 4AM0B 5F1KC 3GMMA 3S5LA 1HCFX 5IV2A 2NY0B 3CH8A 1DBBH 4PGCB 1GXEA 2APBA 1OARL 3RTQA 1DCLA 5ANMB 4D0DB 5T3XE 2A0LD 4YHMH 3L95B 2FJGB 3CLFH 3OG4B 4LRNL 4ACPA 2E9WA 4NQEB 1YEGL 2VDLL 5FA3A 2FATH 2JCCF 3D69A 5JLZA 2ZWLT 3MROA 5CIPA 3VFSA 4ZO6A 4JFFE 5E8PA 2PYEA 5I1JH 5JPNB 3GHBH 5JZ7D 3QCVL 2J2ZA 3CFEA 4N90D 3HMXL 4NNPH 4URTB 1IAKB 2UV3A 4HXAH 5EOQH 1QLRB 2G75A 4TNVK 3V52L 2OJEA 1MHHA 2Z93A 4NQCE 1VENA 2OR9L 3ARBA 3EOTH 2HTLD 4X9HA 5D8JL 2V7HA 3GMOA 1I7ZB 1JFQL 1YMHA 2I9TA 4JCMA 2C5DC 1NGQL 1QSED 2E27L 3QNZB 3ARFD 5JPMA 1MIEH 5MEPA 1S7UB 1T04A 3SDCA 3FB7B 1I3RB 4P49A 1D5BA 1HDMB 1NKRA 3I02B 5C86A 1BAFH 3DIFB 3PDDA 1J0ZA 2OLDA 4Y5YC 4Y4FB 1CBVH 4KAQL 3KR3H 4PJDF 3M17A 5IR1B 3WDJA 4WEMB 4XXDA 5D96B 4P48A 1C1EL 2YRZA 3IXTA 4Z7NF 2OTUA 1RZJH 3MBEC 5CEXA 3VGFA 3IDJB 3VFOA 4GG6E 5IFAL 2MQCA 5INCA 2ITCA 4P2RB 5HVGB 5HYEA 5EZJA 1CDBA 1A7RL 1IAOA 5ETUB 4V1DD 1JWSB 3QUYC 4K3JH 1DEEA 1ZHKB 2J3SA 1KN4L 3M8OH 1QTYT 2EH8L 3S34L 5EUOF 1QQDB 3EGSA 4FOMA 2R1XA 1QRNA 3LS5H 3H7LA 3GUTA 3MRJB 2CUMA 15C8H 4P59H 2YPLD 3VXTB 3WHXB 5KJRH 1IILE 4HCRL 5FXCH 2C7UB 3C5SB 2VDOH 1OAQH 4NQVB 4FQ2H 4YDIH 4PGBA 2F5AH 4WU7B 2AGJH 1OW0A 5IW1B 2J8UF 3DMMD 4XVTL 2X5PA 3OHXB 3W0WA 5D7KD 5IVXA 1R0AH 3ULVH 1U91A 4NQTA 2HJLB 4KGJA 1L7IH 1YN7A 5IVNA 3ARFA 1YUHA 5IIEA 4LFHD 2LAGB 5L2KE 1LO2L 4FQJH 1MCLA 5EU5B 1RULH 4NKIL 5CSBA 1OGAD 2I60L 1MEXH 3IKCB 1DQQB 1U8QB 4N1HB 4Y19A 3WJLC 3V0VA 4Y8DC 3EOAA 3QCTH 1FNAA 3CPLA 5IK3A 4HIIA 3BKMH 1XR9B 3GZKA 1SEQL 2E5EA 4OAWB 1A9EA 2N7AA 2X4NB 3F6LA 2WBJB 4OV6F 3KPSE 2X1XR 1DQJA 4HWBH 3ZKND 2UWEE 4JKWA 2FECL 3MCKB 5A2FA 4Y89A 4ALAH 4J3WA 1FIGL 2NY7L 3E1F1 4QLRA 4KZEL 4Q9CA 4QHLB 2D0GA 3WL9B 3P4NA 1NFIA 3B8SA 5C09D 1I9IL 4EXKA 3GB7A 3PHOB 4OF8A 1X9QA 4OLWL 1VGKB 2B20A 3GSNH 4Z7UE 4X83A 3D2UD 3WSQH 1JTOA 1CLOH 2Z31C 1X7QB 2B1HL 2AEQL 2VOTA 5F7KC 4OT1L 4WDIA 1TZHB 1UG9A 1AXSA 2NY6C 3G5XB 3MRIB 5DVOA 5MI0C 4P5TC 1EHXA 3ARGB 1GZQA 4BYHA 2X1QA 2V2TB 4QRPE 4F15B 1G0XA 3OAZH 3UMTA 3FRUA 3VXRA 2YS4A 5IOPB 2GFBA 4LDOB 5GS1B 4GRLC 3EJYD 5B22A 2AABH 1R3IH 3VXUA 3UEZA 5T5NG 3E6FB 4FZ8L 2D7TL 1JWUB 3FT3A 1NANI 5F9AC 4I8DA 2Z91A 3GBNL 4NM4L 2IPKB 4KXZH 3PL6C 2FJFB 1KPUB 3KG5A 4X7CC 3OJDB 1I9RL 4GAJH 2FYYA 4XWGL 2X44D 4GAGL 1P84J 4NWUL 5DRWA 3O4LA 4HWBA 2ADGA 1TJGL 5DEFB 2JJSA 5IUSA 2NZ9C 2ZG1A 3DGGA 2BRQA 8FABB 4PGDB 4N0YH 1I3GH 4MAUH 3K2UL 1UENA 4RAVA 4MXWL 4W70A 5AG8A 1QO3B 3GSNA 3QZWA 5HHPA 2GAZB 2Z8WC 4DN3H 2H2PC 4OGYL 3G5VA 4KI1A 5EO1A 4R97B 2IPTH 5L8JB 5I1IL 2B39A 4YDJB 1EBAA 3HC0B 1N5AA 2HVJB 2CLRB 2UUDK 3UJIH 3QNYB 5EPMA 5J1AB 2GCYB 2VLJD 3RKPA 3PWPB 3QHTC 1EIBA 1H3TA 3PIQA 1A4JA 3D2UA 3VH8B 1IJ9A 5I1LA 1E27B 3D5OF 5D71L 5CWSA 2E3VA 4QTHB 2DM4A 2W92A 4K7PX 4LCCC 2MNUA 