5EZLA

Crystal structure of fab of parasite invasion inhibitory antibody c1 - monoclinic form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
NVNLLESGGGLVQPGGSLNLSCAASGFDFSRYWMSWARQAPGKGQEWIGEINPGSSTIKYTPSLKDKFIISRDNAKNTLYLQMSKVSSEDTALYYCARYGSYVYAMDYWGPGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab c12
total genus 42
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezlA01
4LHUD 5ERWB 3KJ4C 3LKOB 4NQXA 3VXUB 4I18C 1ORSA 3QEUB 2VYRE 3BN9C 2QJDA 1OSZA 4MDJA 4PJCF 4WW2C 1J0IA 1IC1A 5T1DL 4HG4K 1VGKB 3KYKL 4N0YL 4RRPA 3ZT5A 1H5BC 2Y5EA 3BQUC 3OJDA 4GQPH 1RIHL 4ODSL 5TF1H 2YC1B 3GSXB 3BZEA 3PQYA 4X6CE 4JQVC 3VXUD 1S9VB 1GZPA 4RA3A 4ZS7L 1IGTA 1HHHB 3SDAB 2XN9A 4PFEA 5L2KB 3MRCB 2I07B 4IS6A 5JXAH 2CUIA 1GCFA 1X5IA 4HUXA 3EFDL 4WCYL 3AS2A 1MCRA 4L8DA 4IMKA 1ZLWK 3NAAH 5J89A 3CGTA 4OM1H 3C5ZC 4WUKH 2P8LB 2YXMA 3KXFA 4IMKC 3O2VH 1HSBB 3LEXA 3VA2C 5J13C 1U0QA 2VR5A 3TO4A 4YFLI 3C2AL 1MIML 2AJXL 3B5GA 4OV5B 2OL3B 5I1DB 5SWSE 4OQ1A 1P84K 3KYOA 4U6YB 5FKAB 2IGFL 1SY6H 4JPKH 4M6MH 1RMFL 5B38G 1IGMH 2VAAB 4D0BA 1CLZH 4XHQA 3OMZA 4QYOA 4YGVA 1NBQA 4X4YA 1I9RH 4IRJB 3TVMB 3W9DB 4S1SL 1T20B 2VZUA 3NCMA 3LD8C 1MRFH 5HY9B 2Q8AL 3T3MF 2P5WB 1MHCA 5I1JH 1OY3B 2GY5A 3ILQC 4AIZB 3JVGA 1TZGH 1HOCA 2NTFA 2FRGP 5K9QG 2BCKB 4F57H 3N1PC 1BAFH 1JGLH 2FR4A 3MOBL 5HPMB 3P3YA 1NCAH 4C4KT 1JWMB 2VABA 5IFJA 3T3ME 4MAYD 1UWXK 3QQNA 1U3HD 3S35H 3QI9B 5C6PB 3T2NH 5CMAB 4XNMA 1MRCL 1VFAA 5A2FA 3MGAA 1X5ZA 3W82A 2X4SB 5EH1A 3QUXC 1BF8A 4U6VL 4QF1B 4PJ7F 5D70H 1HHIB 2BCKA 2HT2C 4D94A 4KAQL 4Z7OE 1ZEAH 2DYPB 3CLEH 2AJSL 3WNOA 3OPZL 5L8KB 2PW1A 1OD7A 2XWJA 4QHLB 2V2TA 1RZFL 1B4JH 2VIRA 5HPMA 1RZIA 2AAVA 1I7TB 2HH0H 2V17H 32C2B 4E9LA 2DB8A 3K8MA 5BCAA 2J88H 2A6DA 1MFAL 4X99A 4I8DA 1T20A 3S4SG 1WTLA 4GKZB 1KB5H 4MWFA 1TJIH 1RZ8B 1MCHA 5JLZA 4ZOCA 3FB5A 4ZAKC 1HHJA 3MRQA 1J0YA 2W07A 1T2QH 5DHYA 2JJTA 2RHEA 2PW1B 4BSJA 4LLVA 1A7OL 5DJ8A 1ED3B 4H1LA 4XI5C 5T5FL 4M6ML 1URLA 1FVDA 1KPUB 5F7DB 4MXWH 5BV7C 4HH9B 3LMJH 3SE9H 1IGFH 4J3VA 1DE4A 2B5IC 2ICCA 3KPTA 3RGVB 4ONGH 3BISA 3DSFH 5ESQA 3BPLB 1NC2A 5K33A 1IEAB 2FX7H 5EO0A 1A7RH 1D5BB 2B20A 4PRBB 3U0WL 4A6YA 3KYOB 3I9GL 3SO5A 5DEFA 4FNLH 4LGPB 5DEZA 3DGCR 4PJDE 5H35B 4KZEH 4ZYKA 3MRQB 1J11A 1NSNH 3O0RL 2NY1B 4FQPA 4OCXL 5DI8B 2DQTL 1FVCA 2GIYA 2Y06L 1KV3A 1EXUB 5F3BA 1ZT1A 4YHYC 3V6OA 3SDCC 1MJUH 3AY4A 4P3WA 4GAJH 5J0BA 4JFHD 4ZFZA 5BS0B 3ARDB 4LCUB 2YUWA 1GHFL 5JQHC 1L0YA 2XG4A 5EOQL 3U0PB 3T2NL 4EI5B 3ZL4H 2EIEA 1I85A 3C6LA 3GSNH 3VXTB 3MPCA 3KPMB 3JV4B 1CDGA 2K7PA 4QXUL 2NY2D 4PRID 1JNJA 4EDXB 2BVUA 4XVUC 1G6RL 2D7TL 4L3EA 4P99A 1OTSD 4MGXA 4AYFA 5ADOH 2VZ3A 2X4RA 1IEBA 5IW3A 4Y88A 5HYJA 3OB0K 5C0RL 1HILB 2Z4QB 1N8ZA 1ZE3C 2O5YH 4NO3A 3R0NA 1MHEB 1Q1JH 2YKLL 1I9EA 5BRZD 2VLJD 2VISA 3DTXB 2XQYK 1AIFA 1G1YA 1G7JA 4OSUL 3MRHB 4R3SB 4C55A 3AB0C 5ISZD 4JCMA 4TUKH 3TV3L 2R0WH 2LAGB 2HKHL 4LF3A 4J12A 3FQTB 4NC2B 4M1GH 3RU8L 4Y16C 1MCOH 1UH3A 5F1KC 3NH7L 1YY8A 1S7RB 2RCSH 2CKBL 3DUUB 5C0IB 2E7HA 3U46A 2BNQA 5D1XA 4Z7QE 3PL6C 1W0WB 4TTGA 2GAZB 5GZND 3RWEA 5F1IA 4ZDHB 2VAJA 3NN8B 3BPCB 3SE9L 2FYYA 1LP9B 4W6WB 3PQYE 4PV8A 2QQKL 1DN0B 1PX3A 3ALWA 3EHBD 1Y6NR 5I66A 3VH8B 2VB5A 3HR5B 5DJ0B 4LCWA 4Y5YC 5DJZB 2YHGA 3HFMH 3ULUE 4TQEL 2YD9A 1S7RA 4DKFH 4HPYL 3B9KB 4Y5YA 2NTSP 3DMMA 3MV9E 2CO7B 4PJFE 4ODXA 4PRPA 2Z91B 3HMXA 3LN4A 2PW2B 1T0MA 3MLUH 1CLYL 3GHEL 1CK0L 1A7QH 4PJBA 2XFXA 5GGVH 1DEEB 2R1WB 3QEQD 3SCMD 2EEDA 3FN9A 1RK1A 4B5EA 3UROR 2GJ6D 1V7MH 4OUUB 1AGDA 4YEEA 1K8DA 3QG6A 3PJSB 2ED8A 2NW3B 5CILH 5HHOD 4DEPB 4Q9CA 5GS1B 3HI1A 5IFHH 5C0AE 1IJ9A 4OB5L 4WI2A 1LO0L 4HLJA 2PN5A 4D0DA 5CGMA 3O3UN 3ARFD 4OD2B 1I1FA 4L4VD 3IDGB 1I8MB 5CLWA 5F8QC 5CCKL 5I8CA 3C08H 1H0DA 3ZKXB 3VRIA 3V7AG 3OF6A 4KRPC 1YQVH 2Z92B 4NQUA 5C0RH 5L2JA 2FNBA 5F7HA 3P0GB 1KENL 3QRGL 3FJTA 2VDKH 5D9SA 5JUEL 3D1MC 4U1SB 1S78D 1N3NA 2BNUA 4OZGA 2XKUA 1DN2A 1Q9KB 1IBGH 3CLFL 3CFKA 3Q6FB 4KRMB 3DROB 2VUOA 4MNGB 1EJOL 3I6GB 3MYJB 5IVXF 4C56E 5D5ME 5JIIA 4TNWK 3VD7A 1CFSB 3NH7H 3TO4D 5HVGB 5ID1A 1ERNA 5BW7C 4MA3A 3CXDL 1JNNH 5E0QA 5HHQA 4EOWL 4FQHB 1MFDH 3FQTA 1BVKB 5SWSB 3DV4A 3CVHB 1M7IB 1YEIL 4QTIH 1UENA 1ZLVH 3EFDH 2LU4A 3V0WH 1NJ9B 3SDXE 4HKJA 1KXTB 3L3HA 5IB2A 3QJHA 4WHTA 2A0LC 3GHEH 2YK1H 5CSGA 1S9WB 1CK0H 1RUML 1OQOA 4M48L 5CEZE 5D96C 3FOMB 3OZ9H 1Z0NA 3LHPH 5GGUA 5DD6B 3VXRE 2EYSA 4AEEA 4X4XB 4L4VA 4LQFL 3ARZA 1MVUB 1TFHA 1LEGB 3K81A 2XT1B 1ZHBA 2CLVB 4UOW1 4P9HC 3FQWB 1KELL 4MA8L 4ZOAA 5IB2B 4GRMA 3B5HA 3MJ8A 3Q3GB 4MB5A 1IGML 1R0AL 3V6ZA 4XPAH 2FLBT 4J7RA 3ULSB 4R26L 5IW1B 1TTFA 3KNBA 5I1IL 1HIMH 1WFTA 3IDNB 2EDYA 4X4YB 4PJGF 3F6IA 3GI9L 5CWSB 5ILTH 1TIUA 2VAAA 4OUOA 3GO1H 3ZKSD 4JRXD 1YEDA 4MJIB 3IRPX 1OGTB 4C83B 5GJTL 3INUH 5CP3H 4W4OC 2EDQA 1JGLL 1UWEH 2XZQH 2ATPB 3KYNA 1EJOH 2HJFA 1XR8B 5DO2D 5SWSD 5D5MB 1CFQB 3U7AA 3CZJA 3IS1X 4PJFA 2O26U 3GBNH 3QXDA 2BNRA 3C8HA 3ARFC 3CFJB 1QFOA 4NNPH 3X13A 1BQLH 5DS8B 5JIKA 1UEMA 4LCIH 1IRAY 1ZLWH 5MEOB 4KTDL 3EO9L 1RJZB 3LQZA 5DR5H 2AI0H 2OL3L 1EIBA 5K9JL 5F9WC 4GXVH 4CADA 3H0TA 