4Z7UE

S13 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
198
structure length
198
Chain Sequence
DAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRDRSNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 198
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uE02
3JV4B 4FQ1H 1AFVH 4MAUH 1E4XL 3KS0H 1I1AC 1NUDA 3QCUH 1WAAA 2CDEA 3B5TA 1HH9B 3HI6L 1U3HC 4GQ9L 4IEFB 1JNHB 3WL9B 1FYTB 3MRBA 3THML 4ODHL 5C7XH 1HOCB 2CR6A 3OV6A 3B2VH 1EERB 1MOEA 1QQDB 4P9MH 4ALAH 2DBLH 2KL6A 1KENH 1QO3A 4HAFA 2UZXB 4UOW1 1NC2B 4POZD 3HI6H 4QCIA 3REVB 2V9QA 3QQ4B 1N5YH 3HE6D 5BCAA 2P7TB 3BIKB 3F7QA 4PJ5E 3THMH 1NCAH 3QNXA 3G5VB 5E99L 3BFOA 3I6KB 5HYIA 2GCYA 1XIWA 3SQOL 4F57H 5E2WH 5F89B 5MERB 5IIEB 2ZNXA 4LKCB 5I18H 1DFBH 1FVEB 3O3AA 4X7CC 2P1YA 4H8WL 2BSRB 3QXTA 1EZVX 3C5ZA 1CVSC 1S9WB 4Q97A 4X0KB 3TC9A 4J1UB 1ZSDB 4LK4A 3TJEH 2VZUA 3X3GL 4PJDF 4X9HA 3VRLE 3JWDL 3DXAE 3SQOH 3HE6B 3QDJD 4HD9A 5KJRL 4WJ5B 2V2WA 1BVLB 4ZG1A 1E6OH 2VLKA 5FO9B 3VFSB 3MGAA 5I1EL 5HHVL 1EO5A 5DRXA 5IHUH 4K7FB 3BDYL 4WI7A 3FRUA 3QEGL 4K7PY 5EOCH 1KGCE 5IT2L 1CD0A 4H1LG 4OZIA 4H25A 4NHCH 3K4DA 4YZFF 3E2HB 3VXSD 4NJAH 3QDJB 4EI5D 4YC2C 3CVHA 5I1EH 1Q9OA 1M6OB 4K94H 1I7TA 1QLEH 2F58H 3C6SB 3DX6B 3ES6B 4L9DA 4W4OA 3SCMD 1EMTH 1FSKB 15C8L 5DZLA 5GGVL 4I4WB 3U46B 3NCYP 4U0RB 3GJFH 3EJJX 3R4DA 2FLRT 4NWUH 1LE5B 4TNVK 1MHEA 2ZCLL 4U1LA 4ELMB 2Y72A 3X11B 3VXSB 4XCYA 1MQKH 4EI5B 4ETQA 4H1LB 4GMSH 3OXSA 3VDCA 15C8H 5EBWB 4GJTB 4TPRL 3ULVH 4RMUA 1DUYA 4QOKD 3VFTA 3VG0L 3SCMB 4NT6B 1KTLA 3BDBA 2OZ4L 4OV6F 3RWHA 1JHLL 1NMAH 3CX5J 1JPTH 6FABH 4OZHE 1BF8A 4P9HC 3QWOB 2GSGB 2BMKB 2EDYA 3IAGC 1CDBA 5MEPB 3O2VL 4PJ7B 4PJGE 5C9KA 1VKXA 2WINA 5JOPE 3NFPA 2AQ2A 2NXYD 3PWNA 3QXWA 4QOKB 2OZ4H 5D70L 1JHLH 2GEEA 5HVFB 5C07A 2XN9A 2EDHA 5HVHC 2EDOA 3Q6FA 3O2VH 4MLSA 2W9EL 4XNMA 3MFFB 3QA3B 4MSWB 1NBQA 1L7TL 1J5OH 5I8KL 3P77B 5GRZA 1VHPA 2W60A 2ORBL 3QIWD 5D2LE 5GRVL 1IGJA 1OCWL 4MNQD 3DMMA 3MLYH 2NXYB 5C0EA 3ARUA 4W6XB 1KPVA 1OHQA 1Q0YH 1U8NB 2W9EH 5D5MF 2BVPA 5C92A 3ULVE 5DJYA 3EYUL 2VDOL 4CMHC 5I0DA 1A4JB 4ZTOL 1WBXA 1ZT1B 3GMOB 4NZRH 3RGVD 4W70A 2ORBH 2J3SA 5F6HJ 5IK3B 3MRLB 5BRZD 2A6DA 3SO5A 1YYLL 5IOPB 1XF5B 4XXCC 3O9WA 1EZVY 1QSFA 3QIWB 2Q7YA 3NMEA 4MNQB 3AFLA 4G6FD 5JW4Q 3EYVB 4NQDA 5E56A 3VFWA 3OX8B 5KSVB 3NZ8B 1OAKH 3SBWC 3WFDH 1K8IA 5IKCA 4YHKH 5HI3D 3WFBH 3RGVB 4P23D 1KTKE 3BZEA 4TTDC 4BSJA 4OLEA 4LLUB 4X6CB 4YBLC 5BRZB 4WTWA 4MVBD 2MCG1 1HZHL 3LKRB 4LNRB 4ZFZB 2HJFA 3SE8H 4F7EA 1FE8L 3U4EB 3DVNA 1FH5H 2DIAA 1BFVL 4PJFB 2DQGH 4PD4K 4G6FB 5DYOB 4M02A 4XTRD 1CFSB 3V6FB 5IBLC 5I17B 5A2LH 2XWBA 2FLBT 4GKZA 4IMLA 2R23B 4M6ML 1I3UA 5IW6B 4HEME 4JM2A 3KPPB 4KK8C 2Z91B 5EPMA 5I1DA 3QQ9C 1EGJH 4P23B 1FE8H 3C09C 4EQ2A 4LPXA 1CWVA 2FEDC 1Q72L 2B2XH 2LVEA 1T4KB 2JF1A 1P84K 3U4BH 1H5BC 2AJXH 2GK0B 4X6DE 4XPAL 4F3FB 1X6LA 3QEUB 2IPUK 3C6LD 4PJAB 3AY4A 4PLKD 1UZ8B 3UTTD 5IEKA 3KPNA 4GXUM 5F6IC 3GB7A 1CS6A 4R90L 4FHBD 5F1NB 