1BVLB

Humanized anti-lysozyme fv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASGNIHNYLAWYQQKPGKAPKLLIYYTTTLADGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQHFWSTPRTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HULYS11
publication title Structural consequences of humanizing an antibody.
pubmed rcsb
source organism Homo sapiens, mus musculus
molecule tags Humanized antibody
total genus 23
structure length 108
sequence length 108
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bvlB00
4HPOH 4PJEF 4GBXC 4OLXL 4PJ7B 2WUBH 4D2NA 5IB1A 3M45A 1OTUC 1DP0A 2ZOKB 1HSAA 1MF2H 4ZUVB 5DJ6A 1XZ0A 5L2KE 4KHXH 1C16A 1XH3B 4WW1A 4GRLC 3HS0A 3REWB 5EZIL 5I19H 5HYJE 1DLHA 3RY4A 5FYLH 4PLJC 4JY4B 3AM8C 4I3SH 3C9NB 4HJJH 3KYMB 2VDNL 1QOKA 4K3EH 3Q5TA 1B3JA 2VOTA 1S8DB 2ADJB 1NL0H 1MH5B 2F53E 4KJQC 3MR9A 3LKSB 5F1IB 5GGSB 2B4CH 5LWYH 1DANT 3D2UD 2RQ8A 2VDKH 1U91A 5ICZB 2MQCA 1FZKB 2VR4A 3THMH 1SEBB 4O58L 2FWOA 4Y8DC 1GGBL 4D9RE 5GJTL 3EOAA 2VKXA 1F90H 1GCFA 1BQLL 3QO1B 1BQHB 2OXHA 4IOFC 1EDQA 2ENYA 2YEZA 1OAXH 2F74B 3MUY1 4ZOEA 4U05A 4KHTH 4WO4D 3OWEA 4JFFA 3WS3B 3IETA 3W11C 3CK0L 5MEQA 1AY1H 4K23L 4UUJA 1FN4B 1W72H 1SJVA 4LHUA 3DGCR 3MRPA 4UDTB 2AABL 4P2QD 2V6HA 2OM5A 1W8NA 4Z0BH 3BSZH 4GW1B 1QRNB 2VXUH 1HDMA 5SV4A 5I1KH 1XR8B 1I9JH 4DN3L 4ZFZA 1I8KA 2VLKA 4UV4L 4N0CD 4JFDD 2XXMB 5MEND 3TFKD 1FP5A 3PWJB 3MREB 4HG4J 2EYSA 4ZQKA 1AXSA 3HZKB 4AM0B 5EOTB 4NO2B 1FFOB 5T1KB 4Z0XB 5GGVH 1VEMA 1MRCH 5CEZL 3KYKL 2A77L 1OD7A 3Q2CA 4W68A 4DVRH 1OD9A 1AI1H 1BZ7B 2GKIA 1NAKH 3U30C 1CDUA 4IDLA 5KJRH 2X42A 2OP4H 4Y4HC 1HSBA 2FDBP 4OCRH 3UBXA 5KVMC 5F21B 1B4RA 4NZRH 1E4JA 4OV6F 4PP2B 1BEYH 1ZA6A 3OAZH 4GMSL 4KI5E 4K3GA 5DRNB 1U92B 2XG4A 5I16A 3JV0A 3CLFL 1NLDL 4JG1L 4J4PC 4P5KA 4G8GA 1BFSA 4E5XB 2OTUA 2NY5H 2ITDA 4ZUTB 1P84J 4M1DL 5FYJU 1WITA 4X4ME 1JGLL 2MJWA 4PJBF 1NC2B 4PJ7A 4TULH 5F1NA 5LG1A 3ARED 4ZD3H 2BSTB 3MLYH 1TITA 5BVJA 4FQ2L 3UBXI 5CZXC 3P11L 2BSRA 1NFIA 3BP5B 4DZBA 4J8RA 4KVNH 3P4NA 4WHYG 4QHKI 4PJHA 1CGYA 3RTQC 3V4UH 4BSJA 2DQHL 4NC1E 3DXAE 4ORGA 4E9LA 1YEFL 1INDH 3VD5A 4M93B 3RDTC 1OGTB 4Z5RA 1UZ6E 3K7UA 3R0MA 4U0QB 4R26H 4BFIA 1V5JA 2ZCHH 1BVKA 1A7QH 4LLUB 1VFMA 5E56A 3K2UH 3WFBH 2QKIA 3C6SA 1R3JB 4ZTOH 4WI8A 1AO7D 1YYML 1FFNA 3BE1L 3FB8A 4I4WB 4DUVA 2AJUH 1BVLA 5HYFA 1OAQL 3D39D 4WHCA 2F74A 4Z8FH 1CYGA 2YBRB 4WNQA 3O9WC 3ZHDA 4YDLC 3QUZA 1FFRA 1N2RA 5F7NC 1X5KA 2XQYG 1MJ7H 3QNXA 2BVTA 1FN4A 1Q94A 3B6SA 3OHXB 4L29B 4APQB 2NX5A 1P4IL 4RFEB 1RUAH 3MYZA 3NH7H 2YC1A 1I8IA 2CLRB 2R56L 4GW1A 5BV7C 5F6IB 5GRVK 4M7LH 4KTDL 4L3EA 5CBEA 5ITBH 2OBGA 3Q48A 2X4OA 5F7UA 4X9HA 1FV1B 3F5WA 1U8QA 3B2VH 3PGCA 2LVCA 2VH5L 1T5WA 2UWEB 1IGCH 2A83B 1UADC 3G9AB 1ULVA 2XN9B 2XTJC 3KPSA 1LD9B 2NY2C 4OZHA 1WFTA 4OLUH 1BAFL 3UTPE 1CLOL 3CX5K 5JW3L 4KDTC 3BXNA 4YDVA 1A5FH 3HE6A 3O3DB 3BT2L 4KVCH 4OQTA 5KSBE 4ODUA 1JPGA 5CSZA 1KPVA 1NGWB 1JWMB 3HAEA 5I75B 2GY7B 3K81A 1IQWL 1K5NA 3H2WA 3QUXA 4WWID 1UC6A 4NCC1 2L7UA 4IDJL 5ILTH 2GAZB 4M6NL 4KKLC 4X83A 2AJ3B 3LSOA 3MLRL 3P4MB 4KROD 3SQBA 5KVEH 4XPBL 4Y4KA 3GSRA 2Y36L 4GS7B 4AEIH 2YR3A 5DJXA 1GHFH 5GS0H 3GDBA 4PJCB 4PRAB 3WIHA 4IRSD 3RUGF 2BHUA 1NJ9B 1AGFA 4YFDB 4OCSH 3TN0A 3MCKB 1R24A 3WNPA 5HGAB 2MNUA 1A3RL 3IT8D 5E9DA 4NZTL 3A6BH 4EN3C 2F8XC 3VCLA 3FO9A 3FQWB 5SX4I 3HRZB 3KPNA 4GKZA 3QIBC 2HJLB 8FABB 3FRPA 3D25B 4PB9H 4XNUL 4RCAA 1UCBL 1QFWH 3MJ6A 3HR5B 5IVOA 1KG0A 3TZVD 3BPOC 1ZGLA 4G6AC 3KYNB 4FNLH 1T0PB 5CGMA 4YHPA 2PCPB 2JCCF 2VLRA 3AS1A 2B20A 4E41E 5BS0A 3T1FA 5C09D 4JKLA 4ZSOA 4F8TA 5E8NB 3ARGC 2GUOB 4HH9A 5FV2A 4BUGA 3GKWH 4PRHA 2VAAA 3RWJB 4MHHI 1MHEB 2XV6B 4Q9RH 4Q6IA 4WEBH 3H9HA 7FABH 4LGRB 4IMKC 1I7TA 3VU2A 2ICWA 1A47A 2X1WL 3LPFA 2HLAA 3GIZH 4M8VA 3SDAC 5KSVA 1XF5B 4PS4H 4NWTL 5B38B 2PO6D 4TQEH 5AWNH 4TPRH 4WY7L 1RVFH 2P8MA 3CXDH 2DJUA 3DMMA 5D1QD 3T0BA 5EORH 3TVMA 4F58H 4BH7A 1TNNA 5C08E 3SKUD 1JNJA 3S5LB 2A6DB 1FZMA 4XP5H 5BVPL 5ADOL 4HPYL 1CLYH 4GAJH 3Q0HA 1AKJB 3GNMH 4RBPK 4HMCA 2EDJA 4U1GB 3N85H 1B2WH 4PJAF 3L7EB 2LQRA 5GPRA 2BC4A 2AEQL 1SBSH 2MHAB 2VC2L 5EC1A 1L4IA 4NQUA 3WNOA 1IMHC 4GO6B 1NDGB 3H3PH 3BQUA 4XP4L 5IK3A 1T66C 2V5TA 3CUPB 3QFJB 2OR9H 1KJ3L 2LTQB 3QG7H 3QIWA 4C55A 3IXTB 1PVHA 4PREB 3NZHH 4NNPL 1DEEA 5DVLA 4W81A 5J8OA 5HGHB 3BEWA 1RJCA 5IEKA 35C8H 4QTHA 5F71A 1IC7L 3FMGH 1IAMA 2EDQA 2Z92A 4XMLL 3C60C 1H3GA 2H9GA 2ZG2A 3QXUA 1KGCE 5C0DA 4G80B 2XZCL 4Y5VA 3ULVE 2UWEA 4JRXE 3NMEA 1REIA 3L3HA 5JPMA 1GL4B 1I3UA 1FGNL 4CADB 4PB0H 4X5LA 3EFFB 1T03H 4HFUH 3H3BC 2ESVB 1RJLB 4JZOB 2ICWJ 2W0FA 4GKSA 3KHOA 5F93C 5TH2B 4FTVB 4H1LB 1QO3A 3U0TA 1U8PB 4F9PA 4AIZA 2FJHB 5HGGS 5DMIL 3QULA 1N5YH 2X4NA 5BXFB 2EYTA 5DD6A 4JZJC 4M1GL 1J1PH 1NLBL 3O41B 5EUKA 3ARBA 2XN9E 1UXWA 4FQCL 4J3TA 5ACLA 1I85A 6FABL 3U7YH 1NGXA 3CVIL 4TNVF 3O6LL 5CBAB 1HQ4B 3I2CH 1NCCH 4KJYA 3FHQA 2PXYD 3DVFA 4NN6B 5DD5L 1EHAA 5KSAB 1ACYH 1NC4D 2Q7YA 3B5TA 1NEZB 1SYSB 1YPZE 3RI5K 3BUTA 4WDIB 2HJLA 1DBMH 2XWJB 5A2JH 1YEIH 3RIFK 2E9WA 1QACA 2UUDH 4X9BA 1MEXH 4JO1H 1CIUA 5IBUB 1WIUA 5D70H 5F70A 1D5BB 3SY0B 3QCUL 1RZIB 