2WJ7A

Human alphab crystallin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CRYSTALLIN B CHAIN
publication title Crystal Structures of Alpha-Crystallin Domain Dimers of Alphab-Crystallin and Hsp20.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 13
structure length 85
sequence length 85
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wj7A00
4JUSA 2JKIS 2WJ7A 4YE0A 4ZJ9A 1SHSA 4ELDA 1GMEA 2K8QA 4FEIA 4YLCA 4JUTA 3VQLA 2CG9X 1EJFA 3W1ZA 2BOLA 1X5MA 1RL1A 4M5TA 3IGFA 2Y1ZA 4RZKA 2KMWA 3L1FA 4MJHA 3GUFA 3QORD 4PCKA 4YLBA 5DS1A 5DS2A 2N3JA 1WGVA 2Y1YA 2CR0A 3AABA 2WJ5A 3Q9QA 3QORB 4YDZA 3Q9PA 3L1EA 4PBDA 3AACA 3N3EA 3QORA 2MNWA 2KLRA 2RH0A 2N0KA 3EUDA 3J07A 4M5SA 1WH0A 3GT6A 4I88A 4YL9A 2Y22A 3GLAA 1WFIA 3L1GA 3QORC 5LUMA 2XCMC 3VQMA 2O30A
chains in the Genus database with same CATH superfamily
3DTXA 4UT9A 4HFUH 5DMJB 1TT6A 2E46A 2WV3A 3GSXA 2F58H 1UOWA 3TEWA 2OP4H 5T1KD 3W1ZA 3GI8L 3N41B 3H6AA 4O02A 4L4TE 1D5IH 1C8PA 1Z7JA 1FFOB 3P3SA 4L3CA 4YFLF 1RU9H 25C8L 1MUJA 3LB6D 4F9PC 5HI5C 2ZUVA 1UTDA 4JE0A 3FUKA 3UGEA 3KYMA 2BS9A 3FTUA 4JRYD 2C9XA 3IDNB 4OLYH 3DETD 1UZ8A 4MS8C 5D1ZD 1GHFH 1HHKB 3RWIA 3VJ6B 3QEUB 1NFDE 4HC1A 3HE6B 4HUVA 2QGCA 3H7BA 4IS6B 4ZD3L 1S5HB 2C9SA 1R3IL 2AJZA 3ARGC 1ZDQA 2RB8A 3MRGA 1JRHI 3PHAA 5H4ZA 2B8OT 2CUMA 1IAII 4PJEE 2YEZB 5C08A 3UJTL 1E42A 1OEZW 3GXIA 3E1F1 3L4TA 4KKAC 3ZHDA 3QCUL 3RU8L 2JJTA 3TBWB 3G9VA 1LO0L 1LO5A 3QS2A 4KMLB 1WV7T 2IBZY 4LCCA 2HT4D 1FLTX 3QJOA 4HZLB 4GKZA 5F7DB 4ODTL 1UGKA 2BVYA 1F6AB 1R5VA 1XMWA 4H0HB 2JB6A 3KHOA 5C92A 4N8VA 3V5DA 3SN6N 2X87A 4MB3A 1JGEB 4WUUB 2O5ZH 3AY4C 3B9KC 3UC0H 1DVXA 3OG4B 1LM8V 1WCBA 5FGBC 4PJGB 4UM9B 1JXKA 4GQQA 4N2LA 4EN3C 4L5FE 3MR9A 4L4VA 1E6JH 1MNNA 4NHCL 3MO1B 4NT6A 5E24E 2ZCKL 1A4JB 1GW6A 2J88H 2DTML 2YD9A 1DJIA 3BW9A 4JE4B 4M62H 2YD2A 1NFAA 2FQFA 1U91B 4TUJB 4U1KB 3L13A 5IQ7H 5F7AA 1DUZA 3S88L 4LHUD 3U4AA 3SDXF 3IXAB 1MHPL 2GI0A 1U8MA 3QORC 2EXSA 1ZGLM 1F1DA 1SYSB 2EDWA 3CFCL 3FUMA 1G7MA 5KYYB 1G87A 5FYJL 5BS0D 1OCZB 6FABL 3T0XA 1ZT1B 1E9OA 3D3VB 4TVPE 1AXSA 3A6BH 4ZMQA 4XC3H 3X1FA 1MCJA 3ARXA 1FZJB 3MNWB 4NQCE 4FKHA 5FYKH 5FECA 3HG1D 3REVA 4QXGH 4QHKI 1XH1A 4J6RL 3ASNB 4BZYA 4KKLD 3T0BA 2GJ6D 1PG7L 1GS8A 3IRCA 4AEHH 5HHVL 3SGEI 2DTSA 4L37A 4R4BA 4MNQD 4IBQA 4P49A 1LDPH 4GAJL 4N90D 1RFDL 5AAMA 2OXHA 3GRBA 4F7MA 4NGHL 4Q9RL 4OCSL 1KEML 1NGZB 2ZSWB 3J7HA 3LKOA 4LFHG 1D6EA 3QDMA 5KSBB 1LK2B 1RZGA 5IEKB 4AE1A 3DJZA 4ATTA 2IQ9H 3ARDB 2IANB 1NGXB 3UBXB 4JDEB 5IVOA 4R97C 2X0VA 3QZMA 4PV1C 5H2BB 3ZHFA 4KJYB 4RVBA 1WYJA 1T0MB 3SO3C 1NCWH 3WY3A 1YEDB 3UYRL 2HLFC 3GRGA 4G8FA 4ELKB 4ZFFA 2E7LA 3CD4A 3SCMD 3OZ9L 1CLCA 1J8KA 1RUMH 5KN5B 3D85A 4ZNCD 3UIYA 1ONQA 5AZEH 3D69B 4AYID 4K55A 3EFDL 4JFZH 5CO1A 5CS7A 5ISZE 1XWVA 1U8OB 2NT1A 3HPJA 4I1NB 4BGDA 5CCJA 2CA4A 2NYZA 3WDJA 1K3ZA 4TQ8A 1EERB 1U8KA 4ZUTB 3T3PF 3KLAA 4R7VA 2AVGA 2B2XH 3VYOA 5FGSA 4AEIL 4KKCD 3CVBA 2BC4A 4OI7A 2EDFA 4BA0A 1XIWD 2JELH 3DECA 4M1GH 2OMVA 3VW3L 3BVXA 3UDWC 2VDML 3OLGA 4JM2A 4PSPA 3T5WA 1NWPA 1KIRB 3WNLA 1R3KB 4XXWA 5T1DH 1J87A 2ADFH 4AQ1C 2WCSA 4QWWD 1NCJA 4HJIA 1SEQL 2QQKH 4LB8A 3MRQB 3ARBB 3KVDD 4M3HA 4L8SB 1NSNL 4DHLA 4QRRA 3HRPA 3ZHNA 3MYJA 3SHSA 3UJJH 2XPGA 3BKYL 2D31B 4QT5B 3AS0A 4JFDA 3QT2A 32C2A 1A7QH 4YO0A 3LD8B 4Z7OB 5LCVH 1MFCH 2A73A 4J3SA 3LNGA 5CEYA 1PZ3A 1WZKA 4I0PA 4WW1B 5CHNA 1AHWC 4XMKH 3PQYB 1OM9A 1T2JA 4QRRE 5CEZD 2Q7NA 4O9HH 4A7UA 4OLWL 1J5OL 3NFNA 3OXRA 4G42A 4M3JA 3PDOB 3T4AB 5T1MB 4JFDE 5IZ7A 3PNWA 4L4TD 1GMIA 3QNXA 1EEZB 4J8RB 5D7SL 5IW6A 4FRWA 2VDPH 1NKGA 3LN9A 3TESA 3ALPA 4GMSL 4CMHB 5CJ8A 4JGMA 2PMZA 1MAJA 3DVNB 4KK8D 3T8VA 1ZSHA 3QHZH 3UG4A 1CMOA 3JXAA 3S3JA 1E50A 3Q2LA 4NSKA 4LE8A 3DX6A 3QFGA 4M5YH 1NM4A 4GKSB 4JQXC 2X4SB 1S7VB 1PQZB 5CKGA 4IJTA 5FA3B 5DD6B 1RIVH 4DGIH 5I16B 1YPZE 5I8EA 1BQHG 1OALA 4W9JC 1ZLWK 2NNCA 4RMRA 1EJFA 2EVHA 1N6QH 4IEFA 4FG4A 2ADJB 3SYOA 3IFLL 3WHXB 3LJ3A 3HW7A 4TL5A 3L95B 1UD5A 4JR9L 3RDTB 3WFEL 4P23D 2X12A 3VGHA 2FE0A 4DPAX 3GI9L 1M1SA 3EOAB 4K5LA 2V4LA 2YZ8A 3GXNA 2BSDA 3N41F 3K6OA 3HI1B 3JV6A 2H0FA 3QH3A 2Z93A 3TIEB 1TEGA 4JKMA 3X11A 2EIZB 3IN2A 1ACCA 3QEQB 1R1CA 1KJVA 3BLPX 1K9TA 5C08D 1KENH 5JW4N 2IGLA 2XWXA 2ZKYA 2QQQA 4F2FA 3L1OH 4IDJL 4LT7A 4P4KA 1S7XA 3OXSA 3WY2A 2ITCA 3AMKA 3HJ0A 5D6DA 1MEXH 3ISWA 4PD4J 1GGIH 1UM6H 3G6DL 2J8UB 2J12B 2LR4A 4H5SB 3NK4A 4PQXA 4DPCX 3R1GH 3R18A 5BJTB 4XP1L 4M00A 4IRSB 3ROOB 4K7PH 4YSUA 4PRNB 4WNQA 1T0PB 1QA9A 5DZOA 4L4VD 4YS4A 1IBGH 2YPKA 4JB9H 5F6HJ 3JUYA 4OCRL 1OP3H 5DUPH 4MA3B 2OMUA 3IMSA 2XQYA 5DHYB 4G8EA 4F92B 2WP3T 3FB5A 5I8OL 1HHGB 4GRWE 3WAJA 4U1IA 3NCBB 4GXVH 2ZX7A 3N1MC 4MKTA 1TCMA 4PJGF 1HNYA 1HNGA 5TH2B 2PW2A 2APVA 3F7PC 2XPZA 2R0KH 3SY0B 2FSEA 5HVWA 4LKXB 1ASPA 2MNUA 5DC4B 4JZNB 4O5LH 1BECA 1I8MA 4WTZG 1E4KA 1DTUA 1I8LC 3DXAE 3IDYC 3WEMA 3L4VA 4Q6IA 2NY1C 1IC5L 2CBTA 5E5LA 2BZ7A 3DX4A 4N2OA 4PY8J 1F3DH 4CKVX 1XF5B 4DVRH 4PI0A 2AMGA 3ILQC 3PWVB 4HWBH 4IIZA 1G7JA 4U1HA 5E8DH 5I6KA 5SX5K 2P47B 1WDAA 2ZQKA 4IHOA 1R3LB 3QDMD 1HHHB 4P8QA 5J8OA 4P3CL 4X4ME 1KIPB 