3SGKA 3V2AR 3O0RL 1NBYB 1H0DB 5D9SB 4L9LC 3ZE1F 4BELD 1JYNA 3VFGL 2ESVD 2DD8L 3Q6GH 5T1KD 3SJVD 5CHNA 1OB1A 4YE4H 1INEL 2FH8A 5BXFB 1X9QA 4DZBB 5I16A 3ULUL 3C6LB 1CR9H 1QLFA 3UTTB 4HS8L 2ZKHH 3QFJA 5JA8B 4N1HB 4P46A 5C6TH 3O3BB 3SGDI 2O5YH 2VERN 1D5IL 5B8CB 1LO3L 2IQAA 4KMLB 5ERWB 3REWA 3VFRA 3PQYE 1DUZA 3HCVA 4GMTL 3VFGH 4YGVA 1W72A 2CUHA 4ZO6A 5IMMA 2ESVB 1A2YA 5T1KB 3SJVB 4BA8A 5DD5H 4I13B 4P5MA 3TCLB 5I71C 5D7LE 1YC7A 3NABH 1HSBA 1D5IH 1RZ8A 1I1AA 1DBKL 3GMMA 5C0BA 3UTOA 4EI6B 5FECA 1KJ2A 1U3HA 4JZOB 5E9DE 1QBML 1ZLSH 1AXTL 3TVMC 1A7PL 3UAJC 1VDGA 1AC6A 3RZCD 1AGDA 1KB5H 1YY8A 1RURH 1AGBA 3TIEB 3UZQA 4R4NC 1E6JL 3F65A 3B5HA 1WBYA 3LKPB 5IQ7H 5DWUL 1C5DA 4HXBL 1DBKH 4BQBA 1IKFL 2Q8BL 3SKNA 4ZXBD 5JMOC 2L7JA 4J3TA 2E27H 1QBMH 3GIVA 5ISZE 5CJOH 3SDCD 3QWQB 2QADD 2ENSA 4NQTA 4OCSH 3RZCB 1MQ8A 3VWJC 5LBSL 1WC7B 1JWSB 1IKFH 1AI1L 1J86A 4Z7VB 4MQ7A 1J9CT 3BEVB 3DURB 2VLJE 5HYJD 4IIQC 2MNUA 4NZTH 4KFZC 4MHHG 4ODUB 4ZXBB 5EU5B 3HLAA 4LP4A 5D93C 4KRPD 1JGVL 4NP4L 1T0MA 5IJKC 4JFEA 1IGFH 5I2IB 2VISA 4PRHA 4MDJB 3SDCB 4PGCB 2ARJB 4J4PC 1HNFA 2FCBA 5LBSH 1XR8A 2QADB 4O58L 5MENE 3TBSB 1A6TB 2DQDH 2E6QA 2H41A 4XAWH 2NY7H 2HVKA 1MLBA 2Q86A 3H9SE 3MA7B 3DUHA 5C3LD 4YHYC 5F7YC 1JGVH 5HYJB 5F8QC 3V95A 1FAKT 4JPVH 1N4XH 1HYSD 4KRPB 3PXJA 3L7FA 2E8YA 4QHNA 4L4VD 1G7MA 2JCCF 1KC5H 4G8FA 5H35A 2IPKA 2NTFB 3C9NB 3IXTA 1TQBC 1ADQH 3AU1A 5SWQB 1CN4A 2CRYA 2HTLD 2Q87A 1A1OB 1FGVL 1K4DA 3O6FC 4ZFOL 3LS5L 1R3JB 5IROC 2EXYC 4OGZA 5AG8A 4U7SA 4X7TB 3FB7B 4M5ZL 3ZKND 1WCBB 1W0WB 1YMHB 4QRSA 4L4VB 1TPXB 1ZANL 4YFLI 3LRSA 3DO7A 4PLNC 5E03A 1DVFD 1FJ1B 1VFAB 2VDKL 3TYGL 3I84A 3RBGA 2J8UF 4KPHH 5DGQA 3G08B 4ESKA 4M5ZH 2F53D 1VESA 3CVIH 2P5ED 4KTDH 3TWCL 3DGGB 4IRJD 5F9OL 4CMMA 4WI5A 1ZANH 4HKXA 4Z5RA 4DFIA 3OKNB 1I3RB 4Y7MA 2FIKB 1NH6A 2GJ6A 3VXTA 2H6PB 2CKBB 5I74B 3AXLA 1P9MC 1LNUB 4YIQA 1N8ZB 3EOAB 4R96A 5KG9B 5LJYH 2IEPA 1DVFB 1GZPA 5HDBE 1F4HA 4G5ZL 5IVXF 4ONGL 4PYHA 3QUMB 4WW1A 4HIHB 3LEYH 4NZUL 2F53B 1X5AA 4PTTA 3EIFA 3GHBL 1A3LH 3PV6B 2P5EB 4RBPK 4IRJB 3JWNC 3OKMB 1KCRH 3JSSA 1MHCB 4L1DA 4Z77A 1WVZA 4PJEF 1JRHI 2CIIB 3S5LA 1XGRA 2Y1VA 4NBYB 2D3VA 1I85C 3R8BB 5TH2A 3O3UN 3GHBH 2PR4L 1ZVSA 4IOIA 5FUZL 1KEGL 3VRIB 3U6RA 5EU4A 2Y7QB 2YMXL 4GG6B 5ICXA 5J13C 2EE6A 1JPGA 2EDJA 5LVEA 4AL8L 4AK1A 4JY6A 2CXGA 4XXCA 3S9DB 4DOHB 1R3IL 1WCQA 2FWOB 4OZFG 4LARL 3EO9L 1J1OH 1NGXA 12E8L 3RU8L 2VDQL 4AEFA 2A6KB 5GS1B 4Y8DC 3S96B 4JGJA 3QJHA 5KAQF 3SBWA 3QAZC 5FO7A 1SY6L 1H15B 1VFUA 1R3IH 1Q8MA 3HNSL 1VADB 2DQHL 1CIUA 1VFBB 2VJXA 1QR4A 1C12A 3SGEI 3MUGB 2NY6D 3FOLB 3WDIA 4OZFB 5E2JA 5DDHB 3HS0A 4N8VG 3HNTH 3R06B 3GSUB 4I5BB 1IBGH 4HFUL 5F8RC 2CIKB 2X5PA 2FJGA 4LSRL 2VLRE 4AG4L 4EN3C 1UWEH 1BLNB 1O7SA 2ZSWA 4KZDH 1X4YA 2ADGA 1H5BA 2Z31D 2IH3B 3BEWB 3I3BA 3WYRA 3ARQA 3CUPB 3MX0A 3BP7A 3PWVB 2G5RA 3BN3B 2NY6B 4FQPA 1YDPA 2XICA 2HFGH 2RAMA 3TNNB 4LIQL 3ZKXB 3MYJB 4PIRF 4K8RH 5FV2A 1RJCA 4N8VB 1J1PL 4N1EA 