1BVLB

Humanized anti-lysozyme fv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASGNIHNYLAWYQQKPGKAPKLLIYYTTTLADGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQHFWSTPRTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HULYS11
publication title Structural consequences of humanizing an antibody.
pubmed rcsb
source organism Homo sapiens, mus musculus
molecule tags Humanized antibody
total genus 23
structure length 108
sequence length 108
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bvlB00
4MZ3A 4ZG1A 1CXFA 1QRND 4F33A 2EXYC 5I74B 1FPTH 5E6IC 3ZYIA 5KS9F 1P7KA 5DRNA 1PYWB 2KZWA 3LKRB 2EDHA 4HQQL 4U6YA 1QSEA 4OB5L 4NZDA 4QWWC 1HXYB 4LSPL 3BKCH 1YEKL 5DUMH 1QKZL 2Q87A 2FATH 4XB8A 1A1OA 3MLVL 3LD8B 5E95B 3HPLA 1MHCB 3CFCL 1R6VA 2FD6L 3IDJB 1GC1L 4FABH 2KQNA 1AGDB 4LBEA 5J11B 1J0IA 3UTTB 4L4VA 5GGTL 5K9KA 4LPVA 4KKLD 3D0VB 2YUWA 2P8PA 3F7VA 4ZAKD 2K3TA 2ID5A 1F90L 4Z7WE 3SDXF 3SO3B 3LIZH 4WWKC 3BEVA 4L4TD 2LFGA 1XZ0A 4PRID 1IL1A 1OLLA 3AREC 3UC0L 5FYJE 3OL2A 3PWNB 1TVBB 4JDTH 4PJEB 4FQPA 5F6IC 3PWVB 5DMGC 1CGUA 1A6UH 3N9GH 1XMWA 4Y4KA 4QRTA 4TNVF 4ZTPL 1CICA 2X4TB 4QRPB 3VFVA 2BNQE 4JLRA 4U6VH 2DLFH 1HQRA 1LDPL 4NSKA 3GFUA 4YAQA 4WI2A 5DGRA 4YX2H 4ZUTA 1AGBA 3GIZL 4G6MH 5GS0H 3H0TA 4K8RH 4X6EA 3QQ4B 1TZHB 4Y4FC 4GMTH 1KN2H 5J1SC 3B9KD 1LILA 1SYVA 2VLMD 3TO2A 4MNGA 1FYHB 1K8IB 4JHBA 4RGOH 4APQA 3TGXA 4FG6D 4MNQB 2VDQH 4AENA 4ENEC 3B8SA 2BRQA 3T08A 1ACYH 2H2SC 2VZ1A 3C5ZA 1UM6L 3QG7L 4JN2A 5IWLC 1AXIB 4GLRI 5FUZH 3SGKA 2R0WL 1ACZA 1HKFA 4TSAH 1T2QL 3UPCA 4FQLL 4KPHH 4U1JA 5I71C 1RJLA 2C7UB 3HHRB 4KVNH 3MR9A 1LEIA 4HUVA 3HE7D 1TNMA 3BIBX 5HYJE 1A6TB 5DRZA 4OBSA 4OV5A 3CPLB 4PRAB 5E24E 3OV6A 3AU1B 2AJSL 1JNHA 1HWGB 4HWEL 5DZNA 3BQUA 3B2UC 2MPAH 3THML 3UZEA 3QNZA 1KLGA 4O9HH 2W0FA 3F12B 2YD8A 2AGJL 1FE8H 3LVEA 3GSNL 5EUOB 7CGTA 4KZDH 5JMOC 3OKNA 4GG6F 1B6DA 3HRZA 4K7PH 4YHNB 3AAZB 5K59E 1RAMA 4BQCA 4F3FA 3QDGA 4PRHE 3LRSB 4UT6L 5MEQA 1HSBB 2QADB 3QUML 4J4PD 2HFFB 1GH7A 5DT1H 4LSTL 5IB3A 1KSRA 5FM4A 1G7JA 5I1DA 32C2A 3LKSB 4PJ8A 3E6HA 4PRPE 5IEKA 2IH3B 4OD2A 1ZSDA 3ROOB 1HH9B 4R97C 5SWSB 3FB6A 5MENA 3RL2B 1I8KB 3QULB 1ZLUH 2ZOLA 3VXSE 2C1PB 4Z7OF 5JPNA 1BP3B 2AQ1A 4LRNH 1XF3A 2OK0L 3QIUC 3UTTD 2CDFB 2FCBA 1GSMA 1ZXQA 1ND0A 2D2OA 2Z91B 4Y16A 1CFVL 5DJ8B 4HXAL 1CFTB 4NQXA 2VDKH 5MHSD 2D31A 5T3ZE 5KBNC 4HIIB 3LKNB 5TDNB 3IT8D 1AC6A 1QTYT 4F2MB 1VPOL 5IT2H 2Q8BL 1V7NL 5C0JA 4QRPD 3DRTA 3RVUC 5IVZB 4LSQL 3FQXB 3W9DB 2DQGH 3ZKQD 3OKMB 5DEGB 1WC7B 1QEWA 3RL1B 5HD8D 4PY8J 2C3XA 5C09E 4A2MA 4EKXA 2IF7A 3VI3F 3RU8L 3R4DA 4OLXH 2Z93A 3MODL 4JY5L 5SWZA 1DTUA 1KCLA 3SCMD 2DQTH 3X14A 4JDZB 3K1DA 3FOLB 1WZKA 3EDJA 3S34L 5J13B 1F13A 3MOAH 5C0IB 2OJEA 2FEDD 3C2AL 3C8KB 2XZCH 4UAOC 2F8VA 5C3LD 4ZQKA 1CLZH 1FG2A 4OGAD 3HUJB 1RIHH 1LO2L 1AY1H 1HINL 3DV6A 4A6YH 3SDAC 1A7PL 1EEYB 3U0PA 4WU5A 2BSRA 1T1ZB 1QSFA 1NPUA 4LKCB 3FB5A 5E8OB 4WNQA 1BD2A 4YBLB 4D3CH 1IARB 2QBWA 4D0CA 4G42A 1K8DA 1U8HA 4DVBB 2YA2A 3VFGH 4I3GA 3VXRB 1LEKB 1ZHKA 2NW2B 3SGJA 1BQHB 4TQEL 1IZJA 1L6ZA 5ITFB 1HN1A 2P1YA 2IPUG 4Y2DA 3CC5B 4OFYD 5SX4I 3RNQB 4R96B 3CFEB 4DN3H 5EFIB 3LB6C 1MLBB 3O3UN 5EZIH 4I2XB 1NFIB 1RK0B 3OR7A 3V52H 5HDBE 5DWUL 4UUJA 2QKIB 3NIGF 1M6OB 2X1OA 3JWOL 1VSCA 2A1WL 4OQTA 5BV7B 3ORJA 1S7SB 2AJYH 2NY2B 4PJIE 5F3HB 1AGFB 2PF6A 3G5VA 1MRFH 1U3HD 2VQ1B 3QDMA 2B0SL 5C0EB 4W4OA 3PL6C 3ZTNH 3DO3A 4RZCB 3C6LD 5SWSD 1B4RA 4X7TB 3E8UL 5GGVH 3ARDB 3IU3B 3D3VE 2LU7A 4HS8H 4ZDHB 4QGTA 5C8JB 4XGZA 3O4LA 4OFVA 3WSQH 5CWSB 5AD0A 2HG5B 5EZOH 4RFEB 3V5DA 1JGLL 2C1OA 2ICEA 4XAKD 1FZJB 1BEYH 2WLYA 5DVNA 4NQED 4DZBB 5CBAB 1CGSH 4P46A 5F1KC 3PV6A 1LD9A 3QXDB 3HG1B 3ARXA 3FQUB 1RK1B 5EBGA 3RUGF 4F8QA 4XPAL 3WUWG 4OD3H 3U30C 2VZ3A 3RWEA 3TT3H 3GSRA 1U6AH 3VXUA 5BZWB 1KPRA 2NXZC 3SDDB 1M7IA 1HQ4A 3N0PB 2OP4L 1OM3H 3JXAA 3NOIA 1IGYB 5HYSG 2R8SL 1AGEA 2V2WB 1BVKB 4LEXH 4M8VA 1T1XB 3MJGX 5EU6A 2WUBH 4ZXBC 4Z78A 1UWEH 3NACH 4AG4H 4C55A 1CS6A 2HKHL 3EJYC 4MVBD 3Q2CA 4HZLA 2MKWA 4OCRH 4NQVA 1PGRB 3VXOA 3F7QA 3HB3C 2X4UA 4NIKB 2AK4A 1DQML 4PJCA 4JFQB 2A0LD 2FECI 1N6QH 2J1KA 2WBJA 2AEIT 5IW1B 3MCG1 3H3PL 4FFVD 4MDJB 3GMQB 2DYPB 1KB5L 3ARFD 2VRAA 4YDIH 4RGMC 5DUPH 3REVA 1DANT 1AHWB 2AJUH 1U91B 4TPRL 4CVZB 1GGIL 5M95B 3LY6A 1IQWH 2DQJH 1EFQA 1LVEA 2BVUA 5EOCJ 4P9MH 1BOGA 2DJSA 5CGYD 3NIDE 4K9EC 4CUCA 3BMVA 2AV7B 4KKBC 4HFUH 1VFUA 5HHVL 3IFNH 1G6VK 5CEYB 5GIRA 4BK4A 3WFCH 1UEYA 3VXRD 4NO5B 1PQZB 1S9VB 3OXSA 4W6YB 5IGXH 2VAJA 2NLJA 5HSFA 2GUOB 5CJBA 5FXCH 1TITA 5BMFL 1S9YB 3OB0K 1M05B 2J6EL 4OZGF 1S78C 1X9QA 2Y23A 4HSQA 3H3BC 5E6IA 4W70A 5FDYA 4I3RH 3RJDA 3X13A 1FJ1B 3WD5L 3WJLC 4JPVH 3M8OL 1ZANH 3QQNA 4LQFH 1YECH 4JY4A 5BZDA 5IKCA 4CU6A 5KVGL 3OKOA 4ODUA 3RVXD 5T1KA 4EUPG 3GSWA 1N59B 2NY2D 3ZO0A 4NPYB 2BNQB 1WWCA 3ZDYF 5FYJL 4HV8B 5JUEL 4KK5C 4W6XB 1RFDL 2EXWC 4P3WA 4HK3J 2HYMA 1OAYL 5E8NB 5IK3B 2OMBA 1H3VA 1JFQL 1R3LB 4U49A 1TQCC 1TPXC 3TYGH 4AH2A 3FRUA 1IC1A 2KKQA 4FQXB 3BO8A 5CIPB 2P44B 5JW3H 1MJ7H 1ZMYA 3VXPA 2OTUA 4KAQH 4WWKA 5CJ8A 1NMCB 3J7HA 1HYSC 4JO2L 2K9UA 1T22A 4IOFC 