5C0BA 1KBGH 4DVBA 3CFDB 4Q74A 4PY7B 1F4WH 2CH8A 4FZ8L 2A6JB 5DJDB 1XIWB 1O5DT 1H3PL 4HXBH 5EO0B 1D9KD 3BJLA 4RA0C 3OG6B 3DPBA 4ZTPL 1MHEA 4PJDF 5FFLA 4N0RA 4HHAA 1X5YA 3C5ZD 5HDBE 3O4LE 3BHBA 4U0RC 3DIFA 5HJ3A 1VPOH 2Y1VA 2H26B 3TNMA 1PSKH 3RWDB 3UTTD 4F57L 3FT3B 2D7QA 5FUZL 2Z0BA 1JHKH 2WWMD 4KJPD 1A22B 5A16A 2Z4QB 3D0VB 1DQMH 4PJIA 5I1EL 1F8TH 4P3WA 2EYRB 1WSST 3QYCA 2PW2A 4PTUB 5ACMA 3MLSL 1MIMH 4RAHA 2DAVA 5JDJA 3T2OA 1XGPA 3D85A 1MCHA 5F44A 3S96B 3MOAH 5F89A 4BKLB 5IROC 1UQSB 2DBJA 4Y2DC 4D0CA 1A1OA 3HHRB 4DQOH 1T89A 4KPHL 4WI2A 1BFTA 4BQ9A 1JCKA 1MFEH 4ZOAA 3VFRB 5TE7L 2K7QA 2AJXL 1KPRB 4XT1C 4OSUL 3EFDL 3GRWL 3JWDL 3N1PC 1JI1A 2PTUA 3OKMB 3QFDB 2P8PB 1MQKL 3NCCB 1RY7B 2ZOLB 3KDMB 4JDVB 1FIGH 4HIEA 3RVTC 3O45B 3ZHKA 4LQFL 1LVEA 5F7EH 4P9HL 1WFUA 3SE4C 3QZWG 43C9B 5DC4B 2YPKA 4LNRB 1HH9B 5HGDA 5DURD 2NY4B 3HI5H 3P40A 3DETC 5BV7H 5IMKB 2G2RB 4GXVL 3GM0A 3GMOA 3GRWA 2UZIL 4Z7QF 1M6OB 4XBGA 4FQLH 4HEME 5L6YL 2P5EA 1MAMH 3KLDA 3QFJE 3TCLB 2D0HA 3ZTJG 1B0RA 4YGVA 1IRAY 4HZAA 4X9FA 5FCUH 3SO5A 3RGVD 9CGTA 3WFDH 3MRIB 2HA1A 4PV9B 1MRFH 1CF8L 1MCEA 4GLRI 1J10A 1BECA 1P2CB 3TH4T 4PJHF 1MWAH 3HG1D 2P5WA 4LK4A 1G7IA 1IGYB 1MLCB 2GFBB 5I18H 3FTGA 3MC0A 5A3IC 1M71A 3O0RL 4Z7VB 2ITCB 3O6FA 2K1MA 4QRRE 2GK0A 1OARL 4U1MA 1RJZB 4OF6A 2ESVE 2ATKA 1A64A 1EUTA 1OPGL 5IW6A 2VDMH 3BD3A 5GRXG 1W0WB 4HJGB 5HSFA 4M1CC 2H1PH 2AV1B 3VMNA 1IEAA 4OZIA 1H5BA 2R69L 3C87A 1EO7A 2P7TA 1R6VA 2XWJA 4LLWA 3CH1A 3VXMD 1NMCB 1UYWH 3KXFA 1K4DB 2QQKH 5DUMH 3VXRB 1Q38A 1KSRA 1TVHA 1TLKA 4MXVE 2QLVB 4AENA 3QUXC 1KTDA 4R2GC 3NVQA 4FFWD 4PJXB 5L8LB 1NMBL 2OK0H 3L6FA 4Y4KC 5EU6A 4MSWA 4DGYL 5D7SL 1E27B 5HHXL 1RJYA 3FCTB 4OGXH 5EO0A 3IVKA 4K7PL 5D7JA 3DUSB 4LCWA 2BFVL 4KI1A 3MO1B 4NRXA 2YMXL 3TN0C 4LASL 1QRKA 5JNYB 5D7KD 3N06B 5DS8A 5HTSA 3QUYC 4UU9B 1F4YH 1YC8A 3CMGA 2V7NA 4NM8H 5BQ7B 4AEEA 1L9NA 5L7XH 3FFCA 3V0AC 4M4RA 2QQLL 3ZE2F 4PJ5A 3LEVH 4OZHF 5D2NA 4U6VL 4Z95H 4R90L 5JOPD 2G60L 1E6JL 2O5XH 2VZTA 4NP4H 4WV1B 4OV5A 2VDOL 3AC0A 3LKNB 3SDDA 4LPXA 4UILH 3VGAC 4PJGF 4M6AA 4ODWB 3QCVH 2XWBA 2EE2A 4P2CG 4AK1A 3DYOA 3VWJC 4YDJB 1MCNA 3DURB 3V6ZA 4ZO9A 3MBED 3DHJA 3LQMA 4MAYA 1SM3H 3TA3A 3V4VH 1Z6JT 4OGAD 3ZSTA 2FO1A 5FDWA 1S9XA 1P7KB 5B22A 3CD4A 5T3ZH 1I8LA 3BIBX 1ZHLA 4LKCB 1KJ2B 4K7FB 1S7VB 3DMMC 3VDBA 1HQRB 5E7FA 5FA4B 5LAXA 1NGPH 3MV7A 1MREL 4XNXL 1KELL 3GO1L 3B9VA 1T1YA 5EZIH 3SEPA 1S9YB 1I4FB 5D2LB 5J56B 4NHUA 5GZOD 4LIQE 5EN2A 1IAIM 3U2SA 3BP6B 1G84A 3QWOA 3LQZB 2OL3L 1ZLSL 2VDNH 2ZNWA 1MY5A 3SKNA 3HE7A 4G9FB 1DQJB 4EEEA 5TDOB 3W9EB 3EDKA 4LQ1A 5IB5B 2NNAB 5C1MB 2JIXD 3QIWC 1H15B 2VDQL 4P46D 1OT1A 4LHJB 4XNZC 3GSXA 4JCLA 4POZD 4CGTA 4L4VE 2P1YA 3I3BA 1VA9A 4O58H 5FA3A 1GGBH 3LN4A 3UP1A 3P4OB 4CNIA 3P30L 1BQLH 1YEGL 4I2XA 3GI9L 1NFDA 4OUUA 3VJ6A 3R06B 2WP3T 5ETUB 5BO1L 4R7DA 2AQ3A 2XQBL 5CZKA 2IPUG 1ADQL 3UYRL 4GG6A 1FL5B 5ID1B 3OB0H 3TO4B 5DO2D 4HKJB 2DTML 2XA8H 5D1ZB 1RUPL 5I1AB 4U1HA 3HUJF 4KJWD 4L1DA 2DM4A 4OF3A 4F9PC 1AC6A 2DQGL 2AABH 2BNQA 3S36X 3BN3B 3X13B 3DRTB 3PL6C 1OWRM 4J3WA 2IBBA 5JIIA 3V95A 1CR9L 4MXQC 3MBXL 2BY2A 3MRHB 3IFNL 4P2YA 4OFKA 4DN3H 4IJ3B 1Q72L 4KKNA 1ADQA 1E27A 4RFOL 4UV4H 32C2B 4ETYA 1I85C 1RMFL 1S9WB 3OKOA 1K2DB 1J05A 1OL0A 4XCNB 4WTXA 1WWBX 1CICA 1PZ5A 4FQIL 2GSGA 2A38A 4NZDA 5DQJB 4C56D 3VXRE 3QBTB 3PJSA 5CCKL 1D7FA 3KJ4B 2R0LL 4FXLA 4PJXE 5CEZH 3KYKH 5K9OA 2CK0L 5JPNA 2A77H 5C07A 1GOHA 1PD6A 4P23D 1E6OH 1A2YA 2VLJE 3H8NA 4MA8H 1G9ML 4MQXD 3AXLA 4HK3N 2I07B 3A0OA 3QDGA 5LKNA 3WDJA 1ZTXL 4MA1C 1OAYL 5E8EA 4PLKD 1YEHL 4QHLB 1YNLL 5ICYA 1TJHL 5CILL 5MEPB 3AB0B 3L5WA 1YNTB 2P44B 4CU6A 1HHKB 1KXVC 4IRJA 2MCPL 5TDPA 5JHDA 3CLFH 2C7UA 1NLDH 4JG1H 3MLXL 4N9GA 1CXFA 2DKUA 1B0WA 2V2WB 4UI2A 2VRAA 2X9XA 3QEQA 2FX7L 1KTLB 1K85A 5TQ2H 1PEZA 4KKCC 4M1DH 3O2DL 5JXEC 2VABA 4I0KA 1JGLH 4R0LB 4X99A 2W9EL 5D1XD 4BFBD 4ORZC 5GSRB 2D31B 4CMHB 2NY0B 4FQ2H 4KRNA 5D7IA 1ZXQA 3GJFA 3P11H 4P5TA 5F97E 5AD0B 2AK4E 1EZVX 4M62L 5CJXC 5FB8A 4P2RE 2CUHA 3UO1L 4HAGA 3RVXD 1EHNA 5C0GB 1PAMA 2DQHH 4OBSA 5F9WC 2HT3D 1FG2A 4P4KD 3PDDA 1YEFH 4WEUD 1U3HD 4N9OB 4YGAB 2ATPA 3LQZA 4M7ZC 1VFBB 5CZVL 3TO2A 4V1DE 4KK9C 2D0GA 3ZT7A 2MPAL 5IM7A 4Y8AA 4W6YB 4X8JA 4EDXB 5TE6L 3JV6A 2DQUL 3GB7B 1JZ8A 5DJZA 5JQHC 4X7TB 1CXLA 4HDIA 3MFFA 1VFAA 5FKAB 2F19L 3O8XC 4MJ5B 3VD3A 5JQ6L 5DEZA 4HZLB 2ADGA 5D2LE 2P46B 2R39A 3LOWA 5GS0D 1YYMH 3PWLB 1AHWB 5KVGH 2FSEB 5J3HD 3BE1H 4NT6A 1S3KL 5JUEL 1OAQH 2DS4A 3JWDC 4JVUA 4LMQE 5J9PA 3B9KB 5JXAL 4EVNA 3EKCA 5DJ0B 1TZGL 5IJVB 2XKNA 1JGEB 3O2WH 5D8JL 4HKJA 2Y6SC 3IDYC 1EPFA 5E5MB 43CAA 4X6EB 3JBG7 5SX4H 5FO7B 3U6RB 4P9HC 1RAMA 5EU3B 1YY8A 4F7PB 3S34L 1LILA 5FCSH 3T2QA 3T0EB 3F62A 2XT1B 3T04D 3X13A 2ADIA 2DIAA 2R56H 4NO0D 4KTDH 1P4LB 4ZUWB 1B4JL 2EE6A 4K94L 3HAEH 2H2PD 3O6FC 4G9DB 2P42B 4GBXD 4MD4A 1WBYA 3G08A 3M8OH 1OTUD 1JRHI 4NQDD 3WEXA 4BH8B 1BX2A 4Z6AT 3G04A 3NCEB 1OSZB 1QSEB 5FYJE 5CWSA 1BAFH 1YDPB 3S36H 1CLOH 3U36B 5JW3H 4GRLD 3S88L 1CFTB 3P2TA 3BT2H 5T1LA 3IDUA 5D5MF 2KUTA 1F3JA 1IAKB 2JB5L 2E27H 3OTTA 2J5LB 4JJHA 4QGTA 3AUVA 1IQWH 1D5XA 1QD0A 