4L9LA 3MXVL 3LPGA 3TO2A 1ZT7A 4BFGA 3QHZH 2NY0D 2Z31B 1U42A 4ZNEE 3P30H 4XCFL 1EK3A 5CJQH 4QGTA 4OAWB 3LSOB 3DX7A 4HULB 1KELH 2YPKB 4P57B 4RMQA 1VPOL 3U7WH 4HUWB 4UDTA 3ALWA 3CH1A 1HHHB 4NRZA 3G6DL 1WT5C 1AXSB 4BFBD 4C56A 3F5WB 1DQJA 2QL1A 1FAIH 4NN5B 5E5RB 4M6OH 2NYYD 5IB1A 2WBKA 3GSNA 5F71A 3QB7C 4QRUA 3PWPE 1R24A 2SEBA 3A6CH 1FCGA 3MROA 3VFPB 2NY0B 2VYRE 1BHGA 5D4QA 1LO0H 2A9ML 4RZCA 1A1MB 2FR4B 1YJDL 3ZMRA 3VJ6A 3WFZA 2V2TB 3ZTNL 1S7SA 2BNUB 1JK8B 3QXDB 1UZ6F 4NNPL 5AWNL 5HHQB 1G7LB 2CGRL 2WQRA 5C0DB 2BSSB 3TVMA 2OI9C 2WQ8A 3WLWD 5FUOL 1QSZA 4XWOD 3BP4B 2B1HL 2AKRA 3QDAA 3TT1L 1C1EL 5FDWA 1MCPL 3DYOA 1C5CL 1YJDH 1UVQA 1FL5B 3L95A 2YUVA 4TUJA 4NNPH 1JNLH 3WIHA 1HILB 3FB8B 1JPFB 3FT4A 1BFOA 2WZPD 2UWEE 3BRGC 4LMQI 1LO2L 3AREA 4R7NA 3VWJA 1WSST 3L5HA 3FO9B 3SEPA 4IIQA 4L3EA 4K94C 5EDXA 2HFFA 4Y4FC 3BH8B 5FHBL 2JIXD 3BGAA 5FYJD 5IJKA 2H9GB 1KCVL 5T1DH 5I1AA 4JO2H 4J4PA 5T3XL 3O6MH 3P0VH 3BAEH 2HLFD 4LAQH 3H3KA 5IG7B 5JZ7C 3OHXA 3DECA 2NY1D 5EFIA 1DBAH 3LKOA 1BZ7B 5SX4H 4I3GA 2AK4E 4PRAA 1M7XA 5J11C 4M5YL 4U1KB 3ULVC 1DDHB 4HJGA 2MPAL 1X5XA 4DUVA 1KT2A 3GM0A 2MFNA 3OB0K 5T3XH 1IMHC 3BQUC 2JIXB 3ILQD 3VWKC 1DCLA 4YR6B 3MXWH 4X7DC 4JDZA 4KQ4L 1UKQA 4KI5D 5I9QB 4KVCH 4QRRA 3B2UD 4TQEH 1TVDA 2CDGB 3LV3A 1ZA3A 5J1SC 5IVZA 1QP1A 4CL7A 5EN2A 3O6FA 3EDFA 2NY1B 1EX0A 1L6XA 5D1XC 4GAGH 1IL1B 1MJJB 5IROA 2H3NA 3UPAA 3S37H 3WNLA 3B3IA 4IHOA 4LBEA 2WMPA 2C3VB 1CBVL 5DHYA 3FQUA 1T0NB 5SV3A 3DTXB 1RJLB 5BZDA 1A14H 2W0KA 5GRUL 1GVIA 1B9ZA 1LMKA 4LEOA 2YC1B 4ZQKB 2E7HA 1H3VA 1KJ3H 3ROLA 3LCYA 1EEYA 1XH3B 2RGSA 2C5DC 3P73B 1O5DT 2DQUL 2PO6C 1TMCB 4JREB 5IESL 1I9EA 2VXSL 2FX9L 4RWYH 1MWAL 1YPZA 4ZUUB 3DPBA 2NR6C 1HXYB 3HAEG 1DBJH 3W0WE 3FL7A 4JKMA 4GG8B 3QXAA 1Z3GH 4WV1B 2E9BA 3O11A 1B2WL 3FT2B 2IAMC 3BRFA 2NW2A 2Z4QA 3G6JB 4R6UA 4PP2A 1D9KC 4FQQA 4TSBH 4Y1AA 2G75B 2G2RA 1ROWA 1INQA 2OR9L 5T3XE 1P9MA 2J5LB 3LN5A 4Y5VB 3OL2A 4DN4H 3K1KC 2DDQH 3NCFB 2H32B 3RVXD 3C8DA 1AHWC 1JI1A 2IH1B 3N9GL 1CL7H 4M8QA 5DK0B 3HTLX 2DI7A 3LH2L 1CFTA 3O2DA 4HLZH 4LQ1A 2OR9H 4FN0A 3IDXH 5ESQB 4L3AA 4MD0B 5KANG 5F7MC 5L2KA 4OGAC 5FK9B 1PAMA 1I85A 2C3HA 3L1OL 3BYYA 4XVUD 4DCQB 1IRAY 5F9JA 4QY8A 5CD3B 2D9QB 4LSVL 5TF0A 1BBJB 4NM4L 3LAFA 1F3DH 2FSEA 4EUPH 5HJ3A 2APFA 4OZIF 3T4AB 3S37X 4XVTH 3ARFD 4XAKD 3HUJE 5FO8A 4TSAL 1IM9D 1P7QA 3I6GA 5T5FL 3PP3H 3B9EA 1P5VA 5ESVB 4MHHI 4N0YH 3HB3C 4MJ2A 4YAQB 2WV3A 2WP3T 4PJ8C 5F7EL 5EU3B 2VITB 2VQ1B 1ORQB 2FX8H 1CFVH 1FP5A 4TULL 3FQTA 3HZMA 1R3HB 4M61B 1YNTA 3BWUC 3S35L 1U8OB 5DD1H 4GKOA 3MV7E 4QTHA 1CXKA 5T5FH 3ARFB 1UCBL 3RWEA 1HHGA 1H3UA 1YQVL 1IM9B 1RQ5A 3S6CA 4L4TD 3OJVC 1G7JA 1FNGA 1K4CA 1PLGH 5DRZB 3RA7H 4FRWA 1PGRB 5ICZB 4TULH 3HRZA 1FO0B 1U8MB 4B7IA 3BP6B 3KPLA 4DUXA 1I75A 5DGRA 2I5YH 4PJIB 3WNPA 1XMWA 2DTMH 4PJ5A 2IWGA 4IJ3B 3ARSA 3VW3L 2A77L 2J12B 1YQVH 3ILPB 4EN3A 4YO0A 3E1F1 1BQLH 4M6NH 4QWWC 1DBBH 4L4TB 3U0WL 2IANE 1I3GH 2VMFA 4E0RA 3WIIH 4X80H 3U83A 3O3EB 