4P5TD 3BZ4B 4NCC2 1WAAF 4YBLC 1A22B 4PJDF 5L7XH 1UCTA 4JM4L 2ARJA 4N9GB 3QQ4B 4JQVA 2BFVH 2A73A 5ISZE 3IS0X 1X7QA 5DDHB 4G6KH 4O02H 5BRZE 32C2A 4FQQA 2XTJC 4HH8A 4TNWF 1Y18A 1FYTB 4GJTB 4HKZB 3VGAB 4K9EH 2QEJA 3UTZB 3GSVB 3T0EE 4MCYA 2ICES 5F7NC 4HXBL 3UO1L 4EVNA 4OLEA 5HVHC 4FRWA 3VXRB 5I19L 1BPVA 5EOCL 3ZDZF 2YRZA 4LU5L 1DVFD 2X9YA 4ZAKA 4Y4FB 2DDQH 3FHAA 4R4ND 4NHCH 2CRZA 1EXUA 5M94B 4LLWA 3DX8B 2DN7A 1IAKB 5F9JA 1KBGH 4XCEB 2VQUA 2HLAA 5F3HA 3U0WH 4RAVB 5F6IC 3I9GH 2CDGA 4KY1L 3STZB 4P2QD 4CUCA 1AP2B 2DQEL 1OCWL 2DQTH 4MHHG 3RHWF 5KVMC 2HN7B 3T0EC 1DLHB 3TIDA 4ZXBC 1OP9A 4KHTL 4GBXC 5F72S 5BZDA 3KS0J 4KROD 3QIUC 2NY3C 2EIBA 4XCCL 5JW4Q 4MJ6B 1IAOA 2HJKA 2WWMC 4NWUL 4OTXH 3I3DA 4H8WL 5F3HB 1FLRL 1QRNB 3FTGB 3OBAA 5HHME 2FATL 2HKFL 2NX5A 3VGEA 3HC4H 5DK0A 3TFKD 1GGBL 3EO9H 1UEYA 2HFTA 5GISH 2EYRB 4RX4D 4OKVA 2AI0L 2OL3H 2PO6B 5ESVB 2W59A 5KW9H 2MCPL 3TBYA 4BK4A 2J3SA 4MWFB 1EO5A 2R9HD 3WD5L 2W91A 2YPLB 4ZO6A 4GXVL 2CDFA 3SCMA 2ZUVA 4QRPB 2XQBL 4AM0B 5DRZA 4P2YA 4H1LB 1XGTB 4GG8B 5DJCB 1IL1A 3HKFA 5DFVC 4FG6D 4KK8C 4WNQB 1CVRA 4PB9L 3SOBL 4Y2DB 2WM0A 1KB5B 1UXSA 4DFHA 3BPNC 1S8DA 1WC7B 2AJVL 5I16B 5CP7B 5EU3A 1CI5A 2A6IB 1LK2B 3L1OH 5C08A 4EI6B 4JHAL 1AGEA 2WW8A 3VXMD 1CFNB 1PW3A 4Z7NF 1J8HB 4GAYA 1KUMA 3EDEA 4QRPA 1XFPA 5C0DB 2ED7A 5DHVA 1KTLA 5E6YA 5D7IB 4XP4L 3T65B 4PJIF 2XTLA 3TYFB 4JRYB 4GW5B 5K59F 4L5FH 3EZJB 2KZ1B 4B0MM 4ODTH 3P11H 3DO7B 4HGWA 5KTEH 4HIIB 2BNRD 3WFBH 3WL9B 1SM3H 3BD5A 4C56A 5IMOB 5DVKA 1P2CB 5F96H 4PRIE 4KQ4H 1J8HA 3P9LB 1NAML 3HS0B 3WIIH 1OTUD 2V5MA 1KIPA 1AGFA 5E9DB 3PE9A 3IDMA 6FABH 4ELKB 2CGRH 1DVFC 3FB8B 4WWKB 4ZFOA 5KANI 5DUMH 1NCCH 3H7LA 1U8KA 3QA3A 1ZVYA 4FQXC 2EDHA 3BKYH 5T1LB 4GKZA 4KFZC 4P46B 2V9QA 5CBAA 1PQZB 2HKFH 1ES0B 2DLTA 3MV8D 3VXSA 5EA0L 4PTUA 3UC0H 5CILL 3MJ9L 5TDOA 4ISVA 5GISL 3JUYA 4EIGB 5BVPH 5BJTA 1EK3A 2H1PL 1PLGL 1A0QH 4O2FB 1MJJA 3K46A 4FABL 4BH7B 1SEBA 1T0NB 3K4ZA 2R69H 4GRLA 1U8MB 2AQ3A 3JWOH 1FZKB 4CL7A 1CL7H 3QUYA 2GTZA 1NAKL 4UINL 1PKQB 2FIKB 3TVMD 1QFPA 1IQDA 4GW5A 4KI5C 4D2NA 1QSFE 1U3JA 1KENH 1ORQB 4RCAA 5I1EH 1NCBH 1I1AD 2I07A 5KAQG 2DQGL 1TENA 5IJKC 4Q6IB 2ZG2A 1FFOB 1JPST 4F7CA 3V0VB 3AY4C 1BFVH 3CFDA 4M3JA 4BELD 3QHTC 1DFBL 1QYGL 5ENWA 1I4FB 1N64L 3MLZL 2ESVE 1QA9A 1FN4A 4L3CB 3P30H 4HUVB 1RK0B 4WWID 3DMMB 3QT2A 3PWLA 1TJGL 4YBLB 4YHIA 4ODHH 1WZMA 3N85H 2YD5A 2X09A 1ZGLP 4Y4HB 2EH8L 5HGAB 4XRCB 3OAZH 1MFDL 3BIBX 4PJ7E 5ITBH 3IFLH 4D8PA 2YZ1A 3MACL 4LSSH 5IF0A 1F13A 5BW7A 1Q9OA 2DM7A 3QFDB 4G80B 4U05A 3ILQD 3H3KA 3KJ6L 3DBXB 1MCPH 2EKSB 4RMQA 1YEJL 1BHGA 5SWZB 1KNOB 2I25N 4NBXB 4OIIL 1J9CT 1Q72L 5HJ3B 4AENA 3VXUA 5D8JH 3S37H 43C9B 4HUVA 1IKNA 3EFFB 3VRLE 5SWQB 3C87A 5ERWA 4R7DA 1HKLL 1IGIH 2OJZL 3B9EA 3LN5A 3MLXH 2J4WL 1CGTA 5I1GH 3BKYL 4LPYA 4APQB 2IG2H 1C12B 2IEPA 1AXIB 4P5KB 3HAEA 3LB6C 5EBLA 4M6OL 2ZNXA 2JB5H 4IHOB 4IOFC 3PHSA 2BSRB 2KBGA 4LEOA 1DSFH 3BIKB 1KJ3L 3KPOB 5H2BB 4LLUA 3HPLA 5F1NA 3ZHLA 5I1IH 4NZUH 2DQJL 1YPZA 1ZHNB 3CD4A 1KJMA 5TE7L 3GI9H 1KIQA 5E8NB 5L2JB 2GEEA 4CVZB 1OPGH 3GRWA 3VWJD 1OGAA 5HHNB 1ZWIB 5MHSD 5FUZL 4OIBA 4ZXBB 3CVHA 3G6DH 5DK2B 3NFPB 1UWEL 2XZQL 3HAEB 3QULB 1FDLL 3RNQB 1HCVA 1F4XL 5E4EC 1F2XK 1HDMA 3HUJA 4JO1H 2A1WL 4Z7WB 1MFCH 4I2XB 4NZRH 2NXYB 3MRRB 1G9MC 1NGZA 5DJ2B 1QBBA 3TVMC 3QQ4A 3CCHA 1WIOA 4U1HB 1BOGB 5FYKL 4K9EC 2AABH 2E8ZA 4KJQC 4MMXC 2CMRL 4PV9B 3CDGB 5IGXL 4KRNA 4Y4FC 5DT1L 2EH8H 3ZDYE 4QRUA 3BI9X 1OAKH 3GMRA 3NIDF 3QUZD 4M02A 3OKDA 4FZ8H 5KSBB 3VD4A 4W6YB 2V7HB 1U8PA 4NZTH 2LAAA 3GK8L 1IAIH 1NMCC 4KC3B 3GMOB 2CLVA 3X12A 2VRAA 4KI5F 4XCFL 4EQ2A 1CXEA 4YHIB 1L0XA 1ZS8B 4OIIH 1G0DA 2AEPL 1NL0L 1XF2B 3HB3C 4Y0GA 2FGWH 3KAAA 1AGCA 5D93B 3W81A 4Z6AT 1F2QA 3IXAB 3MXVH 5HYJD 4NO0A 4G7YL 5I71B 1X9QA 4H25B 2ZG1A 3G6AA 4N8VA 3UTSE 1YEDB 1WC7A 4BQ9A 4DW2L 5GRUH 4P2RA 1KEML 4OF5A 1XIWC 5DLMH 1N0XH 4RMTA 1N5YH 3MV01 1NANI 4HFUL 4ODWA 1DSFL 2CUMA 1FE8L 3D0LA 4LASH 5KSBF 4UTBH 1DBBL 4RBPH 3SO3C 3R0MA 4PGCA 4UBDC 2IH1B 2WZPD 3QUXD 1X4XA 2SEBA 5D1ZD 3OKNB 3IAGC 1FNAA 5I1KH 1EO8L 3GHBL 4J1UA 3HZVA 2D7PA 1CN4A 3TT1L 3GEWB 1EFXD 1JHTB 1G9ML 4OKVB 4V1DA 1OM3H 4F2MB 3QWRA 4BM7A 1E4XH 3BH8B 3P77B 1BZ7B 3NA9L 3MRPB 1EEYA 2NZ9C 2W0LA 5B4MC 1NC2D 1BOYA 1J87A 3BWAA 3TBTB 3QUYD 3NTCL 4YDIH 4PLOB 1X4YA 4QRQA 4R97C 5BZDB 2GW5A 4HPOL 5AG8A 2IADB 4UDUB 5EG6C 5GQBA 1IZJA 4HH9A 1CXIA 4EZMA 4JCLA 1KPRB 2W1NA 1SJEA 5EFIB 4AEHL 4ZUSB 1BX2A 2EDJA 3U9UA 3FKUS 1MCLA 2YBRB 3F5WB 1EVTC 3VFNB 1CD1A 2KH2B 5T3XE 4V2CB 3LH2H 3BESR 5HHPA 3TNMB 1C5CL 4EUPA 4EBQH 2XOTA 1SYVA 1UFUA 2G5RA 4X98A 2YD4A 4K55A 1XZ0B 4M5YL 5EPMA 3D87B 5I1HH 1RUKL 3HNVL 4PV9A 4PB9H 1FZKA 4HBQA 3D69B 3SOBH 4Y1AB 4OZHB 3SCMC 5GS2H 3NIDE 2FGWL 5F3BB 3IGAA 4YHZH 2J8UB 2NY0C 3WUWG 3FO2B 3IFOB 3T2OA 3MFFA 4I5BA 1H8NA 5IMOA 4P2OB 4YHML 5HHMB 5TQ0H 3SQOL 5I16A 2CKBB 1BVLA 5GRUL 4XVJL 3FB5B 3C6LC 2ZUQB 3IKKA 5C0JB 4M8QA 1BWMA 3ZE0E 5D7IA 3IDMB 4N0CC 3L5WA 1FE8H 4N9OB 4BSVA 3O9WC 4XVSL 4G42B 2HFFA 4KAQH 1ZEAL 1MFNA 4EJ1C 5EIIA 5F96L 3B2VH 2DTML 5FGSA 5CBAB 2PR4L 5BZWB 1BECA 1NCDH 