4JKKA 5FYLE 3MLRH 1A7RL 2W0KA 4XPBH 3FQRB 3UDWA 2Y36H 4OI8A 4IEFB 3MRMB 2X2YA 3OAZK 4H0IA 2BOBA 4QWWC 3IU4L 4P2OC 3K4DA 2J3SA 1M1SA 5C2UB 3NAAL 2EXYC 5D7JC 3UC0L 5EU4A 2KBGA 1QFUL 2G9HB 3GMQB 3OKEB 1FL6A 3UPRB 4HLZG 4NZTH 4JQVA 1WIOA 1WBXA 2NMSA 4IOFD 2VXTL 4S11A 3CPLB 2DQTL 4XNUH 1UCBH 2CLZB 1V3KA 4PYGA 4ZS7L 3I02B 4NWUL 2LFGA 3W11D 4MMZC 5TQ0L 4YE4L 3EW3B 4GKNA 3QIUB 2Y7QA 3WSQL 4OZIF 5D2NC 1QLEL 4Y5XA 3AROA 3CSGA 2C3HA 4K8RL 2X05A 2FBOJ 4ZXBA 3ZE1F 4MZ3A 3SDDC 1MHHA 3QJHB 2HMIC 2JJSA 5MHSE 4X9GA 1CDGA 1HH6B 2GI7A 4HKXB 5HYJA 1MAKA 2Q76A 3C6LA 4ONHA 2VISB 4UBDD 3T4AA 1KN4H 3BH8A 3OXSA 3QZWA 1WBZB 3BGMB 5B8CA 4H8WL 4NWTH 5IMMB 3TA3C 2B8OT 2YOCA 1S7QA 5IFHL 5DJYA 3GK8L 2F53A 2VKWA 3MRCA 4WY7H 1OSPL 1H0DB 5B38G 4MJIB 5E95B 2AK1L 5EO1B 3N0PB 1KPUA 2BSED 2D7PA 5BVPH 4JE4B 4NCC2 4HPYH 5ADOH 4YHLL 5ALBH 1A3QA 4CN4A 4Y2OA 2HTKC 3S5LG 4Y4HD 2A1WL 4NBXB 1QP1A 2EDWA 5LJYH 2AEQH 3GMPA 3CCHB 2ZSWA 5EBLA 3RX8A 3WHXB 1LE9B 3QJFA 5T3XD 4KH2A 4KK6C 5TDNA 2YRLA 3DVNA 1HHGA 3VFVB 3STLB 4RAUA 3DO7A 3HE7C 1KJ3H 2FZ3A 3PWVB 3ARFA 4OUOA 5F96L 1U8MB 3OXRA 4NNPH 3RPIB 3BPLB 2R0ZL 4BQ6A 1MI5A 3TBYA 3NPZB 5KOVC 1IC7H 4XMLH 2IQAA 2HJFA 2XZCH 3OJDA 5HPOA 2OJEA 5HHPB 1FGNH 3BEVA 2NZ9C 5CZXD 1JBJA 3X12A 3VXOB 3T0EE 1MNUL 1QG3A 3LRSA 3I3EA 1K8IB 1LNUB 3IRZA 3DX7A 2Y5TA 2R0KH 3AS2A 2BNRE 3S4SA 2XFXB 3OR6A 3LB6C 4KFZC 4H1LG 4M1GH 4Y19B 3RDTD 1IGFL 2BJML 2APFA 1I1FB 3BN9C 4MVBC 1F6FB 5B4MC 4HIJA 1FH5L 1FFPB 1L0QA 6FABH 1IZJA 1QSEE 2ILLA 3GSOB 3CVIH 3O6LH 1DBKL 2IADA 4JFOA 1PG7L 4YBHA 4Z7WF 1EAPA 3LIZH 1WC7A 3EGSB 4Y88A 4XXCA 1JUFA 5DD5H 1IAOA 1II4E 1A4JA 1GH7A 3FZUC 4LGSB 4JFXA 1AD0A 4K7PX 4UT9L 5FUOL 4FQXB 1IT9L 1X6LA 4WFGD 3DV6B 4ELME 1G6VK 1KIRB 4QRSA 3MNWA 5KAQG 5J6HA 5BZDA 2E7MA 3O9WD 4WWKB 3SO3B 4HKZB 1TCRB 3QCUH 4Z7UB 3UTSB 2Y07H 4IS6B 4LKXA 5IBUG 1MCCA 4FZ8H 2FHBA 4L4TB 3TIEA 4QYOA 4Z7NE 1H3PH 1NMAL 3DBXB 4JN2B 4BQ8A 2YN5A 2CRIA 3OAYH 5FOBB 5FO8A 4PV8B 1FCGA 2N4IA 4ZTPH 1KXQE 2PYED 1QLRA 3E6FB 1PY9A 3DXAA 5I17A 4UNUA 1UT9A 4OZFB 4NQEE 3FQXA 3STBA 3M17B 4XNQA 4F57H 4LGPB 5D96C 1SVCP 3RKPA 5FUZH 5ISZD 2XTJD 2IALB 5IWLA 4AQ1B 1FVDB 2NY2D 3FOMA 1G9MC 2HKFL 4YIQB 1P5UA 2W91A 3LRHA 4GLRH 4N1HB 4XBPB 5I1EH 4MQTB 4K2UH 5HVFB 1TQCC 3MLSH 1A6TA 4LCCA 2YWZA 1S9KC 5C7XL 3PQYD 1CS6A 3KLHC 4GRWB 5DHXB 3B83A 1UB6B 2P47B 3HMWH 3QEUA 5F9OL 5FYKU 5IF0A 2H6PA 1JNHA 4KKLD 3D2UB 1HK6A 2L0DA 1U8NB 4JQXA 15C8L 1C5DB 4KPHH 3QDJD 3DRQA 3KAAA 2IAND 1NBZA 5EU7E 5TE7H 1CE6B 1J8HE 2HG5B 2F54D 2AJXH 3D69B 3LMJL 4OSUH 2HKHH 4MJIE 3JWDH 1R3HB 3SDXB 3F6IA 1CIDA 4I3RL 4EN3D 2NW2B 4NUJB 4X4YA 4WO4B 4MWFB 1K4CA 3QIBD 4F7CA 1U8MA 5EU5A 2Q8AL 4LQFH 4EI6B 4MYWB 2Z31A 4J3SA 5MERB 2Z8SA 4G6AD 4PGCA 5C9KA 1C7SA 3E2HB 4QCIB 2VSDA 5I1LA 4GXVH 4OAWA 3PWNB 2BVEA 4OKDA 4MCYA 3ARGD 4GAFB 3FO2B 5L6YH 2GITA 2J8UB 4I0PA 3OKLB 1CD9B 4X6BA 3FT4B 3MTRA 3QNYA 1IEBA 2AJSL 4JFDB 1Q9WA 1CF8H 5MENB 2WMPA 5F8QC 5KSBA 2FRGP 4Y1AB 1P7QD 1R3LA 5IJKA 3SDAD 2DQIL 3VFPA 2Z91B 3CFBA 5I6XC 4JRYD 3ET9F 3O0RH 4FXKA 5DQ9A 1JI2A 2X4QB 2P45B 3DUHA 4PJ8B 3V0VB 4HS8L 4LVHB 2C3WA 5E0QA 4ODHL 2FGZA 2R69H 4DN4L 1CFVL 4RGNE 4Y19E 1KIRA 5K59E 1MCJA 2BNUA 3HZVB 1JHLL 1TFHA 1JZ4A 5T3ZD 3ZO0A 1I9IH 2GT9B 3G5YB 1ONQA 4K94C 1TMCB 1IKNA 4M4PA 5FUCE 3U7AA 4NDMB 1RZ7L 5GRVL 1NMBH 2YD2A 4QY8A 1RZFL 1I3RB 4ODVH 5F7KC 1G7MA 1CD0A 4WHYH 4KWUA 5D7SH 5HHXH 4K71B 4K7PH 5DEFA 1FGVH 4HF5L 1C12A 1JZ2A 4Z7OE 2BFVH 2AJZB 5E8DL 2YMXH 1PDKA 2EIEA 1FC1A 3HMXA 3AREB 1T22A 4LASH 4FQHB 4PLOB 3B9EA 2M8XA 3C60D 1PZUB 5IKCB 4JQVC 3QR2A 3EYFB 4NSKA 4Z7UE 1Q9OB 2EKSA 1FVDA 3NOIA 2I25N 5KG9B 3ZKMD 4YIQA 2XTLA 2QQLH 5E7BA 2OI9C 4NNYA 2VQ1A 4DGIL 4JFFD 1QLFA 3G5XB 3P9LB 1HZHL 1UJ3C 1KJVB 3H7BB 4QKXB 4U6VH 3V5KA 5C08A 1XCQB 1A7OL 3N50A 4NFCA 4XGZA 4R90H 2G60H 2Q20A 4LNVA 4LHUD 1IFHL 2VDOH 3VE0B 4NKOA 1F4HA 1ND0A 2JJSC 1BFOB 2C4FU 4ZNCD 1KNOA 3BMWA 4W4NA 3C6LC 4NRZA 5ESVB 3ZKXC 2VLKD 1AO7B 5SWZB 5I0DA 3ULVL 5CMAB 4JFYA 5B8CC 1IC5L 4U3CA 1YUHB 2DMBA 3LKOA 3D39B 3NCFB 2BDNL 5TF0A 1Y6KR 2NCMA 2NW2A 1EHLL 3MMEA 1DQDH 4K8RC 5C0EA 2JJTC 4UAOB 3K0WA 4G43B 2ZCKL 1G9NL 3D0LB 1ZT4B 4MA3B 1WGOA 4WI3A 4NKIL 1S7XA 3HCVA 5CIPH 1T5XA 1MREH 4QEGA 4P2QA 2Z35A 2XA3A 4JRXA 5IT2H 5CD3B 4XNXH 4H8WC 5EPMA 3AU1B 3GO1H 3SDXE 4R7NA 1MIEL 1P1ZB 3X3FL 5J57B 2FX8L 1A7BA 3BP7B 3RNKA 2OL3H 5C2BH 1ZLSH 4M48L 4PP1C 2J2ZA 5F8RC 4X4XA 5CEZD 4HWZB 3ZYZA 4PTTB 1MUJA 3HA0A 1E0OB 2ICES 4BK5A 4HKBA 2AKRB 3ARFC 2WIMA 4LFHG 2VDQH 3W5NA 4LSTL 4G8GD 2FLBT 4J1UA 2J8UE 2EIZA 2H3NA 1NKOA 5IFAL 3P30H 4OGYH 2NTFA 1YEGH 5IB4B 3GI9H 1DUYB 3CX5J 4GQPH 1VGKB 5CEXA 4JQIH 5BO1H 3T65A 2I9LB 1G7HB 2ZSVB 4Y1AE 3EYQC 4LSUL 1ADQH 3UYRH 1YPZA 4XB8A 4CRPA 2HT2C 1DANU 3BUYB 4IRSB 1RUPH 3HFML 1QR4A 4NQCE 2HFFB 3RNQB 3IKCA 5F6HJ 1CFNB 2DQGH 3OV6A 4ZPVA 3IF1A 1U93B 5K9QG 1JGVL 1CR9H 4RAVA 3MBXH 5BJTB 3WFZA 4OD2A 1EVTC 3IFNH 4L3CB 4GJTB 3HTLX 2EDRA 2AQ1A 2IFGA 1Q72H 4RFOH 4HBQA 3RVTD 3TZVB 1RMFH 1QR1A 3FRUA 3BD4A 2UY6A 4EI5A 1U58A 1RQ5A 3O4LA 5C09B 4KI5C 1HILA 4MJ6B 1JPFB 1HHHB 4NHCL 4D0DB 5C9JB 4XXCC 5IV2B 2HRLA 3DETD 2PTTB 