4Z7UE

S13 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
198
structure length
198
Chain Sequence
DAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRDRSNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 198
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uE02
1OCWH 2LU7A 3V9FA 1XGQA 1HHIB 5FYKH 1QSZA 4QRQA 4R7NB 4UQ3B 3OX8A 4JN1H 1DSFL 4YWGH 3ILQD 2V2WB 3AM8C 1I7RB 3IETB 5JUEL 4D3CH 3O0RH 2OZ4H 4HJJL 3AS2A 5AZ2L 4RAUB 1TVDA 3P9LA 4NGHL 4NHUA 2VDKL 3HG1B 2PYEA 4KJPD 4TOYH 5SV3A 5C08B 1H8NA 4ZFZA 4WCYL 3SJVB 1IT9H 2P5ED 4J3XA 2DM7A 4KK9D 2EDHA 1BJ1H 3EFDH 1U92A 1GYAA 5I8CB 5C6TL 3O3EA 1I7UB 4PD4K 3PWVA 5IJKC 1ORSB 4K3EH 5DR5L 4G8GD 3OGCA 3QA3A 3KYAA 4GRWB 3Q2CA 3U7WL 2LE9A 3VG9C 4PLNC 1GGTA 1MRFL 2EYSA 3OG4B 1EV2E 2HFFB 5JPNA 4LLQB 1NGZA 3FFCB 2ZCLL 1CGUA 5I17A 5E99L 3ARFD 3QHZH 3NTCL 2A74B 4U1GB 3HMXH 1YZZA 2LVCA 5HHQA 2BNRD 5C09E 4PTTB 2A38A 1LE5A 4PJCF 4IRSB 2QJDA 5A16B 4F7TB 1AGEA 4L9LA 4LCUA 1QFUL 4OM0H 5C0CA 2GJZA 1QLFA 4QHKI 3GSXA 2J3SA 4KKBC 2Y5EA 2K9UA 5C0BE 5B8CA 5JOFB 1QACA 1F3JB 1XGPB 3SDAD 4MHHG 4RDQG 5EOQH 3WXVH 1RZIB 1ZWIA 1PX4A 3FQUB 3TP4A 2BY2A 2ZNWA 1EUUA 1AIFA 2ILLA 4YBQC 5C0NC 5DGQA 1T89A 1V7ML 4LSPL 1EHAA 2I07B 3QEQE 5D7KE 1MQKL 5ISZB 1HHIA 4R7NA 4UQ3A 3P73B 5GRWA 2PNDA 1OGAE 4U6VL 4FTVD 2DICA 2V2WA 4WI4A 1I7RA 2R0KL 3IETA 5C3TA 1NC2B 2X4OA 4UT6L 1SEQL 4OGAD 3QUZD 1FBIH 3ULVC 3EFFB 2RIKA 4RAUA 1X5AA 4EI6A 3HG1A 3LN9A 3WCYA 4XNYH 5C08A 4NYLB 5HHOD 5J4MA 3GIVA 2H32H 4J4PA 5CLTA 4XVUD 1KXQE 1MFDL 4N1EA 3SJVA 2VUOA 3Q48A 5KAQF 3MGOB 4R4FH 1MCIA 2EIEA 2DMBA 3PL6D 5IMMB 3MUHL 1I7UA 3IFLH 5EOTB 1ORSA 4X5XB 4NZRH 5BJTB 1AGBB 3KYOB 3BPCB 4HAGA 4KKNA 3FZUD 4XP1L 4KQ4H 2XZCH 2HFFA 4LLQA 1I8LC 3FFCA 3WD5H 4H88H 3WJJC 2DLEA 3BZ4B 5K9OB 2IAND 1RVFL 2WBJD 1N5YH 2A74A 2FWOB 5F7EL 4JRYB 4EIGB 5HHVL 4PTTA 3AS0A 1MCHA 4IRSA 3ARYA 5A16A 5F6IC 4F7TA 4QGTA 5CSGA 1ZHNB 2PXYD 1QLEH 4OIAA 2NY2C 4WUUD 3R0MA 1EBAA 3GHBH 5HPOA 1F02I 1MIMH 5JOFA 5L88L 3RVXD 5GRJH 1F3JA 3DGCR 1XGPA 5I1JH 1FVCB 1K5NB 4KDTA 1RZIA 4KKLC 1SMAA 2D7TH 4F9LA 3MV7D 4YHOL 3IDGB 5GGSY 4EJ1C 2I07A 4ZS6D 3HC3L 3GBNH 2CQVA 5ISZA 1T1YB 3ZHLA 5B21A 1U41A 3P73A 3MOAL 4TSAH 1UWXH 2AJZB 3T0EC 3TJHD 3VWKD 5KVGL 3OKLB 4OUUB 3D2UB 1JGUL 2EDJA 1NC2A 3QCTH 3MJGX 4MZ2A 3EFFA 2VUYA 3B5TA 4NKIH 4H5SB 5DVKA 5DC4B 3MJ9A 4JDTH 3W0WB 4NYLA 3QEUB 2XWTB 3CH1B 4OD2B 4HXBL 1U2HA 1OP3K 4P46C 4YHNB 1LDPH 2EEBA 3MGOA 3C8DA 1HE7A 1DVFC 1AI1L 1I85C 2VDPL 2FO1A 1FC2D 3KJ4B 5IMMA 4R26L 4HPYH 5EOTA 1YDPB 4WFHE 5FK9B 3EOBB 3DX6B 3LSOB 4X5XA 3WUWB 5BJTA 1AGBA 3KYOA 4IS6B 3KPNA 3BPCA 3LB6C 2W60B 5C92A 3ME0A 1UB6B 5E2TL 1MY5A 4RAHA 1YY9C 3MRCB 4I48B 4MAYD 2GTWB 4JFDD 4RISL 5CJXC 3U30C 3MO1B 2CD0A 5F1NB 4XHJD 5K9OA 1A7BA 1BVKB 2MHAB 3KPPB 5C0AB 2FWOA 7CGTA 2Q3ZA 4OAWB 3TIEB 3GI8H 4NKOB 2YR3A 5I0ZA 4PY8I 1OAKH 1ZHNA 5D7IE 4XBGA 2XOTA 3ZT7A 3IDIB 2DMCA 1AO7A 2MCPL 4BZ2L 2B5IB 3WO4B 3R1GL 4XP6H 2UYLB 1RJZB 2DQIL 4UT9L 1BECA 1FVCA 1K5NA 4FMKA 3H7LA 1LNUB 3SCMB 4OGYL 2B0SH 3VI4F 1V3JA 2VDLL 4RMSA 1URLA 4ZS7L 5IBTH 3IDGA 2DWEB 1VA9A 4M6MH 5FUZH 1OPGL 1R3IH 1T1YA 1PFCA 4HLJA 1RZ7H 2XWBB 2AJZA 2YKLL 4OUUA 3D2UA 5D96B 2EXYD 4FQ2H 4X6BB 2AEPH 3T4AB 2H1PL 1MFCH 4Z7UE 3GHEL 4H5SA 1N26A 1A9EB 5TDPB 5ALBH 3W0WA 3QEUA 3WFCH 2XWTA 3CH1A 4OD2A 3O11B 1QSEB 5IVOA 1CFVL 4YHNA 2J7LA 4R3SA 4DN3H 3MLVH 4HGWA 1JZ8A 4YDIH 2R0ZL 1Q38A 3NGBB 4ODVL 1B4RA 3JWOL 1YDPA 5FK9A 3EOBA 5D70L 3DX6A 3LSOA 4ODSH 3WUWA 1XGRB 4ZOCA 3MJ9L 1A64A 3H42L 4IS6A 2UWEF 2V5TA 4LLUB 2W60A 2X42A 4NFDA 5ESQB 1UB6A 2ADGB 5D5MF 4PRID 3MRCA 4QRUB 4I48A 3C87A 4ODXA 2GTWA 4KRNA 1N0XH 3CXDL 2E7CA 3MO1A 1IFHH 4PJ5E 2NY1D 3C5ZC 1W0VB 1ZANL 5M7QA 1BVKA 4KI5E 2MHAA 3KPPA 1Q0XH 4PJFB 5C0AA 1IGMH 1LMKA 2F5BH 2H45A 4JB9H 3CSBA 4OAWA 3TIEA 2GQHA 4NKOA 2I9LB 2EDEA 5IW3A 1NANH 3VI3E 3CMOH 1G1CA 3UBXI 2QQKH 3IDIA 4GG6F 4ISVB 4OCXH 2X1PA 5L2JB 5B4MD 1N2RB 3NPZB 5EUOB 4FA8A 1BLNB 3IFPB 1D7FA 3N1FC 1JNLL 2UYLA 3HNVH 1MLCB 1RJZA 3VDAA 4M8QB 4HBCH 4Y1AD 5LWYL 1LNUA 3SCMA 2NY3D 2WLYA 3A6BH 2D03L 4ZYKB 2DWEA 4YHKH 4V2BA 4XB7A 1EJ6A 4LDOB 2XWBA 3O9WD 4LAQL 4UAOB 2HT3C 4M3KB 2O93L 5GXBB 3T4AA 2KBGA 1I3RB 4PJ9B 3PG2A 3ZKMD 1G7HB 3MNVB 5DA4A 1MJ8L 2V9TA 4X5WB 3HFMH 1TTGA 1A9EA 5TDPA 5HYSG 5FYLH 3O11A 1QSEA 4XVTH 3LZFH 1WF5A 4WU7B 4XMKL 4JHAL 3ZKNC 1RUQH 3ARGD 2CR6A 1VKXB 1JF1B 2DQJH 1MNUL 4JHZA 3KS0H 1JNNH 4K3JH 5FYJH 4BM7A 4NDMB 1XGRA 5HI4D 4LLUA 2GIYA 4YUEH 3DETC 4K3HA 5ESQA 3BD3A 2ADGA 3K2UL 4XXCC 4QRUA 5DJXB 4OF7A 2GI7A 3AB0B 4LQFL 1W0VA 4MJ5B 4HJGB 3D3VD 9CGTA 2GKIA 4PJFA 3FN0L 3VXRD 2I27N 3UJTL 4OCMC 5LXGH 2I9LA 2E6JA 1CTOA 4PLJC 5IG7B 5TFSL 1TZIB 1INDL 3BHBB 4MAUL 3HE6A 4ISVA 3A6CL 4WWID 3U4EB 2AJXL 1EGJA 5L2JA 4GXVL 5B3NA 1N2RA 5EUOA 4DZBB 4PUBL 4HQQL 3TV3H 3GIZL 5HTSA 1ACZA 3IDYB 4R0LC 2WBWB 4DUVA 1C1EH 3IFPA 3QDGD 5FM5O 3UAJC 1MLCA 4YXLL 4M8QA 4WW1B 4KI5F 2OXGA 2Q76B 1RIVH 4G6AC 4K8RH 3HC4L 1EO5A 1S78D 5DLML 2ZKHL 4ZYKA 4HKZB 3VXMB 2YXMA 4Y4HC 2UVEA 1CD1B 4P2CG 4TSCL 2E9IA 1ZTXL 3WJLA 1YQVL 2P5WB 2H2SC 3K80A 1D5XB 