2WJ7A

Human alphab crystallin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ALPHA-CRYSTALLIN B CHAIN
publication title Crystal Structures of Alpha-Crystallin Domain Dimers of Alphab-Crystallin and Hsp20.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 85
sequence length 85
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wj7A00
3QORD 1WGVA 2WJ5A 4PCKA 2KMWA 1GMEA 2N0KA 4YLBA 3QORA 2JKIS 2CR0A 2O30A 3J07A 4M5TA 4YE0A 4YDZA 3EUDA 5DS1A 1EJFA 1WFIA 4I88A 2MNWA 3GUFA 2BOLA 3QORC 3L1EA 4JUSA 4M5SA 5LUMA 4JUTA 3N3EA 4PBDA 1RL1A 4YLCA 5DS2A 2WJ7A 3AABA 3GT6A 3W1ZA 4MJHA 2RH0A 3VQMA 2N3JA 2Y1ZA 1X5MA 3L1GA 2KLRA 4ELDA 2CG9X 2Y22A 3Q9QA 4RZKA 3AACA 2Y1YA 3VQLA 3L1FA 2K8QA 1WH0A 3GLAA 4YL9A 4FEIA 3Q9PA 1SHSA 3IGFA 4ZJ9A 3QORB 2XCMC
chains in the Genus database with same CATH superfamily
3KPNB 2DQEH 4N8VA 4KRPB 4G8EB 5TE6H 4KGLA 3T2NL 4F91B 4HCFA 1PYWB 3CXHK 1FVEA 4W6WB 4OJFL 4D0DB 4B5ZA 4EI6A 1OE1A 1RJYB 4JO3L 4GG8A 1C5DA 2EKSA 4R8WH 4WIQA 5EBLA 5FYKD 3ZE2E 4PR5B 1ORSB 2EACA 4XCNB 1HWWA 4FTVB 1PG7H 4TL4A 4H8WC 1H9VA 4UUJB 2AZUA 4P2YA 4YL4A 1RCYA 1R1CA 4O9HH 3M86A 2H7WA 3WTWA 2NYKA 3PNWA 3FQXB 2AAAA 4K7PL 1QA9A 5EU6A 1ZRUA 3AM8C 1F58H 2IJ0C 4TVUA 4PLKD 3JWDL 2N0KA 1QBML 4I48B 1OO2A 3FFCB 1KT2B 2XETA 2XDHA 5EN2B 4ETYA 2BP3A 3VNYA 1PY9A 2VIRA 4XP5H 5ISZA 5B7EA 2ATPB 4FQCL 2VLJA 3F6IA 3L5JA 1BEYL 3MLSL 3VU2A 4R7DA 1G7MB 1U2HA 1XD0A 1W91A 2EZ0C 3V0VB 2G9HA 3QCVH 1Z5YD 3VXPB 3SB3A 4ZI8A 3T0EE 5H37A 1O9VA 4XOBA 2JF1A 2IH3A 4JM4L 5CZKA 4PJ9A 1GYUA 2CJSA 1QFUH 4Q2ZB 4GP4B 1CQKA 3HS8A 5CLXA 3TA4D 4C55A 1SDAB 4M5YH 5EMYA 1RJLA 4BFIA 4GKNB 1KCBA 2J7LA 2P43B 3CHPA 3VVVA 1N6QL 4XC1L 4B96A 3G6JF 4IOFC 3FO0L 2BERA 3CU7A 4UM8A 5GS1C 4NS0A 5MERA 2AQ1A 4F9LC 4J3TA 1ILSA 4LSRL 2HCZX 3ULVF 2BNUA 4HKXB 2O5XL 1MFUA 4WUUA 1D9KA 2G2PA 3SDXE 4XMUA 3WIFB 4QHUA 4ZQKA 5C0CB 1RVFH 5E23A 1OKEA 3K1KC 4ZAKD 2QKIB 5ILTL 3AGVA 1M6OB 1TZAA 1VGKB 4GSRA 1HWHB 4MD0B 4RESB 3IT8D 4X6DE 3V4VL 1LO3L 1AQ8A 4MNGA 2WWNA 1HCZA 2VLLA 5GS2D 3VI3F 3F00A 1WSST 3DA0A 3MRKA 3T6XA 4QHNB 4MQXC 5KJ4A 4HJ0C 1Q9LA 2VDPB 1RULL 1JTOA 4N1EA 5IHZA 4RMRA 2AITA 4JFXA 3G7TA 1LP9F 3IDJB 3WUZA 3KYNA 4N2EA 4E9SA 1X9QA 3F7PC 2WXRA 3GFUA 1SOXA 4EZKA 4N3TA 4Z7VE 2C9XA 3FF7A 1AE6H 3MRIB 4L8SB 1IEBA 1YNKH 4DQOH 3K0WA 4G71B 2OMUB 4E42B 5F1NA 2FCBA 1NAML 3D0VA 4B50A 4BZ1A 2NZ9C 2J44A 2XPYA 3AABA 1TLMA 4AKQA 1OSYA 1F3JB 3CBRA 2VC2H 4ANKA 1JZGA 5IMKB 3K81A 4TSCL 1JJUA 3T77B 4LARL 4M6NL 5I1LA 2Q2LA 3NSCA 2VLRD 1OY3B 3AG4B 2R23A 2PCPA 4YGVB 2P47B 4OJFH 2RCSL 5CCKL 2YD0A 4JO3H 4TNVF 3OAUL 5E24E 2AK4A 3B9EA 1F18A 4G7VL 1NCCH 2FEEL 1GZHA 1AZCA 5PCYA 5JXEC 2ZX5A 2Y6SC 4WKZA 2A77L 2GBVA 1PNCA 5KVFH 4GP5B 4PCYA 4PRDA 5IQ9A 3OC8A 4F58L 1GZQB 3BH4A 1A9EA 1XBDA 2O72A 3R1GH 1EFXA 4PJCB 3UTQA 4M7ZB 1AXSA 3JWDH 3QJFB 1FG9C 1QBMH 5BZDA 1OPOA 3BPLB 5IW6B 1MJUH 3IJSA 4LQ1A 3EW3B 2ZCLH 4U6XA 5T1MA 4FQCH 1ND0A 2DBLL 1TSRA 1IAIH 3BZ4B 4NRYB 3MLSH 4P2OB 3MFFB 1U92B 1KYOJ 5AW6B 1GPOL 2CO6B 4X98A 5A16B 4CN4A 2ICWJ 3NPSB 2W5PA 3TP4A 4IKLA 4BWWA 4JM4H 5A1AA 1LD9A 1RU9L 4PTUA 2VKXA 2DI9A 1T66C 2YAPA 5FX3A 1OF0A 2ROXA 5DUJA 4ZMYA 2WW8A 3S3CB 5EU6D 4ELKA 4IGBB 4MDRA 3RPIB 2YKLL 1KV3A 3OZLA 4FABL 3L4VA 3UTSA 1S9WA 1F42A 2X38A 4HIJB 1X7TA 4HU8A 3WTTA 2O6CA 3MV7E 4K4KA 4LF3B 1QFWL 4XC1H 3WLWC 2FJGA 2UYLA 4ZW8A 3MNWA 2DM3A 4YSQA 2GAZB 5JTWA 2VLJD 4JFHD 1M1XB 3P30L 1TZIA 4I85A 1EVTC 2O5XH 5DYFA 4GJTB 1QPPA 1SJXA 5CU9A 2WVTA 4HKZB 3WFHB 2B2XL 4G3YL 2X70B 2XKUA 4K9EH 3X11B 4OU3A 5D8JL 1Q0YL 1THAA 3TXAA 2DLGA 1S7TA 2QR0B 3BUYA 1H3TA 4Y2NA 4LLMB 3V4VH 2HMID 4QRPB 3RWJB 2PO6C 3K6SB 1J0KA 2J4WL 4YX2L 3T0EC 43C9A 2XBZA 3BHBB 5CCGE 5DD5L 3D30A 4PG9A 1SOKA 4EZJA 1ZKAA 2V9UA 3KPSE 4ZTOH 3HN5A 2HH0L 4AM0Q 1CBJA 3KYOA 4B9ZA 3KDMA 4WUUD 1OP3H 1D9KD 3RDTA 3VM5A 1VEMA 3NJNA 5A2IH 1FYHB 3WSQL 1I8LC 4ZJ9A 4UDTA 3X14B 4YSRA 2ZP9A 5FO8B 2EVHA 4AL8C 3VFWB 4Y8DC 4N2KA 3UTOA 4I4WA 5FDYA 2Y5QA 3EOAB 4NZJA 4OQ1A 1UKSA 1C9SA 5J1AA 1IGIH 2QADB 3GJEA 4A2GA 2NOYA 3D2UA 2YOCA 5D1QD 4MXQC 3L5WB 3WLBA 2MOVA 2FVNA 1HNGA 3PWJB 2GTWA 3PJNA 4HFWB 5C2BL 4ONHA 1TNMA 4TSCH 2Y3AA 3DPBA 4M6NH 4FFVD 4ZDHA 3FONB 2GT9B 4GQRA 5HHOE 3HNVH 4Y4KC 3H85A 5T33H 3CXHJ 3QS3A 3UYPA 4AGMA 3SGKA 5CCKH 2RCSH 3QDMB 4AJYV 5C0BD 5BW7A 3AROA 3WS6A 1U8CB 1OLLA 3QUYD 4Q6IA 3OAUH 2NZ1A 3MRQB 3O4LE 3BT2L 2OJZL 2XOTA 3ASWA 4XN1A 1CK0L 4KK9D 2DQFB 2A77H 2VC2B 3E8UL 4WI8A 1MFEL 5EG6C 2NY7L 1T21B 3O6FB 1E7UA 4HKJA 1K4DA 2EDEA 4G82A 2VO5A 2FEEI 2UV3A 3GMLA 4R4FH 1ZTMA 4G5AA 1T2JA 4F58H 4C54A 4P49A 2QSCL 3WY4A 1JD9A 1KJ2A 2HLAB 1C8PA 1HK6A 1IRAY 3CTTA 5JLZB 2XQ0A 4J6IA 2H9GB 4FLRA 4DOHB 2WWKO 4EI5D 1AMXA 3T0XA 2JJTC 1NCOA 3QA3B 4QHLB 4GBXB 3FUFA 4HIEA 4N0CC 2K70A 3FCSA 2AK4D 3BAJA 4L1HA 5EU4A 3SGJC 1QR1A 1CICD 2PW2B 1M71B 4JPIB 5EOQH 5I82A 1GPOH 2BOLA 1TQUA 2IPUK 1ONQB 2YN3A 1R0AL 4YDJA 4JE0A 2CO3A 3RZWA 1FDLL 1BVLA 4FTVE 1RU9H 1T1WA 1F3DH 5HSFA 1PAMA 2HVJB 1YQ2A 2R15A 2ZOUA 4YBHA 4OF8A 1YY9C 1KCUH 1OPGH 2EEBA 2Y22A 1NCHA 1I9RL 4KXCA 4OLYL 4UILL 4DN3L 5FPIA 5HYIA 1ZGLP 4FABH 5E9DD 