4U1KA 1XGUB 5J4MA 3GMRB 1MPAL 1T7WA 3KLAA 3FN3A 4BSJA 1BGXH 4Y2DC 3GO1L 2HH0H 1NCAL 4C55A 4HIJB 1FZOA 2MHAA 3H9YA 4JREB 2CKBH 3EZJB 5EBLB 5F3BA 3TBYB 5F72S 5EO9B 5KVFL 3MJ8B 2QJDA 1G6RL 1A9BA 1W0WA 2HFFB 4FTVB 3HLAB 2VAJA 2MKLC 3CFBB 3PABA 5EC2B 1QFWH 1YECL 5HYJD 1PAMA 4XAKD 1A21A 2VLKA 1SYSB 3FB5B 3T0BA 2E9BA 2ARJQ 5MP6L 5FF6A 5IJKC 5CINL 3REWA 4F9PC 1XF5A 1XF4A 2FX9H 5FOBA 5EA0L 1FAIH 3V6OC 3CLFL 2B2XL 4FFWC 3GM0A 1CQKA 2G5BA 3DXAB 4PJ7E 4PFEA 5D2LA 5I1JL 2HJFB 3C6LD 5SX5H 4HWEH 1R3HA 2HFGH 3O3DB 4UTBH 3GMQB 4PUBH 5F8RC 2ZUXA 4HX1A 2D3VA 3QIUD 2ESVD 4PJAF 1HIMH 2K9UA 4LKCB 3BH8B 3D0VB 1UCTA 5J6GB 4NCC1 1DFBL 1P7HL 1XF2B 3OSKA 5FHBL 3SDCC 3U2SB 5TPWH 2CKBA 3KXFA 4OZGF 2GSIB 5EO0A 3O11B 1N64L 4G9FB 5GGQH 3BRFA 4E5XA 1DQML 1QVOA 4OZIE 1DLFH 1FO0L 2ZUQB 2OL3H 4F9LC 1R3KB 3P11H 4AQOA 3LDBC 3GHEH 3JWOH 4QRQB 5TQ0L 3WEXB 3DVIA 4UT7L 3W5NA 4X0KA 5ENWA 1SMAA 4KRPD 3L3KB 4JJHA 4N8PA 4JKKA 4DKEH 2XKSA 4WWKD 1U92B 4KJWC 4J3VA 1WF5A 4X4XA 3SPVA 2DLFH 4XNMB 3MRDB 4RDQF 1KULA 5EOTB 1D7FA 4YDVA 4WW2C 3B9KA 3MJ6A 1HH9B 4WTZG 3PWNA 3R0MA 1TQCC 1UM5L 4MQXD 3TIEB 1T89C 5C0AE 4HBQA 3QEHA 1JL8A 4M5ZL 1N4XH 5GJTL 4U2ZA 5DQJB 2YHGA 1XMWA 1U93A 1UQSA 4F8QA 4L3ED 5DUMH 3DETD 1AI1H 1U8KA 1MJJA 1EFXD 4L4VD 2AI0H 2W38A 3KDMB 4ONHB 4P59L 3FB6A 4M8QA 3ALXA 4AT6B 4RGOL 2HFEB 1FBIL 2V5MA 3QIUA 4LLVA 5GGSY 1ZGLB 5LXGH 2DI8A 4X6DA 3IJSA 3EOYG 1JVKA 1F90H 3B2UD 4HKZA 4HH8A 4Z76A 2V5YA 2OL3A 5TFSH 3OB8A 1X5FA 1SJHA 5CEYB 5TF1L 3ULVL 3FZUC 1EFQA 3MV11 3WUZA 3CAFA 2EO9A 2BK8A 1S5IL 1FZJA 3FQUA 5CGMA 4FQJL 1MCFA 1RULL 1OTSC 1GZPA 3KPNB 4HJGB 1RZJC 4NNXB 4O51B 3OKEB 4O00A 5BW7C 3CIQA 2IG2H 1F58H 5BV7L 2DJ4A 1T3FA 3VXMA 4QEGA 5FAAA 3OKLA 3GSRA 4PGEB 4S1DD 2NXYC 4HUXA 1HOCA 5C0CB 4YDLC 1EUTA 4P23A 4OLVL 5EWIH 5BRZE 2DWDA 5CEZD 3AGVA 4JZOA 1B0RA 3VXSD 1XH3B 5SWZE 1ZA3B 4AM0A 2HP4A 5I6XC 2GYSA 3LHPL 2X1OA 1YPZF 4S1SL 3SE8L 3P3YA 1I7TB 1T7VA 2OQJB 2X10A 5TJWK 5F9DC 1S7WB 3GRWH 5ANMA 4D0DA 3TGXA 4HT1H 2FJGA 1VFAB 3VFWA 1IAIH 3NCCB 1YEJH 4XX1E 4NQEA 4O02H 1FFOB 2HT2C 1A02N 4L3EA 1E4WH 4XP4L 1JNHB 1GRWA 3BGAA 5E2VH 1SBBA 4QWWC 1EFXA 1VACB 5JPNA 1JNNL 4L4VA 3T3PE 3J7HA 4NHUB 4HUMB 1WIUA 1FC2D 5I8KH 1GC1C 1IAKA 4JRYD 3PQYE 1QLRA 3I6GB 3C08H 5J12C 1WWCA 3CX5J 4JM4H 3L9RB 2BNUB 2BVYA 4JG1L 5BO1H 1P5VA 1TJHL 2AABL 2QR0B 4L8SC 2IANB 1I7ZA 5DZLA 2AERT 5B21A 3QNZA 3SGKA 1I8MB 2WV3A 1YEHH 2ARJB 2YXFA 3FB7A 2OXGA 1I3RA 3LZFL 3WNKA 1MRDH 4MVBD 1M05A 1HDMA 5CCKH 1OAUL 1TETH 5CD5C 3I02A 2Z8SA 3CU1A 3DIFA 4RX4A 2GJ6D 1J8KA 4Y4FA 3CGTA 2CXGA 1KYOJ 1S9VB 1OPGL 1A47A 5IR1A 3DJ9A 1I85C 4XBPB 3BPCA 2Y6SC 2DQHL 4WFGE 1D5ZB 2IBZX 3TT3L 2JJUA 4FG6D 4BH7B 2YD8A 4OF3A 4Z78B 3GSVA 3BAEL 3CLEH 3IDJA 3K8KA 4TVPE 4UIKH 