1JRHH 3LKNB 4DUWA 1I3RA 3HUJB 4PJ9A 2IH3B 3A67H 2NNAB 1G7HA 3MNVA 4X5WA 3V8CA 1LO0H 5KSBE 3SDDB 4BZ1L 4NZDA 5EOCJ 1BF2A 2W91A 1QQDB 2YD5A 1Z6JT 1GJIA 4W6WB 5CP7B 3CSYB 4U0QB 1A1OB 5F3HB 3HZYB 4WU7A 3D5OF 1JPTL 1OAZH 5IEKB 1H3PL 1R5IB 4LP5A 1IGTB 4ALAL 4X7SL 1VKXA 1JF1A 4OZFB 1NMBH 1NLDH 1X5KA 3EO9L 4YJZL 1JZ3A 4NDMA 1DQMH 3SKMB 4JG0L 2HWZL 5DJXA 5J89A 4NQED 1CFQB 4M7LH 1MRCH 4MJ5A 1FSKC 5CJOL 4EUPB 2VXUH 1YEHL 1CDIA 4EZMA 4M62L 4PJ8C 4JZNB 4W68A 4UT7H 2IG2L 1OSPH 5IG7A 1TZIA 3BHBA 5DXWA 3U4EA 1RI8A 4G7YH 1MLBB 1DP0A 4I2XE 1IGFL 2BVUA 2YPLB 4RMVA 1OSZB 4DZBA 3H7BB 4ZXBC 1S7WB 3RWCA 4APQB 3J8F7 3NCMA 5F6HI 1NGWB 5E2VL 1I1AB 3ARBB 5CD5D 5DJYB 5GPRA 1HH6B 3FT3B 5IFJB 3EOAB 3RWHA 2Q76A 3LH2H 2HJKB 4J3TA 4TTDC 5EC1B 2EZ0C 4HKZA 3VXMA 2WWKO 3O4OB 2IQAB 4OQTH 4JM2C 3OAUH 5TF1H 1EGJL 3PP4L 4XC1L 2DM4A 5JQ6H 4W4OA 1IEAB 2VO5A 1FRGL 1VHPA 1CD1A 3VGFA 3FQWB 2HRPH 2P5WA 2J8HA 1D5XA 3LKNA 3GRWH 4JGMA 3HUJA 4CMMB 1FL3B 2IH3A 2NNAA 3ZDXE 4OFDA 1INEL 5L8LB 3SDDA 4ENEC 4YDLB 4X8XA 1QQDA 5CP7A 1U8IB 3CSYA 2JIXD 1A1OA 5F3HA 3SE3A 4MB5A 3HZYA 2P8PB 3TH3T 1A6WH 2AQ2A 2DDQH 4ERSH 2Q8AL 5C86A 4FQPA 4XVSH 4CAGA 5IEKA 1Y0LB 3U83A 1R5IA 3OZ9H 1UACL 1IGTA 3JWDL 4U33A 2A77H 4NT6B 5GGTA 4G6KL 4OZFA 4OIBA 1MVUB 3HC0B 1MWAH 4XH2B 4FS0A 5J11B 3CVHL 5DRZA 3SKMA 1GVIA 4X9HA 5KSBF 5BMFH 1T7XA 1CFQA 5HJ3B 4QRRD 1WZ1H 4H8WC 5BV7H 1T2QL 4D94A 4FABL 2OR7A 3U9UB 2IFFH 2DQHL 5GZND 1G9NC 4JZNA 1MFEH 2AKRB 1KBGL 4J3VA 4LLWB 1UM5L 3SGKC 4GS7B 5CBAB 3I50L 2XY1A 1QBMH 2O61B 2Z8VC 3NFSH 1FCGA 1MLBA 2Z35B 1QR4A 2YPLA 1G9MH 1OSZA 4I0PD 5D72H 1S7WA 1DN0B 1FP5A 4APQA 4UB0H 2CRIA 4KRLB 5BVPL 2PYEE 1NGWA 5B38B 1I1AA 3ARBA 5E9DB 4NNXB 4P23D 4HMCA 5J0BA 5DJCB 3BP7B 1HH6A 3FT3A 5IFJA 3EOAA 5C7XL 1IRAY 1YEJH 2HJKA 2FATL 4A2LA 4Q9BA 5EC1A 2XZZA 1PQZB 2JJSC 1AD9B 3VFTB 3VXUE 4CN4A 4LGSB 1AFVH 2IQAA 3AMKA 4UMGA 3GNMH 4M5YL 3UJJL 4I0KA 1IEAA 4HAFA 1BEYH 4J3OC 3AY4A 3ULUH 4HBQA 3FQWA 3IS0X 3U0WL 3LEYL 4WI8A 2AK4E 4CMMA 1FL3A 5AD0B 1WWWX 3LIZL 2OZ4A 4V1DD 4ODTL 1F3DJ 5IFHL 2DQFB 1WAAA 4PJAB 3WNOA 4JFHD 1U8IA 5CBEB 4Z95L 2FRGP 3IDXL 1PG7H 2P8PA 1OQOA 1E4KC 1RULH 5GS3A 5JR1L 1MF2H 1Y0LA 4NT6A 2ZJSH 35C8L 1MVUA 2R2EB 3QUYD 5D6DC 3HC0A 5C0CE 4XH2A 1O5DT 4RGND 1BM3L 2X10A 4HK3J 2DTMH 1TFHA 5ABDE 3RWGB 2R4RH 4KJWD 1YQ2A 5HJ3A 2IAMB 1TQBB 3KWWB 5F1KC 2OTWB 3WUZA 3U9UA 4FNLH 1B3JA 3HI1B 5CZXC 4JFYB 5GGTL 1PY9A 4LLWA 4ZFGL 5FFLA 1NGQL 4P2QD 1I1YB 5CBAA 4ZTPH 3NAAH 1U3HC 2I60L 2YEZB 1T1ZB 5GRXG 3DPBA 3VMOA 1IAIL 1NLBL 4ONGL 2W0FB 4N1HB 2Y25A 5F7KC 4H0GA 4G3YL 2VN7A 4FFZL 3N85L 3TN0B 3GBML 1A14H 3B83A 1DN0A 3HG1E 3CK0L 5B38A 4PGEB 5E9DA 4NNXA 2VZSA 3QDHA 2JJWA 3WNNA 5ELIA 3BP7A 3S35H 3OF6A 1CGSL 3ZL4H 4HC1A 4JFED 2H2PC 1PQZA 1AD9A 2OMBA 4BFIB 4GRLB 2ZUQB 3RZCB 1IGIH 1CK0H 3I6LE 1FORL 3W9EB 5D1ZC 5KW9H 3ZYJA 2R9HC 3MV9B 1ACYL 3M17B 2NY7L 2FIKB 1CDBA 5AD0A 4G8GB 1NANI 2WK2A 4JKWA 2DQFA 3BSZH 4PJ7B 4WV1C 4PJAA 1N4XL 3BEWB 3ZE2E 4P57B 5CBEA 1OCWL 2PYFB 4FQJL 2IADB 4A6YH 4WY7L 1J0IA 4HPOL 4TNVF 5FYKL 1HNGA 4JO4H 2ATPB 1MIEL 4JN1L 4JFZH 3CH8A 3RI5F 4YWGL 1GAFH 1P4BH 2GK0B 4X4MA 1DUZA 3QG7H 5KZCD 2R2EA 2YMXL 5JTWA 2OZ4L 5CZKA 4C57C 4XAKD 1DZBA 2WLZA 4PJDB 4TOYL 3RWGA 1K3ZA 2IAMA 1KGCD 1QSFD 1F11B 3KWWA 2OTWA 3CZFB 5F7NC 1IT9L 2BOCB 3HI1A 4I3SL 5D4QA 4JFYA 1R3JB 5ISZE 3EFDL 5DO2D 2BJML 3HB3D 5DMGC 1I1YA 3NIFF 3OR7B 1HYRC 2YEZA 3NPSC 3QRGH 4Y4FC 1T1ZA 3WHXB 3EO0B 3T3PE 2ZCKL 4MCYB 2W0FA 1G0DA 1WJ3A 3RHWF 3ARZA 3TN0A 4RBPK 2NY0C 5T5FL 1MAKA 4PGEA 4JVUA 5I73C 3FONB 3ES6B 3QHZL 2CXKA 2W9EH 2OJZH 4N0YH 4OM1L 3EO1B 1Z9MA 3TF7C 3X12A 1F42A 4YDKL 5DMIL 4WGWB 4MWFB 4BFIA 2VLJE 4GRLA 3H0TB 3RZCA 1JV5B 4MS8C 4OM0L 5IROA 2OM5A 1ZLWH 3W9EA 2CMRH 4ESKA 2AABL 4L5FH 3MV9A 1YMHB 2PCPB 1K8DA 3UEZA 2FIKA 4L3ED 1U95B 4KUCF 3QDME 1WT5A 1OHQA 5EOQL 2YHGA 3WXVL 3NIDE 3QIWB 2NQCA 4HC1L 3BEWA 4MXVF 4P57A 3RBSA 5EU4B 2PYFA 2R8SL 5AG9A 2IADA 5I74B 3RPKA 1S7XB 3HI5H 2V9QA 5JHDE 2ATPA 3G5YB 1CDGA 3TBYB 4EOWH 5I6XB 3FO2B 2GK0A 1M6OB 2ARJB 5E4IA 3QZWG 4IOSD 1NDMB 4M7JL 1Q9KB 4XZUB 4Z8FL 5CILL 5MI0C 1AO7E 3V0AC 4LCIL 2HFGH 1QVOB 4QRSB 3WDJA 5IMKB 1I3VA 4TVPH 4PJDA 4XNYL 4L4TB 5JIKA 1NUGA 1Q1JL 4XB8A 3ZE2F 3QXAB 2SEBA 1F11A 3DX9B 3TT3L 4XCYB 3AS3A 1YNTB 2ADIB 3MQIA 5DQJB 3CZFA 3QCVL 1JRHI 2BOCA 2A73B 1C08B 4KKBD 2DOCA 1SJEB 4R4FL 1R3JA 3QAZC 3AMLA 2A9ML 1F00I 3DV4B 4AEHL 2DM3A 1A02N 2X1OA 1AY1H 3OR7A 3VGHA 5C0ND 1WCBB 3C09C 1DL7H 4YBQD 1OAYH 1QFWL 5CHNB 4YGAB 3U1SL 3WHXA 3EO0A 1KPUB 1QZ1A 4MCYA 3KPOB 1ZE3C 3OAZH 4MZ3A 3TM6A 3S3JA 1X4ZA 3RX8A 1FAIH 3MOQA 4XMPL 3WD5L 4TRPH 4U3XA 3RDTB 3FONA 3ES6A 3BKYL 1N5YL 2B2XH 2Z8SA 2DLTA 3EO1A 4GSDL 3ULVD 4L9LC 1YA5A 1RUPH 2AK1H 3LOWA 3LPFA 3M8OH 4MWFA 3LMJL 4DEPC 5IHLB 5F97E 3H0TA 5DRWB 3UZEA 1JV5A 1QLEL 4S1SL 3MRHB 3SE4A 3T3PF 5KVDH 5B8CC 1TVHB 1YMHA 2PCPA 1I1CA 3UBXG 1U95A 2DYPD 4QGYA 4WFEE 1T89C 3ZE0E 3QIWA 1WC7B 1U8HA 3EDKA 1S7UB 4OBSA 5EU4A 5B3JE 3FL7A 1S7XA 5E2UH 4TVSa 2VLMD 3G5YA 3TBYA 5C1MB 4TSAL 1CN4A 3FO2A 1JF5A 1CDYA 5BRZB 1M6OA 2ARJA 3PJSB 4ELKB 3REVB 1RIUH 