5CCKH 1F45A 4D8PB 3RUGE 4R9HA 4KKBC 2R0LH 1D6VL 4PBWD 1MHCB 2CK0H 1S5HA 1CD1A 4F9LC 4F2MA 5IBTL 4XZUA 3QUZD 2HP4A 5IUSA 3LDBB 5ITFA 2J8OA 3IJHB 3LAFA 1L7TL 1G9MH 5GXBB 4R3SA 3EYSL 4WTZG 2NX5D 5CGYD 5JOEA 1ZTXH 2LE9A 3VFMA 1LEKA 1YEHH 1Q9LB 1YNLH 3RGHA 5D1QB 4ZAKC 5CILH 5A3ID 4HS3B 3BZEB 2VN4A 4YEEA 3UEZA 1CQYA 3GBNL 4L3ED 2MCPH 4NC1C 1FYTE 1EEQA 3DTXA 4JFPB 3MLXH 2GJ6A 1MCBA 4D3CL 5HVHC 4ZUSB 4F7MB 1AR1C 4M1CD 3KPSD 5GGTL 3CGTA 1CDCA 1V8HA 3GMMA 3PV6A 4MQSB 4PRDA 4KI5F 4TNVK 2N56A 2YS4A 1NH6A 5DEGA 4RISL 3O2DH 5CHNB 5SWSD 4F7EA 3QXDB 3HE6D 5M95B 2JLLA 2W9EH 4OF0A 4P4RB 5AUMB 2W60B 1XGRA 4Z9KB 1E4KA 4DJMA 3TC9A 4RQQB 3QUXD 1AO7E 4OKVB 5SWZE 5J4MA 1N64H 2F5AL 2EDBA 4M5ZL 3UO1H 3BWAA 3MRLB 4Y4KD 4WEMB 1MPAL 4JQXC 3MRJB 4PJ9B 3EO1A 3QEHA 3T2PA 1JRHH 4XCYB 2QSCL 1F2XK 5T1MA 3Q5YA 4ZMAT 1JGUH 4O2EA 1LEGA 3TN0D 5J1TC 4KMLB 4HWBA 2MPAH 5KN5B 2O61B 1NQBA 3U4AA 5TE6H 3W0WE 2R1XA 3QUYD 5E94B 2DQUH 1UWEL 3NTCH 4A6YB 4ZODA 4ETQA 5J1AA 5INDA 2MFNA 3C09C 3CFEA 3FB6A 1M7IB 3S37L 2F19H 3IDJA 4WW2B 5E4IA 1R0AL 5JQ6H 1BD2A 4QRRA 1EV2E 5I76B 3BGFC 1J7VR 2Z31C 3EYOB 4EBQL 1U2HA 1MFCH 1UZ6F 3LD8B 3QQ4A 2OJZL 5CEYA 5D9SA 1XR9A 3RA7L 2HRPL 1S3KH 5JUEH 3DARA 1FZJB 4ZPTB 4LDEB 5BS0D 1F11A 3OB0K 1FNLA 1Q1JL 1MLBA 2V2XA 2AVGA 3QP3A 2EIDA 5GS2D 5JXAH 5HVWA 4MQ7B 4TSCH 1TZGH 3MV01 5L8KB 4PRHD 3HC0B 2AV7A 4AEFA 5D8JH 3BUYA 2X1QA 1Q0XL 1OLLA 1BGXL 2CRYA 1G0YR 1RURL 4MB5A 4NQVB 4OGZA 4RIRB 3VWJD 1HOCB 2HFGH 1CG9A 1YMMD 2PXYB 4XH2A 1NCWH 2YXMA 3S34H 1NC4B 1QBLL 5IJKC 3ILQC 2C1PA 2VO5A 3CDGB 3T0WA 2B7DT 3KLSA 5BRZE 3MROB 1PQZB 4OD3H 3TWCL 1B4JH 4K94H 3KNBB 4XWGH 3H42L 3DMMD 5F7DA 3LKRB 1CFBA 2X70A 4FG6C 4XPHL 2EDHA 2A73B 1FL3A 5C0CD 2CRZA 1AGDB 2J4WL 1PG7X 4FFZL 3O3AB 3S88H 1D9KB 3L3GB 3L3IA 3SE8L 4GW4B 3C5ZB 5HDQL 2JB5H 4WJ5A 3Q3GB 1M05A 2LU3A 1QVOA 1YMHA 3ALWA 4U1NA 2NY6D 3OR7B 3O11B 2B1HL 4U1KB 2HJKA 3BQUD 2Q87A 1A6PA 1A7RH 5T5FL 1XF2A 2PO6A 1WT5C 4HC1L 5KSBF 4NO5B 3IU4H 3QIWD 3QPXH 2G5BB 2QL1A 1I7ZB 1SJEB 4UINL 2CKBL 3NAAH 4LSSL 5I8EB 3UC0H 3QA3B 1I9RL 1QFUH 2E8ZA 1J1OL 3ARZA 4Q97A 4YR6B 4FQQB 1P69B 1A6AB 3C2SA 4ZFFB 4HV8B 4JY6B 2VXTH 2DQTH 4JRWA 4JFQB 1KACB 5DFTA 3VFOA 1ZHNA 3MLVL 5IB3B 4ZS7H 4LIQL 4IMLB 4NWUH 5TQ0H 5HXMA 4YE4H 3DNKA 1MHPL 1CTOA 1YEDA 3WSQH 2CKBA 5I9QC 5TE4H 3WIFA 4C4KT 1QLEH 5AUMA 5JOFB 4OCWL 1FNEB 4PRPE 5IBLC 3VG0L 3VGDA 4K8RH 1BLNB 1AJ7L 2K7PA 5H2BA 4PY8J 3VFTB 3ZTJH 5JZ7C 4MXQD 2R4RL 3H0TB 1C08A 4QF1A 3KPOB 3WLBB 3WNKA 4M93C 3KHQA 5GGRB 3BD5A 3BVNA 5EIQA 5TGBA 1IM3B 4S2SB 4IOIA 3I6LE 2D9QB 2ZG3A 1NSNL 3MLTA 5DURB 4H8WH 4I9WE 1IGJA 2X7LB 3U46B 5IFHH 3UPAA 4Z76A 3GK8H 5I2IA 4NFDA 1G7PB 1QPPA 1XAUA 2JB6A 1YEKL 2NLJB 4Q58C 5JORB 1KLGA 1OSPH 4A6YA 4HX1A 4JANA 2AK1H 5K93A 2VIRB 3RGVB 3RL1A 1YC7A 3S9DB 1KB5B 2EECA 2DWDA 4L4VA 4MDJA 3BZFA 1KFAL 4QNPE 5TFSH 1OTTC 3FL7A 2YUVA 5EBWA 2Q86B 3WFEL 2BERA 3DROA 3P77A 2VXVH 1CGSL 2IPTL 3HG1B 2PR4L 3NPSC 3QQ3A 1T20B 3MODH 2A1WH 3ULVC 3DECA 5EB9A 4BK4A 4QHMA 4Q9CA 2P43B 3GSUB 1X44A 4LEOB 1UWXH 5C6WH 1YJDL 5IQ7L 4GG8B 1QSFB 3TYFA 1G9NC 2FLRT 3NCYS 2AXGB 1S78C 2V5RA 4UOW1 1CZ8L 2ZPKL 4ZYKB 5F96H 4U2YA 1GZQA 1U8KB 4I18A 2PYFB 3LN9A 1TVDA 2R0ZH 4NUGL 2QR0A 3T3PE 1K8DB 4ELKA 3VXMB 4ZNEA 1U8HB 5CLWA 4JVWA 2EDXA 4KKCD 4UIKL 4S0SD 4OZGA 2NY3B 2MCG1 2VZ3A 5DHYB 5JXED 5DHVA 4UIMA 3D85D 5ENWB 3CFJA 1LMKA 4L9LA 1T04B 3R4DA 4PBVC 3CFKB 5HHME 1ETZA 4RFNC 3ROOB 4MD0A 1DN0B 4S1DD 5DRZB 5DSCA 5I75C 1BPVA 5HYIA 1P6AB 2EZ0C 3ROLB 5FAAA 3PXJA 3UTQA 1DCLA 3ULVF 2EDNA 5I66A 3MLPA 1QKZL 2OSLA 1F58L 3NIDE 4GS7C 4DCQA 3MNZB 2VLJA 3WUWG 3RWHB 3UTTA 4MAUL 1X9QA 1TNMA 1IGFH 2BJMH 4KK9D 1R5WA 4KUZH 3R0NA 1FH5H 4L8BB 1DBKH 1PG7H 3O8XD 2YZ1A 2OQJB 3T3ME 1PGRB 3VA2C 4EI5C 1U95B 3ZDZE 1BJ1J 4F3FA 4ZFFA 3F7PC 1S7UB 2WQ8A 2FB4L 1IT9H 3STZB 3FJTA 5D7LE 3G6JB 2P5ED 1DBBH 1GGUA 4EIGB 2F5BL 4YDKL 5JTWA 1KJ2L 3MBEB 4QGYA 3BAEH 4QOKE 4POUB 5D72L 5FGSA 1U8JB 1YNKL 1YPZF 3ORJA 2ZCLL 5DK2A 3HNSL 1LE5A 1BVZA 4XVTH 3ECBA 1INQB 1NMAH 3QXAB 2WAHA 2AK4A 1X5XA 2P5WD 5GS1B 3MV8B 4P2RA 4QT5A 2ED9A 5FK9B 1I8MA 3DYPA 3NGBC 4CW1A 3EZ8A 3TT3L 4OQ1A 1OCWL 4XHJC 2FL5B 3O6FD 4WI4A 1DQQB 5GGUA 2X1PA 5BZWA 1DE4A 1KLUB 3RX7A 4WVRA 3JSSA 4GH7B 4U1LB 1R5IA 1ZS8B 3EYUL 4V1DA 2OTPA 2ZUTA 1QBAA 3D3VB 3OJ2C 1I1AA 2DKSA 1KB9K 3WMSA 1TZHB 1G7PA 5HDBF 2DQJH 2NLJA 3IGAB 1X6NA 3MCLH 2I26N 4U1GC 1H3UA 4Z77B 5GRUH 1E4XI 3KXFD 2W59A 1MY7A 5C7XH 3CH8A 1AP2A 3WFCL 2RAMA 2BRQA 2ED7A 1E4KC 3KWWB 3HZMB 3QAZB 4O2FA 2YHGA 1BIHA 3G5ZA 4P46B 5FV1L 3UJJH 15C8H 4QWWD 1X3DA 5EU6D 3U9UA 4P2OD 3PP4L 2ZG1A 3U0PA 2WBJB 1VSCA 3DX6A 3SCMB 2LTQC 1J9CT 2EXYD 1IM9A 3LMJH 5D7JD 1O0VA 4U6TA 3PNWB 1DEDA 3MRGA 4LCWD 4ENEC 5FYJL 4I3RH 1UH4A 1MF2L 2I5YH 3WV0A 3VGGA 2Q8BL 2Q8AH 3VXPA 2R1YA 1JZ7A 1T0MB 4KHXL 4U49A 5ANMA 3FFCD 3UZEA 4M7JH 4PJ5D 4GUPA 1SJHB 3VFWB 5FYLL 2QSQA 2I24N 3OKDA 4I3SL 1PX3A 3EO0B 3BESR 4JO2L 4JLRB 3L95B 2Q6WB 4LRNL 1QSFE 4Z78A 4PLNC 2R2HA 2AJSH 3SDDD 4QRTA 5IW1B 5FEBA 2HMID 4ACPA 2X41A 2V2TA 4J12A 3BMVA 2B1AH 1AGEA 4OFPA 3TBWA 4LAJH 2VDKL 4D9LL 1T0NB 4YFLI 4S10A 4LLYB 4C56B 1N59B 