4X7FC 4P2RA 2BVQA 3UP1A 1IE5A 4YHYB 3ZDZF 4OCXL 4EXPX 2EYRA 3X3GL 4OI9A 1UCBL 3WIFB 5J0BA 5LGHH 2FIKB 2E6JA 2BVUA 5HGBB 4GMTL 3TNNB 3NIGE 5DEGB 3NCMA 2C7UA 4NQVA 3UCRA 3V7MA 3SEPA 3A6CH 3SOBL 3HUJF 3IDYC 2W9DH 4AEEA 2AXGB 4M62L 4M7ZB 3SE9H 2ADIB 2VL5B 1MCQA 1J1PL 3BPLC 2CKBL 2ZNXA 4PJ5E 3RWGA 2EIZB 5IFJB 1DUZB 4ZUSA 2HJLA 5CSGA 3QP3A 3QQNA 2VXSH 4JZJB 4WHCA 2ZOLB 3Q0HA 5EOCL 4I13B 3OGCB 5EU5A 4LHJB 1ZVSB 1CK0H 5EZOH 4U1MA 2IBBA 5DJDB 2QLVB 3C5ZC 3DV4A 2X9YA 4P2OB 1JBJA 1ZLVK 1XR9A 5SWQB 5ERWA 4APQC 4XMLH 2V2WA 2X4NA 2YPKA 3HAEG 4N68A 2I24N 4UOJA 2VZ3A 2A9NL 1QSFD 3QULA 1CR9L 2FX9L 4XZUB 2CDFB 5IHLB 2PYEE 4XVJL 3RRQA 1MHCB 5EBGA 3MYJA 2DL2A 3MCKA 5JR1L 3U4EA 3BD4A 1RJYB 4BUHA 4PS4L 1AGFB 3WL9A 3H9SE 4LASH 4NC1E 1WVZA 3RIAF 5IMLB 2AEPL 5GJSH 2R2BB 3JSSA 3PHOA 3KPOB 3SE4C 2V7NB 4PUBL 1Q94A 3U46B 3ZT6A 1A7OH 5MEOB 5C0RL 4JDTH 1FJ1B 3UO1L 1UM4H 3TH2T 3KS0H 4OZIF 2R8SH 3O41B 1LEIB 4KMQA 1JGVL 1F6LL 3SO3C 4XGZB 3ROLB 4G42B 1TZHA 1H3UA 4KFZC 5JW4N 3BIKB 5GGQL 2ICEB 5J11B 3MRIA 3ULUH 3ARGA 4G8IA 2V2TA 3K4ZA 4AYFA 1D9KB 1IBGH 4ZMAT 2Y5EA 3AREB 4LMQE 1T7ZA 3GDBA 1UKQA 5IOPA 3L5IA 5GS1A 4HKJB 3SGEH 2B4CH 5D1XC 5K9JH 4XTRD 5HDLA 1J05A 4OCLC 3BHBB 4YC2B 5DDHB 1E0OB 1JWUA 3D85B 4O5LH 3VMNA 3GJFK 3WLWD 1MCWM 2FZ3A 2Y07L 4HPOL 3LKPB 2DQTL 3B9KC 2FJFA 1KPUA 3T04D 1U6AH 3R06B 3OJDA 2LAAA 5JHDB 5LKNA 2E7HA 3VXQB 4PG2C 2GI7A 4H0GA 5DEFA 3ZT7A 2GJZB 4GQ9L 5D1ZD 4YFDB 3HC3H 4JHAL 3DROB 1TZGL 3LQMA 8FABA 4PGDA 1KCLA 1QRNE 5HHQB 1S9XA 4PJBF 4U6VH 4LLUA 4R4FH 5JW4Q 1IKFH 4RQQB 2G5RA 3D3VD 5GISL 5DRZB 4N90E 4HK0B 1E4XH 5DD0L 4OCMC 5I0DA 5TE6L 2NCMA 4RFNB 5LBSL 3EDDA 3O45B 1J8HA 1Z5LB 4FQLL 3MLPA 1JTPA 4Y16B 4YDJA 5JQ6H 3W0WE 3SQOL 4Y4HB 2HVJA 3ARDB 2CLRA 5IVXE 5ISZB 3QNYA 4LOUC 3MBED 4U0RB 5J1AA 2DQGL 2R56H 2B8OT 5AWNL 3MRRA 3JWOC 3UC0H 1D5XB 4MQSB 3C2AH 4J4PC 4ZQKB 3HZVB 3VH8A 1E27A 1S5HA 1B3JA 4PJ8C 4QTHA 2AQ2A 4Y19E 3ZE2F 4XP5L 4M5YL 3SN6N 4H8WL 1Z6JT 3RDTC 5HVHC 3GMRA 4HUVB 4JPWL 3CX2A 1U3YA 5JQHC 4HIJA 2VXUH 2EZ0C 4JR9H 5EBLA 4N8CL 3TBYA 1CFSA 4QYOB 4UIMB 5EO9A 5SX4H 2X4PB 3MJ8A 3T0WA 5IT2H 2HFFA 3CXDH 2Z0BA 4L9LB 3DOSA 3HLAA 4LEOB 1AHWB 5EC2A 2NY0C 3BQUD 3FJTA 1FORH 2Q76A 1SYSA 1Y6NR 3T0EB 3UJTH 5D1ZA 4EIGB 1LK3L 1ROWA 4RAHA 1ZVYA 4PJIE 2IEPA 3WNNA 5MEQB 1H8NA 1HYRC 3MACL 5CEZL 1TZIB 1IAMA 2EYSB 2XN9D 5GS0C 3VRLF 2NY3B 5AD0B 3DURA 1A7PH 1EXUA 2NR6C 2NX5D 4EI5D 5M95B 3BYTA 4UT6L 5I8EB 3ULVE 1RVFL 4X80L 3DXAA 1A6TB 1MFEL 2HJFA 3IDXL 3VXRE 3BMVA 3UTSD 2A6JB 2ZUWA 3O3DA 4UILL 3GMQA 3VXUE 4L5FH 4I48B 3MRHA 1HINL 4UUJB 3QHZH 5KVEL 2B0SL 4PJCB 4QHNB 1CXIA 4LKCA 3D0VA 4DUXA 5J6GA 3SGKC 5AZEL 3X11A 3GMNB 4LSPH 2D03L 3VRJA 3C60B 4PJEB 4JQVC 2GSIA 3MLZL 1YEKH 2R1WA 4RRPA 3HNTH 2HKFL 