2RD0A 2OR8A 3FN9A 4POZC 2FATH 2IV8A 2ADGA 2AKRB 4QCIB 1U3NA 4MMXA 1TPXC 2DKSA 2GT9B 2EDXA 4TLSA 3FQXA 2FNBA 2R0ZH 1Q90A 2O6FA 1NWOA 3D85D 4WV1B 1U8JB 1G6RB 5KSBF 5IF0B 2E7CA 4WCYL 3V79C 5FCUH 1REIA 2P5WB 3TNNB 3LN5B 2J43A 4XP6L 1HWHB 4XMLL 4BZ1L 1S9VB 1SRDA 3JTTA 3QFJE 1UB5B 3OKYA 4M7LT 3WO4B 4CADA 2WM0A 4HJSA 3FT2B 3IJHA 4A67A 2YPVH 1HCFX 4FFZH 4L4JA 5LNGA 4JM2D 5KZCB 3X13B 3MLYL 4ZO6A 1JXFA 1QSEE 5L7XH 4N68A 1CYGA 2WXPA 1YJDL 2P8PB 3CFMA 3CGTA 4W6WB 4ZMZA 4FQXB 4B9IA 2GTQA 1I7UB 2OFQA 4QRRD 4YFLI 2FLRT 2RA1A 3IGAA 4WSKA 2MKWA 4V11A 1BAGA 4Q8BA 3HHRB 4TNFA 2RHEA 4PJBF 3EW3B 5E2TL 4O2CA 4JFDD 4FYRA 1NDMB 4QKTA 4CW1A 5EC2B 5DHEA 4ZW5A 5I2IB 3D87B 3IB4A 5KVGH 1JPTH 4HSAC 1WAAE 3E38A 5LLIC 5GGUB 3GBLA 4I0PD 5EDXA 4WO4B 2ZF9A 1BQLL 1YAIA 2XG4A 1QRNA 1FNSH 3OR7A 3VNYA 4A68A 5BQ7A 4OZIA 2CO7A 4NDMB 3L1EA 3GSNA 1BQKA 3ET9F 2B20A 4OZFH 4PTUB 3WGUB 3K5SA 1JCVA 3P40A 2CUHA 1NAMH 1ZT7A 3L3GB 5BOPA 2UUDH 2A6KA 3DURB 5C1MB 4MDIA 4Y4KC 1KB5B 4M8QB 1D5ZA 3N91A 4CC4A 2P5PA 4M43L 1DUYB 4H4NA 1JZDC 2A1WH 1Z0NA 2DJMA 4KKNA 5HYJA 1BVLB 3CVIL 4IBVA 4AIZA 1AO7B 5EU5A 4K7PY 3FU0A 3RWFB 4B3VA 5F6IC 4PJDE 1JZIA 1SDAB 2X2YA 1ZMYA 2YAMA 3QJFB 4OZIE 1U4FA 5E9DB 4JFEA 2A99A 2DPKA 4UB0H 4X8CA 5T8IA 3U7YH 3PGFL 4K7FA 4K71B 5CKAA 5IKCA 4PJFB 4P57A 2H45A 4U31A 2BSRA 1OF2B 1JGVL 1XDTT 3SDYH 3T4YB 2DYSB 4YR6B 3U9UA 3PWPB 3PJLA 4OF0A 4YZWA 1YN7A 4B6ZA 4DP8X 4EDXA 1BWMA 1GMEA 3C6LB 1DLHA 3PWJA 4JRLA 5IJVA 2J56A 4LCWA 1KV3A 1ZHKB 3VXMA 5ECGA 5JOFB 1HAWA 1T83C 4DKDC 3LRSA 2CRZA 4JFEE 5F3BB 4U3HA 2HH0H 4XPAH 2F8OA 5CR1A 1K5NA 4MA1C 5T33L 1NBZB 2F5AL 4FXGB 1N19A 2RCSH 4X7CC 5AW8B 5C3TA 4PBDA 3GINA 3H9SE 1FBIL 4YBQC 4LNVA 4AQZA 1U6AH 3RVTD 2C8NA 3MODH 3AMLA 4TLKA 5IBLD 5KS9E 1P4IL 3FT3A 4M3KB 4R0LA 4JLRB 2BOCB 2QBWA 3UAFA 4QI3A 1GY2A 3TT1H 4P4KD 4JY4B 2WZAA 2WB1A 2J1YA 3U6XA 1EHLH 5GISL 4UT6A 3VSUA 1QHQA 4Y2DB 4JVUA 4Z95L 2H2SD 4JANA 5LDSA 5L6YH 3U2SA 5DD1H 1DVFC 4UDTB 1QO3B 4X4XA 4APQB 3PE9A 4AYSA 4B96A 4XOAA 4ANUA 4KZCA 3SE9L 1FVDA 4FKEA 3L5JA 4AYEC 1FFNA 5EEZA 3MREB 5HD8C 1R17A 2HVKA 2E75C 2XN9A 4OKVA 1I8KB 4P2OA 2R4SL 3K72A 5CXPA 4H8WH 3E8UL 5I1HH 3TEYA 1UWGH 3U0PA 5I8KL 2EDYA 3X3FH 4G9FA 3CFQA 1YHPA 2J8UF 4ONGH 4CN1A 5CEXB 4X0KA 1YMMA 2EILB 5GS0D 2YO3A 3IGFA 1DEDA 2DQGL 4P46A 1PSKH 2H9GA 3D25B 2OBGA 3M8OH 3FCGA 4JN1L 1YEHH 2O5XL 3WFDH 1E43A 2AABH 4LRIC 4DW2H 5KVDH 2I5YH 3HBQA 3L54A 3QEGH 2ZAHA 4KJWD 1H8LA 5B1AB 2JXMB 5LBSH 3ZE0E 2KZKA 1EFQA 4IJ3B 4Z7VB 1ZLUK 5HYSA 4HIQA 2CMRH 3FQ2A 3S34L 2RIKA 1YEJL 4XN7A 2IH8A 4F57H 1NINA 5DS8B 5IM7B 1EDQA 4YE4H 4BWTA 2Y1AA 2G60H 4GAAA 4N8UA 1IIKA 2BVOA 1LTXA 4HGKC 4JO4H 4NPYB 3U0WL 3I74A 5LG1A 3OC8A 1AYRA 2RGSA 5FYJU 4MYWB 2CDGB 2QGDA 2FVNA 3LZRA 5KVFH 1JYWA 1XO8A 1AOZA 1I4FA 3V4PA 4I13B 4F7PA 3HLAA 1ZGLA 3K6FA 4HV8A 4KZDH 2ICCA 3O11B 2BS8A 3LKNB 5BO0D 4LCIH 3RX8A 1EZVX 4NQEA 1AIFB 3W0WE 3C5SA 4OLVL 5FR3A 3FXIC 2WWOA 2VMDA 2AS5M 2EUXA 5HI3C 1DCEA 2FNWA 1R46A 5LXGL 2HLEB 1LQBC 3VCLB 1CFSA 3EDKA 5GGTL 3U46A 5DD0H 1GR7A 3S37L 2WXIA 2B0SH 1F6FB 1IGFL 3HNTL 1ZPUA 2BJMH 2XDHA 2P8LA 1HKLH 1RZFH 3DSNB 4MBRA 2ALWA 1WCQA 1VAHA 1MIEL 3BP7B 5AW9B 5GS1B 2CBPA 1HHJB 4WWOA 3MRLA 1MI5B 2YOCA 2GSMB 4U1GB 1GIGL 1BX2B 3P3TA 2X89A 4GLRI 5TE6L 3WHE0 4G8GE 4TULH 4HLEA 4FXKA 5L0QC 2AANA 1E6OH 4B9YA 1TQWA 4JVPA 1QUNA 5CBAB 3EYQD 1HFUA 1TQBB 4HXAH 3HCVA 1EPFA 4HWZB 2XETA 4LPYA 4H8WC 1Z32X 3SPCA 2AQPA 1JZEA 4MMZC 4W9ZA 3CV5A 3V0VB 1A3ZA 3M1CA 4N0YL 1QRND 2Z92B 1L9PA 2YK1L 1TZIB 3GSQB 1I1AA 3ILPA 3EJZD 5HDWA 1HH6B 3E6FA 1GGBL 1L9SA 1F4YL 3N43B 1ZTXH 5F7LB 2DLEA 3R8QA 2NXZD 4A2FA 4DPRA 1X5HA 4A6YB 3WJJC 4TUUA 2E6JA 3I50H 1PF3A 1F4XL 2APFA 4AGLA 2X09A 5HYJD 1T89A 5I1JL 3QIBC 5JHDB 2FZ3B 3OVUB 3K81A 1ZLEA 3BUBA 4BSWB 4GW5A 3U30C 1FGNH 1ROCA 4MD5B 5SX4H 4CN4A 1UFGA 1UYWL 4GAGL 3JBG7 3IAPA 1S9XA 1GZQA 2ADIA 5DGRA 2R69H 2KPWA 4F2ME 2VSMB 2UV3A 2I9LB 2ZUQC 3TO4A 4JFED 4PRDA 5HGAA 2Y6SD 1RPUA 3DO3A 1R47A 3ZR6A 4NNPH 4P5RA 5DK3A 3T6XA 1CL7L 1UADC 5D2NA 4HUMB 2X2HA 5T3XD 2DQ6A 3EADA 4PG9B 4ZS6D 4X7TA 3C08L 3DMMC 1B4TA 4PB0L 4U49A 2QR0B 1JZ4A 2BRRL 5A2AA 1A4CA 1MW0A 4JHUA 1QFHA 4LCWD 1R5IB 3VXMD 4FLQA 2DLIA 1MG3C 4L9LC 3QQ3A 1IKFL 2PXYB 3ULUF 1M3JA 5KVEL 1I9RH 5DK0A 4C4UA 2VAAA 4WI2A 3I6GA 1DFBH 2ISDA 4PJFF 5CSBA 2N56A 3EGXB 3U25A 2JKWA 3OV6A 1UEYA 3R0NA 2WTRA 3FMGL 2IFFH 2F5BH 5FHAL 3GUTA 4HQQL 3DUHA 4J3UA 5IWLA 4UNIA 2ZCHL 4MWFB 4AQAA 4TVPH 4WKXA 3C5ZB 4D0CB 5IT2H 2Q76B 5INDA 2E9BA 3MJ7B 4HXBH 5GS2D 3RY6C 3UJIL 4YEEA 3FT9A 4KH9A 3F7QA 3IPBA 4ZXBB 4DOHE 2PYEE 1NKRA 4NKIH 5F0JB 1TZGL 3H3BC 3S96B 2V7HB 2ENYA 2P48B 1ES0A 3F7VA 4GY4A 4Z7UA 3SDAB 1Q38A 1M1XB 3PGDA 1FZMA 1T1XA 2CH8A 4DAGL 1DL7H 5EBLA 4E42B 1HIML 3SODB 1PDKB 1J0KA 4ZW3A 2N1TE 4PJCA 2XN9D 4P2OD 5FO9A 4Z23A 2CKBL 2CDEA 1IGTA 4NLHA 3AREC 1YYML 3SE3A 5DMKB 4G9FD 3HAEG 2YLKA 3BVDB 4F5CA 5IHLB 3SGKC 1EXUB 1YMMD 2GK0B 3GSVB 4PLJC 5IHWA 4UQ2B 1FIGL 1RKRA 1XD0A 5I71B 3AM8A 5G4NA 3UBXI 4X80H 4G9DA 4PG2C 4NWTH 5TE4L 3HPLB 3WEOA 5D1QE 2GFBA 5LCVA 5JXAL 4JDZB 4OD3L 4Z7QF 4PIBA 4FEMA 2WY3B 4HU8A 