3WIIL 3U4BH 2Q3AA 3G6JA 4J3XA 4Y5XC 2YSSB 1MCDA 3ARDC 3DI2B 5EWIH 3OF6D 5E03A 5KAQF 1TZHA 1I1RA 1KB5L 4QOKE 4YPJA 5SV3A 4ZOEA 1UXWA 4HCRH 1RU9L 4ZQKA 2R2BA 4QY8B 4L8CA 1QSFD 5LVEA 1IZKA 43C9A 1G9NH 1PQZA 1T2QL 2WWKO 4PD4J 4Z0BL 1CFVH 2PXYB 5T3ZL 4R90L 2EDEA 2PO6A 5E7FA 1N6UA 1A21A 1QBLH 2BNQD 2XZCL 1KLUB 5ACZA 3LH2L 2GYSA 1LO3H 1U58B 5DHVB 5DFWH 5MERB 4ODVL 5ADPH 5JMRA 4GKSA 1JPTH 3FT4B 4GG8A 3I02B 4PG2C 5SWZD 1NFDA 4PJEF 4HZLA 3MRKA 4FNLL 2FX9H 4JFOA 4MJID 2NLJA 4JRXB 1I3GL 4TSBH 5J6HA 1S8DB 1JTTA 2P44B 2Y06H 1V3JA 4FFWD 3VGDA 4NHUB 2FEDC 4KWUA 3G6JB 4U1NA 5D7LA 3HA0A 1IE5A 2G60H 2UZXB 4G3YL 5HGHB 3U6RB 3CFDB 5GGRA 5E2TL 5E9DA 3T8XB 1XMWA 1KLUA 1U92A 4F7CB 5JW5B 4CAGA 3S34H 4XVJH 2WMPA 2X70B 4ZSOE 3HHRB 4RQQB 3T0VA 3BHBA 5BV7H 3EYFA 2C1PB 4LLMB 2XXCB 3O81A 3IDIB 5B39B 5F9AC 2UVFA 1PVHA 1G6RH 2D7TH 5GSRA 4YC2B 4KK9C 1KC5H 1QBML 1UA6L 1QQDB 4KKBD 3D39D 4PJIB 3FRPG 4NRZB 1NCDL 4NZJA 3OGCA 5IOPB 2BHZA 3KPPA 4I77H 3WFCL 5CUSL 3U4EA 2Q6WB 4HMCA 3HI5H 5SX4H 1M05B 4BSVB 4KUCF 4HULB 3RVWD 3LPFA 1ZT7B 1CE1L 4OGYH 3PWNA 3MO1A 3LQMA 3EJYC 4HK0A 4PJXE 5I1GL 3RX7A 3BUYA 5D5MA 2HVJA 1S78C 5E8OA 5IV2A 1S5HB 1W8OA 2OTPA 2Y07L 1CGWA 2BVTA 4LPXA 4S2SB 3T0DA 5IBLD 2BRRH 4JFZH 2ZUYA 2FEEI 2G9HB 1KG0B 3LQZB 3IETA 5IMKB 1BZ9A 4NZUL 3FOLA 1XGQA 5ANME 3VFUB 4Y8AA 2R4RL 2HG5A 1JYXA 4QY8A 3QBTB 1CF8L 1OARH 4JG1H 3WXWH 1I1FB 3ROLB 1E6JL 5D7SH 2MQ3A 5FUZH 4DK3A 2QL1A 5JHLL 1C5DB 5JORA 2JB6A 5CJXA 1UJTA 1FDLH 4NN7C 4HS6B 2EZ0D 3GSRB 4XC1H 1X7QB 5DDHA 1PYWB 1U3HB 4KJPC 2ZUXA 2LVEA 2D31A 4NZRL 3LV3B 3X14A 5FM8A 5GGUB 3H9YA 4JANB 1OP3K 5JO5B 4YAQA 3C9NB 5IVOA 4P23C 3KYNB 5E9DE 1VACA 1HQ4B 5IGXH 1E6OH 1RJYB 5DMYA 1KXVC 1NCWL 1UKTA 1GXEA 4PLJD 5E6IA 2MFNA 2ED9A 3OR7A 4RGOH 1IM9A 3O8XB 5CJQL 2YPLD 2EDFA 2XNAA 3S4SA 3SGKC 4IOIA 3T0ED 1MHPH 4RQQA 4LPUA 3C8KB 5HPOA 4KUZH 1RZJC 4F15C 4ZS6C 4J8RA 1CDBA 3REWB 1CL7I 1QRND 1X5FA 3VDAA 2KKQA 2VOTA 1DEEA 3G08A 3ES6A 3GB7B 3BW9A 4XAKD 4U4BA 2Y5TA 5CBEA 1VESA 2D03H 4PJ9C 5HD8C 1T66D 5DUBA 1CDJA 5B39G 1AQDB 3RY6C 1UADC 3B9KD 3CXDH 1AC6A 4W6XB 4XBPB 1S9VA 4O2CA 5C08D 4LASL 4QOKA 2VZTA 1ACZA 5C0EA 2B4CC 3IU4H 3QHFL 4BFGA 1SEQL 3B8SA 3CSGA 3HZKA 3CCHB 4JFFD 3QDMB 5GPRA 1LK3L 2I60H 4RA0C 4HUWB 4JEGB 3HNTH 1KJMB 5C0BD 4ZNCD 3VFOB 3WXWL 2IH3B 5ANMA 3M1BA 3E2HC 1U8JA 5IEKA 3GHBH 4J4PC 5EO1B 3RL1A 2NNAA 4WW2A 2C26A 1J5OH 2BVQB 5BO1L 1L6ZA 4JZJB 1YNKH 2ITCB 4K2UH 1XF5A 1XT5A 3NA9H 1HZHL 2YK1L 3X12B 2GSGB 3X17A 3U0PA 1XGRA 3GJEB 5INDA 1DDHA 5BXFB 3FB7B 3FQXA 3O6MH 2JELL 1MFEH 5FGCE 4HPOH 5JOFA 1DLFH 4LK4A 4NKOA 2VLRA 1ONQA 4LQ1A 2ZZUT 3TBWA 1BOGA 1RHHA 4NKMB 3SKNA 5FV1L 3ARED 1D5MB 1KLFA 3BPOC 1QKZL 4YDVB 3QHZL 3RVTD 4MD4A 4N1EA 1ZHKA 4MA1B 5C7XH 1W72B 2R23A 5CZXC 4QHUB 2ZSWA 3N1GC 1JF1A 2NXYC 5LXGH 5I1HL 4N0FA 2XY2A 3ZKXC 1HQ4A 3GIZH 3AS3A 5D6DC 1OAXL 2I24N 3PDOB 3ULUC 5BMFL 1I1AB 5FYLD 5J11C 1D5MA 1A47A 4FFVD 1KFAL 1G7PB 2NNAB 4G6FB 1FZOB 2BXYA 1JHTA 4YDJA 3PWUA 2CH8A 2OI9B 2XACC 1KJ2A 3FCTB 3IRZA 3FT2A 1FAKT 4ORGB 3VFWA 5KN5B 2VQ1B 2YUVA 2AEQL 2FO1A 1YDPB 2BSSB 3REWA 4HIEB 3N1MC 3OKYA 5B38A 3FFCA 3IJYA 4LVNB 3CPLA 4OCSL 1K9TA 3VGFA 5C0GB 4XPFL 3KPLA 4QNPE 1G7QB 4U1HA 2VDLL 2XWTA 3DX9A 4K8RL 4Y2DC 1C5BL 5GRYA 1CT8A 5FYKU 4OZFB 5D2NC 2FIKA 4OF7A 4P59H 2VQ1A 2LU7A 5FK9B 1CDHA 3LSOA 3WN5A 3RY4A 3BRFA 3NAAL 3KLAA 3D2UB 4X8JB 3T04D 4LNRA 1TTGA 5DJXA 1CWVA 3RUGB 3ULVD 5A1AA 1K85A 3D6GA 1A3LH 1UCBL 4LARL 4I48A 1MCCA 5JW4M 1EHNA 4WFFE 3QIWB 4IJ3B 2QQNL 4BZ2L 3QEGH 5FV2A 4JDTH 2AK4B 4J4PD 3QRFM 3C60C 4KRLB 4QXGH 4ERSL 1A14H 2ADJB 3BFOA 3HE6A 1JZ4A 4NO3B 5C7XL 4HS8L 4WFEE 5HXMA 1JPTL 2JCCA 4LVHB 5E08L 5LGHH 4ZFOL 2RFXA 2C5DC 3E0GA 4LVHC 2HT4D 1VEPA 1ZT1B 4GOSA 1NANH 3HZYA 4WWKA 5DI8A 1J1PH 2E9BA 3QCVL 3GM8A 3WCYA 4NRYA 1NGXA 5HVFB 4TSBL 4X5WA 4LCWD 5IT2L 4PG2A 1Q8MA 4LRNL 5IHUL 2F54D 1BMGA 2G60L 5CJ5A 1G84A 3LQAH 4PRHD 4ZNEA 1R3JB 3LB6D 3BGFB 1BWWA 3RDTA 3RWDA 1LK2A 5D6CB 4I9WE 4Z5RA 5I1LA 4KMTL 3V9FA 2VXQH 3VXSD 1ACYH 1OQXA 3PNWA 3S36H 4F8QA 3O9WB 1I7TA 1AJ7L 5JOPE 2NXZD 2MHAB 1QSEB 4MX7A 4NC1C 3HRZA 5K9KB 4LEOB 2X05A 4M1CD 25C8H 3CVHH 4K8RH 3RTQB 1OOAA 1A1NB 2A74B 3CH1A 3OPZH 5ITFA 1CLCA 1H0DB 3DVFA 4FFVC 2N1KA 5HDQH 1WV7T 5E8OB 5GSRB 3G5YB 2PCPA 5ALBH 1QRNE 3DVIA 4YE4H 3WFCH 3UTOA 2A6IA 5C08B 4M5ZL 4NPYB 3GKWH 3GSQA 3BSZL 3VGBA 4KI5D 3GDBA 3U4AA 3P9LA 1AGDB 3LKQB 2F9BT 4UTAL 4N90D 3VRLF 5AAWA 3B8YA 4KKLD 1JRHL 3L1OL 3H9HA 1PZUB 5D5MF 2JJWA 3EBAA 4HIHB 1IGYB 2XZAL 3DVGB 2Q86A 1JHLH 3VI3E 4CVXB 2K3TA 2CXGA 1MNUL 2BSED 4PJGE 1F8TL 2YMXL 3X3FH 4OV6F 4NPYA 4GRWF 4P5MA 2AXFA 3GIVA 3PL6A 4TTDD 1WBXA 3RWJB 4X9HA 5IFAH 2DOCA 1MJJB 4R9HA 2RIKA 3ARSA 3O41B 5J3HD 1PYWA 1U3HA 3RPIA 4JY5L 1B0RA 4JPVH 4JN1H 5TJWK 3V4PH 7CGTA 1T1ZB 4NO2A 5DVNA 1B90A 3KPRD 2H6PA 5EUOA 2PUQT 3MRFA 2O61A 4LCCB 4OCWL 2HMID 5DXWA 1HQRB 4R97B 5GS0C 3PWPB 3OXSB 4KZEL 1KGCD 4LSUH 4Q9QH 3RI5K 4A6YH 3MRBA 1ORSB 4Z76A 3MOAH 3UTSB 3OL2A 2OQJB 1X3DA 4JFEB 5KVEH 3MV11 3OB8A 3QPQC 3K80A 1JHKL 2P8MB 3G04A 5F70A 3VA6A 1MY5A 3RIAF 4Y19E 2MKWA 4XNYL 1RJLA 5FB8A 1WWCA 5DRNA 