4Z7UE

S13 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
198
structure length
198
Chain Sequence
DAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRDRSNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 198
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uE02
1G6VK 4NBYB 4XPBH 3SDCB 4TSBH 3QFDB 5EA0L 4OFVA 2BOCB 4GMTL 3ULVH 3A6CH 1B88A 1FYHB 4NKDA 3T77B 2ICES 3OKOB 3AFLA 3V6FA 3SJVB 3VXME 5IVXF 3HPJB 1AD0A 4D0CB 1I8LC 1HHIB 3UMTA 3GI9H 1VGEL 3NABH 3QUYB 4UIKL 4X6CA 3QQ9C 4K7PH 2AXJA 3VGAC 1EUTA 5FO9B 5IBLD 5E00A 1X5XA 4HD9A 5JQHC 1ADQL 3O0RL 3BH8B 5I66A 1UACH 1DLFL 4JANB 4J6RL 3FQRA 4GBXD 4YJZL 4H5SA 5DURD 1NAMB 5ICYA 3I6GB 2OTWA 1QHPA 4HKXB 2P5WD 3KPSB 2AJXH 3K1KC 1WLHA 4G7VH 5E8NB 1NUDA 4KTEH 1ZS8A 3OL2A 3QQ4A 4EI6B 1JRHI 1L6XA 3DXAA 4YC2C 1UVQA 1MSPA 1R5WA 5E9DB 2FECL 2CKNA 3TA3D 3VXQB 1ZSDB 3KYOA 5KJRL 3U6RB 1KNOA 4LKCA 3SGDI 2Z4QA 5D1QA 3IS1X 3CUPA 1X7QB 3D87B 5IMKA 3WHE1 3U1SL 3V5DB 4J1UB 2BNRA 3E6FB 4JN1H 1DSFH 4FOMA 1E6JH 5F96H 3FHQA 4LQ1A 5FK9A 4Z7OF 2Q3ZA 2OX5A 3B9EA 2IADB 4M6OH 4F7TA 4YFDB 4FXKB 1EX0A 2HKHL 1KV3A 5DC9B 4E0RA 1QRKA 1UYWL 4XGZA 1ROWA 1FVEB 2F5AH 4H8WH 3S36H 1UJTA 4JGMA 4LAJH 5KSAC 4R6UA 3DUUA 4WENB 5AZEH 3VXOA 1IAKB 1UXWB 2R1YB 2BFVH 4FQIL 2VERN 4JPIB 4JO4H 4ZAKA 3TESA 3ABZA 3MSPA 1UM5H 1MWAA 4LAQL 4W6WB 5B39B 2OM5A 3MLUL 1AGDB 4PBWD 5DC4B 4HLJA 4XNUH 12E8H 1X5AA 3UJTL 3MCKA 5F9OH 1QSFA 1JGLL 5C0DA 4MA3B 4R0LA 1YECL 2Y9RT 3KPQA 1I8KB 3KPMB 3QZWB 4LCWB 3T2NH 5IT2H 2GTWA 3NPSB 3W9EB 1NC4B 2DLFL 3MV7B 5BZDA 3G6JF 1PG7H 3NA9H 2C1OA 4U1HA 5AYUL 4BFGA 3GO1L 1BF2A 2AJVL 1IC1A 3WFEL 1GGIL 5EUOF 1NFIA 3NN8B 2CLRB 1F6FB 4RISH 4HIEA 5I30L 4LIQE 3MUHL 4OZGA 4OGYH 1FIGH 3P0YL 5C7XH 8CGTA 5I1CH 2JE8A 3OPZL 3I9GL 5FOBA 4G8IB 5E2WH 3ARDA 4PRIA 3JV4A 3PWJB 2QQNH 2JIXB 1I85A 3P9MA 3K2UL 4P4KA 2FO4B 1II4E 3V6BR 1J1PH 2DIJA 3MLYL 1R5VB 4WWKC 3GMRA 4TNVK 1JGUH 1KTLA 1XAUA 4WHYG 2Z93B 3HE6B 1P7HL 2YD3A 3W82A 3LKNA 5T3ZE 4JHAH 4BUGA 2PTTB 2D0HA 3D69B 1GJIA 3CFEA 5IB2A 3SCMB 1S3KH 2ZUWA 1TQBB 1FLTX 2YWYA 4IMLA 3DO7B 2PO6A 3EYVB 3GRWA 3U83A 2BC4B 4PRDA 1YA5A 3CLFL 3CMOH 4R8WL 2HMID 4Q2ZB 2WP3T 1WFTA 3I75B 3QDJA 4RRPG 1MCWM 5C07E 3NGBB 3RWIB 1ORSB 2E3VA 4L8BB 2OXHA 4QT5A 1KIQA 3H7BB 5D7IE 1NH6A 3FOMA 1JZ4A 3DX9A 1VFUA 2CXGA 3P9LA 4ZD3H 1IVLA 2QBWA 4GKZB 4OFKA 4LRIA 1J88A 3T2PA 1S7XA 4NRYB 2RIKA 4NJAH 1BQLH 3RVUC 5JOPE 4GRWE 2DQTH 3MLSH 3PWPB 5IK3A 4ZUWA 4OQ1A 5IVOA 4BFIA 3IDIA 1CFVL 4AJ0A 3OKNB 4R90H 3OKEA 4HUUA 2VNCA 2IANA 5I18H 4IJ3B 1P7QA 1HDMA 5CZVL 1D5IH 1S5IH 3ARGB 1HSAB 1ZLUK 4NGHL 3EJYD 4OBRA 5EBGA 4HUWB 3G04B 3VFVB 1U93A 4Y4FD 3KJ6L 3UAJD 4EDXA 1I7ZB 4Q9RL 2R2BB 3HI5H 4HUXA 5C0ND 4KVCL 3SBWA 5I1HL 1WGOA 2AJ3B 1AP2A 1BFOA 1EK3A 1X44A 1J0IA 1D6VH 1RUQH 4XVTL 2J8OA 1HH6A 1OAKH 1PY9A 3ZKND 3MYZA 3GZKA 3WXWH 3UC0H 2XZCL 3QIBB 1QZ1A 5JHDA 4G8EB 3WJLC 1O7VA 5IIEB 3QEQA 5HVHC 3CGTA 3HPLB 1GSMA 1W8OA 4P2RD 2IGFL 4PY7B 5D6DA 5IW1A 3QFJD 2YKLH 4Y5XC 4IRSB 4YHYB 1G7MA 4LPVA 1IAIM 2P8LB 3P4NB 4HCRL 2A77L 5JORB 2JJSA 4BFEA 5F3BA 4AEIH 4F9LA 1BFTA 4OGXL 1LHZA 5H35A 4QGTA 3SDCC 3NZHL 4PG2C 1YY9D 2BNQA 4QHMA 2C3VA 4L3ED 1QLFB 5K9KB 1UZ6F 3PGCB 1W2KT 3LSOB 4QNPE 3RUGB 4L29B 3VFOB 3VFWB 2Y36H 4MNGB 3NCJH 4PRPD 1PGRB 4HWUA 3QUYC 4TULL 3AY4C 2A9ML 4AIOA 3HUJB 2CO7B 3V6OC 1IC5L 1NANI 3CSBA 5GGTA 4V2BA 4JHZA 2WNGA 1I1YA 3VI3F 2EO1A 1JNHB 3BFOA 4PB0H 5F88A 3QA3A 4WFHE 5IB5A 1E4XI 1FYTD 3VXPA 2J88H 1UH3A 5I8EA 3OWEA 2BSSA 2VLRD 5DO2C 2A0LD 3CSGA 1FE8H 4QOKA 1EEYA 3VMPA 4TUOA 1ZLWK 2ADFH 5I16B 2A6KB 3DRTB 1DVFB 4F7MA 1NKRA 2ZG1A 5D7JB 1F11B 4R4ND 2PYEA 4D8PA 3O4LE 5I1GH 4P4RA 2V5RA 1ONQA 3OAUH 2ESVD 1KEGL 3WNKA 4QGYA 2FX7L 5DQJA 3VJ6A 1JGEB 1JGDA 3MJ7B 4PRAA 5CGTA 3LMJL 1BZ7B 3EOTL 4MVBD 3EYUH 1IGIH 1Q0YH 1LK3L 3HA0A 5JIHA 4WHYH 5FYLH 3D9AL 1G7QA 5DJ2B 1MAKA 1RZGB 2VXVL 5FUOH 3NTCH 1IAOB 5J1TC 5C09A 1FDLH 1MCNA 4HEME 1I7TA 2DYPA 1INDL 2BOBB 4HIHA 3JZ7A 1FZKA 2BZDA 3RL1B 5GS0C 1P9MA 2R1XB 1Z0NA 5ID0B 3GSRA 4UUJA 2J8UE 3OXRA 4CADA 1NJ9A 2D9CA 2EDBA 3BT2H 4OF8A 3S4SB 1EV2E 1MLCA 1MJ7H 3UZVB 3O3AA 5FHAL 2NXZC 1OLZA 2W9DL 1G9MH 4NQDD 1XGQA 2GAZB 2V7NB 2Q3AA 4U1NA 4FRWA 3ZMRA 2EKJA 3MRKB 5DJXA 2HVJA 4S2SA 5J57B 1UGNA 3ARFD 5D7LB 4D9QD 3NPSC 1WICA 4AM0A 4H1LB 4K3DH 5IESL 2YPKB 3REVB 3QNXA 3INUL 1BAFL 4Q97A 1I3RB 2DQCH 2EH7H 3FJTA 5DHYB 1KIPB 5EC2B 3MZTA 3FMGH 3ULVC 5EORL 3LS4H 3PP3H 2GSGA 1ZT1B 4PJ5B 4TSAH 4U1IB 1KTKE 4WFFD 1WFNA 5IB1A 2FJGB 1RURH 3LRHA 5CWSB 4CBPA 3ARSA 5TF1H 1RZ7H 2EZ0C 1FC1A 1MCDA 2UYLB 3A67H 3RNQA 3UCRA 3ZYJA 1M7IA 3KS0J 4V2CB 5TFSH 2R0KL 4NQEE 1JGVL 4P2QA 1MFBH 5J3HD 3HG1D 5HGBB 3ULUL 3L3HB 2VLKE 4JM2B 4WO4B 3Q0HA 4Y88A 2ZUVA 4G9DA 5EIIA 2HKFL 4G9FB 2NZIA 4M93C 3WNOA 3SCMC 5FV1L 3O9WB 1TQBC 4G6FB 3KLHD 1X6LA 5HHOA 2EDNA 2ICWA 2I9LB 1DDHA 3CX2A 4KMTL 3TPKA 5EBMA 4LLMB 1TETH 4WEBL 4LLVA 4LOUC 4XWOC 1J1XL 4X99B 5CGYD 5ESQB 3SE3A 3LRSA 4QRQA 4GT7A 3NGBC 4X6DA 1TZGH 4DN4L 5CSBA 4PD4K 3HRPA 3QRGL 3SDAD 4OZFA 1Q72H 5H2BA 2XY2A 5FYKH 3X3FL 1AGCA 1YZZA 3BKJH 3G9VA 3ULUD 4I9WE 4NO0A 