1RZ8A 3NFSL 3QQ9D 1W72A 1EFXA 3OTTA 3HG1D 1RY7B 5C0CE 2A9NL 3GMRB 4BK5A 2Z92B 3VXQB 4BKLB 4R2GC 1D9KB 3DTXB 4GS7B 4ONOA 1CDUA 2ITCA 3CCHA 4XCFH 3IDGA 4PJAF 4XNQB 3PXHA 3S36L 3C2SA 3O0RH 2R4SH 5DUML 5DEFA 3MRFA 1VFMA 4X9HA 1MCDA 2HMIC 5DQJB 3O2VH 4O2CB 3ARUA 5JO5B 4TSBL 3GJFH 3MRCA 4LNRB 3HI5L 2ZP0T 1KN4H 4TSCL 5CJQL 2V17H 5IP4A 1T0MA 1U8JB 3HN3A 4FABL 1GGBL 5IW6A 3A6BL 3EYUL 5GJTH 3C60C 4MNHB 2VH5H 4YUEH 2CSPA 4Q9QH 1NCTA 4O2FA 4KRPC 3RKDD 3BRGC 4MXQD 5FOJA 3MLZL 2BSSA 3PHSA 2QL1A 4PRHB 1OW0C 4S1RH 5E1AA 4EDWL 2YD3A 1WLHA 5IFHL 5F7DB 5F88A 1QQDA 1X5IA 2R15A 3EFDH 3OAUH 1TZGH 1J87A 4F15C 4P23B 4P5TB 3FJTA 5H8DA 1T1YB 5IFAH 3V6FB 4PRPB 2CK0H 1D5BA 3CDCA 1NCAH 1PG7H 4JFOA 4PJ7E 4YE4L 5CP7A 4UQ2B 3BVNB 3SHSA 3QA3B 4LCCB 4M6OL 4OGZA 1S8DA 3ZT5A 4AQ1B 4YFEA 2J8UE 1MFBL 4HJJL 4JQXC 3VXSB 5EZJB 4YX2L 4JVPA 2GK2A 2X9YA 3PQYA 5GS0L 3RX7A 1KEGH 1JGEB 3LDBB 3O81A 1KV3A 1OY3B 1GZPB 3QHFH 5CJOH 5LGJB 2GKIA 4WW2B 2GAZB 4RSVA 5GJSH 5CGTA 3MRDA 3CSYB 2VDRL 4NZUL 2VDQL 4X6DA 1P4LA 5BXFA 4KKNA 2E8YA 4F7TA 2B8OT 5MEPB 1TTFA 5FYJD 3H9HA 3FT3A 5KVMC 2Y4SA 2MKLC 2Q76B 1CLCA 4I77H 2BNQD 2DWDA 5DFVD 4AY0A 1OT2A 1UYWL 1SEBB 3W81A 5TQ0L 5C09B 5JXAL 3HNSH 1S7TB 2EDTA 4S0TD 2PR4H 3QIUA 3FO2A 3R0MA 5DSCA 4FQXD 2ZG1A 5AAMA 1NKOA 2IAMC 1H15B 4PP2A 1RJYA 6CGTA 1L9NA 5CEXB 3L5JA 4JG1L 4XCYA 1WZMA 2X4NB 4N0FA 5IESH 3SDXA 4OKVB 5K9JL 4A2LA 3FFDA 4I1NB 5GGRY 3GKWH 4CVXB 1X5XA 1FIGL 4DGIL 4QNPF 4HDIA 1INQB 1MJJB 5KG9A 5TE7H 4I0PB 4XPFH 4U7KA 5L2KA 4D0BA 2AKRB 2ZOKB 3GJEA 2NW3A 1OQXA 1RD6A 5CEZH 5HYJD 4JAMB 1AKJD 2NR6C 4LFHG 4BH7A 1YNKH 3WFDH 1T5XB 2XPGA 4HJGA 4DTGL 5HPOA 2AXJA 1FDLH 1CFQB 3MLUL 4PJ9B 5TE6L 2QTEA 1FNSH 4IMLA 2BVQB 5IFJB 3MBXH 3V0WL 1MFEL 5L0QB 1T7ZA 1YPZF 5BO1L 4YDJA 3DGGA 4ZPVB 1ADQH 3DRQB 3K7UA 1N3NA 1WFUA 2EIDA 3QO0B 3WNLA 2EDOA 3RGVB 4I9WE 1XF5B 1DLHA 1LP9A 1YY9C 3I3BA 3WUWB 1I1YB 5J57B 5CKAA 1NUNB 3F6IA 5GS3A 2H26B 4PGBB 5HDLA 1CZ8H 3QDHA 4M6AA 2WZPD 3WKML 5JXED 2P5WB 3IDIB 3JUZA 3QHZL 1MFDH 2C4FT 4P5TD 4NQDE 2J88H 4PRPD 4PJIB 4XWOC 3D2UA 5D1QB 3MA7B 4AIZB 5BOZG 1NDGA 1D5XA 2O5XH 4KI1A 2NY4B 1OD9A 2CO6B 3UTZA 2BNUA 1UVQA 1BVZA 2O61A 3TH2T 4P3DB 4IS6B 2HVJB 3VE0B 1P7QB 1DBAH 1YZZA 3VXSD 3D3VB 1R0AL 2XKUA 4KV5F 1JWMA 3MA9H 4DCQA 1B6UA 4KMTL 1YYLH 3QEGL 3HI1A 4OLXL 1RURL 2YPKA 3PP3H 3O2DL 4WY7L 5ERWB 1KB9K 3HNTH 1BBDL 2F8OA 5D1ZD 1JYVA 4XVSL 3G5XA 1F3DJ 1Q0XL 2N1KA 4R4NC 5CINL 3S88H 2P7TB 2F53E 1A3LL 5IBTL 5T3ZD 2LE9A 4DKFH 3MJ6A 3KPSE 3C09B 4HMCA 1FLRH 5TF1H 5JDSB 2IAND 4KJWC 1RIHL 2EKJA 3DVGA 4A6YL 4LLMB 5LG1A 4QLRA 1QFWM 3TJHC 1XT5A 3GNML 4XPBH 2CXGA 4EVNA 2NY0C 2P8LA 2WWMC 3BRDA 3PL6A 2LU3A 5EA0H 3UJJH 2ZCLL 5L6YH 3VDBA 4XNZB 1S7XB 5C09D 3WFEH 4M00A 4DUXA 4OM1H 1IBGH 3FRPA 1YC7A 3UPRB 3H8NA 3HMXH 4QHMB 4CU7A 2AEPH 1EO8L 4RBPK 1MSPA 1JZ8A 1I1AC 4J3TA 1WBZB 1NCDL 2FL5A 3BHBA 1LNUA 2GSGB 4XNUL 3SEPA 5ENWA 4UB0H 2XTJC 2ZUXA 1WUNT 4KK6D 1A6VH 4L1DA 3L3JB 2FBJH 3L1OL 5HYQA 2UUDH 4JQVA 1NBVL 5L2JB 1T2XA 4ZFFA 1Q1JH 1YEJH 3CH1B 3UJIL 5F9WC 3HZYB 3KPOB 2ZUQC 4LPCA 4EUPB 1IGCH 1EVTC 4I0PD 3SJVE 3P9LB 3HMWH 4OF0A 5EIVA 3X12B 1G7QB 3BESR 4Q6IC 4GRLB 4R0LB 2N4IA 4EN3A 4TULL 2VDNL 1Z2KA 4RAVA 2Z35A 4FFZL 3WYRA 2H9GA 4YJZL 1KIQB 1VEOA 3MRIB 5DTFA 5EOTA 4ZXBA 4NHCL 4G7VL 1N2RB 2WIIA 5DHVA 4QRUB 1PZUB 4PJ9D 4GKZB 3NCMA 1C5CH 4EZMA 1PEZA 1UM5H 2UZIH 1FYTE 1FIEA 3T1FA 4IRSC 3VMOA 2LVCA 7FABH 1D5IH 3PABA 3NZHH 4DGVH 4WWID 2X4OA 4ONHA 4QGYA 4OZIB 1JZ3A 3RGVD 4GUPA 5C0DB 3WSQL 1IKNC 3WFBH 3ULSB 3KPRA 4YHKH 3TT1L 2BMKA 1SJHA 1RHHA 1P53A 1LK3L 3CXDL 1T21B 1ZOXA 4KC3B 5D2LE 4WCYH 2NY4D 2DWEA 1MF2L 5HGAB 4J12A 4P2OD 2JTDA 1P7QD 5GZND 3U7YL 4U1IA 1U3JA 3D3VD 1MWAA 4GW4A 4L4VE 4XAWL 5DLMH 3TA3B 5IOPB 5IJVB 1A7RL 4AZ8A 4LQ1A 4XI5D 5FYKL 4K3EH 5JLZB 5D7IA 3P0YL 3NACL 5J89A 3TC9A 5AEAA 1Y18A 2E7CA 3WJLA 5ALBH 4YNYB 5HHOA 4MA1C 3U6RB 1FAIL 2IADB 4POYA 3MUHL 1S5IH 3C08H 4KKLC 1EMTL 5BRZB 5C0CB 3BPLC 2BFVH 4ZAKC 1XF4A 3HNVH 3MV9D 4OM0L 3WDIA 2B39A 2XWBB 4PJEF 2AJUL 2MFNA 35C8H 2ADIB 3LN9A 1HXMA 5JW4N 1DEEB 2XQBH 5E6ZA 3MGOB 5GGVY 2IGFH 4X5XB 4YWGH 1DBBL 3BE1L 1KCUH 4Z7NE 3QIBD 3KYOA 4ALAH 4U1HA 1GGTA 3UTOA 5HPMA 3WFZA 4K2UL 1SBBA 1MCFA 3NIFE 5ANMA 2ZPKH 3BPNB 1WZ1L 4OLYH 2JELH 4XCCH 5LWYL 4IRJB 5JZ7D 4NWUL 5IMKB 3QXWA 2VSCA 5TQ2L 4FG6C 3WIFA 3F6LA 3Q0HA 4I3RL 3I02B 1S7WB 4WFHE 2DLGA 5IHLB 3W11C 1RUQH 4NO3B 3IJYA 4GRLD 1DVFB 3KPQA 1CK0H 1G6RH 2JCCE 1F6AA 1KEML 1XCTA 1FNHA 25C8H 4J8RB 4PJ7B 4XPTL 4Z7QE 2C4XA 3QWOA 2ICWB 4WVRA 5C71A 3HE7C 5DK0B 4RA0C 4MDIA 1QFPA 2J8UB 1X5ZA 3VFTA 3GHEL 3MNZA 1DQTA 2A6JA 3MUJA 1Q9WA 4I5BB 4FQQB 4JG0L 2G2RB 1LO4H 1XGYH 1ZS8A 3C60A 1HZHH 2VR9A 2VDML 5A1AA 1BZ7A 4D94A 5GS2H 4M1GL 1MJ7L 1MIEH 4U4BA 3C8DA 2PYED 2AQ3A 3LEYL 4FQCL 1AO7A 2E7MA 5FO9B 3CFKA 1L0QA 2B2XH 1NBYB 1A14L 2JJUA 2F8XC 3GM0A 5FV2A 1KLUA 1A7BA 4U1LB 5HHPA 1UWGH 1Y6MR 2HFGH 4L4JA 3CZFB 5F21B 2W0KA 4GW5B 4YHLL 3BZDA 5INCA 1JK8A 3FO1B 5T1DH 3TBYB 3VFSB 4J4PC 1HEZB 4M6ML 1JV5A 3H9ZA 5EIIB 2ZG3A 4JQXA 1GC1C 1HDMB 1A6AA 1UKSA 3TA3D 2A9MH 3PGDB 1D6VL 3CIQA 3LD8C 4G7YL 1TJGH 2OL3L 1F42A 2V7NB 