1BVLB

Humanized anti-lysozyme fv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASGNIHNYLAWYQQKPGKAPKLLIYYTTTLADGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQHFWSTPRTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Humanized antibody
molecule keywords HULYS11
publication title Structural consequences of humanizing an antibody.
pubmed rcsb
source organism Homo sapiens, mus musculus
total genus 23
structure length 108
sequence length 108
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bvlB00
2VQ1A 1RPQA 2DBJA 3SDDD 2DM4A 1OLZA 2YKLH 4YDLC 1IKNC 4XMPH 2W0LA 4PJXB 3WIHA 2DWEA 3TA3D 1AQKL 4Y5YA 4PLOB 1CLYH 4HW6A 5K59E 4FQLH 2EDDA 3ARYA 3INUL 1TVDA 3MCKA 4LPUA 4IHOB 3RNKB 1KTDA 3AU1A 1J1OH 4OFYA 3DO7B 3VXMD 2V2TB 5GS1A 3QIWA 5JZ7C 1A1NA 1G7PA 1YEHL 1KACB 3QDMA 1KELL 1T7XA 1NJ9B 1KIUA 1ZS8B 5E6IB 3B9KB 4YGVA 2DDQH 5KSBE 4R96A 2FLRT 4QRRA 3BP6B 1ZLUK 1MRDH 5A3ID 4P3CH 1BIIA 5J57B 5KSUA 3S8WA 2VXVH 5ICZB 1NFDA 2VLKE 3RUGF 3DSFH 1IM9A 2C7UB 4XPBL 2E6QA 5DD1H 3EOAB 1F11B 4NYLA 4UV7L 2X4UB 1KTRL 1AR1D 4ELKB 3IS1X 2W9EH 3HCVA 4HJJL 1VKXA 3MLXL 4JZNB 3TJHD 5BZDA 5DC0A 3OKMB 5TF0A 4KJPC 2GKIA 1FPTL 4ORGA 5C08E 2OZ4H 2H2SC 3MZTA 4Z77B 1HXYB 3HRZA 1SJHA 4JREB 5L8KB 1MCKA 1KC5L 4LCYA 3LRHA 3MRRB 2P46B 1OW0A 2CDGB 1DQDH 4BQ8A 5F9JB 3RGVB 4P99A 5IFAL 1XF5A 3SDDC 5HYIA 1P9MC 3G5YA 5KSAA 1ZEAH 2QSQA 1B0RA 4H1LH 4MYWB 2FZ3B 1YECH 3DX8A 3OKLB 2QKIB 1DR9A 2Y36H 4NRZA 5DMGC 4Z7WA 5IBLD 1KCVL 2HA1A 2QEJA 3OKNB 5DQJB 4M8VA 1QSEB 4IRJC 4LCCC 3ROOB 5EBWA 4X0KA 1U6AL 4Z8FH 4K55A 1WF5A 2A38A 2AABH 4X9FA 3U0WH 3TVMD 5F1IA 1OT1A 1S7TA 1HWHB 1LK3L 2ZG1A 3LEYL 4GKNA 4QRQA 5D4QA 3WJLA 3GDBA 3QXTA 3UPRB 3T09A 4PLNC 3I6LE 3UTZB 3VXSB 4U3HA 2FIKB 4F2MA 1C7SA 2ID5A 2AJVL 5DZNA 1B0WA 4QYOB 5D8JH 5A3IC 3QI9B 4W6YB 4DZBA 3VFWA 4LVHC 4Y1AB 3FFCD 3TBSA 2AJZA 3L7EA 2A6DB 3CFBA 4X4ME 4F7PA 5GGUA 2IGFL 4P2OA 5J1SC 2X9XA 4NKQB 2P5WB 3G6JB 5F9AC 3MJ9H 3V8OA 2BVPA 3P4NB 3V4UL 4WUKH 2GAZA 4ONFH 3V7MA 1AR1C 3C6LA 4K7PH 1RMFL 3VG9B 3NGBB 4BKLA 1UWXK 3DIFB 2BNQB 5T3XE 3TJHC 1YNKL 1V7ML 5CIPA 3G5ZB 4ELME 2Q6WB 2NY0D 3QHTC 5I1IL 3WLBA 6FABH 2FSEB 2YEZA 5ENWA 3BT2H 3X13B 4NNXB 3ZHDA 2IH3B 4YHML 4LCUA 2NY4D 1FNAA 5K9KB 4OFYD 1ZLVK 3TBYB 4XX1G 3QIWD 1DDHB 1TCRA 3KJ6H 5DJDA 2GTWB 3QDMD 3OAUL 2F58H 4CMHC 5C9JB 5GGSB 2XG5A 2IPKA 2J8UE 1I3RB 4EQ3A 1LE9B 3ULSA 3CSGA 4NNYA 2J7LA 3C5JB 5IBLC 2DI8A 9CGTA 4XCFL 4HKBB 4QRRD 1QRNB 4QXTA 1ACZA 4L4TA 4Q97A 4M61B 1HDMB 3KPOB 1T3FB 4R4FH 3GSOA 3H3PH 3KPSE 3O0RH 3TVMC 4AY0A 1XIWC 4P5MB 1RUQH 3W81A 4JFDA 3V0VA 2VISA 4O02H 2P5EA 1IM9D 1NUNB 1TLKA 3U36B 4EBQH 5IGXL 1QFWM 4OQTA 2AK4D 3HKFA 3QG6A 4MD0A 4PJCF 3IU4L 5CZVH 2PW1B 4N0YH 2CLZB 3LKQB 2IEPA 3MLUL 3BKJH 3HC0B 5DJ2A 1G7IB 3ARWA 1J10A 1OSZA 4M3KB 4HKJB 4XPAH 5EB9A 1ZA3B 5FYJL 4L8CB 2EZ0D 5DA0B 4RWHA 1EHAA 3ZZ1A 3AM8A 4QXGL 2CSPA 1JNJA 4UB0L 2XA8L 4AEIL 2GJZA 1OGAB 1QBLL 4NKIL 2UVEA 5CEXA 3Q5OA 4WJ5B 1WAAA 2XWJB 1YYLH 5KSAD 2NY0C 4GRMA 1JNNL 4XCEA 4ESKA 3QWRD 5IMOA 1I4FB 1KGCE 1NBVL 2G5BA 5CMAB 5AUMA 1QLFA 1AH1A 4CVZA 4BZ2L 2D9QB 3K8LA 3LQZA 4HWBH 1CF8L 2H32A 2X10A 5JXAH 4L3AA 2HJKB 5IMMB 4I3SH 4JQXC 3DX9B 5DI8B 1X7QA 1N8ZB 5CJOL 4I48A 4WWKA 2HLFC 1RZ7H 1XFPA 2WUBH 2ICCA 3GRWA 4XP6L 3M1BB 1B9ZA 5IROA 2WNGA 5MEOB 4FS0A 4DEPB 2YA2A 5GGRB 3Q1SH 3D25A 3FRPG 4LDOB 3RA7L 1I9EA 4P2OD 3T77A 1HKLL 5D71L 2EECA 2X4PB 2EC9U 4GRWE 1J8HA 3WXVH 1IAIM 2GK0A 1TCMA 1J0JA 2UWEB 1F90H 4FQJL 4KDTA 4WVRA 1N5YH 3W2DL 1GHFL 5SV3A 3W0WE 2FB4H 4OLXL 1LEKA 1RK1B 2EZ0C 1UZ6F 2XXMB 4RFOH 5IK3A 3O3EB 4JO2L 1CU4L 4ZUSB 3PQYA 4HXBH 3JTSA 4KUCD 1CFSB 5D2LF 5FIEA 1FYTA 3I75B 3MRIB 3C87A 4OZIA 4F15B 4Z0BL 4D0BB 1CG9B 4JCLA 1BBJA 4GW5B 4POZC 4U1JB 5A16A 2DQFB 5BOPA 1MCNA 2BHUA 1WBXB 4MD5A 3HZKB 3T65A 1II4E 4L4TD 5I8EA 3INUH 2DRUA 3UMTA 2VWEE 1K4DB 2DLGA 2OXHA 4O2CB 1ZA6B 1NC4B 1NCBH 1QZ1A 3MLVL 4RGNE 5CZXC 3MBXL 4DFIA 4JFDD 4WU7A 1YEHH 5EA0H 1T4KA 1AI1L 3EJYD 4MD4B 1KELH 4WDIA 5E2WL 3GMQA 1EXUA 3VH8G 4D9RE 3WHXA 1KT2B 4XI5C 2X05A 1WBYB 2DYPA 5IG7B 3RUGB 3WDJA 1XEDA 4Y7MA 2BY2A 4M9PA 5E5UB 2YSSB 4Y16A 3HPLA 4CJ0A 4KU1A 1DN2A 1C12A 1Q9LA 1S9XA 1HILB 5L0QB 1Q94A 5DJAA 2ADGA 1U3YA 5FA4B 4HJJH 3MLXH 5BRZE 3BH8B 4NT6B 2VDNL 4OCSL 1MI5B 5EBMA 2NW2B 1FPTH 4GG8A 5ID0B 3RWIB 1Z5LB 2B20A 2ED7A 1UA6L 2WV3A 5FYLD 5T1KB 4X80H 5AAMA 4XMLL 4YK4B 5TDNB 2R0WL 2Y07H 1KC5H 2QBWA 2WBJD 1AKJA 1CFTA 1XCQB 1OM3H 3AAZB 1FC2D 3DMMB 5IFAH 4NCC1 5FM4A 3LKPA 3AY4C 3QO1A 4S1DD 3OHXB 5JIHA 1ZT7B 1KIRB 2P43B 3FTGB 4WWKD 3U48A 1DSFH 3LQAL 5I74C 4MJ4A 1UVQA 2OL3A 3GRWL 5E9DE 5DUBA 5IB5A 4KXZI 3CDGA 3DUHA 5IB2A 4ZO8A 4PJBA 2K9UA 4Z78B 1Q9OB 3MLTA 5ECJE 5HGHA 3ARGA 1CD1B 1NFIB 1FL6A 4HCRA 3G04B 3JWDL 1NCCL 1LK3H 1T1XB 3LEYH 1E4KC 1P4LB 3BUTA 4RA0C 1K85A 3P30L 4PJGE 1ZK9A 1HEZB 3MJGX 4O4YL 4A6YB 3TGXA 2CLRA 1FFPA 1FO0A 5DEGB 4PTTB 2PN5A 4PRPD 4XP5L 5C2UB 2EYSA 4X6EB 1VEOA 2NY6B 5F3BB 5IFJA 1NUFA 3B6SA 1TETH 4G6AC 5JQHC 1CTNA 3LKSB 4ZSOA 3VGAC 3FFDA 3WYRA 3DTXB 5TE4H 3PQYD 4Q9QL 2ESVE 1RMFH 5MERB 2X1QA 4N0RA 1UXWA 1TENA 1FYTD 2AKRB 4QT5A 4P4KA 1AQDB 