5DJCB 3TO2A 1MH5A 3SGEH 5GSRB 4EN3A 1A14L 2IAMD 4KQ4H 2F74B 1S7TB 1NEZG 4ZFZA 4U6XB 1D5ZA 1R3LB 3RTQD 3L6FA 3JWDC 3MMEA 4KI5D 1QLEH 3CCHA 5EZLB 4BZ2L 2X41A 4Q9CA 3I6LE 1DBML 1J8HD 3HKFA 4H8WC 5GRXG 4UT9H 1U3HD 2ITCB 1LP9E 4U6VL 3OG6B 1LGVA 4HBCL 2JCCA 3VFTA 4IJ3C 5CSZA 4NOBA 1C5DA 3ARGC 3IYLW 5T1LD 3VGEA 4OCNC 4ZFOA 3B43A 2V17H 1WTGT 3IDNA 3MOBH 1VERA 1XF2A 1RSFA 1N5YH 2O61A 3GSUA 1JUFA 2N7BA 4ETQB 1MNUL 3BOVA 5EN2B 3VWKA 1GGBH 1R3HA 3LCYA 4DZBA 5JPMB 4LSTH 1IL1B 4IBLT 4AQ1B 5MEQA 1UFUA 5D72L 1EGJH 4TTDC 4XNMA 4JFEA 2F8OA 5BOPA 4JKWA 3L3OB 2ZCKH 2ICWJ 4Y8DC 5DYOA 1NSNH 1EZVY 3QIBC 3F5WA 2X4TB 2CXKA 5EU5A 1EMTH 3MRIB 3QO1A 4GG6B 5DMGD 5BVJA 5F7NC 4YK4B 3TO4C 2PN5A 5T1KD 3DURA 3MBXH 3TNMA 3PWVB 1CLOL 2EXWC 4IRSC 4I0PB 4FQJL 4YHYC 1Z0MA 1PKQB 3MUGB 1WISA 4MJIB 3V2AR 1DUZA 5F89A 3MOAH 1UM4L 1GVIA 3MRRA 2IBGA 2M1KA 3LN9A 1L0QA 4HWZB 3WNNA 5E2TL 5DVNA 1CL7H 2DM3A 2V9TA 4KUZL 1MCRA 5CJQL 4Y2DD 2R39A 2P42B 4LLUB 2AEQH 3O3BB 4GAYA 2YBRB 3LS5H 4QXWA 4PJFB 1XR9A 5DHVA 3BKYL 2X4PA 4U1JA 5GGVY 4GAGL 2Y5EA 1F4XH 1QSFE 2I07B 3WS6A 3EYSL 3F6IA 1BZQK 4M6ML 5EDXA 1S7QA 3O6FB 4KY1H 3V79C 4E41D 5SX5H 1J18A 4KC3B 3QUZA 2MNUA 1A6UH 2XN9B 3GIVA 3LKQA 2GT9B 3RHWF 5FM5O 2NXYB 4XNXH 4WFGD 4E42A 4BK4A 2E6JA 4P5KA 5IJVA 3X14A 2GJ6D 3MREA 1E6OL 5HI3C 2GIYA 4X6EB 4WCYH 3SY0B 3BVNB 3B9KD 5DFWH 1N8ZB 3W39B 1T5XB 4TUKL 1DVFC 5HHNB 1R3JB 4LF3A 2GY5A 3WSQH 2DMCA 5D7JC 5IHUH 4DWHA 2BHZA 2PW1B 4HWEL 1HCFX 4MQ7A 2YMXH 1A7RL 2JJVA 3AM8C 2CGRH 2AKRB 1BD2B 1YEEL 4WFEE 3UDWC 1DEDA 1XF1A 1NAKL 1OM3H 2EEAA 3LDBB 4DKFH 1SEBB 4FG6C 3T1FA 4Z7VE 1OGTA 4LDOB 2YD7A 1DQDL 3SQOH 3EJZD 3ARQA 3QXUA 3DYMA 4AK1A 4KTDH 5B22A 4GW1B 3I2CH 4U05A 2NW3A 3FB5A 5LJYH 3L7EA 2DKSA 1PY4A 3HFMH 1P6FA 5GS3A 4CJ0A 2VZUA 4BSJA 4RNRA 4FABL 4IIQA 4I77L 5HD8C 3CNKA 4LMQI 4I3GA 4KKAD 3AS1A 5DJ0B 3X12A 4RMUA 2BVUA 2D03L 3MC0A 5C8JA 3V4UL 3O0RH 4JO2L 2XQBL 2I24N 2Z92A 2GITA 4UQ3B 4M43H 2COQA 1YY8A 5J6HA 4JHWH 4ZYKB 4PJFF 2VABB 5IW6A 4YHLL 1F58L 3FTGB 2EIDA 2M8XA 5E08H 4NQVB 4K7PY 5DRNB 4G8FB 2F58L 4JQIH 4JZNB 1JYWA 2B0SL 3UZQA 2UWEB 5H94B 3HZKA 2IANE 4YUEH 1U36A 4D3CL 3EAKA 3OJMB 4AEEA 4M7ZB 5I74B 1KJMA 5EPMB 5C0AB 3KXFB 5AYQA 1MQKL 1HH9B 3CFKA 4G3YH 3F7PC 3IRZA 1T66D 3S35L 3HNTL 1CXKA 3QXWA 3ROOA 2VXTL 2UZIH 3DVNA 4F7EA 4KVNL 4JO1L 4KDVA 1EHXA 1VFBB 1AR1C 3CDCA 4OUUB 4XC3H 2IC2A 3BH9B 2HKHH 4UB0H 1A7PL 1EJ6A 3HRZB 3QQ3B 2FEDC 3SKMB 3WFDH 1DLHB 4KAQL 2FD6L 3GNML 2DQJH 2Y07H 1MWAL 4HZLA 2X10A 5C0FA 1GIGL 1WWBX 4WO4C 2I9TA 2A1WL 3FFDA 3GSVB 3MYJB 2FHFA 4LLYB 1AH1A 1I9IH 3DBXB 3O9WC 4JFFD 5JHLH 3L3DA 1DQQA 1QKZH 2NY3B 2FATL 4LAQH 4R4FL 1YN7A 4PJHB 3AC0A 1OY3B 2OR9L 3BUTA 4JVPA 4YDVB 1JV5B 3UTSA 3UJTH 2ZJSL 2ZOKA 4OGZA 3IRPX 3C08L 5BVPL 2X4NA 2Z31A 4S11A 3HR5A 2C3WA 4EKXA 3DX8A 3MX0A 2DLFH 3ROLA 4EEEA 1U92B 2GSIB 2AP2A 1XCTB 3MXVL 4XI5C 4DTGH 1DN0B 1QFHA 1I7UA 1DFBL 3PWLA 1C5BH 5GJTH 1ZT7A 4HULB 5I30H 4HT1L 5GISH 2W65B 4MJ2A 1H3GA 5KS9A 4K3GA 4QOKE 4XB8A 4ZTPL 1RULL 1C5CH 1U8QA 3NCEB 4ZTOL 4YHMH 4P46B 4FZ8L 3WXVL 2B4CC 4V1DE 1C08B 1KGCE 1S9XB 1T04B 4HXBL 4RGNB 2YPLE 3IVKB 2VZVA 4MJ5A 1M05A 2ICCA 3T0EA 2CR6A 4OSUL 1NEZB 2DTML 1JZ3A 4HKBA 4X8JB 2WLYA 3QEUB 3CFJB 5DMKA 4BZYA 2XWTB 3U0PB 1FNEB 3DO3A 4YAQB 5BW7A 3VGGA 4J3XA 3GMLA 4P2OB 3VFMB 3L5XH 4LLDB 3BP7B 4YPGB 2QHLA 4YK4C 1YMMB 1JNLL 1IAII 4PRNA 5GQBA 1WAAA 3EO0A 3SE4C 4LCIL 4I0PC 3OJDA 5DA0B 4FFZL 3KLDA 3O8XD 1TVBB 3BPCB 4OGAC 3WO4B 1TJGH 2CR3A 4PFEA 3VGHA 2W9EH 2I5YL 4F8QA 1LO5A 4K3HA 5KVGL 3PUCA 3GSNH 5F97E 3M17A 3N9GL 1QFUL 5C0CB 5HHMD 4PG9A 2EXYD 3U7WL 2A9NL 2DLEA 2VLMD 4WJ5A 1MVUB 2NY2B 4P5TD 4BZ1L 1U2HA 2AS5M 1B0WA 2CLZA 4Y5YA 4IHOA 1HXMB 5CJBA 2PR4L 4JRXE 2YUXA 5AEAA 5FO8A 3O6FC 3N1PC 2XQYG 5IGXH 5ICZA 5F7EH 3TCLB 3LAFA 4YZFE 2NXYC 2H6PB 1GXEA 2O5YL 4GS7B 1A1NA 4Z9KB 2AXFB 5I1HH 4OD3H 4LCYA 5IFAL 5BS0B 1F4YH 3IJHB 5D5MA 5FA4B 1NLBL 4A2LA 4KPHL 1P6AB 3OJ2C 1QFWM 1QSZA 2L7JA 1QFWH 1UM6L 1CQKA 3BIBX 3QDGD 5DMIL 1ED3B 2HRPH 3H9SD 3MA7A 4G6AC 3OXSA 2X6MA 1NUFA 1FZJB 3VG0H 2P5WE 3U0TA 4X80H 5EU4B 1ZT4A 5CEZD 3M07A 5TQ2L 3HC4L 4ODWA 3LN4A 3IFPB 3AVEA 5E8DH 4HFUL 5GGQL 2E27H 4GFTB 2GCYA 2LV4A 5F1NA 3KLAB 2BJMH 1A9EA 2E8ZA 4RWHA 3DX7A 1E4WL 5M95B 4OCSL 5F7HA 4KRMB 2VZOA 2FWOB 1VSCA 4ZUTB 4MA1B 4LSPH 3BZ4B 1E0OB 3G6DH 3MGTB 2ZSWA 5GRVK 3TH3T 2VUOA 3K8MA 4TNWK 5DD5H 1PX3A 3VU2A 3F7QA 1T1WA 3QUKA 2DIAA 1PYWA 5IROA 2DOCA 1G9NL 3HZVB 2V2TB 1A2YB 4PGDB 4QRPA 2Y06L 2NLJB 2WMPA 1U8LA 2D31A 2CUHA 3CLEL 1RUPH 5I8KH 3MRPB 1RVFH 3U9UA 4NQXA 3QWOA 1PLGL 5T3ZH 2NX5A 3J7HA 3MTRA 2VDPL 3V7AE 5EC1A 2YD2A 3EYOB 4YFLF 1U8MB 3GI8H 5BO1L 3RX5A 4EI5D 1EFXA 1IGML 4OF7A 4M7ZC 1QR1A 4PJXE 5I74C 4M62L 4N1EA 3QIWB 3GSNB 3ARED 1T3FA 4IRJA 3PDOA 2V2WA 1CFNA 4YHPB 4UIMB 5DZLA 3NAAL 3LRGA 1OAYL 4PP1C 3LMJH 4Y19D 3L5WA 1YPZB 4MHHG 1ZEAH 4L4TD 1A4KA 2OK0L 3G5VB 3QI9D 3D9AH 4JFEE 1PKOA 4CVUA 4LKXA 5IF0A 5DXWA 5DD1H 3CZJA 3L5IA 2ORBL 5T1MA 4U1SA 4GRWH 3I6KA 1OTSC 4QRSA 4PRHD 1GH7A 2A6IB 2BMKA 4JFHE 4HHAA 3BQUB 1JWMB 4POZD 5I71C 1OSZB 5E5MA 5C2UB 3C5ZB 1XR8A 