3FQUB 3JTSB 3TA3D 5DYOB 1Z2KA 2D7OA 1ZSDB 1FBIH 2A74B 4XPGL 3H9YA 3SE3A 3ARRA 1WWCA 5KSAC 2R1WB 4HUUB 4GQ9L 1DTUA 5INCA 4P23B 4HS8H 1FRGL 5IR1B 3WN5B 3WIIL 3ZE0E 3F7RA 3SOBL 2ZKHL 4ODHH 3MRBB 1W72L 1IEHA 2B5IB 4YWGL 4IIQA 3ZL4L 1CFVH 4DN4H 5K9QI 2HTKD 3MV7D 4NQXA 4X6CE 1GOGA 4JDZA 5TJWK 3S35X 4X5XA 4Z0BL 4M5YL 4YZFF 2W65B 1N5AA 1JHLH 2DWEA 4XMKL 4JM4L 5FYKE 1I9JL 3T77B 5IOPB 4LLDB 3NFPA 1BFVL 3PHOA 3UZQA 4YXKH 3VMPA 4KK6D 5EZJA 3VWKA 1RZ7H 3OAYK 1RZFH 4G8FB 4P5MB 3HE7D 3M1BB 4O51A 1W72A 1JWUA 3X14A 4NO3B 2E9IA 2XKUA 5JW5A 4HF5H 4MXVF 5GGVL 4FFYL 3CVHB 3EUUA 3P73B 2ED8A 5F9DC 1MRCL 3G6JE 3REVA 1HHIA 5ABDE 3K74B 3IU3A 3DV4B 3JV5A 4I3GA 5KAQF 2EDOA 1AI1L 1FNFA 4MNQB 3C5SB 2W38A 3PGDA 3DUUB 1NCDH 2NZ9D 3MACL 4CMMB 5F3HA 4YHIA 2RFXB 3KPRE 4U1IA 4DGIH 2H8PA 5FXCH 1F4AA 5E2TL 2DBLL 4P4KB 3L3JB 1U3HB 3LKQA 3GIVA 3PDOA 1A7OH 4HK0A 3MV8E 2WLYA 4V2CB 1AC0A 1BEYL 1TVBB 3HI1B 1U8LB 2J8HA 2A6KA 2X89D 4WFHE 4YPGA 3LB6D 4PJEB 3TIDA 3BN9D 2JIXA 4MVBD 5B4MD 1T7ZA 1F4XL 3FB5A 3MA7B 1VKXB 3Q6GH 5JDSA 3D3VE 4WU7A 5IMOA 1UACH 1UM4L 4J7RA 4EJ1C 4YHZL 3QQ9D 1GGTA 5KS9E 2X4PA 2NY5L 3PHQB 3TNNA 4X6DE 1CT8B 3RVWC 1BM3L 1J11A 5AYUL 1IC5H 4M8QB 4HUWB 5DUBB 1U3JA 1HI6A 1CICD 3FZUD 3VXNB 2BDNH 1OF2A 1EHLH 4TTDC 3LN5A 1UGNA 1RV6X 5I30H 4WUKL 1G9NH 3EDDA 4MCZB 3T8XA 1CGWA 4KVNL 4XXDA 5C07D 4JDTL 4NKIH 1EHXA 3ZDXE 2AS5M 1UEYA 3S37X 4QHNB 2R23A 3L3OB 4NO0B 3P0VL 1MIEH 1YZZA 3AY4C 2WIIA 4Q6YA 4Y5YB 1UCTA 1ZANL 3U83A 3X3FH 2FX8H 3IFPA 5T1DL 4H26B 3OGCB 4M48H 2YSSB 2YPLB 2IFFH 4HUMB 1QUNA 1LK2A 4NQDB 2BNRA 4WFFE 5F7WC 4FZEL 5JHDD 3L5HA 4WGWB 2BCKB 2BSSA 4GRLB 4LSTH 4LCUB 2VNCA 4I18C 3P9MB 5IIEA 3RWFB 1I1YA 4DGVH 3QEQD 5C6PB 4YXHL 1TZIA 3MQIA 4HLZH 2WBKA 2Y06H 4PR5A 3VXQA 2XWTA 3MLUH 5SWQB 4MMXC 4PG2C 2SEBB 1JHTA 2KKQA 1G7JB 1MJ7L 1YJDC 4RZCA 3KLHD 4YK4C 2NZIA 4LSUH 5L8JB 4TOYL 1RUAL 3RY6A 4P5TD 4C56E 1LP9E 2WINA 4ELMA 2D7MA 2IPKA 4OM1L 5DRWB 3U1SL 2QADC 3HKFA 2W07A 1ES0B 3WCYA 4KQ3L 3JZ7A 4TVPE 1RI8A 3V52H 3D1MC 3RWEB 1JGVH 4BSWB 5I1DB 2APTA 3B2VL 4HWNA 4JB9H 4P5MA 4U6HB 3S3JA 3ZYJA 5HHQB 1F6AA 2F8OA 3I6KB 3FQNA 4Z7VF 3BW9A 1FO0B 3B3IA 3S35H 3CU1A 1T2QL 1A5FL 2HN7B 1RK0B 5F3BA 4OLWL 4NQEA 4NHCH 5D1XA 3H9SE 1DVFB 3V4PL 2APBA 2Q1EA 5ESAB 5HGBB 5EC2A 3RJDA 3NIGE 2BY0A 5IBTH 1UH2A 4DOHB 1WAAE 4YC2B 1E28B 4OF7A 3AS0A 1L7TH 1YY9C 3F65A 5IQ9B 5I0ZA 1AQDA 4JHAH 1NUDA 4PJXF 2XQYK 4KRMB 4C57C 1JYNA 3MGTA 1GRWA 3A6BL 2CXGA 2OTWB 4N90D 5E70A 1CCZA 4NPYA 3GBNH 2GJZA 5F88B 4G6FD 4LBEB 3ZTNL 4MNQE 1QFWL 4JO3L 2RGSA 5EFIA 4ZUUB 1T1WB 1WEJL 1J8HA 1WWAX 4MGXA 1D5ZB 1LGVA 4WU5B 2EXWC 1L0XA 2NY1C 1LEIB 3T08A 2IH3B 1HXYA 4N0UB 2VZ1A 1FJ1A 1OB1A 3BZ4B 4Y4HB 3P0GB 5GGTH 3MV9E 5AZ2L 1NDMA 2I9TB 1CVRA 1I1AC 3AVEA 2XNAA 4ZOCA 3L3KB 4PRBB 4R96A 5AG9A 4YO0A 4JY5L 2VMFA 3PWPA 2VXSL 5T1LD 4JEGB 3BIKB 2BOCA 4NRYB 2EC8A 5HY9B 1S7SB 3QXVA 1JV5B 3O6KH 1HHJB 5LVEA 2EEAA 1EO5A 1RZGA 3KS0H 5I8OL 2F5AH 4PS4L 4L8CA 3UX9B 2DM3A 5FIEA 3IDIA 4XPFH 1MPAH 1UB5A 1A0QL 3MRQB 4MNGB 5AWNL 1F5WA 1W0VB 1TJIL 2YD5A 3QG6B 1ZVSB 1RVFL 1U8IB 3V6OE 1S9VA 4GBXA 1PKQB 4OCXL 4H1LH 2EDLA 4NQDA 1C8PA 5DD3L 5C71A 1FDLL 5DGQA 5I15H 1UWEH 2E6PA 1OVZA 1HINL 3K4ZA 4GRLA 3N85L 5DGRA 3S37H 4CAGA 4F33A 4B5EA 1R0AH 4JKMA 5IFJA 5E99H 1AXIB 3MRFB 4EBQH 3SE9L 2OJZH 3ARWA 4NQTA 3RA7H 2HRPH 1NCBH 2CO7B 4E42A 1DDHA 3WUWA 1TTFA 5D1ZC 1Q9KA 2YPLE 1FNGA 2HVJB 1CTNA 2DYPA 3AAZB 3TJHC 1GZPB 5L2KD 2OR9L 1X5LA 5D2LF 4ZXBD 3F58H 4XNMB 1Q0XH 1BGXH 3F6LA 1RURH 2VL5A 2LU4A 3GMRB 4GAYA 3TPUB 5HYJD 3C6LD 3IJYA 2L7JA 4N0YH 5EOCH 3RWIB 3RWGB 4FP8H 4IJ3C 1QBLH 1Z9OA 1JTTA 4PJFE 2FX9H 2BVPB 4FMKA 4MLIA 4YFLF 3QI9B 4LDOB 3TWCH 1EXUB 2D2OA 1WF5A 2F53D 4AL8L 1IE5A 1WV7T 4K8RD 2NR6C 3O9WB 5GZNC 3ARSA 3PHSA 3OJMB 3T4YA 4XRCA 3TM6A 5H35A 1A6ZA 1OTSC 5DZLA 4Y16B 2J4WH 3P9WB 4FFZH 3NFNA 4IIQC 4LCYB 4KAQH 4HUVA 4JPIA 3TT1L 5BV7B 3SE8H 3KPMA 2PYEB 2DLFL 4E0RB 5I1CH 5HDQH 1X7QB 1JK8A 3VRIA 4JFHE 3BP4A 4TUJA 3WNMA 3W9DB 3G6DL 4UQ3B 4OBRA 1XCTA 4N8PA 2A9NL 1ORQB 2B1HH 1XGQB 1PLGL 3VXUE 4OCMC 1FVEA 1NAMB 4KU1A 3VWKC 5ISZB 3AB0C 5T5FH 2HLFC 1ZT1B 2NY2B 4U1JB 2XY1A 4TYUA 4HC1H 1ACYL 3RVVC 2JCCB 5FGCE 3OGOE 3DI3B 3ARFD 3TF7C 2FYYA 4LLMB 4PJBA 4UINH 2OR7A 4LSSH 4QXTB 1I9RH 1JZ3A 4GW5A 4MJ2A 1MI5D 2PKDA 5ADPL 3PQYB 2WP3O 5GHWL 3PABA 4P59L 1KIQB 4DOHE 1LEIA 1G7LA 4NZUL 4R0LC 5JO5B 3L7FB 3EYQD 4LIQH 1DN2A 4X7DC 1R5VB 3QDJB 2IANB 5C8JA 2NXZC 3U4EB 3WBDA 4CMHC 1MHPH 1CE1L 2NY0C 5CUSL 2F54B 2NXYC 5E00B 3O81A 5C0AB 5IVZA 3OX8A 4PGEB 3VG0H 4LLQB 1OHQA 4EN3B 1HYRC 4HCRL 3FQTB 1CFSA 1BQUA 1DBAL 4J4PA 5DJ2B 3QIBB 2R4RH 5E2UH 5B3JE 1A4KA 1EZVY 2FHFA 3MUGB 4BUHA 1IGIL 4DZ8B 2DLIA 1RUQL 1IL1B 1QQDA 3BPOB 1T7XA 1XGUA 4PJAB 5I8KL 3ESVF 5DA0B 1BIIA 1NSNH 1ZVSA 5E6IA 1F8TL 4YNYB 2GJJA 1BJ1H 1A1NA 1RZ8A 4KI5D 3HZYB 4XBEL 5T3XE 3ARGB 3C5JB 4RX4D 4X6FA 2BMKB 1GVIA 3CSYB 3O3BA 4HCRA 4KKBD 4M6ML 4PG9B 2VERN 4LVNC 3H6JA 1KFAH 2BX5A 3RTQA 4DQOL 5JLZA 1EEZA 1P7QB 3B9KC 5HI4C 3U7WL 4Q2ZA 4MNGE 1CGSH 2PR4H 3VFGL 1UXSB 3ULSB 3RDTA 5EULV 3V0WL 1HEZA 3NZ8A 4RGOL 3T0EC 1MQ8A 3E6HA 1YJDH 2NW3A 4NQCA 2WZPD 