2HYMA 3WS6A 1MAKA 1PNDA 2EIKB 2HTKC 5AVSB 3RZCC 3II3A 2FR4A 2X6CA 1QFOA 3PL6B 1F1GA 3RX7A 4FNRA 4XODA 3B9EA 3WV0A 4MX7A 4IBTA 5K69A 4YNYA 3EYSH 3FN0H 3G5XA 3I85A 3O6FA 3SOTA 3B34A 3RAJL 3US0A 5B39G 3OWEA 4U1SB 4XVSH 1BA9A 3N55A 4F33B 4N3UA 1F45A 5J6SA 1BJ1H 1NLBH 1N7ML 4WRLA 1KTLA 2DM2A 5JPMB 2CIKB 3EJUA 4QOKB 2HFEA 2B9AA 3AS1A 4Z7VF 4DK6A 1V55B 2ZCLL 3VFRB 4UYQA 4PVNA 3Q44A 3CU1A 1JGLL 2K3HA 2HFTA 3QB7C 1RZIA 3DROB 2IDCA 4Y1AA 2OI9C 3LPGA 2Q7AA 4ORGA 3BYYA 4HUKB 3I6KB 3U4KA 3EYUL 2YRLA 2XA8H 3JTSB 1KJ2A 1FHGA 4NQED 4KZEH 1IFHL 3T1FA 1KYAA 1U8LB 2VM3A 2JJVA 5AG9A 3PP4H 2FTAA 2Y0SA 4OZHA 5D9SB 4NUJB 2VZSA 1AJ7L 5CEZL 4N85A 5SV4A 1DQKA 1ED3B 1OT1A 5EIVA 2LFGA 4RGMC 3C8HA 2HX8A 4GAFB 1CD9B 1IBYA 4Z0BL 1N8OE 1HE7A 3L3HB 1HXYA 4OH2A 3MRRA 4RNRA 1ND0B 4EIZC 3VXSB 3L5WA 1YMHA 4H20L 3PAVA 3OKKB 2QKIB 2CUIA 3HMXH 2NY6C 3S3CB 4BRJA 4FD0A 3UABA 3IMUA 5CZRA 1WFMA 4X8JB 2XWTA 4TVUA 4YHZH 3D05A 4OZGB 4A2GA 1Z3GH 1FNAA 5DJAB 5ABDE 4HP5A 5F7UA 4N28A 1NGWA 3GMPA 1M2VB 1V3JA 3CPUA 3IK2A 3QUZC 3O3AB 4PLNC 2VDRB 2ZF8A 4HKZB 3GXMA 3QQ9C 5DC0A 4WW2B 3A6OA 4O02L 3FCTA 1OTTD 2WTPA 4WEBL 1AGEA 4QXUL 2F53A 5IK3A 3NESA 4JREB 3ARYA 1ASQA 4X6CA 2FO1A 4NQTA 1B4RA 1KJMA 1NCCL 4TUOB 2OW7A 2C3WA 4H8HA 2DD8L 4P2YA 1AP2B 1CU4H 2J8OA 3KCPB 4YHNB 1I1AD 5IROC 5JW3H 4A55A 1NC2A 2VQ1A 3WD5H 1VEOA 2EO9A 1E40A 3D4YA 35C8H 1RXLA 2XBDA 2F53E 2Z6FA 3QULA 5SWSA 1W0WB 3ZDYE 4PJAB 3LVTA 1TMCB 1DQML 2XIBA 4MJ2A 1PG7W 2VM4A 4FXLA 4JQIH 3ZO9A 5IP4A 4LVOC 2WXFA 4X6DE 5IMMB 1UOKA 5BZZA 3K2UH 4JHVA 4L5FL 4XNBA 2R4RH 2YAEA 2E56A 1A8ZA 3FSAA 3IN0A 4GI9A 3WKQA 4LQ1A 4X4YB 2HAZA 1YG9A 3G04B 2N0KA 3TN0A 4GW4A 4AGOA 3MRFB 4M93B 4I88A 1U3HC 3B4NA 4TPRH 1T1ZA 1PLGH 3N43F 3TO4D 3VFVA 5FYKD 1HSAB 3QG6B 2H6PB 4XXDB 5DQJB 3QAZC 5HGGS 4O4YL 3W9DB 4RMWA 3LRHA 3NA9L 1XSIA 1MCKA 4PGBB 2HKHL 4TRPH 2D3LA 4NENA 2XFGB 3QRGL 2BCKA 2B39A 3CIAA 1BFOA 4HWBA 1H3PH 3TZVA 2Y36H 4Z7WB 4LLUA 5CGYD 5BV7B 1P9MA 2XG5A 1F56A 4RFEB 4JPQA 1IM9B 4WWKC 2PCXA 1KC5H 4FZ8L 2FX8L 1A6UL 4HPHA 5AVXB 1U93B 4WQOA 5JIMA 3E6HB 4ODBD 3GHBH 1OW0A 3H4FA 2AJYL 5I74C 3Q2VA 2FJHB 5D7JC 2FYYB 5IB4B 3DUUB 1JNHB 4EVNB 4BA8A 4P0DA 4UQAA 1YNKL 5GRYA 3NIDB 3PUUA 5I1IL 2AXFB 3CFEA 1KLUB 4GXUN 4P23B 2FX9L 1MW3A 2C5DC 2ZOUA 4FHKA 2HJKA 5EIIA 1JPGA 1TDQA 4HUVB 3H7BB 3KG5A 1JNNH 2AQSA 4NZDA 4I87A 4XN4A 3RNQA 2LU7A 1HQRA 1HCVA 3QPXL 4A66A 1MXDA 2YPVA 4BKTC 4E0RA 3MRGB 4FFZA 2V2TB 4PB9L 4XNQB 1W72H 3CVHB 3MZGB 3QDGA 2R0LL 3U2JA 2BVQA 1MJJB 3QFDA 4M9OA 3MV7A 5AUMB 1LO2H 1B0RB 1XZ0A 1U92B 1B0IA 1SY6L 1YYLL 2ZD0A 3BO8B 2EABA 3F00A 3FONA 2ARJA 4N5UA 3LXAA 5E8PB 2F8XC 2R27A 2R2HB 2YAOA 1R5VB 4G6MH 3MOBH 4W9GC 3LEYH 1SOQA 1LWRA 4JGUA 5FB8B 2W9EL 4UWQB 4F27A 3LNFA 3BKMH 3GK8L 3GMMB 1KPVB 3LRMA 4GG8B 3LS4H 3MV7E 4YLCA 4UQ9A 1PCXA 3GM8A 4IOFD 1VGEH 2CPUA 2NDGA 2ZSVA 1ZIBA 4ABUA 4BFGA 1MG2C 1WT5A 1J0IA 5EO1A 5C0CE 2OJEA 1ZEAL 2F6AA 2DYPB 2IPUG 2XBZA 2R2EB 3S5LA 3UYPA 3QUXB 3O3EA 4KTEH 1BAFL 3O6LL 5HXMA 4DO4A 2EO1A 5D93C 5IB2B 3O6FD 4OI9A 4OTXL 2NTSP 4S1QH 5IMLB 1UWEH 2F54A 3GS4A 3HB3C 1JRHH 1KPRB 2N0MA 3KVQA 4KVPA 4QO1B 1E9OB 5JOPD 2OYMA 1AXSB 2CLZB 1QPPA 4C4KO 5C0GB 3WENA 4RAUA 1TNNA 2PWHA 2VDNL 2BSCA 2QVFB 3CFBB 1HZKA 1FV1A 2KZ1B 2JJSA 2FEEI 3B2PA 2BNQB 3OB0H 1XR9B 2JKNA 1KB9J 3D4ZA 4Y1AD 1SFHA 3V52H 4PGEA 3AGVA 5DDHB 5AZ2H 2R2BA 4JM4H 3EGSB 4XAWL 3A22A 5DFTA 1RZJL 1VADA 4NZTH 2OXHB 4QRUA 4RGNE 3BUIA 3MXVH 5HJBA 2AJUH 2SEBB 5GS3A 1JZJA 3WIIH 5IBUG 4GS7B 4N20A 3TJEL 5CCGE 3AU1B 5HBBA 3DPDA 1I7RB 2FJGA 3BPCB 4X4KA 3EO0B 2VLJD 1VEMA 1KN2L 4UILL 3W38A 4XVJL 2WOBA 4KK6D 1QLRB 1DJGA 4M7ZB 4XI5D 4DNLA 1GGCH 3EJYD 3UPCA 4O58H 4XMXA 3WIAA 3P02A 1JNJA 2VKXA 1GYAA 5E4EB 5AZUA 3WNKA 4YBLC 5AW4B 1HAUA 4PCTA 3A0OA 4TSAL 1A14L 3VI3E 4NN5C 4WJG3 4ODVH 2IBBA 4LEXL 1IGJA 2BOBA 4U3SA 4UUJB 2F53D 3OX8A 5TGBA 2DJUA 5GRUH 3SGEH 2H5UA 4ATWA 3WUWA 5IIEA 3PAUA 2Z1PA 4QRSB 4X7SH 4AENB 4BCZA 4JG0H 4OZGF 4BFFA 1O6VA 1G7LA 4ZUSB 5JTWA 3IS0X 4PWGA 4RIRA 3VFOB 1IAIM 4PTTB 4I77L 1NC2D 4QXVA 4XVOA 4ZFZA 1GCYA 1U58B 4WW2F 3U9PH 3ESUF 3L4CA 4FXTA 1C5DB 2R8SH 3FFCB 4ZI8A 4JFXA 3NACH 3PREA 5C0AE 5SWSD 3CZSA 3ULVE 3CFNA 2PKDA 2I69A 5AYUL 2XZAL 3RGVB 1MOEA 1X9UA 3G6JA 5I15H 3B5HA 3QZWB 3TTYA 3I3EA 1G4RA 3BN9D 4JJOA 1KCSH 4LLWB 1ZHLB 3BWSA 4G5ZL 5J11C 1JXGA 4HAKA 1MIMH 1CR9H 2X42A 2ZYRA 3TN0D 4KUZL 3W39A 4J12A 3H42L 3SGDI 4J3XA 2FQEA 4MCZB 1GPOL 4R26L 4AKQA 4AC4A 2FL5B 4FTVE 5HGDB 4AQ8A 2H7WA 3KLKA 1WG3A 4KV5F 1RIHL 4PJAF 3FHAA 4KTGA 4YL9A 1KV7A 2G5RA 5JUEL 4UQDA 3W2DL 2XTJE 4L8CB 3QR1A 4LP4A 3JWNE 5I6XC 4A7QA 1JV2B 2YAPA 4Z3IA 3DRTA 1N67A 4U6HB 5D2LB 3SKUD 3TZVD 1DEEB 3HE7C 2X44D 4KI5F 1JYVA 4L48A 1IT9L 5FV2A 4ZQKA 3BHBB 4PRAA 2WQWA 4RCAA 5FEBA 4NSKB 5A7EA 5I30H 4MMYA 2EACA 3EGDB 1JWSA 3QUMA 4K3EL 4LPWA 2HUHA 5LN8A 5GS0L 4X98A 5GZNA 2ICEC 1J48A 3BZDA 3IDMB 5KJ7E 3CVCA 3FO1A 5AOJA 1HXKA 4JQVC 4KVCH 3C2AH 4Z7WF 1NDGB 1EMTL 2LABA 3I02B 2EZ0C 3MBEA 1INDH 1ETZA 3F5WA 1G0YR 4QF1A 5BXFA 3N50A 4H88L 1OAJA 3KLHD 2FQGA 2QADD 1NBYB 5LG6A 2R39A 5DS2A 3RUGE 1U8HA 2OXGA 3OQ3B 4AIEA 4NM4L 