4LCUA 5T1MA 3RWGB 2CLZA 3WN5B 12E8H 3MJ7B 3CZJA 3FAXA 2P45B 3B6SB 1RU9H 2ENSA 2OXGA 3GO1H 3U9UB 2VLJD 1NL0H 3IDXL 3UX9B 2Z8WC 1NEZG 5J11C 4PJDE 2R39A 4ZPTB 2PCPA 3EOAA 5EOCH 4DK3A 1K4DB 3AB0C 4E42A 4Z7VE 4OT1L 1J7VR 4JQIH 5FGSA 5EULV 2UZYB 2NY3B 1EA9C 3QFJA 2Q8AH 3SO3C 1QACA 1J5OL 2W9DH 1R3KA 5F7LB 2VKWA 2Z8RA 4O51B 5E4EB 5C0FA 1PVHA 2X4QB 5DRWB 1CXLA 2EDDA 4YXKH 3CFIC 3IXAB 1IGTB 4Y5VA 2FWOA 4ZUWB 4GQPH 3SKMA 4MD0B 1OTSC 3EFDL 1P5UA 1JF1B 4Y5YB 1JMZA 3WIHA 4YDKL 2OZ4H 5JNYB 3RIFK 4NO0D 5ICXB 2YD7A 2IAMA 4OKDA 5HD8C 2O5YH 2CGRH 2CKBH 3PDOB 4LVNB 4PREA 1PKQA 2D03H 3OZ9H 4NNYB 3QFDA 3SCMC 1I75A 2COQA 4TVPH 1QFHA 2R1WB 1SJXA 4YFDB 4MCZB 5D93B 1T03L 1IKFL 1R5WB 2C26A 1SY6A 4OF3A 3BKYL 1FLTX 2JB6A 4PJXE 1L4IA 1U8NA 5E99H 2FJGB 5E6YA 2D7PA 3SGEH 3CMGA 5GJSL 1QLRB 4NJ9H 5JOPD 1GZQA 3VMNA 4LSSH 1Q8MA 4JREB 2VXTL 2DM2A 4LASH 4NKDA 1YQVL 4NQDB 3O3DA 1RVFL 5MERB 5FYLH 1U36A 4PJ5E 1XGQB 3MYJB 2NNAA 1BMGA 2GFBA 4M5ZL 5D7LE 5J7CC 4HX1A 3LMJL 2VLRD 3T8XA 4C4KT 3NCCB 4FQ1H 5ACMA 3MRQB 2VDPH 3WXWH 1KJ2A 1NH6A 4PTUB 3HC3H 3MRKB 4O02H 2DQDL 3L95A 2PR4L 3WXVH 4XNYL 3HLAA 1KJ3H 2F5BH 4GW1A 2OM5A 4NN6B 4KHXH 1YN6A 1IAOA 5IESL 3MRJB 3IETB 1OAQH 1V05A 1OF2B 1VB9A 3HC4L 1PD6A 5LQBL 4GBXD 5F7KC 4MB5A 3A67H 1MI5A 4LFHD 4MLSA 3C5JB 5T1LD 3TPKA 1AFVH 5DJAA 3L7EA 3PP4H 4HKBB 2BJMH 4ONFL 2GK0A 4JRWA 3V4VH 1J05B 4UT9L 4XPFL 3N50A 3ZE1F 4I3SH 5C08D 2OQJB 4JR9H 4GAGL 1CXEA 4XHJD 2ZCHL 5EU7C 4HKJA 2ZUWA 3ZYJA 1DBMH 2QLVB 5IBUG 4X98B 5DJ2A 1XGRB 1YYMH 1U3HC 1YNKL 3FMGH 3CDFA 4LK4A 1RZGB 3PXJA 3O4LE 4GAJL 3C6LC 4Q7DA 4KUZH 3WHXB 2DQHH 3DGCR 1FDLL 4E0RB 3IAQA 1EV2E 2VZUA 5CHNB 1DBKH 2FBOJ 5HJ3A 3VGHA 5I8OL 4GAYA 5DA4A 1CFSB 3MBXL 4KMLB 4OLWL 1HHGB 4IOSD 4F58H 1KPUB 5A40E 1BF2A 5DVKA 4H26B 4XNXL 2W1NA 3AGVA 2NY3D 1S7QB 5C0BB 5B39G 4LLYA 5CCKH 2P4AB 3GSOB 4D9LH 5C2BH 4PJHF 3GMMA 1JF5A 2YUZA 4LIQH 3O11A 2H1PL 5JHLL 5HGGS 2Q3ZA 3SBWC 3W39A 5ISZB 3JVGA 2NY5C 4JFPB 2DF3A 2EDQA 2WWKT 4RWHA 1I1AA 3D39E 5H37H 3FTGB 3VWKB 3WFHA 1FYTB 4FP8H 3CDGB 3BUTA 2VJXA 5K9OB 2XOTA 1A64A 4YZFF 4HF5H 3MA9L 1N6UA 4MVBC 1BZQK 2NTFA 3DVNB 1YYLL 3E6FB 3GRWL 4JZOB 5EU5A 4PGEA 4X9IA 1A3RL 4YQXH 1IGJB 3IDNB 4I9WD 2HFTA 2A0LC 4ODVL 4OGYL 1R3HA 1PX4A 3ARWA 3I6GA 1TENA 3PG2A 3EYFA 4RGNB 4FFVC 3BFOA 4Q6IA 3RVVD 1SYSA 3ARFC 4NOFA 1G7MA 3AXLA 4WTZG 4RRPA 3O6LH 3MXWH 2XWTB 1ZGLP 4XPBL 4UU9A 1DSFL 5E2WL 4GLRH 3L3HB 4YBLC 4NKIH 3O41A 1P4IH 3O9WB 5JQ6H 1E6JH 3QNYA 4WGWB 3MMEB 5L6YL 4ORGB 5T33L 4IRSA 4CN4A 1IBGL 1JI2A 1NAMH 5GRWA 4CBPA 3BP5A 1NCUA 2GT9B 5TPWH 5F1IA 4HFWB 4WW1A 1S7VA 3H42H 3RPIB 4HK0A 5FHBL 2F53D 1L7TH 4AYFA 1IKNA 2VAAA 1BGXH 1T66D 4K94C 4UB0L 2DI9A 5L7XL 3KPSD 2PO6A 2W60A 4PFEA 4LLQB 4Z7WF 1QRNA 4MAYB 3TIEB 4JGMA 1QVOB 3GMLB 3PWLB 3WEXB 5I1CH 2AXGA 3P9MB 1A9BA 1AD0A 3PGFH 4OZFA 3PWUB 3FN9A 3RVXC 2FGZA 4F9PC 4R4BB 1PZ5A 3O4OB 3P11H 4J1UB 2EEDA 3VXNB 1WBYB 3BZFA 5BV7C 5ID0A 2NY2C 3R06A 3VGAB 4OZHE 1CD0A 4LDLB 4XVTH 2ITDB 2ENYA 3QDJE 1BAFL 5CD3A 43CAA 4U6XB 3HS0A 4ZYKA 3BKML 2ED8A 2UZIL 4N8CH 3K2UH 5I76B 3P4NB 3VRIA 5ACZB 3NA9L 1NFKA 4NZRH 5D1XB 1EZVX 1QBML 3NZHL 3KLAA 4ZAKA 4BQ6A 3CD4A 2HKFH 5AYUL 4L4TA 1KOAA 1IEAA 3SJVD 4PRIA 1KACB 2D9QB 2BC4B 5C07A 3QQ9C 2DQCL 4K7FA 4FQIH 5I8EB 3F7YB 2JCCB 4X6FB 3ZE0F 1FG9C 2DBLL 1SBSL 1NMAL 1XR9B 2BSTB 1FGVH 1I8LC 4HUUB 4PJGE 4PRNA 4N0CD 3EDDA 1BIIB 1I8IA 1MVFA 5KSVB 1PDKA 2VDOH 4NJAH 3VWKD 4EXKA 1F3DH 4NRYB 1FFPB 1FBIL 5HHXH 4X4YA 2YD9A 1MIML 1NEZB 3H3KA 3VJ6B 5DD5L 5EBWA 1CU4H 5J9PB 1L7IL 1MRDH 2FO1A 1I1RA 3TBTA 2HT3D 3STBA 5IR1B 5FAAA 4IEFB 3SE8H 1TVHB 1VKXA 5JORA 2OR9L 4M1DL 5BVJA 5K59F 4NT6B 1Y6KR 4MXQC 3EO9H 2HJKA 1UH4A 4H1LH 2R1YA 3BH8A 4URTB 3IDMA 5C7XH 1UB5B 4L8SB 3LRHA 1UQSA 5FGBC 5IB4A 3FOMB 1TETL 2YUVA 1D5ZB 4JY6B 3O9WD 1EAPA 3ECBA 3VFUB 3H7BB 5E08H 4L4VD 3QNXB 4HLZH 5FKAA 4OUOA 3T77B 5I1GL 3VD5A 3DHMA 4JPWL 3R1GL 4MD4A 3WNPA 3CVHA 1LK2A 5ESQB 1AIFB 4PJDB 2D7OA 3O6FA 4R7NB 2GJ6A 4G9DB 1G9MH 5CMAB 1KIRB 3C5SB 4Z7VB 4MAYD 1P1ZB 4WI6A 1PYWA 2VERN 4L5FH 5FM5O 3HFMH 2X4RB 1XH3B 3LKRA 4J4PA 3ZL4H 3TNNB 3OX8B 3IF1B 5E2VH 4NWTL 1HXYA 1WAAA 4AM0B 5SX4H 4EEEA 2OCFD 2QHRH 5HY9B 3ELAT 3KXFE 5KSAD 3B5HA 2CH8A 5DFVC 2P5EE 2KQMA 1Z0NA 3OBAA 1RZFL 3LHPL 4APQD 2DTMH 3IDJA 3MRHB 3P0VH 1GOHA 3GBMH 2W9EL 4CU8A 3VGBA 1CTOA 1ZEAL 1AGDA 3QCVL 4UINH 3C5ZD 3WHE0 2PNDA 5I1IH 3UTTA 4XX1E 4LU5L 1OP3H 4FQXC 3D0VA 3CXHJ 4R8WH 4XMLH 5D1XD 1GAFH 3KDMB 3WNOA 4PJXB 1NMCC 2D0GA 4JM4L 4WFHD 4KDWA 4MJ4A 5C6WH 2E5EA 1MJ8L 3PWNA 1I9IH 1TVBA 4PJEA 3QPXL 1T20A 1NEUA 3PWVA 4G80B 3QCTH 5CD5D 1UWGL 2X4TA 4QRPA 4ZOCA 4GS7C 1QFWI 4PJ5B 4W6WB 5IBUB 3S35H 2ZJSL 5D7LB 3R0NA 2F58H 5E2TL 2R69L 5AYQA 3PHOB 1VGEH 3TNMA 4QY8B 4TYUA 1RUPL 1IAIH 1YNTB 2ORBL 1FFQA 1TZHA 3QI9B 3SCMA 5CUSH 1TJGL 3UTQB 1K8IA 4KUCF 3PWPE 3UMTA 4MNQA 4HJ0D 5B39B 2WINB 4X7EC 4K71B 1YEEL 3EOTH 1SM3L 2W0LA 1AXTL 3SKJL 5KVEL 5AAWA 5TE4L 3QUXB 1KJMB 2K7PA 4PJFE 3VW3H 1KELL 3ILQD 2C7UA 5HDBF 2Q8AL 4RWYL 3STLB 5MEND 2W9DL 4OQTL 3ESUF 5JXEC 4EIGB 1A6TA 3KJ6H 3BW9B 4P5TC 3CPLA 3V9FA 3D48R 4PRAA 3AU1A 3I3DA 1AD9B 4LMQI 2EC8A 