4JZNA 4LLAA 4XCEA 5HD8C 3DXAD 5IB1B 4MDIA 1MCRA 2WBWB 3VGEA 2CK2A 1CZ8H 1HSAB 2ZPKH 1BMGA 5DJ6B 4YAQA 4X80H 1XZ0B 1A8JH 3HI5L 1T3FA 1AR1D 1C16B 4WW1B 4NUGH 2EE9A 1FZOA 3HS0B 4WI6A 4BZ1L 3ARDA 4UIKH 5TPWL 1DLHB 2VZOA 3O9WA 5F7LB 4YPJA 4LEXL 2PW1A 5F9JA 3MJ7A 1MFAH 3ARTA 1CBVH 1IGTB 3RUGA 2F9BT 3QO0A 5KANI 3MR9B 1MWAL 1S7TA 3RY6C 1ED3A 1U91B 3RL2A 1QKZH 2IJ0C 3ARYA 1F58H 2FWOB 1ZVYA 2X4TA 4MAUH 3EOAB 5JHLH 1RSFA 3NFSL 2YEZB 1AH1A 3DOSA 3L5JA 1E4XH 2CKNA 4JFFB 4KDTA 3IETB 1MWAA 3BPCB 3CSPA 4DKFH 2AERT 5MEQB 2Z31D 4OTXL 4UUJB 5EBMA 5FM5M 1FYTA 5DMYA 4LHUB 1OP3H 4YXLL 3MRPB 1U3YA 2FB4H 4S1RL 1D5MA 4F7TA 1NCAL 4HMEA 3FT2A 2F5BH 3RX5A 3UTPD 4ZFZB 4AH2A 1I8KB 1KJ2H 2VLKB 4R97C 5D72H 5I71B 4EQ3A 5F9AC 3CXHK 1YNKH 2ZCLH 1VB9A 2RCSL 3HNSH 4ELMF 1T83A 4LLVA 4QRPA 3ILQD 3PQYE 2EYSB 4NM4L 4PRIE 1AXSB 4ZQKB 5HBBA 5IVXE 3QIBA 5J11B 2GCYA 1RULL 2D4DA 2C4FT 3ZT5A 1OCWH 1A21A 4A2MA 1B0GA 5EU7C 4FG6D 4Z7NF 3LEVL 5T1KD 1H3TA 4CVXA 1OAUH 3EYUH 2F54E 5C0AE 4WHDA 2G5RA 1HSBB 3B2UC 3UBXB 3W0WA 3V6FA 1OY3B 4NP4L 1GJIA 2XG5A 1NGZA 4K3JL 1AGBA 4UILL 1EH9A 3EDJA 4PG9A 2EO9A 1AFVL 4MNHA 1ZA6B 4P99A 4IMKA 1P7QA 1WK0A 3WFCH 2G75A 1RK1A 1OP5H 5I16B 4LOUC 3SDAA 4E41D 4XCCH 4OF5A 5FKPA 3V4VL 1UXSA 1K6QL 4P5KB 2DL2A 4G8GB 1UWXK 1QZ1A 4JRYA 3UTZA 1AGCA 4BQBA 1QBMH 1F3RB 2OTUB 3BRGC 5EOQH 2FEDC 3PP4H 3VRLE 2AGJH 2ITDB 4M7LT 1DR9A 4YBLC 2VITA 3DVGA 1GGYA 3HB3C 1BQSA 1P53A 3HPJA 5F1NB 2ADFL 5FYJH 5DZOA 3UPCA 5D6CB 1GGIH 1NGPL 3D87B 5IEHA 3VW3H 2N1KA 4N68A 5BVJB 2Q8BH 2AJVH 2DIBA 1IC4L 2BSRB 1NFIB 3VH8A 2FIRT 5BRZA 4DZBB 1NC2D 2FH6A 4J8RB 3P4NB 1IARB 25C8L 4PJHB 1DQTA 5HPMA 1SQ2N 4ORGB 3TPKA 5C08D 4JO2H 3TESA 4LRNH 3K1DA 1UJTA 4Z5RB 4OZ4A 3ZDYF 1IGTA 4CVZA 5JZ7D 4BFIB 4L4JA 1BVKB 4RGNC 5GSVA 5TF1H 1T21A 4D9LH 2QKIB 2KQMA 2MWCA 3C6SB 1RZJL 5DI8A 1VACA 2P8LA 3BGAA 3C60A 3V5HA 1ORSA 5FUCC 1FFNB 1WZ1H 3FB8B 3W2DL 3WL9A 3GUTA 3MNVA 1BVLB 1OGAA 3VXSE 4N8VG 4XPGH 4KV5E 1SBBA 3TBTA 1RU9L 4QRQA 4C83A 2MSPA 4WNQB 3P4LA 2W9LA 4GQ9H 3QUZB 3BPCA 1N2RB 1FRGH 1Z5LA 2XA8L 3WIIH 3QNXB 2GY5A 3GBLA 3SOBH 2ZKHH 2O93L 5KSUA 1Q94B 3B6SB 4DWHA 2NX5B 5HVGB 4YWGH 2DKMA 3ZL4H 4O2CA 3SO3C 4G8IA 1CK0H 1KGCD 4PJDA 2HAZA 2YC1B 3ULVD 4JZJA 4JRXD 4K7PY 1I8IB 4LSRH 1RHHA 4M5YH 1GSMA 1BBJA 2IBZX 4XMKH 4ODSL 5CBEB 1B6UA 4JM4H 4L3EB 5L9DL 2X4OB 1BOGA 1BFVH 3KPQA 2V7HA 2HH0H 3F5WB 1U8QB 3PGCB 2RHEA 1T5WB 3Q6FA 4PRPA 5DD1L 4FABL 1S78D 8CGTA 5K59F 3KPSB 5K9JL 4OZHB 1HXMA 3WLWC 4ESKA 3BXNB 4FOMA 4YDVB 1NANI 3CSBA 3HE6B 3TV3H 4FFYH 2XN9D 4RMWA 4ODUB 1JPGB 5CSZB 3B5HA 1KPVB 3HAEB 4N0FA 3K1KC 1K5NB 3QUXB 1E6OL 4JREC 4MA8L 3LSOB 3MACH 4Z7OF 4HGWA 4Y4KB 3GSRB 1VADA 4JGMA 3GSWA 5DJXB 5E2TH 2K3TA 2DBLH 4AY0A 3OZ9H 1T1XA 2IPUK 1X5IA 3HNTL 1AGFB 4Z7UF 3TN0B 5ACZA 1R24B 3E3QE 3FONB 4S1QL 2HVKA 5E9DB 5K9KA 1MVUA 3QUYB 2APXA 3VCLB 3FO9B 2VDRL 3VFNA 2VL4A 3KPNB 4GKZB 5EG6C 1F4XH 4UZGA 1WZKA 1UM4H 4YHZH 4WENB 5KVDH 1A9BA 1KG0B 1ZGLB 5TQ2L 3FOLA 4HFWA 5E6IC 5ELIA 4YHPB 1BM3H 5AYUH 4EI5D 2VLRB 4JN1H 2VQTA 4C58B 3O4LD 5BS0B 3T1FB 5EUOE 4ZSOB 2E9JA 3PG2A 4WUUA 5IROA 5D6CA 1TIUA 2QHRL 4KTEL 3EYVA 5C86A 4HH9B 4Y2DA 4PRHB 2VAAB 3E2HC 3VFUA 4M61A 4NBZB 4WUKH 4NN7C 3RKDC 4Q6IB 3H9HB 1I7TB 4JDTH 5HYSG 2ICWB 3BYYA 2HLAB 5KSVB 1ZGLM 4O00A 1YYLL 3P0VH 1UEMA 4PJ7E 1S7WA 3FB7A 3HRPA 3OKYA 1ZANH 4TNWF 3DMMB 2P8MB 5T1DH 4HUXA 3TVMB 3SE4A 4BH7B 1GIGH 1MCOL 4XHJD 1KTKE 4HMDA 5C0CB 4FZEH 1FZMB 5DJCA 3SDXF 1R3KA 1EJ6A 1H3XA 4UT6H 4P49A 2GJ6D 5GGQL 3BKJL 5KVGL 4PJ8C 4QHKJ 1DLFL 3TBVA 2BC4B 5DC9B 3ARDC 4YXHH 5EC1B 2PUQT 3UMTA 1AKJD 5A1AA 2NY6B 5MI0B 2D3VA 4RWHA 3O2WL 2QQNL 1DUZA 5E2WH 1JTPA 1X5JA 3KGRA 3BQUB 1A6VL 5IK3B 1KOAA 1MCDA 4KRPB 3MRNA 4DFIA 4TOYH 2J8UF 3QIWB 1DEEB 1CI5A 4OM1H 3U1SH 5D7LA 1H3VA 4PGBA 4X7FC 1YECL 3LV3A 3BEWB 5C6TH 4KQ3H 1KENH 3ULUE 5IEKB 4JJ5A 4QOKA 4QTHB 3MXWL 3TEUA 5B39A 2Z92B 2H9GB 5C0DB 4ENED 2BK8A 3ABZA 4Y5VB 5FGBC 1L9MA 4WFEE 1OWWA 3M8OL 5AYQA 5CP7A 3BO8A 3L3HB 5JPMB 1D6EA 4XAKD 3L1OL 1C7TA 2ARJQ 3KPPA 3S36L 3CZJA 5SWSA 1T2QH 1T2XA 2W0FB 4GKSB 1BD2D 4QRRD 5I8CA 4OLWH 1QO3B 1QRNE 3U0TB 3VGBA 2YRPA 4AIZB 4L3EE 4B7LA 3O6ML 4PJGA 3V4PH 2E27L 1NFKA 2DLHA 5C0IA 3QULB 2X4NB 2EYTB 5DD6B 3NIFE 3GSVA 1LO2L 3S97C 1H8OA 4RNRA 5EUKB 3ARBB 3QRFM 7CGTA 4DK6A 3IDNA 1UXWB 3AS3A 1NGXB 2W0PA 3RVUC 3UAJC 4KJYB 3KPLA 5ESQA 2AW2A 3FONA 3OKKA 1T83C 3IAGC 2Q7YB 3QUYA 3ZKNC 4J3UA 2VYRE 4KMQA 3LEYH 4XB7A 3ZTNH 1KIPB 2APVA 4JO3H 5KSAD 5DMJB 1WEJH 2W0LA 4OLYL 4DKAA 5C0BB 4D0BA 1O7VA 1MRDL 2RJMA 4DVBB 1M7DA 4NC2B 5J6GA 5AZ2H 1ZVHA 4MA1B 5E9DE 4D94A 1P5VA 4JY5H 2VXSH 2GTWA 3VWJA 4D9QE 1G7QA 4HHAB 4UOJA 2XPGA 4KY1H 5IB2A 1YMMA 3BHBB 1KN4L 3DIFB 5HJ3B 3A6CL 4QXUH 1KYOK 3TNMB 5I8OH 4Y7MA 2VLRE 3GHEL 1OW0C 1JF1A 1A0QH 3U82B 3QUML 5A16B 1TJIH 4PJIB 2I27N 3ALXA 4YHYC 2PW2B 4OCXH 1LDSA 1XGPB 3D85B 3QWRD 3MUHL 5C0CA 5F89B 5DD3H 1JVKA 1FDLH 2XZAL 3MLWL 4R4BA 2VN7A 3HUJA 5ALBL 1HINH 4D0CB 1A1OB 2OR8A 5FYKL 2B2XH 2J12B 5J12B 3SE9H 3QUMA 3CFCH 1J18A 4IHOA 4KXZI 4M7ZB 3HN3A 3DI2B 1MSPA 5J13C 3LEXA 4X6CA 1JJUA 4HIEB 5LQBL 2BHYA 1A9EA 1EBAA 2YPKB 2FECL 