4DGYH 4RWYH 4M6NH 4JO4H 1R3KA 4UAOB 2XNAB 4ERSH 4LGRB 1XZ0A 3D6GA 4JM2B 4QRQA 3WEXA 2NY6D 2YBRB 4O2EA 1Y6KR 4Z9KB 4FS0A 4P5TD 3SDDD 3L3KA 3P9MA 5ELIA 1NLDL 2ZUSA 5J1SC 4FFZH 3QQ9D 3O6FD 5CBAB 5C2BH 4BZYA 3BVNB 3KPPB 3EDKA 4KC3B 3BQUA 3PXJA 5EOTA 3LEXA 2PCPB 3WLBB 3P0YL 3MODH 4U1IB 3UYRL 3PL6D 1QHOA 3LQZB 3TIEA 1HHGB 1TIUA 4G6ML 4LSVH 5DQJA 5HHMD 5GIRB 2NZ9D 4KQ3H 5F7DA 1E28A 6CGTA 3BE1H 2AVGA 4X6CB 4QRRB 4DFIA 3KDMA 5BQ7A 4ONHA 4HKXA 4KDWA 4X8XA 3GKWH 2XZQL 5CP7A 3NGBC 4D9QD 4KQ4L 5DFVC 1ZGLA 4DZBB 4YXKH 5GGSB 3HAEB 1I7UB 3SJVD 4YHZH 3W9EB 4LCYA 3NPZB 4NBXB 5T5FH 5CEYA 2CXKA 4NZUL 1A1NB 4YFLF 2VLKE 1PYWB 2R0ZL 3IFNH 1N0XL 3RX5A 1NCUA 3HA0A 2WW8A 3NVQA 1T83A 3KPNA 1AR1C 1P6AB 2WBJC 5E4IA 4ZYKB 4O51A 2XWBB 3OKEA 4JN2A 1QBML 5HI4C 1X5KA 2QV2A 3GK8H 3O2WH 4PGEA 3VG0H 3PP3H 3DX8A 4NBZB 5C0CA 1OGTB 5HGDA 3EO9H 5D2LE 2NXZB 4Q0XH 3CDGA 1WAAA 3S37H 4DWHA 2Y5TB 1ZLUK 3VA6A 1HQRB 4P4KD 3IDIB 1I7TA 1JNLL 2I26N 2PTUA 5L9DL 5CHNB 4LU5L 2BSSB 2M2DA 3RY6A 2R0LL 1VFAA 5JA9A 3BDXA 4F7PB 1FFOA 4ONGH 1UM4L 3L1OH 4HUKB 1PJ9A 4FP8L 1ZHLB 4MSWA 2OYPA 1JNHA 2CUIA 4HGWB 1NGWB 1W0YT 3MR9B 3RHWF 4YE4L 5J1TC 2QHRL 5GRYA 5IMMB 2MOVA 1EHLH 5IBTH 1ORQB 4NHUA 4UQ3B 4GJTB 3VG9B 5F9JB 5C70A 3I6GA 1XGYH 2N7BA 3RVWC 4ZSOB 1HILA 4XP1L 3L9RA 4UB0L 2BNUA 4JFXB 2ZCHH 2IANA 4RMTA 4WW2F 4DOHB 4JFZH 2PXYB 5FYLH 3L3JA 8CGTA 3ZTNH 2VDML 3WIHL 5F88B 4UU9B 4MHHG 1OCWL 1CD8A 1I8MA 1QPPA 5C6TH 4HMEA 1ULVA 4R3SB 1F6AA 5T1LD 4ZTOH 1KC5H 4DAGH 2DBLL 2R69H 4PJGE 2XA8L 1NJ9B 3TO4B 4LHUD 2K1MA 4X9GA 3VD4A 3TVMD 2QSTA 5HYSG 1S9VA 1QEWA 4MMXC 2MJWA 2J4WH 2C1PB 2YXMA 4XBPA 5GGTH 4UNUA 2IH1B 1D5ZA 5E6IB 4YPGB 4BH7A 3BESR 4R97C 4M3KB 4M7KH 1XCQB 2VXVH 1WEJH 3I2CH 4Z78A 4ZUWA 3TM6A 4HS6B 5DUBB 4BQBA 1H9VA 4X6DE 3RL1B 1MFBH 4JN1H 4K8RH 3ULUC 4WO4B 5C07D 4K3EL 5IB2B 2C9AA 1TJIH 5I2IB 5JQ6L 1IAIM 3SCMD 1RFDL 3PP4L 5ESVA 1RK1B 4FQCH 3WFDH 2CR3A 3VDAA 2ZSWB 3P30H 4GH7B 3MJGX 3E3QC 1DQLH 2FIKA 3TYFB 4BA8A 3TNNA 5DEGA 3IS0X 2XWTB 2YKLH 1FNEA 5ACZA 2EE9A 3VXME 1T03H 3MA9L 3VXPB 1YNLH 2AXGA 5FKPB 2ADIA 4H1LA 1L0XA 4XC3H 1N8ZB 5AEAA 2EDRA 3VFRA 3JWDH 3AMKA 1FZKB 4Z7WB 4JRWA 3BOVA 1CLYH 4M7LL 2X9XA 2FBJH 4JZJA 2HWZH 3B9AA 2ZOLA 3CXDL 1F4HA 1U41A 5HI5C 4DQOH 3G5ZB 1ZVSA 2YD9A 5ANME 5DJDA 3FZUD 2XYCA 3X17A 2BY3A 4P2OA 5GGVL 2C4XA 5GRUH 5SWQA 3QUMB 3I9GH 3MQIA 3ILPB 1JK8B 4R96A 3TVMA 5I1CL 4L3EE 1OTSD 2V5RA 4XZUA 5KBNC 4JO2H 3NA4A 2X70B 1X5AA 4L4VE 5IGXL 4G80B 1NSNH 4MD0A 4D0BB 5DYOA 1WBXB 3FOLA 4OZ4A 1RJYA 1IC4L 1X5LA 5BS0D 2NXYD 4JHBA 3BKYL 3QXTA 1OAXH 4KKCD 5FGBA 4OCSL 1I4FB 3OKKB 4WGWB 5IMLA 1G7LB 1S9KC 1MAMH 1MELA 4GO6B 3KPOA 4MNQB 2AJUH 5C07A 3U46A 3LRSB 5CMAA 5GS3A 2PO6B 4LRIA 2F9BT 5MEOA 1MJUH 1FJ1A 5ADPL 1X5ZA 4HJJH 