4KDWA 4GW5B 1H3WM 1MUJA 2XZQH 2X89A 3DXAA 4GUPB 3UTSA 4R4BA 4ZFFA 4JFYB 3OKOB 1U91B 3QEHA 1PX3A 1I9RH 4F7TB 4KK5C 4M4RA 2X4OA 4P2QD 3WV0A 5KVEL 2ICES 3IDIA 5DO2D 3W9DA 3QUML 2NW3A 1F00I 4FQXD 5JXEC 3C5SA 4GRLD 4RGMB 1AD9B 2ENYA 5EUKB 1E0OB 5T3ZH 1RZFL 2L7UA 1D6VL 2FECI 3QNZB 4DJMA 3EJZC 5H2BB 4AENB 1QHPA 1LP9B 1Q9KB 1JN6A 4KJYB 2FD6L 4MLIA 5FYKL 4RFNC 1WT5A 2LAAA 3PIQA 4RCAA 3MCLL 3FRPA 4Y89A 2WWMC 4Z7WE 1L7IH 4Y19E 3FQRA 4D0BA 2FDBP 3U2SA 1BD2D 4P2QB 5FF6B 4G43A 5DSCA 5J1AB 4FQXB 4LPWA 1RZIB 5E2UL 4GRLB 2XTJD 3QR2A 2FD6H 2XKUA 3MV9A 2EH8L 3U9UA 4IMKC 4TVPH 2F8VA 4RX4A 3FOMA 4OFIA 3HI1B 3RWFA 4X98B 1W0VA 5K9OA 1T6WA 4OKDA 5FA4B 1F2QA 1UWXH 3RL1B 1ZLUH 1BREA 3WFCL 2YWZA 2OYPA 5KVFH 1EHLL 3VRJA 5SX5K 2JJUA 1BD2B 1IQDA 3BDXA 1U8KA 3IXAB 2IG2L 1CK0H 5T1MA 3L3IB 2IPTL 1NFDE 4O2CB 4EBQH 5DRNA 1BZQK 2PCPA 2XTJB 4XMPH 5EUOE 1DLFL 2IALA 4CW1A 4OZHA 1KIRA 2EYRA 1SMAA 1AR1C 4JM2F 5AUMB 2B4CL 3WFCH 4PJGA 2FEEI 5IR1B 3EUUA 1I7ZB 4UQ2A 1ZHKB 5KVGL 4C4KO 1FNEA 1U3YA 2W1NA 3Q5OA 2P8MB 2Q8AL 4M1DL 1NMCB 5I1GH 2FZ3B 4LVOC 3QWRA 2VN7A 4Q9BA 1ZWIB 2BVQA 1SYSB 4Y4FA 4TN9A 4R2GC 1YEEL 2XQYK 5C0JA 3CCHB 3SKOB 4NPYB 3O45A 3Q1SL 1CGYA 2X4QA 3GJFA 1OAQH 4QXTB 2VAAB 4TVPE 2YXMA 1ONQB 4JHWL 3TYFA 1J0JA 4DW2L 1IC7L 2AP2A 2R56L 5FM8A 2Q8AH 5D2LA 1NAML 3IB4A 3FO1B 1JJUA 5GIRB 3BD3A 2X4PB 1JHTB 3BPNB 3OPZL 3GO1L 5E8EA 1F5WA 4HH9A 4P4KD 1QPXA 1Z0MA 4H0GA 4M1GL 4MAYD 5C9JB 4J7RA 1YMMD 1KV3A 1DBML 2X40A 3BQUA 4N8PA 1CD8A 3VWKA 2D31A 2YKLL 2DI9A 3LZFH 4FFVC 1IC7H 4KUZL 2R56H 2BVOA 3PDDA 3JVGC 4JN2B 1X5HA 1XT5A 1PQZA 5EO9A 3SDXA 4GKNB 2R1YA 3BGMA 1RY7B 4UV4H 5I8CA 1A02N 5D1XA 1MFBL 3NPSC 3RWDB 2YD5A 4P4KB 3MRFB 5E94B 3DBXA 5HYQB 3H0TA 2OZ4A 3DGCR 5C09E 4MAYB 4QHKJ 5I1KL 1YMMB 2ZUQC 1H3PH 3GSRB 3KPRD 1DE4B 1R6VA 4MA8H 4MA3B 5GXBB 4YHZL 2PO6A 4AT6B 3MJ6A 5CSZA 4HC1L 1EFXD 5J6GB 1QFPA 1XF4A 1EEUA 3UTQA 1YEIL 5J12B 4PG9A 3U0TB 4HZLB 2IADA 3CDFA 4KVNL 1F90L 3IJHB 3UTZA 3V9FA 1OVZA 3L3JB 2GT9A 2IAMA 4XT1C 4XP6H 4YBHA 2P43B 3O4OB 4M7LL 2JE8A 4RMVA 2LV4A 1GGIH 1D9KA 5HD8C 3QZWG 2HVJA 5FA3B 4GRMB 3KPRB 5D72L 4L8DB 1CT8B 1EVUA 1R3KA 1NCBL 2QV2A 2LQRA 2HT2C 4OUUB 5HGAB 1T3FA 4YXLH 1HH6B 4BK4A 4M93B 1SYVA 4X6DA 4XB7A 2VXUH 2OTPA 5L8KB 1EFXB 1RPQA 1AHWA 1ORSB 4M7LH 4U1SA 5BZWB 4JRWA 1UCTA 1D5BA 1BAFL 5BMFH 1B0RA 4J3WA 4ZSOB 1MEXL 2UYLB 2C1PB 3OG6B 3VH8G 1MCKA 4YDKH 5E2TH 4FABH 5JNYB 2PXYD 1CI5A 1M05A 1N7ML 4M4PA 2JELH 3RNQB 4IDJH 4H5SA 3EFFB 2BHYA 3QZWB 4ELKA 1GSMA 4EOWH 2FL5A 4KQ3H 1JI2A 4Y16C 2HJLA 4MCZB 1TJIL 1OAYH 4NUGL 1Z9OA 3OGCA 3ALPA 4PRDA 1DEDA 3HC4H 2XOTA 3PQYA 4OI7A 2PXYB 2OS7A 4QEGA 1RIUH 4MJID 2D03L 4KKNA 3VXNB 1IEAB 4JKKA 3VH8B 1EGJA 5TF1H 5KS9B 1IM3B 4YDLC 4UDUA 5D7LA 1QA9B 3QUYD 4PJ8A 2WLZA 3IFPB 5CIPB 4M7ZB 5FYJL 5TFSL 3NFSH 3G9AB 5FDYA 5M94B 5DI8B 3U36A 3MRIB 4PY7B 4ODSL 3M1BA 5A2JH 2XWTA 1DQML 3WIFA 4MJIB 4M48H 4K8RC 3FCTA 1L0XA 2EYSA 1CYGA 4LLYA 3PJSB 3IFNL 1R5VB 4YHOL 3S88L 2KZ1B 4NQXB 