3LS5H 1EUUA 5HGDB 5FECA 3RVWD 1X5HA 1KCUL 3INUL 4OCLC 3GMOB 4AG4L 1CXHA 1CDJA 4XBGB 4TTDD 3GSNL 2P5EB 4AL8H 3X11A 1B0RB 4YGVB 3BYTA 2F58L 5F1KC 4NJ9L 4L4VD 3EOTL 1SMAA 3Q5OA 5JW4N 5DRXA 1M4KA 4OT1L 2R0KL 1RZJC 2GSIA 3PL6A 4I5BA 1UM5L 4B7IA 2P5WB 3TT1H 5T33L 1G7IB 1JNNH 1HCFX 3PIQA 2DLFH 3FTGB 3BRDA 2UWEE 3KPRA 3WE6A 1M71B 3GSNA 4I48A 3O6FB 5CD5C 3G6DH 2GK0B 1ZHKA 3CC5A 2A9NH 3QHFL 4U1MB 1PLGH 4K3DL 2ATKB 5BW7A 2EH8H 3S98A 2FIKA 3LIZL 5IW6B 4GRWH 4H0HB 4OZIB 1IEAB 1H5BB 4UV7L 3D9AH 2P7TB 1KCVL 2HT4C 4UDUA 1KIPA 4LLWB 3CH1B 1SMOA 3KXFB 1UKSA 5ADPH 5KS9A 1KB9J 5GHWH 1WCBA 1UG9A 4X6DA 4P59H 1TVHB 4O02L 4PJCE 4AENB 1KTDB 4NZUH 2Y07L 2FECI 3FO0L 1IQDA 3VXRD 3L6FB 4XPAL 4M7KH 1UZ8A 5EU6B 4MSWB 1CE1H 1RJYB 4QO1A 5CUSH 1RFDL 2QADD 5A40E 3IVKB 2GTZA 5D7JB 1JYVA 4ODXA 2NYYC 4NIKB 4LCWB 5IHZA 4NRXB 2FNBA 3ILPA 4J6RL 4P48A 4HCRH 3G6AA 4I1NB 4PJ9C 2VLJD 5DS8B 1DBAH 3KR3H 1IGIH 5C0BE 2V7NB 2DLGA 1RUQH 2AXFA 3FFCB 5I8KH 4PJ5B 3TBSA 4NGHL 5ID0A 4K2UL 3DSFL 4GKOA 1U8OA 5JXEA 5D2NB 1F2QA 1RHFA 4XBEH 2CDEA 3OL2A 2IQ9L 2BY1A 3K46A 5HHOA 4OV5B 3L3DA 3HMWL 3SDDB 3GGWA 4M6MH 5CJXA 3L5IA 3C8KB 4NYLA 4S1SL 2I60L 2XWBB 3OPZL 2FO4A 5LBSL 4TVPL 5JIKA 3VI4E 3MJ8A 3U7WH 3V6ZB 4PJIE 4M00A 1YY9D 1QA9A 3FN9A 4HD9A 4MAYB 3VFGH 3TA3B 2HTLD 2HKHL 3WYRA 5FDWB 2X4UA 3V0WH 1S9XB 2JE8A 4QNPF 5ERWA 4N8VA 2CIKA 1LP9A 4RGOH 1ZHLB 5CAYB 2HFEA 2AK4D 5EIIA 4P2RD 3O8XA 2RIKA 3LKPA 4HS6B 1JPSL 5IMLA 5LAXB 1QSZA 2EXWD 2NY1D 1YQ2A 4FQJL 1P9MC 1UVQA 3MV7B 5D5MA 3QDMA 4X7CC 4V1DD 1I1AD 1N4XL 4BZ1H 1T1YB 5TPWH 4WW2F 1J0IA 4NHUB 4RWYL 5EN2B 3U2SB 4LARL 4LEXH 3QWOB 1D9KC 3CVHL 3I3DA 4P57A 3H9SA 3SKNB 1S7RA 3HE7B 3T3PF 4Q0XH 4LVOB 1AIFA 3U4BL 1A7PL 3RIAF 3QNZA 4LFHD 3VRJA 4U6XA 3GSXB 3VXTA 3VG9B 2E9BA 3KYOB 4ZDHA 1YN6A 3BFOA 5FA3B 4F8QA 5E1AA 3LN4B 1T7WA 1XT5A 4JM2C 1IM9D 4CNIB 1XF4A 1AE6L 4M3JA 4YZFE 4I2XB 1NFDB 3NFSH 4OUUB 3VJ6B 1ZWIA 4OB5H 4R7DB 2H32A 4FTVE 2QTEA 5E08L 3SDCA 3MPCA 3NIDF 4GG6B 1Z3GH 5FF6B 1T7YA 5IG7A 2P5WE 1Y0LA 4U1HB 4OTXH 4U4BA 4YXLH 3QUKA 4U1SA 2BNQB 1I9IL 1N8ZA 4S1RH 3WDIA 3D18A 4B53A 2CMRL 5D1ZD 4KMTL 3BPNB 3V5DA 1NCAH 5DJ8A 3MV9A 4LHUG 1LDPL 1PG7W 3T3MF 4ODVL 5FYJD 3TJHD 2JJVA 2GYSA 3ZDZF 4EXPX 3DX8A 1WVZA 4P2OA 4MX7A 2CDFA 2VE6A 2ZP0T 1KEML 1B6DA 1FGVL 3CZFA 3OKOB 1J05B 2RCSH 2P24A 2JELH 3SKOA 4YH6A 3SGKA 3SGDI 1CICB 1PZ5B 3KXFE 2GSGB 1J0KA 4NM4H 4J3XA 2XXCB 5GGSY 5FYLD 3PJSB 1EGJL 1ERNA 3T0VA 1TQBB 5DMKA 1RULH 4OLVL 4JM2F 5GRZA 4RRPG 1WZMA 5K9OB 2NR6D 4X9IA 5GZND 5JPNB 5C07B 4LVEA 3EO9H 1KJMA 5HYSA 3F7VA 1A2YB 4ZG1A 1OTSD 3UJTL 3AXLB 2LAAA 4JPWH 1J88A 4FXGA 4LCWE 5D71L 3DGGA 2X4RA 3QDGB 5DDHA 2DJSA 2ARWA 4K3JH 5E8EB 3IXAA 1KXTB 1EGJA 5ICYB 3C8KA 1FIEA 1NBYA 1AFVH 4OFYA 3L5WB 2FR4A 5DJAA 4EUPG 3MGOA 4IRJB 3SDYL 3N9GL 5TDPB 4OFVA 1JGDA 5JHDB 2C7UB 3BDXA 3VWKD 4N9GB 4LCIL 5C0ND 1K6QH 1ZEAL 3BKCL 2HLFD 1LHZA 5J0BA 3RPKA 4AT6A 1XGTA 3RVVD 3C08H 5D93B 3QEQB 3I6GA 2XYCA 1MCFA 2XZQL 1DQDL 3KG5A 5L88L 5MHSD 2VABB 1KT2A 4X99B 4XI5C 4HXAL 2EDEA 2ADFH 4HS6A 4PJFA 3SKMA 4H5SA 2IAMA 2NY3C 5D7IB 4P5TB 3GJFB 1IC4H 1WCQA 5HHVL 5FB8B 5IT2L 1WFNA 2EO1A 25C8H 4F37F 2NXZD 4C4KO 1PEWA 2C3VA 4B0MM 1FG2B 3WJJA 1ZT7A 2NXYD 1FO0L 1C5CL 5FO9A 2ATPB 3MRDA 1T4KA 5JW4R 5C2BL 1FORL 2NPLX 5JA9A 3TO2B 5IM7B 1L6XA 1NANH 2VDPL 4X8JB 3DX9A 4Z7WA 3JV6B 3MRKA 5C3LD 3GJEA 5CIPA 5DJZB 3MV7E 3SJVA 4HDIB 3MFFB 1VFAB 2DQCH 1RZJH 3KYOA 3G5VA 2ADGB 3PWUA 1INEL 5CJQL 1MJJA 4LF3A 3VXUA 4OGYL 4NT6B 3W2DH 2OL3A 5I74B 2ZNXA 1RU9H 5J9PB 4JQIL 2OZ4H 4EVNB 4G6KL 2XKNB 1BQHG 4HEPG 1OP3K 3F7QA 5FF6A 3UROR 43CAB 5EZLA 4Y4FA 5HI4D 2GK2A 1MVFA 4HIHA 1YY8B 4Z7VE 4HWEH 2X89A 5E2JA 1N3NA 3MBEC 4XWOC 2QEJA 2ADIB 4X98A 1CU4L 2E3VA 4I2XE 1NFDE 4ODSH 4G6FB 5L9DH 3ZE0F 3RZCA 1NGYA 3GKZA 4JFEA 5ICXA 4F15C 1Y6NR 4GG6E 2X44D 4X6CF 4MD4B 5HD8D 1WBYB 3G08B 5DD1H 4JGUA 4FABH 1IGML 5BW7C 3GMLA 2BNRD 3WEXB 2E7LC 1BX2B 3FFDA 5K9JH 3G04B 5H94B 5CWSB 1GOFA 2BNQE 1AD9A 4LRIC 4KC3B 5T1LB 3LRGA 1QSED 1F3JB 1WTLA 4PGDA 1KCLA 2W1NA 4FN0A 4K9EL 4CL7A 1D5XB 3RAJL 5CS7A 1CDIA 4G6JL 3OF6A 1T1ZA 3H9ZA 2DD8L 1FYHB 2ORBL 3G6JF 3E8UL 2BOBB 1OP5K 1Y18A 1KCKA 3QAZC 2X4SA 1EVUA 1FPTL 3HNTH 5EU4B 1FL6B 1F02I 4POZC 4S1QH 3ZMRA 2ARJA 3FO1B 1UWGL 1WBXB 1YEJL 2WBJC 2VDRH 4L8DA 1CQKA 4AQOA 5E24E 3SCMC 2CDGA 1PW3A 1ZHBA 2XKSA 1XF3A 5GRWA 5DUPL 1JIBA 2XOTA 3RU8L 3MRRA 5D6DC 4NKQB 1H3WM 1BOYA 3QDGE 4GKNB 1V7ML 4G8EA 2VB5A 1CLCA 2Y7QB 4MXWL 1QFHA 3F12A 4X8XA 4NQED 2DQEL 2QHRH 4KTEH 4Y5XB 1B90A 3ES6A 5KS9F 4ZXBB 4FMFA 2Z93A 1MHHB 4L8SA 1N64L 4QHUA 4X6DF 4X5WA 2E7HA 5HYJB 2Q76B 3C6LB 2R2EA 3ZKXB 4ONHB 3GSQA 3T4AB 3BH8B 3GBML 3OXSB 3QZWB 1FVCA 1JRHL 4H25A 3S7GA 5B8CB 3O2DA 2YKLL 3SPVA 1JGUL 1YYLH 1S7QB 2J88L 5DJYB 4W6WB 2F53B 3MRCB 2D7TL 4NNXA 3JV4A 2J1KA 3NTCL 4QRUA 4ODTL 2A6IA 5D7IE 4X0KA 3ZDXF 1MCOH 4XVUD 4G7VL 1KPUB 1EFXA 3W39A 2VLLA 1J8HD 1MFCL 3QH3A 4MJID 5GGQH 4CUCA 1EBPA 3BKJH 4OCYL 5I1GL 2CLVA 5E8PA 1NAML 1GC1L 3B2UD 1CN4A 1DLFH 3VFSB 3SN6N 2ICEA 3WN5C 4NKMA 3IJSA 4LU5H 3GMPB 4XVJL 2ZSWB 4TSCL 4G9FE 2B5IC 5EBLB 1KIUA 3PWPD 2QQNH 4PLKC 3QJFB 1JE6A 