4HGMA 1WIPA 2DI9A 4U7KA 3S36L 3BUYB 5BVPL 2YXFA 4QXUH 3P9WB 1HOCB 3MBXL 3MO1B 4X7TA 5AZ2H 4R0LA 3CVHL 3JWOL 3HR6A 2IAMB 5IJVB 5ADOL 2AEIT 2G5BB 4YK4C 5IW1A 2F53B 1F58H 5HDQL 3O8XA 4XBEL 3L6FB 1KG0A 2NY4C 3C5JB 1P1ZA 5F7LB 1E4WL 3TN0A 4GG6B 1MAML 5MERA 4O4YH 4OT1L 5KSUA 2VTFA 4UB0H 3RX8A 2VLRE 5CEZH 3MRJA 3MROB 4KPHL 4ZUTA 2X1QA 2H2PD 3ARBD 3CAFA 4F7EA 4OFDA 3QFJB 4H0HB 1R3HA 4MJ2A 1S7SA 5IVZA 3PWPA 3VWJC 2ADGB 2HTLD 4NQEE 3LAFA 2NY2B 1DQQA 3IT8D 4YXHL 4CRPA 4DCQA 1P1ZB 2XZAH 5FO7A 3L3GA 4DZ8A 3ARBB 2VIRB 3F58L 5J13B 3LEXB 2R0LL 1MQ8A 1DBJH 3QUMB 2D9CA 1PZ5A 4KHXL 5E99H 4N5UA 1SHMA 4G9DB 1S7SB 1C8PA 1RUAL 1VFMA 5SWSA 4M8VA 4QRTB 4Y16A 2AV1A 1HHKB 3IFLL 5T3XL 3TNMA 4OCWH 5HVHB 5D7LD 4NN5C 1FFPB 3ULUF 4ZSOB 3JTSB 3IJYB 1KN2H 4XVTH 3P0VH 4OJFH 5GGTA 1MJ7H 3JWDH 1RVFH 2A73B 1L0QA 2LABA 4WI6A 2V5YA 2A6KB 1BFTA 1S7QB 1UB6A 1ZT4B 2GJ6E 5HI3C 4U1IA 4KVCH 1HKLH 1RJZA 4WENB 4L4VB 1FG2B 1VERA 1YUHB 4X6DE 2NW2A 4UQ3A 1FGVH 1N6QL 4BKLB 3MRPA 4M43H 3D39A 4I4WB 5J4MA 3ULSA 5DJXB 1NPUA 2B8OT 5GS0D 5E94B 3QNXA 4ZTPL 1YC8A 2P8LA 3KXFB 1ZLSL 2JJVA 1AFVL 2MPAL 4U31A 5CCKH 4UNTA 1Z3GH 5J9PB 3MGOA 4MJIA 2JCCF 4XBEH 4X4XA 1L7TH 1H8OA 1PY9A 2GJJA 5CINH 3RUGE 5BOPA 1FJ1A 2DRUA 4J3WA 5J1AA 1I8IB 4UB0L 2VDKL 4LPWA 4MNQA 3KJ4B 1IC7L 5IJKA 1IGTB 2HFEB 2W0PA 3T1FA 1OW0A 1PGRB 4YUEH 4I3GA 2FO4A 1T1WA 4XMLH 4JREB 1E4JA 1WUNT 2J6EH 2WIMA 4JFQA 2CRYA 4PY7B 4ETQA 1GOHA 1KGCE 1MLBA 4ZUUA 4LSQH 3D69A 1BIHA 3S5LG 1KB9J 3K1DA 3PWUB 1D9KC 4K3JH 3BEWA 3PP4L 2WUCH 2CO6B 4R96B 2AEQH 2HYMA 5HGBA 1AE6H 4F58H 3EOYG 3ET9F 1DBJL 1A6VH 1UQSB 1JGVL 4MD0A 3K8LA 1R3LA 4OCSH 1GAFL 3WO4B 1JJUA 2FJHB 5DZOA 4YR6A 2ATPA 2FCBA 4HWNA 2YS4A 5I1LB 1FRGH 4HWZA 5T3XH 2CK2A 2RAMA 5IROA 2B1HH 2SEBB 3QFJE 1Y6KR 3QDJA 3P0VL 4OJFL 1DP0A 1FL6B 2GSIB 4XNQB 2H8PA 4L4TA 3UPRA 2AEPH 3FTGA 1A64A 4JDZA 4M48H 2R8SL 3H42H 3IGAB 1MSPA 4KVCL 4CW1A 1AKJD 3JWDC 4U6TA 2VWEE 1RIVH 1PKQE 2BVOA 3FQXB 4LBEA 1CGSL 4PJCE 3DX6A 4G6JH 2CKNA 4HFWB 3VWKD 1DUZB 4I0PA 1KELH 3WXVH 2IJ0C 5DRXA 5JHDA 4XNQA 4XXCC 5FOBB 4FQCL 3KPNA 4GG6F 5DLML 4PJIE 1S9YA 2YD8A 1J1OL 4ERSH 4KXZI 1R5VB 1PAMA 2HLFC 5J6GA 1MUJA 3WHXB 1AFVH 3B2UD 5BRZA 4X80H 4XCEA 2X4OB 3U36B 3QEQA 1Y0LB 3KXFE 5ISZB 4KJWC 5EOTB 2ERJC 1BX2B 4LAQH 1LVEA 2IALA 5E4IA 3WN5C 4XI5D 5C07D 3H3PH 1CFBA 1IEHA 3O9WD 1HNGA 4OD1H 5KVDL 4LLDB 4Z78A 4K8RC 1AGBA 2W92A 5DVLA 3O6KL 1MCFA 1LMKA 1J1PL 4FZEL 2C3WA 4N0RA 2XN9E 1GOGA 3C09C 3UYOD 1U42A 2VXVL 1XH3A 4OGXL 1LHZA 1HH6B 1NCUA 3LSOB 5CKAA 3SKJH 5H94B 1TDQA 3O2DL 4FMFA 2IPUK 5I8CB 3B3IA 5ETUB 4L9DA 2V7NB 1A6ZB 1IVLA 2EDBA 4CVWA 1JMZA 3P9MA 5FUCE 1UM6L 4EDWL 3MRHA 3FB7A 3U2SA 2EDNA 4U33A 1AJ7H 3A6CH 4TULL 5EPMB 3D39E 4PJ5A 4GBXA 1YEKH 2D7MA 2GTZB 2OP4L 1VSCA 3Q6FA 4Y5YB 3RTQA 2AK4A 2YPVH 1NAMB 4I13B 4ENED 4WU5B 4J6RL 1EEUA 4MYWB 4LOUC 4QLRA 5MENE 1WT5A 4XVUD 3GKWL 4K94C 4PJBF 3BSZH 4PTUB 4JG0H 4JO2H 5J12C 3QI9C 5M7QA 3R1GH 4Y16D 3BGAA 3H7BB 4K94L 5F1IB 4ZDHA 3F7RA 4WHYH 4GBXB 2Q7YB 3VXPB 3QNZA 2CIIB 4FXGB 3ZKMC 3OX8B 5I66B 1XF4A 2NXZB 3HPJA 1CGYA 3MNWB 5CIPA 2NR6C 3BRGC 4YDJB 1MCQA 3CMOH 5EBGA 4YFEA 5DQJB 3IKCA 1KTRL 2YD3A 3O3DB 4MCZA 1NKRA 4MA7L 1AIFB 2EECA 2BHUA 4U3XA 3HCVB 3FN0L 5H37H 3RGHA 3IFPA 3C6LB 4YHNB 1LNUA 4GS7C 3QG6B 4JVUA 3RY5A 4DJMA 1BBJA 5DTFA 3LY6A 1IT9H 3JZ7A 4OUUA 2A9NH 4Z7UE 2DIAA 5F1OB 4ZS6D 4KY1H 1PZ5B 2XA8H 4XGZA 5EUOF 2E7LA 1J12A 3CSPA 4OD1L 5KVDH 2PR4H 5JXAL 3MOQA 3NCFB 4LSUL 5AYUL 2LV4A 3HAEH 4I3SH 4P46D 1WITA 2FJFB 2AERT 4DUXA 3H9SA 5EWIL 3SJVD 3MYZA 2Z4QA 4OGXH 4OM1L 5IHZB 4JFEE 3STBA 2EO1A 5C0BA 3PWLB 4O5LL 4NQSB 4NWUH 1GZQB 4H8WH 4Y5VA 1D5BA 1P6FA 1RU9H 4GFTB 3WFHB 4F8TA 2CPCA 2QR0A 3CDCA 3MLTB 4KJWD 5EIQA 1DN0A 1YJDC 4OLXH 4WO4B 2AJYH 3UTQB 4HCRA 1B0GA 1KIRB 4D8PB 4HJGA 4XP9H 2D2OA 3LDBC 2P7TA 5KW9L 5C71A 4X4MA 1SJXA 3SE3C 1MJ8H 2DTSA 1RMFH 2YD6A 4H26B 4JAMA 4IDJL 4UT9H 1JZ3A 3LZFL 4L8SC 4LCUA 4YXKH 5LWYL 1KNOA 3FMGH 1VGEH 3BGFC 1FO0L 1QQDA 1K8IA 1K6QH 4HAFA 1JNLL 3ROLA 1CICC 1MRFL 2N4IA 5IQ7H 43CAA 4L29A 5I1JL 3O8XC 3RWFA 4NKDB 1YC7A 1IKFL 4BH7A 1CGUA 4TUJB 3MV7B 4U1LB 2ICWJ 4G3YH 4NC1E 3QEHA 4JFDA 2EZ0C 2C4FU 5D72L 4PGBA 2X41A 1G7HB 4PYHA 3SBWA 6CGTA 3HG1D 1PG7H 1P4IH 4LOUD 5CHNA 4LCYA 3PIQA 5D2NA 3QUMA 1X5XA 4RFEA 4W4NA 3WE6B 4OGAC 3K2UL 1OAZL 2YPKB 5MI0B 3I6KB 2NX5D 2AW2A 3U7WL 5E8EB 2WBWB 3W0WD 3I02A 2W65B 4LSRH 1NMAL 2A77L 4O00A 3SO3B 4Z7UB 3O6FA 1RK0A 2OXGA 1U8KB 1T7YA 5EZOL 1T21A 4MDIB 3LCYA 2VDOL 3SGEH 2AV7A 2VDNL 2XYCA 3PF2A 4RISL 5FKPA 2AKRA 2OJEA 4GXUM 1QFWL 1C5DA 3JWOC 5JORB 3VXQB 5HYSA 4O51A 3DUSB 3VMPA 4DVRH 4UIKL 4O2FA 3I6LD 3QSKB 2WBKA 2VDPH 3BXNA 4G8GE 2VLLB 2RB8A 2X40A 3TCXA 5JDSB 5C07E 1XGYL 1I8IA 4DGVH 4NUJA 5DRWA 4XP9L 5J11B 3LKNB 2H1PH 2NCMA 2AV7B 1L7IH 2P48B 1RAMA 2IFFL 5FYKE 1T66C 1FNEA 2MPAH 5CKGA 1CL7L 3V5KB 5C9JA 4MZ3A 2JK5B 3FHQA 1YJDH 1Z3GL 4HD9A 3UYPA 5EBWA 4YHOH 5L6YL 1M71A 3M8OH 4LEXH 2VABB 1Z2KA 3LD8B 4LLQB 3NBNA 3ZO0A 2VDQH 2P24A 5FGBC 2OR9L 1CF8H 1OARL 3PWJB 4JG1L 3CDFA 3U4EB 5LCVH 4LRIA 3HG1B 4WV1C 5I6XB 4YX2H 2P7TB 2P8PA 4IRJA 3S36X 3V2AR 