2WQSA 4Z3FA 3JV6B 1EUUA 3OKLB 1Q72L 3QH3B 3TBSA 4KQ4L 1AR1C 1AC0A 1MDTA 2VXVH 1WHOA 3K4ZA 3QDGD 2FJSA 3NTCL 4WU7A 2VR6A 3NDZE 2QHLA 5IVNA 2Y3AA 3NIDF 4I5BB 2Y7QB 3MV7D 4HGWA 5C07E 1A3RH 2UXTA 4Q74A 3DO7A 1RUKH 1KYFA 3VWKA 4MKMA 3FNKA 1QFUH 2VXSL 1BEYL 3S35X 1AGDB 1GJWA 2H26B 4HF5L 3W9EB 5EZIL 2WXRA 5CILL 4B27A 3UBXG 3BZFB 2VSKB 1CLVA 4MQ7A 3LS5L 4JZJB 4FYQA 1UXWA 3RYMA 3QUHA 4ZMTA 4MD4B 2A0LD 5AKTA 5ANME 1A25A 1I8IB 3B3BA 4TSBL 1MW1A 2HUEA 2JKXA 3RL2B 4HKXB 1HILB 1OZTG 3ZVVA 1NGQH 4XAKE 2ITEA 2EXWC 4LLMB 2Q8AH 1INEH 2HLAB 3BUDA 2C7UB 3NCEB 4UTBH 4IBWA 1MQ8A 4G8EB 3F8UB 5F1OB 3RP1A 4RGOH 4KRPB 2F54D 3D39B 1T04A 1AE6L 2OCFD 1NOFA 4I4WA 2XYBA 4UM8B 3VFGL 4YHLL 5F7NC 4AM0A 1YQ2A 5MHSD 3DVFA 4WY7L 3TP4A 1G9NC 3B3IA 4XGZB 4MASA 3T0EA 1OLZA 2ICWB 4MNGA 5AKVA 3CC1A 1PFOA 4GP8B 4K15A 5M95B 2OK0H 2QSVA 2VDLH 1TQSA 4WGWB 3RFZB 1N4XL 4XOBA 1GZPA 3MV11 1ZLVH 4FJ6A 4MB4A 4PV8A 2V5SA 3OGCA 1QD0A 4R0LC 4CNIB 3EJJX 1GGYA 2HB0A 3VYPA 4DVBB 1ITCA 2IALA 1A6VH 3NZHL 4L8BA 4NLAA 2YD0A 1TCRA 5A43C 2IGFL 4GQ9H 3O6MH 3ZYZA 2MRYA 5B7FA 1NBQA 1T1YA 3P0GB 3GSNL 3ZTJG 5D1XB 1P4UA 3IFNL 4NHUA 4OJDH 3I6LE 3QIUD 2X0UA 3Q0HA 1XB8A 5G5DA 4RETB 5ICYB 1JFHA 4Y8DC 3H3PL 5E2VH 4YSQA 3D0LB 5HHOB 2X7LA 4MMXB 5GGQH 5CN1A 3E80A 3FB7B 4FKKA 1A6AB 3S48A 3V6OA 4OZ4A 1IEAA 3F6LA 3OL2A 3ALWA 4KDTC 4LSVL 4QTHB 3ZHKA 3F58L 1VZIA 3C2SA 1XZWA 4XMWA 3CCHB 3NJVA 4P46C 3GSOA 3PHQB 1IU1A 1DBBL 1QFWL 3NP3A 2F2HA 3QHFL 1EAPB 5C0EA 2JIXB 4I9WD 1MCEA 4OGXL 1KY7A 2V8MA 3ULVD 4RA0C 5CLYA 1FAKT 2K9FB 3D51A 5I66A 5C6TL 1TJGL 3V6OE 3ARFA 4ZMXA 1D6VL 3B2VL 5HHPB 2FX7H 3GFUA 4ZMPA 5DC9B 5TDPB 2P7TA 3REWB 4HWEL 4HG4K 1OHQA 1LE5A 1UCTA 4XXCC 3RIAF 1OP9A 4MXQC 5I9QC 3P4OB 5FUOH 4CBPA 1G9NL 4MAYB 2W0KA 4S1SH 4XNAA 5IMKB 2X1OA 4HH9A 4R5VA 1W16A 1AR2A 1EFXB 1QKZL 2CCVA 5HGHB 1RUPH 2WLZA 1E4HA 1EZVY 5DRZA 5AALA 5GSVA 2YLHA 1ET8A 3UIZA 2XBTA 5EWIL 3I2CH 1OB1B 4XPTH 1EO7A 2HG5A 5IQ9B 1BQHA 3D4CA 4QRAA 4KGJA 1ZE3H 4HUCA 1K6QH 4MCYA 3B56A 1NL0L 2JWYA 1DDHB 4Q2ZB 4UT6L 5A40E 1KBGH 2MMXA 4PCKA 1KELL 4BFIB 2A6DA 3GIVB 2AF2A 2NXZB 4X5WA 3VFUA 1YN6A 5BRZE 5L2KD 3JWDH 2MIZA 2OPCA 1C08B 3HZVA 4RLDA 3CHRA 1MFAH 2E74C 3L3DA 5F7EH 3WKNA 4TUKH 1QZ1A 3JVGA 2Y6TE 5HDQH 4FA6A 4EXPX 3L3OB 1YEIH 3PDGA 5I5RA 1UM4H 2BO0A 1UB6B 3FRUB 3U4BH 2C3XA 3GJFK 4HK3J 1A64A 5J6GB 4X6FA 3L3JB 4R4ND 5DRNA 3ZZQA 5GZND 3QDJE 5EU6A 4I8DA 3TBYB 2VLKA 3S0PA 2FD6L 2PLTA 5D2LF 5EO9B 2QFPA 1X5YA 1WZMA 3OLDA 4JHBA 4ODXA 2XY1A 5EULV 3MBED 3LX9A 5DT1L 4KZ0A 3OMAB 1PZAA 4LPUA 4FXKC 2QLYA 1DLHB 1U8CA 4LCWB 5DQDL 3VTTA 2ED9A 2PYFA 3AY2A 4P2QA 1U3YA 2NNRA 2ZG3A 1I85C 4KY1H 1KYOJ 4DP0X 5EU6E 3IDGA 1INQB 1E7VA 1Y1DA 4R7NA 5IREA 4GI8A 4IGBA 1KG0B 5EZLA 4K4KA 3KPPB 3HMXA 2CR0A 5EF1A 4S2SB 2VJXA 5L4MA 4WUKH 4GIPD 2GHZA 1H6UA 2YC1A 2QSQA 5DXWA 4BUHA 1IILE 5JLZB 3VWKD 3V4PL 1A0QL 3KBHE 2YA2A 2IMMA 3EYFB 4XAKD 4XO5A 5D7LE 4ZDHB 4N8CH 4YPGB 2OP4L 2AQ2A 5HHQA 4CU7A 1VFAA 3DLQR 1SJEB 4WTZA 4G6KL 1QR4A 3NFPA 1ETA1 4LGSB 8FABA 3IT8D 4I7ZC 4R7LA 5K1JA 1UT2A 4XX1G 5ID0A 5DWUH 1AZCA 3F83A 2X1PA 3SPGA 1OWRM 2V5RA 4TNWF 4BUGA 3CLWA 1PAMA 3B9KB 2WKGA 4OKVB 4UAOC 5TE7H 4EUPB 2H4EA 5F7FA 5CNHA 2YFOA 4LFHD 2HPTA 1AY1L 4EN3B 5EV7A 5CGYC 1YMMB 3BDXA 3HUJB 3WNNA 2G75B 4WHCA 2VOTA 1FNEB 5AYTA 3EJQA 2OV0A 3X2QB 3H8NA 1UT1A 5KW9L 3AB0C 3FN3A 3V5HA 4ELMB 3SJVA 3T0ED 1NDTA 5AENA 3HR5B 3ZX1A 2LGNA 5J4MA 3K1DA 3QORB 4EE2A 3H55A 3PU7A 5MENE 3VG0L 3JWDC 1XGTA 5KOVC 1HEZB 4URTB 1UJ3B 2QDWA 2Y5EA 2VW7A 5DFVD 1MAML 4GRLA 3MA7A 1JMZA 2LAAA 3BWUC 3BEWB 4EOWH 1IBBA 4WHYH 1JF1A 2DBJA 1V27A 4RSYA 5IB1A 4KNTA 5LGHL 3P30H 4FCAA 4I1RA 4HH8A 1AI1L 4OLXL 1QOKA 3NPZB 3CMOL 1L7TL 1WRFA 1L6PA 5F88A 1A4KB 2WXJA 1KEGL 1SNRA 2HKFL 1F42A 2V0AA 1I4FB 4N2GA 2Z4TA 4ZPVB 5J12C 5C0DA 2A4ZA 2QL1A 4N0UA 3FSZA 1IFGA 4ZUWB 2MNWA 4OQTA 1MCRA 3NP4A 5D1QC 3MLSL 4F7PB 3MCKA 5B4MD 1WFJA 4JMXA 1MCPL 5JHBA 3ETBF 3C6SA 4KKBC 2JCCA 5TJWK 4F93B 3MBWB 3TV3H 5SWZE 3FTXA 4R97B 3MLUH 2MTAA 2HX7A 5A16A 4HUWB 1EDYA 1W6LA 5JNYA 3L48A 3SO3B 1A7OL 1AZNA 3AM8C 4OCXL 2KUTA 3WS3A 5KSAC 2AHIA 3ZOAA 1LHZA 2NT0A 3SD5A 5C0IA 1RI8A 3H9HB 3M1BB 4E41A 4TXVB 1TLMA 1EK3A 4PW9A 3ARFD 1T4KB 1NEUA 2JKSA 5IUCA 4NQDB 3WJLC 1AD9A 2Y25A 4ZZKA 1FFPB 1BCIA 3APMA 3GMLB 4DCQA 3EFFA 3O8XA 1FNGB 4LU5L 4Q9CA 5C0RH 1O7DE 2YRPA 2X4OA 2YA1A 1JGUL 3HKZA 4NRXA 5DYOA 1F3JA 3PJNA 4HVBA 5DR5H 3WE1A 3WKMH 3PDDA 1JHTA 2AJXH 5FV1L 1RZKC 3QXUA 1CD1A 5EU4A 3MRNB 1RZ7L 2HRPL 3JTBA 4R2GD 4BQBA 2X28A 1C5BL 5DLLA 1LEKB 1IQDB 4Q0XH 2OMXA 3KGTA 4G6JL 2X4PB 1MFVA 3B9DA 3BKCH 3Q2CA 1D5MA 4K3DH 1ET7A 4ZMVA 5B8CA 5FM5O 3BVVA 1XL4A 4RFNB 1Z9SB 4Y4HA 1EAJA 2Y1VA 1M7IA 1KLGA 5CLXA 1K8DB 4ETQA 3KDPB 1AHWB 1EA9C 3ECBA 4Y9EA 2W38A 1LEGA 3FSWA 4XC1H 1BF8A 2X4RA 2G0LA 3JVFC 3OG6B 3VTAA 5FPIA 2IWKA 1RCYA 3BP6A 4NNYA 4QKXB 4J1UA 1Q0YH 1T6VN 3Q3GA 3RTLA 1GZQB 1CYXA 2FEJA 5BZWB 1EGJA 2CO6A 4L3EA 5ADPH 4HKBA 4PJHB 1CG9A 1V7NH 4W1TA 3C60C 2X5PA 4LP5A 4UINH 2VLKD 2VDKL 1P84K 1MVYA 2BPBA 2ALAA 3JT2A 3APNA 2EC9T 5LCVL 3WFHB 1XF2B 1L0XA 2ZKXA 3MUY1 1GYWA 4ZO8A 3ABZA 3KPRB 1HOCA 