3GIZL 3SCMA 3AAZB 4YHNB 5CILL 1A6VL 4ZODA 4JY4A 1LEIA 1OM3H 4PB9L 4DKDC 4D8PB 1NL0H 4XGZA 2J6EL 2ZUQC 5FB8B 3ROLA 4U7MA 1H5BC 3RX8A 2HT2D 2X42A 3MNVB 5EC1B 3TF7C 4PRDB 4YHIB 2O93L 4I3SL 1D9KA 3HKFA 3E6HA 1J10A 1YMMB 3HMWH 4HKJA 1W8OA 5IHUL 5DDHA 3BHBA 2JIXB 3D85A 1ED3B 4G8GD 4MXVE 1NGZA 1Q38A 1AQKH 4IM8A 4P2RE 1KGCD 5JHDA 1QKZH 1HKLH 1MQKH 2YK1H 2O61A 1CDCA 5DVLA 1CXHA 2GJZA 3B3IB 1T1WB 2HRPL 3DROA 4CJ0A 1HSBA 4G7YL 1BQLL 1H8SA 5CD5D 1EEZB 4KVCH 4YAQA 4RQQA 1J1XH 4FQQB 1ZE3C 5DRZA 3FFDB 4K55A 1JZ6A 4HK0A 1DBJH 4JRYE 1J18A 4Z7QE 3JTSB 1Z5LA 4HV8B 1KFAL 3T0AA 4MMZC 3UTPE 3SGDH 5ACLA 4Y16A 1ORSB 3ARDA 5CSZA 5ISZA 1J1OH 2AXFB 5EORH 5KZCB 1LO3L 5L6YH 3CC5B 4YXKL 1JMZA 3AM8C 3HZVA 4ZQKA 3BW9B 5ALBH 1PY4A 1BWWA 2DM3A 2IJ0C 1WZ1H 1RMFL 3GFUA 2VUYA 2XZAH 4KHTH 3MTRA 2IAMB 4OCYH 3GI9L 4HUVA 4GFTB 1HHHB 3RY4A 3RZCD 3QPXL 5DFWH 5GSRB 1RPQA 2P5EB 5IBLC 5C08B 4OM1H 4GRWB 3FAWA 4H25B 3WE6A 2QQLL 3RIFF 3A67H 4UIMA 1U8MB 4Y0GA 4HZAA 4NP4L 4X7SL 4HF5L 3VDCA 2X4PA 2F15A 3ES6B 1JPSL 4PRAB 7FABH 5JNYB 1AHWA 4PJFA 1Q9KB 1A3RH 4Q0XL 4Z0BL 2D7OA 4X5XB 4BJLA 3FQRB 2YA2A 4NDMB 3RY6C 3T0EA 5D9SB 3PNWB 4KDTC 5DT1H 1U3JA 3IETB 5EFIB 4XP9H 1BVLB 4L3AA 1BFOB 5LVEA 5MEQA 5FHAH 1TZIA 4XHJC 2EYSA 4OIIL 1G7MB 1HH6B 1UACL 4L4JA 4XBEH 1YYLL 4WV1B 3BKCL 4BELD 2C3HA 1CGWA 2X4RA 5IB5B 4GW1A 5I8EA 1EBPA 1KJ2L 1T2QL 3RWCA 1A6TA 1UA6H 3UJJH 2Z9TA 2A6JA 2P4AB 3PDOB 1RZKC 4I48A 4K2UH 4X98B 3TYGL 4UUJA 3U82B 3RWHA 5GGUB 5B3NA 3FAXA 4ZS6D 3S98A 3FQNB 4WUKH 5HYSB 3H3PL 3MXVL 1G7PB 3GMNA 3OJMB 3C60A 1IKNC 5ID1B 3G6DL 2FR4A 4NM8H 5E99L 5C0DB 5AYUL 1BVZA 2VDKL 2NYYC 3HAEH 3THMH 3QHFL 2R15A 3MV7D 4XMKH 5I75C 4FQXB 3TA3B 4ZTOL 1MCRA 1KIQB 3QXWA 1X5JA 4OIAA 1AR2A 1RU9L 1RURH 3U1SL 2YBRA 4PTUB 5DURD 4NYLB 3TBWB 1A6PA 5L0QC 2W1NA 1MWAB 2FCBA 3BSZL 5F96H 1CI5A 1IEBB 4X6DF 1J8HE 5DJYB 3S88H 5CBAA 4HG4K 3BZFB 5D1XD 3BVNA 3F62A 3IF1B 1SYVB 4X9BA 3I2CL 2P5WD 4YHYC 4XXCC 4P0DA 4U1IA 4YGVB 5F1IB 2EC9T 1HHJB 1KACB 3LQZA 5JDSB 1OAKL 1NC2D 3BEWA 4K8RL 3LN9A 4HPYH 4Z8FL 3QFJB 4JZNB 4KHXH 4D9LL 3VGHA 3JWNC 4OCWL 1NFDF 4PR5B 1OLLA 4X6CA 3TPKA 1F8TH 1LMKA 1J11A 5KW9L 1N26A 4QT5B 5ILTL 4MA7H 2MCPL 1AC0A 1NEUA 2PTVA 1CWVA 1M7IB 4WCYH 4NUJB 1MLCB 2W65B 1V8HA 3PG2A 4ODHH 1Z3GH 5D70H 2HAZA 4MCZB 5CGYD 2DKMA 2DLEA 4ZOBA 2D4FA 5GGSA 4ZO7A 3HAEA 5LAXA 4CGTA 4PP1C 1QR1A 3RWIB 1FN4B 3OL2A 2WP3T 3DUSA 1A1NA 2VE6B 2ENYA 3HRPA 3I75B 3S36H 4BZ1L 2NY5C 1PYWA 5HJ3B 1J7VR 4J4PD 5IMOB 3WDHA 1UB6B 1TDQA 3HNVL 4P2YA 4EI6B 2CMRL 4QNPE 3HC4L 4QXTA 1MF2H 1KB5B 4ZYKA 3MV7A 4PJXB 2XZZA 3WS6C 3RDTD 3TIDA 3D3VE 1FCCA 1CE1H 4PD4K 2VDQH 2FX7H 3C8KB 1RUPH 3DXAE 3LMJH 3NCEB 1OGTA 1NEZG 4LCWB 3VFTB 5FGBC 1CD1A 2WUCH 2Q8BH 4H88H 2OP4L 5ICXB 2BSRB 1BQSA 