4JY6B 3FQNA 5KSUA 4EJ1C 1X4ZA 4PJ8A 4NZTH 3BPLB 4PJCE 1TIUA 2I60L 4FQQA 4N5EC 4KRPC 4XMLH 5E2UH 1S9VA 4JY4B 4M8QA 2CDFA 5E6IB 5ALBH 2CUIA 2A6JB 3VMOA 4PTTA 5LCVL 3Q5TA 4PJIB 2CUMA 1XT5A 4G8GD 1RV6X 3MRHA 5GS2D 1IFHL 4PJDB 4N68A 3ZDZE 1EO8L 2VO5A 3RZCA 3GSWA 1R3IL 3JV6B 3C9NA 1FFNB 4N8VA 5CFHA 5JUEL 2AK4D 1GZPB 2F54B 4CN6A 5MEPB 1RJLB 5IBUG 1HHKB 2BRRL 4BQ6A 3VWJA 3QUMH 3NZ8A 1FRGL 2VC2H 3MV8B 1CDIA 1Q9KB 2HVKA 3GMQB 4M1CD 4QWWC 3ARBA 1CCZA 3WNPA 2V5MA 4MD5B 1FLRH 5SWSA 5FUZL 1L6ZA 4XTRD 1OB1B 3PWUB 5JR1H 4LCCA 5DA4A 1KSRA 4RFOH 5KVDL 1LWRA 4P46C 1KN2L 1KJ3L 1NFDF 2EIBA 5CJOL 5I1DB 1G7JB 3FQTB 1QVOB 1FNLA 4JB9L 1BLNB 4UDUB 3L3GB 4XP9L 3TBWA 1CDYA 2AEPH 4HUMB 1JN6A 4P5MB 4M7LH 3RJDA 4PJ9B 3EO9H 4DGVL 2VDML 2AJUH 4RCAA 4GW4A 4LHQB 3SGJA 3KHOA 4KKCC 4ORZC 3U7AA 1QRND 4KMTH 4Z5RB 1DBBH 4RIRA 2R0ZH 4P2OC 5DD0H 5KSAA 1EJOH 5J56B 5LGJA 1KB5L 4GMSL 5D2LB 2HFGH 4R97B 2X4UB 4FTVB 2BY2A 4P23D 4ZOEA 1F3JB 3RI5K 4AIZB 4WW2A 5E5RB 5D7IB 3CZFA 4U3HA 3WO4C 1U8OB 2ADGB 4N9GA 4OQTA 3GHEH 1A14H 3V4VH 3HC0B 3S3JA 8FABB 3HE7A 5D7SL 4TVSa 2OSLA 3QJFA 3BUYB 1PAMA 5IP4A 4DCQA 4FQ2L 3SDDA 3IFOA 1LD9A 1NCDH 4ZFOL 3QFJE 4U1KA 3BO8A 4GRWB 4HS8H 4PJIF 1DBMH 3JWOL 1MIML 2NY2C 4PJDF 1JYXA 1TPXB 4NO5A 7FABL 4U6VH 1Z9SA 1G1CA 1H8NA 1D9KD 4R3SB 3NFSH 3A0OA 3F58H 3LKPA 3C6SA 1LO4L 5FO7B 1RIUL 4CJ1A 1T2XA 3MGOB 3QHFH 4MCYA 4L3EE 1BJMA 3UYOD 4GS7C 2ADJA 1AQKH 4FQPA 2JJTC 1MI5A 4ISVA 1NBZB 5HYJB 2P5ED 1OGAA 5HYQA 3BRDA 5F1SA 1OF2B 5H37H 2QSQA 4L8DB 1U8NA 5LKNA 4ZXBD 2VLLA 5C0GB 4WUUD 2EDEA 5D1ZA 4EBQH 5ILTL 4Z7WA 5DUMH 1FYTE 3FKUS 4N0CD 4XT1C 5C0EB 4M7JH 4OUOA 2VLRE 3RVWD 5D2NB 3QUMB 1ZLVH 3SDYL 1AY1L 5F21B 5JIKA 4OFPA 3IDGA 1TITA 4LVNC 1XIWB 3GSOA 4ODVH 4XRCA 4KI1A 1T21A 1KC5H 4G43A 4YGVB 4EXPX 4OZIA 1A6TB 2D7QA 3HMXH 5TE6L 1FIEA 2ESVE 5TE4H 4XPGL 5D2LF 5CIPA 4K3EL 4O2FB 3UTSE 1LEIB 1NCWL 1MCQA 3QUXD 1N6QL 2EDDA 4M02A 1E27B 4D94A 3SEPA 4OZ4A 3VH8A 4YX2H 4M6MH 1RIVH 5DJ8A 3OGCA 2F8XC 2X89A 5IKCA 1INQA 4M48L 5IOPA 4FQ1L 4OCXH 3O11A 4NZUL 5DJDB 5DRWB 3VCLA 3VXSB 2E9IA 2VE6A 1S8DB 4RFEA 2VLJA 3C2AL 4YHIB 5B8CB 3UBXB 3BYTA 4KJPC 4X4XA 4QXUH 1E6OH 1N5AA 3P73A 3PHOB 1RJYA 3ARYA 4MA8H 5FF6B 4XBPA 4F15B 3WKNA 5IB4A 2HA1A 4LHUB 3T3MF 1MCHA 4P3DA 5L2KA 3MUY1 4JKPL 4PJ7E 5I1EL 1OTTD 2D7TL 1LE5B 4OCYH 3T3PE 3FOLA 3IDJB 1BQHA 4PGEA 4OFIA 2ITDB 4NQDE 3WS3B 3FO9B 2QSTA 3QIWC 4I5BA 4HLZG 1FORL 2CIIA 5DSCA 5C6PB 2D0FA 1FGVL 2J6EA 2AK1H 4MJ6A 1D6EB 4KK9D 4FXGB 4GRLD 4D9QE 3BN3B 2CRMA 3O45A 5JW4M 2WBJD 1G7HB 2ADIB 2QSVA 3T3ME 1JTOA 5IEKA 1T03L 4EVNA 1MRDH 1X6NA 2XRAL 2J3SA 4D9LH 3U9PH 2MTPA 1ORQA 1TDQA 4QY8B 4WFFE 4OF3A 2YHGA 3KNBB 3BQUC 3S34L 1ZA3A 3EO1B 4LP4A 1JFQL 5SWZB 4ZOCA 5FKPA 5LAXA 3C5ZC 5CJXA 4BJLA 4DGYH 3QFDA 2JLLA 1DEEB 2D03H 2BOCA 5I15H 3MJ9H 1T2QH 3D3VD 2O5XL 2XQBH 4JO2H 4F2MA 1SJHB 2OTUB 2HN7A 5C9JA 4FQHB 3HG1E 4B7IA 3RWFA 2NPLX 5E6IC 1T7YA 4W6XB 1S7RB 3G08A 3ULUF 3GKWL 1F58H 1V7MH 2VDQH 4Z76A 5DI8A 3AY4A 1EHLH 1WT5C 3NACL 4GOSA 3CVIL 4JQXA 4Z78A 1AXSB 3V6OA 4FQLL 1NCTA 3BHBB 2EKSA 3DMMA 4WHTA 4YE4L 2EDYA 3IDYB 2UY7A 4GXUM 3D39A 3VXRD 2VDNH 3GJFA 1NBYB 2V9RA 1MQKH 4KZDL 2X40A 2P7TA 2EE2A 1IEHA 4R4BB 2YSSA 4QXTB 1T2JA 4JG1L 1FZOB 3D2UD 3DETC 4F80A 3DPBA 3UTPD 4XVUC 2R56H 2YC1B 4BQBA 4L4JA 1TZIB 4PGCA 4W68A 2IPKB 4EI6A 5ACZA 2HTLC 1PZ5B 3C60D 3RDTA 4DGIL 2X70A 4NNPL 4DQOH 1A7PH 4KI5E 3U6RA 1Q1JH 3QNYB 5IR1B 1X7QA 2IFFH 3GNMH 4NQEB 2KL6A 4C56A 2DQGL 1J8HE 1MCSA 4ZS7L 1U95B 3S88H 4MX7B 3M8OH 4GKNA 1IC4L 1CD1B 4PJ9C 4Z7QE 2VLKB 4MQSB 3S9DB 1PQZA 5DK3A 3VXUB 3TN0B 1LDSA 1TZHB 4GRMA 5HHVH 4ODXA 4FXKA 4YXHL 2FATH 2NR6C 2VWEC 1FVEA 1N26A 4C57C 5CBAA 2EE3A 3TYFA 5BVPH 4R97C 1IAKA 1UXWA 1QACA 4LEXH 4TUJB 4XVJL 2XTJB 1XZ0A 3X3GH 2DN7A 4JPIA 3V6FB 1MUJA 1AD0B 1A6VL 1J87A 2IALA 3D0LA 4X6CB 1AGDA 5E94A 4TVPD 4Z0XA 4JN2A 1PBYA 3K1DA 2ZNWA 4ZUUB 1C1EL 1T0NA 4NM8L 2CD0A 3AB0B 4HT1H 1CF8L 3GMMA 2Q1EA 4CN1A 1G9EA 2W0FA 3BGFB 1NC4A 4PRBA 4FFVD 4H5SB 5EIVA 4P57A 5ICYB 4B50A 5MP6L 2VTFA 3QEGL 4PP2A 4Z95L 4ZTOH 1QA9B 2W91A 1EVTC 2WWMC 4QHUA 5HYSG 1Y18A 4Q74A 4U6YA 2HJKA 1JMZA 3NN8A 2CLRA 1OP5K 3MCLH 3GRWH 5I8CB 4GKSB 1LO2L 1TTGA 5HJ3A 3QQ4B 4IRZH 1RZKH 3DXAB 1IZJA 4G8IA 2DTMH 1UVQB 1R5WB 3W0WA 3CK0H 4HJJH 2GFBA 4HLZH 3QEHA 3KYOB 2RGSA 2W60B 4E41E 4L8SA 4LKCB 1S9WA 1CR9L 4HUVA 5D1QB 3QCUL 1R5VA 5C0BD 5HHXL 4PJAE 2C7UA 1GPOL 3EFFA 3V6ZA 4KK6D 2BNRB 5FA3B 1AI1H 2BY3A 5FK9B 3HE6A 2GJ6E 3RGVD 1BM3L 3MBEA 3HAEG 3D69A 4F7TB 1LDPH 3SCMA 2ZWLT 5CJ8A 5D2NC 3F12A 1RJZA 1JZ7A 1OAQL 4E0RB 4W81A 4XGZB 1XIWC 2PXYD 3I75A 3VXOB 4NQUA 3KDMA 3HMWL 1CDCA 1ORSA 1E4KC 3N9GH 4N1CA 4HV8A 4PJBF 5KAQF 3GIZH 5F70A 3BPOB 3LHPH 1DZBA 3H0TA 2AAVA 4ZAKB 4F58L 5C3LD 4ELMA 3RWDA 3DVGB 3FT4A 2DQIH 4PV8B 3WEXA 4LEOA 4FQXB 5CD5C 4R2GD 1X5ZA 1QSFB 1AE6L 1SJXA 5T33L 1BWMA 1T89A 4R0LB 4AT6B 3KPQB 4UTAL 2GTWB 5T5NG 5B8CC 3RVTD 4UILL 5BZDB 5IQ7L 2DDQL 5E03A 4PGBB 4U1HB 5JZ7C 1NLBH 5L9DH 2CDEA 4KPHH 3IJSB 2EC9U 4JKLA 4KHXH 5HGGS 1OT2A 4XCNA 4F15C 5EO9A 4PB9H 3EKCA 1NFIB 4NKIL 4X6FB 4HIEB 4OFYA 4OZGB 