2YN5A 3QCTL 1NDMA 5CEZL 1Q9KA 4XZUA 5ANMB 2FB4H 1QVOA 4J4PC 4QRSA 2J8OA 5IMKA 4ZODA 3KPSD 3T0AA 4L4TA 4ZD3H 2NX5D 3QXAA 1JWUB 2NY2D 3DX9A 3BUTA 4XCYA 2EYRB 5DQJA 2ADIA 5C0DA 5CKAA 5FO7A 2A73A 1C08A 1P9MA 5GZOC 1SJEA 3RUGE 1A7NH 4YDVA 4KKLD 3S88H 5F7WC 1MCPH 1WCBA 1S9KC 1T1WB 5CHNA 4S10A 1KPUA 4J1UB 3DECA 3KPOA 4MLIA 1MCDA 5EU6E 3SGJA 1FYHB 3T0ED 3RDTA 4DJMA 3GJFK 4IRSC 2VYRE 1J8HE 1G0XA 1UXWB 3MA9H 2DF3A 3OB8A 2HH0H 3LV3B 4PYHA 5DRWA 4LSRL 2E27H 1MCOH 2QSQA 4XBPB 5I1KL 3O8XB 3MRHA 2QQNL 3BKCH 3Q6GH 4F37F 2L0DA 4EKXA 4P46D 1JK8B 1TVHA 5AZEL 1VFAB 1OD7A 4OLWH 4KDTC 3REWB 3WYRA 4KPHH 4XP6L 4F9LC 4NO0D 1DVFD 1KCRH 2ITCB 4YR6B 4MMXC 2HTKC 1WC7A 2B0SL 2N7AA 1QBLH 2AEQH 4NCC1 1S7UA 4DGVL 4NBZB 2YD2A 1SYVB 3LB6D 3PGDB 4M6ML 5FUZL 1FDLL 1R3IL 1YY9D 1Q8MA 3P11H 8FABB 4R90H 3C2SA 1A3QA 3OKKB 4N0FB 5BRZA 2YD7A 3JWOC 3PJSA 4HS8H 3REVA 4ELKA 1S7VB 2K7PA 4Y5XB 1J1OL 3B5HA 2VLKB 5EUOE 3LQAL 4OT1H 1N7MH 4RGOH 1IGCL 1TITA 1X9QA 4JM4H 1NFDE 4BQ8A 1JWUA 4K3DH 2EYRA 5CJ5A 4E41B 3T4YA 1DQTA 2XIDA 5IP4A 5CWSB 4EN3B 4PV8B 3MLVL 3PE9A 4LRNH 4LU5L 4P2RE 3L6FB 5HY9B 4YDIL 5DJZB 4DZ8B 3UTTB 1T1WA 1ODAA 4TUJB 3H9YA 5F9WB 4J1UA 4HEME 4OLZH 3QQNA 3ZYIA 3MLUH 43C9B 5IHZA 2XTJE 1IFHL 1QR1B 3G9AB 2WINB 4G6ML 4MDJB 1LVEA 1NMCB 2YRZA 1KIPA 2ZOLB 1KN2H 5IB4B 1UXWA 5E00B 3RUGF 3GSWB 1T2XA 3CMOL 4FG6C 1JZ4A 3LV3A 4N68A 1SBSL 1DBAH 2VXQH 2DKUA 4XBPA 3VFGL 4XTRC 3O8XA 3SDXB 1SVZA 5TH2B 1QHOA 1BF8A 1JK8A 5E08L 4GKOA 4MB4A 4OZ4B 3DVGB 3QRFM 4OI7A 1VFAA 3RRQA 3U48A 3REWA 1OTSC 5IIEB 4WEBH 3S96B 3PWPB 4YR6A 5C0BD 1Y18B 1JN6A 2QV2A 4OZGB 1UQSB 3BQUD 5IB1B 1N3NB 4YHKL 1SYVA 3PGDA 5IM7B 2X9XA 1CT8B 3CLEH 1JZ2A 3CVIH 8FABA 1G9EA 5SWZD 1E28B 1CU4H 3QEQD 5D7KD 1WQVT 3OKKA 3C5ZD 3T3MF 4N0FA 5E8PB 1UA6H 2V5MA 1KFAL 4GO6B 5L9DL 3T65B 1REIA 5I9QB 1S7VA 4Y5XA 1JF6A 1UZ6E 2HG5B 1AP2B 2VLKA 3JV5A 6FABL 5ADOL 4GMTH 4I4WB 3T8XB 2EDTA 3CFBB 4NUJB 3R4DA 4KY1H 3ZMRA 4E41A 1A6VL 2C9AA 1U8LB 1CIUA 1CCZA 4LIQH 5FA4A 3KJ4C 5CWSA 4EN3A 3NIGE 4PV8A 5K33A 3C5SB 4M6OL 4OB5H 3MACL 3L6FA 4JFQB 4KKCC 5HY9A 4P59H 5DJZA 4DZ8A 1JNNL 2W9DL 4EEEA 1X3DA 3UTTA 4F8QA 4F8TA 1E6OL 1RUML 2FECL 3F58H 1LO4H 4N0RA 2P5WE 4YUEL 3RL1B 3C2AH 1S7SB 3QFJB 3HUJE 43C9A 1BQSA 4CKVX 3ZLQC 5CAYB 1QR1A 1NFDF 3HHRB 2HT3D 4LHUD 5A2LH 2WINA 2N4IA 3P77B 4MDJA 3SPVB 3KYNA 3QJHB 3MUGB 2ZOLA 2B4CH 1CGVA 3MRMB 4AMKH 1KENH 2C5DC 3GSUA 4OF0A 5IB4A 4B53A 1MJ7L 4HUNB 3NMEA 3GSWA 5KJRH 4WEMB 5CZVH 2LQRA 2YD8A 4PBWD 3VG0H 4M7KL 3FAWA 4GRMB 3SDXA 5TH2A 3WO4C 3K8KA 3O2VL 3ILPB 4OZ4A 3C6LB 3DVGA 4OKDA 3G6JF 3ZKND 3TV3L 3X11B 1YY8B 1NAKH 1X5IA 4UNTA 3SCMC 4BELD 5IIEA 4WWKA 4LASH 1EERB 1EK3A 3V6FB 3S96A 3PWPA 2ZSWB 1Y18A 4OCRH 4LPUA 3GMMB 1AC6A 1PLGL 1UQSA 1W72H 4OZGA 5FHAL 4X83A 4K8RL 5IB1A 1N3NA 4PJEA 3DETD 4I13B 4S1QH 5IM7A 1CT8A 2NW2A 5D96C 4NJ9H 1E28A 4ZQKB 2XKSA 7FABL 3NBNA 5E8PA 1JPSH 3T65A 2PN5A 1EFXD 3MPCA 4QTHB 2YPLE 1EHLH 2HG5A 1AP2A 4PLJD 2E8YA 5H2BB 3MRLB 3KHQA 4DN4L 2AJ3B 1YECH 1ETZB 3UC0H 4LPCA 1MJUL 3UTSB 4I4WA 4P3DB 3T8XA 3S5LG 4XGZB 1KJVB 3CFBA 4NUJA 3UXFA 2FH8A 3S4SB 2BVTA 3U7AA 3MODH 1OAZL 1U8LA 3GK8H 5E70A 4R8WL 3NGBC 4KROB 1JI1A 1B4JH 3C5SA 3IDJB 4PRHD 3UAJD 4JFQA 1OY3B 1NLDL 3QWRD 4HFWB 5FYKE 4WVRA 4G6AD 4CDHA 1CE6B 4CL7A 4HKJB 3RL1A 1FNEB 5FYKU 4WFHD 1S7SA 3P4OA 4Y19B 3DVFA 3QFJA 1E6JH 4UNUA 4Y4HD 1I1RA 4XBEH 3VFUB 1NQBA 3SOBH 2OL3B 2WSKA 4KMQA 5EC2B 3P77A 3WNMA 2H2SD 3SPVA 3QJHA 3MUGA 3MRMA 3NIGF 3HE6C 1U91A 4UT7L 2FL5B 1OSPL 2WUCH 4QNPF 3UDWA 3V6BR 2DQTH 3R8QA 4ZOAA 1MFAL 4R4BB 1NPUA 3M1BB 2VC2L 2I5YH 2IQ9L 4GRMA 1WBYB 1X5ZA 2YUZA 4XMLH 2ZUTA 3ILPA 3C6LA 2YPKB 1N6QH 2VXVH 1T6WA 3X11A 1YY8A 4LCWB 4QYOB 5F1OB 2IF7A 3CDCA 3F8UB 1LK3L 1Z5LB 4GQ9L 3V6FA 2W92A 4BUGA 4IRJB 2ZSWA 4Z6AT 5J06A 3GMMA 5GJTH 5I8KL 4M1DL 1A6ZB 1LD9A 4FXGB 3OBAA 1M71B 2VDNH 5A3IC 3OAUL 4UAOC 5I66A 5JQ6L 3JWDC 4HUWB 3WJLC 4ZQKA 4NO5B 4CJ1A 4P3CH 5J6HB 4PJ9C 2HRPL 5HSFA 3BEVB 4MA1B 4NOBA 4PJ8D 3QXDB 4G8FB 5DZNA 4QTHA 2PO6B 1KEGH 4YO0A 4K3GA 3MRLA 4Z7VB 5H2BA 2AJ3A 2HJLB 4HHAB 1ETZA 2ORBH 3UTSA 4P3DA 5E9DE 5AYUL 4XGZA 1KJVA 1EJOH 1PW3A 2D4FA 4HUXB 1H3GA 1A6WL 2DDQL 4ZXBD 4AG4L 1JGLH 3IDJA 4YK4B 1RZ8B 4RRPA 4HFWA 3CUPB 1CE6A 1Q72H 3WLBB 4TTDD 1L6ZA 2EZ0D 5FCUH 4HKJA 3AB0C 1FNEA 4KZEH 4JM2D 1XF5B 4Y19A 3KNBB 1GHFH 5BO1L 4IDJL 5BMFL 3BOVA 4MJ4A 4UIKH 4WTXA 3VFUA 2WANA 4LNRB 1MCWW 2F5AH 2OL3A 5EC2A 3AXLB 4PJ5D 4U31A 2IWGA 1CGWA 1KEML 1RJCA 2VAAB 2FL5A 2BNUB 3SO3C 3BPLB 2YA2A 1FGNH 4ENED 1T03L 2XT1B 2EEDA 4R4BA 3M1BA 3NFSL 4YIQB 2XZAL 4X4ME 1WBYA 3IDYC 5E1HB 1QNZH 3MC0A 1G9ML 3IJHB 5D72L 5JNYB 4LCWA 4QYOA 3O6LL 1TETL 2HT2C 4TUKL 1Z5LA 5EO1A 4IRJA 1NUFA 1V3LA 3CSPA 3FO1B 1A6ZA 4FXGA 1M71A 4W4OC 1F8TH 5F96L 1CFSB 1JJUA 4YE4H 3SQOH 5K9KB 4HUWA 4KJYA 1S7RB 5HDBF 4NO5A 4PJHE 4UV7H 1BEYL 3ULUL 4D9QD 2FSEB 5J6HA 5T1KB 2QLVB 2RQ8A 3BEVA 1AH1A 3SDDC 3QXDA 1BQLH 4G8FA 4CN1A 5I76B 2DBJA 2PO6A 5KVMC 3FRUB 5GISL 4Z7VA 2HJLA 3SE3C 1HHKB 1N64L 5FGCB 3DWTA 2ESVB 1PG7L 5IF0B 1IJ9A 1RULL 1WZLA 4NQCB 1AQKL 5FDYA 3UROR 3BP5B 4JFFB 1YEKH 5C71A 