3ECWA 5I5JA 1HYSD 2A2QT 3LXCA 4P2QD 2R0WH 4L3EE 1JE6A 4FQHA 4QRTB 1PIGA 4XMUA 3LIZH 3N40F 5FUZH 5HI4D 4QHPA 3VDAA 4NN7B 1QBBA 2HFGL 3OSVA 4ANVA 5FUCE 4ZUVA 2ZKWA 1RZKL 4IGBD 1A1NB 1PFCA 4LPCA 5I28A 4TQPA 4XOCA 4BDVB 2JB5L 5FGRA 5B38A 5FW7A 4BSVA 4L1BA 5GJSH 1I53A 4P5KA 2XZZA 1G1YA 3QXDB 4I0KA 2XXGA 3HZKA 4LL9A 3PG2A 4ODUA 1G7IA 3IDXL 43C9B 4JAMB 2XV6B 3FB8A 4IMLA 1IL1A 2HMIC 4EBQH 5AVVB 1DBAH 2VN5A 3MRPA 4FNUA 5DRXA 2RFXA 3LIUA 3ZRFC 1E27A 4PWFA 3WDHA 1KJ2L 4YDKH 3BD5A 2VXUL 3T2PA 2ESVB 3NJGA 5IR1A 1T66C 1JN6A 3KAAA 1OAYL 5JYLA 1M7DA 1ZT4A 4G11A 5ILTH 1MHEB 3VXUE 1F97A 1DJWA 3H0TB 2OX5A 1J1OH 3S5ZA 1PKQA 5E2JA 3P4NB 5JHLH 1KCUL 1QW9A 2WQRA 1AZRA 3K8KA 3ATDA 2CWRA 3BE1H 4UCFA 4LIQH 4WWPA 2CDEB 3RI5F 4QJ5B 3GPEA 5TPWH 2XV0A 2FCBA 3TZVC 5B3NA 1WFTA 1CLZL 5FM5M 4F3FA 2GJPA 3TVMD 2J1KA 2BZDA 3ZMEA 1TYJA 1PZ5B 2NCMA 3H4HA 3SJVD 2CRIA 3BLBA 1PKQE 2JI3A 4PRHA 3NJFA 1RJYA 4YSCA 1RHHA 3QQ4A 4N0CD 1KFGA 1AG6A 5ICXB 4H44C 4P2RB 3X12A 4YHMH 4GRLD 5K9QG 2YAFA 2HT3D 3VI4A 4FG6C 5K9KA 4UIKH 3HUJF 5KBNC 5AD0A 3TH3T 1I7TB 3FUJA 4LSQH 3KPNB 2ROYA 1CFNB 2KDYA 4NAQA 2N1KA 1EJOH 3LZNA 5ESAA 3IDYB 4ELMF 2VDPB 1SN5A 2OM5A 5BUAA 3A6CH 2Q20A 1WBXB 4CL7A 4PRHE 2VN3A 2DQJL 5HPOA 1W9XA 4PD4K 4ONHA 1B88A 1ADWA 3PV6B 1S2EA 1QLFA 4ONFL 1TKWB 4M4PA 3SDCD 5IOPA 1LO4L 3DRQA 3H54A 3KPSE 4HS6B 1QYGH 5ADOH 4N0RA 4PJ7B 2Q86B 3P2BA 5E1AB 2Z31C 3L3IA 2QFRA 1XGQB 2H3NB 4RWHA 4DN4H 4XVUD 4R6UA 3UO1H 4MQXD 1A5FL 2VW6A 4XOEA 4OF5A 2ZX8A 3LQMA 3VXNB 1TPXB 4DUXA 2L0DA 1P5UA 5E6YA 3IGKA 5BVPL 1JVLA 1LP9B 5D6CB 5FO7A 4D7BA 3C75A 3DO4A 1A7PH 2VN6A 4G3YL 4XMPL 3RWEB 4E41D 1A9BA 1HVXA 4JHAH 2VLJB 4CVZA 4UTAH 3LH2H 1DVTA 3L5WB 2A0LC 5D8JL 1QQDB 4KU1A 5IG7A 3O41B 3MNMA 5DJ0B 4WFFD 4JO2H 4IW4C 3O8XD 2XZCH 4RWYL 2GVYA 3BRGC 2Y5QA 5JYMA 1A3LH 1IKNA 1MCIA 4PGJA 4FJZA 5E5MA 3CBRA 1CUOA 3UO8B 2E7DA 3I6SA 1RJLB 3LVEA 4RGNC 3BISA 4DKEL 1AGEB 4X7DC 3IMVA 3ME0A 1LWHA 4G7YL 5HP5A 1MCQA 3QG7L 3L4YA 3B1UA 1BD2E 1SDDA 2EDBA 4EI6A 2DJSA 1E8ZA 2DMCA 5IB3B 3NAAL 2CBQA 2JJSC 3LEXA 3S36L 1KJMB 1A7RH 4M1CC 3VXPB 3IFPB 1A6WH 3QR0A 3S35H 4HJGA 2DQUL 3RPKA 1XCQB 4QR7A 5BUGA 1TTRA 2W0FA 2Z64C 4Y4HD 1JS4A 3WEXB 1J12A 2WXNA 2ZOKB 5CD3B 2CK0H 5DJ6A 4MFHA 1JGIA 4WWID 4UTBA 1JPSH 2HJFB 4FEIA 1CFQA 3V4VH 3FQRB 4BZ2L 5TQ0L 3OKMA 2BINA 4Y5XC 1UA7A 2Y06H 3FK3A 1ZA3A 2EEDA 3FT0A 1CFBA 5LWYL 2GEEA 1PJWA 2A77L 1FORH 1ZS8A 3V10A 1B0GA 1FRGL 3V8OA 4Y4KB 4WAFA 1BQRA 4L3ED 2IAMC 4UOW1 2DIAA 3BWAB 5FKAA 1GXEA 4R3SB 1BPVA 4JW3A 4HIIA 4Q14A 5F6IB 5KBKA 2EDHA 4LEEA 1UWFA 5DJ8B 2ZYSA 3VD9A 4PJIF 1CGTA 4H8UA 5DZAA 5E00B 1YAZA 2YPLB 1TJHH 3B7SA 3RNKB 2GCYA 4N2DA 2DWDA 4V33A 5CJQL 2E27L 3FH5A 2B1HL 4NM8L 1A7NH 1PYWA 3VH8B 5C3LD 3H7LA 1CE6B 5F1IB 3OAUL 2MHAA 1YNLL 3POCA 4I89A 1DJHA 4PJHF 2NQCA 1LWJA 5EZOL 3NK3A 4WDIB 5AOMA 3VXRA 1KOAA 4J28A 5I1DA 2XIDA 2QZ5A 1DN0B 3WNIA 3BQUA 3OC5A 3AU0A 1L9NA 4G8IA 4HYTB 3M45A 3WJMB 2V17L 4KUCD 3HAEA 2W65B 5IQMA 2VDQL 4LHUG 2YRZA 1HH9A 5IHUH 4KAQL 4PSRA 3N5AA 4MA1B 2YN3A 1N10A 3C5JA 1W8NA 4JHWH 3MBXH 2MCPL 3GKWL 4PS4L 4FI6A 2MPAH 1MVUB 1MWAA 2XTJC 4FFYA 4MA8L 4KOBA 3JWNC 3QE5A 3CQQA 2CGRH 3COOA 1KCBA 3CG8A 4MJIA 3OJDB 2ICWI 1SVZA 2VGLM 3RFRA 4A2MA 3NH7L 4KKZA 1BOGA 2VC2H 4S0HA 3EH1A 1T20A 3NJKA 1WAEA 2B3RA 1UXSA 4QTIL 1MFEL 2WLLA 3MNZA 3PWNA 1E9QA 3BUYB 3E2HC 4CC1A 4Y4FC 3T1WA 4LPTA 4Z3TA 5PAZA 4CBZA 4TNEA 3OHXC 3FQ1A 5I6LA 2J5WA 2FLBT 4K94C 4LVNC 5JA8B 2ARJB 4PJ9A 5D96B 4ZYKA 4LLDB 3P77A 4H0LC 2VLMD 5IBTH 1WD8A 3ZE2B 1IM3A 1WBYA 4YHPB 1AHKA 1SQMA 4I48B 1PVHA 5F70A 3V0IA 1MF2L 1JWUB 4GBXC 5FYLE 1E2WA 3MGOB 3CSTA 3TT1L 4PRHD 4LGPB 5ENWB 5C0ND 2C4FT 5FCSH 2R56H 4QTFA 2WMPB 5E0QA 5TF1H 3WBDA 3TWCH 2FWOA 3NCMA 5EO1B 2J8HA 3ULVL 4F9LC 5ITBL 3U7AA 3OAYK 1CBVL 4OZFB 5EZJA 4WKZA 1DSWA 2AGJH 1NAMB 1N5YH 1CS6A 4OLZH 4Y19E 1T80A 4N2IA 2HWZL 5KG9A 1JD9A 3ZR5A 3BGMB 3RWJB 3WGVB 4JN2A 4YXKH 1WC7A 3J07A 3S2AA 1AANA 4R90H 1SJHB 2X1WL 1C1EH 3CFDA 3TCXA 4RMVA 1K2DB 1DQIA 2XN0A 2VXTL 3QIWA 4HBCL 5DJZB 1CD0A 1PZUB 4OGYH 1C16A 4PWIA 3QK0A 1JZFA 5DUML 5MP6H 2X9ZA 4LLVB 4P59L 4M7JH 4PGEB 1CDJA 3KBPA 3BSZA 1XTLA 4NKDB 3U7WH 2VAJA 4KQ3L 5ALCL 4NO3B 2Q3AA 2Z35A 4YHKH 5IVXB 5ACLA 1TEYA 3MLPA 4XN5A 3UTPD 3II2A 5I23A 3SPJA 4NQSB 4HKJA 3FU3A 3PWLB 5H35A 1HSBB 1CGUA 2EVGA 1V7MH 4JPVH 1JVOA 5A2IH 4XNYL 5IJBC 4AUJA 1O6SB 2MKLC 3QIUB 1OGAE 3POHA 2UY6A 4RFOL 5BZDB 4K94L 3WXVL 2I27N 1J1XL 5F1NA 2OKMA 4HBQA 1ETJA 2GBVA 4EZLA 5DZVA 3ZDZE 3T8MA 3FQNA 3GUFA 4MAUL 4I3GA 4QXWA 4IOSA 3T8XB 2DB8A 2NNFA 3QUML 4KTDL 4G7RB 5DJXB 1H3UA 3MRIB 5DURD 3QWOA 4HIJA 3QJHB 4X7FC 4HMEA 3MRHB 4N2EA 5D72L 4KHXH 5CFAA 2CJUL 2FJUB 2Y22A 2EH7H 4ZSOE 4Z0XA 5F8RC 4ES9A 1Y18A 3BEVB 1OZUA 3I9PA 4QHMB 4NO2B 1DZBA 4DGYL 4GP4B 4XB8A 1A6ZB 4L9DA 5F9OL 1SJMA 4JFYB 3FU7B 4XBEL 5DUJA 2D2CC 3Q2NA 2W8CA 2VO5A 4AUYA 2O61A 2XC8A 1FL6B 5D4IA 1WBZA 4LAJH 4NZUH 4TOYH 4MMZB 2NY7L 1Q9OB 3CVDA 4JBSA 4U0QB 5IHZA 4CJ0A 2QVIA 3QJZA 5JORA 3UTZB 3RIFF 2UWEE 5AL8A 4ZFOB 3BOVA 2C4XA 3WTXA 3O3DB 2I07B 4KRMB 4I2XB 1BM3L 1FSKC 1KB5H 1KTRL 1YNTB 1RH8A 4XCEA 3QIBB 3QC6X 