1YNKH 3UTTE 5GS0H 4HDIB 2KPNA 4J3VA 4RMRA 4G43A 4POYA 1JF6A 4UT7H 1AO7E 5IMKB 4KRPD 5CP7A 1R3HA 2WBJC 4HAFA 3D3VD 1N26A 3MODL 4YHMH 4Z7UF 3CSYA 2RAMA 2YRPA 3LKOA 1ED3A 4ODHL 2EE2A 3GHEL 4JLRB 2VUOA 4LF3A 1AY1L 4Y4HC 3OTTA 3K7UA 4M1GL 3CFDA 4TVPL 4HIIB 3IFPA 2E7LC 2EDFA 1J9CT 4KK5D 3U0TB 4JPVL 3F7YB 1JHKL 3OJDB 4XCFH 5EIVA 2Q3AA 2A6KB 4AQ1B 3BRFA 1U8NA 2UZIL 5BQ7B 4BSWB 3RVTD 2GK2A 3QO0B 4HHAB 4QRPA 1RZIA 1KIQB 4PJCB 1P7QB 3H9SE 1KG0B 4K94H 3WFEH 4BYHA 4WI2A 3H9ZA 4AT6A 1NGYA 3M8OL 1R0AH 3MLUH 3KYMB 3WS6C 1QBML 5KBNC 4JFZL 2PR4H 1JWMB 4R4ND 4WFGE 3V0WL 1LO2H 5FYJH 4TOYL 4FABH 5C0CD 1A4JA 3TJEL 4PJ7E 3IGAA 5CEZE 4L4VA 4G6KL 4QXGH 2X7LB 3BZ4B 2XA8H 4OQ1A 1AKJD 4FA8A 1RZKL 5F7NC 3MRQB 5EOCL 3LAFA 4PB9L 3ZE1F 5IHBA 4YHLL 2AQ3A 2OL3L 2KQNA 1A6WH 3CCHB 5D93C 3BO8A 3KHQA 5F44A 5AZ2H 4YHYC 3MRMA 1NBVH 3V7AG 3MUY1 5ACMA 1UM5L 5FO7A 1S9VA 2BSRB 3G6DH 3SEPA 4HCRL 3ARGD 4I3RL 1KUMA 5FYKE 1UWEL 3MJ6A 3IFNH 4KROD 4WY7L 3BESR 4KK5C 3SDYL 5INCA 4HS6B 1FO0L 1ODAA 3ULUE 5EWIL 4UDUA 1FFNA 4TULH 4Y2DA 3RVTC 4R90L 2YA0A 4AH2B 4R97C 4KVNH 2Y4SA 2MHAB 3JWOL 5IESL 4RNRA 5DK2A 1SBSL 4G9FB 1CDHA 3GSQB 3G5VB 1AGFA 3SKNA 3QFJE 1QG3A 5KTEL 2Y7QA 4MLSA 4WW2C 4FQJH 5D1XB 4P4KD 4NKDB 5FF6B 5AEAA 3QXAA 4E5XB 2EDOA 4CDHA 1NMBL 4MNHA 4OLXH 4Z76B 1AR2A 2YWZA 4R4NC 2Q76B 1ZT1B 3LN4B 5DVOA 1K8IB 1I9RL 3MOQA 1W0YT 4GAJH 5D2LB 3DWTA 4WFHE 3VU2A 5F8QC 2Y06L 1AFVL 4I2XB 5D72L 2CRYA 5DK0B 2YD9A 4QHNA 3ILPB 3QIUB 5HSFA 5E00B 5K93A 2EC9T 1ZOXA 1MIEL 4RMTA 1KCRL 5DJZA 1EFXB 3IDMA 5EC2A 3OJMB 3I3BA 2XTJE 4P57B 3V4VL 5I8KL 4S2SB 4WWID 3HC3H 4QRPD 3C6SA 3FMGH 3MLVH 1X5XA 3MBXH 2AAVA 1H0DB 4LVOC 1T66D 3FQUA 5FCUL 3VXUD 3PJSB 2ATPB 1LK2A 5IR1A 4NO3A 1XGRA 1JWUA 3RJDA 1FVEB 1WFOA 1NGPL 3LDBB 1FN4A 3VCLB 1G7LB 5HHQB 4PP1C 2WANA 1F6FB 5F9WC 1LEGA 1MLCA 1LEIB 1ZVHA 4YHPB 2A6IA 3PL6D 3ZDXE 4L4VD 1CGUA 2F8OA 1WEJH 2FECL 4MXVF 4WUUB 3WFDH 2OTWA 3UP1A 4U1MB 2AS5M 5D96C 2DQDL 5JW4R 4OCSH 4NHCH 1KN4L 1VFAB 3GMOA 3S97C 4EIZC 5JQ6H 4XMLH 1H8NA 4XAKE 1FZMB 4UV4H 3L5WB 1X5KA 4ZAKC 1N64L 4PS4H 2EDTA 4G6JH 4ONHA 3F7PC 3C09B 5KS9E 3ABZA 3HTLX 4XB7A 4MA1B 4FMFA 4IMKA 2YPLE 4K7PY 4NDMB 3VDCA 4NRYB 4U0RB 5DQ9B 1T7ZA 3LQAH 4JY6A 4NC1E 3OKEA 1B2WL 4MDJA 4MNGE 2EO1A 2VLLA 4XXDA 1DQQB 3D69B 3PHSA 2VABA 4YEFA 2O5YL 2ADFH 4FTVE 4MAYA 4OIAA 1LE5B 4WO4B 4KJQC 1HQ4A 3TBWA 5D2NE 4ZFGL 2NX5B 4ODWA 4F57H 2W0FA 4OGZA 4P49A 4JY4B 4K7PX 3TYFB 4PJDA 1JGVL 5CZKA 1GC1C 5GRXG 4KGJA 2MOVA 2NXZC 2B1AL 2XWTB 4WI4A 3P30H 4K7FB 5CBAA 2DMCA 1WIUA 5BS0B 2E9BA 5JR1L 4RAVB 4O4YH 1NBYB 3O3AA 4AYFA 5B8CA 4PY7A 2JB5H 4PJEE 4XP5H 3TPUB 4CL7A 3PL6C 3I02A 2G2RB 2VAAB 5FGBC 2IPUK 1FVCB 3I84A 5AD0A 4Q9BA 4RFEB 4CNIA 2BSTB 2JIXB 4OD1L 3O2VL 3WKNA 3DI2B 1N6QL 2R1YA 2QQKL 3SO3B 3UX9B 2I9LA 2A74B 1WFUA 4MB3A 1CR9H 2WZPD 2ENSA 4JFYA 3L7FB 4G7VL 4HWNA 4CGTA 1HK6A 3NFNB 3MRPB 3MODH 2D3VA 5SWZE 2YWYA 3OKOB 4WTZG 3AREA 1M7IA 3GIZL 4F7TA 1BF2A 3TZVD 3GHBH 2X4TB 3MUGB 3CJJA 4NKOA 1GPOL 1MHHA 4YR6A 4M1GH 4ZS7H 4TVPH 3T3PF 1W0VA 1DVFA 3BPLC 2EYTB 1JHKH 3MV8B 2BY0A 4IIQB 3WSQL 2UZIH 3BW9A 1L0QA 1BPVA 3KHOA 3ULVE 1OPGL 5GRZA 4WFFE 3NCBB 5DJ8B 5C07B 2H2PC 3HE6B 4RMVA 3TNNB 5CILL 3EGSB 4WHTA 1A6AB 3KS0H 4N0UA 5F21B 1QSFA 5DFVD 1NEUA 5C0GA 3NZ8A 4M7LL 1KBGL 5E1AB 5BVJA 1CXEA 4G9DB 5IP4A 2EEDA 5CLWA 2L0DA 3UBXB 3STBA 5DUPL 1V8HA 3M8OH 5LCVL 2E27H 4H20L 3QUML 2R0KL 4JFZH 2BVUA 4MWFA 4Z95L 2EDNA 1I7UA 3O41B 2O61B 2AGJL 1N3NB 3QEQA 3HFML 2V5RA 2YD3A 3VE0A 1YJDL 1IC1A 2GEEA 5CEYA 4LRNL 4O5LL 4G8GA 5F7FA 4PB9H 1M05B 1AP2B 4YHLH 1MCRA 2R4SH 4ZODA 3U0PA 3LY6A 3QHFL 4FQIH 3CLFH 3JUZA 1YC7A 1BLNA 5D7JB 2FYYB 2E6JA 3K4DA 2D7PA 1J1XH 5BV7H 5IM7A 4U6XB 5HHME 3OX8A 3TIEB 4OM1H 5FO9A 4HV8B 1EUUA 5DJ0A 3TZVC 5IB3A 3QUZA 4I3RH 4WHCA 1MY7A 5EOQL 1Q9KB 3IKCA 3RTQD 3ZO0A 1TFHA 5SX5H 4OF3A 1T1WB 4KXZH 2FH8A 3GSUA 4NCDA 3QYCA 5C0AA 3SDYH 3REWA 2VSCA 4OZFG 1S7UB 1TVBB 1S9YA 4JFOB 5EWIH 3FRPA 5EOCJ 1BJ1H 1CK0H 2UZYB 2HLAA 2FNBA 5E8NA 3L95B 2BVYA 5GRVL 2A2QT 4LEOA 1JV5A 1UGNA 4OCYL 3JWOH 2ZCHL 1IGMH 4PRAA 5J0BA 1SBSH 2IADA 1XF3B 4PD4J 4ZDHB 5KTEH 2ZSWA 4NO5A 5EU4B 4Z7VB 1VGEL 1DBML 2C1OB 3PE9A 4MJ2A 4PJ9B 4JFFB 3VWJD 2IBZY 4NM4L 4X4XA 1I7TB 3O11B 4OZHE 1I9RH 5EN2B 3VFUB 2NY1D 2BMKA 2A73B 3FRUB 3W11C 2PO6C 3P4MA 4X5XA 5F7LB 4E42B 1A7NH 1T80A 1R3LA 3L3KA 5DMIL 5JMOC 3O4LD 3WS3A 5T3XH 3UYRL 1MIEH 5LGKA 2IBZX 1KCRH 4P3WA 1N2RB 1DVFD 2OYPA 1OP5K 3P77A 2F74B 1QP1A 4WU5B 3RVUC 3QWQB 4YFLI 1E28A 4F8TA 4BK5A 3RTQC 4L9DA 1FP5A 4GUPB 3KPNB 2XN9D 4FXKB 2PYFB 4O58L 1T7YA 3VH8A 1GVIA 2Z8VC 1B4RA 4Y4FB 1IJ9A 5FCUH 3ARFC 1R3JB 3HB3D 3FKUS 3ZHLA 1DQJA 3BRDA 2HAZA 2R1XB 3NIFF 1ZWIA 3KR3L 1LP9A 4JDVB 1F42A 4HUVB 4O2EA 5JUEH 2ZWLT 3CX2A 4HBQA 1R5WA 4I9WE 1CFNA 1TDQA 1H3WM 3GMPA 1TZIA 2DLTA 3QXVA 5EU6E 1R3KB 5IBUB 3VXQB 1CQYA 4LSUH 5E2VL 4WGVB 5K9QI 3QEQD 4MXQD 4LVNB 5GIRB 3JXAA 15C8L 2GSIA 3L3GB 2H6PA 3RP1A 3SDAA 4G8GD 1EFQA 4NJAH 3VWJC 1Z0NA 3QULB 3T4AA 3RIAK 1HNFA 5T1DL 1KFAL 3QCUL 4TTGA 5I19L 4UINL 1BJ8A 1KENL 2NY1C 3U46B 1FFOB 4M1CD 1ONQB 2HKHH 4KPHL 5I1LA 3U9UA 4ODXB 4YNYA 1UT9A 4H5SA 