1RZ8A 4PBVC 4I77H 5EORL 5I1CH 5ERWB 2P8MB 4GUPA 3CUPA 2FLRT 1EEQA 3EOTL 3WLBA 2BNQB 2E7BA 4X8JB 2VERN 3MV9E 3JUYA 4NWUH 2EH8H 3RVWC 1XF5A 2ADFH 3KNBA 4AIOA 5CEZE 5FGBA 3CZJA 3WIFB 2CUIA 1ZLUH 4LNRA 2ICES 2PTTB 4OD3H 3AXLA 5FM4A 4XCFH 5T1LD 5D9SA 2DQGL 3L3OA 2Q1EA 2VAAA 1G7JB 3MFGB 2BNUA 1SY6H 1DLFL 2R56H 2E3VA 1FLTX 3NAAL 1RUAH 3PGFH 5C2BH 4YIQA 2DJSA 2VH5H 5FO8A 4APQC 4LVHB 2AJVL 1I1AC 3ARBC 3IJHA 2QSCH 3ORJA 1J0KA 5DD6B 5JNYA 3AVEA 4LDLB 1YYMH 1A21A 2OL3L 2KUTA 3STLB 4XPGL 5J13B 1PX3A 1VGEH 4BH8B 2JCCB 3L5HA 1D5IH 3H9HB 3O4OC 4TULH 3FO1A 2E8ZA 4G7VH 4OTXH 5HVHB 1NEZB 4LSVL 3SY0B 1FFQA 3AY4C 4Z7WE 1CFSA 3IU4H 4XP9H 1SBBA 5K9KA 1ZGLM 4NPYB 1S7RA 4CVZB 3QDJB 1I9JH 3QHFL 2GJ6D 5GGUB 2LAGB 2FSEA 3CDGB 1JNHB 1U0QA 5T1KA 5FDWB 1PEZA 5CZXD 3QWQB 4YPGB 5DT1H 4K23L 4QRPB 5I76A 4YDLC 3MRPB 3FRUA 4TPRH 2EDLA 1JHTB 3FN3A 4S1RH 1X5GA 1BFTA 2FZ3B 5C0FB 1U3HD 2GITB 1HHKA 1CVSC 5C8JB 2ESVA 4ONFH 1OP5K 5IF0A 3VMNA 4Y5YB 4NQCA 4JO4L 4RNRB 1JTPA 4UU9A 4ODBD 4CNIB 4YHYB 4JFZL 2AJUH 4PJHF 3BP5A 4JFFA 2KZWA 3T0XA 1WCQA 5ERWA 2P8MA 3RFZC 2BNQA 1E4WL 4X8JA 5DFWH 1JPFA 1QBBA 2H2PD 1YN6B 2C1OB 3VRLF 3L9RB 5GRYA 1UVQB 3GJFB 1RSFA 5EDXA 5J56B 4G6FB 2DI8A 3B8SA 4DTGL 5HVWA 1WFUA 5D1ZD 3WIFA 2AJYH 2R9HD 5F9OL 1H0DA 5IESH 1X7QB 4GS7C 5I15H 3BFOA 3L3KB 3WFDL 1G7JA 2CKBH 4O4YH 4KDVA 5L2KE 4XNUL 1AGFB 4JO2H 5FXCH 1U42A 4P5KB 4PJBB 1OQXA 2VDQH 5TQ0H 4DUXA 4NZTH 4HX1B 4QF1B 4KHTH 4S11A 4AQOA 3VFVB 4Z7QE 1KJ2H 5T1DL 5DD6A 2RBLA 2CDFB 1KIUA 1G7IB 3R06B 4F33B 4PGDB 3STLA 1CD0A 1NCDH 4GJTB 2D9QB 4BH8A 2JCCA 2W9EL 5TF0A 3H9HA 4OI8A 2ED7A 2XRAL 5EZIH 4Q6YA 5GSRB 4F7EB 1RU9H 3I3DA 1NEZA 1F4YH 3SY0A 1XGYL 4JRXD 1FGVL 2DQUH 4NPYA 3O6MH 4MA7L 3ZE1E 4CVZA 3QDJA 2CMRL 4FQIH 2W0LA 5GGUA 2Y07H 3CDGA 2OLDA 3VXSD 4L5FL 1JNHA 1MAJA 2OBGA 3DXAB 1FL6B 1YMMB 2B8OT 4YPGA 3D25B 4QRPA 5CJQH 3MRPA 1IGJB 4M1GH 5DMGD 4HWBH 1JHTA 3RTQB 4DGIH 2FZ3A 5C0FA 4NO2B 2GITA 4QOKB 4Y4FD 3HPLB 1A6PA 1UM6L 5JMRA 5C8JA 3SEPA 4GW1B 1A1NB 4YHML 4Y5YA 1XH3B 4RNRA 3OSKA 4UI2A 4Z7WF 2DQDL 3BT2L 4EOWL 4CNIA 4PGZA 2NY0D 4MVBC 2ZCHL 4HDIB 2ZUWA 3SKJL 3BX7C 1I4FB 1NH6A 1L7IH 1YN6A 2C1OA 3F65A 2IAMC 3L9RA 3HNSL 1UVQA 3GJFA 3KYKL 3W39A 4MS8D 3JBG7 2MOVA 1JL8A 4HZAA 1ZHBB 4CU6A 1Z0MA 1GGYA 1X7QA 5E1AB 3L3KA 4JR9L 5FOBB 3JV4B 1OD9A 5T33L 1MFBH 3F6IA 5F9AC 2F53B 1RZJH 3FB7B 3P4NB 4NBXB 4P5KA 4PJBA 1DL7L 2VMFA 3TN0C 1ZMYA 4QF1A 3QQ3B 2Z8RA 2A83B 3TFKC 3VFVA 2BSTB 5FYJE 2CDFA 1G7IA 5EOCH 1GGCH 3R06A 4F33A 4PGDA 5SWQB 5FYJU 2PYED 2QTEA 3OPZL 4GRLC 2ZUQC 5GSRA 3RZCC 5F89B 4F7EA 5C6PB 5IROC 2XI9A 5HI3C 1RUPL 2NY2B 3SKNB 4UINH 1IKFH 2A6DB 3MBEB 4D0DB 4FMFA 4XPFL 2QKIB 5D7LB 3T2NH 2HMIC 5LGHL 1T7VA 1WT5C 1DN2A 3DXAA 1FL6A 1YMMA 3BWAB 4GBXB 4PJCB 3D25A 3QUXB 1CE1L 1IGJA 3L3HB 4N8VA 3QEHB 4QXUL 3RTQA 2OX5A 4QOKA 4S0SD 3HPLA 2HFEB 3CDYA 4NQDB 2HA1A 1MHPH 4GW1A 1A1NA 1XH3A 4LEOB 1BQHB 4RWHA 4U2YA 4DGYH 4N5EC 2DQCH 2R1XB 4HDIA 2BP3A 5KBNC 4W81A 3JXAA 5E8DL 5D1QB 1ZA3A 1I4FA 4POYA 3CSGA 1F4XH 2B7DT 5C0CD 5GGRY 4M43L 5DD0H 4Z7OE 3V4UH 1Z2KA 1FCCA 4LPTA 5F7FA 8CGTA 3AROA 5E1AA 1DFBH 4KWUA 3E6HB 5FOBA 3JV4A 3K1KC 1XF1A 1VERA 2F53A 1K85A 3H2WA 3P4NA 3FB7A 3SE8H 2I9TB 1DQQB 4L1DA 4PG2A 5E4EB 1ZK9A 3QQ3A 2JK5B 2A83A 2BSTA 2O5XL 3B8YA 1J10A 4NJAH 3BKJH 4MX7B 5SWQA 1F58L 3HG1D 1WGOA 4PJIF 3ZTNH 2ZPKL 5F89A 5C08D 4BH7B 3LY6A 1RK1B 25C8L 2R69H 4J4PD 3SKNA 3SE4C 5MENB 2A6DA 3OJDB 3MBEA 3SJVD 4D0DA 4Y8AA 1MCOL 4H25B 5HHNA 1NCWH 2QKIA 5D7LA 5HI5C 3GBLA 3U0TB 2KKQA 4YDJA 3I6LD 5TJWK 1BD2B 3BWAA 1EDQA 4GBXA 4PJCA 3VW3H 3QUXA 3QIWC 3LQAC 5GZOD 2A1WL 1KCRL 3SGDH 2X4RB 3L3HA 1F6FB 1P4IL 4QT5B 2YUWA 3QEHA 5E8EB 1J7VR 5I74C 4ODHH 1DBKH 1OTTD 2C4FT 2HFEA 3L7EB 1RZKC 5I6XC 3DYMA 3FFCD 4NQDA 1EVUA 5IW6B 1SJHB 1QO3B 2ED8A 3CU7A 1BFSA 3OV6A 3P11L 4LEOA 4JPVL 4G8IB 4F9PA 3ZKQD 3TA3B 3IVKB 5F72S 2IJ0C 1T7YA 2R1XA 1IQDB 4RMWA 4HS8L 1RUKL 3BN3B 4IRSD 2YD6A 1MCEA 3RP1A 5C09B 1TTFA 3I9GH 5D1QA 3O6FB 4I18B 4XPTH 2YOCA 4OGXL 4RGOL 4OLEA 5JOPE 2YRLA 4R4NC 4JM4L 5LJYH 3DMMA 1DBBH 1RFDL 1P9MC 4OCSL 4OZGE 5C0RH 3NCYS 1ZLSL 1CZ8L 1NCTA 2Y06L 2HVJB 3E6HA 4PJEE 5HDQL 5K9JL 4LRNL 4HKXB 4KRMB 3L5XL 5D2LF 2HTKD 4QO1A 2Z0BA 5GS0L 2GY7B 3F7QA 1UENA 5ISZD 1YUHB 3C5ZB 1QP1A 2I9TA 1DQQA 1KB5H 3SGJC 1UC6A 4OLZL 3RDTC 4Z7OF 1OGAB 1NC2D 4LARL 4OLXL 3X3GL 5J8OA 4TNVK 1NKOA 1JBJA 4MX7A 3RIAF 2F19H 1VFMA 3TO4B 2WMPA 4K94L 4BH7A 5CIPH 1BWWA 1XGUB 1ZVHA 4XP4H 1RK1A 5MENA 1DBAL 3OJDA 1OARL 4HIHB 2CJUH 4QXGL 5F1IA 5I1EL 1L7TL 3QUZA 3U0TA 2CLVB 2CUMA 2P45B 4Y4KB 5GRUL 1BD2A 4G9FB 5DEGB 1M1SA 1HOCB 4U1SB 2X4RA 3MLXL 3QFJE 4QT5A 4DW2H 4PLKC 3ZO0A 5E8EA 4PTUB 4BQCA 3WFBH 4BQ6A 1UADC 1EO8L 5D71H 3L7EA 2QADB 4DFHA 2EXWC 2HKHL 1SJHA 1QO3A 1SEBB 2RCSH 5JW3L 4G8IA 4QHKJ 1J0HA 3RHWK 3TA3A 4JRYD 1IC4H 1HQ4B 5C09A 3UPAA 5DEFB 4HWNA 3O6FA 4K7PL 2UY7A 4I18A 3ULUE 4FG6D 4OZFG 3GMOB 1KNOB 3EDFA 3STZB 2GYSA 1OOAA 4X7FC 4XTRD 4XP5H 4KY1L 4G43B 1FZMB 3N9GL 3GMQB 2Y36H 4AL8H 1NAMB 5JDSB 3TNMB 4OFVA 1UWEH 3PDOB 4NC0B 3QHTC 2HVJA 1OTSD 3ZKSD 3IJYB 3RAJH 4HKXA 1BREA 