1CLYH 2VL4A 1JYWA 4LCCC 3MLXH 4DK6A 3F12A 3S37X 2FX9H 3VG9B 2OR8A 5EUOA 2DB8A 3MRRB 4AT6B 2R0LH 3VWJB 3LDBC 4G3YL 4N9GB 1UZ8B 3V6OE 3OJMB 3EDKA 2XZQL 4OFYA 3BDXA 3CX2A 4YHNA 3AAZA 3GB7B 1Z9OA 3PJSB 4XT1C 4YHMH 5F72S 5GGRB 3LRSA 4WW2C 2XA3A 3KVQA 4AMKH 1HSBA 3J8F7 2HFFA 3V8OA 1JNNL 5EO9B 5E99L 3T0DA 5CSGA 3ULUL 2BNRE 3F65A 5DD3L 4FN0A 4NJ9L 3BH9B 4RX4D 4U33A 3BSZH 3LKSA 3U48A 5SWQB 4LLDB 4WU7A 4XVUD 2AABH 3ZTJH 1JGDB 4LASL 1A5FL 4HG4K 4MJ5B 4F80A 2IH3A 5TH2B 1U3HA 3ROOA 3L5IA 1HH9A 4HGMA 3VDAA 3CSGA 5D71H 5SWSA 4JO1L 3D39B 3RL2A 1I8KA 3QULA 4PG2A 1JYXA 3EZJB 1P7HL 2IG2H 3DXAB 2C1PA 4M4RA 1G7LB 4JO3H 2CDFA 3JV6B 5I30L 4DJMA 4ERSL 3WO4B 2Z91A 4HUWB 2R1XB 3P30H 1L0XA 3MOBH 1A7OH 3MV01 4UV7H 4UV4L 5DJ8A 3RJQB 1CFTA 4JFEE 3VH8G 2VMFA 4YDVA 5FUOH 4KK6C 1DN0B 1J11A 4HIIA 3LKNA 5TDNA 4NQEA 1Q0YH 5MP6L 1JGVH 4PB0H 4F2MA 5DVOA 3SBWA 4LAJH 2BOBB 4I0PC 1E6OH 4EOWL 4PJ5D 5IVZA 1BQLH 4B7LA 1TZIB 5D7LD 1AFVL 2C4FU 3W9DA 4CNIB 3OKMA 4OCSL 3C6SB 5DEGA 1WC7A 3RL1A 5TF0A 3K8LA 4J3OC 5I1HL 3QI9D 1IZKA 4I0CC 4W68A 1HH6B 3MUZ1 3QBTB 4N0UE 4PJ9C 4JDZA 5ID1B 1A4KB 3FOLA 4OLVH 1QLFB 3GI8H 5C6PB 2GY7B 1CR9H 5C0IA 4HXBL 1C1EH 2XN9B 4NKMB 5L0QC 1XGTB 2X40A 3C8KA 2HH0L 5I17B 4YXLL 1KFAL 3FHAA 2E9JA 2ZUTA 5HHME 4F58L 3WNKA 1EEYA 3QUXD 3RGVC 2VIRB 3DX7B 1T1ZA 1FNFA 2YPVL 4LKXB 2ZG2A 4LKCA 5E8OA 3DECA 3L5XH 5FGCE 4LIQL 3GIVB 1XR8B 4X8XA 5KSBB 4NQUA 2VXVL 4OZHB 5D1QC 3Q48A 5E5RB 1IGIL 2BRRL 1FNLA 2RCSH 3QDJB 1YMME 5EU4B 3VXRA 1LEKA 2NW2A 2NY4C 1BQHA 3O4LD 4UMGA 4UTAH 2N56A 5ITFA 4FQJH 5GZNC 5DZOA 4NN7C 4KTDL 2UWEF 1WWWX 5T3XL 2XQYG 4P46D 4TN9A 4LCIH 1ZV5A 4XI5C 3CC5A 2PXYB 4OCWL 4YBHA 3RNQA 3ALWA 3CK0H 4R96A 3CFEA 1N0XL 4GXVL 3EKCA 4EXPX 5EFIA 3ULUD 4Z77B 2V2TB 1MLBA 4L8DB 1LDSA 4I2XA 3S37H 1NFIA 1W72L 3VXUD 5DHXB 3EUUA 5EB9A 2QKIA 1M6OA 1KXVC 4F9PA 3B9AA 2CJUH 2OBGA 1S7SA 1UFUA 5F3HA 4OCLC 1AGFA 3H9SB 2VQ1A 4PJGB 1KCKA 1OSZB 3RY4A 4JKLA 4RZCA 1TJIH 1Z0MA 3D39D 2DD8L 4X7TA 3KPLB 4XNZC 4FZEL 3VGDA 4XMPH 2AK4D 4NM4H 3IU3A 4UT7L 5KN5B 2PUQT 4J6RL 3I9GH 4ZDHA 1F4HA 4NRXB 8FABB 3W0WB 2DQUH 3QO1B 1XGPB 3JWNC 3I2CL 3QIBC 3VD3A 5C8JA 1S9XB 1Q9OB 2KH2B 5CWSA 1OAKL 2HG5A 5E00B 4WI8A 4RFEA 2EYSB 1FZJA 3SKNB 3ISWA 5INDB 6FABH 1DLFH 4DZBA 5CBAA 5JZ7C 2VE6B 4ODSL 4X9FA 3QXDA 3HG1A 2YR3A 3FQUA 1RK1A 1REIA 4NC0B 4HS6B 3VMPA 1R3IL 3LN5B 4YH6A 1I8LA 3EO1B 3LKPB 1KPVB 1N4XL 4P57B 5BZWA 3O6ML 1V3KA 3UO1H 4ZUSB 4S2SB 4GRLC 4R0LC 5CEZE 4FNLL 1IGYA 1M7DB 2V2WA 1BVKA 2FO4A 1T1XA 4MCYB 3ROLB 1GCFA 3NTCH 3D6GA 4ODWB 2EXYD 3QEQE 4K3DL 2VXUL 3WS3B 3ZZ1A 4JFQA 1JL8A 4R3SB 3TYFB 2AV1B 1YUHB 4YEFA 5IW1A 4N8CL 4MXWH 4MDJA 3CLFL 3GMQA 4J3UA 2DYPA 3OJVC 3E1F1 5JDJA 1BIHA 4YO0B 1AHWA 1U91A 4CVZA 4ELKB 2EEBA 4XBEL 2XXMB 3JZ7A 4XZUB 1Q38A 3P40A 3PHQB 1C12B 2H6PB 5FGBA 1XF1A 1UT9A 2AV7A 2Z8SA 4GG8B 2EDFA 3KXFB 5CEYA 2IEPA 3MV7E 1ZLSL 3QDJD 5T3XD 5HI5D 4Z5RB 4NO5A 1PQZA 1S9VA 2P5EB 1U42A 4GH7B 4P9HC 4JPKL 1KCRL 1I1FA 1OGTB 4WWKD 2B1HH 2APVA 4XP6L 1CGWA 2GUOA 3LQAC 3TA3C 1S9YA 4NM8L 2UUDK 3CSPA 1M05A 3H9YA 4Z7UF 5T5FL 1VADB 5D8JH 3LAFA 1QYGH 4DEPB 3Q1SH 5IB1B 1CU4L 3QXAB 1E4WL 1MRDL 1FJ1A 3DETC 5FO8B 3G6DH 2R56H 4Y5XB 1CDBA 1MPAH 1KLFA 2F54E 2E3VA 1NFDE 1MHPH 4PLKD 1F4YH 4XWGH 1WZLA 1N59A 3N1GC 1RV6X 4NPYA 2BNQA 2Z9TA 4HV8A 2HWZL 1I7RB 4LP5A 4ZSOE 4ZUVB 2B4CC 3O6KL 5GHWL 5E8NA 5IK3A 3DO7B 1QPXA 2H2SD 5IQ7H 1R3LA 1RZKC 3FZUD 5GZOD 3P0GB 5JA8B 2GQHA 2YXMA 4FQXA 5CIPA 1G7PB 2UZXB 3B5GA 4J23A 4OI9A 1DQJB 2YUXA 3OGCB 3D18B 4XCEB 5I19L 3PWPB 3BPNC 3TCXA 4U6HB 3FFCE 4RFNB 1MH5B 3DUUB 4OD1H 1MNUH 3GMRA 2Z92A 4LNVA 5C86A 3VXQA 1FL5B 4NGHH 4PJFB 1D9KA 3A6CH 4XVJL 4U6TA 3DTXA 3B2UD 2QV2A 1K6QH 3GMNB 5IMLB 2A77L 3U4BH 4XNQA 1MHHB 5CP3A 4XC3H 1INDL 5TFSL 5D7JB 2FJHB 2HJLB 1RHFA 1KG0B 5M7QA 1NCCH 5DQJA 2G75B 4O2CA 3QYCA 1VESA 5JO5A 1MRCH 5FHAL 4LNRA 4WHYH 5DMJB 4N1HB 1JUFB 1MFCH 4UNTA 3VH8B 2YSSB 1FGNL 3TESA 2J4WH 4FTVB 5I1AB 1PX3A 4CMMB 1TIUA 4MNHA 5DD6B 2ESVE 3LZFL 3MV8B 2FGWL 1MI5E 4PRHA 1FV1B 1MQKH 3BIKB 2LV4A 2VYRE 5F7DA 4EBQH 2Y5TB 1CDGA 5KTEH 2BNRB 2BOCB 1LO3H 3ALPA 4JKPH 4OFPA 4P23A 4P5TA 1T1YA 3KXFD 3V6FA 4PRPA 1YEIH 4B5EA 2Y5EA 3PIQB 4UQ2A 2P5ED 3BVNA 1AR2A 4JM2B 1RUKH 2HAZA 3KHOA 3QA3A 5DD0H 1A3QA 4LCCA 3RHWF 2F58L 4JDVB 4XHJC 3VXSA 1BM3H 5EZJA 2XRAL 4L3AA 1JGEA 2VDLL 4NQSB 2X89A 3OB0H 4XMKH 3WN5C 3LS4H 4KY1H 2W92A 1GZPA 4S1QH 3JTSB 4G6KL 1F11B 2MQCA 4G8EB 1JRHL 4HIXL 5LGJA 4JFEB 2EICA 5BW7C 4WW2A 2GAZA 1IC7L 4M9OA 1H0DA 5JOFB 1GGCH 3CSYA 3TJEL 3REWB 5MEPA 1FP5A 4MHHG 3KLHD 1IEHA 4YHYB 3EOTL 1JHKL 5E1HB 2ATPB 1UXWB 3HZMB 5IVXE 2NY3C 3QCUH 2IBZY 5F7YC 5L9DH 1BWMA 4JKWA 4JN1L 2Q76A 5DI8B 1JZ4A 3ZYOA 2VUOA 2G60H 3PGCB 2X9XA 5E4EC 3SPVB 3DI3B 1G1CA 3D0LB 3W82A 1SEBA 5C09A 3MJ8B 1S7TA 1AE6H 2VTFA 3KYKH 3F8UB 4OGXL 4Y5YC 3F58H 3HAEH 4N0UB 1H15A 1CLYL 1KENL 3GJFB 5ITBH 2J2ZA 4BFIB 3KPPB 3JWDC 3PWPD 3MLXL 2X4NA 3KPTA 5C70A 4M48H 5ADOL 2LAGB 3ZKSD 4OKVA 4V1DE 4CVXA 4Z6AT 3MGTB 5D93C 3S98A 1HKLH 3D2UD 1INQA 1MJJA 5FA4B 4I0PA 4M8QB 4K9EL 4O2EB 3HZKB 2PETA 2AKRA 2ZOKA 1N64H 2EH7H 2F19H 5FGCB 3RVVC 4JAMA 4JREC 