1N64H 3OGCA 3HN3A 5I1GL 2D31B 3ZTJG 1A7RL 3QUKB 4WW1A 5C0AD 3ZLQC 1B2WH 1RUPH 4HFUL 3DV4A 3PIQA 4HS8L 5SWQB 1JYXA 1JWSA 4HG4J 3FO9B 2WMPA 3IJYB 2O5YH 3GJFH 5TDOB 1Q72H 5C8JB 4DGYH 3W9EA 2EDLA 4I18C 4ZFGH 1SQ2N 3R06A 5FYKL 5HDQH 3VI3F 3S4SB 4NZDA 3PWJA 1SYSB 3EO9L 3RPIA 2FGZA 4RBPH 4MA7H 5B38B 4Y5XB 2B1AH 3F5WB 1SEBA 1BVLB 5JR1H 3ULUL 4ZFOL 1DN0B 4XGZB 5D7LD 5DD6B 4M6OH 4L3CB 4CJ1A 2BVQA 4JRXD 3WCYA 2B4CH 2P4AB 2Y72A 1FZOA 5HYFA 4E0RB 3F6IA 4YHNA 4LBEB 4ZUVA 1AGDA 3DXAB 4S0TD 4ZUUB 5J13C 1RK0A 2VLJA 2V5SA 5EO0A 4OI8A 2JB6A 4OD1H 3O2VH 5T3ZL 4JHAL 3K1DA 7CGTA 3PABA 4LLYA 5IQ9A 3U9PL 4PJIE 3PHOB 1ADQH 1T1ZA 1IBGL 3OG4B 4XWGL 1MEXH 4YFDB 5CJQL 4G7VH 2FWOA 3FO0L 3KXFA 4JM2A 4ZQKB 1G84A 4FMKA 4PREB 1YQVL 3GSWA 4X6DE 4RISL 4NRXA 5FHBL 1EJOL 1A8JH 3WIIL 1AHWA 1DUYA 3NBNA 1GPOH 3FB6A 1C5DB 4JFXB 3RL1A 4MB5A 2EE6A 2DLFH 5HYQA 1UKSA 5TGBB 4UILH 3I6KB 4TUJA 4BFGA 4FFYL 3NA9L 3S5LG 4KJYA 4K71B 3WSQH 3O9WA 4JM4H 1S5IL 3DRTA 1OPGH 3RBSA 1CZ8L 2IMMA 5I17A 2O26U 3CVHB 3T1FA 5LJYH 2VXTL 2C3VB 4HGKC 1YEGL 4Z7WF 1FH5L 3NFSL 1UYWL 1FRGL 4N9GB 3TCLA 1KBGH 1HHGA 1I3GL 3SDAD 3FB5A 1C1EH 3O2WL 5F6HJ 4MB4A 1GL4B 2Q7YA 1UEMA 3WO4C 2EDHA 4JPIB 4JDZA 1KTKE 3HNTL 3SGDI 4H20H 2YBRB 5E8OB 3QUMH 2R0KH 3GI8H 5C0FB 4JPWL 3ZE2F 3MA7B 3FB8A 1XR9A 3P0VH 4Z95H 1U8MB 5E8EA 4LLVB 1KPVA 2AGJH 3HFMH 2DLEA 1FL3A 3M17A 4XNQB 1YJDH 1T04A 5D1ZC 1W0WA 1A4KB 3S96B 3WLWD 4LRNH 1D9KC 4O5LH 5TQ0L 4JO1L 5IJKA 5MENE 4U7KA 5HPOA 1MAJA 1PQZA 3FT4A 4NM8L 3BAEL 3JV0A 4PJ5D 3QHFH 4QCIA 2DM2A 12E8L 3KPRE 4U6VH 2WBWB 3LRSA 1IEBA 3G6JE 4OLYL 2DQGH 3BRGC 5JW4M 2UYLB 1QLEL 3WNKA 1U2HA 3VFTA 3MOAL 2HFTA 3G5XA 1NCAL 2V2WA 3CH1B 1S7VA 2BNQE 1DLFH 5EOQH 2PXYB 2BJML 4LEXL 2C4FT 4M8QA 4ZD3L 4RMWA 4C4KO 3T2NH 2X6MA 1N59A 4KHXL 4MJID 5DO2D 5I9QB 5KZCD 4HMCA 4KUCF 2F54A 3THML 1U3HD 3TA3B 3JV6A 3SJVE 4C4KT 4J4PC 1MHCB 1LNUA 1RJCA 3WFBL 2G5RA 8FABB 3CLEH 4N8VB 1P69B 2A1WL 2EXWD 4OCYH 4WEUD 1D5BA 3GIVA 1KB5B 3KLSA 3LHPL 2OCFD 5HI3C 3X12A 2GW5A 3LV3B 1OAKH 1CGVA 3QH3B 3RWGB 2VLJD 4YWGH 3IJSB 3MV9A 4YQXH 5GS0D 5IJVB 5E94B 5E08L 1I8IA 1ND0B 4P0DA 5FK9A 2PTVA 35C8H 3IAPA 4OKVA 1KIPB 4X4YA 2A9NL 2FHBA 3BQUA 3KXFD 4Q6IA 5F96L 2E5EA 1J7VR 4GQ9L 1D6EB 3NH7L 1OB1A 3QWOA 1MWAA 1S8DA 5HY9B 1QRKA 2R2BA 4YHZL 5L2JA 4S1RL 3BD4A 3MNWA 5DMIH 5J7CC 3D2UA 2JCCB 2OSLA 3QHZH 4ODVH 3RIAF 1K2DB 4J23A 3T0EC 4BA8A 2F5AL 4TN9A 3IXAB 2A9ML 4JJHA 5HHPA 5IW3A 3K3QA 4R7DA 5DS8B 5ICXA 1WAAF 3BVNA 3O9WD 5ALBL 1D5ZA 2WLYA 5HYSG 1A6ZA 3MJ8A 5KVMC 4TNWF 4XNZC 5EOTA 3PDOA 1NANI 3EFFB 5IVZB 3C08L 4O58H 1E4JA 3DVGA 4PRDA 2F53D 1QFUL 5DO2C 3MPCA 4RA3A 5GRJL 4GAYB 3T3MF 4WHDA 3BDBA 3MV11 1U3HC 1T0NA 4J3XA 4XBGB 4NN7B 5FM8A 2P45B 4HIXH 1PKQA 4HKZA 4DQOL 3ULVL 4F7EB 4P5KA 4IOFC 5IWLA 5E2VH 1E6OL 1IGYB 1A6UH 2WLZA 1M71A 4EXPX 3UJJL 15C8H 2CIKA 5F1OB 2CDEB 1WSST 3ALWA 5GS0C 4NUJB 4PLKD 1HH6B 3CPLA 3BH9B 5SWSA 1KFAH 3QCUH 3VXRB 5I19H 3GJEA 1BQHG 5F7MC 1IAKA 3NZHL 1OAQL 5IQ7L 3S3JA 2W60B 3ARBC 3W39A 1L9NA 2DQCH 3FFCB 3PWNB 4KPHH 1FAKT 1YDPA 3GM0A 4PP2A 4NQVA 3S88L 5CEZH 1ZVYA 3MFFA 2FO4B 4OAWB 2CKBH 1A7RH 1X5YA 5F93C 3LVEA 2VQ1B 1U8KA 3WFCH 4CADA 1DZBA 4HFUH 1LILA 1CVSC 2XICA 2VN7A 4QOKE 2N1KA 5J4MA 1NC2A 2DWEB 4EDWH 4Y5YB 4OZIF 1N6UA 1YEFL 3IXTA 3F65A 3VWKD 3MCKB 4KAQL 3GKWH 3MRBA 1TJIH 2KH2B 1F4HA 2NY4B 4LKCA 4M43L 1KTDB 3AU1B 1FLRH 2F19H 4Z7QF 3GMNA 5FYKH 4K94C 5DURD 1MFEH 5MEPA 5GS1B 3QIWB 3BPNC 1ZLUH 1A1NB 1G7PB 2CUHA 1F02I 5FB8A 3QDMB 5GSVA 5D5MA 3LD8C 2YUXA 4F9PA 4K3JL 4N1EA 2HJFA 3N1PC 4YGVB 4R96B 3ULUH 1MJUL 4QRRB 1HNGA 1HYSD 1UJ3C 3I3EA 1F58H 3BQUD 5FUZH 1BIIB 1YNTA 5KSUB 4ALAL 1G9EA 2DF3A 4GS7C 4NO2A 1ZLWH 1NFDB 5I71C 3E3QC 1IM9B 1HOCA 4BFEA 3MOBH 4NYLB 5T3ZH 2APTA 5I1AA 3U9PH 2XPGA 3HCVB 3UO1L 1VKXB 4LIQE 4X7TA 5BZDB 4XWGH 5D7SH 2C3WA 4ORGB 5CJQH 2G75A 5HHVL 4TTDC 3HRZB 1SJHB 4RISH 1CE6A 2KKQA 1JGUL 5DLML 4LCYB 5FHBH 1EJOH 3WIIH 2WAHA 4N90E 4OLZH 1MI5E 3SE4C 1XF5B 4CW1A 3FB7A 1YQ2A 3G5YB 1GGIL 1KLUA 2BXYA 2XZCL 5KSAB 1B0RB 4Z7NE 5C2BH 1MCLA 3ZDZF 4FFYH 4X6CA 3DX8B 4Y4KA 3NA9H 2AJ3A 1YC8A 2VKWA 4IRSC 4NRZB 4UUJA 4EN3D 4Z7WB 1S5IH 2OI9C 1BWWA 5F8RC 3VWKC 3WO3B 2NY5H 2RIKA 4X6FA 1CZ8H 2BRQA 1P84J 5EBWB 2VXTH 3JUYA 4X0KB 4YBHA 1YEGH 1GGUA 3SE8L 1FH5H 4PJBF 3NFSH 3N9GH 5F1IB 4C59B 1I3GH 1GGBL 4AEFA 1R3IL 1C5CL 1S7TB 1P4BL 4GKNB 1PSKH 3AS3A 4O51A 4QRQB 1J1PH 4XVSL 5SWSD 4OB5L 3S7GA 4F2MB 1A2YA 4JPWH 1B4JL 5MHSD 4S1SL 4DZBB 3VFWB 1EO7A 3EO0A 3RI5F 1NGWA 3TBSB 4GMSL 2AJZB 3L7EB 3CFBB 4IJ3C 4F7PB 2ERJC 5GGUB 5HDBF 4CVWA 4P2OB 1I9IL 1NDGA 2JJSA 2BVPB 2EO9A 5C0BA 1JNLH 1FE8H 4JO1H 4TNVK 5TQ0H 2GAZB 4OLWL 5LQBL 3C6LB 3EO1A 3GMLA 4BKLB 4NM8H 1F2XK 4P46D 12E8H 2B1HL 3HAEH 1JI1A 5CIPB 2QQNH 2R69L 3WLBB 1NC2D 2YEZB 4NPYA 5HGBA 5HDOA 5ENWB 3C5ZC 2YPVL 3ZKXB 1OAZH 2PYEE 1CCZA 4HZLA 4LCUB 1VACA 2BJMH 4LEXH 5GHWL 4OZFA 4GAGL 1IC4L 2XY2A 1TCRB 2BNRA 2ICES 5DJDB 4HWEL 3KPQA 4KHXH 4D0DA 2IPKB 4EN3C 4TPRH 4NNYB 4Y8DC 5HI4D 3ULSB 3THMH 1YMMA 2AP2A 4QXTB 4L4TB 1RULH 1WZ1H 3MACL 3ZSTA 4WI3A 1JMXA 2A1WH 4R26H 3GSOB 5CD3A 2DQJL 5DD0L 1WFNA 1FNEA 1G9NL 2Z31C 1S5HA 