2WBWB 4B53A 1AFVL 5I5IA 4Y5VA 3U30B 2AEQH 2D7TL 1UD8A 2J6WA 2CKBB 5HHXL 1ZANL 2F0CA 2ZUUA 3CX5J 3G5ZA 2XRAH 5L2KB 1B3IA 3QXTA 5T5FL 2WP3O 2ZUQB 3DBXB 1MREH 2OYKA 1I8AA 4V2BA 3L4ZA 4WGVB 1GAFL 3AS3A 4HD9A 4ZQTA 2BHUA 1J0HA 3U36B 1CVRA 2HVJA 5AB2A 5EC1A 4LL4A 3WLWC 3DMMB 5L2JB 5TDNB 3VXRD 4F20A 2D0GA 5HJGA 3SKMA 3BQUD 3HS0C 4DUWA 1SHXA 2YD7A 2DWSA 3A21A 5GJTL 1OT2A 4EDWL 5ITFA 3U6RB 3BRFA 4NXKA 4L9LB 3DGDA 5CCKH 1PY4A 3VWJA 1P7QA 2IDSA 4LP8A 1KIUB 4KFMA 1ZWIA 2VR9A 4YE0A 5KAQF 3SGDH 1L6ZA 1KN4L 3SPVB 1JPFA 5JPNC 3KPLA 4MJID 2DWTA 3B83A 2BM3A 5INCB 1BVOA 4JRXA 4OAWB 1U9KA 1GS6X 2P5EA 5J9PB 4KQ0A 2V3FA 2ROXA 2ODIA 3W5NA 4RDQG 2AJVL 4GUPA 2F9BT 4P5MB 1UZ6E 4QEGA 5I8CB 3HNSH 3NCWA 5FYLD 3UPRB 4YHOL 5JW5A 3KYNA 3LAFA 5GRZA 4FI7A 3O0RL 4DQOH 1QHOA 2IPTH 3OKNB 4JFQB 3ZYJA 2Y9RT 1ZV9A 3EHBD 3VXQB 1GSKA 5AAWC 1AQKL 2APWA 5IB5A 4IRZH 4PJ9D 3MUGB 3THML 2FEDC 2P5EE 3D18B 3M1OA 2FWLB 1IM3D 4UBDC 3FH8A 5B22A 1M9WA 4LSRL 4QAMB 3ZMNA 2Q0ZX 1U8QA 1HCZA 2P24A 3BKJL 1AACA 3DX8B 3AREB 2NY0D 2WN2A 4OGQC 1JZ2A 2FGWL 1PLCA 4F7EA 2JKRM 2VISB 4TTGA 2FO8A 2P52A 5IGXH 4Z3JA 4DH2A 4KTYA 2VJ0A 4YSPA 4CVWA 4G43A 1P4LA 1NFDB 1OQOA 2Q7YB 3IE4A 3APFA 1C12A 2VYRE 3FU9A 1OTUD 2LU4A 1Z1WA 3RZCB 3X17A 2R1YB 3P9MB 4HS3A 1B9KA 2WNWA 3X1BA 4PJEB 5CMAB 3MGTB 3RB7A 4PRBA 3RTQD 3QIWD 1R19A 3ZZ1A 1PGRB 4QRPE 5DZNA 1TTUA 2J1XA 4ZUUA 4LARH 1QWUA 5E6UB 4UDUB 1VGKB 1WIPA 1G1CA 1SHMA 2PTTA 3J2PA 5JO5B 3VSQA 5ACZA 1UGNA 5ALBL 2VDOL 3DX2A 1E5UI 4PYHA 2AEPL 4Y16C 2EC9U 2Z8VC 3QZWG 2HPOA 3BPLC 2OI9B 2CM5A 3F65A 1TVDA 1EO8H 4V1DB 3KNBB 4LDLB 1FFOA 4H25B 2VUYA 4PY7B 4YHYB 3FQTB 4KDVA 1J1PH 4AT6B 3LIZA 5DZPA 3BQVA 2F7QA 3IDNA 1FO0H 3R8BB 4IBZA 3FO0L 4RGMB 3TGXA 1ZLUH 1HHKA 3GDCA 3HC2A 3QEUA 4U6VH 4GO8A 3HE6A 1T0OA 4IS6A 4NZRH 4ODWB 1S5HA 4IOSD 4BEIA 1HL8A 1OD7A 3NCCB 4MJ5B 2OYLA 1XB3A 2NY6B 2WQXA 4JCWA 3QJUB 3GIZL 2NR6A 3MLTB 4YIQB 2YEZA 4NQCB 2DKMA 5AB1A 4FNSA 4OIAA 5JZ7C 5C0JB 3TBWA 3RHWK 4M6OL 3UH8A 4XX5A 2IG2L 1MRCL 2NY2C 1AKJA 3T2QA 1NM9A 1B4LA 1ORSB 3ZT6A 3QUZB 5A3ID 1GTFA 4HZLA 3LQZB 5F7DA 4ZFGL 1F6AA 4GRLC 3FO9B 2GBAA 3CDZB 3TLRA 2GSGB 3IKKA 1JGEA 4WUUA 3GRWH 2VW4A 1I8UA 5DVLA 1HOEA 4N0FB 3EBHA 3A3YB 4LSTL 4PJGA 4UM9A 3UZQB 1JXJA 4KJQC 4IU2B 3PJSB 1CLYL 5AW1B 1MQKH 2WNKA 3S4SB 2H8PB 3MLVH 3MO1A 4XNUH 1A4JA 3H2QA 3HI5L 1UA3A 1JF6A 1T2QH 2VMFA 5ETUB 5EEXA 1IC1A 1U91A 4D8PB 4TUJA 4U1KA 4Y2NA 2B4CC 4XP9H 4XCFL 4LQFH 4LOUC 4XVTH 3IXAA 1RMFH 4LRNL 3U48A 1AC6A 1SYSA 3IWUA 4HCRH 4J4PC 1HI6B 4MCYB 1VKXB 5KYYA 5ISZB 4ERSH 4PJGE 2R9HC 1LEIB 1OARH 2ENPA 4XWOD 1S78D 2WIIB 2DV6A 3EH2A 1ZT1A 4OKDA 5HHMD 1XHHA 1E4JA 1PJ9A 5E2WH 1IARB 3QUKB 1O7DC 2Z8WC 1GRWA 3MNWA 1FZJA 1U3HB 4RISL 3VM7A 4XNXH 4WFEE 3G7TA 3WFCL 3MJ9H 4OIIH 1M05B 3QAZB 2VERN 3QPQD 3MKGA 1XV8A 3G6AB 5TDOB 1HQ4B 5H4YA 5LVEA 3PAZA 1YNTF 1T7ZA 3OM3B 4JFUA 1ILSA 2CDFB 1I1CA 9PCYA 4K2UL 35C8L 5LDUA 2AV1B 4HEMA 1JHKH 3D3VE 2DAVA 4IOIB 1DQLH 1EHXA 2YBRB 1NGZA 1C5CH 2E4TA 3PY9A 5E95B 2E9GA 4BINA 1UH4A 4WF7A 4FGMA 4WWKB 5KSBA 1LK2A 1D7BA 4QHKJ 4B9GA 2NY4C 3VWJD 1P7QD 3WXWH 5IEKA 3ARDA 2IANA 1NGXA 1DVUA 3NRFA 3UBXA 4Z3GA 1RVFL 3EOYG 1J5IA 5H2BA 4KJYA 1T0MA 2Y07L 4NAMA 4LSPH 5I74B 5D7JB 1YEDA 4ELKA 3LN4B 4L1SA 4YAQB 3J8F7 5J3HD 5D7KD 3S8FB 5KN5A 4JRXD 3V0FA 3D69A 4HUUB 5KSBE 3UEQA 2OQJB 1TJIH 1OSPL 4PUBH 1U8OA 3PXLA 1CZ8H 3CZUB 4Z77B 5FFGA 2VIRB 1JERA 1IKOP 5K1NA 4AW4A 1LQSR 4XN9A 3T77B 2YC1B 2X38A 4ZUTA 2WANA 3FCUB 3QJXA 4BHUI 2FBJH 4G59C 4P06A 3BAEH 4K3JL 2VM9A 4YC2C 3FQWB 1YEGL 3OPZL 2B4CL 1PU0A 2DQIH 3ZSSA 4OQTL 1KIRA 1BXVA 5EUOF 2AI0H 1KWKA 1R3KA 2AXGB 4ZT1A 2ZOLB 2AZUA 4BYHA 1GC1L 1JOIA 3ML8A 3OD3A 3MRQA 3ARBA 3GC3A 3BUQA 1YPZB 2WO3B 2J73A 4FQJL 3NJJA 1SPDA 2D31A 4QT5A 5C0BD 3ZTNL 4M1DH 4Q9QH 4LASH 4MDRA 3ILDA 3T65B 4G7VH 5FUCC 4NP4L 5ESQB 1J11A 5FYJE 4WW1A 4OT1L 1QSFE 3JV0A 4YDMA 5L8LB 4JFFE 3PQYA 1YZZA 3HZYB 3TVMB 5LJYH 2NY5H 5CIPH 1Q94B 1FHNA 1F13A 4HPYL 4QYOB 2PWDA 2VH5H 4NFBA 4ZOCA 4F91B 3PDOA 4PP1D 3T4AA 5CJXA 1CDUA 5T1MA 4Q52A 4ZOAA 3K4AA 4XP5L 4WEMB 3L45A 4I18C 2DM4A 4OBRA 5D93B 3PNRB 1EEZA 4J8RA 4Z7OE 1GTNA 3HB3B 2ZJSL 1FPTH 1NFDF 5JXEC 2XQYK 3KPMB 5AOIA 3MCG1 3V8CA 5FXCH 2OYPA 3DVNA 3HMWL 4ZG1A 3A4FA 4JKKA 5C3IA 4B95C 1GJIA 4ZTPH 1JF1B 3K0WA 4GKSA 4PJEF 2X4SA 4F8PA 3SQOL 1S7VA 1PQZA 4B9KC 1X6LA 3ASOB 4AVJA 2IBZX 4F80A 5FA3A 1YDPB 5DD6A 1OSYA 5I16A 3EO9H 2K3TA 4YZFE 5IV2B 1ZLSH 4MVBD 3O4LE 4P9MH 3FUIA 2OR9H 1TTCA 1VA9A 2V3EA 2ADJA 3WMQA 5F1SA 3WHXA 1DSFL 1PG7X 5IJKC 3KGUA 3L81A 4KK9D 3RDTA 1MFMA 2G0KA 4YMPA 4QD2E 3SDCB 4HCGA 4RBPK 4YHIB 4CILA 4YX2H 4GRWB 2FWUA 1QMUA 5KBMA 1IAIL 1ET5A 3EOAA 3HE6D 3OAZH 2Y72A 4XO8A 4YUEH 2IV9A 1AH1A 1U21A 1TXKA 3HI1A 4NWUH 3KL5A 1NAKH 1RQ5A 1EGJL 1F4WL 3TIEA 1PS3A 2EIZA 1N2RB 3QEQA 4IKIA 2DQTL 2NR6D 1E5ZA 4FNTA 4D9LL 4H8QA 3DXAB 3AT8A 4AIXA 4IHBA 4MB1A 2X10A 3N06B 4HZ1A 3RRQA 3D7PA 1JP5A 3DUSB 1AKJD 2VDRH 4NN5B 2YA0A 4BM7A 5LNDA 4QDGA 4U6XB 1W72B 2VR8A 5CZXD 1QSZA 4L8DB 5BW7C 5LN4A 2QVTA 2J8UA 1BZ7B 4H5SA 4WUUD 2DQMA 2JKJA 3QEQE 4E68A 4NBXB 3BVWA 4L3FA 5KANG 5BJTA 1KB9K 4IRSA 