5JR1L 1YEHH 1YEEH 4OD3H 5ESVA 1HINH 4L3EE 3G9AB 4PP2B 3FQRA 4U6HA 3I50H 1BVLB 3QG7H 1JPFA 2J6EA 2ZNWA 1AI1H 1JGDA 1QYGH 2Q20A 3PUCA 3WLWD 1NGQL 2AGJL 2BY1A 4XHJD 4EUPH 5CD5C 1P7KB 4PJ8C 1CR9L 3QUMH 1FL6A 1QO3B 1UC6A 4HC1H 4NM4L 1WBZA 2QSCH 5CWSA 5GGTL 4U1JA 1FFRA 2W9DH 1NFIA 4XCNA 3MA9H 2B4CL 1YEFH 3HE6B 1H3XA 1JUFB 2BY0A 2PYEB 4NQCE 4AL8H 3O2WL 3UTZA 4AIOA 1LD9A 1RY7B 1MFBH 3Q3GA 4BQCA 3VG9C 1DBMH 3RVTC 4LPTA 4Y4KC 3BDBA 2MMXA 3OV6A 5EN2B 4GAYB 2VLME 2Z31D 2V5TA 3D3VD 4MJ6A 1U8NA 3V4VL 3CIQA 2VH5L 2DMKA 5E7BA 1MH5A 1Z9LA 1MWAL 1A6UL 2P5WA 4XAKE 3UTTB 1IM3A 1KN4L 1N5AB 2F54B 3AVEA 1KYOK 4CADB 2XRAH 1KPVB 2J5LB 3MV9A 4MXVF 1J1OH 2E6PA 4RX4A 4M1CC 1L7IL 1IAOB 2HJKB 3BD4A 5KBNC 2C4FT 4OFIA 4G6ML 2WINB 4YHPA 4JFXA 5MEOA 5DF0A 2YPLE 4PJ7B 3DX9B 1D3CA 3O6FD 4YEFA 3TYGH 2QQKH 3H3PL 4PBXA 5FEBA 3FO2A 4D3CH 3VXRA 3ARTA 4PJHF 1U95A 5ACLA 3H0TB 4HJJL 3HCVA 4UV4L 5KSAA 5I17A 4NSKA 4QHKI 3VJ6B 3CMGA 3V5DB 3B4NA 4H0IA 3M45A 2FLRT 5I1CH 2F5AH 5C07B 2EC9U 1FHGA 2A1WH 3MFGB 3SQBA 3O2DH 4XH2A 2VXUH 2Y7QB 1NGQH 3RVVC 2VJXA 4PGEA 3VXOA 3E8UL 1WLHA 2ZJSL 3O3EA 2HFFB 3GSWA 5BOZG 4G5ZL 4NJ9H 3UX9B 4ESKA 1QD0A 4Y4HC 2ZSWB 5IFHL 3GSOA 5DMKB 5HSFA 4D9RD 1Q94B 3C6SA 4GMSL 3QCUL 4YZFF 4S1RH 4KK8D 2IAMD 2YSSA 3HZYB 3FT3B 1MCEA 1IAIL 1U8OB 4NQDB 1W72L 4ZTOL 2F19H 3E1F1 4NC0B 3WKNA 5JNYA 5I18L 1RI8A 1WBZB 3KVQA 4KVNH 3TH4T 5IIEA 1T22B 3NIGE 4XHJC 1OAXH 2DM3A 3V4VH 3EAKA 1DVFB 3A67H 3RKDC 2R29L 1CU4H 3UYRH 2X4TB 1D6VL 5KJRL 4JO3L 5IQ9A 3FCTA 1MWAH 3WO4C 2EDXA 5DFVD 1MRDH 4YNYA 4U1NB 4H20H 5I15L 2H26B 3STLB 3SE4C 4XNUH 5DUPL 4OBRA 2CKBA 4AZ8A 2Q3ZA 2Q87A 2D7QA 2AJUH 3SE4A 3TP4A 2XWTB 4LDEB 4HZLB 5L2KD 5DJYB 2EKSA 5EIIB 4RNRA 2XKNB 4HMDA 1KJ2H 4NCC1 2EDTA 5GIRA 2Z31C 3TJEH 1OT1A 5C3LD 1UJ3A 3GJFB 3QXTA 5C0BB 2VDLH 2X89D 1HEZB 3LN9A 4NO5A 5B21A 3WSQL 3EJJX 2OZ4H 3RJQB 2O5ZL 1Z5LA 3NCYP 4P3CH 4Y8DC 4ZOBA 1U3YA 2NXZC 4WHDA 4HDIB 3JWNC 4CKVX 4LLYA 5AYUH 4Q9RH 2DJUA 4I3SL 3E3QE 3TPKA 5GS1A 1E4XL 3B83A 3WJLA 5CIPH 4ZQKB 5F7MC 3ABZA 5HI5D 3MXWL 5IBUB 3U9PH 3DGGA 2PTVA 5IUSA 3MQIA 1A3LL 5E5UB 1CD0A 3LVEA 3MRBB 5IVXA 1YY9C 3LS5H 2XFXB 3CUPB 2HFGH 3H7BA 1SMAA 5JPNB 1XF4B 3KPLB 1EGJH 4IDJH 1NGPH 3NFPA 1I1AC 3OX8A 1A14L 3QXVA 3EYQC 4XPAL 4ZMAT 1W0VB 4HUUA 1YNTB 2EE3A 4MNQD 1VGEL 4EBQL 4HBCL 5EU7C 5I8OH 4IIQA 5DVOA 1KCVH 2F19L 5K9KA 3C5SB 4N1HB 2OZ4A 2IALB 4JDVA 1UZ8A 1D5ZA 2FECL 5HI3D 5GXBB 1D6VH 3U1SH 5IT2H 5KJRH 4WEBH 4WUUD 4TUOA 1F4WL 5C0BE 5JQ6L 5L2KE 1EHLH 5TH2B 3FL7A 2UWEF 3DRQA 1BBDL 4LSTH 5TQ0L 4R2GC 4OLYL 4ELKA 5FECA 5H2BA 2VLKE 3G6JF 3I75B 2R2HA 3GMPB 3MRDB 4MSWA 4N0UB 3ALXA 1F6AB 1EEQA 4NYLB 5JW3L 3WNNA 5D1XB 3G5YA 1QR1B 4U1GB 4NGHH 3K3QA 4JVWA 5A2KH 2DIJA 1GGIH 1J1XL 5MEPB 4ZS7H 2XNAB 3B2VL 3P2TA 3S4SB 2DTMH 3FONA 1LO4H 3KYMA 1HYSC 2AXHA 5FGCB 5ALBL 1OT2A 5L9DL 5I8KL 2APVA 3G6AB 4I0CC 4N8VB 5EZOH 5FUOH 2Y6SC 4N0UA 1H3PH 3N9GH 1F02I 5L8LB 2B0SL 1LEKA 4HSQA 1RJYA 1I3RA 1BF2A 1S5HA 1JIBA 3MXWH 4MAUH 3PXHA 1BREA 3MLRL 4UIKH 5D2LE 3J8F7 5C0NC 1VENA 1E28B 2VITB 5MEND 4JGUA 4U1SA 3TBWB 1JZ2A 1INDL 5DFTA 3EYUH 4DGYH 4XRCA 1C16B 3DXAE 4HXBH 2DLGA 1AXSB 1JHLL 2GITA 3UO1H 3BEWB 1GYAA 1ND0A 2GK0A 4EN3A 4J1UB 2V7HA 2E7MA 3IVKA 5GGSY 3GMLA 3D9AL 3P4OA 4NP4H 1CYGA 1RFDL 3O3BB 2IPTL 1UZ6E 4UU9A 4NYLA 1X5HA 2F53A 3ZYJA 4DKEH 2IQAB 4PTTB 3DXAD 4HLZH 2AJZA 5CBEB 4HK3N 2FX8H 4GMTH 4I18B 1HCFX 4WI4A 5MP6H 3TNNA 3QUZA 5CJXC 3C60A 3VG0L 4LHQB 4OLVH 1TZGL 1YEEL 2R2EB 3WJJC 5D7IF 3NIGF 3EGSA 3F7PC 4H25A 5FYKD 3L3KA 3BIKA 4KHTH 3MODH 2XN9D 4MB3A 3BQUB 2ITDB 3QB7C 3L3IA 3CC5A 2QHRH 4QOKB 3FQUB 4JFFA 4GLRH 1NEUA 2IPKA 4QNPF 4LSTL 1CTOA 5EU5B 1H8SA 2NTFB 2XPGA 3SY0B 1NGWB 3MREA 1FLRH 3OKKB 4CVZA 3U30C 4F7TA 2FATH 4P2RD 3UDWC 1U9KA 5F6HJ 3PDGA 3LKRB 2XKSA 3BO8B 3F7YB 1ED3A 2P42B 4NO0D 2VXTH 4X0KB 2FBJH 4PB0H 3CZFB 1XGUB 1A3RH 1LDPH 1PY4A 4KK6C 4OLUL 5LBSH 1J1XH 2WUBL 3CLEL 3D0VA 1QBMH 4PJ8A 4E42A 2QLVB 1MFBL 2XQBH 3BAEH 1LO4L 5GRWA 4YIQB 1ITBB 1YMMD 4OF6A 3T1FB 4N8PA 3C8KA 3JTSA 3C5ZD 2V17L 4LIQE 1WGOA 3MZTA 5CEZL 2X10A 3DETD 4K7PL 3GUTA 2VLRB 3FT3A 4WVRA 2FO4B 5J7CC 3NFSL 4I3RL 4MAUL 1QTYT 3KLSA 2V5RA 1WAAE 4XWGL 4ODUA 3RX5A 4JB9L 1JF5A 2X4PA 3BT2H 3GMMA 5DK2A 1S7UB 2XRAL 3UJIL 4PP2A 1F11A 4FQXB 3FQNB 4I4WA 4XNXL 3UTTA 4Y1AE 4LP5A 4Q2ZA 1CLOH 1DLHA 4XP4H 4CU6A 4X5XB 1D9KD 3QNXB 1IKNC 4WW1A 2VLKA 5D2LF 4NNYA 3R8QA 3WS3B 3ZZ1A 5CD3B 2E7LC 1B0WA 3SKOB 4EDXA 3MV7E 2D0GA 1ZV5A 3VFSB 5EU6B 1SM3L 1S3KL 2E6JA 3BE1H 4BFBD 3S88L 4J3TA 2DQFB 3ZDXE 4YGVB 5D7SL 2GCYA 3FO1A 2ZCHL 5GIRB 4M93B 4GMTL 1MJ7L 5E4EB 3JWDL 1MCKA 3K4DA 1NSNL 3O0RH 5JO5A 3SDDD 3RGVC 4MAYC 2FHBA 1CICA 1GVIA 4GW4A 3TA3D 3MV8B 5E5MA 4K07A 3LKSB 2X9WA 3AGVA 1MJUL 3MA7A 5C07A 1CFQA 5KOVC 1CG9A 3P73B 1KSRA 1VPOH 3C8DA 1GGYA 3VXQA 4Z7VA 2ZOKB 3BP5B 2C7UB 5FGRA 1E6OL 5F88A 4WO4D 4NJ9L 4PGDB 2F54A 4XP1H 3LOWA 3IFNH 4AT6A 2GUOA 4AH2B 2DF3A 4QF1A 1FZMA 4S1RL 3LKSA 4KXZH 5BZWA 1MHCB 1QVOA 1I9JH 4ELMB 1HHHA 1G9EA 1EAPB 2FJHA 5DYOA 1RURL 2HLFD 5C0AA 2IQ9L 4WHYG 3QIBD 3B2UC 2O5YL 5F44A 4KUZL 5ICYA 2IBGA 5CSZA 2DQGH 3A67L 