1BZ7B 4ACPA 4X6EB 1S3KL 1UM4H 4EUPG 4JQXA 5GJSH 1ZHLB 5JLZA 2PR4H 4JPKH 2X89A 4V2CB 1YUHA 3F58L 1JTOA 5EB9A 5HDLA 3C2AL 3MJ6A 3D2UD 4X9GA 3MXWH 3O4LB 1OGAA 1MY7A 2OMNA 3MGAA 3UTSE 4MHHI 2NXZB 4H1LB 4K8RC 4FHBD 3TO4A 5D1XB 2UWEB 3W0WD 4AMKL 5D5MB 4JPWH 2VJXA 1A6TB 4KZDL 3MZTA 4MJ2A 5DHVH 5F8QC 3O8XC 3MSPA 2M8XA 5CZVL 2DIAA 2N1KA 4ZUVB 4HIHA 3I02B 4K9EC 1LWRA 3UO1H 3BDYH 5DJAB 4XVJL 3LRSB 2CLVA 4Y4KA 4NM4H 1JZ6A 4G9FA 5DEGA 1HOCA 2DQEL 4U1SA 4BKLB 4LASL 4O5LH 4KKCD 4Y19E 4GG6B 2AGJH 2WIIB 4OF6A 4OCRL 4PTUA 3TEUA 1W72L 2BRRL 4WFED 4JZOB 5AWNL 1I75A 1FLRL 2Q8BH 4EDXB 1IEHA 3VH8B 1SEBA 1AQDB 1A3RH 3BH9B 5C0AD 5DRXB 5ALCH 4Y5XC 1QLRA 2NCMA 4O02H 3NCEB 1HQ4A 5LGKA 1OP9A 3MROB 2OR9H 5DEFA 3OJ2C 3GMOA 1KNOA 3UC0L 4U1IB 3IFNH 3STZA 2KL6A 5F7DB 4P2OA 4K07A 4AIXA 1BFVH 2VQ1B 4EN3C 1I9IL 4G43A 1FZMA 2VZUA 3B2VH 3GMQA 3K81A 1NAMA 3TNMA 3BGMB 4J8RB 3IJYA 3SCMD 1LO3L 1B4JL 4YXHH 2X40A 4M03A 5ECJE 4YHZH 1BZ7A 4X6EA 5F9WC 2FX9L 1ZHLA 2X2YA 3LKSB 1B6UA 3K1DA 3HMWL 3HR5B 1JYVA 2Z91B 3WSQL 4GMSL 3O2DA 3ULUF 1X5XA 3MLWL 1U6AH 1A3LH 4LSSL 1E6JL 3O4LA 4MQSB 3ULVH 4Z7VE 3I2CL 5IHUL 4XBEL 1G6RH 2D0FA 2JB6B 3SOBL 2AS5M 1FNLA 4JG1L 4H1LA 1SJVA 3KXFE 4Z7UB 5D1XA 3NFNB 2UWEA 3TO2B 1U58B 2IGFH 5D5MA 1A6TA 5ADPL 4OIIL 2AAVA 3C08L 4WFFE 1KCSH 3CX5J 1QSED 2F58L 3LS5H 4ZUVA 3I02A 3OB0H 2AI0L 1BMGA 1WSST 3T2OA 3KDMB 5DJAA 2P4AB 3FO9B 3LRSA 4WWKC 1CDCA 4Q0XH 1N6QL 2VXVL 1AGCB 4JFOB 3SKOA 4BKLA 1QG3A 4GG6A 2WIIA 3HA0A 1IAKB 3KPTA 1TDQA 4JZOA 4BQBA 3KLAB 5T3XL 1H8SA 3FTGB 4LDEB 1NKRA 4EDXA 3VH8A 5DMYA 2LU3A 1S8DA 1AQDA 5E6YA 4NHCL 2JLLA 5CJ8A 3MREB 4U6TA 3BH9A 5KG9B 5I9QC 5JXEA 1DUYB 3K4DA 5DRXA 3SKUD 5CGYC 5L6YH 1OT2A 1DBJL 5HGGS 2F9BT 3MROA 4FQ1H 4XAWL 3HE6D 4JY5L 4NQXB 3U4AA 5F93C 1ZA6B 3FQXB 4GKZB 5DHYB 2ORBL 3G5ZB 4HGMA 1M7IB 2J88L 3PQYB 2VSDA 3K8LA 2VQ1A 1MFNA 3O3UN 4LKXB 3BGMA 4J8RA 3EZ8A 4PJGF 4L8CB 2EE9A 3H3PH 5CINH 4P9HL 3VFWB 3FMGL 1SY6A 1FNAA 2J6EH 2QR0B 3LKSA 2Z31B 2FD6H 2WP3O 3HR5A 1G9MC 2Z91A 5GGVL 3BDXA 5A3ID 1GHFL 4U2ZA 1NL0H 1OM3L 3ZTJG 1I3UA 3T04D 1NAML 5EBMB 2JB6A 2OK0H 4PJ9D 1A2YB 4OV5B 4TVPE 3G6DH 2MQ0A 1FNHA 4LOUC 3NFNA 3TO2A 4FQLL 3UDWC 1IC1A 1U58A 6CGTA 5J6GB 3BE1H 1P1ZA 4NQCE 4U6XB 1QUNA 4D9LH 2BXYA 2J1KA 2MNUA 3C6LC 4JKLA 4JFFE 3EYUH 3O2DL 2KDGA 3KDMA 3ALXA 3FO9A 4NFBA 1FO0B 5DA0B 3FRPA 2O5ZH 1IQWL 3U4BL 4DFIA 3D39B 2JJVA 4JFOA 4B50A 4KRPB 4DAGH 5J7CC 3X3FH 1UJ3B 12E8H 4C55A 1IAKA 5DD3L 3KLAA 4L3CA 3FTGA 3D1MC 2DLFL 4JRWA 1F8TL 4U3HA 4RIRB 4NNPH 1NCAH 5CMAB 5T1LB 3SQOL 2J4WL 4EIZC 3MREA 4BQ9A 5KG9A 4QY8B 3TT1L 5KVFH 1DUYA 4ZFFB 3DOSA 4UV7L 3RU8L 5D8JL 2G60H 5SWSB 2GEEA 2AQ3A 3DUHA 3BD4A 1WICA 4G5ZH 5JXAH 3OL2A 1BQLL 3W82A 1R0AH 1VCAA 3Q5OA 3ZYZA 1ZA6A 2EDNA 4GKZA 4C4KT 2WWMC 1U8PB 4KTDH 3G5ZA 3T2PA 4MA8L 2DMKA 2BY3A 5FEBA 1M7IA 3PQYA 3CXHJ 4X6CF 4KROC 3EW3B 5TE7H 1BGXH 4LKXA 1ZEAH 2AXGB 1T80A 3PWNB 3GB7B 4HXAH 4E5XB 3GSNB 4L8CA 2HT2D 4F15B 1YEKL 3FO0L 1RY7B 3W5NA 3VFWA 3THMH 3VXMD 4QHLB 3BO8B 2XWJB 1C5CH 2QR0A 2Z31A 4AH2B 1EEUA 3HNTL 4DQOH 4NWUL 2VIRB 2P42B 4QRPE 5IKCB 2P5WD 2C3HA 3ARWA 3UTQB 2BVPB 2RFXB 3FT2B 3ABZA 5EBMA 1A2YA 4OV5A 4OD3L 2DAVA 3GSQB 3LS4H 2VSCA 4B7LA 3SDDD 2XACC 4JJHA 5KSBB 5J6GA 1VPOL 1DDHB 3WN5B 1SY6L 3L7FB 4U6XA 3U9PH 2CGRH 4NOFA 2XZQH 5MHSD 2XICA 5J12B 5IQ7H 5E95B 3VCLB 3RY6A 1FO0A 2X41A 3SE9L 4LVEA 2QSCL 5EPMB 3S9DB 3SDCB 4IRJC 4CW1B 3D39A 4ZFOB 4LPVA 4R6UA 2V5SA 4KHXL 5FUOH 1UJ3A 2V17L 4OSUH 4WU5A 1D5IL 5DWUL 2VLLB 3ETBF 1HINH 5ETUB 3GO1H 2AXFB 4MD0B 3RVWD 5DMJB 3VDCA 4DKFL 2R29H 4U0RB 1NCBH 1KB9J 3N06B 4QY8A 2VL5B 4MA1C 4ZFFA 3VFRB 2YD3A 2JKXA 1CLZL 2PO6C 5SWSA 4PJBE 1BJ1J 3SHSA 1U3JA 3KVQA 5DT1L 5K9QI 5A1AA 1P5VA 3QR2A 4TPRL 1ZT7B 3D0VB 1YC7A 1U8PA 2YPLD 3CX5K 3BXNB 3MRDB 4APQD 1FNGB 3V6ZB 2EE2A 1OWWA 5DC9B 1I1AD 3ARBD 4YK4C 2AXGA 3PWNA 3GB7A 1QRKA 4E5XA 2AJUL 4WUKH 3GSOB 4FQCL 3D9AL 1GIGH 4QHLA 3BO8A 2XWJA 1DEEB 1MELA 3D0LA 2K1MA 4I0CC 3MFFA 5FGBC 4AH2A 3PNWB 5LCVH 4TTGA 2G75B 3ZT6A 1YMME 5C0EB 2VIRA 2CK0L 2BVEA 2XKUA 1MI5B 5IKCA 3UTQA 2BVPA 2RFXA 3FT2A 3S34H 2EDOA 1BAFL 2AJYL 3PDGA 4QOKE 2FX8L 3GSQA 3BPLC 4ZO7A 4HZLA 5KSBA 4LSQL 4GXUN 1DDHA 3WN5A 3L7FA 4FXLA 1IC7H 3BPOB 2VDQL 5TQ0L 3PF2A 4JQIH 4N0UE 3VCLA 3WIIH 1LO2H 1A0QH 4XNZB 5D7JB 4KHTL 1NMAH 2EH7L 4NKMB 3ULSB 2DI9A 5EPMA 3V7AE 5T3ZL 1MHHB 1N8ZB 4NN7B 5DGRA 3SDCA 4LLDB 4CW1A 5D7SH 4OKVB 4ZFOA 5F70A 3T1WA 2VLLA 2AEIT 4GG8B 5HVFB 2EDRA 4RX4A 1P7QB 1V8HA 5ETUA 2AXFA 3INUL 1BVZA 4MD0A 4JGJA 3CX2A 1JFQL 2DQUL 2D4DA 2VLRB 4JDVB 1FO0L 2VL5A 3VFRA 4FQIL 2Y07L 4Y16B 3V4PL 4KVCH 1ZT7A 1EBPA 1VGKB 3D0VA 5EZJB 3VXNB 2F8XC 4DGIL 1J86A 1MEXH 3BXNA 3MRDA 5BOPA 3VA6A 3V6ZA 5E9DD 1A5FL 3TH2T 2YXFA 3TYGH 3MXVH 3L5WB 1GGBL 1MCLA 3V52H 3GSOA 5BVJB 4JKPH 5DDHB 4U6HB 4HCRH 4L9DA 1DEEA 4TYUA 3VXUB 5I1AB 1H8OA 1N0LA 3PNWA 3JVGA 5L7XH 2G75A 2EIDA 1KYOJ 4KAQH 5C0EA 3RPIB 4PJCE 1MI5A 4YHLL 2B20A 1YJDL 4PRNB 2VDOL 3B9DA 2AK4B 4NZUL 3VMPA 4NQDE 1MFBL 4U1NB 3GEWB 1CGXA 1T0MB 4OJFH 4LVHC 4LIQE 3Q1SL 3WDHA 3V79C 1FV1B 4FP8H 1O7SA 1D3CA 5D7JA 1OL0A 4NKMA 