3OKLB 5KW9L 3MJ9H 5D2LF 5EZLB 5C3TA 4LLWB 1IE5A 3TBSB 2ZSWA 1T5XA 2AABL 4KI5E 1YMMB 1R5VB 1WVZA 4Z0XB 1JPTH 1CFQA 1SEQH 2AJ3B 1P2CB 4PJ9A 3FN0H 1FFOB 1MWAL 1URLA 2BVQA 5IFJA 4C56E 4J3SA 3FQRB 4X7SL 3N1FC 1IC4H 4ZPVA 1RI8A 1E28B 3DRQA 1ZT1B 2Q7YB 4XP5L 3U9PH 4HUXB 1JHLH 1Q9LB 2OLDA 3NCYS 2K7QA 3QO0A 2WNGA 3GSUB 3P30L 3RGVA 1XF5A 1A7OL 4N90E 1U8QB 1T66C 3WUWA 1I1YA 4MA3B 4NN6C 3HCVB 2H26A 3PL6D 4PGBA 2BNRD 4XP9H 1WFOA 3IDIA 1BZ9B 1JPGB 3E3QE 5EBLB 3X3GL 4JZJB 4PJIA 5D1QA 3MA7A 5HTSA 4AIZA 3WBDA 1HK6A 3KHQA 4GSDH 4KTEH 3BT2L 1W2KT 1QBLH 4ZD3H 3T3ME 3LQZB 1YY8B 1F4AA 4P3DA 4IS6A 2HVJA 3VE0A 1P7QA 3D3VA 3V2AR 3U2SA 3RKPA 4ACPA 5ERWA 1CL7L 3WLWD 1EUUA 4BQ9A 1HSAA 4JFED 3MFGB 4HQQH 2P7TA 3NIFF 1I1CA 4OB5H 1ZVSB 2BVPB 2V2XA 1G9NC 2X42A 2A6DA 1DZBA 1YEKH 5C07E 4JFZL 1I7UB 2XZZA 1QKZH 4EN3D 4UQ3B 5JDSA 1M7XA 1CI5A 5B8CB 3MLVH 2WMPA 2H8PB 3KS0J 4LLMA 4P4KB 1VERA 4WTWA 4Q9CA 3CFCH 4KZEL 5IG7B 4ZXBD 2RFXB 1GC1H 1U8MB 2VLKE 1X5HA 4LF3B 5ELIA 1SMOA 3DIFB 4XTRC 3FQTB 4QHMA 2YN3A 3CFBB 5CBEB 4N0CC 4OCXH 1F90H 3QIBA 2DL2A 3G04B 1WBZA 3QEQB 2GSGA 3VWKC 1J0HA 5IHUL 2YC1B 3UC0H 1X3DA 3X17A 5HI4C 3KPRD 4WUUE 4DGYH 4LP4A 2Y25A 2EDKA 4U05A 3L3JA 1TQBC 3UCRA 4ZTPH 5L2JA 5HHMD 5DJDA 1OAXL 4F57L 3CH1A 2HT3C 1UZ6F 3HZYA 3KPOA 4PLOB 4EUPA 1DE4B 3SY0B 3GBNL 2ZKHL 3P9LA 3BX7C 4HBCL 3X12A 3GIZH 5I8CB 1G7QA 4KDVA 1B9ZA 4U1NB 5AUMB 3BMWA 4GRLA 4R0LA 5KJRH 4PYGA 3KR3L 3BKJH 2DM7A 4RMVA 1G7HB 1KIQA 5EG6C 3MV7B 3LEXB 2Y36L 5FYLE 1V3MA 1YMMD 2CQVA 1N2RA 4QRUA 4NYLB 1KNOA 3PV7A 4GKZA 4I18B 2JIXB 1BREA 5E94B 3O9WC 5A43C 1UM6H 3QG7H 2I5YL 2WLZA 4B53A 2GJ6E 2R0WH 4NM4L 3VGEA 4B7IA 1T7XA 1R24B 3RPKA 3I9GL 3RBSA 4H25B 3NABL 3S5LG 3E0GA 5C0DA 4J3XA 4F33B 1ORQB 4HW6A 2F54B 1NFDB 2AJSH 4MAYC 2XYCA 4HWEH 1QSEB 1MCSA 3V5KB 4JCMA 4RISL 3MNVB 4MQ7B 1T21A 3THMH 3NH7L 4J2XA 3DI2B 2AGJH 3GKZA 1KJVB 1T5WB 5HGAA 3O4OC 4QTIL 3WIHL 3VGAC 4CAGA 5KSAC 3TA3A 5IOPA 5IJVA 5IB2B 4IOFD 1WITA 5CZVL 2I9TB 4UT6H 5JLZA 1MCJA 4APQC 4Q0XL 2IALB 3QUMH 2OYPA 3C5ZC 4LSTH 4YNYA 3U6RA 1YA5A 5ALCL 2EZ0D 2IADA 3FFCB 4BM7A 3EOBB 1SY6L 5HYEA 4JB9L 2CLVB 3EYVB 5D1XC 2YD4A 5C0CA 1KYOK 3W2DL 4BQBA 2QSQA 3DX8B 5I2IB 2HMID 2XWBA 1U3YA 4MHHI 3I75B 2ADIA 2IBGA 4EIZC 1MAJA 2XZAL 5HI3D 4LGPB 4BFEA 3NCJL 4Z9KB 3V4UL 4JKMA 1CLOH 1MOEA 5CD5C 1DEEA 1CFVH 3MGOA 4HXAH 4Q6YA 4RBPH 3E2HB 4MQTB 1KJ2L 2UV3A 5B3JF 2DMBA 3IS0X 4PY8I 3QEQD 2V9RA 1FZKB 1AQKL 3MRNB 1ZHLB 1J9CT 4I4WB 2DQIL 2NY1B 4PJBE 1VPOH 2ESVB 4M5YL 2Q8BH 1V7NH 5IMKA 3VGGA 1UGNA 3MNWB 4LSQH 3NFPB 4HJ0C 1SJVA 2DM4A 1P9MC 2ARJB 3I02A 1S7WA 3G6DL 1UA6L 5FM5M 2R56L 3RU8H 2I25N 3M07A 4NO3A 3MODH 4JY5H 3TVMD 1DVFA 4ELME 4AIOA 3ILQC 3MV7D 4L8SC 4J8RA 1H9VA 1OCWL 3AFLA 4PJ7A 1O7VA 2ICWA 3EYSL 4X4ZA 2ZNXA 1OAZL 5DK0A 5DJ0B 3C2AH 2J8UA 3N1QC 1J0ZA 5FB8B 1LO2H 1HINH 4PIRF 3AROA 2W0FB 3HZVB 1A7PH 4FQQA 4I5BA 2ILLA 2G2RA 5C2UB 5H37G 1A47A 3RAJL 1RUML 2BVTA 2CIIB 1PW3A 4QHKJ 4PYHA 3S96B 3SE4C 1AXSB 1DQQB 3CDYA 5FO9A 3GZKA 4UIMB 1NBYA 3ULUF 3OAYK 2DMCA 5A3ID 4U1LA 5IVXB 4QOKE 3CZFA 4WEUD 1W8NA 3BWAB 4GW5A 4TQEH 3D25B 4U1MB 5T1LA 2FR4B 1OARL 3FO1A 3TBYA 3VFSA 1HEZA 1OT1A 3VFOB 1I7TA 1BJ8A 5EIIA 4XVUC 1HDMA 4HCRA 3PGDA 4JRYB 4E41E 2V7NA 1BJ1H 5SX5K 3RWGA 3WN5A 1BFTA 1F6FB 4TRPH 3MJ7A 3DX6B 1S3KL 2AXHA 3B6SA 4PJCF 1W0WB 1GL4B 1MRCL 5BW7A 3U9UA 4HAFA 3QJHB 2ZNWA 3RWIB 4WJ5B 1NBQA 5I73C 5AZEL 3JWOH 2CPCA 4ZPTA 3FFCD 4V1DB 4H88L 1K4DA 1KC5L 2VXSL 3FT2B 2B0SH 1T7VA 3E8UH 2MQ3A 4O51A 2I60L 4XPHL 2X4QA 5DRWA 1HCVA 2C3GA 3IXAA 1IGTA 4FFWD 4K23L 2WUCL 1JBJA 2I07B 4ZUWA 4MD0A 2VC2L 4XXDB 1G6RB 2EO9A 1JF1A 4KJYB 4XCNB 4Y5YA 1QFOA 4L3CB 5L8LB 2GYSA 3BEWB 1CDHA 1I3RB 3FL7A 3FO9B 5JNYA 1JGLH 1KXTB 2ICWJ 5ICXA 1FO0B 2G9HB 5JMRA 3GMOB 1ZGLB 2UY6A 3MTRA 4YPGB 3S36X 5JHDB 1RZJC 4C56B 3PDOA 4Y8DC 1VCAA 3HUJE 4NNYA 3QI9C 2HT4C 3AS1A 3MLSL 2EE2A 1KF9B 2ESVD 2OJEB 5FECB 2R1WA 4MCZA 1IM9B 1R5WA 4YFLF 1VFAB 1MI5D 1FNEB 4KJPD 4Z18A 4WEMB 3ZE2E 1QP1A 4AEHL 4PR5B 4K71C 4KK9C 5GSRB 2FJGA 1QLRA 2OP4H 3O45B 3Q6FB 2R8SH 5KZCB 4MAUL 3QUXC 2CUHA 1J0KA 4NQDA 2HKHH 5ICZB 5MERA 1J1OL 3CMOL 4W4OC 1XGQA 3MYJA 3IFPB 4YPJA 4JFDE 1A21A 1TVDA 2BDNL 3MRQA 4OZHF 2OI9B 4P2YA 1ZVHA 4HG4J 1BQUA 4PTUA 3H3PH 3MRKA 1KB5H 5E9DB 4DFIA 4M7LT 2HT2D 1NCBL 4TPRH 1GGIH 5DDHB 2NY6B 2V7HB 1UCBL 1WQVT 1E4JA 4KHTL 3KPSA 3MRJA 3BAEL 3IETA 5HHVH 2HN7B 1OF2A 3LQMA 1KGCE 3BP7B 1H8OA 3WKNA 3C5JA 1CBVL 4HKBA 2R2BB 5TDOB 4DN4L 1I1AD 5C0NC 1J05A 4GKNB 2VLKB 1H5BB 1WK0A 2OQJA 5BMFH 4ZOAA 4HWNA 2EIZB 1N64L 2GEEA 4H1LG 2EH7L 2XTJD 2YRLA 2FHBA 1U3ZA 4H5SB 3SGEI 2BCKB 2J6EH 1FNAA 1F3JB 4OJFL 4X98A 1XGRA 4HT1L 1RZGA 4OLUL 3A6OA 3WHXA 3WD5H 4FQ2L 4LGRB 3M8OH 43C9B 2WP3T 4E0RA 1GHFL 4GG6E 4R90L 3S5LB 5CHNA 2CKBB 4FXKB 4HLZG 1CFSA 4K8RC 4WUUB 1N8ZB 3V5DB 5D6DC 4V1DD 5HYFA 1KPUA 3T65B 3WO4C 4H26A 4QHLB 1S7QA 5FYJH 4M7LL 1A9EB 4MB3A 5JUEH 2WQRA 3GSOA 1B90A 1RFDH 1N5YL 1ZKAA 5GRJL 4BZ2L 1OAYH 5J4MA 3MCLL 1JFQH 4X80H 3MACL 5ISZA 3VA6A 4JFPA 2AK1L 4KI5D 5KVFL 3BDYH 4N8VG 3NGBB 5I0ZA 1N0LA 4GSDL 4NC1E 4Z7OE 5D96C 3FTGA 2R2HB 4JO2H 2EDJA 3VWKA 3C87A 3QZWA 4C56D 