4IM8A 3ROOA 4UM9D 2R1WB 5EDSA 4PRNA 1G7PB 2G5BB 5EU7E 2EJ1A 3FHEA 4FHBD 1G9EA 5BO1L 4KBPA 4EZMA 4N25A 2EYSB 2ORBH 4MA3A 4AJ0A 2F8VA 5F96H 1KYUA 3KJ6H 1FH2A 1R24B 5DHYA 3TYGL 2G2RB 4B9CA 3DJTA 2V9UA 1F00I 3QJQB 3U1SH 4NUGH 2WYZA 1E65A 1HHGA 1QSVA 2VXQH 3SYAA 2E47A 2NY3B 3EJCA 4FNQA 3SE8L 4DUVA 3DHPA 1S46A 2WUBH 2NY5C 4UI2A 5TH2A 3T2NH 3LNEA 3F64A 2NUTB 5J11B 5I73C 4AGPA 3SY0A 3SOBL 4LKXA 1ICTA 3QFJB 4JZNA 4OGAD 5CJOH 1ZD6A 5DI8B 4GIAA 1S5IH 5DHVH 1Q1JL 4DKFL 4NO0B 2ZXQA 1RHFA 3CZLA 1QSEB 2CZNA 4B0MM 4MZ2A 1FP5A 1WFNA 5I6XB 1XF5A 4RX4A 1WA1X 3PWVA 4JKLA 2CO6B 3BP5B 2R8SL 2E0PA 3HE7B 3WO3B 1UA6L 4TQEH 3HBZA 4KJPD 2ENJA 1JFQL 4X9YA 5LUMA 1JD7A 1NGPH 1R3LA 2DI9A 3F7YB 1HHHA 3LHPL 3RGBA 3C5XA 2YKKA 2EXYD 2BFVL 3ZKND 3EDJA 5DZ9A 1KIPA 5C2BL 2IQAB 3DVGA 1YY9D 3ARDD 2IAND 3UG5A 1GYCA 2LU5A 3L5XL 4YWGL 3T2LA 2ICEB 4F15C 1HOCB 2AKRA 4QCIA 2IFGA 2GT9A 1SXAA 2D7MA 1KXVC 5HDRA 4WV1A 2OMWB 4OI8A 1G6RA 3MX0B 5IF0A 4PRPB 1SN2A 2P5WA 3TNNA 2G9HB 3LN5A 3LNHA 4NN6B 4G1MB 5FC9A 4PS3A 5FIEA 4J3OH 5BMFL 4QRFA 1S9VA 1UG9A 1UB5A 2VQTA 1U8NB 2PO6C 3KWXA 4L29B 3L5IA 3FT2A 2GUYA 4XRCB 4PJDB 5GZOD 3MVSA 1OM3H 3CVHH 1F90L 2ODHA 4M7KH 4XX1E 5FM8A 3X13A 1E8XA 3GMRB 4R4FL 2D03L 1EIBA 2FH6A 5G4OA 2JKTM 2P5WE 2A3TA 2H6OA 3T3ME 3RVVD 2P8PA 2C9PA 4HWNA 3ARBD 5JMOC 1BYOA 4FQXA 1I7UA 2IH3B 3WN5C 2X3AA 2ZWLT 4AITA 2WO4A 1LLAA 1R3HB 5GSRB 4HMCA 3EBIA 3BPOB 2O5YH 1FGVL 3Q1SL 2EUZA 4RQQB 1CFMA 1NDMA 5EC2A 4KROC 2DQDL 1CGYA 4M5TA 5I2IA 1CDYA 2FH8A 2TRHA 3AAZB 1OAZH 5GGUA 2C3VB 4WO4A 3C8KB 3VA2C 2Z4QB 3AQZA 3PQYD 1YPZF 4P9HC 5JIHA 3QWQB 4WFGD 4AXWB 1DQQB 3H9SB 4NDMA 1VLXA 2L7QA 3F05A 5I24A 2HVBA 5KS9B 2WQAA 4PTUA 3HC3H 1CL7I 2X3BA 3L3GA 4Y5YC 3DURA 1RJYB 2UXVA 5FKPB 5I1GH 1JNLL 1KB5A 4JKPH 4M8QA 1XGUB 1DUYA 4JO3H 4OCWL 5TFSL 1O0VA 1DSYA 1BVLA 1GS7A 4W93A 1AO7A 1OSZB 4LVEA 1EWHA 1UOLA 3D5OF 1RIUH 2LLLA 3RWFA 1YECH 4OUUB 4FG0A 1T22B 3Q6GL 1XGYL 2B1AH 4XMVA 4HX1B 1L0QA 3CLFH 3QJFA 5ABAA 4E9TA 5E9DA 3RVUD 1EZUA 2R51A 2ZKHH 4UU9B 3RLSA 1KBKA 4LOEA 1CGSH 5I6PA 4EI5C 4IBLT 1RK1B 4PJFA 4QJ3B 1PZ2A 2BSBA 4MD0B 1OF2A 2Y4SA 5CGBA 4Z8FH 1Q1PA 3T4YA 3K7UA 3MLWH 4YR6A 1MJ7L 3PWPA 3P69A 1YYCA 2BLFA 1PY9A 2V9QA 2YXFA 3MSPA 1IGYB 3RDTD 2NYYD 1S7TB 3C6LA 3K80A 4JMNA 2OTPA 3MRJB 3QZLA 3P54A 5E6IC 1ZHKA 5JOFA 3R0MA 3BH9B 3O81A 5E9DE 4BQ6A 4OJAA 1U2HA 4HJ0D 5F3BA 3Q9QA 1KGCE 7FABH 3VFPB 3C9NB 1NBZA 5DEFB 1A9VA 4FXGA 2FRGP 4LEOB 1I9IL 3QEQD 4DQAA 2JFCA 4N1EA 4CVUA 4H8VA 3MU3A 4ANXA 3PWPE 2YSSB 4J3OC 1KJ3L 4JLRA 2BOCA 2HKAA 2ZUWA 4F7KA 4GRWF 2J6EA 4JY4A 4AI7A 1FWXA 3NSCA 3V7AG 4PHZA 4P9HL 3IS1X 1Y6MR 4YDLC 4Y2DA 3JWOH 4F58L 2CR6A 3JV5A 4X6EB 4UDTA 1QO3A 4EKXA 2OTWB 4APQA 1KCRL 3O6KL 1VPOL 1K4DB 4IRSD 3CQPA 1X4ZA 4K23L 2F1BA 1BBDH 4UV4L 4IRZA 5E99L 3MREA 4PAZA 3BX7C 5DD5H 5I9QB 2Q6WB 4FFTA 3V0GA 1I8KA 4OSUH 1YEKL 2V5TA 3GZKA 4FLRA 1ZXQA 1MNUL 3F7KA 3V4UL 3AG2B 5L9DL 2VL5B 4C83B 1NC4B 5CEXA 1E4XL 1MWAL 4FFYL 5CSZB 1WEJL 3VDBA 3D25A 3U83A 3AQDA 2AXJA 2NZ1A 3VQ2C 3HHSB 4FL4C 3IFOB 2R29H 3MLXH 2CNYA 1CIUA 2K78A 2JXMA 4PREB 2ZZUT 4M6NH 4ES8A 4YDIH 1MJ8L 5FYLL 1VACB 4Z7VA 1NIFA 4AC2A 2HFFB 3V7MA 4PJ5E 4NXSA 5DLML 1O7VA 4FADA 1MCFA 2AQNA 4CMMB 5HYIA 2WWKO 3EF4A 3FC8A 3CFJB 3FDWA 2DLFL 4RX4D 5DS8A 1NUGA 2NRDA 3KWVA 5IM7A 4NRYB 1UFUA 2WK2A 4POUB 3LEVH 3AABA 4JFOA 2VDLB 4V2CB 4NPYA 1J8HE 4G8GB 3DC0A 4H0GA 1VZGA 2GB2A 1RD6A 2CDGA 1WZ1H 1FDLL 1AXTH 1OCOB 3B8YA 4P5TC 1ZV5A 4ADGA 3O11A 3LKNA 2DIJA 1PNCA 1ZDSA 5IFHH 5D70H 2ZUSA 4WJKB 1AIFA 1B90A 4EPSA 4BK5C 3P73B 5IMOB 2BDNH 2VR5A 3W56A 2P5WD 1D9KC 4C47A 2BWQA 3UZEC 5GQBA 5HGBB 5JIDA 3VCLA 1FG2B 1HC1A 1N5AB 2DQEH 4GI6A 1WAAF 1TTGA 4UT7H 2VLRE 5DO8A 3V95A 1NCBL 4ZAKC 1YEFH 1RZQA 3STLB 2QQNH 3MUZ1 5HYFA 3FBQA 4QGTA 5F0MB 3D9AH 2F18A 3DSNA 5KZCD 4F2MB 4N5EC 3BP7A 3BSZL 4GYBA 2XZQL 4MJIB 2ZUTA 3W3BA 1XT5A 1HHJA 2X1QA 3MCLH 5GS1A 2AC0A 1MI5A 2A9DA 5J57B 1BOGB 2WGNB 3JWOC 1BX2A 1DBKL 3L2NA 4FQXD 4A7VA 4L18A 1T20B 2MQ0A 2YJQA 1THCA 3BXNB 2BX5A 1IC7H 1XEUA 3MAWA 2W88A 1DJXA 2PP9A 2Y24A 2YGQA 4BE5A 4XMTA 3UTTE 5E9AA 2C1OB 3PP3H 2H1XA 1JK8A 1VFUA 5CINL 3FPYA 4PJDF 1RLBA 4OZIF 5CBAA 3GRWA 1KBWA 4AL8C 5I18H 5E8NB 1BGXH 2UZXB 2E6PA 3OR6B 4GH7B 2VZTA 4IMKC 4HWZA 2FB4H 2IDFA 4U3CA 4WO4D 5EOCH 4TKWA 1TG8A 1B4JH 3SGJC 4W68A 3V0VA 3IKCB 1RERA 5EOQL 3ZHLA 2Z92A 4L0YA 1TZIA 2V2XB 1IM3B 4L3AA 4Y2OB 3O3UN 4UAOB 3GSQA 4URKA 4MRBA 5ESVB 1HH6A 4FABL 3M88A 4GQRA 2NY0B 3AACA 4A6YA 2CJTA 2FO4A 1EZLA 3MUJA 3D30A 4OFQA 4FA7B 3NCJH 1KYOK 1ZKAA 4G6FB 4W81A 3FUEA 4HCRA 5JHDA 2FZ3A 3ZKXC 3VWJC 4BSWA 1AO7D 3G08B 4KK5D 4MD5A 1F02I 4PWHA 1T3FB 2FWSA 5H94B 3OSKA 4K8RH 4ZTEA 1MPAH 2K4WA 3NSFA 1TQCC 5AW7B 4DOHB 3BRDA 1KXHA 2PUQT 2PYEB 3F6IA 2Y69B 4XHJD 5E9DD 4GG6E 2I9LA 4N24A 1TZ8A 4YXLH 3ULUD 1UXLA 5KS9F 3C09C 5F7HA 1KGCD 3MJ9A 3FCBA 4GUQA 1DBJH 4JN2B 3CDCA 2A74B 4N4YB 2FT7A 3JV4B 3JSSA 3PWUB 1B0WA 1MHHB 4XCCH 4PG9A 3GBNH 3RTQB 1IZJA 3PWPD 4WNJA 1C16B 1C7TA 2QR0A 2ATKB 2QVMA 3DV4B 3FU5A 2CU9A 3C6LD 3NVQA 3QCVH 3CFKB 2CIIB 5EFIB 1R5IA 1L3NA 4LOFA 4KNUA 3TCTA 2EIEA 1PZCA 5F93C 2AERT 