4JFDB 3LHPH 3V0VB 2VISB 5CD5C 2P5EB 1EA9C 4J2XA 5LWYL 4D9QE 4KTDH 1WV7T 3QG6B 4MD0B 5F70A 2DQHL 4JFHE 1WQVT 1T89A 1RD6A 5JORA 3DROA 1ITBB 4RQQA 4PJCE 5DJ2B 4P5TD 3RAJH 1OSZB 2A9NH 5T1LD 2BZDA 1U95A 3EDKA 4GQ9H 4UZGA 1AC0A 3OMZA 5IKCA 2HVKA 5CJBA 3SBWC 2GJZB 3LQAC 3T2QA 4P46C 1CXFA 5CEXB 4AMKL 3OXSA 3TO4A 5JPNA 4GRMB 4M7ZB 1DBBL 4XCEB 1IM3A 3JVGA 4U1KA 2RB8A 5CAYB 5BCAA 4Y4KD 5IMOB 2ORBL 1PY4A 1EVUA 1K9TA 2BFVL 3NIGE 2G5BB 5AUMB 1QLFB 3OR7A 5ALBH 4G8EA 4CVZB 1WVZA 4K8RL 3LQZB 1QPXA 2DJSA 1L0YA 2H32B 2HFGH 3C08H 3CXHK 1I1AD 2W07A 1X7QB 5E99H 2J8UA 4I48B 4WWKB 1MCPL 1IQDA 3NCYP 4HQQL 3E8UH 1VFBA 4LPYA 3SGEI 3ULVH 1BF8A 1I85A 3KPSA 1RURL 3RY6C 3D25B 1P1ZA 1E6OH 3T77B 2VLKD 4FOMA 4C56A 4I0KA 3TBVA 4XAWL 2ZUQB 1RV6X 3N1GC 5C0BD 3SGDH 3MXWH 4ZXBC 1J8HB 1VEPA 1LO0H 2GK0B 4AIOA 5L9DL 1GYAA 1T20A 2WWMD 2ARJA 5IQ7H 3NZHH 1OAQH 4P5TC 1JHLL 1LEKB 5EFIA 3TF7C 4G9FE 5CP3A 3CMOL 5DSCA 1MLBA 5IK3B 3DGCR 3D85A 4APQD 4JZJC 2YMXL 3PQYB 2VDOH 3QCTL 3JTSB 3R4DA 2G9HA 1CFQA 2BNRD 1FYTB 2XZAL 4XNXH 4KKAC 4Z6AT 2J6EL 5E2TL 4OZIB 1B88A 3PWLA 3MCG1 1ZTXL 1BBJB 4OCMC 2XQBL 3EZ8A 3CXDL 5A16B 4HUKB 1UM4H 4KI5C 4ZOCA 4KRPB 4I2XE 4MD5B 4FQ2L 1YEFH 3T65B 4K23H 5I8EB 4KAQH 2QSCL 3SCMD 1GXEA 5DRXA 3RBGA 1FG9C 2GT9A 1I1AC 4LLDA 4PRBA 1DCLA 2E7CA 1CE1L 4WU7B 1T4KB 1LO3L 2I60L 3ARDA 4M9OA 3WJJC 4ODTL 4HSQA 4WDIB 3GMQB 3I6LD 1EXUB 2ITDA 3O3BA 4NZTL 3WHXB 4I0PA 1DLHA 1MJUH 2DYPB 4M02A 2IBGA 4LL9A 5TF1H 2JJSC 4FQQA 4CVXA 3AS2A 1K4CA 4ALAH 1X3DA 4HMEA 4HH8A 4Y16B 3HPLB 1IGJA 3ECBA 2WP3O 4ZG1A 2MQ0A 1KB9J 1KPUA 1C12B 2KQMA 4PB0L 2H45A 1Q9LB 2EEBA 1S9XB 5T3XD 2WWMC 3RX8A 1IILE 1Q94B 5H37G 2WP3T 5DJAB 2ADGB 4EKXA 3O4OC 3UO1H 1YEEH 2P8LA 3ZKQD 5BV7C 2FX9L 5EBMB 1CD0A 4GG8B 1IGTA 4LK4A 1EEYA 5MI0B 5HHVH 2YK1H 3AMLA 4APQC 5I1DA 5H8DA 3VFGH 2R2EA 4CN1A 4WUUE 5DLMH 3B2UC 2IF7A 5I73C 3QJHA 1AKJB 1CFTB 1JGEA 1VSCA 4RAUA 5CGYC 4OGXL 3LKPB 2SEBA 3QO1B 3S5LA 1WISA 2FHFA 1UVQB 2OL3B 4U1SA 2VLRA 5DUBB 5IB5B 3CDGB 5IB2B 1NANH 1BFVH 4PJBB 4I1NB 3JWOC 3SCMC 4JE4B 4GLRI 3MLTB 3KPSD 4WV1A 1ZHLA 5DHVA 5I16A 5HGHB 1DQTA 3ARGB 3SE8H 3T0DA 1FL6B 4KROB 2X42A 3LSOA 1R3IH 1C5CH 3FT2A 2QQLH 1P4BH 4MJ5A 2CLVA 3QDJE 3W9DA 2HG5A 4XVSH 4NIKB 4HIJA 4OB5H 4PJDF 2NX5E 1EGJL 1BJMA 1B4JH 2CLRB 1FFPB 1FO0B 3ZYIA 3OB8A 3ORJA 2EYSB 3VFNA 5IFJB 1I9IH 4PY8J 3D85D 3B6SB 2GTZA 2LTQB 4GBXD 4ZSOB 5BS0E 3FFDB 3QA3A 5LQBH 1J05A 4OLWH 4OM0L 1UXWB 4JDTL 3HG1E 4QT5B 2NY3D 4P4KB 3PHQA 2EKSA 1MPAH 1K6QL 2R69H 1KGCD 4G43B 2OK0L 1DTUA 2YPVH 4NNPL 1R3HB 4M6NH 2OJZL 1OQXA 1ZXQA 3CSYB 3PNWA 3WXWL 4KZDH 2ARJQ 3LKOB 1ED3B 1IC4H 1KYOJ 2LQRA 4LF3B 4K3HA 3HNSH 4XC3H 3VG0L 1CICA 3ARDD 3CFDB 3KLAA 5H2BA 4HWEH 5EULV 1QQDA 3IFPB 4DUVA 1QOKA 2A0LD 5FGSA 2C3XA 5HD8D 3S36L 4I0PD 3Q48A 1U8NB 4UIKL 4NN6B 3MACH 1FVDA 4GXVL 4QRPB 1URLA 1RZIB 2R8SL 3VRJA 1YUHA 1ZAGA 5DD5L 1AD9A 2IANA 3S35L 4YDKL 3TFKC 2O5XL 1D5XA 3EYVA 3SHSA 3V6OA 4M93C 4AT6B 1NGYB 5GGTL 4PGEA 4KDWA 1F6LL 3BP7A 4G3YH 2X89A 2IPTH 4LAQL 3P9LA 1MJ7L 4GBXC 4F9LA 4N5UA 1A4JB 3IGAB 4L4VB 3B3IA 3P0GB 4QHUA 1JTOA 1KJ2H 4AMKH 2AJYL 1YYMH 1TJHL 1HHHA 1Y18A 1DBBH 3QQ3A 4TSAL 3BO8B 3C60A 5HYSA 2VLRD 5GGVL 3HMWH 3MRMB 2BFVH 4P9HL 3RDTC 4HF5L 5FO7B 1U9KA 2OXGA 4K8RH 1S9VB 1DFBH 1IAOA 2AXHA 3RWFA 4M6MH 3TN0D 1D5MA 2A0LC 2D03L 1MCPH 3TV3L 2IFFL 5INCB 1YEIL 2AJSH 5I15H 3FQXA 3UDWA 4HEPG 4HQQH 3F58H 4UDUB 1FFNB 4Y2DB 5FV2A 2B4CC 2ZKHH 1RURH 4P4RA 2DKSA 2YXMA 1BQUA 4HLJA 3H9SA 1NMCB 5EZOL 1OL0A 4RNRB 5DK2B 4OFDA 5E03A 1HN1A 4NFDA 4LHJB 1BQHA 2WUCL 4HK3N 3QNXA 3SKNB 1TTGA 3BP4A 3O3DA 4YHOL 5K9OA 5BRZD 3B2VL 1I8KA 2B0SL 3MXVL 3HR6A 2AI0L 2RGSA 5DDHA 3QXAB 4H25A 4NQEA 4MNHB 5LXGH 1UWGL 2W0KA 1CLZL 1V3MA 5C1MB 4PG2C 1SBBA 2JJTC 2YC1A 3T2OA 1P5UA 4PJ7A 1FZJA 3MREA 4Z7VE 1X4YA 2YMXH 4MS8C 4KTYA 2CKBA 2RQ8A 4QHNB 2Q8BL 4XPGL 2XZAH 4A6YL 2W0PA 3MGOA 3MUHL 5ERWA 3SGKC 3QUXA 5E2TH 1CICD 5I1HH 2X41A 5E9DD 5DJZB 5EC2B 3IDMB 3ZKND 3CXDH 4JJ5A 4BFBD 3O2DA 2VWEC 3ROLA 3LEXA 3VFPA 4FQ2H 2E9WA 2VN4A 2MCG1 2QSCH 4RGNC 1FNSL 3TN0C 5C0JA 4NQCE 3C6SB 5E8PA 3ZE0F 4G7YL 4CAGA 1JYWA 4BK4A 4WTXA 2I60H 1LO3H 2IAND 4JVWA 3FQUB 2DQEL 3LB6D 5C6WH 1WIOA 1MRCL 1YEKH 2Z35A 1LK2B 5IR1B 4NO3B 1XGRB 4NZTH 1JWUB 5LG1A 3IDNA 3L5IA 5E95B 5F97E 1FN4B 1M6OA 3QQNA 3RU8H 4PJAE 4P59L 4D3CH 4RAHA 5I75C 2J12B 4XCNA 2X89D 4OCLC 5KVEH 3C8KA 1YJDC 1LEGB 1MLCB 1V3KA 2MFNA 1LP9F 2A6IB 1IC5L 3I50L 3UZVB 3GK8L 2ESVD 1UACL 4PB0H 1E6JL 2OTWB 1DQLH 4HXAH 3UTTD 1SJEA 3A67L 4P2YA 1Y6MR 4GKZA 3QSKB 4MXVE 4OIBA 2FX9H 3QIBC 2J8OA 3C60D 1AO7D 3H2WA 4M00A 3NTCH 5DMKA 3GMOB 4GXUM 4X5WA 3C5SA 3TT1L 1OD9A 4RCAA 3VDBA 1EJ6A 4MGXA 3NAAH 4R0LA 1ZANL 2VC2L 4LQFH 2MCPH 3VA2C 4ONHB 1JIBA 3NN8A 4DCQA 4OGXH 4ETQA 2AW2A 1WK0A 4WI9A 4YHIA 2VLME 2AXGA 1S7WA 2OTUA 1JJUA 3EKCA 4NP4L 4JY6B 3V9FA 3OKEB 4X83A 4MDJB 4OT1L 2VLLB 4XXDB 2VZOA 4ISVA 4K3DL 2VABB 3GSVA 4G6FB 4MAYB 2VH5H 2XYCA 3IDXL 4WNQA 1HQ4B 2R4RL 3A6BL 3TBWB 1XH3A 3O8XD 4ODWB 2W0FB 4W6WB 4BH8A 4QHKI 3H9SD 2VDKH 3DJ9A 3NFPA 4L9LA 4URTB 2BP3A 1IRAY 4PJDB 1ZLSH 5JHDE 4ZNEE 1TTFA 3SGEH 2V9RA 1AXSA 4D8PA 1Z9MA 