3V6OA 3ULSA 4V1DA 5J13C 3WFEH 1MHHA 1N8ZA 2V9RA 3KGRA 4LLDA 1GGCL 4AEFA 4MVBD 5EU3B 2B39A 5FIEA 5C0CB 5HVHC 4GXUM 4DEPB 2GSGA 1A7OH 3ROLB 2D2OA 1RV6X 4GG8A 4LMQE 4M4PA 4NCC2 4UTBH 1P7QA 1ZHKB 2VISB 2IAMD 3Q5YA 2ZG3A 5I1IL 1MRDH 4JFXB 3WIHA 1WISA 5TE4H 3PDDA 4KJQD 2VLRA 4JDVA 4PGBB 5DD5H 1CL7L 1NCNA 3QIBB 2IFGA 2BC4B 4Y16A 4HF5H 2FDBP 4N8CL 4ZFOL 3OAYH 4NP4L 2P8LB 4WW2F 2R4SH 3H9SB 5HPMB 1VGKA 5EZJA 1HKLH 3VXNA 3B9EA 5LQBH 2DBLH 4R9HA 2R1WA 2X4OB 4Y5YC 2NY5L 3TN0D 2ZUYA 4YHYC 1CFTB 1MHPL 2VDRH 4EI6B 1V7NL 4D2NA 3S36L 3TFKD 4MXWH 4MLSA 3L5WA 3D18B 3GIVB 2FBJH 5MENE 4FTVE 5ACMA 5BVJA 5DDHA 3B4NA 4JHWH 4U6HA 1KJ3H 4GRLD 3RZCD 1KF9B 3VXUA 5I1AA 3BGAA 2YK1L 1KCVH 3QG6A 5HI3D 1VESA 1BD2E 2DL9A 3RPIA 2DD8H 1D5MB 1AD0B 4UTAL 3IFOB 4AJ0A 3MV9D 5I1GH 2D0GA 1TJGL 2HMID 4PRNA 1KB9K 2M1KA 5CEZD 3GDBA 1TQCC 2AK4A 1DFBL 1DTUA 3SBWA 1WK0A 1MUJB 1DBML 3ISWA 3NH7L 4M6NH 4U1NA 1MSPA 2JTDA 3CFJB 5DJ2B 1T0MA 3GM8A 4Y2DB 3RA7L 3SE8L 3NACL 5JHLH 4J6RL 3ARQA 1FV1A 3QNXA 2E6QA 3LDBB 4JKMA 2O5YH 3TVMA 4TNWF 5HHXH 4PGJA 1IBGL 2BVQB 4KTEL 5EU3A 5DURD 4N5ED 1PSKL 1ZLVK 3BKJL 3OXSB 3ROOB 1YEIH 1PG7X 3ROLA 5IB5B 2MCG1 4KK6C 1EO7A 2VDML 4H8WH 1ZHKA 2VISA 2D0HA 1QEWB 2OTUB 4JFXA 3MLYH 1UWGH 4KQ3H 2J8UF 1ORQB 1G9NH 3MRJB 1W2KT 1WEJH 2CDGB 4AT6B 3P0VH 4PGBA 4X80L 5ILTL 3QIBA 2BC4A 1HHGB 4PJ7F 2UY6A 3E3QC 3RTQC 3C5JB 2P8LA 3ZHDA 3H9SA 3SDYL 3P0YH 5DVOA 4QTIH 15C8H 5HPMA 4QWWC 3MV7E 3MLTB 1DBKL 1W0WB 1P7KB 3C8HA 4MJIB 3WIHL 1CFTA 4PB9H 4O58L 3WKNA 5CUSH 3JSSA 3HAEB 5GGQH 5T3XE 3D18A 5GS0C 2NY4B 3HI6H 3MRQB 2Z93B 4M6AA 4WFGD 1AXTH 2AV7B 2VLJB 3QEGH 1CF8H 4G9FE 1D5MA 1CR9L 1AD0A 4MB3A 3IFOA 3QPXH 1DQLL 5HI5D 4X7TB 3HTLX 3WXWH 4ZUUB 3KPNB 3QDMB 4K94C 4LLMB 3U7YH 4RFOH 3BYYA 3QIWD 5K59F 1FIGH 1MUJA 1MCRA 4BJLA 3CC5B 2VXSH 1F4AA 2BRQA 3CFJA 5DJ2A 3E8UH 4Y2DA 1Z9LA 4PG2C 1U8OB 2C3VB 5ENWB 3FQTB 5FHBH 4OCNC 4NWTH 3VI4E 5JHDB 3QNYB 2R39A 1A6UL 4TSBH 1WBXB 1YEGH 4XBGB 3QUMH 4OZHE 2BVQA 4CVWA 5CP3H 3F6LA 3OXSA 3ROOA 3IS1X 4YXKH 4DK3A 5IB5A 1AO7B 2ZG1A 4LEXL 3MBEC 4L4TD 1QEWA 2OTUA 1FPTH 1JPGB 1KYOK 2PW2B 1ORQA 4R4ND 2E7LA 3MRJA 5BXFA 2CDGA 4AT6A 3EYQC 2X7LB 5HHMB 4GBXC 2BDNH 3QUXC 1LP9E 4DCQB 4UV4H 5CKGA 3VE0B 1HHGA 1AE6H 5EZOH 3C5JA 5M94B 1KLFA 2FX7H 2D7NA 4L3AA 5JO5B 3L1OL 3O4LE 4BUHA 1CLOL 1OTUC 1WFOA 3WFBL 3MLTA 5JZ7C 1RURL 4O2EB 1W0WA 1P7KA 1EPFA 5D71L 4P4RB 2LU4A 5INDB 4X9FA 4MJIA 4F9PC 1YNLH 3GZKA 5MEPB 2RCSL 2UWEE 3RDTD 1GGIH 1RQ5A 5D5ME 1UWXK 3HAEA 1OB1B 3DYOA 5D1QC 1F2QA 3S4SG 3TJEL 4M48H 3WEXA 3MRQA 2W0PA 2Z93A 2PUQT 1FH5L 2AV7A 1FYTB 5JUEH 2VLJA 1ADQH 3QO1B 2COQA 4R3SB 5SX5H 4HGWB 4HJJH 3BKML 5J3HC 1MH5B 3DMMC 4NGHH 2VDKH 4OCLC 4GG6E 5I19L 4X7TA 5JPMB 1H3WM 4MNGB 1F6LL 4ZUUA 3PP3H 3QDMA 4LLMA 1X4XA 1UWEL 2NY6B 4YEFA 1KG0B 5DVLA 4NQUA 4ODXB 4WTZG 2EIZB 2DRUA 3CC5A 3FKUS 3MRFA 4PLKD 1UM4L 2C1PB 1JE6A 1U8OA 2C3VA 5E4EC 3FQTA 5ENWA 5DTFB 2JJTA 5C6TH 2EXWD 3QNYA 5JHDA 2ICWJ 4PRIE 1WBXA 2IBGA 5FO9B 5BRZD 1HSAB 3RY5A 1XAUA 2H3NB 3U7WH 3V4VH 3CDFA 4WO4B 4FFWC 3LQMA 3N1QC 5E99H 4RAVB 3RWEB 3X17A 3GSVB 2R1YB 2NPLX 4LHJB 1JPGA 4B0MM 3QUZC 2PW2A 4UDUB 1YNKH 5TDNB 3V5HB 2X7LA 3P9MA 4ETQB 4ZDHB 4DCQA 1QFUH 3VE0A 2VZ1A 1SVCP 4NM4L 3D85B 1HKFA 4JY4B 3RUGB 1F97A 1EHXA 4OZHF 1QFOA 4K2UL 4F58L 1TJIL 3BH8B 5JO5A 4HUKB 3C8KB 1F2XK 3LPWA 4O2EA 1E4XI 4P4RA 2WUBL 5EU6B 5INDA 1ZGLP 5MEPA 3TA3C 3KAAA 2ZSVB 4LSPH 3EYFA 1WIPA 3V0WL 3B9KA 4YBLB 1OB1A 1CIDA 1LP9F 4O02L 1J8HB 3O6FC 4AY0A 4I18C 2C4XA 1GZPB 4U6VH 1J11A 4ZG1A 5I1DB 1KV3A 2R0KH 3MMEB 1FYTA 1J0YA 1FN4B 1GC1L 3QO1A 3FQNB 3O8XD 2J5LB 5ACLA 4UT6H 4IOFC 1SEQH 1ZGLA 1MH5A 1K2DB 4LLVB 5JPMA 3WS6A 4MNGA 1VDGA 4X7DC 1R5WB 5C0IB 2VZVA 1T7WA 1MFDH 1KG0A 4JQXC 2ID5A 4OLYL 1EEYB 2EIZA 1A7PH 1GOFA 1IC5H 2G5BB 4HUVB 2C1PA 2IPTL 5HGHB 2JF1A 4LCCB 4N9GB 1UH3A 5DTFA 4F57H 1II4E 2G9HB 5I71B 1SMOA 4O2FB 1FZKB 3TBSA 1S7TB 5FO9A 1HSAA 3T2QA 2H3NA 3DROB 4ZS6C 3ULVL 2DIBA 3HE6B 1BBDL 4XP1H 3TO4C 2P44B 2ZZUT 4WO4A 2VLKD 3PQYE 3VXRE 1I3GL 1JZ7A 4RAVA 3V2AR 3RWEA 1RVFH 1YEEL 3GSVA 3MLRH 2R1YA 5D2NE 5HHVH 3LS5L 4LSDA 4UDUA 1NFDB 4E41D 5TDNA 3V5HA 4Y4KC 1EEZB 1KIRB 4ETQA 1JYXA 4ZDHA 4EN3D 4Y8DC 3KLSA 3D85A 3SGEI 4D8PB 4Q0XL 1HQRB 4JY4A 3RUGA 4P2RB 3BJ91 5TE6L 3QDGE 4X6DE 3UTTD 3B2UC 1JHLL 4QHMB 3BH8A 4ZNCD 1FFOB 2QADC 3C8KA 5L88H 1CFNB 5SX4I 3FOMB 5T3ZE 1VADB 4X4XB 1Y6NR 2KH2B 3G6JB 5EU6A 4YHOH 4LSTL 2VN4A 4OFYA 3UZQA 2WWKT 2CRZA 2XTJB 2ZSVA 3OKEB 4YBHA 5IB3B 3CVHB 4D9RD 3HC3H 5DJDB 1BOGB 4P9HC 5L6YL 3TWCH 4KMTL 1J8HA 3MOAH 1IM3B 1GZPA 2R15A 1JGUH 5I1DA 3MMEA 3DHJA 1FN4A 4P2OC 3FQNA 5C70A 3GI9L 4XC3L 1EMTL 3ZYOA 3D39E 1K2DA 4UILL 3QO0B 3FHAA 1IILE 4PYGA 4LLVA 1RMFH 5K9QG 5JOPD 1MPAL 3LHPL 2AERT 4WWKD 5CS7A 1R3KB 4HXBH 1I7TB 3PWPD 1R5WA 4F7CB 5C0IA 1EEYA 3QZWB 4Q9QH 2G5BA 4HUVA 5HGHA 4LCCA 4N9GA 1HHHB 1AI1H 2VDPH 1FFNB 3GJEB 4NUGL 5SWSE 1V5JA 2DI7A 2G9HA 4LGRB 4O2FA 1FZKA 1S7TA 2FH6A 1MAML 3DROA 2NXZC 1J1XL 3UYRL 5E2TH 5D1XC 4GAGL 3BQUA 5ID0B 4KFZC 4RISH 3SO3B 3NOIA 4OD1L 1YEDB 2LV4A 5J1AB 1OLZA 1QSVA 3H8NA 1K9TA 5FB8B 3RWCB 