2ZG3A 3JUZA 3QUYB 5GZOD 4WHTA 5IGXL 4G8EB 5EBLA 4YGAB 5T1LA 1ZVYA 4KHTH 1XF2B 5K59F 5ISZA 5CILH 3WS6C 4I8DA 1OAUL 4XP4H 1IFHL 1WTLA 3GKWH 5HHXH 1HEZA 3VXMD 5CJ5A 5DVMA 4X7EC 5C70A 3KLAB 5IV2B 1NAKL 1JZ5A 3MRBB 4P5TC 4JPWH 4GLRI 4BFEA 2YD3A 4D9LH 1GJIA 3QO1B 1RIVL 2ADFL 2VLJA 3CFJA 3GMQA 4YJZL 2P8PA 1N5AB 2YXFA 3B9VA 3NA4A 2DN7A 5J8OA 5JLZA 1LE9A 3P4OA 1QLRA 3DROA 3ZYOA 4HV8B 1L9NA 2Z8SA 3GBML 3NIGF 4Q0XH 3ZKQD 1T5WA 3VXMB 4Y5YC 3OB8A 2HYMA 5MENA 5DR5L 3L3KA 1U95A 1G6RH 2VLKD 3H9SA 5JXEA 2R2HB 3VFVA 3O3AB 3OJ2C 1KB5A 1YECH 4YQXH 1KLUB 3CFBB 2DM2A 3VFOA 2CMRH 2YN3A 3O3DB 4G9FD 4O2FA 3L3OB 2AABH 3QP3A 1T1YA 1QBAA 1YJDC 2HKHH 3M8OL 3PNWB 1P6AB 2APWA 1VEOA 4BM7A 3CLEL 4G80A 4PJHB 3ZE1E 5LAXB 2V2WB 4YXKH 3UJIL 2RJMA 3IGAA 1B6DA 1JWUB 2UUDK 1XFPA 2VLKB 5C2BH 3B6SA 4OLYH 3H9ZA 1L4IA 5AZEH 1FFRA 3FFCD 4IMKA 5DD6A 4G9FB 4DVRH 4XX1G 5KANI 2WUCL 1DSFL 4H25B 3KR3L 3TBYA 1UQSB 3CX2A 4P5KB 3NCCB 5ID1A 4J2XA 3NH7L 1HHKA 3ZE0F 5FGBC 2VNCA 3MJ7B 4IDLA 1REIA 5E6ID 3ZSSA 3ZHLA 5GS0D 3OAUL 1RAMA 1A64A 2XQBL 3VI3E 5I1JL 5JPMA 4XPGH 1CICC 3LRHA 1YZZA 3GFUA 4LL9A 1UB6A 5ELIA 3FFCB 4YHML 4S1QL 2AGJL 5J3HD 2NLJA 1MHEB 1P1ZB 4KY1L 1XGTA 2W59A 4U1LB 3OAUH 1FFPA 2C7UA 1ZGLB 2D7QA 4ETQB 3OXSB 1KJVA 1KG0A 3GNMH 1MFAH 4P3CL 5E6IB 1ADQA 1DUYB 3VGDA 5MHSE 1OAXL 4FQ2H 1KTLB 4OFVA 3EW3B 2AGJH 5C07D 2XN9D 4HEPG 4LSUH 5DMYA 1NKRA 3X3FL 5C3TA 2IGFL 1Q94A 4RFEA 1GAFL 1JWMB 4Q6YA 3V7AG 2XA3A 1YNKH 2ZWLT 5HI4D 5E2VH 1EBAA 4I0KA 1K5NB 1FPTL 3NFPB 1OAXH 3SGDH 2XA8L 4L8BB 1R5WA 2Z8RA 2GUOB 3DMMD 4X9FA 1AQKH 4ZFOA 4NC1E 1PG7H 4G7VL 2FYYA 2EXWC 2IGFH 5C07B 2XN9B 1OTUD 1GAFH 2QQLL 5C08E 1QG3A 3TFKC 4XNMB 5L88L 3ARPA 3CZFB 3JVGA 1T03L 4M9PA 5ACMA 1SJEA 5I30L 1NFIA 1ZK9A 3MLSH 1NSNH 4IRSC 5F6HI 3KS0J 3O9WD 1QSFD 3CSYA 2VAJA 1X44A 3DMMB 2AEPL 3N06B 5HTSA 4QTIL 4U1HA 3QQ3A 4P59H 1KPVB 4JM4L 5TE6L 1EDQA 2BVPB 4KKAD 2A6JB 4WHYH 3IKCA 1WBXB 3VI4E 1YA5A 1KULA 3D3VE 3N1PC 1HN1A 1QBLL 1FZMA 5IJVA 4X6FB 1GGCL 5A16A 1GIGL 2A6DB 5IVNA 4FXGB 1T80A 2E7LC 2AEPH 2FHFA 3O9WB 1QSFB 5EH1A 2G5BA 4LLVB 4U3HA 1JZ3A 5TE6H 3TT3L 3BOVA 5F9DC 4ZS6D 4NQCA 5JR1L 1U58B 1CF8L 4N90D 1XGQB 4JN1H 4JM2D 4NO2B 2DYPA 1KBGL 2VC2L 3OJDA 5HDOA 5I15L 5ITBL 2VLRA 3BZEB 5I1CL 4OSUH 3GRWL 4FQIH 2Q7NA 3PGCA 1CD9B 2B1AL 5JR1H 2HJFB 1LEIA 4YEFA 3DVNB 4P48A 1AO7D 1YEJL 1ZHLB 5A3IC 1KBGH 2KQMA 2QQNH 4PV9B 2X1PA 1MCWM 1U8HA 4NZJA 2XWBB 1CLZL 2V2XA 4IMLB 3OGOE 3PGDB 4JM2B 4RGNE 5JORB 2ERJC 1PG7X 4PBXA 2O5XL 5EPMB 3UZEA 1F3RB 2V7NB 4JFZH 4OGXL 4AEIH 1A7OH 2ZUYA 4U3XA 4UUJA 4U1JB 4XNYH 5EOCJ 5DJXA 2ZSVA 4ZOBA 4ZPTB 1S3KL 4ODWA 4ZNEA 1I1FB 3V6ZA 1QVOA 4LLMB 4MQSB 2R4RH 2F5BL 1AO7B 3T8XB 3U30C 1JVKA 1MHPH 5HGDA 4Y16A 2ADIA 1F13A 1RU9L 4UQ3A 3GB7B 1URLA 4DKEH 5DQ9B 2BFVL 3S4SA 2DWDA 2XV6B 43CAA 2GFBB 4CADA 4CVZB 3D69A 5MEQA 3GI9L 1BOYA 2H2PD 5CEXB 4PJEE 5I66A 5FYLD 2XNAA 3PWPA 2X05A 1G0DA 2VTFA 5B38A 5LGJB 3ET9F 5L2JA 3NZHH 4XC1H 5DJZA 3PG2A 2BFVH 1MCBA 2I07A 4H20H 