3VFGL 5DMJB 4U7MA 1NUNB 4LLWB 1NKOA 3EO1A 4FXLA 3BP4B 2CDGB 4O58H 1RHFA 4X4ZA 3IDIA 3MV7D 4TUKL 4C56D 5B39A 1D9KA 3CSYB 4LSQL 3RKPA 5JZ7C 2X4SA 1FNHA 1TCMA 5CGYD 2FIRT 1NBYB 1VFOA 4IRSD 2VSCA 4LCCC 3Q5TA 1X5AA 2WUCL 2HJFB 2R1XB 4Y1AD 2BVPA 3OGCB 5GGRY 3L5IA 3S6CA 1CLOL 5MENB 1EBPA 4MZ2A 4NRYB 3WNMA 3DVNB 2ARWA 2HJLA 3HRPA 4P0DA 5L88L 2F8VA 4RDQG 2IAND 4K7PX 3RGVA 1DBAL 1QSED 4XCNB 1U8QB 4P2OA 4TRPH 5EORL 3VXME 2EH7H 3NMEA 3F5WA 3GSWB 3VFNA 2R1XA 4F3FB 1UWGH 5BQ7A 5TDOB 2PYFA 1ZTXL 1YNKL 2CLRB 4OCLC 3QIWD 1CLYH 3T8XA 1K5NA 2YPLA 2R8SH 3DMMC 4TOYL 2Z35B 3CSBA 1A9BB 4NQEA 3L7FA 3QI9D 4JKPH 2OJZH 1M7DA 2MTPA 3O6ML 4JRWA 3FO0H 1O5DT 5ITFB 1V8HA 3K2MC 2I5YH 3QYCA 5HHXL 4JLRB 4G6JL 2VNCA 4QCIB 5EZJB 3SDCB 3Q48A 3VMOA 4OZFG 5F9OL 2PYFB 3RIFK 4FQCH 3QXAA 1QNZL 5EO9B 1I7RB 4N8CL 4X9BA 1HKFA 3UAJC 4HBCH 5I8OL 4WTWA 1C1EL 3KPSB 3RNKB 2DQJH 4NQCB 2ORBH 3EOTL 4U3CA 1QLEL 3GMNB 3TA3A 1RZ7H 3OKMB 4RZCB 3F65A 1KTLB 2PXYD 3IJSA 4Y19A 2X4UB 3BHBB 3HC3H 2OMNA 3HMWH 4U2ZA 4UU9B 1ZSDA 5IV2B 3H9SB 3U9UB 4CU7A 2VXVH 3SGEI 2DQIH 5JQ6H 3L3OA 4Z5RB 1EUTA 1WT5C 2HN7A 4WO4A 3UTSD 4DGIH 3WBDA 1J0JA 1SJVA 1MCIA 3D2UD 4PRNA 1A6AB 1M4KA 4U0RC 2NY5H 4ZXBA 4WDIB 3ARGD 1NCNA 4P9HH 4ZAKD 1A1NA 4ELME 4U1MA 2UY6A 2X7LB 4OAWA 4X5WB 1JNNL 1KCSL 3ULVF 2IMMA 5EU5A 3A6CL 4TULH 3JV5A 4Z0XA 1NMBH 5ISZA 4F9PA 3KLAB 4JFDD 1JTPA 5EZIL 1YYML 2QQLH 2VITA 5FYLH 1K4DA 1J88A 4F15B 2YPVL 5D2NB 3T08A 43CAB 1IAIM 3BPCA 4UDTB 4QHNB 2CK0H 3BH9A 2B5IB 4QWWC 3OAYK 4X83A 4XCFH 3WO3B 5JW4R 4PRPE 1ZA6B 1NJ9A 5IESL 5KSAC 3RHWK 1OB1A 3QO1A 2J8UF 4PJ8D 4Y89A 3O8XD 5A16B 2DQHL 2I27N 1KB9K 2WQ8A 1ZLUH 4LQFH 3VFPA 1EPFA 5DJDB 3Q0HA 2C1OB 3PABA 5MEQA 1J0ZA 3MCG1 1FYTE 4JGJA 4DW2H 1ND0B 1KEMH 3ULUL 1AHWB 1V3LA 2BNQE 4RFEB 4PJGB 2W9LA 1SBBA 2DI7A 1T1ZA 4NO2B 5CFHA 3QDGD 4DKEL 4JJ5B 5EU4B 2GJ6A 2J5LC 2ORBL 3EOTH 4HQQL 1NMCB 3EYSL 1UB5B 1X5KA 3O3AB 4X5XA 5B3NA 4G8GD 4LLUB 4PTTA 3ULVH 1N4XH 4G8EA 3VRIB 3QCVH 2JIXD 1D5ZB 2PO6C 1FVEB 2V6HA 3T3PF 1FP5A 3CH8A 2Q7YA 2BDNH 5F9DC 5IVNA 1YMMB 3ARFA 2QHRL 1A6WL 4NUGL 4P23D 3QIUA 4BFIB 5DUBB 5HYSB 3SPVA 1BIIB 3RWFB 4P5TB 4C83A 3FQWA 4F9LA 4XB8A 3RWHB 4W4OA 1T2JA 2NY5L 4F2MA 1MF2L 3MRRA 3IF1A 1FNFA 4HWBA 1EFXB 3DYOA 2X4UA 4LKCB 1Q0YH 1KT2A 4OZ4B 3BKJH 4J23A 4YXLH 1MI5A 1JGEB 1RSFA 4K71C 2EKJA 3QUXB 1NMBL 1LNUB 3JVGC 2WUBH 4RMSA 5F6IB 3BVNA 5EUKB 1H5BA 4YXKL 4PJXA 2ZUUA 1U8MA 1KTDA 4JM4H 1N3NB 4KQ3L 4H5SB 3L9RA 1T5WB 2NPLX 3E3QC 4JM2D 2X5PA 1JNLH 3EHBC 4YE4L 4DK6A 3VGAC 5HI4D 4XBGB 2VMFA 4NIKB 2MOVA 4PRPB 3BP6A 2FZ3A 2LFGA 5EC2A 2NQCA 4A2LA 2RQ8A 3TWCL 5HYIA 1EHXA 4UTAH 5HD8D 1J8HE 1HHJB 1U8JB 5I8EB 4U1KA 3NVQA 1XR8A 1UH4A 5DRXB 3F62A 5GS0L 3LS4L 1KTDB 3CFBA 1ZVSB 4P9MH 1OAQL 3CJJA 1QLRB 5IB5B 5GGSB 3TO2A 5HHOA 3GNMH 4LAJH 2ITCA 1RIHH 1HDMB 4YPGB 5FFLA 3MLVH 4HS3A 4PJ9D 3EYOA 5DEGB 1ZLVK 2AV1B 5CJOH 5I75C 4IRSB 3P40A 1JUFA 5F89B 3U7WH 4LLAA 1TQCC 5GS1C 4DEPC 4HQQH 1Z9OA 1MI5B 3G08B 2A77H 2W60A 5FYJL 4LKXA 3WLBA 2R1YA 3ROOA 3SJVB 4JFPA 5LGKA 5HHOB 1ZHKB 3MJ7B 2WWKT 2BDNL 3B3IB 1CCZA 5FYLE 1R3LB 3QIBB 4WUKL 2KUTA 4RFOL 4D9LL 4QRSA 1EEYB 1MCSA 3BP6B 3ECBA 3KPQA 4XMPH 1VPOL 4O2CB 2QTEA 2IH3A 5ANMB 4RIRB 1P53A 1JPGB 2E7CA 3C2AH 5D1QB 3S98A 4I0PB 3ES6B 3GB7A 2GFBB 5IB4A 4CNIB 5KS9B 4POYA 2DKSA 4HWZB 1CFVL 4BUHA 3ZKNC 4X9IA 2Y5TB 4X99B 4ELMF 5DMIL 1QBLL 1CZ8H 5IHLB 2A6JB 3KPRE 3EDFA 4LGSB 1IAII 1AQDA 4QCIA 5EZJA 1PG7W 1T2XA 3UZEA 3TBYB 4JR9L 4PRBA 3M17B 2Q8AH 3LQAC 4BH8B 2H32H 1QG3A 1DUZA 1S7XB 2YA2A 2NY6B 4S1DC 1OW0C 3RZCA 4U3HA 2OYPA 3MRIB 4ZO9A 2AJVH 3WIHA 5F71A 3TBSA 4MQTB 4E41B 2A0LD 3Q5YA 4LLVB 3ULUD 1UQSA 2Z9TA 3H9ZA 1MH5B 3W2DH 1I85C 1Z9SA 2HT3C 4FP8H 3F58H 3W5MA 4UV7L 5I2IB 2CDEB 1T1YB 3STLA 4HC1L 5L8JB 3FRPA 4N0FB 5DMKA 5E8PB 4PY7A 3VRJB 4P49A 5KTEL 1BM3L 5GRJH 2FJGA 1W0VA 2VKWA 4AM0A 5IIEB 3PWJA 1INQB 3BX7C 1RZIB 5FYJH 1DBML 3HI6H 4NM8H 4X7SL 1ZTXH 5EU3B 3WDIA 1FG2A 2UZIL 4LIQL 5CUSH 2WWMD 1C08B 2JLLA 1MFAH 2H26A 4HFWA 1OHQA 4RBPK 3V8OA 5IP4A 4RFOH 4D9LH 5DQDL 2FBOJ 4OGYL 3QNYB 1A6UH 3TFKC 3DYPA 3RTQD 3WIHH 4NFDA 4G8GA 5C0DA 5K9OB 3Q1SH 5E94A 4H8WC 3VFTB 2G75A 3EUUA 3L5XL 2AEWA 3K74B 1JVKA 3ULVC 1ZT7A 1T7VA 5E00A 4CJ0A 1P7QD 5KVFH 1QP1A 2IBZX 4WRLA 3BP4A 2HVJB 4MXQC 4L9LA 1IQWH 1WCBA 2K7QA 5HGDB 3QXUA 4YZFE 4PV8B 4WEUD 1IGFL 2IFGA 3TYGL 5HGHA 3U6RA 4OI9A 1CGXA 2VN7A 3ZYZA 5C0AB 4P5TC 4YH6A 2OTUB 1A7RL 3R4DA 5JHDB 1WBYB 3O45B 1RD6A 4X6CF 5DD3H 4H0GA 1IC7H 2A2QT 4OAWB 1I1YA 5JHLH 3L5WB 1U8QA 3CVIL 4P2QA 1V7NH 5HGBB 1KPUA 5F7DA 3WJLC 3VW3L 4MD5B 3OB0H 4K3GA 1VKXA 2H9GB 5SWQA 3ZKND 3SDYL 4KZDH 1XIWB 5EC1B 1LQSR 4DQOL 1G7IA 5H8DA 5FOJA 5HI5C 1FZJA 2E8YA 3L3OB 3P30L 1FIGL 2Q7NA 3LKQA 3E8UH 2FGZA 5I74B 4I2XE 1AH1A 1XF1A 2FH8A 1JGVH 3VFTA 5MENA 5D93C 3MRLB 4PJ7A 4S1DD 4KV5E 3AREA 4LVNC 5DHXB 4PBVC 1FRGL 4RGOL 4Z0XB 4PRAA 1PKQA 1T21B 2B1HL 3EJZD 4OCMC 1G7IB 4JE4B 5IKCB 4S2SA 1RZKH 2Z8VC 3O4LE 1BZQK 4OQTL 1X5LA 3VXTA 2OI9C 1RUQL 5DYOB 1T3FB 3MCLL 1FFNA 2IBBA 4FS0A 1AGEB 3KLHC 3H42L 3VRJA 3OTTA 4N1CA 1U58A 3T09A 5DSCA 3UTQA 2CD0A 3ARVA 5GGQL 2R0WL 