5L2JA 1A6VH 5TDNB 3DVNB 1HHGB 2HFGL 3NCJL 2H41A 4LOUD 4RAUB 3DO7B 1NCWL 1PFCA 2FZ3B 1CDHA 3NABL 3LCYA 3ARFB 3OXRB 3JWOL 1VEOA 1YECH 2FEDD 3JTTA 1JP5A 4OD3L 1BF2A 1MI5B 3TBYB 4G42A 4XWGL 3MXWH 3MA9L 2IQAB 2HJFB 3HB3D 1LP9F 5C0RL 3WHE0 4EQ2A 3OJDB 2OJEB 3MYJA 4UQ2A 5EDXA 4PRIA 3BEVB 3FN0L 3L1OH 4YEFA 5IVXA 5H94A 3SDCC 3X12B 4QXWA 2FJFA 5E4EC 1NCUA 4M9OA 3LRSB 4JAMA 1EMTL 3DX7B 3O6MH 2Y5TB 4PLJD 4BSVA 5CJ5A 2QV2A 2BVUA 3S4SB 3OR6B 4P4KC 4CJ0A 5MEOA 1U3HC 1LO2H 5JA8B 3LS4H 4ISVA 4HIJB 2DYPD 1F42A 4KJQD 5HHNA 2WWKT 4RGND 3CNKA 4WHTA 5DTFA 3QPXL 1RIHH 2IADB 4JFOB 4Y19D 1KB5H 5H8DA 1EAPB 3WO4B 2WLZA 1WC7B 4U6YA 3IFOA 1JUFB 1IAOB 4UNTA 3SGKC 3FO1A 1A4JB 3NIGF 4JFXB 5F72S 1AD0B 1WAAF 3IDGA 3BH9A 4KXZH 4QRSB 3LVEA 2UVFA 3MNWB 5J6HB 5BZDB 2WM0A 2MTPA 3WD5L 4Q9QH 3KPTA 4OLYH 1UJ3A 5BOPA 5C0FA 2PN5A 2FATL 3R8BB 3V6OC 1BWMA 3HPLA 1MRDH 5TE4L 4LKXB 5KW9L 1YN7A 3TIEB 4QYOB 5A2KH 2FJGA 4HIIA 2D7NA 5GIRA 4JKPL 5CP3H 5L2KA 3DYMA 5FO8B 1SJXA 5IP4A 1T6WA 1DBJL 1I1RA 1QLRB 1Z9SA 4YHNA 3DXAB 5I17B 2J7LA 2A9ML 3NN8A 1IVLA 3FQXB 3A6CH 4XNQB 1F13A 1G6RL 1JWSA 5HVHB 3GHEH 1U41A 3FOMB 3QUMH 2D03H 3WLWD 1W8OA 2JJTA 2BRRL 2UVEA 3QWQB 1MCQA 5KZCD 1A6TB 4LCCB 2QBWA 1I3GL 1WWWX 5TFSL 3LHPL 2UYLA 4P3DA 2XZAH 3QEUB 3MLWH 2IAMC 1ITBB 5IF0B 2H6PB 1JNHB 2VXVL 3VXSA 3GMNA 1G6RA 2VLME 3MODL 5E2VL 5FYKH 3VFSA 2DQFA 3DRQB 1NBZB 3WJJC 1N6QL 4UNVA 1D5IL 5BOZG 2H2SC 2R2BA 2IH1A 4X4YB 1K4CB 4J4PD 4F7CB 2EDKA 3C09B 3OJVC 4HGKC 4TUOA 5EU5B 5LQBH 3F7YA 5C0JA 1M7XA 3V7AE 4EOWL 3BGFB 2Z31B 4BZ2H 1BZ9A 5E6ID 1QEWA 2R29L 4PGCB 1J0ZA 3VA6A 4XP6L 1KCUH 5I1LB 3INUH 4OAWB 2JJUA 4AG4H 2VUYA 4MCYB 1SYVA 2YA0A 1WLHA 4UTBL 3GSNH 2GITB 4I0PB 4X6BB 5LGHH 4ZFOL 1N6UA 5C70A 1DVFC 4NQSA 3QNYB 1IEBB 3RKDD 4PJFF 2F58H 1IILE 4NJ9H 1Q9WB 3EOTH 3RTQD 4QLRA 5KSBB 3O3EA 1BBDL 1R3LB 3OKNA 4Y4FC 5DXWA 4OT1H 5AEAA 1I7RA 4UBDC 1ZA3A 1MI5E 3VFPB 1UM5H 3CFBB 4YC2C 5T33H 1JN6A 3CXHJ 4Y1AD 1CFQA 4KUZL 4FXKB 4RRPA 5DQ9B 5GJSL 3RZCC 4ZFOA 3IDMA 3QHFH 2CIIA 3OBAA 4K3DH 4NQCD 4HGMA 3L9RA 4RX4A 1Q8MA 1H8SA 1OP9A 4UV7H 3KJ6L 2JK5A 4PJ8D 3MSPA 1KCVH 1U9KA 3ARUA 3ARDD 2BNUB 3I75A 4F9LA 3B9DA 1DBBL 1NEZG 2C1OA 4EUPA 3T0XA 1ONQB 2IBGA 4X4MA 4E41B 3BAEL 4O02H 4MB3A 5EUOA 3WXWL 3F8UB 3FO0H 4KGJA 4QY8B 4NKDA 1G7MB 4XVTL 4XPAH 3V79C 3KLAA 4ZAKA 1MOEA 1RFDH 3MLZH 5DEFB 3ME0A 1C12B 4NN5B 2BVOA 4J6RH 1T22B 4HWUA 5E8OA 1OAKH 4K9EC 4NSKB 3VMOA 1FLTX 2CRMA 2EKSB 2ZOKA 4CKVX 2DQJL 3KYAA 4NGHH 2VQ1B 4NNYB 4ZUVA 3DSFH 1QLFB 5IW3A 3WJLC 4KQ4H 5I9QB 3V5KB 5C08B 3MCLL 1XH3A 5B3JF 4XGZB 5GRUL 2IQ9H 3REWA 3WFHB 1BJ8A 1FYTD 1KTRL 3SKJH 2JJWA 4JY4A 1J5OL 4NKOB 1ZLVH 4KK8C 1ND0B 4S1SH 2I60H 3C9NA 3KYMA 3OPZH 3ULUL 4L8SC 5LBSH 3UJJL 4TVPH 1KNOB 1S8DA 1VERA 4NRZB 2ADJA 1MH5A 5M7QA 3RVUD 3LKSA 5F1IA 5GGSA 3UAJD 1VDGA 1KF9B 4XP9L 4JFYB 5M94B 2OS7A 1UH3A 1I1CA 5ICZA 5CSBA 1Z9LA 1FZKA 3LKOB 4QRPD 1SEBA 3ZKND 1WJ3A 5SWZD 3MMEB 5C0EB 2I5YL 3VGHA 3QO1A 1NCTA 1BQHA 2IWGA 5DT1H 2DMCA 3O4OC 4G5ZL 3QI9C 1JPSH 1C5BL 2VZSA 3ZDYE 1AXTL 4FQJH 4M7JL 3NPSB 3WS3A 3HCVB 1S7XB 1T5XB 2J6EH 4P2QB 2Z35B 4JRXB 1AQKL 4NOBA 1N4XH 5EPMB 4PGJA 3HC4L 3W0WD 2IG2L 4R7NB 4UDTA 4Y16C 1A6WL 4RWYH 5DK0B 4LARH 3SGEI 3SGDH 2V5MA 3RNKB 2B1AL 3CVHH 1QRNA 4OQTL 4X4XB 1XR8A 2H32H 2VAJA 1MUJB 3U4BH 1JZ6A 1HIML 2RR3A 4HKBB 1A7PH 3C2AL 1EK3A 3LY6A 1FBIL 1GC1C 2BP3A 4O9HL 2VDLL 3PWJA 4J1UB 1JFQH 1SY6H 3MREA 2EIZB 2LVEA 2H3NB 2DL9A 3RJQB 3WIHL 2CO6B 3HZKA 3QB7C 4NO2A 1U0QA 1FFOA 5EOTA 4AM0A 2NTFB 5FHAL 1AE6H 5T1KA 4Z0XA 1RD6A 2Q3ZA 5D4QA 5CEXB 3T65B 2XICA 5DC0A 4RFNB 4TNWK 5E08H 2O5YL 4JHBA 5JMRA 1YPZB 1BZ7A 1ZLWH 5BRZD 3JWOC 1F00I 2PETA 3IKCB 4ZPVB 3IF1B 4YXKL 4E41A 1RPQA 1TPXC 2CMRH 4DFHA 4KMTH 4PP2A 1T66D 2BXYA 4RAVB 3WKML 5HI5C 1LDPH 5GRJL 4OD2B 1WT5A 1MJUH 2JTDA 5DRNA 3N1QC 1U92A 4KK5C 4OF8A 3D5OF 2IC2A 4LSVL 1QR1B 1KEMH 3FRUB 4FS0A 3T0AA 3M07A 4EI5B 1U58B 2AAVA 4E5XA 3IKKA 3O4LB 3HNVL 1HILB 3MOBL 1J0YA 4ZUTA 1EGJH 3SBWC 4OLVH 1OGAD 1CDYA 3UTSE 1NC2A 4G3YH 2BSTA 1S5HB 1NCDL 4L4TE 1CD1B 5DWUL 1B88A 4F2MB 4XZUB 3W81A 3BP5A 5ITFB 5IVXF 3T0DA 3UJTH 3BISA 4O4YL 4R3SB 3WFHA 5D71H 4M43L 4V2BA 3VDAA 2OYPA 1BZQK 3ZHLA 3VFMB 1LEKB 3NGBB 3K8LA 4ERSL 1OGTA 3Q6GL 3SDYH 5CD5D 4AJ0A 3N9GH 1MCPL 1UACL 3HLAB 3DTXB 1TTGA 1NPUA 4LLUA 2GJ6B 4LCIH 2YUZA 1SEQL 1ZEAH 3BKCH 4PRPD 4N5EC 1R3JA 2VWEE 1L6ZA 3GMMB 3PV7A 3PV6B 4LSQL 4PRDB 5L88H 2XZQH 4GRWE 4GSDL 2D9CA 5DEGB 2HT4D 5I30L 4I4WA 4F7EB 3EHBC 4GAGL 5I1IH 3B9AA 1WISA 4HXAH 1XGRB 4UTAH 3I6LD 2YBRA 2FGWL 1JYWA 4I9WD 3VRLF 3ZYIA 5HHVH 2ICWI 3BWAB 3OHXA 4APQA 4L29A 2R2CA 4RFEA 3EO1B 3QEHB 5DK0A 1FO0H 1C5CH 1HYSC 4CN6A 2CLRA 2NYYD 5T1MB 3RWCB 4KDVA 4LSPL 1FORH 4O2EB 4WCYL 1LEGB 2IFFL 3PUCA 4PJ9D 2VDPH 2R1XB 1A7NL 4JHWL 4ETQB 1FV1A 2AEIT 5J1AB 3IDXL 5AZEL 5INDB 4ALAL 3CFEB 4P2QE 3FB6B 3BJ91 5CJOL 1UKQA 2A83A 3IDJB 3HR6A 2XN9A 1BD2B 4QRRB 1UFUA 1LD9A 2PF6A 4DGVL 1INEH 1FNHA 3QQ4B 3ZKMC 2ZUQB 4RGMB 5CJQH 5CEYB 4L5FL 5D9SB 1XR9B 3L5XH 2Y06L 2VR9A 3MLUL 4LDLB 4W70A 1F11B 3O3DA 4JFDE 3RHWF 1MLBB 1QFPA 2V2XB 5MENE 2BHZA 4XPTL 4WUUD 4KROB 4G6KH 1NGWA 1JWMA 4Y2DD