3DUSA 5CBAB 4C57C 4NQUA 3U30B 3O3AB 3WNOA 3S98A 1XF4A 2IPUG 4NQED 1HIML 4PY7B 5B8CB 4M7LT 4WFGD 4B5EA 2W65A 3MLWH 3I02B 5AG8A 3AB0B 5CEZD 2EIDA 2MJWA 4YUEL 5E4EB 5AD0B 2IMNA 3GI9H 1A6TA 1RIUL 4OM0H 4CNIB 4D94A 3QUXD 2R1YB 5D1QC 4YPGA 2FX7H 2I9LB 4UQ3A 3OJ2C 3QPQD 1MREL 4JFYB 4NNPH 5DEZA 3DXAE 1YN6A 2ADJA 4LNRA 4KK6D 5FYKD 4F7CA 3AREB 3WXWH 1M7IB 5KS9A 2QSTA 3ES6A 4F7TB 4HZAA 1TNMA 4NKOB 1MHHB 4YR6B 3VG0H 1W0VB 1QR4A 2J8HA 4L8SC 4YZFE 3SE3A 1DVFB 2BRRL 3CVIL 3QQ9D 4YX2H 4PGCA 2BHZA 5IVOA 3ULUD 4KGLA 2Q86A 2QLVB 4FTVA 2LU7A 1BGXL 4UIKH 3BW9B 1TQCC 3PWPA 3O8XC 4I13B 3BZFA 4M1DL 5D2NA 4HC1A 4GXVH 1QYGH 2BY1A 3PXHA 3EYOA 4LPXA 1W2KT 4WHTB 4N0UB 1WZMA 1QSFB 4X5LA 5C0GB 3NZ8B 1NMAH 4YDKH 2O5XH 3QFJD 5BVJB 4XPHH 2HMIC 4Z7UA 2VDRH 3L5HA 5IW1A 5GGTH 2I25N 3BE1L 1MJ8L 5CS7A 4PJEA 1T03L 1W72A 5ANME 4LAQH 5FCSH 1MJ7H 3G6AA 4MWFB 4WFHD 2ZOKA 5FUCE 4M5YH 2PTUA 1I7UB 4JHBA 3QUYA 4OF6A 4JKPL 5D6DC 1A6PA 3QEQB 2NPLX 1VFMA 4EEEA 4EI5C 3VE0B 1NGQL 5CEYB 4G8GB 4HJ0D 3ZL4L 4HPOL 3U0PB 3SDCA 3UBXI 2AEPL 4TSAH 1F97A 4HJGA 4LIQH 5GGVH 1BLNB 2XTJD 4QTIH 5JA8B 3QXDA 4P9HH 1REIA 4WFEE 2YD8A 2YPKA 5IM7B 4H26A 4HF5H 3OX8B 1HINL 4R8WH 5FO9B 2VZ3A 2FATL 5DJ0B 5IB3B 3QUZB 1RIHL 5FYJU 1CDJA 2D7MA 3IKCB 3N50A 5E4IA 3MRGB 2FJHA 4FXGA 4X6BA 3GSUB 2D03H 5C0AB 3ULUC 2IFFH 3REWB 1YEIH 4KKBD 1EZVY 3MBEA 4GLRH 1EH9A 4WRLA 1S9YB 4TQEL 4J3TA 4PJHA 4Y5VC 3CGTA 3E0GA 5J89A 5T5FL 5DT1L 3VMNA 1JHTA 2HLAB 1OAUL 5B22A 1AJ7H 4NSKA 1PX3A 1IFHL 4CU8A 4LEOB 4UNUA 1JV5B 2EC8A 4I0CC 1BM3L 4PRAB 2X2YA 2IADB 4A2MA 1HYRC 2HJLA 2L4OA 2ZSWB 4NO5B 1OP9A 3GSRA 2ZJSL 4NWUL 5FM5O 2LABA 4LPVA 3O6FA 4PR5A 4X4XB 4ODSL 4U1IA 1UWGH 3B9VA 4X8JA 1KTLA 2E7MA 4XXCA 4GXUN 1CGTA 4XAKD 2BMKB 2V17H 5JW3H 2YN5A 4UIMA 3S9DB 1NAMA 3P4MB 2ZUWA 1U8LA 2I5YL 2VDLH 4X5XB 2YPLD 1R3LB 4A6YH 3L3KB 3QNZA 2JLLA 2CIIA 3HE7A 3WS3B 4WENB 2HT4D 1NLBL 3PDGA 4NGHL 3HPJA 2XKUA 3BGFC 5SX5K 3J7HA 3P77B 1PG7W 4FTVD 1MFDH 5BW7A 3UPAA 1CXLA 1A64A 3PWPD 1E28B 3BP5A 5DVNA 5B4MD 5HVHC 2JCCE 1FNSH 4ZTPL 1JF1A 4G7YH 3VH8B 3HZVA 2A77H 4KKBC 2DQEH 2YD2A 3CFCH 2VNCA 3QXUA 5DVLA 2MPAL 4LCWA 1DQJB 1ZHNA 1ZWIB 4L1DA 1LP9B 1G6RA 1SY6L 4J8RA 3U7YL 2DQIH 4O2EB 1R5WB 1PG7L 3TM6A 5I1JH 1CFNB 1WT5A 3GMPB 3BJ91 1TZIB 2DWDA 2B5IC 3T0AA 3BYTA 4BUHA 1U8PA 3GK8H 2VDPL 1UACH 3LRGA 2GSIB 2H6PB 3SDAB 1HZHH 4NZUH 5EC1A 1A02N 3VFOA 4IDJH 4ZUWA 3T4AB 3HI6L 3T0EE 2AV1A 2EDXA 3K2UL 4PRHE 3N85H 1BEYL 2W59A 3Q3GA 4OZHA 4KK8D 1KXQE 3CU1A 1JPSL 3F7VA 1VEMA 2M8XA 3HNVL 5TE7L 5ILTH 5CJXA 3WN5C 5I1LB 4ZOAA 3TT1H 3VXNA 1FIGL 1C5BL 5SWZD 3U9UB 1VPOL 1JGLL 4YNYB 5J12C 2VC2H 4H5SB 3VXRE 1KEML 3OGCB 4XVTL 5E5MA 4YDIL 2HT4C 5D7IE 1RZ8A 1MVFA 4WW1B 1OY3B 1MCWM 2P7TA 3DV4B 3PIQB 3MBED 1JWSB 4R9HA 2ED8A 5B4MC 1J18A 4JKWA 3IDXH 3ARRA 3RIFF 4WFFD 3GGWA 4WI7A 2R4RH 2GHWB 3W9EB 2CXKA 4MAUL 2R23A 2EYRA 1KPRA 1G7MA 3R06B 4K07A 5GZND 4OGAD 1VA9A 3PWJB 5CUSH 4XBPA 4JFPA 3RPIB 1VFUA 5KG9A 2X4SA 3VI3E 5KZCB 1SEBB 4DUXA 3EDEA 4JANA 4OD3L 1U8IA 4LSDA 1HIMH 1VB9A 5D5MF 4GH7B 4F58L 3HUJE 4NUGL 4EUPH 1JZ5A 1NAML 1P7KA 2BVQB 4EUPG 4YUEH 3KNBA 4U1HA 4LKXA 3KGRA 5D9SA 2QADC 1FZOB 2DICA 4YHNB 1RIUH 1AGDB 4PRIE 4ZUVB 5LAXA 1RK0B 2VLJB 5EO0B 2JB6B 1MNUL 3PABB 4LLYB 3E2HC 5IQ9B 4YE4L 1RZJH 2W92A 3KPLA 1T1ZB 3RZCD 1NFDE 1FG2A 5HHMD 2O5ZL 2FWOB 3KXFB 4JM2B 3AROA 1UJTA 3AC0A 32C2A 3GSWB 3QISA 4NRXB 3MNVA 3GJFK 4AEHH 4AM0A 1AHWB 1DUYB 3FB6B 1RFDH 3RL1B 1G9MH 1A1MA 2WQ8A 3FCTA 3TESA 5HYQB 1G6RL 4TUJB 3ULVC 4JY5L 4LCWD 2XA3A 3D39A 1H5BC 4KJYB 3V5HA 5FYJE 4QXWA 3O9WB 3DRTB 3HMXL 2QR0A 1KLFA 5I17B 5KSVA 4X6CF 3T1FB 1EO8H 5GZNC 2VERN 3X3GL 2WIIA 3IDYC 5DMJB 1MVUA 3TCLB 4TRPL 1HHGB 4FZ8H 2ZUTA 4PJ8A 3FB5B 2ENYA 1Y6KR 4MNQA 2Q7YB 1N4XH 1OF2A 4JDZB 3LIZL 3BE1H 1MJ8H 2J2ZA 3FB8B 1XR9B 3SDXE 5B39G 5E8EB 4B7IA 5KSBF 4HPYL 1I7ZA 2A83A 4JKPH 4BH7A 1KPVB 3ZE2E 1FYHB 1SMOA 4PGJA 1FL3B 3M17B 5TFSL 1NGQH 5EO1A 1T04B 1EBAA 1W0WB 2JKXA 2VZTA 4HWUA 1IEHA 1KJ2A 3KLHD 3ZL4H 4GRLC 1PQZB 4HPOH 2J5LC 3U7WH 4TSBH 3FT4B 4QCIB 4PJIA 1IKNA 1FCCA 4KTEL 3RZCC 3ALPA 3LRSB 1DEEA 1UM6L 1IEBB 4WI8A 4RGMB 1RZGA 3F8UB 2H3NA 3EJJX 4X6DA 3VFTB 1F6AA 3G5XB 5EU3A 2V2WB 1RIHH 1OGTA 1S7VB 4XHJC 4M8QB 4UOW1 4X7DC 2X4QA 1NBZA 3PV6A 5DVKA 1IGIL 1N59B 2IAMC 3IVKA 2F54B 2I07A 1MELA 3JV6B 5T5FH 4I9WD 3ZHKA 1OAUH 1LNUB 3B8SA 4DAGH 5EU6D 2DL2A 4M7JL 2CQVA 3E1F1 2X40A 4MDIA 1D5BB 3GIVB 2FEEI 3NACL 1C16A 4EOWL 2V5MA 3L3DA 3X12B 1TZGH 2GJ6E 1MCOL 5DR5H 4PV8A 3MV9B 4JG0L 1I8IB 5FK9B 4WTWA 5HHOA 4NWUH 2GITA 4OKVB 5AZEH 5CJ8A 5EZIH 3V8CA 4X4YB 4JFDE 3AXLA 3BQUB 2P5EE 4Q6IB 1RI8A 3DX6A 4XNYL 3WBDA 4KHTL 1YEJH 1OB1B 3QAZC 3QWOB 1MWAB 5GGSY 5MENA 1S8DB 2P8MA 2R2BB 4RWYL 3SDDA 5L2JB 2FJGA 1P9MA 4XVJL 3MNWB 3D2UB 2OSLB 3KPRA 3PGFL 1NLBH 1EMTL 1S7XA 2XY1A 4AQOA 3BKYH 3VDAA 5HHPB 1CDIA 2EH7L 3OAYH 3D39D 3PP4L 4R7DB 5ICXB 3BVNB 4IRJA 4LCCA 4ELMF 3VXMA 1D5ZB 3B5TA 1A6ZB 4ZTPH 3MJ8B 5FDYA 3MROA 1XT5A 5CKGA 4BSVA 4JR9L 3PDOB 5EOTB 3NCJL 1UB6A 1VGKA 3DVGB 4N1CA 2VR9A 4RGOL 5J6HA 5GRVK 4PRDB 3RL2A 1NGZA 4OF7A 1B6UA 2Y9RT 2LVEA 1T0NB 3MV7A 5JLZA 3SJVA 2E9IA 4PUBL 1HCFX 