7TAAA 4XMTA 1XVSA 1T6BX 2JB5L 3WAJA 4RAVB 4BEIA 2A9MH 4X5QA 5K1VA 4AIXA 3FFCE 3KYAA 2V2WB 1QSFB 5D7LB 3TJPA 2YJQA 4TPRL 1NEZG 2DYPB 2GFBA 4YDIL 1AS6A 1IO4C 1NBQA 4MB1A 3NOIA 2GI7A 1QFWI 3K2UL 3OKKA 4GLRH 2Z8RA 1ACZA 3OJDA 4WWNA 4ZMZA 2Q6WB 1Y1DA 2Z31C 1U30A 4G3YH 5AB2A 1AFVH 4B7IA 3HZVB 1XH0A 1SMAA 2FD6L 4NNXB 4QHPA 3PAUA 1Q0YH 5L4FA 1AGEA 3VH8A 1FYTB 4XMZA 3KZ8A 4UOW1 3JV6B 1KJMA 3UTSD 5KBNC 3P0YL 4QTIH 2YRLA 3HA0A 3KEHA 4MXWH 4YX2H 1MHCB 2CK2A 5FDWB 2XPGB 5DD5H 3VRJB 3NGBC 2BCMA 3LS5L 3FQYA 3MLTA 4LLYB 4HP5A 3B8YA 3GM8A 3WGVB 4OZGF 5DEFB 2Y5TB 4EN3C 3ZE1F 4N8UA 3NIDE 1YZZA 4OD3H 4GO9A 2HKAA 2HVBA 1HAUA 5F1SA 2X05A 4CSPA 5C0CE 3KBEA 3GEWB 3VJ6A 3GXFA 3PHQB 5ITFB 3V4VB 3GI9L 2JCCB 3MCLL 3NFSL 1D5MB 4OFPA 1NGZB 5C0DA 4HC1L 1OGTB 2IDUA 3VFGL 4I5BB 1CD1A 4PN6A 4Y4FA 1H0DA 3WFDL 2XWDA 2WN2A 1JGUH 1YECL 3AU1A 4APQA 4QRBA 1JWUA 3EJYC 1Z5LB 1E5CA 3WV0A 1HILA 2G3NA 5AD0A 1CD8A 5LBSL 5DVKA 3PLYA 4OZIF 1VGEL 3RVWD 1QRNA 3BWSA 1WZMA 1U8OA 5HYSG 4O2EB 3J07A 2GHZA 3UEQA 3UERA 3LZLA 2WSKA 3BT2H 2F15A 1AD9A 3DGGB 2I24N 4UQ3B 1ZSDA 2AV7B 1NTDA 1CK0H 3JTTB 1ZXKA 4IKKA 3D2UD 5EO0B 3E8UH 3NSFA 4N1HB 4B53A 5C0NC 4FULA 2NY7H 1IILE 1UM6H 3ZZ1A 1HEZA 3S48A 5B38G 5C8JA 1KGXA 3D39E 2CUMA 4HSAC 4B9JA 2GJZA 3OVUB 4AIOA 5TPWL 1DJSA 2MPAL 3IAQA 4C47A 4JFED 5TDOA 1F5WA 4D8OA 3Q9PA 2Q10A 3ZX1A 3QWOA 3BZEB 5E1AB 1OK8A 2X0VA 5KN5B 5DO2D 1ZHBA 5FOJA 5D1XD 1KIRB 2VABB 4I0KA 4U3CA 5FM4A 4MDIB 4P0DA 4BSWA 4K23H 1FDLH 1ORQA 4JEGB 2IALA 2ZUQB 1FNHA 4WO4C 3BSZA 3ZQWA 4GRWH 4I8DA 4PVNA 4OLYH 4RDQG 2KUTA 5JPNA 1I3RA 2ADJA 3QPXL 4DN3H 2HX7A 3ULVL 1YN7A 2KZWA 5I1CL 3WE6B 2P49B 3ECBA 3D50A 3KWXA 5DD0L 5DHMC 1E5YA 4WO0A 4AYSA 1GC1L 3BFOA 3KW7A 1S7UA 4TPRH 3OXSA 1DN2A 3ZGHA 4WI2A 4YDIH 3QBTB 2NNCA 3HR6A 1FL3B 2PYFA 2Y24A 3K2UH 4PS8A 2AAVA 4DK3A 5D7JA 4ZFZB 5DEZA 2I85A 1EHKB 3Q2LA 4ABUA 5FLUA 3Q3GB 1TVBA 2PXYB 2WBXA 1P6FA 5FYKL 3U2SB 4PP1C 5HI4C 1UTDA 3WI9A 3BX7C 2WNKA 3PWVB 4KY2A 1P69B 4TXVB 4P59L 3NK4A 2WNXA 1N59A 3EFOB 1A7QL 1WCBA 3D05A 2OR7A 5JHDA 3GXIA 2FEDD 4BHUA 4JN2A 3O3EA 4OVUA 2A83B 3P4NA 2NY5L 3Q8AA 2AVGA 4IDLA 2DWDB 4O02L 4YHML 1TYRA 3MXVL 1S9VA 2V3EA 4QWWC 3NEXA 4R4BB 3C8KB 5IQMA 1LTXA 4RIRB 3AY2A 3X12B 1TXKA 5HGBB 1TKWB 4AYFB 3T08A 3UC0H 3MCLH 4AQEB 3NFSH 4JFYB 3D85B 2FUQA 3PQYA 3RGHA 4F33A 3DO7A 4HC1H 5B4MC 5K1JA 4LHUA 2AJVH 3RTQD 4M8QB 4EUPA 3OGCB 1N6VA 2L7EA 3IJHB 4N2HA 3SD5A 4U1IB 1BZ9B 2CKBA 5C3IA 4HS3A 2JFCA 1DSWA 5TFSH 5LBSH 3IVKA 4IIQB 3W5MA 3TBYA 2AJYL 3VFOA 4KKAD 5EBGA 4XNAA 3QJHA 2OTWB 5A2KH 2V8MA 5ID1A 1N0LA 3QXDA 5IQLA 4A04A 2ICEC 3FB7A 2QL1A 4NC1E 5EZPA 3CGTA 1T1ZA 3FOMB 4Y4FD 4ZFOA 4NBXB 4GAYA 2MNWA 5L2KA 5FA4A 1UXWA 3MUUA 2F5AL 3OF6D 2QKIC 5TPWH 3ZY7A 4Z7OB 1QRND 1UD4A 4RGNC 4FOMA 1JNHB 5IG7A 1DANU 3OKDB 3QDME 4KRMB 5GZNC 5D7HA 1IFGA 4XP1H 1TLKA 2MNJB 2W60A 4HJSA 3QSKB 2ZWZA 4OY9A 1MCOH 3W0WB 1ZGLB 1JFHA 1KWGA 1TTAA 1XB3A 1VADB 1Q72H 4A38A 2VXQA 1BPVA 2QQKL 1EXUA 2X4RA 2I9TA 4YIQA 4DP4X 3O3BA 4JVPA 1BQLL 3EDKA 3P4LA 1DUYB 5HHXH 1ECZA 5JIHA 3ZT5A 2ZCHL 2VR5A 2C26A 3ZZQA 2AK1L 4DOHE 1E0OB 4R84A 2BWQA 1Z0MA 1XV8A 2ZCKH 5E4OA 5HHMB 1EAPA 1SLVA 2HLFD 1LVEA 2E4TA 2LE9A 4Y1AB 1ET5A 4OFQA 3PJLA 4IHOB 3CMOH 4W4OA 1GGUA 2FJHA 4UNIA 2UZYB 2D9CA 4GRWB 1MHPL 5CBAA 3UTZA 3E3QE 4JO4H 1K4CA 4NZ8A 3U4EB 2WLLB 4FQLH 3TPUB 3DO4A 5ALBH 3B2DC 1A66A 3PXJA 4DGVL 4NO2A 4P59H 5EOCH 5LDSA 3S4SB 5I0VA 4K0OA 3EO0A 4HETA 4P4RB 4MMZC 4DPCX 1HHHA 4AQ8C 3HLAA 5D7LE 2NTSP 3BVDB 2XG5B 3A23A 3GS0A 4O02H 3W11C 2EVJA 3MXVH 4P2RB 4N90D 1UB6B 1E4KC 1IQDA 1Z9OA 2Z93A 4X50A 1E6OH 5DMJB 2XFXB 1CFTA 4WDIA 3G5VA 1NBVL 5IOKA 4NKMA 4L3FA 4X0KA 1GXEA 3DX6A 2VR8A 5HYQB 1UOVA 2F58L 2WWKT 3D0AA 1NC2B 5AVWB 5JHDD 4LNRA 3T4YB 5GZOC 3RAJH 2CU9A 1MRCL 1MUJB 2C9SA 4QJ4B 3G5YA 2HZHA 1SEBB 2J3SA 3DVNB 2VOTA 5JOPE 1N7ML 2ZG1A 1N8ZB 3HC0A 4Q14A 5D5MA 3OAYH 1YYMH 3SYCA 1PW3A 4A2HA 2PCFA 3OZ9H 3B2UC 3Q6GL 1WP6A 2AJYH 3C2SA 3F2LA 4U6VH 5MEOB 4JL2A 1U8HB 1UXSA 4J1UB 4H0IA 4AMWA 4ZMOA 2TSBA 1P4BL 4XNMA 3VX1A 3JVFC 3AY4C 4AGOA 4OUUA 2JCCE 3PQYD 3VXRA 1PU0A 2R4RH 4U1SB 3ZDYF 4JG9A 5DJ0B 1CZ8L 2QV4A 4KKBC 3ASNB 4YN3A 4YUEL 2DLTA 1BVZA 1A1MA 2BW5A 4GXUN 4WEUD 4MCZA 3FQ4A 5IFHL 2LT9A 3SCMB 3PABA 3UAAA 3SPCA 4JKPL 2F5AH 2P44B 2XNAB 5KZCD 3SKOA 1W2KT 1ZVSB 1WPCA 1X9RA 2PPFA 4JB9L 4PJ7A 4HSCX 4WFED 3WXVH 5I1AB 5IESL 1IE5A 2ZXBA 3NESA 1ED3A 5BMFL 3CQPA 5I1GL 1AANA 1BCIA 5BZWA 4F8TA 3WNJA 3VSVA 2X4OA 2DLFL 4TQ8A 4TN9A 3MUGA 3FT9A 1T04B 1KJ3L 3IWVA 2YAQA 4KRLB 3TN0B 5T1KD 1IEHA 1F8TL 4ZNEE 3B9KD 1A6ZA 4L23A 3JYCA 1NFDE 1SYSB 1HCYA 2CE6A 1WK0A 3MUZ1 3FUKA 4H2CA 1EQWA 4G8IA 1T0NB 5D93B 4P23C 3GXPA 1TQCC 2AK1H 4R9HA 5IEHB 4NC1C 1XSKA 2DQTL 3DV4B 4F7PB 4GINA 2VXSL 4HIPA 4NUJA 2QMJA 4ONFL 5E2UH 5CKGA 3FB5B 3FUDA 1I7RA 1XTLA 5T3ZD 1A5FL 2CHWA 4ES8A 2VMDA 1MHPH 1E28B 1VFBA 2X0WA 3FNKA 4BSJA 3OMIB 5HVHB 2C9RA 3LZNA 2GC7C 3K6DA 3X3FL 1HCFX 1NA8A 5CJXA 2E47A 4NT6A 3LKNA 4TNEA 1WITA 2B20A 2BNRB 4PVMA 2IH8A 3B7TA 1D5RA 2CIKB 3QUKB 4BZ1L 4HF5L 4Q97A 3M7OA 5JO5A 1T89A 1M57B 4QR7A 2Y1YA 4YO0B 3SYQA 1VJSA 3LB6C 