4L3CA 1I7ZA 5CILH 2R2BA 4XWGL 1BIIA 1FL5A 2Q76A 3ARDB 2HLFC 4XAKD 1IEBA 3P9MB 4P4KB 3VFRA 2BY0A 1ZGLM 2KQNA 4MAYD 5J1SC 3SGKC 3MROA 1JRHL 3HC4H 5TH2A 4HFWB 2J8HA 1CICD 3GMRB 3TJHC 4QO1A 1Q9WA 1KTLB 3I3BA 3KYKL 5SWQA 1WBZA 3LKNB 1MCKA 5IIEA 4Z7VB 5IB2B 4Q7DA 4MWFA 4DOHB 1E4WH 5F6IB 3L95B 3CX5J 2PO6B 5GGTH 1HQRB 3ZDYF 4PRDB 1RJCA 5D71L 2DM7A 1MELA 4DN3H 2Y7QA 1NMAH 2XTLA 3QDJB 1EPFA 1F8TL 2Z35A 4OI8A 3NCMA 5FYJU 4F33A 4J3UA 4QT5B 3K4ZA 3O6KL 1FP5A 3FOMB 2DWEA 4OTXH 3DX9B 5FGRA 2FIKA 3MLTA 5DVMA 2BERA 5D6CA 3V4PH 3P9LB 3TVMD 5K9KA 1RZIA 4F37F 5IMLA 3RUGA 3WL9B 3VFOA 3V0WH 1S7XB 4ONGL 5HTSA 5ITBH 2VSCA 3CLEH 4NO3B 5IK3B 4ZUWB 1IQWL 4K9EH 3MJ8B 4FHBD 4JFFE 4BFIB 2R4RH 1OP9A 1GGUA 1IGMH 3IDYC 2BDNL 1YJDL 3OKEB 3TZVA 4HUUB 3HNSL 2Y25A 1MFDL 2IANB 3KS0H 1P7QB 1KEML 1HDMB 3SHSA 3LEYL 3R0NA 2XWJB 5DEFA 1OAYH 4UV7H 1U93B 3ES6B 5JW4N 4ALAL 4YEFA 4EDXB 5I16A 4N0UA 3DRTA 1OGAE 5DEGA 3FAXA 3AAZA 2OMBA 1GHFH 4C54A 4QRUA 5J11B 1BFOB 2DICA 4LSSH 3VI4E 3UTTD 3OTTA 1KELL 4ACPA 1HH6B 3EDEA 2GHWB 4KGLA 1MJUL 2EDHA 1LVEA 3VRLF 4XHQA 4L5FH 1LMKA 5L88L 3QEQB 1FBIL 4WHCA 2NY0B 2C3HA 3F65A 5C70A 4KQ3L 5K59F 3K2MC 5IW1B 5KVFL 1TNMA 1ZMYA 3C6LD 5DJ2A 3TN0C 1RZGA 2N1KA 1G7MB 2EO9A 3ZKXB 1ZE3C 2I60H 4BYHA 3KPRD 4BQ9A 2VL5A 4TRPL 2BOBA 1CFQA 5IV2A 4NZRH 5FGCE 1FNSL 3RY5A 3E2HC 3TCXA 5F3BB 2VQUA 3ZE0F 5H35B 2X1OA 5LCVH 1GAFH 4KGJA 2DTSA 4QHMB 5DMJB 2C3VB 3UJJH 4GXUN 2XTJC 2NY1B 5KVMC 1EO8H 4PJEA 5F7WC 2MPAH 1MF2L 3OSKA 4B5EA 2CJUH 4AMKH 1NCBL 5JUEH 1FSKB 2GAZA 3QQ9D 2OS7A 3JUYA 4RMVA 2FGWL 7CGTA 3AB0C 3BDYL 1I1YB 1YYMH 3Q1SL 5JA9A 1FGNL 5F88B 2VITB 1C7TA 3WV0A 3BE1L 3D1MC 3QA3B 5IB5B 2HFFB 3TV3H 4HAFA 3VXPB 1TJIL 5BJTA 5I8EB 4Z6AT 2BSSB 3WFHA 4QOKB 5EC2A 2R0WH 1EEYB 4QLRA 2E7LA 3MV11 4TUOB 3RJQB 5HHME 4Y1AD 4PJ5A 4F7MB 2VLME 3H3PL 4NCC2 3N85H 1XCQB 5CWSA 4D8PB 1NGPH 2XA8L 1VACA 3DX6B 4P4RB 5JIPA 1ONQB 1YYLH 4JDVB 3TM6A 2VDMH 3CFCH 3DSNA 2IMNA 2WIIB 1F2QA 5DQJB 4MXWH 3ZZ1A 4OZFH 3VJ6B 5KSBF 1JPSL 1JGDB 5D1QC 3GMOA 4PRAB 3O3UN 1VPOH 4AG4L 3P11L 4OQTL 4DVBB 5JXAL 1DBJL 5F8QC 3WD5H 4X7SL 4JM2A 1U3YA 2G60L 5HYSB 2JJWA 4AL8H 1MY7A 5C09B 2DYPB 1Q9OB 3WUWG 4HIHB 1FZKB 2I9LA 1J0KA 4LSVL 1NL0L 1EA9C 4XMPL 1N64L 1CLZL 5ESQA 5EU6A 4XBEH 3UEZA 3QDGE 5IB3B 5KSBE 3H9SE 5JXEA 3GSRB 4JFOA 4UUJB 1FO0L 3L3JA 5EOQL 4CADB 1NJ9B 3SKJH 1MLCB 3BPOC 3O3AB 4ZAKC 5CEZE 1IGTA 5J13B 1BVZA 2RCSL 1D5MA 1XGQB 3QO0A 4LHJB 3A6BL 4Y4KD 3V0AC 4U1NB 1NC2D 1FFRA 1IGJA 5DJXB 2HVJB 4R0LC 4JRXB 4S2SB 5EZLA 2HT2C 5D96B 2XZAL 2C4XA 5DD3L 4AM0B 1WUNT 3HI6L 1H8SA 2HT3C 3QNXB 2ZOLB 2QJDA 2ERJB 4RRPA 4NM4H 1XGYL 2Z8WC 1QUNA 3TP4A 1DE4A 2GSGB 3BESR 5IG7B 1UWXH 5GHWL 5IB1B 1JHLL 4FZEH 2WANA 4I3SL 5L2JA 1QSED 4OFDA 3ARDC 4LU5L 4J7RA 3RBSA 4ETQA 3RNQB 5DJ6A 1AD9A 1I85C 5JQ6H 4AEHH 1M7IB 4P4KC 3IFNL 1IL1A 3D48R 3LZFL 5GSVA 4I2XA 1L4IA 4KJWC 5DURB 1EAJA 3TT1H 5I6XB 4HEPG 4WWKD 2V5YA 3L3OA 3NMEA 5DHVH 2P5WB 4S0TD 3KGRA 2X4TA 3MRIA 2YRLA 4G9DB 4GG6A 5EIIB 2WQRA 4GSDH 2OL3H 2YD8A 4DAGL 5TE6H 1SM3L 1UH2A 5F6IC 4GXVH 1Q0XL 5HHOB 2PO6C 3PQYA 4K3EH 2ICWB 1DDHB 3VXNB 4XP6L 5EBMB 4Y19E 4LLVB 2NY7L 4JM4L 3ZLQC 2CMRL 3KYNA 4MAUH 3LRSB 5E56A 4QRQB 3MLVH 3R8BB 1BFSA 4IDJH 4UV4H 4X6DB 1OPGH 4L4TE 4HWZA 4G7YL 5C9KA 5F7KC 4OZFB 5H2BB 4OLZL 1K5NA 1AGCB 1F4WL 2GW5A 4LLUA 3DROA 2YBRA 4JG0H 1SYVB 4NO0B 5F6HI 3PIQA 3TO2B 4EN3B 5I17A 4LRIC 1GGYA 2CH8A 4ZFZB 3RVUD 1D5ZB 1SEQL 2I07A 3IU3B 3P0GB 1YEHH 4WI6A 3L3IA 5FDWA 3MMEB 2G5RA 3MV9D 1J5OL 2D4FA 3CCHB 1W0WA 4KXZI 1MHCB 2J6EL 4JKPH 5LGHL 4UAOB 4PJGE 2EECA 1A4JA 5KTEH 2F19L 3LV3B 4HWBA 4Y16A 4D0BB 1RFDL 2JCCB 3C8HA 1FORH 1C5DB 2FSEB 4PJXB 1YMHB 4ZFOB 2H1PL 1KG0A 3IDNB 4G8GE 2CDGA 5C08A 3EJJX 1OW0A 1N8ZA 1XF2B 2O61B 1SY6A 3GSUB 4ZO7A 3U36B 1R3JA 1AO7A 3SBWC 3VWKB 1R3HB 1JHTA 4DZBB 2PW1A 1BOYA 2DQDL 2HWZH 5J11C 5MEQB 2AK4E 4O02L 4XNMB 5F71A 4JFEB 4NQCA 4HS3B 1BD2A 4NPYA 5FHBL 1HYSC 1HXYA 2DQHH 1JZ6A 3F5WB 5EU5B 2YOCA 5ISZA 3S34H 3QO1B 4C58B 5BVJB 2NY0C 5GZOC 1F45A 3DURB 1QTYT 3TNMB 3UROR 1RK1A 5D6DC 2FBOJ 3ZKXC 1CFSA 4XPTL 3QCVH 2ZUUA 2O26U 4PJCB 2JJSC 4NQSA 1DUZB 3MRRB 1VA9A 2VR9A 4F9LC 3GKWH 3SDCD 3IS0X 1NAML 1H0DA 3PDGA 1MIEL 4J8RA 1EGJA 4X6DF 5DJ0A 1P5VA 2JB6B 2VYRE 4GAYB 2NY1C 1XR9B 4O2CB 4YE4H 1QRNE 4Z7UE 1QO3A 5DHVB 3SJVD 3ZKMC 2X4PB 1ZLSH 1RUML 4JZOA 4NHUA 2HFEB 2QQLL 3QUYD 5GGVL 2VABA 2GUOA 2FB4L 4ONHA 4JFDD 1FSKC 5D4QA 4KZDH 5I0DA 2ARWA 2OL3B 4TOYL 3QUZB 2FBJL 4NQVA 3GIVB 5BRZA 5DHXB 1K4DB 1YEFL 1WV7T 4E42B 4FQCL 4K3JH 4NKMA 3X14B 1JK8A 3QQNA 2EH8H 2OYPA 5C0AA 5DO2D 3KXFA 5HDQH 3RZWA 3KPSD 4NNPH 2J4WL 1Y0LA 3T65A 2JCCF 1ZWIA 2UVFA 4UOJA 1OCWH 5JA8B 2AJYH 3GSXB 1WZMA 4P9MH 1QBBA 2Q87A 2MJWA 2DQGH 5INDA 1G9NC 3BJ91 5CCKL 1HNFA 5C0IA 4BKLA 5E9DD 4I18A 4MQ7B 5FYKU 3AXLA 5T5FL 4ODTH 5DK2B 1JPFA 1FNGA 4OUUA 3QG7H 1AJ7L 4OCRH 5D9SA 1S9YA 1ACYH 4GAJL 3LQMA 1MPAH 3T1FB 3U7YL 4M4RA 1OGTB 1Z2KA 1LO0H 2APWA 4HS6B 3MYJA 2P5EE 2OJEA 3CFIC 3DBXA 4ZO8A 1A6AB 2NW3B 3SN6N 4F3FB 1CIUA 3FB5B 3L7EB 4UBDC 5GS0D 1HE7A 1P9MC 4PJHA 4NRXB 3H3BC 4WUUE 4RNRB 4IIQB 