1JPGA 3OQ3B 5A2FA 1M1SA 3U7YH 4MCZA 3LKNA 2BOCA 2J8UF 4OUOA 1PKQB 4HKZB 4LFHD 2OP4H 3F7RA 4P5KB 3MGAA 4P9ML 3SN6N 5MEQA 1M71B 2VDPH 2CIKB 1KOAA 1YPZA 4QY8A 3UJTL 3P73A 3CPLB 2V9TA 3HI6H 1G0YR 2YRZA 5SWSB 3U7AA 3K2UH 4OLVL 3CVHL 3FQRA 3GJEB 5ISZE 1IAKB 2HKFL 3W39B 4TUOA 3MLSH 4DTGL 3DRQA 4LASL 1I1RA 3HNVH 5TE7H 4IS6A 1YDPB 4PP2B 1CFBA 5I6XB 1J8HE 3MRNA 4NQVB 4OV5A 1JGLH 3MRKA 1CDUA 2CGRH 2PCPA 4IEFB 4U6YA 5LGHL 2Z92A 3MFFB 1L6XA 4FQXC 1A7BA 4HUXA 1U8KB 5DHXB 1TJGL 1ZA3A 2FD6H 4CADB 4KWUA 1MCSA 5GGRY 4EZMA 1NC2B 3RFZC 3CFJA 3MYJA 1GOFA 4F37K 4YXLL 3RGVD 3IXTB 1TXKA 3DNKA 3TVMA 1XIWA 3KLDA 3MRBB 4MAUH 3I2CL 3QG7L 2DKMA 4FN0A 1MHPH 4LKCB 1F4WH 3GMNB 5MEPB 2IQ9H 1MFAH 3KJ4B 1MJJA 5EUOA 2XRAL 5CWSA 5FB8B 1IT9L 5GSVB 3CDFA 5D5MB 5JO5A 2EIZA 4M7KL 4QRUA 2HJFB 3QZWA 5HHOD 4NZJA 4LARL 4OD3H 2FEEL 2AEQL 2H2SD 1D7FA 3KWWA 3WKML 3JV4A 1NLDL 3NPSB 1A7OL 1YNTB 4PBVC 5E6IC 3B9KC 3JWNC 5DUML 4NO2B 3ET9F 3LEVL 1XF2A 1OAYL 4TVPE 4KMTL 1CTOA 4HWZA 1O0VA 5MEND 3NMEA 1J12A 1HOCB 3OF6A 3QI9D 1NCNA 5KN5A 2F9BT 5HBBA 1RJZA 4GRWF 3KPRD 4MHHG 5I1AB 2XPGB 3LZFH 4PJFE 3BSZL 4X7TB 5DMGD 1ZVSA 4K8RC 4KRLB 3VXOA 4KI5E 1KB5L 2G75B 4IRJD 4KH2A 4UMGA 2E7BA 2BNQD 3MRJA 1CE6B 4LDLB 2EE9A 5DVMA 4JQXA 5L88L 4CW1B 3FB7B 1U8JA 4JREC 1KLUB 2A6JA 4JO3H 1F5WA 1L9MA 4QOKA 3OPZL 4JQIL 3MV7D 4X6CB 3B4NA 5C9KA 3SJVD 4Y4KB 5GGVY 2AJ3B 3RGVC 5HPMA 4UUJB 4NBYB 4DZ8A 1RJYA 4X6FB 2H8PA 5FM5M 2PF6A 2J3SA 5HYEA 3MMEA 3X3GH 3WV0A 2AK4A 4CMMA 2FHCA 1ZSDA 4TRPH 4WI5A 3HZKA 1FDLL 2YS4A 4O51B 1ZLWK 4U4BA 4PJBE 3O45A 3D9AH 5A2IH 1TPXB 1A2YB 4N0FA 4L8DA 1Q0YL 1BD2E 3BKML 3EO0B 4JGMA 1NGWB 3LPWA 3L3IA 4DK3A 1U3ZA 2E7HA 5GJTL 1NDGB 1JCKA 3QI9C 1FV1A 5C0BB 5IVXE 1J87A 3SKMA 1KEGH 3ZKSD 2PW2A 3EO1B 3GMLB 1INEL 3QWRA 5CINL 4H1LG 1HKFA 5HXMA 1G0DA 3P0YH 4KV5E 4R4BA 1UM6H 1JI2A 3VG9C 4H88L 1E4XI 3NGBC 4NPYB 5HGBB 3R8QA 4LNVA 4ZSOE 1F8TH 4MQ7A 2OX5A 2VDML 5DJ6A 5C70A 4HZLB 1XIWD 1KLGA 1KULA 1VACB 4XBEL 4OZFB 1JBJA 4M5ZH 2BNRB 3MFGB 1FQ9C 2AXFA 3KPQB 3GFUA 1CQKA 1IGIH 4D0DB 1FGVH 5DHYA 3VGEA 1XGQA 4FP8H 3ZT6A 1RVFL 1YMMB 4OLUL 4TSCL 1C08A 2MKLC 1BQLH 4CN6A 1VDGA 4M7JH 1VFOA 5CD3B 1XMWA 4UBDD 4QXUH 2R2HA 1B0GA 3NACH 3TC9A 1DANU 1S5HB 1A9BA 4EOWH 4TVSa 3WIHL 3TNMA 3OF6D 5BO1L 4HKXA 1DBJL 4JRYE 3FN3A 3FN9A 5JORB 1U93A 3DROB 2V6HA 4RQQB 4CVUA 1EEZA 2XI9A 4ODUA 5ESVA 1CXIA 1U95B 3DVIA 2OBGA 3T04D 4XNYH 4KHTH 4Z0XA 4QTHA 1KJMA 3CIQA 3EYUL 5IKCB 2HVKB 4RWYH 1SVCP 3QCVL 4XVJH 2VL5A 3AY4A 1MIMH 1HWGB 4P23B 5IBTL 2HLFD 3GSNA 1VENA 3OXSB 3TO4B 4KVCL 5JPNB 4QOKD 3TPKA 1IM3B 4U1KB 2EH7H 3PP4H 1MAMH 2XZQL 3QDGE 2BY3A 3V52L 2PYEA 1OTUC 3OR7B 4G8EB 3RJQB 3VMPA 3R1GL 1IL1A 1D5IL 3EDFA 4P2RE 4JR9H 3NCJH 4PGBA 1M4KA 5TDPA 5F1NA 5KVGL 4HBCL 3CX5J 1K5NA 3DX7A 5BVPL 1E4KA 4XCCH 2J8UB 2DAVA 1IQDB 1EIBA 2ZG2A 1HHKA 5TQ2H 4PUBH 2Z9TA 3UPCA 4XNMA 1VFBB 4UBDC 3KPSB 3TWCL 2K1MA 5J3HD 1P1ZB 1X5ZA 4CKVX 4C56B 3TBVB 4XZUA 1H3VA 4L3EE 1KNOA 4DEPC 5JXED 4FQPA 1T7WA 2L7UA 4X99A 1T21A 5KJRL 1T20B 4LRIC 3CVHH 4POZD 2ARJB 4UNVA 1J5OH 3K8MA 2MKWA 4G5ZH 4KY1H 4XPFL 5HDLA 5JW5A 2WM0A 2WBJA 5EFIB 2X44D 1O5DT 2HTKC 2ZG3A 5DSCB 1MLBB 5C09E 3D85B 5F1KC 3X3FL 4OCXH 1P4IL 3BKCH 4JG1H 4N90D 4N8CH 4X9HA 5CZXD 4Y4HA 1F3DJ 5AWNH 5HVWA 5L8LB 4Q9RH 2X1OA 2G9HB 1CFQB 2E7LA 1E4XL 4PJ7F 2NY3B 3Q6GH 2K3TA 1CFVL 3PWLB 1H3PH 2YD6A 4XI5D 3WMSA 1UZ8A 1OCWL 2C1PA 4NBZB 3VFVA 4YXLH 3DMMD 4F15C 4ZTOH 5ADOL 1G7JA 4HK3J 3QG7H 5I8OH 5KVDH 5F89A 2DI7A 5DRXB 2GT9B 4LLDB 4PRBB 2CK0L 1I1FA 3BDYH 2P48B 3RWDA 3FONA 2XRAH 3ARDB 1IT9H 2RCSL 3RHWK 2ITDB 3O3BB 1BAFL 4PRPA 5F7DA 4LARH 3WS6A 1FAIL 1DLHB 1QKZH 4I0PB 3RPKA 1LDPL 4EUPA 5J3HC 1PYWA 1AE6L 3WKMH 1A3LL 1NLDH 1XGYL 1A7OH 4FQQB 4CVXB 3LS4H 1K4CB 1ZMYA 5DUMH 3RWEA 4GRWB 5GISH 1IGJB 4KJWC 3ECBB 5JXEC 2ZNXA 1OD7A 4LLAA 5KOMC 1KPUB 4ACPA 2HRLA 5FYKU 3VI4E 3M07A 5ACLA 5AAWA 4P9HC 3FQNA 1AQKH 3G9AB 2P8LB 4JN1L 3BSZH 4HAGA 3L3JA 3D3VA 3KYOA 4YH6A 1IGTB 1KB5H 3BZDA 1EEYB 5L0QC 2NLJA 2PYED 2DS4A 5I1DB 4HMDA 1T2QL 2R2EB 4UT9L 4OQTL 1QR1A 4JAMA 4AK1A 3QJHB 1Y0LA 3D18A 1JGEB 3DLQR 3IDGA 3I9GL 4RAUB 2FH6A 3RKDC 2SEBB 4YK4C 1GSMA 3S5LB 1J0KA 3OPZH 1A5FL 4W81A 5IT2L 1MCFA 4U1SB 2NY2B 2VLRB 2XXCB 4WHYH 3EHBD 3DMMC 4OBSA 2Z8SA 4WHYG 2EDYA 2Z0BA 2F5BL 2EXYC 4WV1B 1ZHLB 1RUAL 5DHVB 5I16B 4L4JA 4FZEL 3MA9L 4G6AD 4XPBH 5F7YC 4UV7H 1RHHA 2CKNA 1NAKL 4D9QD 1INQA 1CN4A 2P8PA 4GFTB 3LSOB 3RX7A 1FDLH 4U7MA 3FT2B 4IRZL 1OT2A 4MJ5B 4WW2A 2VR4A 4GJTB 4JFHD 2CLVB 2B7DT 3W9DB 1MF2L 2HG5B 5FYLL 5B39A 4HIJB 1T6WA 4E41E 5E70A 4MCYA 1OTSC 4YXHL 3QEGL 1Q0YH 3TIDA 4KMLB 3MRHA 1DE4A 3SOBL 1P7QD 5C0CA 2D0FA 5DZLA 1SEQL 4UTAL 3VFNB 3P4LA 5SX4I 1ACYL 2GTZB 3IS0X 4NWTL 3QA3B 1J05B 2CH8A 4Y4HD 3ZSSA 3IRPX 3ZDXF 2NY6C 1INEH 5CINH 1PLGL 3PHQB 2EKSB 1KCVH 5EZJA 4GKSA 3EUUA 2J1KA 1V05A 4RFNB 2ITCA 5K33A 3EZJB 3I6GA 1U6AH 2V5YA 5D7KE 2DIBA 5E56A 3ZDYE 3PNWB 4XBEH 3SQOL 1V3LA 2BVEA 5FECA 2W1NA 3MTRA 1BOGA 1CICB 3KLAB 5H2BB 3SGJC 2R39A 1U36A 5IFHL 2JJVA 2AJVH 1QQDB 5IHUL 3EHBC 5KS9F 2AJXL 4BSJA 4XX1E 3VMOA 3WE6A 1R24A 1WUNT 1VERA 1QTYT 3CSBA 5FGCE 1RVFH 4OLUH 