2ZUTA 3O6FC 3BWUC 2B59B 1Y0LB 1AKPA 4WVRA 3FN3A 4JPWL 4KKCC 4H8HA 4YWGL 3D12B 1UGKA 1KCSL 3N1FC 1AGDA 2Z8SA 2WZ6A 1RK1B 1XCXA 2X2JA 4Z5RB 3CZGA 1JPTL 1BJ1J 5HGHA 5LQBL 1NBVH 1L9SA 4AE0A 4RMBA 1BLNA 4HLEA 4PBVC 4P46C 5E99H 2ADFL 5IREA 2APTA 5DD6A 5GGUA 2VM9A 4ALAH 3A4EA 4U1HA 5JDSA 1ZT1B 5BCAA 3E3QC 4O02B 3B3IA 3RVUD 2DN7A 5DDHB 2W0FA 2JKWA 3GUTA 1Q8MA 3UC2A 4ONOA 5IJVA 1I3GL 1KOAA 1QWNA 3ARDB 3HE7D 3O45A 1CDGA 1YAZA 2NTFA 4K71B 2C34A 1Y7VA 4OIIL 5J7CC 4R7LA 3MGTA 1LMIA 3VMOA 4HJJL 4G7SB 1P4BH 4GQPH 5H37H 1OTSD 5I76A 4X4XA 4JFVA 1OL0A 4PP2B 3LD8B 1SUJA 3T3PF 3TTSA 1YMHB 4NFCA 1F4XL 4YUEH 2FLBT 1JI1A 1VENA 3TBWA 3ECWA 5D55A 3DARA 1UQSA 1MFVA 4ODXA 4HU2A 3RKPA 2Y2YA 4WK2B 2CRZA 2N0MA 2NW2B 4GXFA 4XB8A 5F7UA 5CMAB 3RB5A 4JB9H 5DZVA 4L1TA 1R3IL 5JDJA 4Z3TA 3OB0H 4PBXA 1V7NL 4KUCD 4X6FB 3OQ3B 1T5XA 2WXOA 1A9BB 4LRIC 4U1MB 5I1GH 2HKHL 3NFNB 3WO3B 4K3DL 5GS0H 4PS4L 3GTVA 4LKXB 4W6XB 4Y4HA 2R83A 4M6OH 4IMLA 2GTZA 1CQYA 2LFGA 3FSVA 2GPZA 4NPYA 1ZANL 1KJ3H 4QRQB 2PCXA 2Z64C 4DH2A 1F8TH 3HFMH 1DQTA 3NZHL 3VD7A 4W70A 1X5JA 1FNGB 1UOLA 4WW2B 3TVMD 4RFOL 2VISB 3RFZA 5F7WC 1BMWA 4HIHA 4JJ5A 1F4AA 4Z7OE 2DM4A 1XIWB 2Z0BA 3PY9A 2E5EA 3MUHL 1MXDA 1DHKA 2FATL 3HBGA 4LSVL 4NZRH 1S7WA 2XRAL 1EMTL 4JAMB 4IRJC 5J0BA 4ONFH 3B7RL 2ADGA 2NUPA 3UO8B 3VYPA 4CVZB 4XXCA 4P2QA 5AVQB 1SN2A 3QDJD 3L3HB 3F7RA 1IMHC 3LS4L 4PWGA 5E1QA 1BM3H 4WFFD 5E8PA 2VXUH 3MRMA 5AVTB 3W0WE 3N50A 1UA7A 3AXLB 3RIFK 4GUPB 5H4YA 2FBRA 4OIBA 2ZUVA 5D2LB 2GBUA 3QEHA 2OTUA 5ICUA 1EZVY 1Q90A 3OR6A 2K3HA 2YR3A 4PLNC 4BZ1H 1FCCA 5K9OB 3QG6A 4MGXA 1UOKA 4L3EE 2Q86B 2P8PA 4XGZA 4Z0BL 2NYZA 2WLIB 4JREB 3ZHKA 5C9JA 2CBTA 4OAWB 5HHME 1OB1A 2PP7A 4EKJA 3ABLB 2RJMA 3DIDA 4U49A 4YWGH 3OJVC 2WBJB 3V9CA 3FFOA 4AUYA 1ZVYA 2OX5B 3HZYA 4PJDA 3KPTA 4PJGB 1FL5B 1KCSH 2WVSA 2R1WA 2KS0A 5SWZB 3WNPA 1E9QB 1CLCA 1V05A 5D7EA 3E6HA 4RZCA 5D5MF 2AJZB 4JM2D 1J8SA 1XFPA 3EGDB 4PJXA 1KB3A 4TVPD 3ETBJ 2ADFH 3VD5A 2XXMB 3AS3A 4KUCF 3SKJH 3V6FA 1HH6A 3MAWA 3OWEA 5DZJA 1DDHA 2CXGA 3N43F 4AGQA 1HC1A 1UH4A 3JWNH 3QHZL 4X8CA 2J88L 2ZUQC 4AWJC 1KJ2L 1G4MA 2O61A 3KJ4B 3HG1A 3P3SA 4NQDB 1AY1H 1WS8A 2IO5A 3ISYA 1PS3A 4EI6B 4GG8B 3ARBA 3RA7L 1EK3A 1WJ3A 3QS2A 5AZUA 4OIIH 3SQOH 5DLLA 4HJJH 2IADA 3C6LC 1M7IA 5M94B 1CWVA 1LO2H 2X7LA 1OE3A 1TDQA 3C2AL 3GZQA 4X80L 5DVNA 2LU7A 4NBYB 3C9NA 5CO1A 1QA9B 4TF4A 4ESKA 1C8QA 2X4NB 4CAGA 1W80A 1DBML 1F4XH 4I2XA 1UM4L 1YEWA 3ECUA 2VIRB 3KLQA 3THML 5ISZB 2A6DA 1CR9L 3A22A 1K2DA 1JS4A 4P57B 1FWXA 3RVVC 4UU9A 2GVYA 1U2CA 3FRPG 4S0SD 1V7NH 4YHPA 4M43H 3HFFA 1AKJA 4QI3A 2IH3B 3MR9A 4K3DH 4V33A 4PJ9B 3X1EA 2VN6A 1RUKH 4N2NA 1RJLB 1ZANH 2BSCA 4BFIB 4U6TA 2YHGA 5DJAA 1JIBA 3T9WA 3NZHH 4FG4A 4Y19A 4DWHA 4KXDA 4M1CC 4UM8B 4BUGA 5MERB 4QDGA 5SX5H 2YGVA 5FUOH 5HDLA 3BAEL 5DMGD 2BNUB 3E2HC 4PY8I 4JM2F 2NR6C 2CNYA 4EZLA 4LSVH 1FVDB 4Z7NB 2XRAH 1ET8A 4S1DD 1YPZA 2FJFA 3GHBH 3HB3D 5EOTB 4C4KO 2EVFA 4ZQKB 5F9JA 1BD2E 3R8QA 2J5LB 4AIZA 1BVNP 4Y4HD 2XVKA 3STZA 4KK5C 1ZLSH 1M3IA 4OUOA 3JZ7A 4L3CA 5L88L 4IIQC 4KX8A 1W9XA 2VLLB 1X44A 3WY2A 2DMGA 4NO3A 3V5HA 3DECA 3ARPA 4KQ4L 2XX1A 4LDCA 4XHJC 3RKDC 3FRUA 5BUAA 2WLJA 5IHZB 1BXAA 3MFGB 2QHRL 2DTMH 4Z0BH 3SDAC 1J10A 1E65A 1J9QA 3ESNA 2NLJA 4P2QD 1OOAA 1S7VA 2Z7WA 4YSPA 2NY6C 2J56A 4FHKA 4U1NA 4OZFA 1NCIA 5DJ2A 3G6JE 2K6YA 4J8QA 4Y0GA 1LM8V 4FL4B 5C1MB 5HPOA 5F1NB 1F3RB 3ULVE 3DXAA 4H20L 4NN7B 2BHYA 1FE8L 5HGAA 2BNRE 3S3JA 4DVBA 3T71A 2Y4SA 3C8DA 5I1LB 4JKKA 3TYGL 4CC4C 4AM0A 2Y23A 1KBPA 2R2EB 3QHZH 4YSTA 2W1NA 2J88H 2PCPB 4JHWH 4L2YA 4P9ML 2B0SL 4AQOA 1G7LA 1OD9A 3LXCA 5KJRL 2FTAA 2E6QA 2H0EA 2WUCH 1M7DA 5CN2A 5L4JA 5MHSD 1EDHA 3VI3E 2EXWC 4UNUA 5LXVA 3S7GA 4CL7A 5FYKE 2GC4C 4IK6A 4M1DL 5ADPL 4WKZB 2COVD 4J5VA 1JGEA 5FUZL 2DQIH 2VL4A 1ETB1 4PRDB 1LEKB 3K8LA 1PZ3A 4HLZH 3ZKQD 1AMYA 2E7CA 5IQ9B 1SXCA 1ACXA 1BECA 2GJJA 4X80H 3ZKXB 3BSZL 4KX7A 1S5IL 4Z7WF 2C9PA 1A9EB 3UTQB 2NDGA 1DBMH 1EFXB 3C12A 4Y16D 5CJOH 1AXSB 3UBXG 3ZZSA 1EX0A 1UM4H 2E7BA 3HG1D 2BX5A 2FNBA 2HP4A 4PV8A 1LEIB 3THMH 4U6XB 1CR9H 1ND0B 4GAJH 4JLRB 3ZLQC 1JFQL 4B6ZA 3B8SA 4QRRD 1Q0EA 2ESVA 4X98B 3SE6A 1OT4A 4Z7AA 3N85L 1DJHA 3EYQC 3LHPL 3IRZA 5EZOL 1LD9B 3DOHA 4PTUB 2FX9L 3ZTEA 1BZOA 2I32A 5IROC 2YPLA 5F0JB 1M05A 3T6ZA 4FFZH 2VL5B 1IC4H 3UTSB 1S9WB 4QD2E 5E95B 1H9DA 4CMMA 4UBDC 2FJGB 4PHZA 1JXFA 3S5LG 2UYLB 2W9LA 3MNWB 4DVRL 2Y6TE 5E2WL 2FX8L 2HG5B 3A4AA 4FQXA 4NQTA 3C87A 1G9MC 3HJ0A 3KYMA 4LCWD 1PKOA 4LOFA 3VGAB 1TR7A 3ZU8A 3SOTA 5MEQA 5J1SC 1AKJD 1X9LA 4OIFA 4HULB 2YXVA 1T7XA 4TTDC 1JN6A 4UT9H 3TF7C 4MJIB 4A1RA 3OHXA 3BUYB 4LAJH 5L88H 4BFGA 3F7QA 1A6TA 3IMVA 4MCYA 2BSEA 4FQHA 43C9B 3BOVA 4PJDF 4YH6A 1W0WA 1NMCC 3ULUD 1XGRB 3BUDA 2O30A 3NCWA 4PG9B 1JV5A 3ATDA 2H3XC 1FORL 5IQOA 4LEBA 3TV8A 2P42B 2PW1A 3QRFM 3KYOB 3KDMB 3HI5H 2N1TE 1MRFH 3RDTB 2IWFA 1Q4NX 1OTUD 1OV8A 1UOWA 3RUGF 4FLOA 3SCMC 3HTLX 1MVUB 2WV3A 1PX4A 3BKCL 3EOBA 5F89A 3U1PA 5LWYL 1K72A 1KCLA 5T5NG 1II4E 5D70L 4I4WB 2F18A 2Y7OA 3TJHD 2IDFA 5HDWA 5J1AB 1F1GA 3GJEB 1URIA 4K7PX 4DAGL 3WLBB 5I15H 5ERWA 2YPVA 2XIDA 3NJGA 2AW2A 