1FYTA 2PW1B 4NQVB 3CDGA 1V3LA 3NFSH 5K9OA 1T04A 2PO6D 2A9NH 4JZOA 3DVNA 4KWUA 3CVHL 2KDGA 3E6FA 1IM9D 1A6WL 1AR1D 5GS2D 4MJ2A 4WI7A 4F8TA 4X6DF 2M1KA 2MJWA 2DL9A 3IDNA 5C1MB 4N90D 2EDEA 1OLZA 2E9BA 3S36H 4GRWF 3K46A 3VI4F 4KROB 5KZCD 3JV5A 5L8JB 4Q2ZB 3LSOB 4TSBH 5D2LA 2YBRB 4YFLI 2XWTA 1HE7A 3OAZK 3HI5H 4JO4L 4TSCH 5CJQH 1MCBA 2OSLB 1NUFA 1GGBH 3L3HA 4LLVB 3A6BH 3NMEA 3O9WA 3EYUH 5F97E 3SDCB 3MMEA 1QUNA 4ORGA 2RGSA 3FRPG 2VLLB 5HI5C 5EOQL 3PNWB 3MLZH 3X3FL 5ILTL 1WEJL 2GT9A 4O58L 5E0QA 4EDWH 4HFWA 3NPSB 4OCXL 5CILH 5IFHH 4MS8D 4HPYL 1FORL 5C07D 5DEZA 2FSEB 5TGBB 4DGYL 4LLQA 4YE4H 5HBBA 4MAYA 3T0VA 4CW1B 2X05A 3TIEA 1QVOA 3GMLA 5TDPB 3VRLE 3PWLA 5BZDB 1C7SA 5FF6B 4IBLT 2FIRT 5CLWA 4M6OH 3WEXA 4WHCA 4X99B 3P9MA 1NAKL 1MFBH 4HJJH 1RULH 2WW8A 3PWUA 4P48A 4R4BA 4J1UA 4PLKC 3VXNA 1FRGH 1WBYA 3JV4B 2Z8VC 2VR5A 5KJRL 5KSAA 1K3IA 4CMHC 3MRPB 2ITDA 3BGAA 3BKJL 3MLRL 4CKVX 1DQLL 2VN4A 2EDXA 2FB4L 1AJ7L 2SEBB 3ZKND 2F74B 2APFA 4F37K 2VDRH 4HMDA 4NZUH 4WUUD 2NYYD 2A73A 3FZUC 3W11D 4WFGE 5GZOC 4PJBB 5I76A 5T3ZH 3P4NA 1LP9F 5ACZA 5D1XA 3AREB 2R2EB 4U3XA 4OCMC 2D7QA 3DX9B 1XEDA 1UYWH 1MCQA 1WCBB 2F9BT 3L3IB 5TQ0H 5JXAH 2R0ZL 2BC4A 1MAKA 3O3EA 5J12B 1ZA3B 1WJ3A 1CFNB 5I8EA 3RRQA 3F7YA 1DUZB 2JCCA 4X6FA 4ELMB 4BUHA 3G5ZB 1XR9A 5FYLD 2BSTA 4HUUA 3VA2C 1JNLL 4JG1H 5DEFB 3JTTB 1BIIA 4Y4FB 5KSVA 5IVNA 1CGXA 5K9JH 1YDPB 3ZTJG 3WMSA 4NC2B 1FFPA 2A6IB 3O6FD 1FIGH 3EW3B 2GJ6D 3SN6N 5EN2B 4DGIH 4OUUB 3VJ6A 3I6KB 4NUGL 5HDOA 1NAMB 2N7BA 1FL3B 5J9PA 3I3EA 1T83A 5D4QA 3KS0H 3PF2A 1VGKB 5IR1A 1P9MA 1BBJB 3RUGE 1TVHA 4KROD 5A2FA 4MWFB 3VFRB 4NT6A 5LCVL 4DTGH 4QOKB 4LARH 3MLUH 1YEHL 2NXYB 1UB5A 4L8SA 5F9OL 5TE6H 3SE3A 4OI8A 1LE9B 2FLBT 3V0WH 1MFEH 5BO1H 3FOMA 4CDGC 1OWWA 4JY6A 1D5ZA 4XBGB 5EU3B 3VFUA 3H7BA 3I6LE 5DF0A 2AERT 3QNXA 4E41B 1CLOL 3T77A 1HNGA 4Y4HB 4GT7A 2NX5B 1UWXK 3BJLA 4PGCB 1MHEB 2YKLL 4K3JL 3O8XB 3QWRD 5ESQA 1AIFA 3WKMH 2B1AL 4PJDA 3SE4A 3DOSA 4R7NA 3QHZH 4G9DA 1U8PA 3IU4L 5CMAA 5KS9B 2HRPL 3C5SA 1OTSD 1UC6A 4U7MA 4Z7VA 4LSVH 4F7TB 1P1ZA 4U1SB 2DRUA 1I8MB 4BQ8A 3MRMB 4X4ME 4N8PA 4GO6B 4Y5XC 2X4RA 1XH3A 1I4FB 3MRBB 3TNNA 3OX8A 3KLHC 3IF1A 3VXTB 1R0AH 4HWBA 4AM0A 1F2XK 2NY5L 4KMTH 1YEGL 4RX4A 3QEGH 4C54A 5HY9A 3OKYA 4R26L 1RURH 3IDUA 2DDQL 3O2DH 4WY7H 1VACB 1BBDH 2W38A 4QHUB 4XVSH 1U93B 1Q0XH 1FN4B 3VXME 5CINH 4IIQB 1A3LH 1UEMA 3TIDB 1DJSA 5IBTH 1WTLA 1MCWM 3RZWA 3MRHA 4MNQD 1RZ7L 3TV3L 5JA9A 5IBLD 3QRFM 4OZGE 4DW2L 3RX8A 4PY7B 5AZ2L 2XG4A 1UM4L 4N0FB 5C0GB 3GNMH 3LRGA 4P0DA 5HHNB 3QJFB 2W91A 3KDMA 4PJXA 2ZCLH 3D85B 3NCFB 1X4XA 4RFNC 3MV11 4YGVB 4M7JL 1CDYA 1EO8H 4UBDD 4H1LB 3ZDYE 4G80A 3BOVA 4QYOB 3BN3B 1NCDH 3S3JA 4DKEL 4PJ5A 1PY4A 1U0QA 4OCNC 4XNUH 2XWJB 5D7LA 3OHXA 4KQ4L 3PHOA 5I9QB 4JFDB 4QY8A 4X9BA 1BQSA 2X2YA 1MAML 5LGHH 1YNTA 1N7ML 3L1OH 3TBVB 1NBVH 4LPYA 5D7IF 3ABZA 3QI9A 4PTTB 3UJIH 1HHIB 3IRZA 3IGAB 2J5LB 3UTQA 4JJ5B 4UAOB 4BSWB 4MMXC 4TRPL 4K94L 4N1CA 3H2WA 3SDAB 2QADD 5B39A 2WINA 5DFTA 3QEHB 4TULH 1B2WL 2VDNH 5I1KL 3V6OC 4F9LA 2P5WE 4FFZH 1TCRB 2GCYA 1JZ7A 4RDQF 4EI5B 3RWDB 5DRXB 1PY9A 3QUXA 4NHCH 4G7VH 1KJMA 1ZTXL 3QIWB 3SE9L 3RWJB 4M3JA 2NXYD 4PJAE 3EJZD 4IOIB 3OB8A 4M62L 3STLA 4YK4B 5BV7L 2MMXA 4N8VB 1QNZL 5KOMC 4NKOB 4NCDA 4PLJD 3BW9A 1AD9A 3S97C 3ARGB 4E41D 4L9LB 3M1BB 1JIBA 3O8XD 4GG6B 3MREB 3LPFA 1TFHA 2X10A 4F37F 3MRRA 3TT1H 4AT6A 3VWJA 4JQVC 4N9GA 1UZ8A 2FHFA 2RIKA 4IJ3B 1LK3H 3CXDH 1IAII 3WLWC 3GB7A 5F7FA 4NN5B 3PJSA 1BFVH 5GGRA 1MF2H 2YS4A 5H2BA 3VFWB 5C6TH 4WTZA 5T5NG 1MUJB 4KJQD 5EO9A 1C5BH 1J1XL 1DDHB 2EIBA 2IFFL 3U7YH 4EN3C 4YHYC 4XAWH 3IDYC 3BH9A 3BZ4B 5SWQA 1A7RH 3P2TA 2OXHA 4LLDA 1JGDA 5FYKH 1E4XH 4MJ5A 3P0YH 5TH2A 1U2HA 5J8OA 1EDQA 4LVHB 3D39A 3P4MB 2XG5A 1ZHBB 3CX5K 1FAIH 3DXAA 4WHTB 5H94B 1EMTH 1G7LA 3JV6A 5ENWB 2NMSA 1OP5K 1F8TL 5D6DA 1T0NB 4L3EE 1A1MB 5C92A 5EORL 4OM0H 4EDXB 4HUWA 2R1XA 1PG7X 1H3PL 3ESVF 1DN0A 3D85D 2Y7QB 4L1HA 4QXWA 3BZEB 1FNGB 3I84A 4IHOB 4P4RB 1MCRA 3UBXG 4G8IB 1DBBH 2V5TA 4LCWB 1TLKA 3BE1H 4X5WB 2BOBA 2UYLB 3INUL 4CNIA 4K2UH 3GI9L 3C6SA 4JFDD 1CF8L 3S8WA 1WZ1H 4S10A 4MA7L 5LWYH 1T4KB 3RVTC 3TP4A 1A22B 3HI6L 4HKZB 4NWUH 2FECL 4NUJB 1PEWA 5TQ2H 3BDBA 1HH6A 5ID1A 4OLZL 4OZIE 1A4KA 5EPMB 1QLFA 5GQBA 1I3GL 3NN8B 4AQOA 4NKMA 5F7NC 1XGTA 5F1NB 1KCVL 3BGFB 5I17A 1QPPA 4OSUL 4MX7B 1KEMH 4XPTH 1KGCD 2OTPA 2VIRA 4HZAA 4O4YL 2W0PA 3DX7A 3QIWD 3MO1B 4HKXA 1QHOA 4M02A 1ZT4B 3GHEH 5DUBB 3ARDD 1YMHB 3GIVA 1XR8A 2DWEB 4JG0H 4JZJC 2VDMH 4OZHA 4X80L 4OIAA 1NLBL 3QDJA 3ARGD 4M1GH 5EU4A 3TCLB 1OGAE 4JHWL 1JTTA 4GRMB 4NCC2 3BDYL 1YPZE 3LEYH 2LTQB 3OKDB 4FQCH 1WIOA 5IIEB 4C4KO 2GJJA 3QQ3B 1A14H 2A6KB 5D6CB 1GVIA 4TUJB 3IFLL 5A2LH 4DUWA 4YXHL 1K85A 1CIUA 1EK3A 1MREL 2YN5A 5BRZE 5I18H 4YHLH 4WHYG 1RSFA 4LLUA 4Z77A 4M6MH 1U8IA 4L8DA 2V2TA 4HIHA 2EZ0C 4WIQA 4KU1A 3SDDD 3U0WL 1WWAX 4Y1AB 1D6VH 5B8CC 3KPNB 4DZ8B 4G7YH 2OL3H 4P4KC 5F9JB 2EDNA 4TNWK 2FRGP 2IQAB 3MFFB 1HXMB 2VZSA 4PJGA 1HI6B 4FZ8L 1OSZA 3CXHK 3IDXH 3V6ZA 2YEZB 2FJFB 5HI3C 3KPLA 4QF1B 4D2NA 5JW5B 3T0AA 1TQCB 1TPXB 1MJUL 5KN5A 4Q9RH 5HPMB 4OT1H 5D7SL 