4JRXE 1QLFB 4P99A 4BQCA 2BDNH 5GGSY 3GBLA 1QEWA 1V3LA 1U3HD 1DL7L 3LEVH 3REWB 4DGIH 1DUZB 2HN7A 1V7NH 4N0UB 4YGVB 1W72B 3GKZA 4MXWL 5IMMB 2NQCA 1YPZF 1A2YB 2P8LB 4ZODA 1BJ1H 2P24A 3X17A 5EORL 1RZ8B 3WS6A 3PE9A 2K1MA 4JFXB 3GMMB 3P4MB 1OW0C 1NC4A 1NGYA 3D2UA 4JO1L 2C4FU 1U92A 1S9XA 2UWEA 3RL2B 4LCWE 1U3HB 4OIIL 4P5TA 1AGDB 1YY8B 4OZ4B 3BPLC 2OXHA 3ZYIA 3VXQA 3T0BA 3MRDB 4XHJD 2E6PA 2I9LB 5FKAA 4DGVL 1JRHH 3SKNB 5F88A 1T2QL 2I60L 1KCLA 4JFED 3S8WA 3GIVB 2DWEB 4PRHD 5J89A 1BVZA 3TA3D 5DD3H 1BMGA 3FONB 1GC1L 4Y5YA 2NY4C 1X4ZA 1A4KA 4K3JL 4KZEL 4HK0B 3STZA 3E6HA 2AK4A 4OCYL 5IMLA 4HF5L 1ES0B 1EO7A 5HPMB 3I75A 1G7PA 5LGHL 1MFCL 4GAJH 4OQTH 1OGTA 1QNZH 4GKSA 3HZKA 1GGBH 2APBA 35C8H 1M7DA 1NMBL 3I2CH 1T0MB 1U8QB 2AJVL 4JFEB 1NCDL 3MV01 4PRHB 1RFDL 1QYGL 2XPGA 3TA3B 4Z7OE 2Y5TB 1XF3B 2E9JA 4HIXL 3C2AL 2IC2A 1ZOXA 3RWJA 4IM8A 1JPSH 4HT1H 4U1IB 5JMRA 2Q86B 3GI8H 2OBGA 3IJYA 4XPTL 2R0LH 3MCKB 2R9HC 3D9AL 1QYGH 1NJ9A 5HHME 3SGEH 3SDAC 2VZVA 2DQCH 3L3HA 4Z7NE 3ARWA 4U05A 1W0YT 5H35B 2IPKB 5FHAL 2WWKT 1D5MA 3IXTB 3UZVB 5FGBA 4CN1A 1KLGB 1P4IL 3AU1B 1MCSA 3MMEB 5J06A 5F70A 1CICA 3LQMA 4P4RA 3W0WA 3AB0C 5F3HA 5ACZA 4Q58C 3D9AH 2ZG1A 3VXRD 1GOFA 4CGTA 1I4FA 4MJ5A 4OLWL 2PETA 1TCRB 1RHHA 3JV6A 1DEEA 1TZHA 1QRND 5E0QA 1TJGH 1ZE3C 3V4VL 3LRSB 2IJ0C 3MO1A 3QPXH 1WBZA 3QDJE 3MLVH 4OLXL 3CDCA 1HI6A 5KVDH 4K9EL 2GJZB 1RUQL 3D0VA 4JJHA 4KXZI 3MBEC 1XCTB 2BOBA 2WSKA 3IS1X 1KYOJ 4PP1C 4GAFB 3VXRB 4OTXH 3R8QA 4Z5RB 5GZNC 3V4VH 2I24N 2MQCA 4C54A 3VRLF 2L0DA 4NUJB 5DRWA 3S5LG 5IB2A 1QRNB 4V1DE 4XNUH 3WFHB 4ELME 3U7YH 1N6QL 3ZYZA 3SHSA 4UU9B 3IJSA 1JGLL 4RDQG 3RVUD 5DLMH 1VENA 2D7PA 5E8PA 5D7IB 3CFIC 2NXZC 4I77H 1T7VA 3RKDD 5CZKA 2ZUVA 4PTTB 3D39D 3G5ZB 1HIML 1DZBA 1NGQH 1HKLH 3MUZ1 1KIQA 2QSCH 4MNGE 3DHJA 2HT4C 4KDTC 3MNVB 5DUBB 3HUJA 4JE4B 2OJZL 2Q3ZA 4GQPH 4PJ7E 2NNAB 1TZGL 4IRSA 4P0DA 3S5LB 4RGOH 4L8SB 4UTAL 1QUNA 4HH8A 1DQDL 4AMKH 1HIMH 1QFWL 1ZVSB 3K2MC 4HFWA 1EJOL 3TBWA 3U6RB 4KH2A 4FZEL 3D39B 5JQ6L 4HGMA 4WY7H 4XNZB 4BH7A 2EKJA 2FGWL 4HHAA 3I85A 2ICWA 3LN9A 2BJMH 4JY6B 3RRQA 2E7LA 4JR9L 4RQQB 3KPSE 1T20A 2EZ0C 3NA9L 1IEBA 2E6JA 3EOBA 1D3CA 1PYWA 3QJFA 4FZEH 5IBLD 1SJHA 4AEHH 1A3RL 4X5WB 3BXNB 3AROA 1A8JH 2GITB 2XKNA 3SKUD 2C3WA 2VLME 3QJHB 4OZHF 5E4EB 2A2QT 4Q9RL 1BEYL 5IMOA 3QQ9D 5CBAA 4PJGF 3DSNA 3CVHL 5FO7B 4EUPA 4K55A 4NQSA 2IANA 2FEDD 3QRFM 4WEBH 5DUPL 3W2DH 4Q6IA 5IQ9B 3KYNA 5TJWK 2DI8A 4MNQE 4D0CA 2AXFB 4BUHA 4LASH 4NKDA 1F6LL 3HS0B 1SM3L 1TETL 4NYLB 1G7HA 4Y4KC 5ALCH 1GYAA 4MS8C 1ULVA 4QHLB 4RMRA 2YD9A 2QQKH 3BGFC 3LHPL 2ZSWB 4YHIA 2ZOKA 4X6CE 3QQNA 5D2LF 5IF0A 3W5MA 3VDAA 1I8IA 4M7JH 5HY9B 2HRPL 1NGWB 3MV8E 3BP7B 4MNHB 4PJFE 4JB9L 2AQ1A 3ULVF 3SDDC 4ERSH 5F6IB 2OMNA 1G7QA 4X4XA 2ZCKL 1UADC 3ESUF 4LMQE 3LHPH 4Q9QL 1S7RA 4Y19A 2J6EH 4L9LB 4WTZG 1JGDA 3DV4A 4DVBA 3RVVC 1M71B 1MCIA 3TO2B 5F3BA 1ZT7B 4JO4H 2B7DT 3SDXF 4ORZC 5I1LB 2EO1A 3MOAL 5F7NC 4HKBB 2WBJD 5CEZD 2KQNA 3DX7B 4WUKL 