1JZFA 5D2LE 4H20H 5F21B 3O4OC 2UY7A 4ZFOL 3DPBB 3IPBA 4FP8L 4NN5B 1BYOA 4LL1A 1KMGA 4ZDHB 1BEXA 3W2DL 2GHWB 4BKTC 4LPUA 3VGEA 3UMTA 3W3BA 4WTXA 2VLRE 4P9MH 3UYPB 3N0PB 5FECA 2MKLC 1QNZL 2Q76B 1U8KA 4KXZI 2APWA 4Q6IB 4JANA 3RL1A 2MNUA 1FRGL 1ZLDA 2AXHA 2CXKA 4PJGE 5D93C 3PWPA 2CM6A 1LL1A 4M1DH 3AVEA 4S1SL 5FUZH 3STLA 1WBXA 1K4DB 1MJJA 4N5ED 3GMLB 3FFDA 3VG0H 3WD5H 5FHAL 4CKQA 2VXQL 1UT2A 2X4UA 5JW5A 2GEEA 1BQKA 4L9LC 3WMPA 4LLAA 1U8IA 1ODUA 5ECGA 4IRSD 3UZEA 3BFQG 1O6SB 4HH9A 4BKLB 1WISA 3ULVC 2R0KL 4HIEB 3ZTDC 3FBKA 3FCSB 3HE6C 5EU4B 2OXHA 1JFQH 2E4FA 4YVNA 2X6UA 1GKOA 1GC1C 3ULUF 1CE6A 5DQ9A 4YDJB 1KENH 3P4MA 3LHPH 4D9RD 5EZOH 1BVLB 1LE5A 43CAA 2H2SD 1GIGL 4X7TA 3VX0A 4PW4A 5EIIG 3U36A 4E9XA 1Q1JL 2R0WL 3O8XA 1NC4D 3LYRA 2TSAA 5EU6E 2AGJL 2R2BB 1KC5L 2R2HB 3ZTJH 3RZCB 3ARFA 1F3DJ 1KYDA 4PGEA 5A6IA 3INOA 2QTEA 4DVRH 3VA2C 1ZV2A 2FX8H 5E2WH 1LWHA 1QW9A 3P3TA 5ISZE 3VD0A 3QWRA 2VLJE 1NMBL 3RVTD 5C0RL 3DROB 1JZ4A 1L3WA 2ESVD 2IPKB 3OJDB 5AKRA 2NY5C 4NM8L 1H5BA 5EUOF 1LO0H 4PLKC 3RWIA 4Z7QB 3BSHA 1N19A 3ABGA 5FFGA 4G1EA 4V11A 5B22A 2YPLD 5HDQL 3MZGB 3IYLW 2G0KA 1XAKA 1KJMB 2ZJSH 3H53A 3EGSA 3ARDC 3ECQA 3ZTNH 3VI4B 2GJ6D 2AZAA 4K71C 3REVA 3B34A 1MPAH 5FS5A 3CDZA 1ASQA 4G8AC 3MLTB 5IBLD 3D08A 3QIWA 4OFKA 4EUPH 5I23A 2YD5A 1YEIL 4UCFA 2C7UB 2L4OA 3GIZL 4BQ6A 4E9QA 2CKBH 2WXHA 4WUUE 4GG6F 4YSUA 4Z7NE 1PNDA 4EXPX 1PLAA 2Z1PA 1FJ1A 3QDGA 3BKCH 5IBTH 2ITDA 1CGXA 3ABMB 5D70H 5FHBL 4XVSH 3GRBA 2VGLM 5C0DB 1RZGB 2YAEA 1U8JA 1GJIA 5IHLB 1CUOA 4JQXA 4BQCA 2PMZA 4MZ3A 2BSED 3SBWC 2GK0A 3NCJL 4MNGE 1ZLUK 1H0DB 2EQDA 2WTOA 3FQNA 1USQA 3MMEA 4IBZA 3AU1B 4O58H 4APQB 3T6QC 2FR4A 4G8FA 4TQEH 4ZAKC 1HILB 3LKQA 4GW5A 4OLZH 1GR7A 5AD0B 4M5SA 1IT9L 1VPOH 4MFHA 4H25A 4U0QB 4PJEB 1LJMA 1I1RA 4ZPTB 1QNZH 1U8OB 2H2PD 4MD4A 4GO8A 4OLEA 4WW2C 4QJ5B 2PNDA 1GOHA 1A3RL 1I9EA 3W57A 3F7YA 1ZSDB 2YGQA 4JKLA 3S96A 5JOFB 2XXCB 1XMEB 3CDGA 4BFKA 2BIPA 4CJ0A 4TV3A 4S1SH 4MWFB 1HX0A 2NT1A 1HEZB 4GW4A 1SXNA 4FCHA 3NEEA 4QXGL 5C8JB 5FHAH 3ZE1E 2VXQH 1UG9A 2VSKB 5FEBA 4HEPA 2V7NA 5F1OB 3SE9H 5KVGL 1BFVH 1OHZA 2HJFB 4OFVA 4F8QA 4AXWB 3Q1SL 1O7VA 3GMMA 1KB9K 4HT1H 2FQGA 2R0KH 3QWOB 3DSFL 5ESQA 4XOEA 3EJQA 4JFDD 4KDWA 1ZHBB 3GXTA 1HXKA 2AK4E 3MOAL 4U1GC 1NBYA 3PWPD 4ODHL 4OLUH 1EEYA 5FKPA 3TZVB 2DQDH 4BSWB 4HSQA 5EPMA 1WEJL 1PX3A 3QJRB 2IALB 2A9CA 3KGRA 1IC1A 2KZBA 3FYEB 1OCZB 3I6GA 2QQLL 2YD2A 3F12A 4FQQA 4OZ4B 5JIIA 1GOGA 5JPNB 4NZTL 2ADJB 3JWNE 1YN7B 4GYBA 4Q0XH 2NY3D 2AGJH 2Q7YA 1KC5H 3HC4L 3ECBB 2VUOA 4OTXL 4TVPL 4YDMA 2LV4A 3EOTH 5KSAD 4JHUA 1QATA 4KOBA 1S7UB 3WKML 4P3DA 3INUH 1IM3A 1L9MA 1DBAH 4M6ML 1QUNA 1EEQA 3AITA 3VFNA 1MELA 4YK4B 1NMBH 5DHYA 1Q1PA 3N2JA 5D7JB 4BKSC 1PZ2A 2Z8VC 2D2OA 3QUZA 4NM8H 3S5ZA 3VFMA 4PJFF 5DMIH 1TVBB 1WHPA 2E8ZA 5HDBB 1N26A 4WY7L 5HDQH 2EE6A 3BZFA 3FTUA 3D25A 3WNIA 4LKCA 2R59A 1A6WL 2AQ2A 4PAZA 3I84A 4O2CA 2BFVL 3UTSE 3LMJH 5HHNA 4DCQA 4JN2B 1S7SA 2YK1H 4UQBA 3P4NB 4DW2L 1X4ZA 5K39A 1BVNT 1FL6A 1N9PA 3MRDA 2IVFC 3QWRD 2CBMA 4I18C 1P5UA 2PYED 3GIZH 1PIFA 1S9VB 1D6VL 3HAEH 3HG2A 2VMJA 5T5FA 2J2ZA 4KH2A 3ME0A 4DT2A 1NLDL 3FDWA 3K71A 3NDZE 4PLOB 1W8EA 5G4NA 5DJZB 5LNEA 3S6CA 4MJIE 5FHBH 5KSBA 3DO7B 4F33B 3TO4D 1G94A 4LHUB 1N67A 1UT1A 3NCJH 1U3YA 4EUPB 1BQHA 4M9OA 4WEBH 1BM7A 3QIWD 5HHQA 4PJ9C 1KTLA 5E4EC 1HN1A 2CKBB 1N68A 4PVLA 4HS3B 3NACL 3EH1A 3QP3A 5IB1B 3U9PL 4PPTA 1IT9H 5KYXA 1ZSHA 4PB0L 2XV6B 2ZP8A 3EYOB 3V6ZB 2HMIC 3IVKB 4X4KA 3TBYB 4CVWA 3VGGA 4DNLA 3VFOB 3QDGD 1FVCA 1G6RH 2AQRA 2ZYSA 5EDXA 3T2LA 2BINA 5ID1B 1A3RH 1BV8A 4A37A 3V9FA 5CFAA 3QXDB 1NGPL 2VDOH 4XC3L 1F0LA 1T1YA 1WIUA 2JI2A 1KGYE 4DP2X 4XBPA 2XCMC 1D9KC 3FB7B 5IHBA 3A24A 4ZFOB 5TF0A 1F1AA 1I3UA 4E5XA 2P45B 3WHE1 5L2KB 3RWFA 1SBSH 1U8QA 2A74C 2IOOA 1XH3B 5FA4B 2JJSA 1UXWB 1WIOA 4AEEA 1TJGH 1NCUA 1FPTH 4EZMA 8CGTA 4DGUA 3MBXL 5IMMA 4X9GA 3L9EA 4NLHA 2Q5BA 4EBQL 4HUUA 4U1LA 3Q1SH 2JKNA 3HG3A 4Y5VA 5D2NA 2F0CA 3JSSA 5E6ID 3WJJA 5IG7B 5D1QC 3MLWH 2F53B 2WUBL 2ZONA 1R3KB 4MS6A 4XVTH 3AUVA 3SE4C 3STBA 2W60B 4OGXL 4D9LH 3X1NA 2AJSL 4ODHH 2DTSA 4FFVC 4YPGB 1XWVA 1SLWA 5KVMC 1WAAA 5D6CB 2I9TB 2X4RB 1PJ9A 3CFUA 3ET9F 1P9MA 3FTZA 5ECJE 3W39A 4L0ZA 4YIQB 1XO8A 2FSEA 4LP5A 1JK8A 3QUYC 3CFNA 4OLVL 4NCC1 3CFCL 3EYUL 4I89A 4AOFA 3JTSA 2XN9B 3P40A 1MI5D 3HC4H 4WWKA 4KK9C 4FL4C 3ROOA 1EAPB 4U2ZA 4WHCA 5LGKA 4LCCA 3D7PA 3FHEA 1A7RH 1HWGB 2E7DA 9CGTA 5KVEH 2AV1A 4QXVA 3VWJA 3ZDXB 5HYJA 2FJHB 3U30C 3AREA 4UQDA 3ABKB 5CBAB 3UTZB 3ARWA 4R2GB 4YXLL 5CINL 5J11C 3PPSA 2VLMD 3KCPA 1IBGH 1HESA 1ZLEA 2C5DC 3HMWH 4QRTA 3HI1A 3T8MA 4I7ZC 1A6WH 4NO2B 3TA3A 1KBKA 1MJ7L 2BFVH 1CICC 1GZHC 3NQKA 5F97E 1FGNH 5H35A 3OMZA 4OKDA 3U0WH 1NFKA 5EEUA 3UJIH 5CR1A 5AVUB 1PY4A 1HHHB 4IDJL 3HLAB 5FM5M 3HHSB 1M3JA 3L5XL 4ACPA 5DGQA 3MODL 2Z9TA 1CE1H 3JWNC 4WHYG 1L9PA 2KMWA 1NQBA 1D6VH 3QUZD 1IIKA 1QQDA 1EWHA 1FAIL 4HALA 1IQDB 1MDTA 2ZWNA 1CFTB 2OSLB 3KBPA 1O6VA 4WDIB 4Z7QE 5J6HB 1J9CT 5C08D 3G5VB 2R0LH 1U33A 5B3SB 5HD8D 2IWGA 4AH2A 2TRYA 4YC2C 4X0KB 4F9PA 2R1XB 4X99A 3VGDA 3VWKA 1U4EA 3VI4E 3GLAA 1AAJA 