4U1KB 2XXCB 3ZSTA 2FGWL 4BFBD 1NFDA 3UJIH 1ZT4B 3EYUL 1EEZA 1KIRA 3RWHB 5GQBA 1NEZG 4P2YA 1S5IL 4DKAA 5JOEA 4GRWH 3ARSA 2BSSB 3UTZB 4D8PA 1QHPA 4RDQF 1HQRA 4KMLB 4LPXA 4P2RA 4Y0GA 1YEFH 3OQ3B 3LAFA 4NKQB 4DAGL 2MCPH 4BZ2H 4QHMA 3MOBL 5MP6L 1IVLA 12E8L 1K8IB 3R1GH 1FFOA 3VXQB 3CPLB 3TNNB 1CFNA 3FOMA 2DQIH 4UT9H 1VADA 4X4XA 4MNQA 3QFJD 3VDBA 3G6JA 5JXEC 4OGYH 5HD8C 1GCFA 2VDLH 1MHEB 3OKEA 5IB3A 3CVHA 5F9JB 1OPGH 1BOGA 5DJDA 3UBXB 1IM3A 2YKLH 4G5ZL 4LOUD 1BBJB 1K6QL 4WI5A 4X6DF 3LCYA 2H1PH 4J23A 3C6LD 3QO0A 4W4NA 4P3WA 4FZ8L 5TE7L 5DRZB 4C59B 1D6VL 1R3KA 4Z0BL 1I7TA 4F7CA 3M07A 3QP3A 1NC4B 3QZWA 1WIOA 4L8SA 3THML 3PABB 5DUMH 5DUPL 1HHHA 3WMSA 5F7YC 4LFHD 1FFNA 3GJEA 3LQZA 1WWBX 3JWOH 5IMOB 3Q5TA 5D70H 3MJ9H 2FBOJ 1L9MA 3KJ6L 5ID0A 3ARPA 2Y5TB 1VACB 1YEDA 5J1AA 4FZEH 3MRGB 3UTSD 2B1HL 5FB8A 1M05B 3U9PL 3KG5A 4U1KA 2WWMD 2CGRL 3VD3A 2XZQL 4J2XA 4ELME 5IUSA 1ZT4A 1EFXA 4ODUB 5IQ7L 2BFVL 1QKZL 4PRPB 4KROD 3HLAB 4HIEB 4K7PX 2XN9B 3EJYD 2BSSA 3UTZA 1RZFL 3NZHH 4NC1E 1P84J 1MI5E 3VXQA 1K8IA 3MJ7B 1R24B 3CPLA 3TNNA 1JNLH 1Q9WB 1NEUA 4Y19D 1XIWB 4YX2L 1EX0A 2V7NB 3KPRB 2WV3A 4CU7A 3IDNB 4KI5C 4C56B 1MHEA 2R29L 4RFEB 2R2CA 5F9JA 4OZIE 4X9IA 3H9ZA 1GPOL 3IKKA 3UBXA 1LEKB 3TCXA 1BBJA 3V6OE 4V1DE 5TGBB 5KSAB 1ZAGA 5ESAB 1S9WB 1Q0YL 4LCWD 1J12A 4EI5B 4POZC 1ND0B 4CVUA 4IRJD 1IE5A 1NC4A 1RAMA 4XMKH 5KN5B 4JHAH 2R0WL 2Z31C 4K7PY 2HLFC 2VLRE 3PABA 4K55A 4OCYL 1KPRB 2F8OA 1HDMB 2FIRT 4IIQB 4M1CC 4PR5B 1MCFA 4XX1G 4RGNE 5JA9A 5KS9E 4HWEH 3IT8D 5IMOA 1CL7I 1ZKAA 4L8BB 3ZDYE 2YD4A 3S34L 4PP1C 3K2UH 3HR6A 2Y5TA 1VACA 2PO6D 5F8RC 3S37L 1Y6KR 3KYMA 4LQFH 3V7MA 3P0GB 1NCCH 3MRGA 4G8EB 2VAJA 1M05A 3OG6B 3FN0H 1B9ZA 3UJTH 2OS7A 3RY6C 5MEOB 3F12B 2Z9TA 4WFFD 5TFSH 4ODUA 4MQTB 4PRPA 1LO2L 1A0QL 4MAUH 1NMAL 5IBUB 3A6CH 3HLAA 4HIEA 2XN9A 4KRPC 2AJXH 3PV6B 4NN5B 1F90H 1UJ3C 4GXVH 5I18H 5F3BA 1FNSH 4JAMB 3W9DB 4X4YA 2EICA 1F4WL 4HQQH 4PUBH 2R0LL 4OLUL 2CKNA 3MJ7A 1R24A 1Q9WA 4NIKB 3HZKB 4YXLH 1XIWA 2HT4C 2V7NA 1WZKA 3KPRA 4KUZH 2LABA 5DK2B 4GLRH 2C3WA 3IDNA 4C56A 3HC4H 3QXTA 5DLMH 4RFEA 1R3HB 4EQ3A 4ELMF 5KTEL 5BS0B 1KC5L 4X7CC 5JW4R 1T0NB 1K4DB 5IT2H 2H32B 3B5GA 1LEKA 4LAJH 1BQHG 1UKQA 1ZTXH 4OCWH 4YAQB 1YQVH 4KVCL 5TGBA 5KSAA 5TPWL 3O6KL 3MCLL 4GOSA 1YJDC 5ESAA 1DUZB 3MNWB 3NIFE 3TESA 4XPHH 1S9WA 2ATKB 3N1GC 4XCCL 3NCBB 4F15C 2XA8L 3DRQB 4EI5A 1ND0A 4JKKA 3TYGL 4OZIF 5KN5A 1LEIB 1JNJA 2MPAL 2OP4H 1H3PH 3QPQC 2EEAA 1KPRA 3L5JA 4X7SH 3RBGA 1HDMA 4JJ5B 1JHKL 4IIQA 2WQ8A 4PR5A 1GZQA 3W2DL 1HN1A 5FAAA 5L7XL 3HE7B 2ITDB 3HMXA 1IKNA 5GHWH 1GOGA 2L4OA 4PJHB 4L8BA 5T1KD 4JG0H 1C5BL 2HWZH 3H9SE 3QIUB 1QSFE 3MCG1 2CH8A 5LBSL 4DVRL 2GFBB 5IVXE 2OTPA 4L1HA 2X4SB 3WN5C 4J3SA 2CDEB 4G8EA 5DMKB 2IPKB 1YEHH 5J12C 3S3SA 4N0CC 4M62H 2ESVD 5MEOA 3F12A 2IG2H 4LQ1A 2HLAB 4NQCD 3SDCC 1BP3B 4MXVE 4ZSOB 5KS9F 3X12B 4JFFD 3BVNB 4RWYL 1KLUB 3MLSL 3PV6A 3UP1A 4CBPA 5DS8B 1CLYH 1IGFH 4JAMA 1SHMA 3W9DA 3ZDYF 2IPUK 3O41B 1UCBL 2BNQD 1A7OL 2NY5C 4FQQB 3HZKA 1BWMA 4PJXE 1K8DB 3VFPB 4U0RC 3QYCA 5GRZA 2X6MA 3UYOD 1AJ7L 3KHOA 1MRDL 4E0RB 2VR4A 5DK2A 1U2CA 2VE6B 2D31B 4LKCB 1R3HA 4LLAA 4TUOB 3LD8B 1A7RH 5BS0A 4HEPG 5DD5L 1EGJH 3PP4H 4JQVA 4XC1H 4D0BB 1T0NA 1K4DA 2H32A 3WL9B 4ZUTB 5BCAA 5F9DC 1OLLA 4GW4B 2ADJA 1ED3A 2IBZX 4YAQA 2R4SL 4KI1A 2GTZB 3HRZB 4HJ0C 4HLZG 1HKLL 2F15A 2MWCA 4D3CL 3MNWA 4HWUA 2PW1B 3O0RL 1INEH 4I9WE 4J7RA 5DURB 2ATKA 2A6IA 1BVLB 3DRQA 1H15B 1DCLA 3G04B 5BZWB 2FBJL 1LEIA 1V3MA 2YZ8A 2SEBB 5GS1B 1ZVYA 1P84K 3JVGC 4G42B 3JWDH 1KJ3L 3VD7A 4JJ5A 3CLFH 1CD8A 1KCVL 1VFUA 4Z7WB 3I3BA 3QDJD 3HE7A 2ITDA 4PJHA 4U05A 2YPVH 4L4VB 4Q9RH 1CDHA 3QIUA 5I1GL 5B22A 2GY5A 4QRPD 4K3EL 2GFBA 5CP3A 1AXSB 2X4SA 3ARDB 2HP4A 2CDEA 1T2QH 1B6DA 4FABH 4MJIE 1IM9B 3BPOC 5DMKA 2FEDC 2IPKA 5GGVY 2P49B 1PZUB 4XNZC 3B6SA 1KBGH 3QCUH 4NKDB 5D7JC 5C0GA 3V6OC 1UM5H 2HLAA 4NN7C 3HMXL 3I50H 2N56A 3L3GB 5IJVB 4ZSOA 1TTUA 4ZPTB 3BVNA 1KLUA 3TPKA 1MOEA 2O5YL 5DS8A 5HHXL 3TH4T 3O41A 2LFGA 4WEUD 5IVXF 1YEIL 1EIBA 1BX2A 3I3EA 4AK1A 4FQQA 1RJLB 5BVPH 2EYTB 1UYWH 3ULVE 3VFPA 1P69B 4G6FD 4E0RA 1KTRL 5C7XH 1UWGL 2VE6A 2D31A 2FATH 4LKCA 2MSPA 1G9NL 4TUOA 2C3XA 4Y16C 2CUHA 3RWJB 1U8HB 4LHUG 3O2WH 4M5YH 2BVYA 4M02A 4D0BA 2C7UB 3WL9A 4ZUTA 2R23B 4GW4A 5E0QA 5L2KB 2BHZA 2GTZA 3HRZA 3P0YL 3LEYH 1YC8A 3LIZH 4ODTH 2PW1A 4PJXF 5IFHH 1FBIL 1BVLA 1W8NA 4PB9L 2VLME 4Z95H 1H15A 5CUSL 3IDXH 4UOW1 1CS6A 5GGQL 2NTFB 3G04A 5BZWA 5IMLB 5JR1H 5GS1A 4G42A 4KK6D 3EYVB 5HHME 5C0DB 1KSRA 3EJZC 1AXTL 2A2QT 5FO7B 35C8H 4Z7WA 1CF8L 1GGUA 3KPSE 4YDVB 4LPYA 3DXAD 4L4VA 1BM3H 1YMMD 2NX5E 2WQRA 3IFLL 3SBWC 4KK5C 4NZRL 3MV8B 1AXSA 1MVFA 3ARDA 3U7YL 3WBDA 4KV5F 4LF3B 3RTQD 4KQ4L 4HG4J 2XZCL 1IM9A 1FIGL 3P2TA 4QOKD 4HUMB 4JEGB 2X09A 4H88L 4M7ZB 4QWWD 4H1LG 5GGTH 3E8UL 4NKDA 4OZFH 3EIFA 5FHBL 4ZFGH 4NWTL 1TMCB 3L3GA 3TVMC 5IJVA 2X4UB 1XF4B 2IMNA 4ZPTA 1FG9C 4TSBL 5T1MB 5JORB 1FYTE 2X70B 1IAIH 1YEGL 1NLBH 4ZO9A 3QUML 4ONGH 4Y7MA 2AXHA 3AS1A 1MQ8A 4G3YH 3EAKA 5GS0D 4FFZH 4PB0H 1RJLA 3TYFB 2EYTA 2A0LC 4EUPH 3GHBL 4MNGE 1MIML 