5ALBL 4PJAE 1A7RH 3OKKB 2ZCKH 2VDNH 4NSKB 1KN4L 4JFDE 2V5MA 3FJTA 4KKBC 3CH1B 5CEYA 5FAAA 3GSVA 2O5ZL 1DQJB 4FFWD 3TVMD 3WXVH 5JW3L 1G7IA 1GHFL 2BCKB 5EWIH 3D25A 1AC0A 5DJAB 4R4ND 4EDWH 2Q76A 1WFUA 1NFDA 1R24B 5ALBH 2SEBB 3MA9H 3F12B 1MIMH 2GSIA 1FVDA 1HSAB 5EUOA 3RFZC 1ACZA 1OP3K 2XRAL 3NGBB 3R1GL 4RZCB 2WBJB 4K2UL 5INDB 5J0BA 4I1NB 2EDTA 1ZTXL 3UTTE 5A2KH 3VJ6B 4GW4B 1Q1JL 1OW0A 1FZOA 4HWZA 4LGRB 3FZUC 1VFOA 4UBDC 3TVMB 3ZT5A 3GSOB 4W6WB 4OLZL 4OIAA 3ARED 4HUMB 1YEDB 2JB5H 2OL3B 5D71H 4X6DF 1VA9A 5FDWB 3PHSA 3FN9A 4L3ED 5M95B 4XRCA 2ADJA 5DS8B 1MJ8L 3SJVE 4ODVH 1OOAA 2IQ9H 4U6VH 1FLRL 1F4YL 3KAAA 4XNXL 1XZ0B 3EO1B 1KB9J 1U9KA 3WNNA 3IF1A 2YEZA 3NN8B 5E8OB 4S2SA 1TQCB 2YD4A 3QBTB 4YHNB 4OLZH 2YRLA 4J4PD 2RCSL 3PGFL 4LRNL 2DQIL 1GGUA 1CG9B 1T04A 3FT4B 4YH6A 4TOYH 1WWCA 5E1AA 4NZDA 3U1SH 3ORJA 3WJLC 3AREB 4R7NB 4FXKA 3H3PL 3AS0A 1MJ8H 3VXUE 5BW7C 4NC1C 2QBWA 4OQ1A 3WD5L 4L3EB 1RVFL 3IS0X 3W5NA 2HFFB 3BT2L 5F7HA 1OPGL 1QFUH 1JE6A 3K0WA 2B39A 1IGYB 2RCSH 3PGFH 4LRNH 2VSCA 4ODXA 2ZNWA 3RKPA 1X5IA 4ZD3L 5GGTH 3T0AA 4QRRD 1PFCA 4JCLA 5ETUB 4MD4A 1YEHH 4AQ1B 5DVKA 4C83A 5DC4B 3IRZA 1RVFH 1S7VB 1A7BA 5EFIB 2PW2B 3LKOB 1Z2KA 1HHIB 3QCVH 4KUCF 4ZO7A 2EXYD 4PRAB 4Z7VE 5C09A 7FABL 5GISH 4JDTL 4HJGB 3TV3H 5EZLA 1KT2B 5HYEA 3CXDL 4PBVC 1T89C 3SDAA 1UB5A 4PJXB 1F3JA 1OSPL 3BD5A 4HIEB 2BZDA 4CNIB 3BKYH 5ADPL 3U9PH 4G8EA 3U7AA 4YHLL 4QRRB 2X70A 1TQBB 1NEZA 4ZS7H 4KTEH 3IDYC 3O2WL 3LV3B 5IVZB 2BP3A 3CDGA 5T5NF 4JDTH 3MLWL 4ISVA 1TJHL 5GRWA 1OQOA 5HYJE 2WNGA 3LEXA 4IHOB 1AGCA 2CKBH 1J88A 5C0GA 5DHYB 1F6AB 3FQUB 4NNXA 3MBXL 3MJ9H 3MLRL 5GRJH 1CFBA 5BZDB 3MRGA 1RUPH 4Y1AD 1NGZA 2FO4B 1MFEL 1PY4A 1OGAD 1W72L 4JHAL 3ROLB 1BGXL 4NIKB 3MLWH 4U6YB 1S9VA 5I8OL 3DUUB 4PGEB 1LO5B 1MI5E 1YPZB 3MBEA 4WU7A 5KVMC 3TN0C 3MBXH 3HN3A 4RGNC 5J9PA 2HKFH 4S0SD 2R2BB 2X9YA 3ZSTA 2NW2B 1KJ2L 2Z4QB 2R29H 1K9TA 1NCWL 4PP2B 4FQQB 3GBNL 4I3RH 5ICYA 4Y1AB 1OP5H 4LCYA 2G2RB 4LCIL 1OGAB 5L2KD 3RI5F 3LN5B 4YDIH 5EU7E 3UROR 2WP3O 1RK1B 1H3TA 5EBGA 2OK0H 3GJFK 1S5IL 3VMPA 3QG6B 1F58H 4XCCH 3UX9B 3GIZH 1DN0A 2H1PL 1CFTB 1NCWH 2IBZX 5BO1H 5D7SH 1ZKAA 5E8DL 2QHRL 2VXVH 1LK2A 4KDTA 4XPHL 3TPUA 4ONHB 1OY3B 3BO8A 4U6TA 3H42L 3V4UH 5L2KB 4GSDL 4LSDA 1F4AA 5HSFA 2GTWA 1Z0NA 1I3VA 3P4NB 4QT5B 4ZYKA 4ZPVB 2H1PH 5HYSA 5F9JB 4QY8B 3ZL4H 4GRWH 3DETD 2BRRH 1IGIL 2QHRH 1YEFL 5GHWL 2F53E 2Y6SC 3BSZL 1PZ5A 2P5EE 4NQVA 4JKWA 2F15A 5HJ3B 3WO4B 2N4IA 3C08L 2J2ZA 5J13B 2A1WL 4F7MB 1ZLWH 5L7XL 1BFSA 2F19L 4Z0XB 3PUCA 2LU4A 3IKKA 5FO8B 4XPFH 4W81A 1FORH 5TDPA 2V17L 2CK0H 5L9DL 5CGYC 4OZFH 5GHWH 3BSZH 4LSTH 5L6YL 4PFEA 1JTOA 3FQTB 5ITFB 4GG6E 4UT9H 5JIKA 4PJ5D 2K3TA 1A6VH 1Z5LB 4DK3A 3KXFD 5AAWA 3ZE2E 2COQA 1FL6A 3RWEB 2DJ4A 1PKOA 4R7DA 3G5YA 1YNLL 3VDBA 1MLCB 1G7JB 4DOHE 5I1HL 5HDBF 5L6YH 3NCJL 1MCNA 2G9HB 3VGEA 1D5ZA 3HRZB 3IRPX 1D6EA 1CE6A 1P4LB 3BN9D 5A2FA 1DQLH 4X5XA 1J1XH 1OSZA 3V52L 5EBMB 4Y4KA 4PJ5B 1ZS8A 2BK8A 4FP8L 4GRWE 