4W4OA 4G6MH 1TCRB 4XPBL 3X12B 4TSBL 5E8OA 3TH2T 3KR3H 5C8JB 1CF8H 2FRGP 3ULVL 2NXZD 2ED8A 3LKSB 2Z92B 2GITB 3DARA 4QHLB 5J6HB 1U92A 1YY8B 3T09A 5IW6B 4Z95H 4MSWA 4J3SA 3FQWA 2ARJA 3GI9L 3NABL 3V95A 4DK3A 3QWQB 3MNWA 2VDRH 4K7PL 3HTLX 4MD0B 2AQ2A 4LCWD 3WUWB 4OM1H 5D96C 3MV7D 3HZKB 2NY4B 3N0PB 3ZSSA 1UACL 5MERA 1IAMA 3IGAA 1SBSH 1A9BA 3KPNA 3X13A 1KJMB 2ERJC 1UEMA 4OLWH 3CFKB 1SBBA 2G5BB 4P46A 3ULVD 4J3WA 3E8UH 3T2OA 3QPXH 2CK0H 2AJXL 1S9XA 2OCFD 4G7VL 1OAUL 3ROOB 1CLCA 4KTEL 3AS0A 1CXHA 1WWWX 2EZ0D 3DVNB 4R26H 4FFYL 4F7EB 2JIXD 4MQXC 4QRRA 1NEZA 3DNKA 1AC0A 2EDKA 2F5BH 3MRQA 3CFJA 1V3LA 2ATPA 1OAQH 5I6XC 4HGMA 5DK0A 1FNEA 1V3MA 1N3NB 4HZLB 2IFGA 4M1DH 4LLDA 3VFNB 3V8CA 2IQAA 1RZ8A 1UB6A 2RFXA 3BP7A 2I9TB 4JN1L 1DSFL 4WI7A 5AAWA 3FFDB 1E6JL 3L5JA 4X9IA 4XAWL 2OP4H 3W2DH 3S96A 1QBLH 2LFGA 2AEWA 4JRYD 1DQQB 1EERB 3C5JA 3REWA 1T4KA 3I02A 2ESVB 3UTZB 4LOUD 5GGRY 4XWOD 2XKNA 1AGEB 2GY7B 4BK5A 1XGPA 2F5AL 4H8WL 3SE3C 1I3VA 4ETYA 3BI9X 3UTSB 3LQZA 3WYRA 3UO1H 2ZOKB 5AZEL 3U2SA 2X4NB 2Z31B 1HKLH 3HR5B 2BFVL 3LN5A 3DX8B 2DI8A 1UXSA 3ROLB 5B4MC 3KHQA 4JO4L 4OT1H 1U42A 3FONA 3HS0B 4FMKA 1UM5L 4EN3C 2V5SA 4K7FA 3C09B 12E8L 5J7CC 3PWPD 1I7UB 3PWLB 5F9OL 5GRJH 2EIZA 1ZT7B 5CMAA 2MOVA 3FO1B 3TCLA 3IKCA 4WI4A 3D3VE 3T2NL 4UAOC 1GC1L 4OLYH 5KS9B 1PG7L 2AXFA 4PJ7B 5BS0A 4CVXA 2EEBA 3ARGD 5FA4A 1WBXA 2FX8H 1T7WA 1JRHH 3JWOC 3WMSA 4HMEA 5C7XL 4OGYL 1FIGL 1PG7W 3O2VH 4MJ5B 1M05B 4UT6H 1FH5L 3T0EB 5I1CL 5EOTA 3VWKC 5HHPA 1C12B 5E2WL 4HKBB 3SGDH 3STLA 3VXRE 2QQNL 1YEJH 3TIEB 4TTDD 5DMKB 4IDLA 1UADC 1J1PL 4R7NA 2XKUA 1FZJA 3HZYB 4ORGA 5KOVC 1A3RH 1CD8A 3QIBD 5GIRA 3K81A 3GMLB 4M4PA 3UTPE 3PXJA 3TO4D 1Y6NR 1MCLA 5MENA 4PRNB 4H26A 4JHAL 2EXWD 4IRSD 3S3PA 3EO0B 1KN4H 1IBGH 1S3KL 1W72H 4HQQH 4NHCH 4B41A 1VENA 3QDMA 4ZNCD 5EU6E 3FCTA 5BZWB 1UB5A 1SMAA 3CMOL 3PJSA 1LO5B 1X5HA 5HGHA 5EBWA 3H7LA 4XXCA 1OTUC 3MGTA 3VXMA 3M17B 4NWTH 3L3KA 2UUDK 3VD5A 1F97A 4WJ5B 2YD1A 2VKWA 4ZD3L 1CK0H 1YJDH 4Y5YB 4IHOB 3WS6C 4NJAL 1BQLL 2E7MA 2NLJA 3G6AA 1SYSA 1J12A 2VZ1A 3QUZC 2ED7A 5ICZB 3MLSL 4PR5A 3WHE0 4WEMB 1EAPB 3B83A 1IARB 4TSCL 1A1NB 3LY6A 4ERSH 2BXYA 3ARTA 4LCYB 3SDAB 1U3JA 3KYAA 5HI3D 4R90L 4EQ3A 1A0QH 4OIBA 5KS9F 4TVPE 1CGWA 2DD8H 5I18L 3GSNA 4EXKA 2C3GA 2IAMB 3PV6A 1D5IL 3U4BH 2OI9B 3MRFB 4UIMA 5E6ZA 1DVFD 3ZYIA 3Q3GB 5D7JD 3HI5L 1NMCB 4I2XE 4LPCA 4KQ3H 3G5VA 1H3WM 5KVFH 3MA7B 3OXSB 1IM3A 3U0TB 1D5XA 1RUQL 1ZT4B 4ODWB 3LN4B 1AIFB 4PY8J 4LARH 1OAKL 4FG6D 2A6IA 3WXWL 3UC0L 2IJ0C 5BOZG 2FECI 2W0KA 1RUAH 2GCYB 3LPGA 5F1NB 1LEKA 4LSUH 1A3LH 1A9EB 2YKLL 3DX7B 1ZA6A 1WAAF 3N1FC 1KJ2H 1M6OB 5C0BE 1IAIL 2X4QA 3RBGA 5FM8A 4HBQA 5TPWH 1DBAL 4IIQC 4AEIL 2ZSWB 5HD8D 1HZHH 1WC7A 1UA6H 1FPTH 3QDAA 1YEIH 1IQDA 5T1KB 1T1WB 3QUKB 3EHBC 2XPGA 1PYWB 2ZG3A 2Y36L 1FFNA 3NCJL 4QRPB 5I75B 1U0QA 4JZJA 1U8LB 2D31B 4BSVA 4YFLI 1B4JH 4NQXB 3U9UB 1HHKA 1W72B 1NGYA 5D7LD 1VKXB 5EC1B 4HG4K 2JB5H 2NY4C 4Y2DB 3VXTA 4MD5A 1EFXB 2NW2A 5T3XD 1DCLA 4OZHF 2XA8H 4PB0L 1R0AH 1QR1B 2D0GA 4OB5H 1T3FB 2J88L 4IRJB 3PDOB 1J1OH 1KBGH 4M5ZH 4KZEH 5D5MF 1FE8L 1G7JA 3FQTA 4LGPB 1JPSH 5I1DA 1CFNB 1PDKA 3L3GA 5I1AB 3QXDA 4AG4H 3P11H 2ADFL 3D85A 1JWSB 3G6JA 1DTUA 4ZS6C 1TJHL 1A4KB 5EIQA 2NMSA 2YD5A 4NQCE 5I1GL 4LKXB 3EYFB 1AR1D 5IF0B 1QPXA 3H8NA 3OAUL 5FUCE 5T1MB 4U1SB 2FEDD 32C2B 3I50H 3I6KB 5EUOA 4QRSB 2B1HH 1JE6A 4O9HH 5DF0A 2BMKB 1N64H 4XCFL 1PEZA 1N7MH 1BPVA 4HHAB 4WO4D 4RGOH 1IGIL 2Z9TA 4G9FD 5E5MB 1Q0YL 3LEVH 5DQ9B 5KSUB 1BBDH 1C7SA 5FYLL 4PJ8B 3O9WD 3WIHA 5FUOL 4G6FD 3NTCL 5C07A 1FDLL 4FQQB 4HMCA 1J7VR 4K23H 4XHJC 2AJSL 5D7IA 2ADGA 1S9VB 2R4SL 2CDFB 3K7UA 2APTA 1KB9J 3HC0A 3WKML 3K0WA 4PTTB 2Z31C 3MLWH 5FOJA 2V2XB 4GQ9H 3BT2L 2DJSA 1MJ7L 5K9OA 1EZVX 2F53A 3RZCB 3GSWB 5E95B 3C9NB 4XI5D 4OLXH 5CINH 4ZSOA 4N8VB 1G9ML 1V5JA 4KJQC 1NANH 3N1GC 3C09C 4S1QH 5CZKA 4YQXH 2H2SC 4LGRB 1ES0A 1S7SA 3NH7H 1G0XA 3VWJB 1QR4A 1E4XH 2YUWA 1G7LA 2HVKB 1QQDA 1KJ2B 3ARBB 1AXTH 5JW3H 4I3SH 5J4MA 4ODHL 5SWSB 3FN0H 4LU5H 4K3DL 2VN4A 3DSFH 3BWAA 2VDKL 4OCLC 4LCCB 1V7NH 1DQML 4FNLH 1A5FL 5K9JH 2DQCL 2EH7L 2EYSA 2R8SL 3LS4L 5CIPH 4JCLA 3TBWB 4F7PA 4TSAL 3QT2A 1TCMA 1RURL 1DBKH 3T0EC 4KV5F 5TF1L 1RZ7L 4M6NH 1MJ8H 3DJ9A 3AMLA 4GW4B 5TFSL 4YDIH 4I0KA 5BW7C 4RIRB 4MD4A 1MFBL 1I3GL 2NY7H 5TF0A 2CMRH 1N4XH 6CGTA 5I1JH 2XY1A 5LGJB 1IEAA 1F13A 4I0PD 4YGVA 4NP4L 1A6TA 3UTTE 1MJJB 4OGAD 4WW2B 3MFGB 3CZFB 1OAXH 4MJID 4N9GB 2FCBA 1TETL 1MRFL 1E27A 3HE7B 2OSLB 3QJFB 2CRIA 1CLYH 1ZVHA 2XFXA 5GGUA 3FHAA 3IFOB 4U1KB 3BO8B 1K2DA 2J6EH 2Z8SA 1Q72L 1TTFA 1JPTH 1U9KA 4LPUA 4WRLA 3KPRE 3CD4A 4YHIA 4NO5B 1I9EA 4JFFB 2F19H 2Y1VA 4YXKH 4KQ4L 4Y5YC 2I25N 3O6FD 3LKPB 3PHOA 3UTQA 3C6SB 5FAAA 2XN9D 1K8IB 1EHNA 3G5XB 4PUBL 2CLVA 1QLEL 2NXYD 4MCYB 4OIAA 1CBVH 1FL6A 1PSKH 4L4VA 5JPNA 4UT9L 1MCOH 4ISVB 1JTTA 1CE6A 1KYOJ 1OGAB 5HYIA 5HYQB 5L6YH 1MCEA 1K4CB 5FYKD 1YDPA 3O4LA 2IG2L 2OI9C 1U8NB 4M1GH 3MOBL 1NUNB 2VLLB 1N5YL 4FXGA 5D1ZB 1KCRH 4Z7WB 1NMCC 5CEZH 1GGBL 2ADIA 5L8JB 4JKKA 3U46B 4LSTL 3DYOA 4L1HA 4AH2B 1IM9D 1EGJL 1BF8A 5KZCB 