1CGSH 5GRJL 1BIIB 5EA0H 3QJFB 1T66C 3QIBC 5GSVB 5I1JL 4K7FB 2D7TL 4IRZH 3RWJA 4OBRA 2BDNL 4DVBB 3VH8G 4PJIB 1FORH 2C7UA 2P47B 3GBNL 2R23A 1VEOA 5EZOL 2UUDH 2C3GA 2F53D 5E6IB 5L2KA 4HS3B 2NY7H 3OJMB 1ZT1A 2GW5A 2GHWB 1DJSA 3ULVF 5DD1H 5HYQB 2XG4A 4X0KA 5DFTA 5DRNB 4NKIL 1PJ9A 1TJHH 1OAXH 4FQJH 1ZVSB 4JDTL 5AYQA 4WY7H 4HPOH 5I30H 2NTFA 5IMLA 1EHNA 1MIEH 1Q9LB 4M48L 4LHQB 5IHBA 4NN6B 3EYVA 3BZEB 4KTYA 3T4YB 3MBED 1G84A 1LDPL 2YMXH 1ADQL 5F1SA 1QYGH 5D7LD 1YN7B 4G6JH 4N90E 1P2CB 3RGVB 3EYQD 4R97B 4GBXD 4HPYL 3QUXD 1QBAA 1G7PA 3MV8A 1UH4A 5F7LB 4LF3A 2VABB 4U1JB 4Y2DC 3OXRB 4Y5VB 5I1HH 5IHZB 4I3SH 2CLRB 1XMWA 4NQDD 1OTUD 3LDBC 5JZ7D 3BZDA 2BJMH 2X4TB 1KIPB 2MKLC 2X4UA 3GI8L 1XF4A 3BRDA 1DANT 5T1MA 5JORA 3U79A 4U6YB 1OAKL 4XHQA 2X70A 1U8MB 2ZCKH 3BWUC 5D2LB 3V4VL 5D1QD 3T3ME 1CDJA 3FRPG 3OJVC 4FFYH 3RVVC 5T5FH 3TYFA 2ICWB 2XQYK 4XWOC 2E7LC 4E42B 4OM1H 1ZLVH 1CGTA 5J3HD 1BIIA 3DMMD 3QJFA 3RJQB 3QI9B 4YDKH 1TNMA 5DMIH 5GSVA 1YNKL 3ZSSA 4K7FA 2EC8A 5EZLB 1JN6B 5H37H 2K3TA 1D9KB 5I16A 4DVBA 5IBTL 4PJIA 5DJ6B 3ESVF 1GC1C 1F6AB 2AABH 5E6IA 1AKJA 2EECA 4HS3A 4UUJB 1RZ7L 3LKRB 2XV6B 4FQ2L 2AEPL 2B1AH 1MFCL 4HC1H 5HYQA 4NQSB 5DRNA 1XZ0B 5SWZE 2R8SH 1XT5A 1ZVSA 2NY4C 1QFPA 5ALBL 4U7MA 3WFCL 4FFWD 1OT1A 1Q9LA 2F8VA 2CR3A 4QRTB 4KGLA 3BZEA 5MEND 1J0ZA 5FA4B 2XXMB 1IAMA 4DN3L 5HYIA 4GLRI 4M7JH 1YN7A 4Z8FH 5CILH 4MXQC 1P2CA 4LCIH 3RGVA 3WS3B 1BD2D 2WNGA 4NQTA 4ODSL 2CIKB 3P3YA 1Q1JH 4YHPB 1BJ8A 4MNQE 1CLCA 2VABA 3G6JE 4U1JA 3TT3H 3EYSH 1HSBB 3CU1A 3OXRA 4Y5VA 1N0XL 3QCVH 1A7PL 1IC5L 2JJTC 2CLRA 1KT2B 2A9MH 1AHWB 2X4TA 3KYNB 4AEHH 4F57L 1Q0XL 1IGML 1C7SA 2F5BL 4JB9L 5I8CA 1HNFA 3GSUB 3TA3D 1H3UA 1QFWH 3U1SH 4U6YA 1U8MA 5D2LA 5C09D 2QQKL 5CGMA 4OCXL 4HUUB 3O6FD 1GH7A 4XMPH 2YA1A 2ICWA 3S36X 1LEGB 3BKYH 4E42A 1XF3B 3MLRL 4IOFD 1BZ9B 4WWKB 4GSDH 1CICB 3HNVL 2IC2A 3QI9A 1JGVH 4B41A 4HBCL 3V5DB 5EZLA 3LMJH 1TIUA 1D9KA 3VFNB 3ZTJH 1UB5B 3EUUA 3A6BL 5DJ6A 4PJEB 4S1SH 3RL2B 1F6AA 2ERJB 2NW2B 1EAPB 4HG4K 2X89D 4UUJA 5F7MC 1A6AB 3LKRA 2DS4A 3MZGB 3KLHC 3P30H 1OGAD 3FQUA 3B9KC 4HK3N 4JFPB 1MWAB 4NQSA 1XZ0A 3PIQB 4AYFA 3MRRB 3ZZ1A 3HFML 5FYLL 3TO4D 3SQBA 3TWCL 3VD4A 5EIIB 4QRTA 4TNWK 2NMSA 4XVTL 5T3XD 3LZFL 3LEVH 5EG6C 4O9HH 5BV7B 4DWHA 4Q9CA 1OP3H 1RUQL 5CEZH 5FM5M 1X6NA 2DQJL 4I5BB 3WS6C 4QNPE 5DVNA 4Y4KD 3WS3A 5C07B 4K3JL 4G9FD 2NY6C 5FYJL 1RMFL 4JY6B 2OI9B 1RPQA 2CIKA 4YHPA 1ULVA 3P4OB 1HSBA 1DLHB 4PRHE 2VRAA 3B2UD 4DOHE 4Q9QL 2QADD 1KT2A 3RX5A 4AEIH 1AHWA 4RQQB 1WFNA 5EH1A 1U91B 5LXGL 4WO4C 4XXDB 1IZJA 4MD4B 3VFOB 4YFEA 1HWHB 4OQTA 4HUUA 1CBVH 4NCDA 3BZ4A 1OVZA 1LEGA 4MGXA 2WZPD 4P2OD 1EZVX 1XF3A 4UNVA 1C1EL 1BZ9A 3ZDZE 1CICA 3U6RB 3O3BB 3GRWA 1P6FA 4JRYA 1EH9A 1UGNA 4AENB 3UJIL 5JA8B 4M9PA 4NSKB 3V5DA 2VZOA 3VFNA 5I8OH 1RIVL 1UB5A 1YPZE 4LSRH 1LD9B 5I1KH 5T5NG 2QQNH 1CYGA 4WENB 5IBLC 3RL2A 2XFXB 5I66B 1FG2B 1YEFL 5IV2B 1XGTB 1EAPA 5AZEH 4IHOB 4RMTA 1A6AA 1H3TA 2GT9B 1JRHL 3O4LD 3OWEA 1JUFB 4QEGA 4YBLC 1ROWA 4JFPA 1MWAA 2HN7B 3A67L 4YO0B 3PIQA 1I7ZB 4ZMAT 3MRRA 4DGVH 1LO0L 2NXZD 2EDYA 5D1XD 3MRNB 1FDLH 1FVEB 1TLKA 3P9WB 5EIIA 3BISA 2J5LC 5AAWA 3BYTA 3OKLA 3SN6N 4PRPE 3F7RA 1QTYT 2XN9E 1AR2A 3NFPB 3MUJA 4I5BA 3MUY1 1J1OH 1I9RH 4MYWB 4U4BA 5IR1B 1IZKA 1NMBL 3LQAH 1BFOB 5C07A 3R8BB 4P9MH 4ZAKB 1EZVY 2OQJB 3WHE1 4JY6A 1G0YR 3RWIB 1DQML 1IGCH 4W70A 3KPRE 4IJ3B 4ZTOH 4BA8A 4LCCC 1DLHA 3W11C 1RZKH 4C56E 3BAEH 4M7LL 4W6YB 1MRCL 2Q3AA 3C6SB 5DUML 4GAFB 5IK3B 3B9VA 4LU5H 5I71C 2NW3B 2DN7A 2VXUL 2BX5A 4RQQA 3OGOE 5JXED 1D5BB 5HD8D 3U82B 1UT9A 3BQUC 4PJGB 4G80B 4WI3A 4XXDA 4MD4A 3VFOA 4HMEA 1A4JB 2VQUA 5HDBE 4XI5C 4AQ1B 4G7YL 2Q86B 3RY4A 2Q7YB 1A22B 2APBA 2CSPA 5F1NA 4CDGC 1CXKA 1JZ5A 4FZEL 1EXUB 4G6MH 5C9KA 1QRNB 2RJMA 1G7QB 1F5WA 3C9NB 4UDTB 5EU7E 3O3BA 3U6RA 3LVEA 1U36A 2WIMA 5EO1B 4AENA 3QBTB 4NSKA 1KCUH 4Z77B 1SBSH 1T5XB 3LH2L 5B39G 3VFGH 3NZHL 2XFXA 4OQTL 3TIDB 4A6YB 5TF1L 5E08H 1FG2A 5IV2A 1XGTA 4KJYB 4IHOA 1DANU 2GT9A 1WLHA 2XTJC 1IMHC 1JUFA 3GRWL 2HN7A 3ZDZF 2A6KB 1I7ZA 1IAII 3L5IA 2L7UA 2P7TB 2PTUA 1T4KB 3MRNA 1FVEA 3MA7B 2ZUXA 4QXTB 5D7IF 5GGRB 4D9QE 1YPZF 3KXFB 2HKFH 4KXZH 4XRCB 4QHNB 4DKEH 4ERSL 1KFAH 5L9DH 2PKDA 3CCHB 4XVSL 4HH9B 3RKDC 5E03A 3OZ9L 3NFPA 4X6BA 1MCNA 5D6CB 3STBA 2A77L 5EIVA 2EC9T 5IR1A 4M5ZH 1BFOA 3JV0A 5JW4Q 5F71A 1MWAL 4GUPB 4ZAKA 6FABH 2OQJA 5ADOH 3VXOB 1FZJB 2UZIH 3RWIA 1S9VB 4L8SC 1NBZB 1A6VH 1Q94B 1HYSC 1DQJB 1X5LA 1WZ1L 3FN9A 4R2GB 1IEBB 2QEJA 3C6SA 5EIQA 5IK3A 5BV7L 1ZOXA 4M6OH 2NW3A 4X6CB 4XPBH 3MACH 4BZYA 5BS0E 2IFFL 5D9SB 3L3OB 2RHEA 4HWEL 1MFEL 2W9DH 1D5BA 1BJMA 3A0OA 3JV6B 2E9WA 1E6OH 1RUMH 4KI5D 2LAAA 4PJGA 3VXTB 4G80A 4JZJB 4Z7UF 1FIEA 1QBML 1A4JA 5IQ9B 2XYCA 3IU3B 5FKPB 5FO8B 2Q86A 2Q7YA 2EDBA 1ZV5A 1EXUA 1NCCL 3HZVB 4H26B 1QRNA 1G7QA 2VNCA 3C9NA 4UB0L 4UDTA 3PQYD 1M7XA 5CEYB 5HYJB 1MJ7H 4Z77A 2ZWLT 1T5XA 1YEJL 3MBXH 1KCKA 4JM2F 4POZD 1M4KA 4M7KH 5FF6B 1F90L 1AFVL 3BW9B 1HILB 1XR9B 3O2VH 3TIDA 4A6YA 5I18L 1FNSL 1T22B 2CK2A 3GNML 2Z31D 1BLNA 2HLFD 5A2FA 1UFUA 4K71B 1B2WH 4KGJA 4KUZL 2D7PA