4I4WA 2IGFH 4RMQA 5EO9A 1FVDB 2OR7A 4HUNB 3V4UH 4TYUA 4IOSD 3CFKA 4J6RL 1L7TL 2CRIA 3ALXA 3CC5A 3VRJB 1YUHB 2NY7L 2JELL 2IANB 1IAMA 3WIHH 1V7MH 3QDJA 5BO1H 1D5XB 1WC7A 3EYVB 4Q9CA 5I1IH 4MXWL 3RZWA 3GZKA 1D6VL 1F45A 1NGXA 4KKCC 3L6FA 2KUTA 3MZGB 4PGEB 5KVFL 3BP7B 4N0UE 4X7SL 1QSFE 3P9LB 4G9FD 5DRWB 2CR3A 3GMMA 3UYOD 1XGTA 4KKNA 4PJEF 3EYUH 5D1XD 4ZAKA 5J6GA 1CBVL 3B3IB 4LSQL 3OAUH 4QHUB 1UENA 3HG1A 1X5JA 4Y19E 4U1GB 1PZUB 1FSKB 5IBTH 4S1QL 1CT8A 1HHHB 1Y18B 3AMKA 3QQ3B 2F8XC 1BX2A 3C60B 5HYSB 4R2GB 1PY9A 1FJ1B 4GQPH 1FORL 3DV6A 3E6FA 3V52H 3QIUD 2NXYB 4HS3A 3R1GH 2ZUVA 3OKKA 1IAOB 1BFTA 3CD4A 5IGXH 3RWFB 2CMRL 3UC0L 4UT6L 3VXUA 2VXQL 1D5MB 3IU4H 4YAQA 4ZUTA 4R3SA 5BVPH 2XKNA 5I0ZA 1IARB 5JHLL 2FECI 1H9VA 2RJMA 1DBAL 3U4BL 1AXIB 1AIFA 1GOGA 3OWEA 3FQXB 4OZGA 3TH3T 4GT7A 1CXHA 3QP3A 3PL6A 5A43C 3WUWA 4G42A 5I1KL 1T7VA 5FGBA 4P4RB 3EOTL 4UB0H 3TO2A 1JZ3A 4AEIH 3H9SB 1MAKA 3MRLA 4PJHF 5C0AE 3WFZA 1QBLH 4NKIH 4XP9L 5I2IA 3GEWB 4QEGA 2H1PL 3BHBA 1BQHB 1JNNH 2EDJA 1RZJC 2EH8L 3QNXB 3X17A 3BP4B 3O3DB 4L29A 5K9OB 5KJRH 4UDTA 3MLPA 1I8KB 1MCWW 2OTPA 5DDHB 4H25B 3RVXC 4BZ2H 1XGUA 4NQEB 4XPFH 3QRGL 3QB7C 3MRFA 4G80A 1CF8H 3GNML 4H0HB 2YC1B 5D1XC 4LSTL 3X3FH 1Q9WA 4PJ7B 3BGMA 1JN6A 2B2XL 3C8DA 1FZJB 3MREB 1G9MC 5CJOH 3ZKMC 4GSDL 5I18L 2CKBB 4QO1A 3HC4L 1ZGLM 1E4XH 3MGOB 5ERWB 3QUXB 3FQTB 3C9NA 4XP6H 1Z6JT 1I9JL 5CCKL 3QIUC 4JJ5B 5EZLA 1OCWH 2BXZA 4PP1D 3RA7H 3ROLB 2E9JA 3LEXB 3VFPB 1HKLH 4LPTA 5D71H 5ADOH 1CL7I 3BXNA 1PZ5A 4ZO7A 1PKOA 4QRSA 5C0JB 3IDUA 5E8PB 2CK0H 5T3ZE 3AUVA 1H3GA 1H8SA 3W2DH 3QDJD 1MUJA 3ZE0E 1GHFH 1WBZA 3DUUA 2Z35B 5GQBA 1A9EA 2NX5D 3IDNB 1CI5A 2QSVA 1FAIH 2DD8L 1DBKL 1M6OB 5C3TA 5JIPA 1LDPH 1T1WA 4XCNB 4JO2H 1AE6H 1A3LH 1CU4H 3HS0A 2HWZL 3C8KB 3O81A 2APBA 2GY5A 3LDBC 1IVLA 1U92A 4ZAKD 5F6HI 5BS0D 3ETBF 3WNNA 5ITFA 4I8DA 4Z0BH 2MQCA 5IEKA 5TE6L 1LP9E 3HG1D 3U79A 1BIHA 1SJEB 2YD5A 1CDCA 1JZ7A 4GKZB 4FFZL 1JUFA 5GS3A 3ARUA 3DGGA 5DMKB 3SKJL 4KJQD 4GW1A 5FFLA 4X5WB 3C5SB 3TZVA 1T2QH 4UT9H 1UADC 3L5XL 4OQTH 3MLYL 4OZHF 4R0LB 1AI1H 5E2WH 1HHJA 3NN8B 1AGCA 3WIFA 4DCQB 4ETQB 4YHIB 2NXZD 2AXGB 3KG5A 2OTUB 3P9WB 4ETYA 1EEUA 1X6NA 2IG2L 5IT2H 1GIGL 1MCIA 3C09C 1EV2E 4ISVB 2XTJB 4MA1C 4B7LA 3BPCA 1EK3A 3GSVB 4U0RC 2BVOA 1V7NL 4LGPB 5DRNA 4WNQB 4KC3B 1KXVC 1RUAH 4NQCA 4OSUL 3V79C 1K8DA 1XH3B 5TPWL 1G1YA 4BH8B 1WFTA 5J1TC 3NFPB 3N1MC 4L9LB 3OAZH 4WO4C 1D3CA 1RZFL 3OXRA 3ZT7A 1YA5A 4OUUA 2VDNH 1AXSB 1MF2H 4NKMA 4D8PB 1NCDL 3DUSB 2J4WL 2OZ4A 4PJAA 4YXHH 2CDFA 3IAGC 1GZPA 1UA6H 3SOBH 2H32H 4Z5RA 4U49A 1XF4B 2GUOA 3KPMA 4PBWD 1ZHKA 3JZ7A 1SEQH 2DTML 1MQKL 2R0WH 4UTAH 3AS0A 2W65B 1RIVL 1XR8A 2PO6A 4NWTH 1IE5A 3BWAA 1F3JA 4JZOA 4H1LA 5ABDE 3K1KC 1A6TB 2HVJA 4F7MA 3GRWH 2WINA 1PLGH 3QEHA 5DEFA 3CFEA 5IIEA 4HD9A 4YPGB 4PIRF 4GAFB 4C54A 4OIIL 4UQ3B 4PGDA 4LSRL 1T0MA 5HHXL 4YJZL 3RTQA 2H2PD 1YN6B 2ADJB 4LNRB 3SO3C 1XZ0A 1GAFL 3O3UN 4NN5B 3JWDH 4F7CB 1NCCH 4BQBA 5KS9B 5F6IB 3ES6B 1IQWL 3GO1L 5FOJA 5D7JD 3ARFA 1A0QL 1L6ZA 5IFHH 1QSZA 2EIBA 4DKAA 5HGDA 2IBBA 3NABL 4DVRL 1CL7L 4PGCB 1INDL 2N7AA 4FTVB 2Q86B 4W4OC 5I1EL 4YXKL 1S7QA 3MJ9A 3PWPB 5D2NB 3BZFB 2VE6A 3D87B 1YZZA 4YFEA 4Q9QH 4J6RH 1FZKA 3EYOB 1QHOA 4DN4L 5FEBA 4IIQC 2JELH 5JHDA 4ZNEA 5JDSA 3T8XA 4AIZA 3A6CL 3VWJA 3HE6C 2BSSA 4Z7UB 2X9YA 5IW1B 4YC2B 4KRNA 4PJEB 1W72B 3KYNA 1JF5A 3G6AB 2ZOKB 3QUYB 4JO4L 4ODHH 2Y23A 3GHEH 2R0LL 3HLAA 2ZPKL 4FQCL 3HR5A 1AY1H 4X7FC 4U7SA 2DDQL 2H9GA 3O4LA 3GBNL 2VIRA 4JPVH 4UAOB 3G9VA 4S1QH 3SDCB 4JB9L 3H9YA 4HJGB 8CGTA 1FORH 1UKQA 2XNAA 3DSFL 3QXDB 2Y1VA 2XN9A 4ZMAT 2YPKB 5DD1L 4H26B 4I18A 4NQDE 4PJIF 3ARZA 5IF0A 3IYLW 2YUWA 4L1HA 1NUDA 2D7TL 2VMFA 4NQCD 4P3DA 5D7JC 3LH2L 5H35A 2VXQH 4X6DF 2FJHB 4FXGB 4X6BB 1I8LC 4WIQA 1T83C 1QBMH 3U4BH 5ALCL 5EIQA 3MBEB 3MGTA 1P6FA 1MFNA 1Z0MA 3BPOB 4PJHB 3V0WH 3VFSA 3MX0A 4TOYH 3MJ7A 3O6LL 1JHTB 3DI3B 3HZMA 3KPTA 3TJEH 5I1KH 4NSKB 4FRWA 3EOTH 4G6KH 3W11D 2DL9A 5HI5C 3K4AA 5HYJE 4CU7A 1RZKH 2PO6D 3BJLA 4XP9H 5EOCH 5HGAA 3SKOA 1JRHI 3IJHA 1YECL 2H1PH 2OL3H 2F54E 2Y36L 3KDMA 4U0QB 2EH8H 5CGTA 2HJLB 3B83A 4LHUG 4QGTA 4YDJA 1H8OA 5F88A 4MA3A 1SJVA 3GSRB 5ANMA 1UM5H 4HWBA 2AABL 1MCBA 3RVUD 3O6FB 3QRGH 1T22A 4PR5B 5SX4H 3U0WL 4U1IB 3GNMH 4KRMB 4K9EL 4HCRH 1KTLB 4X8JB 1UWEH 4PJ9C 3MR9A 4UIMB 2B2XH 1NAMB 4WY7H 3MV9E 1ETZA 5I18H 4J3SA 3HC4H 1U8LB 2R29L 3QNZB 1JPST 1X4XA 1FO0H 3ARFD 2CIIB 4CBPA 3HE7B 1CD9B 4P2QE 3NCEB 1TNNA 3HPJB 1N0XL 4R90H 2EDQA 2VUYA 4ONFL 4PYHA 5IESH 3BP5B 3G6JF 5M7QA 1OVZA 1JF1B 5J11B 3EBAA 4AENA 5JHDD 3HZVB 3B9AA 3V5KA 5CHNA 1NMBH 3STZA 4R7NA 4JN2A 4LCWB 1I75A 3TP4A 5JOEA 1ZHNB 2DD8H 5D7LA 4Q2ZA 1G6RB 4J8RB 4Y4FC 4Z7OF 1JZ2A 1LD9A 2ADIA 4JRXA 4R6UA 2Y06H 1RAMA 2WIMA 2DWDB 1AFVH 5D72H 2F58L 3LMJL 1NSNL 5D1ZA 1U8PB 3UROR 1D9KA 2EEAA 4NC2B 4XMKL 3RNQA 5TE6H 1JE6A 5EC1B 5L2KA 3VFOB 4ZUWB 4ZOEA 1PKQE 3EDDA 2XACC 4R4FL 2AV1B 4LVNC 4ERSL 2ICWA 5ID1A 2QV2A 1YPZF 3Q3GB 4FFZH 1B6DA 4OZHB 3V4VH 1ES0A 3F7VB 4O02L 4XVUC 5I8KH 3STLA 3T08A 4EBQL 3DXAD 3VXNB 1G7HA 3L5XH 1S9KC 4MQXC 5SWSE 1HH9A 1EDQA 4C83A 5E5MB 3FOLA 5MHSE 