2HAZA 4NGHL 3G5YB 2OCFD 1U3JA 3I9IA 3LVEA 4DEPB 2IFFL 1T2XA 3HC3L 3HAEB 3NACH 3U9PH 1MCCA 4NI3A 3HC0B 4PB0H 3IDXH 3V0AC 4HIQA 1C16A 1SDDB 2M2DA 2PCFB 3LNFA 4ABQA 5FFLA 3ZDWA 3EO1A 3LTVA 4PJ8D 1XGUA 4PIBA 4XNMB 4IOSA 5GGQL 4GKSA 4L4VA 1NGPH 3VXRB 1D2OA 2WLNA 2UWEF 4XC3H 1A4CA 1C7TA 2P80A 2B77A 3Q8EA 3EFDH 1DDTA 3Q1EA 2HX9A 3FN9A 4H0GA 4K2UL 4NZFA 1LE9A 3FF8A 1HI6B 1CFQA 4Y2DA 5H4ZA 3HI6H 3ZJAA 5E5UB 3ZL4H 1E40A 1EUTA 2OL3H 3EYFA 5CFHA 2Y69B 4PJ7B 1JXGA 4L4TB 4DKFH 4J39A 1G6RB 1KB9J 1QRNE 3PDOA 1ED3B 1CU4L 2XICA 5C97A 3BIKA 2XXGA 4NX0A 2W0LA 4X5XA 4R4ND 5GGSY 4OGXH 2X4OB 4X8XA 4HXBH 2HPOA 5FYLH 2G4GA 3IEAA 3WEXA 1NDMA 4NUMA 3RDTC 3UYOD 3CZUB 5LO7A 2D2CC 2NX5B 3ATEA 2X1PA 3RVWC 4V2CB 1RZFL 3GSQA 2J1KA 4KPHH 2IOIA 5JYMA 3S2AA 2CRYA 3WNLA 3V4UL 4RX4D 3ZE0B 5E2JA 2RHEA 1JPSH 4OLVH 4G8IB 1RZJL 1MHHA 3MHZA 4YOKA 3UPRA 1SLXA 2DRUA 4U6HA 4C58B 5F71A 2ITCA 2V8LA 2EDJA 5CLZA 4OCMC 3ALPA 4E0RA 3WTUA 4HWNA 2ARWA 5SX5K 2JV6A 1KLFA 4HV8A 4NN5C 3MLYL 4PM1A 1RUPL 5DHVH 2QPSA 4WTWA 3MOQA 2WWOA 1VFBB 4YXLH 1IAIM 4X7DC 2ZKWA 4XBMA 4NT6B 4Y1SA 4UOW0 3LKNB 3WS6C 4Q6IC 1VB9A 4XMLH 4MAUH 1PDKA 5JO5B 3TV3L 3L7FA 2OMXA 2CGRL 5CZRA 2A2QT 3P3RA 4IDJH 1HL8A 2J8UA 1MOEA 7FABH 1NJ9A 2E76C 5KG9A 3L5XH 4KITB 3MODH 3MOBH 4PJIB 4JCWA 1DLFL 5FGBA 1RMFH 1IVTA 1WV7T 4N8CH 1UEYA 4EDXB 2FQEA 1SF5A 1IARB 2BSRA 4BFNA 5AAWA 1FAIH 2KL6A 1AGDB 3ARED 3PHOA 1V8HA 4MZIA 3OPUA 3MJGX 5HGHB 4EIBA 8PAZA 2WZPA 1KLUA 2FECL 3QWQB 3HKZA 5KYUB 5HDBE 1K6QH 1NANH 4L37B 5C6WH 3TA3D 1CXIA 5DD6B 2TRHA 3C8HA 1OM9A 2LVEA 3OSKA 4JY6B 4Y89A 3ZQ9A 4A7QA 5IK3A 5JDSB 1SN0A 3ZN6A 3BIAX 4NKQB 2ENPA 5JHDE 2E9GA 1NANI 4NIKB 5E5MA 3DJTA 1ZPUA 5J13C 2IFFH 4U33A 2W0FB 4V1DA 1KF9B 1ZDQA 3GUTB 4NHUA 3O45B 2NTFB 3RNQA 1DP0A 1CF8L 5EO9A 1I7ZB 3MGTB 4FFWD 2FEDC 1U2YA 1J8KA 4B7LA 2H1PL 4PUBL 2ZSVA 3D6GA 3QXUA 5D7KD 5I76B 3P9LB 4X4XB 4MJ4A 2QVTA 3L5HA 1UD5A 3MV8A 3PQYE 3TEXA 5F8QC 4JL1A 1OWWA 2ZAIA 2WO3B 4K2UH 5EO1A 5TK4A 2GSIA 2H26B 3ZYOA 3TBWB 2R69A 1UQSB 4IOFD 4ODXB 4BFOA 3IAGC 4AZ8A 4G8GB 1NUFA 1J86A 3SKNA 3BRDA 4XMXA 4W9IC 2OP4L 4XNQB 1MFNA 4I3GA 4ORZC 4RFNB 5EBMA 4P4KA 4WFEE 3E1F1 4N87A 1T5XB 4PTTA 5AWNL 3CLFL 3CN0A 1UJ3A 4KC3B 4RMSA 4HOZA 4L4VD 2XWRA 3OHMB 4G1MB 1YY8A 5DJXA 4UIKL 4IMLB 2GTZB 1JPGA 2P80D 2MOQA 3CJJA 4A68A 4LLVA 4HPOL 4NPYB 5KBKA 4MA8L 4RRPM 1HKLL 1D3CA 1FF5A 1QPKA 4YNYA 4LIQH 5E08H 3G6DL 5TD4A 1OW0C 4TMPA 3S35L 1AZBA 1H3VA 4KKAC 2OL3B 5AUMA 5L2KE 1BBJA 1EZSA 4OGZA 3BWAB 3RFZB 1U8LA 3MX0A 4HJ0D 3SDYH 4CN6A 4HS8H 2WAHA 3GRWA 2G5UA 2ZAHA 4UTBH 3AS0A 1MFDL 4PGBA 2IIJA 3U9UB 2CH8A 3QHFL 3ZL2A 5CBEA 1KB5A 1TEFA 4QOKB 3IU3A 4PJ5B 3FPXA 1A3QA 1JPFB 1S7WB 3QIBA 4R90L 4Y4FC 4ZS7L 2ADGB 2NUPB 3RYMA 4UI2A 2ZX8A 4APQC 3F04A 3H9ZA 3TIDB 3U6RA 2QGEA 5F7AA 3ARGA 4CGTA 1RUPH 2EIZA 1B4LA 2CMRL 2X4PA 4OZFH 4DIXA 1A7PH 1B2YA 4HH8A 4IMKC 1QBLL 1LNUA 3PL6A 4HIIA 5B39G 4ODSH 4JFSA 4IBWA 3QEHB 4IU2A 4AUUA 4Z7UF 3OKLB 3U9WA 3OR6B 3FH8A 4Q9QL 1OK0A 3TBCA 2C4FU 2P8LA 2YPVL 1MG2C 3QG6B 3LH2L 3TV3H 1E8YA 1GGBL 2QLVB 3VM7A 2XN9E 1NCDL 3IXAB 3NJXA 1I1FA 4ICXA 1JRHL 4XGZB 4L0PB 1AGFA 3LQMA 5BOPA 5C9JB 3DV6A 1E2VA 4HGWA 4NWTL 2B9BA 1OB1B 4ZUVA 4NCC2 1E6JL 1AXTL 4A7TA 1TO4A 2CBOA 3ZDXE 3Q2WA 3UBGA 2HLEB 5F3HA 3VD4A 4HK0A 2AXWA 1GA2A 3P69A 2FHFA 2ZT9C 3E6HB 3NRFA 1WF5A 5L4MA 5DI8A 4PJXB 2HLFC 4QTHA 1XSJA 1A6AB 1ZHNA 2XTJD 3GB7A 4U31A 3V6FB 4J2XA 1HH6B 1CDUA 3F5WB 1DDHB 3LRKA 3JV0A 4C83B 1JZIA 3GT6A 5GS2H 2X6BA 4KI5D 2CKNA 2FQDA 2XV0A 1QTYT 5MENA 5G4MA 5I8EA 5DTFA 1OARL 2WXQA 4DKEL 1JVLA 1I4FA 5FCSH 5JPNC 1J0JA 1SFHA 2DQ6A 2J72A 4G9FD 3ARBB 5F7FA 2B15A 3WMQA 2W0PA 2XQYK 3VSUA 1CF8H 2IDCA 3Q2NA 3RU8L 3W81A 4PGJA 4YDZA 2IADB 5DS1A 1M7IB 2H1PH 5DMYA 1JHKL 1IVLA 3W9EB 2JB6A 4Z76A 2FWSA 3V0HA 4XT1C 4YK4C 3RHWK 3ZDZB 1INEL 4JO8A 2V5YA 4HG4J 1NGQL 4RSYA 3WLWD 3UYRH 2P24A 3B2PA 4G42A 4M5ZL 4MASA 4DPBX 3RILA 2A6DB 2FL5A 5ABDE 2OP4H 4UU9B 5KYWB 5D5ME 2WB1A 2Q3XA 4G6MH 3OSVA 3E9UA 3L3KA 4JFQA 3CLFH 3CE1A 1VA9A 3MR9B 5BRZB 2FO8A 3EJCA 1BQUA 4YE4L 2F19H 3SDCA 2UZXA 4GKOA 1MKFA 2VXTL 1A4BA 4UIKH 3B5GA 3FQTA 4PG2A 3U46B 3QZLA 1NPNA 3VXRE 4WW1A 3QNZA 1HKLH 1FN4A 5JHMA 3G6DH 1QTPA 2K6WA 1RJZA 4F7MB 3T0ED 3DMMB 3PDGA 4N24A 4Y19B 1AGBA 4IBSA 1R5WA 3N42B 4S11A 5J12C 4A7GF 2ARJB 5CP7A 1UZGA 2V4LA 4GPVA 3NJJA 3RY6A 1X4YA 4DPRA 1HT6A 1SXSA 4PJ7E 3U2JA 2QHLA 3I6KA 4PY8J 2HN7B 4R90H 1YPZB 2FJFB 2NXZB 2NYYD 5F9JB 4AITA 1RUQH 2OSYA 4AY0A 1TZHA 1Y6MR 4ZS7H 2WQWA 4XOCA 4AIZB 4KI5F 2FWOA 3A6OA 2J8UF 1LEGB 2D3NA 4S0TD 4MXQD 1WFNA 3LZFL 4P5MB 1DCLA 3QORD 4Y88A 3V5HB 3P2BA 4Q9QH 4LU5L 4GO6B 5KVGE 3ZE0E 3I2CL 1ROWA 3LH8A 4UTCA 3JQOB 1JNLL 1GGBH 5CUSL 3LQZB 1MJ8H 1NCDH 3S37H 3QIBD 1NKOA 5B8CA 2CLZB 2V2XB 4W9KC 1MREL 4NWTH 4GI8A 4MD5A 3WO4C 3VTMA 5CJQH 1X7QB 3N40F 1E6JH 1S7VB 1XGQA 1MLCA 4H8QA 1JRHI 1O6TA 4OZFB 4LLUB 4OJYA 5CS7A 5DJ2B 1B88A 1WFJA 4KROB 4PJBB 2P5EA 3EFFA 1KPVB 4UZGA 1OCWH 3MCKA 3PL6D 1AP2A 2ZX7A 1JNNH 2JK5B 3BT0A 1WG3A 2H5UA 4UT6H 3DXAB 4KTGA 4G6AC 2Q8BL 3CZEA 2DQUH 5HGAB 1VCBC 3MUJA 3AAZA 4DVBB 4LE8A 1OEZW 4TVPE 4F80A 3RNKA 