4M03A 4J23A 1IGJA 1QNZH 5T33H 5E03A 1GGTA 1UM6H 4LSUH 2ZOKB 3O6LL 3O6KH 2P5WA 3IDIA 4KK5D 1DBMH 3OZ9L 4MD4A 4TULH 3LIZL 4KTDH 4IIQB 3T77B 1U2CA 5ESQB 4D9RD 4JPVH 2BSSA 2YSSA 1T2XA 3VFGH 4F7PA 2QSCL 3JWDC 3DHMA 1QYGH 2EDXA 1ZHLA 5ICYA 5CLTA 4RAUB 1T0NB 5IMMA 1T7YA 5GS0D 1D9KC 5E94B 1KJMB 1ORQA 3AREC 4LSTL 4PB0H 4F7TB 2W9LA 32C2B 4XBGB 4YC2C 3O0RH 1PZUB 4JGUA 5SV3A 4JFXA 1KLUB 4TNWK 2BNQB 1ZVHA 4XPFH 3WNOA 2GT9A 2PXYA 1QG3A 3B5HA 1LO0L 5F88A 4UU9A 1UZ8B 2FX8H 3H7BB 3UROR 4F58H 1MCPH 5I71B 4TOYL 3RWJB 2ADJB 4R3SA 2NTFB 4NJ9L 4ZS7L 1GC1L 1RZIB 2WP3O 4X5WA 1MQKL 1FZMA 1NJ9A 4OLXL 1RUAL 1T66C 2EDEA 2XACC 3I50L 1KCRL 5DK2B 4RFNC 4IMLA 3QDAA 3UTSE 4YPGA 4JFEA 4I18B 3QUMH 2OSLB 1XCQA 1HEZB 1M7DB 4Y16C 1MJ7L 3OKYA 4NO2B 4Y4HC 5DUBA 5BXFB 4U0RC 4MX7A 1FV1A 1JPTH 2Y72A 3MREB 4QOKD 1GPOH 4WEUD 3BYYA 3DSFL 4JY5H 3V5HA 4WO4A 4NPYB 2VQUA 5I2IA 2KQNA 5LWYH 5FYKH 1WUNT 4M1DH 5B38A 1IGCL 4PJ9B 3S37X 3TYFA 3KYKL 1XAUA 2EDOA 1KTLB 3MLRH 2XXMB 5ID0B 3BUTA 4LQ1A 4R2GB 4KHTL 2OJZL 3N0PB 3O9WD 4PLJD 3VXPA 2GQHA 3G08B 4G43A 1FGNL 1MJ8L 2CIKB 4YUEH 1IL1A 2WINA 1Y18B 4L9LC 4Z7WA 1AHWC 1WAAE 3FT2B 4XP6H 4NN6B 3RAJL 3EFDL 4H20H 1GGCH 1OQOA 2LU7A 5FCSH 3KJ4B 4GXVH 1YY9D 5E24E 1CZ8H 1GGBH 3T0EC 4UTAH 1RIVH 3CFKB 1OP3H 3ZZ1A 3MJ9L 3QIBB 4OSUH 2FLRT 2GTWB 4XNYL 5D7JA 4JFFB 5LGKA 4JGMA 3QUMA 5HHME 3DX7B 1FYHB 3ILPA 3JV4A 2WBJD 4JFDB 2GY5A 2FO4B 1ADQL 4OGXH 1WBXA 3P0VL 3WIIH 3MRMB 2DQEH 1MSPA 3F5WB 2DS4A 1NC4B 2VISB 3CDYA 2AAVA 4D9QE 1I4FA 4DN4L 1I75A 1QPXA 3OKKA 1KNOB 1DJSA 1MFCH 4KRLB 4DUVA 2YMXH 4MNQA 1HK6A 2CPCA 1MCOL 2IANE 4J3UA 3RVVC 4K2UL 3QWRD 2PO6A 1JHKL 3C60C 4M1GH 3P2TA 3AAZA 4OQTL 4YHNA 4I77L 3OJ2C 4YK4B 4GXUN 3Q3GB 3EYUH 3RBSA 3IAGC 2X4OB 2JB5H 1EVTC 1H15B 1AY1L 2FD6H 3QA3B 3EYSH 4GKSA 3OB0K 3B5GA 1NKOA 1K3IA 4NZTH 1NQBA 4JM2C 2WQ8A 3DYMA 5HPMB 1R3LB 2XTJD 3MNVA 5EC1A 4PRDA 1C12B 4ZDHA 4XVSL 4NGHL 5FUZL 2CK2A 4I3RH 4KUCF 1C5CH 5KG9B 1YMMA 1OAZL 2ADFH 2NW3A 1P7QB 2VZOA 3B43A 3MLTB 1NBYA 3DVNB 1DBAH 1LNUB 3V4VL 4BZ2L 3A6BL 5DA0B 4GG6B 3RVWD 1P2CB 1FPTL 1ED3A 1F5WA 5EOCJ 5FECB 4TTGA 1F4YH 3ULUF 2XQYK 2JELH 4GRWH 3MLSL 4H5SB 3PF2A 1A7QH 3HE7C 4LPCA 1WTGT 5FOJA 2NZIA 3LH2L 5DC4B 4C58B 4Y4KB 2DQCH 1VGEH 3B3IA 1T1WA 3FQTB 4LLQA 2X05A 1WISA 2IFFH 1FCGA 5K9QI 3H3KA 1EEZA 1FQ9C 2EEBA 3GSXB 4FQQA 2BVPA 5IW3A 5C0NC 2HMIC 3ZKMD 5JOPD 2G9HB 1KJVB 3BN9D 5FYLE 4MNHA 2HLAA 1QR4A 4OLEA 4NQDD 4OFYA 5IB4B 3JTSA 4HV8A 1U8PA 2F19H 2R4SL 4XPBH 1ORSA 2ZCLH 1MI5D 1SY6A 4RMQA 4RZCA 5L2KB 3QWRA 1JI2A 2AXFA 2IALA 2APFA 3GI8L 1UKTA 3OKDA 5D7IF 3CC5A 2EICA 5JXAL 3H9ZA 4JO1H 1NEZB 4LSRH 3HPJA 3N1FC 4ODWB 4CMHB 5D1QB 5DD6B 1JGUL 4WEBH 5F1SA 5GRJH 5B4MC 3KPSB 1PY9A 3WD5H 9CGTA 5E8DL 1BD2D 5IJVB 1ITCA 