5F7KC 2QQQA 4PRIB 4OCRL 3FB8A 1OWWA 2A74A 1AD0B 2ADIA 5CHNB 3O6LL 1EV2E 1P7HL 2OK0L 1IQWL 3H6JA 5F8RC 2FECI 2WLZA 3D85B 1AR1C 3GSQB 4M7KL 4FQHA 2FDBP 1HSBA 1A9EB 3RVXC 4L29B 1SEBB 4GT7A 4ZFGL 5IMKA 8FABB 2JJSC 4TUJA 3TN0D 3P4OB 2XWBA 3MNVA 5FB8B 3IXTA 1KCUH 1WAAA 3REVA 1X5YA 3E6FB 2BP3A 1BJ1J 2D4DA 4GRWB 1XR9A 4H88H 1G6VK 3FB6A 1FG9C 5SX5K 1P9MC 2ZUSA 4XNZB 1QSZA 3U9PL 5E1AA 4Y5VB 3BIAX 3F6LA 1HH9B 5E2UL 5FM5O 1XF3B 1MIMH 1YMMA 3O45A 1WBYA 2CUHA 3ARFB 4H26A 3I3BA 1MVFA 5C0ND 2BNRE 3GMLB 2IPKB 4OM0L 5FYKH 3JV6A 2CMRH 4HX1B 2NY4D 4GRMB 3IVKB 3OAUH 4LNVA 2Z0BA 3DSNA 5FKPB 5D1QA 4QRPD 3SDAD 5ALCH 4L8DB 1YPZB 2APFA 2EYTA 3N50A 3QEUA 4AMKL 3EDKA 5C86A 3RWGB 3QQ9C 4TPRH 3BZFB 4JO2L 2NW3A 4FN0A 3QRGH 3GIZL 1JGUH 4XNMB 3TO2B 4OI7A 1NL0H 4KTEL 5C08E 1YMME 1QFWM 5LQBL 5F7EH 1KFAH 3G5ZA 4Z95H 1IBGL 1BAFL 4IRJD 4F37K 1NCAL 5GGQH 1BBDH 1OGAD 2QBWA 3RWCB 5AYQA 3S35L 1EFQA 4X6DB 4FQJH 4WFHE 3UJTH 4G8EB 1TQCB 1W2KT 1E28A 2DM2A 2FL5B 3EJZC 3CZFA 1T1XA 4F7MA 3KNBB 3VXMA 3HG1A 2X1XR 1NBVL 5JW3H 3EO0B 3MJ7A 3HLAA 3IDJB 4YBQD 1LP9F 2UWEE 1DBBH 1KCRL 4PY8J 1JTOA 3L3HB 1HXYA 4PJAF 5KG9A 3AXLA 3PWVA 3PGFH 4OBSA 3BYYA 3RP1A 1YEIH 4QTIL 1OSZB 5ELIA 4MVBD 1JMXA 3WS6C 4PBWD 4PJXB 3TC9A 4P4KD 3TH2T 5E2VH 4HWBL 2R2EA 1S9YB 3EW3B 4HGKC 3TNNB 4M6NH 1H9VA 1TJIL 3DOSA 3VU2A 1ZANH 3E6HA 4GW1B 4ZUVB 5E2UH 5BXFA 4DOHE 2KQNA 3QO0B 2MNUA 35C8L 2XY1A 4RIRA 4MXVE 4U1KB 4OM0H 2ZCLH 3MR9A 1W0YT 3BWAB 1K8IB 5T3XD 1HK6A 1A7OH 3ARRA 4YFDB 4ZD3L 1R5IB 4NKMA 4G6AD 5T1LD 3MV9D 2KPNA 3LZFH 4HUKB 4F9LC 2A6JA 3ZYIA 1A2YA 4ZUWA 1C5CH 4WIQA 4G8FB 4ONGL 4Z7VF 2VDMH 4G80A 2DBLH 3W9EA 2W9EH 4FQLH 5T1MA 3TIEA 4ONHB 2YWZA 3OKNA 5LGHL 4JHBA 1RUKH 1VCAA 4FFYH 3JV6B 1KTKE 2NY2C 3F12A 1NLDH 2KL6A 3DMMD 3GSVA 4PGBB 5DEGA 4WGWB 2IWGA 4GKNB 1G7QA 3G5VA 3QDJD 1E0OB 4JJHA 2BNRB 2EDRA 4ZUWB 3PDOA 2HRLA 3PV7A 4LSVL 5GS3A 3RGVD 2E3VA 3LQAL 5D72H 1EEZA 5EOQH 4UV7H 3WLBB 1MUJB 4UT6L 4JRYD 4X9FA 5J57B 1IC4L 2UUDK 1KJ2B 3KYKH 5INDB 3E6HB 4GW1A 4Z7UF 1OGTA 4YC2C 4YWGL 4HKXB 5DR5L 3GJFH 4M9OA 1OAZH 4XVSH 5D1ZC 5TFSH 3EYOB 1N7MH 2ZWLT 2MQ0A 2ICEA 2Y36L 3D3VE 2CQVA 4G7VL 3BAEL 4M7JL 3M1BB 4NQCA 2GT9A 3DX7A 3WHE1 3WHXA 5C2UB 4BQ6A 3P4MA 2Z31B 1AQKL 5JPMB 5TQ2L 1F6FB 4XPTL 3VXOB 1Y0LA 5J1SC 5IBTH 3VWJA 3AS1A 4MD0B 4XWGH 4LPCA 1JRHH 2CIKA 3GJFK 1BZ7A 4GSDH 1U8OA 4NQDA 4OKDA 4R90H 2V2XB 4YDLB 4ZYKB 5CGYC 1NUFA 3NGBC 3D18B 4ZD3H 1U91A 1FL3A 5IFAL 3GMRB 4L4TB 3ZT6A 2Q76B 2J1KA 4JY5H 1T22A 3X11A 3DX6B 4WFFD 1CS6A 2O5XH 1WZKA 1QOKA 2BVOB 4M7LL 2NY0D 2X44D 2NY7L 3VFOA 3RNKA 1V7NL 1QFUH 5FYJE 1BD2A 4OD3L 3T65A 5J6GB 4HC1A 5FECB 3MOBH 3DGGB 5EU6D 4JY4B 5GGVL 3HMXH 1RZGB 1MI5E 4X6DF 4XCCH 4LSVH 5T5NG 2BNQB 2XKNA 3ZE1F 2VSDA 1V7ML 2AS5M 2YRLA 3L3DA 5D7JB 5GRXG 1U93A 1ES0A 4UT6H 3SBWC 1IC4H 5DJDA 1D9KB 5A2IH 3NCJH 1K2DB 1VFBA 4XNYH 2BVYA 4WUUA 2P46B 4NQTA 4YWGH 1T1WB 5C09B 1EAPA 3HR5A 1Z5LB 3MA9L 4OB5H 1VADA 1H15A 3EOAB 1XIWD 1YEFL 1XF3A 5DJAA 4R3SA 5DHYB 3R8BB 5H35A 1F4YL 5AZ2L 1RHHB 4JKMA 2Y36H 4M00A 1GPOH 4O9HL 2AJSH 4PJDA 3O2WH 4BZYA 5KZCB 4R96A 4CN4A 4ZPTA 1RZFH 3U0TA 4PD4K 2HH0L 5D1ZA 2UVEA 1S7WA 4I77L 4X6EB 1MAMH 3OHXB 3QPXH 3ARDA 4Q6YA 3DURB 1JYVA 2CLRA 1J8HD 4HLZG 3KPRB 3SGJA 3MUHL 1CXFA 4M1DH 4ENEC 4F3FA 1TPXB 4FTVA 3CUPA 1CD8A 3CLFH 1MPAL 2CJUL 3ZSTA 3RWGA 1A9EA 1BIIA 5FYJU 2DAVA 3AFLA 5EZLA 4NWTH 4HF5H 3C5SA 4KI1A 1PJ9A 1HEZA 1SBSL 4P2QB 2DQDL 1SYSA 5B8CB 2K9UA 4Z76B 5FDWB 3V6FB 1UJ3B 3WYRA 1I75A 1S7WB 3BRDA 2Q8BL 2NR6D 4D9QD 3NGBB 3P11L 2Z93B 4ZFGH 2AVGA 5HI4C 5SWZE 5ICYB 1E6JH 5ACZB 3V0WL 1KCUL 3VE0A 5IWLC 3PJSA 1KN2L 2L7UA 3PNWB 5A2JH 4PRAB 3AROA 2D0FA 4HK0B 3H2WA 2NLJB 3LKNA 4JRXA 5IVXB 3V6FA 3ME0A 5FDWA 3E6FA 4JHZA 1S7TA 1U8IB 4FQ1L 3VFPB 5J12B 4B50A 3DXAA 1SVCP 3LN5B 5BVJA 3QXAB 1P5VA 1NCCL 5IB3B 3KPRA 4WV1A 1BFSA 1P2CA 1PG7X 3VXSB 2I5YL 4HHAB 3NCJL 2B1AH 1NDMB 4F7PA 4NN5B 4I0PD 1QSFA 1OP3H 3L7EA 5DO2C 2M1KA 3MTRA 3VE0B 3U82B 3QUYB 5D71H 5FHAH 1JK8A 3F8UB 1F4YH 1ZLSH 4O9HH 4OV5A 4RGNB 3SGJC 1OWRM 5IB3A 4UINH 4L1HA 4HXAL 1NEZG 1REIA 4UNVA 1KEGL 3MBEC 3GSNA 3O41A 4JZOA 4CGTA 5IOPA 2ADIB 2FL5A 3OG6B 3QPXL 5GRZA 2AXFB 1B0GB 4PJEA 5C70A 5I1AA 1UKSA 2D7NA 2YR3A 5A40E 4MS8D 2YA1A 2FD6H 5ICZA 4OZIB 1QA9B 4YUEL 4HJ0C 3UBXG 1HI6A 1S7UA 3VDBA 1NDMA 3C9NA 5I15H 3CC5B 4E41D 4LCCA 2DQUH 1QEWB 4W70A 2XN9B 5C2BH 4M1GL 3RU8H 2XPGB 2XWBB 4OGAD 4MNHB 3PP4H 4HF5L 2RCSL 5CD3A 2DWDB 1NBVH 4O51B 4OF8A 3IJHA 4Z7QF 2FSEA 3WIFB 4FMKA 1WZ1H 4DWHA 3MLPA 1R5WB 3BP7A 3WUWA 1ROWA 2OS7A 4I18A 3SHSA 3WSQH 5EZLB 2ATKB 4NQDE 1YYMH 4NUJB 2X9XA 4HKZA 3MACH 4LSSL 5DRWB 3QEHB 2EE9A 1TXKA 4RMVA 3FOLB 3VFUA 4Q9RL 3NZHL 3QAZB 4U1LA 4WI8A 3FQRB 1KYOJ 4KJPD 5FA4B 3OXSA 5DD5L 3WEXB 3GUTB 3MLUL 3GI8H 4PJ9A 4LLQA 1GL4B 4JM2C 5HHVL 3OKKA 2X4NB 3CFBB 3X3GL 4MAYB 2EDDA 4D0BB 5D7LB 5E1AB 1FFNB 2HT3D 4UIMB 3FAXA 1C16A 2P24B 2VWEC 3D0VB 1MFEL 1P4BH 4GXUN 4K9EL 5JOPD 35C8H 3EDJA 3CFIC 3FO9A 4OF0A 1DLFL 4GRLD 3D3VB 2RR3A 4MLIA 1T1YA 4M6OH 2A9MH 4MHHI 3TO4B 2Q86B 4J4PA 1I3RB 1NGPL 1HWHB 5FM5M 3TLRA 1ZOXA 4XPGH 4KKCD 3UTTD 1P6AB 5D1QC 