3MODL 3IDGB 4D2NA 4Y1AE 2XXMB 3VRJA 1NSNL 4OF6A 4MDIA 3GSOB 3RWHA 4RQQA 3OAYH 1CGVA 3KNBA 3GJFH 1EMTL 1VEOA 1X5GA 3JV5A 1KENH 3SDXE 4XRCB 1L0YA 1T21B 4G43B 4OZIB 4RZCA 1JJUA 4XPAH 5CIPB 2PETA 2F15A 3S37L 2OTUA 2J8UA 5F1IA 3ZKSD 1RUMH 2APVA 4WW2F 4HDIB 2YWZA 2CKBH 2FB4H 3EDKA 4OZ4B 3VH8B 3DV4A 4JLRB 4MMZC 2VISA 3OGCB 2KQMA 1P5UA 3THMH 2FBJH 1J10A 3RNKA 4ZMAT 3O11B 3ARZA 5D1XA 1KLUA 1YEFH 2ZZUT 3VCLB 4FQCH 3LS5L 4LDLB 3BHBA 3PGDA 1UQSA 3CIQA 5IROC 4WU5A 1CFTA 4X4XB 3BPNB 3ZDXE 1N5AB 1F4XL 3VD4A 3QRFM 4MGXA 1RJYB 2J4WH 5I8OH 5IQ9A 5CD3A 3B9DA 2BVPA 5C6TL 5IB4B 1TFHA 4KKLC 3RHWK 1HINH 3QIUA 5L2KB 4XNXL 4XMKL 4P48A 1E28A 4Y2DC 2AABH 3FOLB 2YC1A 2R1WB 4PGEB 1TZIA 3P4MB 4ODUA 4I5BB 4IRJC 2CIIB 3NIFE 5DSCB 3HCVB 1UG9A 1AJ7H 1KTDA 4RX4D 3ULSA 5SV4A 4WCYL 4PP1D 4MJ6B 3TT3H 1B90A 1A21A 2VAAA 4APQA 5EUKA 3JTTA 3O45B 4NQEA 1YJDC 1CQYA 3SE9H 3WSQL 3GBNH 3FN9A 5IHUL 1UKSA 2CRYA 3G5YA 3V7MA 3V52H 4U6TA 5IEKB 3O2WH 4JJ5A 4Z7WF 2VLKA 1AFVH 1CE1H 2CGRL 4ZDHA 1OTSD 3WCYA 3TJEH 5F93C 1OM3L 1ORQB 1PG7X 3VE0A 1ITCA 1ZHNB 4DKFL 1QSEE 1ZA3B 2P45B 5LAXB 5E6YA 5INCA 3QDME 3SQOL 4RDQF 4PJ8C 3ZE1F 3VW3H 4OCWL 4HK0B 3ORJA 4KTDL 3U48A 4F2MB 4MNQA 4TUJA 3PP3K 3I2CL 4N5ED 3ZE2F 2HN7B 5C9JB 4KRPD 3W11C 1NBVH 1HQ4B 3RWFB 5JLZA 1JPGB 3HFML 3BEWB 3G08B 4EUPG 5DLMH 5ICXA 4Z76B 5DI8B 4XVSL 1T22A 1NMBH 1W0VB 5D70H 4ZUUA 4Z78B 4YWGH 3ZSTA 2YXMA 2EKSB 3DMMB 4WHTB 1J11A 3TBTA 3RZCC 4DEPB 1H15B 4M43L 5L8KB 3D39B 4Y4HA 4JHWL 3GJFB 4OKDA 2P7TB 1QA9A 2YSSB 3EIFA 1A64A 5E08L 1LP9A 1FFQA 3RAJH 3IKKA 3VWJC 3RWCA 3QP3A 2GTZB 3MJ9A 1JHKH 4JQIL 4QWWD 1OAUH 5IVXE 3ARBC 5I8CA 4GKSA 3DUSA 4FFYH 4YUEL 2CKBB 1L7TH 4PGCB 4ZOAA 1FG2B 2ATKA 5ITFA 5ACZB 4LCCC 1X5FA 4YBLB 3RDTB 3S7GA 2X70B 4G3YL 3PL6A 3DOSA 3MV9E 2W60A 1HN1A 2Q20A 4C56B 1U58A 2UZIL 5FA3A 3MRBA 1ACZA 5C0JA 4GKNB 3VD9A 4XAWH 1PQZB 4H88H 5B3NA 5DFVC 3G5ZA 4EI5B 4GRMB 5DT1H 4KKCD 4XC3L 5DUBA 4KTYA 3SGJC 4LPWA 4ODXB 4RMSA 4UB0L 5KANG 2CQVA 3K8LA 4P2OD 3WFDL 1IGFH 5J1AA 2DQJL 2Y07L 5CBAB 3OKDB 3TYFB 4C55A 1YMMD 4RA3A 1IGCH 3GJEA 2BVOA 3S3SA 3W9DB 5C1MB 3IFLH 3QISA 1I9IL 1FCGA 3QI9B 1RZJH 4WW2C 5JHLL 1XZ0B 3DYPA 4JFZH 1QKZL 2KUTA 1MUJB 5CZXC 2X5PA 1P4IL 3DVGA 4PV8A 3HE7C 3SE8H 2IALB 3D0LB 4Z7OE 5E94B 4FQXA 4Z0XB 4JN2B 3LD8B 1CD0A 1U8JA 3SDDC 2NQCA 5C0CD 4X5LA 1T0NB 3CXHJ 3EZJB 2V7HA 3GMMB 3I3EA 5DWUH 4AT6A 1MEXH 2NY2D 2W0FB 2BNUA 4YPJA 2JJUA 1GC1H 2ZKHH 3Q6GH 4PRBB 1T0PB 3FO0H 4P57B 4PGBA 1B9ZA 4PP2B 3GMPA 3RVVC 4DTGL 4PJGB 4M3KB 4J3VA 4QHUB 1J0HA 1Y18B 1R24B 4U6YB 3UPCA 4HKJB 2LTQC 3IJSA 5F6HJ 1BHGA 2VXUH 5DVOA 2HJKB 4L8CB 1C5BL 5GJTL 4X6FA 2P1YA 4OD2A 2CRZA 5GISL 1RZFH 5HJ3B 3GB7B 2YPVH 2Q7NA 3SJVE 1FH5H 1UH4A 5HI5C 1P84J 3W0WB 1C5CL 4JFDE 2GFBB 4YHML 3QEHB 5F9WB 2NCMA 4DUWA 4L8SB 4HUVB 1S9WB 3G6JE 3Q6FA 3NIGF 4HFWA 2AJZB 2KH2B 2C7UB 3EFFB 1KF9B 3V6ZB 5D1ZC 4MXVF 4U2ZA 4Y7MA 5DUPH 1K3ZA 3B9VA 5EUOE 4Z7VA 3MBEB 1NKOA 5I19L 5IFJA 5ADOL 3F12B 5SX5K 5B21A 1RJZB 3L95A 5E1HB 1HQRA 2PF6A 4U2YA 3TFKC 1CT8B 3BD4A 1AKJD 3L5XL 3VFUB 2LU4A 3KDMB 5E9DE 4ELKB 4HV8B 1DP0A 2A83A 2XWBA 1U6AL 4EZMA 3H0TB 4ELMB 4JFPA 2QADB 3RWDB 1TJGL 3FT4B 3WEXB 4LEOB 3WL9A 1H5BA 2HJLB 3QWRD 2W9EL 4Z7UB 1OARL 2L7UA 5A40E 4EDWH 4H25A 4PLNC 1EDQA 3GSNL 2DB8A 1SJVA 1CGSH 1SMOA 2F53E 4NO3A 1G7PA 4LK4A 1GZQB 4NBXB 1GYAA 3MJ8A 4ZSOE 2Q8BH 4TSCH 3SO3B 4D0DB 4S1RH 1K9TA 35C8H 5GGRA 3BEVA 4KJPD 1GRWA 3WBDA 3BPNC 4H20L 4TQEH 4OV6F 1WCBA 2CDEB 4XCNB 5EO9B 3UXFA 3O3EA 5IGXL 4J12A 5F7EL 1Q9LA 2XWJA 4L3CB 2DMBA 5GXBB 3ES6A 3ULVF 2E9WA 1BIIB 4U1GC 1FL5B 4X9FA 5CEYB 2Q76B 4RMWA 4UT7L 1IEBB 3QIWD 4OD3L 4K55A 5JW5A 3VFRB 1F4YL 1NCCH 4O00A 3GK8H 3MROB 1QFWL 3OQ3B 5TH2B 3KJ4B 3MV7E 4U7KA 3O6LH 1Q9WB 5SWQB 3FFCD 4KROC 1A7QL 1WBZB 3ZTNH 4Z7NF 4OJFH 2HRPL 3P30H 4HUKB 4UINL 4MWFB 4WU7A 2IPTL 3GHBH 3VG0L 3ZHLA 4X80L 3JSSA 2FZ3A 1IAIH 3BP5A 4YDKH 4U6HA 5HYEA 1CXFA 3BQUD 2Y7QB 5E8DL 4O5LH 3WDHA 1DBAH 1UZ8A 2E27L 4DVRH 3C5ZD 1F90H 1CDGA 2Z35B 4F33B 5CJXC 4YHOL 5SX4I 4OD1H 4NN5B 2DWEB 2EC8A 3MLTB 2FIKB 1AXIB 2BJML 2J2ZA 5D6CB 2RB8A 1ZGLA 1KCVH 3ESUF 5E8EB 5FCUH 3L5HA 1RZIB 5IMLB 2PUQT 4Z7NE 5E6ID 1VGKB 4YH6A 1ZOXA 3QCTH 3RY4A 4ELMF 4OAWB 4JVWA 4G6JH 4LSPL 4XPHL 3G6DL 1IE5A 1OWRM 1VADA 2PNDA 4JQXC 4MZ2A 1Q8MA 1FVCA 1YNTA 5DD5L 2W1NA 5J6GB 4J4PA 4JRYE 3DMMC 5EWIH 5FYJE 1I1AA 2VITA 5C86A 3ZHDA 1HK6A 3TZVB 2HFFA 2GQHA 2F54D 4Q0XH 5EU3B 2OZ4A 2L4OA 3OHXA 1UZ6E 2HFTA 3DETD 1RUPL 5I8KL 1RVFL 1G6RH 3MV8D 4XPFH 5DEFB 5T3ZL 1H3TA 4L4VE 1MHEB 4V1DA 4XVUD 5D7KD 5EB9A 4N0UB 3OX8B 5DD6B 5DEGB 3Q5OA 2V6HA 1TJHH 3AAZB 3GI8L 1XCQA 2E6QA 2HTLD 4YO0B 1A6ZB 2P8MA 4QRUB 2YPLA 2V5TA 4YBLC 3RDTC 3DX6A 4U3CA 1NGWB 3VFPA 4JDVA 2WIIA 3PWPE 5GGSB 5B3JF 3WIHL 3VI3E 1MLBA 4N8CH 3LIZH 4XCFH 1ZEAL 2DI9A 4X98B 3OV6A 4DVBA 4WTXA 3T1WA 4PJ9D 4UU9B 1B2WH 5HYSA 1F4AA 5DD1L 3IETB 2AJSH 2AQ1A 2VL5B 1Q9OA 2NR6D 1CFQB 1KT2B 2R4SH 5IV2B 4H0IA 2MMXA 5A16B 4L9LA 5CLTA 3WKMH 2RBLA 3CMGA 4CMHB 4U4BA 5L0QB 5IB3A 4FTVD 3QXAA 5C3TA 4LSRH 2WBJB 4NZTL 3QI9C 1AHWB 5TE7L 4TVPH 2GEEA 3QH3A 4PJEB 2MSPA 4QRTA 