2UWEB 5GSRA 5D7LB 3LEYH 2H2SD 2P5EA 3UDWA 5I1EL 1SJEB 1J88A 3BWUC 2BSED 1T1XB 1DVFD 2NY1D 4H25A 3P9LB 4U3HA 1V5JA 4ZOEA 2NXZC 1RSFA 1VKXB 3TH3T 2P49B 1AJ7H 4YQXH 3VRIA 4V2CB 1AC6A 3REVA 1AE6H 1A3LH 3LMJL 2OTWA 3ES6A 4U1SB 3NBNA 5JNYA 1FGVH 1QFUL 1UB5B 3C8HA 4Z7UB 1R5WB 4JE4B 1KB9J 3OPZL 1L4IA 4K9EH 3DI3B 4LSDA 5FYJD 5C07E 4LPYA 4F37F 1MWAH 5DVNA 3FO2B 3VGDA 3RWFB 1D6VH 5D9SA 5HI5D 4NN5B 3IETA 3VGAB 1BVLA 5C3TA 3MPCA 4Z7OF 5JOFB 1BFOA 4OZFG 3T2NL 4BM7A 1G7MA 4ELMA 1HH6A 2J7LA 2VLMD 4JPVL 3SBWC 5LQBH 4U05A 2IFGA 4W6WB 5JOEA 1CLZH 4HW6A 4UQ2A 3BI9X 1MVUA 5A1AA 1LDPL 4KKBC 1A8JH 3VG9C 3D9AH 1I1AB 1QSZA 3HI1B 5E8NB 2EEAA 3U7YH 4Y88A 5D2NB 5T1KB 1ZXQA 4TSAH 5ALCH 2Q86B 4OFPA 3AXLA 1MI5A 5GGUA 2R0WL 2PXYC 2KKQA 4YBHA 4LGSB 4LEXL 1MFDH 3S3JA 3FQNA 5HYSA 5GS0L 1FG9C 4HIEA 4MD5B 1R5VA 2AV1B 5JHDE 5HGAB 1AO7D 2VDNH 1BIHA 1JHTB 5L88H 4F58L 3OQ3B 4ORGA 3TO4C 2D9CA 5HI3C 3ZDXE 1QRKA 4N0FA 3TH4T 3IFLH 4JKPL 1K85A 4NRZA 1BD2A 4XAWH 1GGIH 1RHHB 1DVFA 5E6IC 4NYLA 4K7FA 3TBWA 2PW2B 1MWAA 2BY1A 3GNML 1KB5H 1LGVA 3TZVD 1KPRB 4WI2A 3QDGD 4CMMB 3PWUB 3BZFA 4OCRH 2HRLA 1SYVA 5TDPB 1VADB 1E6OH 4XCCH 1TENA 5ISZE 2AXHA 2YC1B 2AQ1A 1U95B 1U8LA 3FO1B 4I0PB 1Z2KA 4UT9L 4W4NA 4JQXA 5JDSA 5JO5B 1U3HC 4OLYH 1FAKT 2EIBA 1WC7B 4MQ7B 3WFEH 3GGWB 3LKNB 4LVNB 3DX9B 3QFJA 2HJKB 4JZNA 4JVUA 1NUFA 2YPVL 4QRSA 5KSUB 2M8XA 4KPHH 5FYKL 2AS5M 2Q20A 5TF0A 4PR5A 3HFML 2IGFL 4YHLH 4M48L 3UYPA 4QT5A 1CDGA 4XRCB 4P5KB 3O3BA 3QEQD 2W9EH 1FNGB 4NUJA 3T1FA 1MLCA 1RZ7H 4GS7B 3ZHLA 2Q7YB 4GBXD 4MCZA 1PVHA 5EUKB 5EU6B 4HS3A 3EYFB 4QY8B 4P3WA 2NW2B 1QBLH 4HFWB 2DL9A 3RWIA 4PJFE 1NDMA 3MRCB 5L8KB 1KTDA 2X9WA 1KGCE 1T5WB 2VE6A 5A43C 3I75A 5DSCB 3O2VH 1HWHB 5HJ3A 5DO2D 1GGCL 5IMOA 5T5NF 4R7DB 1LO5B 1KIPB 1BX2B 2R23B 2W07A 5GRZA 1KB5A 4MA8L 3S5LG 1KXQE 1TVHB 4PJXA 2R2EB 1PFCA 3CK0L 4ZAKB 1CF8H 2D9QB 1NCCH 4PJ7B 3OAYH 4WI7A 3QG7L 5F70A 4OF6A 3ME0A 2DD8L 1Q1JL 4LCWA 3TZVA 3WMSA 1UEMA 1BJ1J 3VFTA 4E9LA 3T8XA 5E5UB 4CVZA 2BXZA 5ICXA 2DDQH 2DQDH 3NPSB 4ZXBB 2ZOKA 4DW2L 1P6FA 5K59E 3EYVB 3ZYIA 5IFHL 4P57B 2O5XL 2CDEA 3T77A 4QHMB 5ESQA 4MAYC 3OAZK 3MUHL 2V9QA 1NCBL 4NT6B 3X3FH 3RUGA 1OT2A 4MA1B 4EBQL 5JW3L 1PSKH 1QBAA 5JORA 7CGTA 1RIHH 2AJYH 3QEUA 3CMGA 4MLSA 3W2DH 4AG4L 1SY6L 5D93B 5DQDL 5E5MB 5K33A 3C6SB 3FO9A 1LO4H 2FEDD 1KV3A 4F7TA 4Q9QL 3QEQA 32C2A 1JYNA 4XBGA 5LG1A 2JKXA 3ETBF 1IT9H 4GBXA 3UTTB 3LQAH 2VQ1A 2CK0H 1FH5L 1T20B 3H42H 4LLMA 2G60L 1VB9A 2BNQA 2Q1EA 1F13A 4XCEB 4LPUA 3TWCL 4LLDB 1FL3B 2XRAL 1XGQA 1KTKE 3MOQA 4U6HA 5DUPL 5C0AB 4AEIL 1A64A 3C09B 4DGVH 4TSCH 3S4SG 3UTOA 4CVUA 1I9JL 2P8MB 4M61B 3TT1L 3U83A 2GTZB 2FIRT 4POZC 1ZAGA 4X6CE 2W0FB 1JF6A 2OK0H 1QOKA 5DK2A 3S36X 4XCYA 4IOSD 3X14B 5GZOD 1FNFA 2FL5B 