1IAKA 3TCXA 1FUNA 3CC1A 5IKCA 1T0OA 1G7LB 1OARH 1E5BA 1YC7A 3RURA 2ZP0T 3U79A 2MCPH 1YAIA 4UNVA 3C60A 3L1FA 5KSVB 5FGRA 1M7DB 4X5RA 4IS6A 1NKRA 3X1FA 3CFEB 4Q7DA 3JWOC 3BXNA 4HJ1A 3RU8H 5E8EB 4P3CL 3QQ3B 3BEVA 4G8EA 4PSPA 4YHYB 4RA0C 5I2IA 1JGEB 1JHKH 5CLTA 1GSKA 2YA0A 1PYWA 2ILLA 3CZNA 1XX9C 2IF7A 3KL5A 3SY0A 5I5JA 1RJYA 3EJJX 4ABVA 3WENA 1TMQA 2BNQA 4W4OC 1INEH 1EAOA 5K9QG 4ELMA 4PR5A 1AQKL 2WLHA 3RLSA 3AMKA 1WBYB 1WFUA 1WC7A 4TRPL 1X5AA 2V2TA 2A9DA 4TOYH 3Q6FB 4PV8B 2HFTA 4UUJA 3GNML 5C6TH 3FHQA 5BO1L 2NUTA 1MW2A 3SDXF 1L0YA 3CIQA 1KLGA 4L8BA 5ESAA 1PCSA 2XG4A 4FQPA 2EIDA 3PNRB 3FQXA 2ZD0A 3QI9A 1TZOA 1IZJA 3N41B 4N2OA 3AMLA 3OKOB 4I48A 2AERT 2VLKA 4YE4H 4KBPA 2VXTH 1ULVA 2YPLB 5DK0A 4KOCA 4TM9A 3DDFA 3ZL1A 2ATPA 3CBJB 1M05B 1CGVA 2YA2A 5FGSA 5CZXD 3VGFA 2DIJA 5FF6B 2MSPA 3ZT7A 2XKSA 5I30H 3VXPA 3DYOA 4HGMA 4I3RL 3GLEA 2CPUA 3D9AL 3MTRA 4FQXB 4U1JB 2CGYA 1D2PA 2A4CA 2EO7A 4Y5XA 3MRHA 4IK7A 4KTDL 4ZXBA 3MA9L 1KYFA 1YUKB 2HFEA 3BVXA 4PJHA 5DUBA 4EOWH 2A99A 5A2JH 3ZMEA 4EF3A 3U6XA 4DEPC 1KN2L 3DNKA 3L9YA 4Z7VF 5T5FL 4BUHA 1XGPB 4JRLA 3VW3L 3CQQA 1VHPA 3BVWA 4A2LA 3AG1B 4JZJA 5E7BA 4JVUA 3SIKA 5IBUG 4G9DA 1Y1UA 3TT1H 3T3MB 1HIMH 2D7MA 3VRIB 1A6TB 4MCYB 1K9TA 3KPPB 3LZFH 1W0WB 2B3IA 3WIFA 2VITA 1AVAA 3B2XA 4LU5H 1FFOA 4WTZA 3I2CH 1GMEA 3UOAB 3UG4A 3VFSA 1JNLH 4RSVA 1M42A 4JZNB 1I8MA 5KVDH 1VGKA 4UANA 5AAMA 2ETWA 3BPCA 1UZ8B 1V54B 4BYHA 5FGCB 3MRJB 1YNLL 1QZ1A 1LILA 3ELQA 3DIFA 4G72B 3T0VA 5JPMA 2V6HA 2OAAA 3QCUH 5D72L 3EOBB 5F89B 5D96C 4P2QE 3KPSD 3J2PA 4HOMA 2VJ8A 1HXMB 3NJKA 1E4JA 3H7BA 5IEKA 4FG6D 3NFPB 2Z3FA 2PETA 4Y5YB 3V4PH 3TONA 4FXGB 1DQML 3CFTA 4CKVX 2UY7B 2CPCA 1AR1D 3V52L 2D7TH 1UGNA 2H32A 1BIHA 4UAOB 5F7NC 1R46A 3DBSA 5J06A 4AV4A 1SY6A 4H2AA 5FECB 2OMUA 4ZO8A 4E42A 2RR3A 4NP4L 5LBGA 2EIJB 3RJQB 3VG9B 2NY0D 1NIBA 4JANB 3N44B 1F3JA 5E00B 5JXAH 5IMKA 5CD5D 4PJDE 2ICCA 4CMHB 4PJ6A 5ETUB 4P3CH 1Z7JA 3DHUA 4G6FD 1RZPA 1WQVT 3STLB 1WBXB 1MJJB 4YGVA 3FFDB 1E7VA 4PJXE 2XPZA 3SPGA 3MRNB 5JW5B 1MCHA 2HFFA 3QJSB 3V0FA 3VXTA 2DQJH 3LNGA 1U8IB 5D71L 1AQKH 3LDBB 4TRPH 4TL5A 1KIPB 3UROR 3P3YA 3HG1E 4DP0X 5CJXC 3GNMH 3N9GL 3ARZA 4ZO7A 3C60D 5BO1H 3FL7A 5MP6L 3GBML 4AVHA 5LCVA 4ZFFA 5FO7A 5K69A 1G1OA 5HPMB 4M48H 1T89C 4Y9GA 5CD3A 1GZQA 1CE6B 1RK0A 4NXSA 4PJCA 2C3VA 3P4MB 1V27A 4KRPD 4AC2A 1ID5I 2WBKA 3QJFA 1LE5B 2GEQA 3CZJA 4QTFA 4HUXB 43CAB 4NUQA 1VESA 2WLYA 1OAQH 3MO1B 4X7TB 2LFEA 3UFIA 3U36B 4BZYA 1F00I 2OSWA 5HI4D 4TNFA 3O8XB 1ZAGA 1G43A 3O2DA 5L2JA 3MFFA 2Y72A 4I87A 2CO6A 4H8UA 3ARFB 4N8VG 5CEXB 4PGEB 2EEAA 4I2XE 3ZPDA 3TEWA 4FTVD 2F68X 5FC9A 4I3RH 3D9AH 4C4UA 1BF8A 4KTDH 1ECYA 4AYDC 1AI1H 4IGBA 1JERA 1H5BB 4XO4A 3RWIB 3BYTA 1L7TL 1IC5H 3FB8A 4AQ1B 1KN2H 3FFCD 4G1EB 2JWYA 2X3BA 2QVFB 3CHOA 1KBBA 5DJ6A 3FSWA 1J48A 3TT3L 1QX1A 3AWFA 3U0TA 3TC9A 4ZOAA 4Y7OC 3MRLA 4DZ8B 2OSXA 4Y19E 3QIWB 4XODA 1DEDA 5LB1A 3TF4A 4XX5A 4HUWB 1IBFA 2K4WA 4PWKA 1VZIA 3QJVB 5JW4R 2QR0A 4LLMA 4QHMA 3U1SL 4QRPA 1YPZE 3UPCA 1P84J 1YNLH 1FJ1B 1GS7A 2Z91A 3SZ6A 3OB8A 3NIFF 4KZ0A 3BHBA 4XNYL 3QDGB 4B9KC 1ZOXA 2ITDB 3QFJB 4LIQE 1NEZA 4XNXL 5HYEA 4P48A 1JOIA 2C3HA 1FC1A 4E41A 4GIPD 3HB3C 4S1DC 2AXFA 5C0CD 1QBBA 3FQNB 5EULV 3MMEB 4JO1H 1DVSA 3FB6B 1GHFL 2FR4B 4G8FB 3CDFA 4Y4HC 3V52H 3X14A 4CDHA 1KN4L 3LKQB 3VFWA 3SGEH 1NCBL 1P4IL 1MFAL 4CSZA 3EOAA 4NP4H 4NIYE 1W0YT 4U05A 5F7EL 1JXKA 2QPDB 3O3DA 5GZND 3JXAA 2BHUA 2WCGA 3RFZC 4ZW3A 4HFWA 1DEEB 4PIRF 1USZA 3C08H 3CDGB 4ODUA 3V4PB 3FONA 4NAJA 1JZ2A 4JGNA 1LHZA 4IBYA 3SDDA 1WWCA 4GW4B 4H8VA 1HE7A 4J3OD 4YDLB 5IQ7L 3D4YA 3DXAE 1JDDA 5EU3A 4XXCC 4PWHA 2YSTA 1OAKL 5LN4A 1U8CA 1ZTXH 5F0MB 1TQBC 5I28A 2AJXL 1H6FA 1WFIA 2ZYIA 4IU3B 5AYTA 3T65B 4F20A 2JH2A 4ZUTB 2FZ3B 3GC3A 4PRAB 5AW9B 2YD8A 4RH4A 3GMMB 3TLRA 2DQFA 5JW3L 2G5BA 4EE2A 1INDL 3NRPA 1WTLA 1T21A 1NDGA 5ESQB 3HIZA 5I6XC 3CV5A 3FO9A 3GBMH 3ZTCC 3G9VA 2F9BT 3H2WA 1XCTA 1EEYB 5FKPB 4ETQB 3K8MA 5IT2L 2HLAA 4ZUWA 3B2MA 2VWEE 5MEPA 4NQEA 5JLZA 5F88B 1AD0A 1F45A 3I6GB 4D9RE 4LLWA 2EECA 1ZLWH 1T5WB 4QHLA 1N2RB 2HUEA 2IBZY 4GBXA 5I71C 1T0MA 3ZHDA 3GMRA 5HYSA 5HYFA 3SQBB 4YXHH 4Z6AT 3UL4A 2ADYA 1H6TA 1M71A 3I75A 1TITA 4MMXA 2Q7YB 5I1JL 4CU6A 3UG5A 2VSCA 5GRUL 3FMGL 2ZX6A 5C07B 1IM3B 1I8KA 5IHWA 1QUNB 2HVJA 3US0A 5CP3A 3W11D 1LK2A 1GH7A 1X5XA 2FBJL 5DHYB 1RH8A 5ESVB 4LDEB 3VFMB 1QO3B 2ESVE 1HYSD 4JHVA 1L7TH 2I07A 3SO3B 3AG2B 4F8LA 2A9BA 3L6FA 5FO9A 1BFOA 1QSFA 2V2WA 3BZFB 2YPLE 4LKCB 3ZGIA 5IB4A 3DX8A 3ARBC 4P2OD 1XCWA 2F54A 3H4HA 1P1ZB 5HHNB 4NQXB 3L3OB 4DCQB 3CZFA 2CSPA 3D06A 2OMYB 3F62A 3OLGA 5H94B 4PB9L 2HRLA 5AW2B 2PR9A 3KR3H 4HKBA 1LO5B 3MV9A 5K39B 1FL6B 3HZVA 3MRDB 3TCTA 4OGYL 2QSVA 1P5UB 1HJCA 1FYTA 5SWSA 1BYNA 3WBDA 4IGBD 3JV6A 4J3OF 3B7UX 4ZSOB 3M7FB 1NCJA 2PWEA 4ENED 4XNYH 4AENB 4HUMB 4NNPH 5GJTL 1HHKA 1R17A 3PXLA 4F8NA 5ITBH 1RAMA 3SSGA 5G5DA 3LEXB 3L3GA 2F7PA 5KSBB 4Q9RL 4P5RA 5DU7A 5I73C 1CFNB 3T3ME 1IBYA 2JKTM 4ERSL 4XZ4A 3BN9D 1OAUL 2APSA 2H6OA 3G3LA 2LAAA 1GHFH 1KTLB 2H8PA 1G7IA 4UV7L 3B5TA 3VE0B 2R69L 3VQ1C 1AZNA 5KYXB 1NCBH 1P4IH 2D03L 1MFAH 