2AJVL 4NRXA 8FABA 3QO1A 1XGPA 2DYPD 4P2RE 5BVPL 1J5OH 3IKCB 1S9XA 1RUAL 2X44D 1Q9OA 3T2NL 2YMXL 2ZCKL 5E00A 4LEOB 2AEQL 2EYSA 1KBGL 5CILL 1NC4B 3SKNA 4X6CE 5INDA 3WIFB 4R2GB 3RUGB 1QLEL 2PYFB 2VE6A 4QT5B 2P8MB 1IAMA 4P59H 1ED3B 4RCAA 3DVFA 4HS6A 3QAZB 4YDKH 1DBJL 2HTLD 2X4SB 3LN5A 1EBPA 3EO1A 3LKPA 1KPVA 3EDEA 4P57A 4ZTOL 1B88A 4ZUSA 4S2SA 3QXUA 3TVMC 1RULL 4OFIA 2MCG1 3Q5TA 1M7DA 1T03H 1FRGL 4MCYA 1IKFH 3K4AA 1GGYA 3ROLA 4AJ0A 1NCWL 4ODWA 3WUZA 3BKYH 3T0EE 3K4ZA 1F4WH 4I18C 4LHUG 2WWKO 1ZS8B 3WS3A 1L6XA 4LDEB 3RI5K 4KRPB 1EHLL 3HAEG 1JWSB 3GDBA 2PKDA 2VXTH 3TYFA 2AV1A 1YUHA 1YQVH 1RVFH 1MCPH 2XT1B 3DJ9A 5T3ZL 1FH5L 4M5ZH 3T2QA 4ZUUB 3LMJH 4YO0A 4ELKA 3TLRA 4XZUA 1A7NL 4GKOA 4Y5VC 1X5FA 4E5XB 3PHQA 1C12A 2H6PA 5LAXB 1I85C 5FA3A 5A3IC 1EJOL 1KYOJ 4HD9A 4JZNB 2DQDH 4GG8A 3MRGB 3KXFA 1S5HB 3B3IB 2GSIA 5KSUB 1PG7W 4Z5RA 2P5EA 4XNYH 3VXMB 5A2IH 4TUKH 1OGTA 3ULVE 3VCLB 2ADGB 4Y0GA 2HRLA 2B7DT 1EEZB 4HIJB 4KDTC 1NJ9B 4OZGB 4Z0BL 4EJ1C 1CD1B 3HC4H 4WFGD 5LQBH 1T80A 1F4XL 1VADA 2BY2A 5IB1A 4LAQL 4X7FC 4ONFH 1D9KD 2FZ3B 4FA8A 3QXAA 1A4JB 4UT9H 3NCBB 5FO8A 1IT9L 2XTLA 1C16B 4GAGH 4GKSB 4Y5XA 3O3BB 3FONB 2ZCHH 3MBEB 5FEBA 1QBAA 5DMKB 9CGTA 1RMFH 4XC1L 2IPTL 1W0VB 4GAJH 5IJKC 2FWOB 2LQRA 3S9DB 1MY5A 4LARL 1ERNA 3BD3A 2B5IB 1I7RA 5I8OH 4FFWC 5ICYB 1LWRA 4MSWB 4ZUVA 2VITB 3OXRB 5EO0B 4OLWH 2IQ9H 1F6LL 3DO7A 2XKNB 2CXKA 4XNXH 1U8LA 3OF6D 3SKOB 3E2HC 1G7PA 5BJTB 2DI7A 1TTGA 3BP4B 4PRHD 1DQJA 4XCEA 3OGCA 3PWPA 2H1PH 2FX7L 4U6HA 5JHLH 3U4EB 1MH5A 5MHSE 3LEVL 2X1WL 3BD4A 2X70B 3DUUA 5IHBA 1PFCA 4P23D 4F7PB 1WFTA 2P42B 4KJPC 3ARBB 3U1SL 1NSNL 1SJEB 5GGSB 5HYSB 4LSVL 1AI1L 1FL5A 4PJFA 1AP2B 3AM8C 4PJAB 3GMNA 5IMLA 3IXTB 1KTRL 3BISA 5D9SB 1MHHA 3UBXI 5HHQB 3EGSB 1M4KA 3MRLB 1M1SA 2FJHA 5D7JA 2HJLA 3I6LD 1KG0A 3FB8B 3GRWH 2ED7A 2X89D 2J8OA 1A3RH 3DYOA 1NGZA 1I9JH 2G75A 3T3MF 2MNUA 3DARA 5J56B 2HJFB 4PD4J 4ODVH 4OGYH 3KYAA 5DVMA 3AVEA 4H8WL 5IMMB 4X7DC 1OD7A 1JUFA 1F5WA 1I9EA 4PRDB 1W0YT 4HIEB 3VH8A 2YSSA 5HVHB 4M7KL 5I1AA 4FTVA 4CMMA 4GXUM 5DD6A 3V6OA 5LGKA 2HT2C 3MV8A 2EH8L 4HK3N 4BH8B 2YPLE 4XPGL 3UBXB 1FV1A 3ES6B 1D5MB 1DSFH 2GI7A 3BIKA 4FQHB 5E2WH 2MQ0A 2IMNA 3ZLQC 2FHCA 2Y5TA 2BNRA 5T33H 2BOCA 1MCCA 4HGKC 3JVGC 1GPOL 5I0DA 1KUMA 5DJ6B 2QQKL 3EFFB 4MD5B 4ONGL 4WI9A 1LEGB 3PIQA 1X44A 4TNWF 3VXMD 1WSST 5DHYB 5FHBH 4R7DA 4U3HA 5B4MD 3HRPA 3GMPB 5L7XH 1FSKB 3BYTA 3AMKA 1KCSL 4YBQC 1CE1H 4YHOL 2ZSVB 5LGHL 3M17B 4TTDD 3UTPE 4NQSA 3QXTA 4L3EB 2QQNL 2OTWB 3WLBB 3JTSA 1F11A 5F7EL 5C0BE 1OSPL 3DBXB 5D70L 4G8EA 3MQIA 4JFEA 4M6NL 4ZS7L 4OZ4B 2NY7L 5JOFA 2C9AA 3REWA 4ODHH 4AEIL 2A74B 3T3PF 2GTWB 3MBED 2H32B 3LH2L 3CGTA 2ATPA 1UXWA 1R3JB 3HZMA 3RVWD 3BUYB 5ISZE 1BAFH 1Q9KB 1ROWA 5DI8A 4NHUA 2DKUA 3HKFA 4AK1A 4NQCE 3PGCA 3ZHLA 4BZ1H 3SPVA 4U2ZA 3SDYH 3D0LA 3BKMH 2JB5H 2MCPL 3VD7A 3MJ8A 3F7PC 5F6HJ 4JRXE 3LKOB 4AL8L 3NA9H 2YD5A 2YK1L 4KI5C 5I1JL 1QBMH 5FCUL 4HMEA 4N0YL 4UDTB 4N0UA 4BUGA 3FB7B 5AYUH 3T4AB 3GJFA 1O5DT 2DQEL 4BFIA 3KPPA 5FCSH 3T0WA 3JSSA 2DQCH 4HH9B 3ME0A 2PO6C 5ETUB 2Y07L 5F9WB 4RGNE 2ZUQB 5ESAB 3RI5F 2P5WD 1HOCB 2ZWLT 2DBLH 1SBSH 1NMAH 5I6XC 5IM7B 1AR1C 3ARBD 3WHE1 1GRWA 4ODXB 3U4AA 5D1QD 5FA4A 1YEFL 2P49B 3OSKA 1BFVL 1WAAF 2R9HD 3AS2A 4M8QA 4O2EA 3HZKA 5C6TL 1JPFB 1FBIH 4Z76B 1U58B 1C5BL 3OKLA 3E3QC 3MROB 1J8HE 1MIMH 1NGQL 3Q6GL 5EZLA 5DD5H 4LLWA 4WV1B 4XBPB 3OG4B 4P9HL 3TBSA 1L7IH 2JKXA 1NQBA 1YMMA 1R5VA 1OGAB 1E4XL 4Z0XA 3BJ91 2AJ3A 2ADJB 1P2CA 1FFOA 1DL7L 1RPQA 3LQAL 1YPZB 5MEOB 3G08B 2OI9C 3U46A 5CZKA 2OR9H 4M1DH 4FXGB 4QCIB 3FQRA 4WDIB 3OKEB 4X5LA 1E28A 1ZT1A 2Q7YA 5EO1B 4MQSB 1X6LA 4JFYA 4HUXA 3DMMB 1Q9LA 2C3VB 1KTDB 3GSUA 2X1QA 1CVRA 4MS8C 1I9RL 1U8QA 4QRSB 4MJIE 1OWRM 1CDIA 1TETH 3P73B 4MA3A 3HCVA 4Y7MA 4R4FL 2Q86B 2VXQL 2Z0BA 4NBXB 1BZ9A 1JPGA 4OIBA 3F62A 1BX2A 5EBLA 5I1GH 4FFYL 2AEWA 4NFCA 5CZXD 4JZJA 4UZGA 4JPWH 4Z8FL 3R1GH 2YD2A 2B4CL 3EHBD 2F5AH 5IHZB 1H5BC 1YNLL 5IF0B 2A83B 3LQZA 1YY8A 1UACL 4OF8A 4LHUB 2IJ0C 4D8PB 1RZKL 2R0KL 3ILPB 4UI2A 1JP5A 1BECA 5HVWA 1UADC 3HAEB 4L3ED 4P2RB 3ZKNC 2XA8L 3WL9B 1MFAL 1H8SA 3TO4B 2Y6SD 4OFKA 4JVWA 3P9WB 4UIKL 1AGCB 4PJBF 1ZVSA 4NWTH 2BVPA 2NYYC 1JTPA 3BPLB 4DKDC 4X6CB 2CUMA 4Q74A 5DD1L 4KKCD 1I7UA 3VDCA 3FT4B 4RNRB 5B8CA 1G0YR 5D7KE 2H8PA 4P4KA 4HWBH 4QRQB 4CGTA 5IG7A 1RZFH 2UVEA 4GQ9H 5AWNL 3LHPH 2Q1EA 3ZE1E 2RFXA 2W9EH 1ZEAH 1I3VA 1U8MA 3QCVH 2FX8L 5D2NE 3MLWL 3OJDB 4LF3A 3DIFA 4LU5H 4QXTB 3GSXB 5E7FA 4KQ3L 3FQTA 5GRVL 4PB9L 5GRUL 2NPLX 3CFBA 2G5BB 2JK5B 3NGBC 3L3DB 2BXZA 1CE6B 3T0EB 5EUOF 4DQOH 3G04A 4KRNA 5HGHB 3QEQA 4S0SD 2E7BA 4JM4H 3B9KB 2YC1A 1MJ8H 3O6FC 3QPXH 3G6JE 3MZGB 5IROC 3DURB 4M93B 1NBZB 1ADQA 3TN0B 5I74C 4MXVF 1HYRC 5I18L 3AY4C 4XP4L 5SV3A 2ZJSH 1J8KA 5E2TH 2R69H 1DE4A 3SY0A 2J12B 3V79C 1RUPH 1FCCA 5I8CA 4KROC 2ORBH 5KAQF 4ISVB 4U1NA 5AUMA 1UKQA 5FV1L 3TVMA 3CVIH 1PLGH 3HE7B 3MV7A 3EOYG 3LEXA 3QPQD 5E8DL 1WF5A 4MZ2A 2AJZB 1YN7B 4H0GA 3AUVA 1OGAD 2MHAB 2HVKA 2GTZB 4PBXA 4NYLA 1FCGA 2WQ8A 4HCRL 4Y8AA 4M43L 5C0AE 4I18A 3V7AE 2JIXA 1F58H 3RWHB 3DVIA 1DP0A 1YEEH 4KVCL 5E94A 5IV2B 