1BEYL 4XMLL 5E2UL 1JNNH 4ZPVA 3RUGF 5ALBL 1NGQH 3LD8C 5JOPD 2A74A 3HAEA 3OF6A 4XZUA 2YUVA 4JRXA 3OAZH 3HUJF 2YD6A 1GOGA 4ODHH 3P0VH 2OXGA 4NJ9H 2VDKH 3RX8A 1KCUH 2DRUA 1A7NH 1H8OA 1DQMH 4S10A 1A5FH 2ZOLA 2WWMD 5BJTB 1BOGB 4W70A 3B8SA 3WFHB 5ACLA 1VHPA 3K4AA 2FDBP 2R8SH 1WWAX 2P24A 3BZDA 4QHNB 3S37X 2W07A 3QUML 5IG7A 2VC2L 3P3YA 1MFAH 3BISA 1U2CA 1VEPA 1FLRL 4KWUA 1VACB 5IMMA 5HYJD 4A6YH 5JR1L 4RFOL 1K8DA 4LNRA 3BKMH 2VUYA 1M71A 5F9WC 3QNZA 3HUJE 4Z77A 4JDZA 4GBXA 5JMOC 3VXRB 4L8SC 1U8IB 3GMOB 3MRDA 4NC1C 3MNZB 5F7UA 3TBSA 1I3GH 3M1BA 2NY6B 1F6AA 2WV3A 2P5WA 1KPRA 2AEPL 3HE6C 5J9PA 4XNQA 3EDFA 4M7LL 1JI2A 3NIDF 3MBEC 4NP4H 3EO9L 2AJUL 2LU3A 4OM0H 3C60B 2AXGA 3VXNA 3TA3A 1DBBL 1XIWD 1MRFH 2R0ZL 4QF1B 1ADQA 5EU6B 4HWBH 1WIOA 5DD0L 1I1RA 1YC8A 9CGTA 1EJOL 4MNQE 4PGZA 4JFOB 5HVFB 3ETBF 2HFGL 3L3JB 3NCBB 4JFYB 2R29H 4BM7A 3BW9B 4Z0BH 1R3KA 1IGTB 1SYVA 3MNVB 2QADC 1SY6H 1D5MB 4DW2H 5CD5D 3E1F1 3GHEL 4B7LA 3K8KA 3QO0B 3V4VL 1FL3B 3IU3A 5HDBF 2W59A 2JK5A 1IGJB 1NQBA 4PUBH 1T89C 3E3QE 1NCDL 4X6BA 3VXSD 3BX7C 4HS8L 1MHCA 3SO3C 2ENSA 1MCCA 5JZ7D 3LV3A 4M7KL 2WIMA 4D0BA 1ZANH 4WFHD 1XF5A 3NFSL 4FXLA 3S6CA 3F58L 1B4RA 4LHUD 3MXWL 2AVGA 2FSEA 2HT4C 4PJXA 1YMHA 2IG2H 1DE4B 1RZJC 3QHFL 4JHBA 1QNZH 5EU7C 5L2JB 2R23A 1KACB 1AQKL 2HLFD 3U36A 4GJTB 5DJ6B 1AD9B 4MXQC 1RI8A 3H42H 5GSVB 4I2XB 1ULVA 4XH2A 3MODH 2R0LH 4HS3A 3VDCA 4G6KH 3TJHD 4WUKH 5D7LE 3H9YA 1GC1C 3KJ4C 2AW2A 3ZTJG 5EO0A 1X5KA 5T3XE 4EBQL 3BRFA 5DUML 4KMQA 4JM2F 5J06A 1J0JA 2WBKA 3F6LA 4M7JL 1BJ1H 3PQYB 1JNJA 3T4AA 3S37H 3B9AA 1I1FA 3OB0H 2VZSA 4PJCA 3KYNB 4DUXA 5SWZD 4A6YB 1DQLH 1MREH 5C0BB 1P69B 3TPUA 5F7LB 5JW4R 4ODVL 4NN5C 2NZ9C 1KC5L 3RPIA 4M00A 3HMXL 1GGTA 1K5NB 2JB6A 5TE4L 1I9JH 2ICEA 3DROB 4L1DA 4O2CA 3PIQB 5ALCH 1PX4A 3ESVF 5I17B 4TTGA 2HFEA 3QG6A 2JTDA 3UJIH 3T0DA 4YX2L 4G9FE 1LK2A 5AWNH 3L3IB 5FDWB 5C6TH 1RIVL 4C4KO 2OL3A 3CSPA 4MA7L 2Q6WA 1W0WB 4OCXL 1K4DA 1IGYA 1U3ZA 4XMKH 4I4WB 3MRCA 1A4JB 4Y16B 1X4XA 3TZVC 1ZTXH 3IXTB 4QXUL 4R96A 3KG5A 3FT3A 4MA8L 4FMFA 4KK8C 4Y2OA 1KG0B 2CDGB 2FEEL 5C08B 1UCBH 3GSXA 1QP1A 1MY5A 1AO7B 1AR2A 4OCYL 1JHTB 4P9HH 5F3HA 2IH3B 3ILPA 3S5LG 5DK2A 4NQCB 1G1YA 4NPYB 4K71B 4XC1L 1T7XA 4MB3A 2AK1L 1KIUA 1YNKH 1HXYB 1IRAY 5I1IH 4J23A 5ISZB 4AY0A 5E2VL 5JMRA 1MOEA 4YDLB 4Y4FA 3VXUD 1RK1B 4PLJC 1NLDH 3TN0D 4RDQG 4HS6A 4GG6F 1NFDA 3FB7B 4IMKA 4OCWH 5ADPL 4C83A 1CFSB 1MRDL 4F57H 4F3FA 1A6AA 4D9LL 3MLRH 5ERWA 3U9PL 3OKLA 5J0BA 5EZIH 4NQSB 4NRXA 4XVSH 4CMHC 4E5XA 5L0QC 1H0DB 1KCLA 1FNAA 1TCRA 4J8RB 4DGYL 3BIKA 2XTJD 1AHWC 5I15L 4DKEH 3MJ9L 1T2QL 3MA9H 1QO3B 2Y23A 3LKSA 4ZFFA 4P2RA 4QHLA 1H3UA 3QFJA 4JZOB 4NHUB 1L9MA 4LPYA 2HJFA 2GUOB 1U8HA 2BVQB 2X1QA 4JQVA 4ONHB 1V7ML 2VDQL 4XCCH 3WE6A 3RKPA 1EHLL 3H3KA 5BRZB 4NSKB 4O51A 5I76A 5M7QA 4MD0A 5EZJB 5LBSL 1PKQE 3WUWA 2DLHA 5C0RH 4NKOB 5TDOB 4MJIE 3B2VH 4NKMB 4RMQA 1JK8B 3C5SA 4L3EA 1URLA 1BVKA 1XH3A 3T04D 2VDNL 2DQEH 5EOCH 2DL9A 2J12B 3VD3A 3KPPA 3TBYB 2G5BA 5FFLA 2E7LC 1Y0LB 3T65B 2QR0A 1ZWIB 4PRPA 1LEGA 4PJFE 5LXGH 5INDB 2ZUYA 2MHAA 3DXAD 3GBMH 5C0IB 2R56L 4BKLB 2B7DT 4HCRA 3CDYA 4I18B 3RL2A 4KUCD 2D7NA 4GO6B 3AXLB 4X9BA 5A3IC 1LILA 3VG9B 1FNFA 1JPFB 1FNGB 2HRLA 3SPVA 3F7RA 2XN9E 5D1QD 5D9SB 4DQOL 1ERNA 1FYTA 1S9YB 3MO1B 4QYOA 3WHXB 3WFBL 1Q1JL 43C9B 3R06B 1N3NA 2NY6C 2BNRD 2VLRA 2IFFL 3K80A 2Y6SC 5KN5A 3QBTB 5IFHH 4Q9QH 4K94H 3VFNA 1AGBA 1ZHBA 4JM2C 3ZTJH 3S88L 2NTSP 4JGUA 3M8OL 4YHNA 2OJEB 1T5WA 1IILE 5FYKE 5HHVL 3V5KB 2K7QA 2ESVA 3UTZA 4L3AA 2APXA 1P4IH 5JOFB 1AGEA 2RHEA 4QHKI 4KK5C 1FZMB 5JXEC 3QAZB 2XG5A 1XGTA 4N0YH 5E8OB 3PDDA 4JR9H 2WLZA 4ZAKD 1YEKL 3KVQA 4LEXL 1HHHA 4PD4J 1DANT 2NYYC 3X3GL 4WEUD 3HS0A 4MSWB 1OSPH 1B0GA 1ITBB 1JCKA 3FQWB 5A2LH 2ARJB 43CAA 1OOAA 2EDQA 2BCKA 1T0MA 1QSFD 3MNWB 1AGFA 1MCBA 4ZUSB 2HT2D 4U1MA 3FO1A 1JZ8A 1ZLVK 3PE9A 4K8RL 2HT3D 4UQ2A 1E4JA 5MERB 3IGAB 3WN5A 2UWEF 1A9BB 4JPVH 5E0QA 3KPNB 4WNQA 3X13B 5EG6C 4PJ7A 5IVNA 5DJYB 1BVLB 1S5HA 1I1CA 4NQDA 2WUCH 4N90E 3MCLL 1H3XA 3GRWL 2W9LA 1VESA 1G9MC 2YN3A 3ARDD 4PRID 4IRZL 3WFCH 1RZKL 1DJSA 3CJJA 4QRRB 4P4KD 1C12A 3ARFA 3DV6A 5I19H 3CK0L 2X1WL 4HJJL 4KJWD 3MRQB 3TIEA 5ADOH 4CNIA 2ATPB 3BAEH 3B5TA 3HZYA 5DK0B 4HJGA 1FN4B 4YLQT 2E8YA 1I7RA 2IQAB 1RZ8B 5JW4Q 1UB6B 2RFXB 1AI1L 5FGBA 2GYSA 3RVXC 1J9CT 5JDSA 5KANI 5L8LB 3S96B 1U6AH 2OJZL 1K85A 3SDXB 1F4HA 2PO6D 3C5JB 1LDPL 1CXLA 1UJ3A 3IDXH 3REWB 3TWCL 2HG5A 1T4KB 3I02B 4NDMA 2XKNB 4PBXA 5BZWA 5GJSH 1XGPB 4P59H 3QDJD 1OARH 3LQZB 3P9WB 2BX5A 5B39G 4PJHF 2VL4A 3U2SB 3HG1A 2OQJA 3LN5B 1CU4H 3BZFA 2D7MA 3GIZL 1UXSB 2VRAA 1WTLA 3LHPL 5EFIA 3FONB 4K7FB 3QZWG 2DQIL 4H20H 3MLXH 3PV7A 2FH6A 5DR5H 2MKWA 2EIZB 5CMAB 5GGSY 2VAJA 4CVZA 2YA2A 1FAIH 4B53A 3IKCB 4UZGA 5LWYH 1EAPA 3RPKA 3CXDH 4NFCA 3GDBA 4UT7H 4Y16C 3SDAA 4ZQKB 2IAND 1EHAA 1P7QD 3WLWC 4CVXB 5AZ2H 5L9DL 4X4YA 1WBXB 4KHXL 3HLAA 1D3CA 2IAMA 4Y5VA 4PB9L 4Y4KB 2ID5A 3VGDA 1OW0C 2J1KA 3MRFA 4QCIA 1NC2B 4NCC1 3SKNA 3RTQA 5FM5M 1A7OH 3Q3GA 4Q6IA 5CILL 5EOTB 1A7QH 5HHPB 1NCUA 2HH0H 4M7LT 3STLB 2Y72A 1NUGA 5FV2A 