1T21B 3QB7C 4JG0L 4Y5VB 3RIFK 1CU4H 2CJUH 4FMKA 5K9KB 2EC8A 1U8OB 4NO2A 3QCUL 4LVOC 4BH8A 3V4UL 1H3GA 1R3JB 3MREA 3BGFC 4XNUH 2NNAB 4NPYA 2DOCA 1BIIB 2VAAB 1G7QB 4I5BB 4Q9RH 4XNZB 2BX5A 5FDWA 1QBBA 3U36B 1BFVH 3SE3A 1GGYA 1PW3A 1W72A 2IAMC 4HG4J 5A2KH 2DTMH 3MV7E 5IQ9B 1KTLA 3U30B 1UJ3C 3CDCA 1VESA 5ID0A 5F7EH 2RCSL 3V6ZB 1CFQA 1YQ2A 5IKCB 2CO7B 1MRFL 3G08A 4OM0L 4KJYB 5F9WC 4ZG1A 4OZHB 5FO7B 5SWZB 3W82A 1Y18A 1INQB 2DIJA 3VFNA 2HT3C 4E41D 3MLXH 4OZFB 4JFOB 3I84A 3FT2A 1CL7I 3QDJD 2Q6WB 1WBYB 2P5WE 4GRMB 1UYWH 4PP1D 2QSQA 4J7RA 4EVNA 5E2WH 2SEBB 4IMKC 3QIBA 3NIFF 4UV7L 5SX5K 3T4YB 2Z4QA 3BJLA 1KPVA 2GTWA 4HIHA 5FUOL 1BBJB 1K5NB 1L7TL 3FMGL 3MV8D 4WV1C 5JXEA 4R26L 2VZSA 2XPGB 4UDTA 4JDVB 2JE8A 4JFDA 3KVQA 4JJ5B 2DLHA 4MCYB 4CVXB 2D0FA 3CFDB 3GBML 3GMLA 3PQYB 2H3NA 1A6WH 5FYJL 1IZKA 2FB4H 4MJ5B 1HQ4B 4Z77B 1GL4B 4EN3B 3F5WA 3TBVB 1KIRB 2VISA 1EUUA 1CS6A 1EJ6A 4XI5D 1KNOA 3B6SB 5E9DB 5I8CB 2CSPA 4I4WB 4JKMA 4DOHE 3N9GL 3M07A 1EAPB 3BX7C 1VFBB 3QO0B 3ISWA 3O3EB 4C54A 5EN2B 1MCSA 2X4TA 3Q3GA 1MFDL 5IROC 2X4OA 2P44B 1H15A 2DKUA 3DECA 4BFIA 3LN4B 2O5ZH 4KY1H 4FQXC 4LFHG 3TA3C 5CJQL 5HPMA 2UYLA 5FO8B 1NGYB 1R3LA 5CJ8A 3IU4L 5I1HL 2X89D 3A0OA 4K9EC 4KI5C 4EJ1C 4XAWL 1RHFA 1P7QA 5CP3H 5B8CA 4JFEE 4M00A 1LNUA 4OCNC 2UZXB 1P2CA 3P77B 2YD6A 4X6BB 1HE7A 1XR8B 3JVGA 4MZ3A 4IRSD 1KENH 1LP9F 2VLRD 4HUNB 4EUPG 3QZWG 2JJTA 5GHWL 2R2HB 4D9RE 4NSKB 5IESL 2UVFA 5T1MB 4R8WH 4Y4KA 1XGTB 4WFED 1IFHL 1N5YH 3FQTA 3MV8A 4P9HH 5FV1L 4M1CD 3BDBA 3FO0H 4ETYA 3B9DA 3GSXA 3EIFA 2P46B 2E7LC 4BQ6A 2OX5A 4KROC 3TESA 4YNYA 2G9HA 1KJVA 3MOBL 2O5YH 4G7VL 2P24A 4WI6A 3RP1A 2ZPKH 4U1LB 3TPUA 4Z7WE 2DB8A 4R90L 1UZ6F 4NOFA 3S5LB 2A6DA 3ILQC 4WUUD 4OFVA 3EO1A 1WBZB 4LVHB 3NZHL 1JYWA 3RTQB 4OIBA 4LSSH 1FNSL 2FWOB 1MIML 1AFVL 4ODWA 3ELAT 4WTXA 5BMFL 3BGMB 5DD6A 4KKAD 1JHLL 5CP3A 4D3CL 1F6FB 3KPSA 2PYEB 2Q8AL 5IJVA 4TUKL 5EULV 5D7LA 3CFEB 1S3KL 1PG7H 4C56D 1SJEA 1AQDB 1UH4A 3P9LA 1FDLL 2G75B 3H9SB 3MLYH 2OJEB 1X4XA 1MHHB 4NO3B 4PJCF 5DQ9B 3ARBB 4NQUA 5FYKE 4N1EA 1FLRL 2HKHL 3GMOB 5SWSD 2I9TB 1UB5A 3U0WL 4Z7UA 1R5WA 3QJFB 5T1DH 4MNQE 1U8IB 4IIQC 4KJQD 1OSZB 3WXWL 5MEPB 1TTFA 3JUYA 1RUKL 4PJEF 1B2WL 3INUL 1G6RB 3FO2A 2BVOA 3RWFA 2BDNH 4EQ3A 3SKNB 1D5BB 4HMDA 5AAMA 5T3ZH 4HDIA 1WWBX 3QI9B 2PYFB 4IRZL 4JM2F 4NN7B 2EXYD 4U6TA 4UI2A 3MJ7A 4XXDB 2X4UA 5GZNC 4JO3H 3B9VA 1OTUC 3HI1A 4HIXL 5D7SH 5E8NA 3H9HB 4G6JH 1P4BH 3WHE1 1YMME 2PETA 5D2NA 2OTUB 3OKMB 1VEMA 4IDJH 5CEXB 4LAQL 3S4SB 2Q86A 1H3VA 1W72L 5INCB 1G0YR 1YEFH 2BJMH 2QQNL 5MEND 4IRJD 2D2OA 2GUOA 1E4KC 5I71C 5D5MB 5F9OL 3U7WH 3RVVD 5FO9B 5I18L 2AV1A 3ARVA 5HGAA 4B41A 5CJOH 3HCVB 3NACH 5ESAB 5KSBA 1YEIL 1JHTA 2R1XB 1NPUA 2PN5A 4GSDH 2OI9C 3SKMB 3TJEL