4ZFOB 1VEPA 4C58B 1SM3H 3DETD 1F97A 3SDCC 4H20L 5A16B 2J3SA 1AXTH 4RAHA 3SKJH 5KVEH 2LVEA 5TE4H 4Q9RL 1WIUA 1K2DB 1R24A 5BRZD 1INEH 5C0CD 4H25A 3DMMD 1KELH 5A2KH 3NPSC 4YHZL 2ADFL 4RWYH 4OQTH 4MLIA 4G43B 4D0DB 1ORQA 3HR5B 4HWZB 3DUSB 2F54A 1I85A 1NFDA 2IH1B 2E9IA 4XXCC 5E56A 2Y06L 4P59L 3V5KA 2DQFB 3MNVA 4MQ7A 1XIWB 3QP3A 4L8CB 1Z3GL 1KJVA 5F93C 1T5WA 4ZSOA 4LHUD 5CAYB 4G3YH 2GIYA 4NQTA 3BPOB 1NGPL 2XZQH 4KDTA 3HMXA 1A0QL 3P4OB 5IB2A 4IRJD 3CNKA 1PSKL 3BP6B 3V7AG 2I9TA 5L88L 1NMBL 3JWDL 4P2RD 3HA0A 3TO4D 2IALA 5DK2A 1F4WL 1JNNH 3HUJF 1ZT7A 5IBLC 3AB0B 3ULUH 3EYOB 5DD3H 3FFCA 3EOBA 1FFNB 3T09A 4NO2B 3OJ2C 1A5FH 4ZNCD 1DVFD 1I7ZB 2CLVA 5CSBA 3EYVA 5H35B 1ORSB 3ZE2F 3DX8A 1MCPL 5I2IA 2VABB 3X11B 5IJKA 3P77B 1T20B 4JO1H 2UY7A 5HGDB 2RB8A 3I75A 4XHQA 3MXVL 1TMCB 1MCLA 4LHQB 5J12C 1Z5LB 5DJXB 2ZUSA 4UBDC 5I30H 1X5YA 4ERSH 1C5DB 1WTGT 3TNMB 1ODAA 3WO3B 2YD1A 4UV4H 3BD5A 1B0GB 3T0ED 3RWCB 4BSVB 5GISL 5LXGL 1SQ2N 3BPCB 4PUBL 4H0IA 3SCMB 1JPST 3IRPX 1FZKA 4TUKL 4WUKL 4MA8L 4J3WA 3MRNA 2HTKD 2L7UA 1ZHLA 5MP6H 3TM6A 1MCOL 4I4WA 3TN0D 2ESVA 3OKKB 3QUYB 4EOWH 4UTBL 3MNWA 1DFBL 1JZ2A 3NFPA 2YPLB 2QADC 3K81A 4OCSH 1U95B 4JVUA 3DWTA 1H3UA 3AM8A 2R29L 2ARJA 4BJLA 2VUYA 1A7QL 1BFOB 2JF1A 1VENA 5I1HH 3ZE0E 1HHJB 1MLCB 5E8EB 3IKKA 1JZ6A 2VL5B 1RMFL 3RWFB 2NXYC 3BGMB 4ZNEE 3EJZC 2EC9U 3DSFL 3SO5A 4HXBH 4TUOB 4PG2C 3GSNB 5DJ0A 3GGWB 4NZTL 1IRAY 1J1PL 2HH0H 4YXLH 4PLJC 5I66B 1KFAH 3ULVD 2JLLA 3TEUA 5FB8A 4R9HA 4LSUL 5K9QG 4OF7A 2IQ9L 3HZVA 4G9FE 5F96H 3OR6B 2QQQA 1CXHA 4TVSa 2X41A 4NRZB 3DSNA 1T6VN 4Y4HC 3EO0B 1JWUB 1MEXL 5DQ9B 2YPVH 1G9NL 5I16B 3O8XC 4GOSA 3QUMB 5FDWA 2CIIA 2AQ2A 3T2PA 3S96A 1AXSA 1DQQA 1JPSL 4LMQE 4IMKC 4UIMA 4YC2B 3TWCL 3OPZL 2VXVH 1Z9MA 1IGIH 2BRRH 3WIIH 5IVXA 4U1KB 4IRZL 1RIVL 3BWAA 3D25A 4U1MA 2FR4A 1XIWD 4NQCB 3L7FB 1Q94B 2IPUK 4KJQC 4WU7B 4X6BB 4S1SL 4KTDH 1N26A 3VFOA 5T3XH 1U3HB 4UOW0 1FVCB 3GSQB 3DXAE 3C6LB 4JRXB 4OCWH 4JRYA 1JGUL 1N0XH 4GXVH 4IIQC 3KWWB 5J13C 3DX6A 1I9JL 1SMAA 2ARJQ 1W72H 1W0WA 4MB4A 5FO7B 4PGDB 4G5ZL 5DQDL 4CN1A 4FXLA 4G6AD 4Y2OA 3QJHA 3V0VB 5F3BB 3RWIA 4WJ5A 3FQWB 1K5NB 3B4NA 4V1DA 4YDVB 4XP1H 3C9NB 1H8NA 2DIBA 3FT2A 3GHBL 4NQDD 4NQEB 3CLEH 1IAKB 3FHQA 5F7HA 2X7LB 2IANE 3LS5L 2DD8H 3RTQB 4FZEH 3WE6B 1T1WB 3U7WH 3V5HB 4UT7H 5KVDL 2I07A 1IILE 1VHPA 4J6RH 1J8HB 4S1DD 2V9TA 3I2CH 4XXDA 1G6RA 1OPGL 4KJYA 4XCNA 4L3CA 3BEWA 1OAKH 1I3RA 3FO9A 3S7GA 3HE6B 5I9QC 3SOBL 1FO0A 2G9HA 2M2DA 3KLSA 3GMOA 2XN9E 1ZGLA 3B9DA 3I50L 1D6EB 2IBZX 5F44A 4YPGA 4CVUA 4F7MB 5JHDA 4NFBA 4C56A 4KRLB 4ODSH 1CE1L 2MWCA 1U41A 5FECA 2J5LC 3QUYD 4U0RB 1IM9A 1ES0B 1R3IH 1VFAA 4G8FB 1FNEA 4QTHB 4RFOL 2YPLD 1N4XH 3O6MH 5F7MC 2XNAB 4MJIB 4PR5A 5GSRA 3ARFB 3GK8L 3G9AB 1BPVA 4D9QE 3O45A 4FNLH 3Q6FA 4ODHL 4EI5C 1G9MC 4ETQB 3VRLF 5KSBE 2CRYA 3QIWC 4LL9A 5ICZA 3DHJA 4K3DH 2VXUH 1ZLWK 3W5NA 2DM3A 4YK4C 3IFPA 3ARDC 4BZ1L 2FYYB 3SDYL 1OQOA 3PWJB 4DAGH 2V5SA 4HUNB 1N5AB 2JB5L 2ICES 3CLFH 4FRWA 3ARGC 3UTPD 5E9DA 2QR0B 4YHIB 1T7YA 4L9LC 3CX5J 5C0BD 4YDLB 3QUKB 5DDHA 1IFHL 2VWEE 4XBEH 2H41A 3S35X 4GRWH 2O26U 1NANH 2V7HA 4ODTL 4F7CB 1XF2A 3NA4A 4IJ3C 2HN7A 1EBAA 4NN5C 1F00I 3OAYH 2XV6B 3DROB 1X7QB 4XTRD 5CKGA 1ZLSH 3BP7A 5ISZD 3WJJA 1GOFA 3ZKMD 4B0MM 3H9SE 4LCYB 4PV8B 4JPKH 1KCRH 4NQCD 2R2BA 1QA9A 5TDOA 4CN6A 4XP6H 4GKNA 3SDDC 15C8L 2VLKA 3TFKD 2JJTC 2JJWA 1H5BA 5D2NB 3EBAA 5FKPB 2XI9A 2EIZA 1FYTD 4NM8H 2ZZUT 5HI4D 5AG8A 3MZTA 4H5SA 5I1LB 2BCKA 1S9KC 1EXUB 5T5FH 1F3JA 3L5WA 4JRXD 4IDJL 3W0WE 5D5ME 5SX5H 1NGYB 1E4WH 4LVHC 2OZ4A 2QEJA 1NGWB 43C9A 4NC1C 5E5MB 4LSRL 4HPOL 3S5LA 2CKBA 4FXKA 4U1GB 3G6JB 4WUUA 4CADB 1N8ZA 4RGND 3T65A 1GIGL 4QHLA 1G84A 3UAJD 4PJHB 3N85H 1AHWC 3MCKB 2HWZH 1A9EA 3CFJA 3B9EA 3RTQD 3O6KH 3MV9E 2K1MA 1IGFL 1ZWIB 5GHWH 1MQ8A 2WM0A 4QXUL 3D5OF 1WT5C 2VISB 3CFDB 3RX5A 3PUCA 1J8HD 4HBQA 2HTLC 4HEPG 2LU4A 3AS3A 4FS0A 1YJDL 5I19H 3MYZA 1RIUL 2FO4B 3HE6D 3IJHB 5C0AB 4C83A 2F5AL 4WEBL 2R2HA 5GGUA 4KTYA 1NLDL 2PW1A 2KZ1B 3DV4B 4LPTA 5IROA 1KB5B 3EDFA 4FMKA 5HVGB 4WW2F 1ZA6B 1CGTA 1NGXB 3VG0L 4XVJH 1RJZB 3AY4A 2A77H 4MJID 3BGFC 3H7LA 3UYRL 3V4PH 3ZYZA 1LE5B 1INDH 5TFSH 4DVRL 1QD0A 3IJSB 1EH9A 5F1SA 1IGML 1RZIB 4QXGL 2ERJB 4Q2ZA 3LSOA 3QSKB 3VRJB 2X1XR 3QRGL 5FHAH 3D1MC 1MHCA 2YBRA 4HWBL 3ARTA 3ZKXB 4GQ9L 3RA7L 2OSLA 4LLVA 1FGNH 1C08B 2E6JA 3SDCA 3WDJA 1I1FB 3LZFH 4I48B 2FGWH 2H45A 2VLLA 3PNWA 5I1EH 3O2WL 4G6JL 2J8HA 2BY3A 1OTTD 2D7NA 4PP1C 2LTQC 4DQOL 3KGRA 4NNPL 5K9QI 1NDMB 2WK2A 3QWRA 2EO1A 4UILH 1X5GA 3WNNA 2Q7NA 4Z7WB 4PG9B 2FSEA 5TGBA 4CJ1A 2PYEE 3GSVB 5F8QC 4M7ZB 4CW1A 5ESVB 5D7KD 5TDPA 4XXCA 1D9KC 5FF6A 2D0FA 3F5WB 5GSVB 1PKOA 4JPIB 4X99A 1J0JA 1MVUB 3TF7C 5ABDE 2XRAH 4G8GE 2VDLH 3ZDXE 3JV4A 1E27B 2D7TL 4X4XB 1V7ML 1TNNA 3QQ4A 5FYKE 3MRPA 4G6KH 3CVIL 1PLGL 1J12A 1JRHH 4HIXH 2CO7B 2Z31B 1RZJL 1IC7H 4IM8A 2SEBA 2UWEE 1A02N 2F74A 3TJEH 3UJTL 1GOGA 5JR1L 1OAUL 5DVLA 1F58L 2RR3A 1JHKH 4LDOB 5LBSL 4PJBA 2VLJE 5DMIL 1KTLB 4JN1H 1BLNB 3UYOD 3VU2A 5FFLA 1INEL 3AREA 5IMOB 2R2EA 2LABA 3DX9A 4ZFGH 1WCBA 1QFWL 5T5NF 2EKSB 3L3IA 1BF8A 1FPTL 5GRVK 4HHAB