4UINH 2GJZA 1J8HA 2IPTH 1U3HA 4R7NB 3DHMA 4ORGB 1BQUA 1HYSD 4M61B 5GIRB 3LDBC 5JHDD 3MACL 1AIFA 4CU6A 5T1LA 3QEQD 2NY0D 3FL7A 5GZOD 3O2DH 5MENB 4YHOH 4H26B 5F9AC 1QSEB 3QDMB 3LQAH 5IBTL 4P2YA 25C8H 1NGZB 1KFAH 3FCTB 5GGTL 1M6OA 2W0LA 1UB5B 4D9RD 5CUSH 4PYHA 4HAGA 4RWYH 3PJSB 4DN3L 2BSTA 4LIQH 5D93B 5HGHB 5EBWB 3BN9C 1A22B 1NMAL 1MAMH 4XPHH 1T1XB 3VXMB 4AIXA 2OZ4L 4F7CB 3MZGB 2BNQD 1PFCA 3LOWA 3L3KB 3GFUA 3B5HA 4OTXL 3ARRA 2NY1D 5F7DB 4F37K 5DDHB 3V4PL 5T1KA 3ZKMD 2OBGA 4HH9B 2YN5A 4LPXA 1IKFH 3V0WL 2H26B 4MLIA 2VDOH 1HEZB 1YMME 3G6AB 1SYSB 3B5GA 4TPRH 5ITBL 4YHZH 4PR5B 5BV7H 3IU4L 2FR4A 1W72A 4K9EL 1KPVA 1VKXA 1MHHB 3VA6A 4MNHA 2R4RL 1T20A 2AI0H 5D8JH 4Y2DA 2R69H 3CH1B 3OR6A 1V8HA 4QOKD 1TVHA 1TENA 3GEWB 5JNYA 3PV6B 3WIHH 2FX9H 2Z91A 5C0CE 3TYGH 1KGCD 5I1AA 2BHUA 4UV7L 2K1MA 3MV9B 4E41A 2PYED 1JWSA 1C16A 4I18C 2HP4A 3LPWA 1GHFL 4PJAA 1EO5A 2PTUA 3VG9C 3EYFA 2OR7A 3ILQC 4LSSL 1T1ZA 1IM3B 1D5XB 1HKFA 2GJ6A 32C2A 4U7MA 3VGBA 1LE9A 4HKZA 3T0VA 4L5FL 2B1AH 3DWTA 3B9KA 5GZNC 1LEKB 4UI2A 2C9AA 2R9HC 5DQ9A 5C09D 4GQPH 1H3PH 3D0VA 2DYPD 5TE7H 5HPOA 2IQ9H 1ZA6B 1U91A 2BRQA 3H9HA 3KWWA 4UTBH 4UBDD 4X4ZA 5E4EB 1CGUA 2NY3C 2EE6A 2XZZA 3K4DA 2X4QB 1BEYH 1A1OA 3CVHA 1KXTB 4NZRL 1F5WA 2X9XA 4P9HC 3ARUA 4W4OC 4DJMA 2KBGA 3QAZC 1WC7B 1GAFL 1DQJA 4NN7B 2V2XA 3QJHB 4FA8A 5ETUA 4U3XA 5A1AA 1IQDB 1CFBA 5I1KH 3UJJL 2XPGB 2MPAL 4OLEA 3V0VA 2CJUL 4AMKL 1KJVA 4JZJB 2HYMA 5A2FA 4BSVB 4PJBA 1NGYB 5GPRA 2O5ZH 2A38A 4WI9A 1KJ2A 1YYML 3VXTB 2NW2B 5TQ0L 4XCEB 3TV3L 4RFNB 1D5BA 5ID1A 4NYLB 5KG9A 5FB8A 1OP3H 2R0WL 1I4FB 3R4DA 1JZ5A 4JFDB 3QXDB 2CIKB 4RGNC 3D85B 3G6JB 3G9AB 4MQXD 1FFOA 3N85L 4W6YB 1YPZF 1ZVSA 1NGPL 1YYLL 1T6WA 3EYQC 3CFCL 5BV7B 4P2QD 2APFA 2E6PA 1N6UA 5EUOB 4MXWL 2QLVB 3B6SA 1VPOL 5CP7A 1ZHKA 1NFDE 5FYJH 3WD5L 4ZUVB 2FJFA 1R5IA 1ZKAA 5C07B 3KAAA 5HHOD 4AL8L 2XZQH 3EBAA 1MJJA 2P44B 5GS1A 1YPZE 3S4SG 2B2XH 2APBA 3MLZH 4PLKC 3D18A 4RA0C 3FFCE 4XBEL 2WP3O 4H0HB 4P2RE 2VKXA 4KDWA 3O6MH 5B4MD 3SKJL 4NO0D 5K9OB 3EOYG 2F53B 5BMFH 2JELH 3BZEA 3JWDH 4EN3D 5E2JA 4ZSOB 4K94C 2FO1A 4JFFA 4WI8A 5A43C 3EOBA 4M7KH 5K9QG 3CDFA 4H1LG 1FFPB 4GLRI 2HTKC 4NUJA 2VH5H 3MXWH 3FT2A 3FB6A 1RHHA 1ES0B 1K8IA 1S7SB 2P8PA 2C1PA 2WQ8A 3G5XA 1G7LB 1NDGA 1QQDB 4HJ0C 3U82B 2H32A 3PABA 4LLWA 3BWAB 5DGRA 5GRUH 2A6DB 2NXZB 4PRPE 2EYSB 2A73A 2D7PA 4PJIE 4NC2B 4JY5H 2F8VA 4OF0A 3ALWA 1K4CA 4NM4L 5BCAA 2VXSH 4PJDE 4Y4KC 1CN4A 3UP1A 3LB6C 4F7PB 4NKQB 4N0FB 3MRJB 3AROA 5DRXA 4FZEL 3VWKD 3HNVH 4X5XA 4EOWL 5JQ6L 4AEHL 2F54E 2YZ8A 3U46A 2AV1A 4JFED 2FIRT 3MRGA 1H3VA 4AH2A 1UENA 2WW8A 3MV8E 4YR6A 3TT1L 4MD4B 4NT6A 2NY5H 5D7KE 2B8OT 5DVLA 3V5HA 1IEAB 4JFHD 1F3DJ 3ZHKA 4GSDL 3K74B 2OL3L 1UWGL 4GXVL 2OLDA 1OAZH 5IM7A 4K2UH 3T0AA 5D7IF 4HDIA 4MA1C 2YXFA 5D93C 2Q8AH 4MAUL 1OTUD 3RX7A 3MLVL 4JLRA 2XFXB 4XXCC 4IDJL 4UV4L 2N56A 5GGUB 1OPGL 1YC7A 4U49A 4MA7H 5TDPA 1JI1A 1K2DB 4M93B 3HI1A 1REIA 1SJEB 4JG0L 2VWEE 3WUZA 4X9HA 4GRWF 3STBA 4P2CG 4JRYB 1OHQA 4OIIH 3DGGB 1N0XH 1Z5LA 5DZOA 4RAHA 3GBLA 3O8XA 4XP1H 4JFXA 3UTQB 1FCCA 3QUZD 5D2LE 1QYGL 2QHRH 4HXAH 5E99H 1YEHL 4CAGA 1QD0A 5E24E 4FTVE 3RWGB 5K33A 1UWEH 3FZUC 2CLVB 2YA1A 4JKMA 2VXQH 1UKQA 4XP4H 1FL6B 1YQVH 2QKIA 4L4VB 1JVKA 1YN6A 5JPNB 2R1WA 5KTEL 1CE6B 4LGSB 3P4MA 1V3KA 4P5TA 5CJ5A 4HGWA 1YDPB 3O4LB 3HCVA 4NNXA 4XC1H 4KDTA 3QHZH 3P77A 5DJAA 2XNAB 1U8PA 3SKOA 4NC0B 3C2SA 3UTOA 5E2VH 2UY6A 2ZSVA 1RU9H 2WWKT 2E5EA 3IAQA 2HWZL 5ADPH 1T1YA 3MOQA 4IOFC 3MLPA 3VRJB 2C3XA 2Z8VC 1ZHNA 4MDIB 2DQHL 3RWHB 4RQQB 2J5LB 2WUBH 5IMOA 4S0SD 5HYJE 5IHBA 4RZCB 3BPLC 3QDGA 4HK0A 5E4EC 5KSBA 3ZYZA 3H9SA 3QCVL 5F1IB 2J8UB 4P0DA 1HQ4A 1JPGA 4WVRA 3BEWA 3DV4B 2VISB 1L7IH 1NCAH 4QNPF 4ZODA 3HB3C 3RNKB 2DBJA 1W0VA 4NN7C 3TO4B 5D1XB 5D2NE 1KLUB 5LBSH 3UX9B 1NCNA 2C4FT 4GUPB 2H8PB 3EHBD 3PGDB 1UQSB 4WU5B 1H15A 1CFTB 3WIIH 3NFPA 1ZLSL 4XXDB 4HW6A 1TXKA 1KCKA 4KXZH 4JZJC 4HIXH 1KOAA 3GMNA 4H1LH 5CD3B 4FP8H 5IQ9B 4B0MM 2BVPB 5T3XH 4G42B 3U4EA 2FHBA 3HZMA 3QIUB 1A02N 2F9BT 3MCG1 3WIFA 3LQAC 2GTZA 2NY4D 1E28B 3ULUE 4ZNEE 3SOBH 1MCPH 3L1OH 4K3JL 2CKBA 3J8F7 1FG2A 4RFNC 4ODUB 2EH8L 4Y89A 4NNYA 3L7FA 2IEPA 5HDQL 4MB5A 1KTDB 3ULSB 1CS6A 5J12B 1AQDA 1X5IA 3WFBH 2VAAB 1OCWL 3VXSE 4APQB 2AJYL 3JTTB 5EUKB 3TLRA 4RBPH 4P9ML 4LFHD 4ZS6D 3UPRB 4XNZB 5KSVA 2EIEA 2M2DA 3NOIA 3G5YB 4WTWA 4JJ5B 5BV7C 4ODTL 4EI5A 4ZDHB 1YNLL 3Q2CA 5IBUB 4DKAA 3F7YA 3QG7L 4OCRL 3VFSB 1ACYL 1MFEH 3VE0B 3AREA 2FYYB 1MPAL 2QQKH 4JREB 5JO5A 3OKDA 1GGCL 1RMFH 3KPLA 5INCB 4Y19A 5E1AA 1LO0L 1ZVYA 3KYMA 3JTSA 3W9DA 3MJGX 1YEKH 4L4TA 4MNQB 4XHJD 1W8NA 2Q7YB 3QI9A 3CFBA 5CP3A 1UWXK 3JBG7 5JLZB 3MRLB 5EH1A 3UTSD 1WBYA 2J8UF 4UOW1 4MDJA 1P2CA 2Z8RA 5ICXB 2Z31D 1T22B 4PRHA 1CXEA 4G6ML 2FL5A 3KR3L 3GGWA 4K8RH 3TBTB 1I8IA 1YQ2A 4KJQD 1TPXC 4Y4HB 1DUYB 4YBQC 4PJGA 5SWZE 1LNUA 4HGKC 2H2SD 1R24A 4HKJA 1LP9B 2VDRL 3RWCB 4PS4H 4L8CA 2AGJH 4U1LA 2B4CH 2ZPKH 1RPQA 3BWUC 4OM1L 4QTIH 3DUSB 4YHKH 5FEBA 4HC1H 3GB7A 4G8GA 3LPFA 4YEEA 2RR3A 2ATKB 5ITFB 1WVZA 4PTUB 4WDIA 1SBSL 6FABH 5HVWA 4U0RB 2MFNA 4OLW