2ZNWA 3FTVA 3FSZA 3HHMA 1PG7W 2EYSB 1IKFH 4QRPD 3ETBF 1OGTA 3DX2A 3WUWG 5F7EH 3IGUA 5FGCE 3RVXD 1FVCB 2XN0A 3ULUC 1YVLA 3VXNA 3GEFA 4WLCA 4DFIA 1W72H 3T6VA 4IJ3C 1U3ZA 1T1YB 3UJTL 1MCKA 3VDAA 4KNUA 4XBPB 2H0PA 1CVSC 5KTEH 2NXZC 3H54A 3IPEA 4M02A 3F01A 1A2YB 1OTUC 1U3HB 3HMXA 4M7KL 1GYVA 1QHOA 4G5ZL 5LG1A 2GUOA 1OAKH 4O2EA 2DDQL 4PJCF 5DHDA 3QXAA 5IMMB 3E8VA 4UV4L 3TASA 4S1QL 1QFOA 2GK2A 4HUUB 3TJHC 5ABZA 4U1LB 2AV7A 3D48R 1EZVX 4GQ9L 1R24A 1BSIA 2QADD 3GRWL 3FTSA 4JO5A 4Y5VB 5D2NB 1EERB 1MCNA 1RZJC 1KB5L 5L9DL 4LSPL 3Q8CA 4AYMC 3K72B 5I1DA 3PCYA 3BVNA 4EQ3A 2AMGA 4E9VA 2HWZL 3T0BA 1YYCA 2F6AA 3F3HA 3NCMA 3OKMA 4RRPA 1VAHA 3W39B 3QDMD 2ZKXA 4LAQH 3DK2A 2FSEB 3FT4A 2DMKA 4YJZL 4NC2B 3BZEA 1JK8B 1HSBA 1DBBL 5LKNA 5KN5A 5F9WB 4ADIA 4KUZL 3GKWL 3D5OF 3JTSB 5H8DA 4KROC 4XBEL 1FFPB 4WWKB 4MDIA 5I1JH 3ROOB 4QRFA 3FMGH 3S3BB 3O6FD 4A6YH 3K74B 4LCCB 3EDJA 4N5EC 3QYNA 3VD9A 4GMSH 2FBJH 3Q5YA 3C09B 2AV1B 1EJOL 3VWJB 5HYJB 1JZ5A 5DURB 3AREB 5M95B 4Q89A 1SN5A 5SV4A 2EC8A 1A3ZA 4FQ1L 3CG8A 4OFDA 3KCPB 4X6EB 1BG1A 3US1A 3FQUA 4QRTB 4GBXD 3HI1B 4L18A 2QT6A 5AZ2L 2EC9T 1Z0NA 1KELL 1FL3A 1RI8A 4M4PA 4XAKD 1J9SA 5H35B 5K9KA 3IDYC 5DYOB 2IMNA 5AENA 2VWEC 4ZFZA 2PXYA 4PRHA 5F7DB 2H2SC 3FU8A 1NBZA 4OGYH 1D5ZB 1SMDA 4ZK8A 2O6EA 4LVOC 3AT8A 1QAWA 1QQDB 4B9YA 4RETB 3HRPA 4F7CA 3GM0A 4AZUA 2BY2A 2QVIA 3EFOA 5D7LD 5GJTH 1QSFD 1S2EA 1VF5C 3BPNB 4F15C 4AH2B 1S6NA 5IHUH 1T2QH 4JDEA 2X1QA 1P7HL 4Q9RH 2W91A 3VWKB 4UZUA 2P3YA 2ZE0A 4O4YL 2JNZA 3RVTC 4DTGL 3VFVA 4YLQT 1CL7H 2VDKL 4LO9A 2A5UA 1KGIA 1OAUH 4X5PA 4DP8X 1MIMH 4PBWD 5IR1B 4RIRA 3BDYL 2BVOA 4GI9A 2UZIL 1KXTA 2VM3A 1FYTD 4UMGA 3SGDH 5TGBB 1F6LL 2YAMA 5J1TC 2XXFA 1P7KA 1ZE3H 4LPYA 2O26U 4M93B 4Y9BA 1XTMA 1C16B 2FJUB 4OCXH 4WGKA 3V8CA 1PZUB 2CDEA 4S2SB 2DKSA 4GP8B 3GWJA 4N2MA 4M8QA 3ZHLA 1MAJA 2JQAA 2WCSA 3QDGE 5ADOL 5IBLC 4AEIH 3VH8G 1S7XA 1PL3A 3PP3H 4GKSB 4U1IA 1LO4L 4L4VB 5I9QB 2FGWH 3T1WA 4LASL 3KJ6L 2WKOF 1MZZA 3UJTH 4NUGL 3FSOA 4XXWA 5F7BA 1S3KL 3BWUF 5GRXG 3WDHA 1G9EA 4XTRC 4ZUUA 4NJ9H 3BFWA 4ZFGL 1U41A 1CFQB 1VFOA 4OW6A 4Y2DB 5KBLA 1IKOP 4UYPA 1XCQA 1S8DA 1GMIA 2DDQH 5D7SH 9PCYA 3EYFB 4UV4H 4S1QH 3OHXC 4EKXA 4KMTH 3L16A 3HPJA 3GRWH 5KS9B 4IKIA 1W72B 3FOMA 4H13C 1KB5H 3BE1H 3DVGA 2V5SA 2XZZA 4LSDA 3RIAK 3BIKB 5E8DH 1TUPA 1YYLL 4X5XB 2XWZA 1A3LL 4D0CB 3WEXB 2NW3B 4OI9A 5EZIH 2E3VA 4ODVH 3RWDB 2RQ8A 5CGTA 3ZO9A 2H2PC 1JNHA 4UYQA 1DBBH 3OKDA 4XPBL 3D69B 1M56B 2X53A 3GKWH 4X6CA 4XBEH 2R39A 3HLKA 3WY3A 4BCYA 4WAFA 4FKKA 4OFIA 4U6HB 1Z9NA 1URZA 2J57A 2ITCB 3KYKL 5C7XL 1TQSA 4MHHI 3HNSH 4FFYH 2A4ZA 4E0RB 3HUJA 4MAYA 1T03L 4NSKA 3UIZA 3PUCA 3D3VB 1KLFB 3H0TB 3IRPX 4HV8B 4BRVA 1EJOH 1RZIA 1DUYA 5T3XL 4JZOB 3WNMA 4FQ1H 3K4AA 4D94A 2EDDA 4HMEA 3MYJA 1ZHLA 1E9PB 2X89A 5KANI 2VLME 1B4JL 1A22B 3O6MH 2VKWA 4QRAA 3MLZL 5AZ2H 5B1JA 3VTAA 1JGLL 1KELH 3ELAT 4Y1AA 2XTJB 3CFMA 3F84A 15C8H 1E4XL 1F56A 5IWLA 3U0PB 3B2VL 4WI0A 5DUML 3MKKA 3L7FB 4A6YB 4ZQTA 4GOSA 1Z9MA 2LU4A 1HL9A 2UZYA 5EEXA 1NJ9B 5KG9B 3KBFA 3AQDA 1SEQL 5C07E 1RZKL 3RIFF 1U36A 4WNSA 4HA1A 3SYAA 1UKTA 2Z92A 1KCRL 2BSRB 1DSFL 3KNBB 3B1UA 2NY3C 3UZEC 5IB5A 1QWHA 3II2A 2JCCF 2Q7AA 1KLUB 4P4RA 1U8PB 2GCYB 1KY6A 1JTTA 3QW9A 3QQDA 4O4YH 5DZOA 5FFOA 5AVXB 5IK3B 1MCSA 3SKMA 2N1KA 2X9XA 4P2RA 2VDKH 5HDRA 2FO1A 3DWTA 3S2CA 2XWJA 5E5MB 2YKKA 4R97B 5I26A 3QH3B 2PXYD 2G5RA 4K94L 2WSPA 3NCCB 2UZIH 4V1DB 4AIEA 2CWRA 2ZZUT 2X12A 1H8SA 3O3UN 2BY1A 3EYSH 4FG0A 4ZTEA 3RNQB 4RGOL 1CGWA 2F5BH 4GW1A 5HYQA 4X9HA 1NC2A 3DK0A 1ETJA 3ARFC 4YBQD 2GUYA 4FZ8L 5D1ZA 2ZSVB 2ZYRA 5ADOH 1ES0A 1LO4H 4XP9L 4Y9CA 5CEZL 5D9SA 3KJ6H 3DVNA 3P4OA 3MV8B 5KSBE 2DLEA 4HWZB 5EO1B 3VXMB 4NLAA 5DR5H 1KDJA 2YLKA 1NDTA 2GSIB 5LJYH 2A73A 1Z3GL 3VYOA 3PYCA 2ZAGA 5D7IA 3IFOA 3SKNB 4RMUA 5DQJB 3DHJA 3FT2A 3D85D 3AZUA 1MEXL 2ALWA 2GIYA 4WGVB 4U1SA 4P4KB 4BBWA 5GRJL 5DJ0A 4FQIL 4YDKH 1QSEB 4H1LG 4K3EH 1UJ3B 2MJWA 2DH2A 5EZJA 3BRFA 1YYLH 3IRCA 3QIWC 4UF7C 2BPBA 3PGDA 1KTRL 5DLMH 1A3LH 1YY8B 5E6UB 5DJXB 1OM3L 4FKHA 1JPGB 3GIVA 3L1OH 4LLVB 3BAIA 4PWJA 4MTMA 1ZVSA 2LGNA 4DP7X 2YD6A 1GCFA 4CADB 4E2OA 1HZLA 4NXKA 5B7MA 4X9BA 5DGRA 1BBJB 2NRDA 1M7UA 3I9GH 2I27N 1U8LB 3MX0B 4GRLB 1FI8C 3IE9A 5CBEB 1KB5B 3BKML 3IU3B 4JQXC 5DA0B 1RY7B 1T04A 3GMNA 1UA6L 3KYKH 5D2NE 3TN0A 2AABL 2PUQT 3PV6B 4GKLA 1O7DE 3CN1A 3O2WL 4U0RB 4X7EC 5KBPA 4XNZC 3LEVH 3UTTB 3MLUL 1SYSA 3U6RB 4WGWB 3ARGB 2DIEA 5T3XH 1ZJBA 1Z6JT 2Z7ZA 1T0NA 2X4PB 3ZZLA 1UA3A 2GY7B 3GHEL 3MC0A 3U4AA 4MLSA 4ZMLA 1WAAE 3B7YA 4HIIB 5E6IC 3MLZH 1JGLH 2P8LB 1ETA1 5GS1A 1E4XH 2BS8A 5HGGS 1ODAA 5EA0L 4BZ2A 3W0WD 5DUMH 1ANUA 3HG5A 3ZT6A 2G0LA 1E8ZA 2WHVA 5E8OA 3DX9A 3ZRSA 5KAQF 2AI0L 3MPCA 1PBYA 3DV6B 4N28A 1KEML 3IFLL 4HGWB 4PCTA 4J28A 1RZKH 4ZUVB 1E4XI 1SY6L 4BCZA 1PZDA 3CPLB 3N6YA 4HWUA 4Z3JA 3L1GA 1DSFH 5F9DC 4L4JA 3S34L 4Z1PA 5HYJE 1ZJAA 3SPJA 1JZ8A 4HK0B 3EJZD 1WUZA 1F4WL 3W56A 2X89D 4GT0A 3A47A 1QABA 4YO0A 1CD0A 2QFPA 3GDCA 5HHMD 4N2IA 4QTHB 4MZRA 1WT5A 1ZHNB 1O0VA 4NQCB 4Y1AD 2B59A 3P9WB 1Y0LA 3AU0A 2P48B 3Q8FA 5C0IB 4ZPVA 2G3ZA 2FH6A 2VT0A 