2IH1A 4HXAH 1A2YB 4QT5B 4KTYA 3ELAT 1YEGH 1J7VR 4MLSA 3KS0H 4UI2A 1OPGL 4OLWL 1AXTH 2H6PB 1N4XL 2BVEA 5JUEH 1OCWH 2W65A 4Z9KB 3RTQC 5DJ2A 2APTA 1T83A 3VXNB 1NBYA 4WW1B 3O6FB 5GZOC 12E8L 3LDBB 1A7NH 4HW6A 2AXGA 4M61B 3RVWC 1NGWA 3UJJH 1X4ZA 4WEMB 3HNSH 3EJYD 1QSEE 2HTKD 4KKAD 5T1KA 1MRCH 4K3EH 3W39A 4CU8A 3EYVB 2GCYB 4ONFL 5E5RB 1QLFB 3ARYA 5L0QB 3BKJL 4OZHF 3VFSA 4X0KA 4NOFA 2DWEA 5TFSL 5T3ZD 4MS8C 5D7KD 1QRKA 2QV2A 5GGSA 3R06B 4NKIH 3QAZC 4HJ0D 5I73C 5KG9B 1JV5A 4CVUA 2BY2A 4X7TB 3CFJA 4NCDA 3X13B 5L9DH 3B6SB 5FUOL 4OLZH 3I2CH 1AGCB 2V9RA 1QO3A 5FOBA 3CFEA 4YO0B 3TBTA 5AUMB 5C8JA 1LE5B 4BQBA 1XF2A 4APQA 4Y5XA 2F8XC 5HHQB 2RBLA 1EUUA 1MREL 4L8CB 5IG7A 4PYGA 3P0YL 1I1CA 1PBYA 4JM2F 4Q6IC 4LHUB 1RPQA 4JDZB 1DR9A 4XP6L 4EI5C 2Y23A 4G7YH 4GKNA 3TIDB 4Z7NE 1DDHB 4QHKJ 3QEGL 4ETYA 3CX5J 4EUPG 1QBAA 1NBZB 4PJFB 3TEUA 5F89A 3ZE2E 1S9WA 4ZG1A 3CMOL 1JGEA 2H32A 1SYVB 2GK2A 4CN6A 4OZGF 1R0AH 2VERN 4FTVD 1WWWX 5E8PA 5JNYB 1CE6A 4MA7H 4JN2B 4FA8A 2H41A 4K7FB 3QDGB 4R8WH 2MHAA 4HS8H 1IC5L 3EIFA 5TDPA 1HIML 1UVQA 1II4E 4JFED 4WUUE 1BJ1H 2DWEB 3BGMB 5E70A 3W0WA 3HUJB 3U36A 5BRZB 2FZ3B 1UGNA 1Z0MA 3DRTA 1I1AA 2QKIA 5GJTH 4MQXD 1G9MH 3ARPA 1OM3L 6FABL 3O2DA 4PRNB 3RFZC 2CGRL 3LKPA 4G8IB 4B41A 3D0LB 4IIQC 2ZOLA 4GAJL 3HZMA 3MCKA 2O93L 3V7MA 4LSPH 4NN6C 4EKXA 2GT9B 3NTCH 3P4LA 3Q5OA 4RGNC 2IAMC 2VXQL 2AJYL 3DURA 1ADQA 4DZBA 5I17B 2R1WA 3F7QA 2VISB 2JCCB 3DTXA 5IM7A 4PB0L 3RVXD 4AEHH 5DMIH 3B9KC 2ADJA 3VXPA 4IRSA 4HIEA 5I0DA 4RAHA 1J18A 1MLCB 1J05B 1EMTL 1VB9A 4C59B 3FMGL 5EU7E 3CFCH 3O9WA 3RL1B 1H15B 3EOAA 4B7IA 1VA9A 4OLZL 2UWEA 3I2CL 4M5YH 1TETL 4L3EB 2W0FB 2BFVL 4K7PH 3SDCA 5E24E 1T6VN 1NAMA 1CFTB 1S9KC 4IOSD 4OSUH 3W0WB 2X4QA 3TF7C 3V4UH 1DJSA 4POZC 3VH8A 3BKML 3DRTB 3VJ6A 4NWTL 1JFQL 3RKDD 4Z78B 4Z7WF 1HH9A 3W2DL 4ZPVB 4YHMH 4Y4KA 1RQ5A 1J05A 1F8TH 2YMXH 4PGCB 1YN7A 4NQED 1FVCB 1CT8B 5ETUA 3DUUA 1OD9A 3DECA 3MJ9A 4OCNC 5D2LA 5HJ3A 4AENB 3C09B 5IQ9B 3NCCB 4RZCA 4R8WL 1LO5B 1EBAA 5ITBL 3AREC 1DVFA 1YNLL 2G2RA 3M07A 4JRYE 1NC2B 2ZCHH 4QHNA 1GJIA 1Q94A 2VL5A 3VFVB 1N59B 1LP9A 5I30L 3HI6L 4NM8L 3U83A 3NCEB 3S96A 1M6OA 2DQEH 5BJTB 3UTTE 3QCTH 5DJ0A 1A1OA 3S37L 4PRDB 3KWWA 3LN4B 3NPSC 1N8ZB 3O4LA 5DSCB 3KPOA 1HH6A 5DQDH 2KZWA 3DUHA 1MI5D 3V95A 4P4RA 3MLXL 2J4WH 3T4YA 1IQDB 4HCRL 2GQHA 5IHBA 4P2OC 1DBKH 4L8SB 1Y6MR 3L5XH 2B1AL 4XPBH 1RZ8A 3EYQD 1XGPA 3HC4L 5JOEA 3RIAK 4NO5B 4AY0A 4MAYA 4OF3A 5IMMA 4PJEB 5I1AB 2YWYA 4DGVL 5IF0B 4Z0BH 1PDKA 1KIPB 3IFNL 1I7UA 4D0CA 3ARWA 2ID5A 2VR9A 8CGTA 2YD2A 8FABA 2VN4A 1FO0A 1I9JL 1H3VA 4GKSB 4XXCA 5L6YH 1YQVL 3FFDA 3M8OL 3MRLA 4L9LC 1EERB 4LEXL 1R5VA 5D7JC 3GMNA 3TA3B 4HK3J 2NY3D 2MSPA 2OR9H 1BD2E 1QR1A 4ZFOB 2EDOA 3CNKA 3PGCB 3QEQE 4GUPB 1A1MB 4PJ5D 2JE8A 1YECH 4WTZA 5FUCC 1RUPH 2HP4A 3G6DL 1T0NA 3DO3A 5M95B 4A6YB 4B53A 3G04B 2FEEL 3ZDZE 1N2RA 5GSVA 2X70A 3QWQB 2APXA 1A4JA 5L0QC 1KXQE 4JFDE 1MFCL 5C2BL 1NH6A 2Y9RT 4CMMA 2WQRA 1JFQH 2VKXA 5E2TH 1BZ9B 2ADGA 2GTWA 1UM5L 1AO7A 3QUML 4Q0XL 4U6XB 3S34L 5C0CB 4JDVB 3BZDA 2C3VB 2EXYD 4FFZH 1FBIL 3A6BH 3LRGA 4UDTA 4M61A 1TQBB 2R2CA 2FSEB 5ACMA 3QWOA 3UCRA 3WIFA 1AD0A 1T83C 2WBJA 3L3GB 4DZ8B 3BVNB 5EUKA 1DBAH 2D7OA 1FFOA 3I6KA 4ZODA 4LVOB 4HS6A 3FO9B 1NFIB 3L5HA 5I30H 1DQML 4HKBA 4QXWA 5FHBH 4JGMA 1RZKC 2X4RB 4QRTA 3GI8L 2JJUA 3NZ8A 1FN4B 3MCLH 3VWKB 4L1DA 4J2XA 2VLKD 2HFEA 3VFMA 1XR9B 2GTWB 4F33A 3G5ZB 3OZ9L 1U3HC 4JQXA 4WI3A 4Q9BA 1JNHB 1XIWA 4KK5C 4ETQB 1AKJB 1TVDA 4EXPX 3FO0L 3WEXA 5AEAA 4IDLA 3MLSH 4FTVB 1P4LA 1I3VA 2R0KL 4OCRH 2M26A 4JFEA 1D6EA 5EA0H 3UC0L 4HKBB 4JRXE 2P5WD 1NLBL 5I0ZA 4YDKL 4UQ2B 2HT2D 1VFAB 1A0QL 5T1KD 4FABH 1HI6B 4JY6B 3DBXA 2BMKB 1B6DA 4LMQE 4JJ5A 4S10A 4PJ5E 3AC0A 4HUXB 1HXYB 1JWUB 2R56H 3BQUD 2R4RH 1BD2D 1G0XA 3BDXA 3TCLB 3MX0A 2H2PC 3ARBC 1YEGL 2NY6D 2H32B 2WLYA 3GO1L 1OF2B 4MJIE 2HTLC 1EO8H 1I3UA 5KS9F 4FQXD 1S7QA 1UB6B 1ZT4A 3KYAA 4YK4B 3HMWL 3TT1H 1I7UB 4D0CB 3TVMA 4UQ2A 1ETZB 4JANA 4U2YA 1YECL 1R3IH 2J6EL 1JBJA 1YUHA 4PUBL 12E8H 4DKAA 1BFVL 5I1CL 1EZVX 4F37F 4U1IB 2BOBA 3GBNL 2PKDA 3ILPB 2EC8A 1BGXH 3KR3H 4P4KC 1QVOB 4NNPL 2ZKHL 1BQLL 4JFDB 2ESVB 4MQ7A 4JFQB 4R2GB 1AE6L 4OFPA 4X4ME 1WFUA 4Z7WE 2OTWB 3C5ZB 4KMQA 3ULVE 2AJZB 3QI9A 4X6FA 3OAUL 1NCWH 4E0RB 1UZ6F 4U1JB 2EIZA 1RJCA 5ALCL 5L7XL 3JUZA 4ZUTB 1MIEL 1DQLH 2DI8A 4PR5B 5HDOA 4AMKH 4BJLA 7FABL 4N0CD 1YEJH 1VACB 3EDDA 1JYWA 3SKOA 1MWAA 4X6CA 5D8JL 4DUWA 5C1MB 5IESH 1DCLA 1MREH 1TVBB 4JPWL 2J8UE 2EE6A 2IADA 4UDUA 2GFBA 5KS9A 4GAFB 4PJEE 1DZBA 1TNNA 3T77A 5I19H 3IDXH 4RGMB 3MMEA 2IG2L 3FO1B 3BQUA 2I26N 2Z8SA 1S7XA 1OTSC 4M4PA 4NHCL 2D9QB 5IK3B 1HNFA 3QQ3B 4X80L 2G5BA 4LDLB 2CRMA 2ZUTA 1KCRH 3BP5A 3N1FC 4UT7H 1NUGA 4PJBE 5A43C 1D6EB 1FVDB 4LVOC 2ZP0T 1FSKC 5F88B 4EN3C 4OGZA 5HHPB 1J5OL 1A6WH 4L3AA 1R24A 3T4AB 4CDHA 4XXDA 3TZVC 4WO4C 4LSPL 2FHFA 5IMLA 5JW4N 4B7LA 4NQVA 3SDDC 5EB9A 5IB1A 3ZE1E 5HDBF 1T04A 3RDTD 5JMOC 1TCRB 2JF1A 4PRDA 1VGKA 4ACPA 4DN3L 3MLYH 1A5FL 2W0FA 1U8NB 2J12B 4XWOD 1RZGA 3B9AA 5T3ZH 2AABL 1MCBA 3W9DA 3CH1B 4FFWC 2X4PB 3GSXA 3BZEB 1U91B 1Q0XH 1HXMA