2PXYA 2NX5D 4HS8H 1PLBA 3BT2H 3ZL4H 2MH4A 1W8EA 1E3ZA 1CF8H 3EGXA 5D1QB 4E9QA 1OAQL 2J5LC 1BAWA 5D7IE 3CZEA 4KITB 4X5XA 1FYTE 4TTDC 4P4RB 5H8DA 2WLYA 3OGOE 4HJUA 3W81A 4MWFA 4EAEA 3TTSA 3QZPA 2UY6B 4H1LB 3V9EA 1X7TA 3VRJB 1J9RA 3US1A 4AL8L 3C5ZA 4D0CA 3LRGA 2Q76A 4DTGH 3WSQH 2C9UA 3MJ7A 5KSAB 3BDBA 4BKLB 4Y2DD 2G5UA 3T08A 4ZXBA 1UC6A 3IU4L 4IRJC 5DRWB 5F44A 2OCJA 3S96A 3LKQB 3VH8G 2E9IA 3GI8H 2V7HA 4GXUM 4APQD 3ZE0F 2OZ4A 1Z9OA 3C8DA 3BGAA 3SDAA 2HRGA 1M1XA 3HTLX 4RZCB 5ELIA 3VDCA 4G72B 3TYFB 4NO5B 4E42A 5CP3H 1PDKA 1KDIA 3D07A 3Q8FA 4JRYE 4BFOA 3H85A 2C9QA 3US9A 4AMKL 4MXWL 4NZ8A 5KSUB 2K9UA 5EF3A 3G5VB 2O6EA 2VNCA 5KYUB 3KR3L 1FIEA 5DMKA 3T0VA 4BE6A 3GTNA 4DZ8B 1JTOA 1EXUA 2B16A 2GK0A 3GSVA 3RZWA 4UQ2A 4ZD3H 2W92A 3FKUS 1R3IH 3SDXB 5D5ME 4LESA 8CGTA 4X83A 4BIKA 1OY3B 3HPLA 1OVZA 1BFVL 1BOYA 4BCYA 4JDZA 1I9JL 4KO5A 3UJTH 3VRLE 3RWGB 3QCUH 3RU8H 1G7HB 1TYEB 2QPDB 1LO0H 3QA3B 2F15A 1BF2A 3TH4T 1XB6A 1TETL 4AYDC 2XWDA 3PL6A 3T6ZA 2L04A 2E7HA 3WFBL 4A2LA 3Q1EA 4N2BA 4ODTH 5I1AB 2WKLA 4NRZB 4BXVA 3O2DA 4U1SA 2D3VA 1QEXA 3I75B 1OP3K 3UERA 4F33A 1DJSA 4X6BB 5JPMA 2CIKA 4QOKA 4Q4EA 1Z9PA 4U3XA 4ZW7A 2JVUA 3D6GA 1CK0L 4JCMA 1QLEL 3F12B 4NHCH 3VFRA 5HSFA 5DCCA 2ZCKH 3OPUA 2DTMH 2BVUA 3DROA 3B1TA 4P04A 2EEAA 3LNDA 4JG9A 2AK1L 3S88H 2BY2A 3I6KA 2OSXA 1OTSD 4PS7A 3JTSA 1MHPH 3CDYA 4LF3B 3CFCH 5BS0E 5I1CL 1U8LA 5FYJH 3WTSA 6FABH 5K9JL 5D9SA 1BG9A 4EZJA 4NUJA 5CZXC 1TEFA 3HC4L 3PIQB 1ED3A 4HJ1A 4OZFG 4LLYB 3W11D 3HG1E 4W6YB 3L3HA 4X6DB 3OKEB 3TFKC 3HN5A 4JCLA 3O3BB 1ND0A 3LPPA 4J6RH 2GJ6E 3VXSA 3ZT7A 5MEOB 1WZAA 1NCHA 2XV2A 3WE6B 3OKKA 5L4JA 1PG7H 4N8PA 1ZWIB 2QKIA 1SMOA 3CSBA 1EJ8A 3DJSA 3F2LA 4MNQE 5HHVH 3WELA 4EI0A 1SEBB 4N90E 1JPFB 1IQWH 1HL4A 2NSQA 3LPOA 4GAJH 4N6QA 1OCCB 1RFDH 4X8JA 5IQOA 1MI5D 5CP7B 3CX2A 2D0HA 4NGHH 3L7EB 4OZGA 4OCSH 2OLDA 4Q9RH 3EYVB 3SBRA 1KEMH 3GJFH 5DJAA 3QJVB 2FECL 4KHTL 3B2UD 2XWZA 3VGBA 4BGLA 4WEEA 1B6UA 1M2VA 1TITA 3O3AA 1EV2E 4BJLA 4HKZA 4WW2A 3EOTL 1S9WB 3F85A 4X50A 2X2JA 4OFDA 3GZQA 3UYRH 4TUOA 4AYGA 2KLSA 3KHQA 1TQUA 3VQ1C 3OZ9H 2P49B 3TA3C 2DMKA 3ZKMC 4EUPH 1AP2A 1H0DB 3KCPA 2D9QB 4YHNA 3BVTA 1J9CT 3EFDH 3TJHC 3QZOA 5GJSL 2CCLA 3PCYA 4Z76B 2WW8A 3E9UA 4DP2X 3F62A 4UNVA 4QHLB 3R7QA 2ID5A 5LXVA 1YSOA 4I3SL 1W0WA 3FSOA 4PJAA 5C0BB 2XVBA 4N2KA 4AEIH 5IMMA 1CLOL 5JHDD 5J1AB 3VW3H 4FQCL 3EH4B 2VDMH 4AG4L 4X4YA 4LSSL 3G04A 1UXMA 4UV7L 3VYNA 3ZQWA 3MRFA 3SE4A 4N87A 1L5GB 3VVWA 2NW3A 1HSAA 1SEQH 2OJZL 2H6PA 3QG6A 4KKPA 5DQJA 5IUSA 1NSNH 1SUJA 4C58B 1KNOB 1CDGA 2YMXL 1B2WL 3W9DA 5KJRL 3BKYH 3RWCB 4BWUA 1XF3B 2DH2A 2NNXA 4PGBA 5TQ2L 3N9GL 3P0VL 3G5WA 4N3TA 1OAKL 3CSPA 3GF8A 4Z7WA 4RFEA 1IGML 1IM9A 1NCDL 2PXYD 3HBPA 4IK6A 5ACZB 2UUDK 5CEZE 3CN4A 1U93A 3BWUF 3E6HA 2B5IC 4OLWH 1J5OH 1NMAL 2I60L 4C56B 4S1RL 1EVUA 3SZ6A 2Z31B 2W9DL 2FJHA 3OTTA 5B1BB 2FYYA 5IB4A 1DQDL 3DUUA 1NH6A 4L8SC 5D7SH 1BG1A 1JNHA 1D5BB 3LKPB 5C0CB 4EVNA 2CJ3A 5BRQA 4AH2B 4GMSH 3C5ZD 2AJSL 3CDGB 1QWNA 2AXFA 3MLRL 4C57C 1KLUA 3BAWA 4P23A 3D34A 3TO2B 1UCBL 3LD8C 2A4CA 5C6PB 4NZJA 2LTQC 1IMHC 5IESL 2XTSA 3A6CL 3WIHA 1ZCRA 4ZXBD 3VFWB 1RUQL 1N8ZB 4TNVK 3VGFA 1VFOA 4PFEA 3TIDB 3ZK0A 2WINB 4WNSA 2ZICA 4OM1L 3SDAD 1KCVL 2V2TA 5ERWB 3CPLB 3CVHA 4XNQA 4BXSV 4OJYA 1T5XB 3RY5A 1T7YA 4PVMA 1MJJA 3GBDA 3T4AC 5CJXC 3IFLH 5AUMA 2RMNA 1B0RA 2DMHA 1U92A 3R06B 4JR9H 3WFEH 4YDZA 3ELAT 1B9ZA 1AKJB 5CGMA 3BO8A 5DHMC 5E8PA 1V8HA 3ZDXE 5CF3A 3GI9H 1IC4L 4CMHC 2R2HA 2APXA 3NT0A 4NB7A 3L6FB 4RGNB 3FSVA 3TNMB 1Y7VA 4XBGB 4W9EC 2BVTA 3E0GA 4DZBB 5K93A 5FB8A 5C08E 4M8UA 3SE6A 1YUHB 3GMMA 1KPVA 4GG8A 2HTLC 3CMGA 3ZKSD 2KMWA 4IDJH 3N85L 3ESNA 4KGLA 4UANA 4B41A 1QEWB 3PL6D 2Y2TA 2DYPA 4MB5A 2R2EA 3EG9B 2ZAGA 3QUXA 4KPHL 3PUCA 2EYTB 4WGKA 5IB2A 3U4EB 5IMLA 1CICC 3G6DH 3TCLA 4J3BA 3X14B 1TO4A 3C87A 3UMNA 3WEBA 2FT6A 1I1RA 3VI3B 4Y5XB 4K9EL 4XP1H 1KPRA 4QO1A 5F7MC 5B7EA 4QOKD 1F6LL 3NZSA 4HHGA 4L4VE 2CLZA 5C0GA 5DJCB 3NSYA 4UQEA 1P4BL 2IAMB 3CFBA 1H6EA 4OCRH 1ZVYA 5B1CA 2BNQA 4TS6A 3DI2B 5DD3L 1XR9A 1T03L 2JQAA 1ULVA 5EU7C 5DDHA 2VABB 2BP5M 5F9JB 4XN8A 5I8OH 3EGSA 3NSDA 2X3CA 3RVWD 4O2FB 1OD9A 2G30A 4W9IC 4D94A 2SEBA 5FO8B 3FTGB 1AZZC 4PPTA 5C0AB 1E0OB 3AU1A 4UOJA 1WPCA 1H5BB 4D9QD 1NOLA 2AQTA 1RAMA 1OIOA 2QMJA 1I7RA 3BPCA 4WJ5B 4IRSC 3EO0A 3L3KB 2Z91B 4WWNA 3VXSD 1OGSA 2XY2A 1BYPA 1F8TL 3IJEB 1K85A 3NJXA 1IC5H 5IFJB 1YEEL 1QLRA 1H8SA 2PTVA 3DYPA 4B9PA 1SVCP 1NCAL 2GJRA 4FTVB 5C8JA 2XYCA 2Z8SA 4AV0A 4XTRC 1A02N 3ZDYF 4I9XA 4PP2B 4DSYA 4UAHA 2AXHA 3QDME 2BIQA 5FF6B 2O93L 2XTJB 4X6DF 1XR8B 1R5WB 3OLIA 3PS6A 1KFAL 3IXTB 4P3CH 3VD2A 3VUAA 4WI7A 2IMNA 5GHWL 4UUJA 4JK0D 4H26B 4PJBB 4GSXA 4MS6A 2YWYA 3MA9L 3NG5A 3WYRA 4QRSA 1XGRB 1HINL 4AENA 2I25N 3I9AA 3NJLA 1RJZB 4GSDL 4ZUSA 3BAJA 3E2HB 3QNZB 5FK9B 1QR1B 4Y4FB 3VFOA 2EVFA 2F08A 4PTTA 3ZXAC 5I5MA 1NGYB 4WCYH 4PGCB 1U58A 3OHXB 3NMEA 3P9WB 3K3QA 4LVNB 1C5DA 4XT1C 5FDWB 1OE1A 4XP6H 5FX3A 3B6SB 3FFCA 4XMLH 4BZ1H 1QASA 2B14A 3ZIMA 4D0BB 3Q6FB 2LU3A 2VQUA 4GNKB 4JFHD 4G6AC 3RGVA 1NFKA 3BIAX 3QEHB 3QZWA 2GJZB 4GBXB 1ZHLA 1P7BA