4JPSA 2NCMA 1RK1A 1GRWA 5MENB 3B7SA 5FK9A 4ICWA 4K94H 1KXHA 3ILDA 5I8EB 3DBXA 2APFA 5F44A 3WTSA 2O5YH 4XX1G 1JHTB 2B1HL 4RGOH 4JKWA 4OD1L 1A1NB 3DJSA 3FCTA 2DF3A 2BDNL 5C0FA 5LCVL 4BQ8A 1ZT1A 3EYQD 5TE6L 2DQEL 3LQAL 4S1RL 2GG1A 1RLBA 1KCKA 1IGJB 2JB6B 4PJAA 4Z76B 1J5CA 5CEZH 3N1PC 2KDYA 4GSUA 5DDHA 2VDKB 3NCYP 3ZUNC 3CVHH 4KJQC 4P2RD 3QUZC 4Z77A 2YPKA 4WKXA 2CDFA 3BWZA 2WOYA 3QZWB 1P0SE 3WN5B 3O2DL 3LEYL 1Z3GH 3IJ7A 1PG7L 3NSDA 4Z7OF 5GS3A 3N04A 5HD8C 3TBVA 3NN8A 2FL5B 1MEXH 2QSTA 1NC2D 4O2FB 3H8NA 1KYAA 2IDTA 3L3KB 5GRJH 1TYEB 1F58L 1YMHA 5JHLH 3QUXA 4AK1A 3QWNA 3SDCB 4IIZA 4Z0XB 2P7TB 3LKPB 3O9WA 4L4VE 1P5UC 3FUNA 2NW2A 5T1JA 1M9SA 4R83A 1YDPB 2BOCA 4UT7L 3QNZB 1FN4B 4FCAA 1IAOA 1RJZB 2BVYA 2HT3D 4X6FA 2YARA 4AT6B 3QCVL 1BQSA 1AGBB 1GGIH 1R5WB 3LPPA 4PJ8C 5CP7B 4F2EA 3GSNH 1QFUL 2NY2B 4BELD 3GSRA 1D5IH 4M5YL 1JUFA 1EHNA 3B9VA 2W9DL 3K8KA 5DK3A 1UA6H 2YGPA 3ZRCC 3QUHA 1CXEA 2G3MA 1TZHB 3S8WA 3SCMD 3VFTA 3BVVA 2CLRB 4BJLA 1NUNB 3MLUH 1FLRL 2FWOB 2QEJA 4N85A 4NNYA 2ODHA 4FNTA 4GRWF 4H8PA 4M62L 2Y25A 3CUPA 4XZUA 3KEDA 4P5TB 1DJGA 3GHEH 1XIWA 1CGTA 3A4DA 5L4IA 2W92A 1IL1A 1A0QL 3FRPA 5CIPA 1UD6A 4JAMA 1XGTB 3E38A 2Q2EB 3AQZA 3TL5A 1IBHA 3K4DA 1UWXK 4R4NC 2WZAA 2QTVA 2WWMC 1J1XH 3N06B 1KV7A 4FLSA 5B8CB 1KGWA 3TN0D 1VEPA 1KEMH 3AXLA 4H88H 2DMCA 1ADQA 4GUPA 4W6YB 4YSDA 1X4XA 1SY6H 2L3BA 2UUDH 3KLDA 2JJSC 4JG1L 1TJHL 1U21A 1T4KA 1XGQB 3BD4A 1MLCB 4KH9A 3V5DA 1UWEL 1X5LA 3GINA 3S34H 4EDWL 1MZYA 2FT8A 3NJHA 2P5EB 1BAWA 3MCKB 2GIMA 1AP2B 4XMKH 1BVKB 3PJSA 1TETH 2L0DA 2PO6A 4OAWA 4HFUH 4LSQL 2A3TA 3AAZB 4MYPA 1SGKA 2V3FA 2V5MA 4DP9X 4ZMNA 2XTJE 4F3FA 1JGDB 2WBJA 4KX9A 1SJEB 1BLIA 4TUKH 2E86A 3EBHA 4NC0B 3RNKB 3WKPA 3EBIA 3IXTA 1IAKB 4KI5E 5SWZA 1T6WA 2CO7B 2J8UE 4OM1L 5IKCB 1QNIA 1P9MC 2AANA 2OFQA 4DO5A 2AJZA 4QPEA 5KUKA 1MDAA 2BNRD 3EJPA 2CCLA 1I8LA 4QUOA 5F9WC 2CGZA 35C8H 2NZIA 2LW3A 4OD1H 3MACH 3BXNB 2BDNH 4WWKC 5LCVH 3O6KH 3BEVB 3LQAH 4Q9BA 4S1RH 5AVRB 5I2IB 5C3TA 1NOFA 4OM0H 4OJAA 2KZKA 2PCYA 4NQDA 3S35X 2RALA 3WOVA 1QEWA 4WU5A 3SY0B 3C09C 3CFIC 4PGZA 2EEXA 3UXFA 3WEMA 3VWJC 2BNQB 4CBZA 1BQRA 3RY5A 4ELMB 1NCCL 3AREC 1NOAA 3O2DH 2OYKA 3LEYH 1WC7B 4JM0A 2V2TB 4Z3FA 3HR5B 3U48A 2UY6B 5TF1L 3VXSA 3LV3B 4HEMA 4RNRB 1ZA3B 4V1DE 3GS7A 2NUTB 5KVFL 1DBJL 2ICES 1KLGB 4L8BB 2OTPA 4YZWA 5ESAB 5FM5O 2XG4B 1WFMA 3OG6B 5D4IA 2Q87A 3TA3C 1RHHA 3UDWA 1BOGA 3QI9B 4YSEA 3NCEB 2IANA 2X4NA 4R3SA 3R1GL 3PFUA 3QQ4B 1FNEA 1WGVA 4BFJA 2YD9A 2VLKB 3DJ9A 4YLBA 1MJUL 3CVHB 4R7VA 4N2FA 5DK0B 2BCKB 2ZCLL 1TTRA 2DL9A 3NQIA 1IAIL 2RBLA 4P57A 3MV8E 3ARDD 4UT7H 1JZ6A 2VSDA 4NN6C 1PFOA 3L54A 4LRNL 4FFWC 4Q58C 2IBBA 4W9FC 1ZLWK 3M8OH 1TG8A 1YCSA 3IDGA 3BPNC 2XX0A 3AXHA 4Y5XB 2GYSA 4ZXBB 4F9PC 3MRHB 4BE5A 5I17A 2BIIA 4XWGL 3VWKC 2HFEB 4FMKA 5A40E 1LXMA 1WICA 4PJHB 5DUBB 5EWIL 2W9DH 3QG7L 3K5SA 1QHQA 3GLZA 1EUUA 5CLYA 2BOBA 4TQPA 1NAKL 2A9AA 3UBXA 1FLRH 2SEBB 3C5ZA 3HW7A 4JZJB 4M62H 3OM3B 2OYLA 1YJDL 2A4EA 3ILQD 3FTXA 3NJMA 4G9DB 4M93C 2CJTA 4HZ1A 1A0QH 5FXCH 2BZDA 1FVDA 3I6LE 2AEWA 3GSNB 2VITB 5EOTA 4LESA 1JAEA 2FYYA 2OI9C 3B43A 1TEGA 1FFOB 3L4TA 5E1IA 3IMBA 4K9EL 3N5AA 1MIEH 2FRGP 4TSAH 4WSJA 2I60H 2YAFA 3VFSB 5I9QC 3IGLA 5ANHA 4O51B 1I8MB 5K33A 5DC0A 1X5YA 3U7WH 1AZZC 3BPCB 2BJMH 4LB8A 1FNSH 5AKTA 4Y2DC 3V7AE 1G1KA 3DIFB 4JG1H 5A7BA 5JPMB 2OBGA 1TJHH 5CLWA 5E8NB 2AHIA 1S7QB 1UWEH 3S5LA 4EDWH 1JD7A 4PS7A 1FHGA 3HG4A 1XIWD 3QDAA 4ZTOL 3H7BB 2WAQA 5IEKB 4I1PA 3COOA 3FKUS 3DJRA 4HIXH 4DUXA 1C12B 3CDYA 5KW9L 2FT7A 4MLIA 4WUKH 4LSQH 5I74B 3HMXL 4IRZA 4MA1B 2H32B 3CFQA 2ZIDA 4FGMA 5EFIA 4JDVA 4I0PA 4OM1H 1QI4A 1IGIL 2CUIA 2G2RB 3VFRA 5HI5D 4IKJA 3HS0A 4LSSH 1OSEA 3QB7C 4G7QB 2LR4A 2HT4C 2DJSA 3ARSA 3MSPA 5B21A 4KHTL 1ROCA 1I1AA 5HHVH 4YDNA 1JF1B 4KMLB 2R2EA 3HNVL 3RWGA 4IBVA 5T33L 2OZ4H 5K59E 3DPDA 5AQ0A 3CZSA 5C3LD 2HFFB 3QT2A 2Z7YA 2WBJD 3VXTB 3LKSA 3ZSTA 3BP5A 3B56A 3CFDA 4KJYB 5AOJA 5SWZD 3GYRA 5MENE 1KXVA 3B9DA 1XF4A 5TF1H 3IFPA 3LPGA 1DBJH 5HVGB 1LEKA 2ZOWA 2BWDA 4R4FL 1CBVL 2XTJC 4ZFFB 5FO7B 1ZEAH 4GKZA 2WYTA 4D8PB 5CD3B 5CP3H 1RK0B 2VQTA 4RLDA 4DZBB 1OIOA 2C3VB 3RTLA 4YFDB 4B3VA 4KI5C 1EDQA 5AL0A 2VE6A 1B3IA 3EDFA 4NQDD 2ARJQ 5FGBC 4GXVH 1LEIA 2J5WA 1DQQA 4JLRA 5L2JB 4EIZC 1N5YL 1UWYA 1JDCA 5JYLA 5EOQL 4HAGA 4LRNH 2XVBA 4WW2F 1PZBA 5FYJU 3GTNA 4QKXB 1IAII 3M1CA 4PVBA 3BYYA 2YQ2A 4EPSA 2XWTA 1CDYA 4XWGH 1IGYA 1KCUL 1OPGL 3PU7A 4PI2A 5EWIH 3QG7H 2VL5A 4KZDL 3NIGB 1VLXA 4NBZB 5GJSH 3FB8B 5EDSA 3DI3B 3WIIL 1YEKL 1MWAA 1NAKH 2A9ML 2R8SH 1FA4A 3H6JA 2LLLA 3IWUA 4JE4B 5DJ6B 2YRBA 4HCRA 5ISZD 2VMCA 2HG5A 1VERA 1YJDH 3DTXB 3Q8BA 4NDMB 3U0TB 4DN4H 1BGXL 4L05A 3IMSA 3MRLB 5D2LF 3T1FB 5HY9B 3VD1A 2PN5A 3I50H 1AFVL 3GZPA 4PJ9D 3K3QA 1DTUA 5JA9A 1B9KA 5CN1A 4MJIA 2H6PA 2F7IA 2GITA 3HRZA 1S9KC 5EIIA 4I3SL 3EKCA 3KMDA 3QJUB 2CCWA 4FXKB 3QR2A 4QHMB 4QTIL 2Z91B 3WYRA 4MXWL 4LCIH 1XB8A 4PJGF 1XGRA 1AS8A 3M07A 3JT2A 1NEZB 1HJBC 1FNLA 5CNHA 1JCVA 4MJ2A 2NDFA 4P4KC 3MA7B 5GS0D 1ADWA 4E41B 2NYYC 2AXFB 2WQAA 2X4QB 4OD3L 5KW9H 2WXIA 2WVVA 1BYPA 5AKVA 1MVUA 2DB8A 2LLGA 3HMXH