3F7QA 1UG9A 1RZ8B 1U8OA 3T0WA 1NGPH 1MCQA 1EHXA 2P7TB 2IG2H 3UTSE 6CGTA 1GIGH 5CFHA 3VJ6A 4HH9A 4J4PA 1U58A 3VXPA 1O7VA 1QFWI 5JA9A 3GGWB 4OSUH 5TPWH 3IDIA 2R23B 4Q6YA 2EYRB 1KPRB 1G7MB 1TQBB 4XBPB 4JFPB 1RZFH 2DQDH 5HGGS 5KG9B 2BCKA 2X4SB 1EERB 4KDVA 1NCDH 2J4WH 1KN4H 1DUZA 5F7WC 3SQBA 5DTFA 1W8NA 2EKJA 4JANB 1U8IB 5EUOF 4K2UL 5JXAL 2Y25A 1JRHL 4Y5XC 4I3SL 2DTMH 1MQKH 1YY8A 1RIVH 5JIKA 3P9MA 3H42L 1P7KB 5D5ME 4DKDC 2PKDA 2R15A 3VRLE 3KNBB 4U1HB 2WUBL 4LKXB 4PJ5A 1GZQA 5D9SB 3B5HA 5LAXB 4JFEA 5EUKA 2DTSA 3T0EA 4PRHA 3DVNA 4N5ED 1U42A 3KPLB 2NTFA 4WFED 2D7NA 1FG2B 3UTPE 5HHXH 3NCMA 4V1DA 4ZO6A 1A3QA 32C2B 1GAFH 1JGVH 3MNVB 2NNAA 4PJXE 4HT1L 1IQWH 5D7IA 4AM0B 2FB4L 4JQVC 4MJIA 3RRQA 1U41A 1A1MB 2H26A 1U3HA 3NABH 3FCTB 4DVRH 1S78D 1INDH 1CS6A 1NEZG 3D39B 2PXYD 4HXBL 3U1SL 3V5HB 1IAII 2QR0B 5JOFA 2YXFA 5KSVB 2IFGA 3WL9A 1HSBA 4DN4H 3E6HA 3LN5A 4K71C 5FV1L 5D1ZD 2KL6A 2WIIB 5GJSL 2NW3A 1D9KD 4X6CE 1C7TA 3ZTNL 1MVUB 1N6QH 3A6CH 4OGYL 4PJ8B 2QQKH 3ME0A 3MQIA 4MNQB 5L2KD 3P4OA 1GCFA 1OF2B 3ARBA 4BQCA 5FUCC 4XHQA 3IDJA 1YN7A 1NCBL 3HUJA 4QHMA 5EA0L 2W9LA 5BJTA 1I7ZB 2A83B 3GIZH 3LOWA 4FFWD 4JO4H 3H7LA 4BH7B 2R0LH 2ZPKH 4FQCH 1Q8MA 1R5VA 4DKFL 5EO1B 4PRIA 2XFXA 4ZYKA 5AG9A 3GBNH 1KJ2B 3D6GA 4FFVC 4QF1A 4N5EC 1TVHA 4QHLA 4YDLB 4PJIB 4JB9H 3W5NA 1QLRA 1DEEB 4J4PD 1VESA 1RZGB 5CILH 4RMSA 2H3NB 5C0BE 4X6DB 1WICA 1F6AB 2D7TH 2GQHA 5ESQA 1JP5A 1YY9C 2VAJA 4M7LH 5EU3B 3T4YA 2F53A 1OGTB 3LH2H 5HI3D 4AL8L 4FNLL 2RHEA 4HUUA 4I5BA 4RX4D 4KZEL 5DUPH 1QSEE 2X4QB 1S78C 5LCVH 1QFWL 1NBZB 3PV6B 3VFRA 4LMQI 5C0NC 4X80L 5ALCH 2PXYC 2Y5EA 3X14A 2Y07L 3IVKB 2I07B 4MX7A 1GGCL 3GBLA 5HHNA 1WCBA 4Z7NF 1UJ3A 1OM3L 3O6LH 4MSWA 1UB5A 5AYUL 4YBQD 2BNRE 5EPMA 5I9QC 3VXSE 4U2YA 1DSFL 3TA3C 4MDIB 3P11L 5J1AA 5E6ZA 4Y1AE 5C0EA 5DWUL 2HYMA 1C16B 4LLQA 3IFLL 5KAQG 3L3DB 1MH5A 1YMME 1NUGA 4KQ3L 4JFED 5EIIA 4I77L 3T0ED 4PV8B 4PRHD 2P5WE 5HHOB 3RWJA 2GITB 3SDXA 1JMZA 4FFWC 4K9EH 3AXLB 1HE7A 1X5FA 4V1DD 2GCYA 4O2FA 3DX6B 2CR6A 3PWUA 5INDA 3VXRD 1GJIA 4WEMB 2D7OA 5MENB 1F3RB 2P8MB 2R29H 3SE4A 1ZHBA 3SDDB 2FJGB 3BYYA 4M3JA 3KPRB 3SPVA 4JRWA 3IFOA 3NCYS 1E0OB 1S7XB 3FAWA 4LLUA 2VXUL 1N0XH 1TETL 4IRSA 3VWKA 1W8OA 5TE4L 4UQ2A 4IRJB 4LCCB 1NKRA 2ZCHH 3VXMB 4IOFD 2LVCA 3PGCA 2Q1EA 1HQRA 5J8OA 4CU6A 2X70A 1OQOA 3MROB 4BSVB 5GS0L 1UB6B 1VGKB 4JKLA 1J0HA 1QRNE 3H8NA 1VGEH 1DBMH 2D4FA 5J6HB 4UT7L 2HRPL 5H94A 3RL2B 4NM4H 1NGZB 3BUYA 1IAIL 4XNUL 2C9AA 4DJMA 5JLZB 3MV7B 3PV7A 2GFBA 3SJVB 3ARBD 1JPGB 4LVHB 4MCZB 4YBQC 3LKNB 2BOCB 1AD0A 1XGPA 1RSFA 5T1MA 3FO1A 2Q8AL 2N56A 5MEQB 3LMJH 4MVBD 1NSNH 4NN7C 5FO8A 2N7BA 4XMKH 4PRNA 3UYRH 4PRID 1CGSL 2GJ6A 1YPZB 4OFIA 4QY8B 1JZ4A 4NZRL 3P73B 4ERSH 1X5HA 2CD0A 2MQ3A 5IVNA 3FQRB 5B3JF 1EVTC 1JPFA 3RX5A 1OTTD 4TUOB 4C56E 1OGAE 3DRQB 3C5ZA 2XQYK 4IS6B 4PY8I 4K94L 4U33A 3WFEL 3MRNB 4OV5B 3MRKB 2PCPB 3VGHA 5KANI 3OAYK 4U6YB 2DQUL 3CH8A 5IHLB 1R0AL 2Z92B 3OJVC 2PR4L 2YZ1A 4HUXB 4NC0B 2FR4A 4CMHB 1QEWA 3KR3H 4J3OC 1LO2L 3BN3B 4EN3A 1T5XA 4FABL 1J11A 5FYJD 1KCUL 3CXHJ 1JNHA 3CFJB 3MYJB 3A6OA 4GG6A 3TVMB 1XIWB 3RWHA 1A6WL 1JK8A 3NIGF 1F4XL 2Z31A 1IEAA 5I8CA 4Y5YC 5AZ2L 1JTTA 1MJJB 5T1DH 5EUOB 4KK9D 3L3HA 4UINH 2HFEA 5CWSB 2NY4C 3SY0A 5JO5B 2EIZB 4LPCA 3AGVA 4QRUB 1KENH 4ZFFA 1LO4L 3G6DL 3QZWB 4LOUD 3QIWC 3QFDA 5GS1C 2IH1A 3DBXA 4K2UH 1JRHH 1QHPA 1BZQK 3IFNL 4MVBC 3KWWB 4PFEA 3JV4B 5FA3A 3ZYOA 2FJFA 2UWEE 4TTDD 3H42H 4HLZH 2IC2A 5I1GH 4M4PA 3SBWA 1WGOA 1XF2B 4HLZG 4P46A 4HWZB 4TULL 4JHWL 4HX1A 4HS8H 2NY0B 5KN5B 1RJZB 4YO0A 5ISZA 4XP4L 1OTTC 3ZT5A 4KVNL 4D2NA 5LKNA 3Q5TA 4IRSD 1UH2A 1ZVSB 3SO5A 3VXOB 3C6LD 3ZYJA 3MRJB 3EO9H 1N5AA 3BDXA 5C6TL 4HT1H 4WCYL 4PG9A 1NL0L 2Z91A 3F12A 1U8JB 2A6JB 4GAJL 2IALA 4QOKB 1X6LA 1OW0C 1ZGLA 1M7DA 5HPMB 3U1SH 4DZ8B 1MWAL 1RJYB 5KSAC 3RY6A 2H8PB 2V7HA 4HK0A 1S7SA 3MMEB 5CKAA 5GJSH 2AK4B 4KK9C 4CMMB 4JHAH 3ZTNH 4ZXBA 1ZSDB 2VLRE 3RUGE 2B8OT 4OGYH 2GJ6D 2JJWA 3T1WA 4LOUC 1I3UA 3O45B 1BBDL 1IBGH 4P5TA 4WTZA 3HC3L 5T1LA 3FO0H 1T5WA 4MMXC 4CN4A 5JW4N 3FMGL 4N0FB 4L8DB 4ZS6D 5KOVC 5GGQL 1YQVH 4WW2F 4YPJA 3HI5L 3WJLC 3C5ZD 2P5ED 4NO0A 3L3IB 1JGDA 2X4RA 5C7XL 4JZJA 4DKFH 4YHKL 3BD3A 4RDQG 3TBTA 4OCRL 4RZCA 1FV1B 1KCSL 3SKMB 1R5IA 2PW2B 1EAPA 4OI9A 1HXMA 4P2OC 5DFTA 1QNZL 4PJFA 2ZCLL 4R4BB 1NDMA 3C6LC 4O00A 4FQ1L 4MQ7B 1EHNA 1WEJL 2ICWJ 3WFDL 5DJ6B 3H0TA 1UYWH 1I1AA 1FRGH 1KLGB 5I76A 1U8QA 2Z31D 3O2WH 5CD5D 4AL8H 3WJJA 4FNLH 4NHCL 4KZEH 2RBLA 5KSBA 2P42B 3ZKXC 5J56B 2MWCA 3HNTH 1QFWH 3CK0L 3DSNA 1UFUA 2OM5A 2AXFB 5JQ6L 2M2DA 3KAAA 4UV4L 5DHYB 1GGCH 1XGQB 5K9QG 4PS4L 4G6JL 2UY6A 1C08B 2VLKA 5AYUH 1A3RL 4FHBD 4FQHA 2R2HB 1B0GB 4OCNC 2GY7B 3P11H 2XIDA 4LHUA 3BAEH 1A9BB 5DWUH 2OJEA 3IFLH 2ADFL 2EDEA 3TNMB 4KQ3H 2QHLA 4NOFA 4I77H 4HKXB 4U1LA 2IQAA 3HAEG 4M4RA 1XAUA 4OLYH 5C08A 4ZS6C 2FGWL 4F57L 43C9A 5ISZD 1S7RA 5EDXA 1QLEH 1ITCA 5ADPL 3VFMA 1U93B 1BD2A 3EJYC 5FGRA 3MOAH 3PGDA 5C92A 2E8ZA 1NCAH 4APQA 1EEZB 1QO3A 4ODUB 5ESVB 2IANE 5A2KH 1J8HD 4G6ML 4N8PA 4Z0XB 3JTTA 3MLRL 4QTHB 4ZD3H 1KJMB 5IVXA 3V6OE 4B53A 1BZ7A 2VL5B 2HFFA 5C0IA 4QRTA 2JB5L