4KWUA 2ZCHL 5GRVK 5IB4A 5TE4H 1N0LA 2W9DL 3NIDE 2CJUH 5I1HH 3KXFB 3TLRA 5KTEH 3SDYL 2I25N 2AV1A 3MRJA 4E0RB 1MPAH 1P7KB 1SHMA 2YUZA 3I50L 3BPCA 4TRPL 4OT1H 4EVNA 3SDDA 3VCLA 1RZKH 4P9HL 4HJ0D 1MUJB 5DQDL 3S3PA 3EOYG 3VD5A 3WUWG 1WFTA 4MJ6A 5EZIL 4M3JA 2DIBA 4HIJA 4R4BB 1CQYA 3MUJA 4GBXD 1X5ZA 5BJTB 3QEHB 1UACH 4YPGA 5H94B 3IDIB 4TRPH 3W9DB 1NLDL 2NW3B 1TZIA 1MVUA 3I02B 3WKMH 1KNOB 5TPWH 4OJFH 1FG2A 1CLYH 4OZGE 1Y18A 3IDMB 4RX4D 4EJ1C 1JN6B 1UKTA 3AVEA 1JFQL 5EO1B 3OR7B 2GYSA 4LQFH 3INUH 1QHOA 3HE6C 3QG7L 5E8NA 5JW5A 5ANMB 4GBXB 4M03A 3WUWB 4HPOH 2NY3C 4HSQA 1QACA 2W9LA 1TCMA 5DSCB 1A6ZB 3CNKA 3M45A 3NACL 1I7UA 1G6RA 2IBZY 2AJSH 4NKIL 3QIUC 3RWFB 1VACA 2LFGA 4RISH 3RAJL 5GGSA 3E2HC 1KYOK 3MRKB 2EE3A 2OI9B 5JOPD 4LVNB 4BQ8A 2ICWJ 5ILTL 1GL4B 3NACH 5GJSH 1IQDB 3T09A 1FV1A 1VERA 5J56B 4S1RL 2DLIA 3L5WB 3ABZA 5DRNB 4U0RC 4UT7L 1S7XA 3DYPA 4XBPB 5TDOB 2IALB 1KIRB 5KSBB 3HC3L 1HQRB 1IAII 4XP9L 4DAGL 2YD6A 3D1MC 2FRGP 4G9DA 4JFHD 4PB9H 5ILTH 3KNBB 5LQBL 1JHKL 5JZ7D 3ARDC 4ENED 4S1RH 3BE1L 1F3DJ 3WJLA 1AKJA 2PTTB 1IAKB 5INCA 3T2OA 5BW7A 4UT7H 3SCMC 3J7HA 3ULVD 4HAGA 2HFEA 1JNJA 5BQ7B 5C08A 1AY1L 2YZ1A 4M9OA 5C0JB 2W92A 1BQUA 3MOBH 5CWSA 3RI5K 3VWKD 3O45B 2F74A 2X4QB 4QRPA 1CU4L 4PBWD 2R15A 4LPYA 4OD2A 4PS4H 3FFDA 2YZ8A 3G04A 3RY6C 4HDIB 4OV5B 4JQVC 1B88A 4I48A 2DICA 4UTBL 1NBVL 5IW1A 3WLBA 5DFTA 4QXUL 1AIFB 2KUTA 4L8CB 4UIMA 3CFEB 5E8EB 3GHEL 4HH9B 4MD5A 4ZUSB 1A7NH 1A5FH 3OKEA 3F58H 2DB8A 4R97B 5GGQL 4KJQC 4Z0BL 4YUEH 4KKCD 1T89A 2MKWA 5AEAA 5MI0C 3D3VA 3VWKB 2D31B 1WWAX 2DOCA 3DJ9A 2BVOB 2BY1A 4FQCL 4QXWA 1JF1A 1U8JB 4XWGL 3MACH 3PP4L 5EO9B 2VIRA 3EO0A 3GHEH 5DZNA 2JB6A 1N59A 2ZJSL 3MREA 3CH8A 4YLQT 1P6FA 5JXAH 2CDFB 2NXYC 4Z0BH 2P42B 2MCPH 5E7BA 2EDKA 4RNRA 1RMFL 4GLRH 2K7QA 1XR9A 3DRTA 3DIFA 1T2XA 4XGZA 5GPRA 4HPYH 2A0LD 2W0PA 5E08H 1FFOB 1UA6L 3GSNL 3UXFA 3QEQD 2VDML 1F4WL 2UWEF 2H32H 1B0GA 1KFAH 1LD9B 2AJUH 5DVNA 1TVBA 5LCVL 3ULSA 2X4NA 1MCLA 3OF6A 4QRTA 3CDYA 3TN0A 1AQDA 3MLZL 4PG9B 3HAEH 5C0IA 1I9JL 3BKML 2EIZA 4U2ZA 4FFZH 3UTZB 3JBG7 2EE9A 4M8VA 1UA6H 25C8L 2X4TA 2DM7A 1IT9L 3IU4L 3PABB 3N85L 3RGVC 3H7BB 1J0IA 1FG9C 3GMLA 3EAKA 3OQ3B 3QEQB 4KI5E 2R0WH 3IAQA 1A9EA 1T3FB 3F7RA 1T7YA 1N2RA 3MLZH 4TUKH 4MMZC 1AHWB 1WQVT 3IFOA 1M7IA 2AV7A 2NZ9C 4U1SB 1CGUA 1IT9H 3IU4H 4ONFL 5C0FA 3RJQB 4M43H 1NCUA 2YOCA 3MLTA 3G6JE 4PJEA 4J8RA 4WDIB 5HI3C 3PQYD 5GJTL 4NO0D 1I9IL 2H8PA 2W0FA 2E8ZA 1L0QA 5DD0L 3STLA 5HI5C 5IMKA 5AAMA 3CSPA 1HQ4B 3HB3D 4HG4J 2BOCA 5C0CA 1J8HE 4PJ8D 3T0XA 4ONFH 4JRXA 2NCMA 1FDLL 3CFCL 3TBVA 5DVLA 3I9GL 2HJLB 4AY0A 5BV7L 2H2SC 2DIJA 5GJTH 4FNLL 4XP1L 4PRDB 5DMJB 5E9DD 5KN5A 1KTDA 1NCCH 1RUMH 4DGYL 4O2EA 1CGSH 3N1MC 3PQYB 4NO0B 2XZCL 1WZ1L 1J87A 3EDKA 4UNVA 3MCG1 1W2KT 3CFCH 3WMSA 3SKJH 4LU5L 3I9GH 5MEOB 4I3SH 1FL3B 4PJ8B 5BV7H 4JFPA 2FNBA 3C6LC 4HWNA 4PLKC 3H2WA 2A83A 2BVTA 5C71A 5T1LD 4WRLA 4XBGA 5ISZD 4DGYH 5EOTB 2Y36H 4LCWA 5E9DB 2NX5E 1I8LC 3RWGA 3M1BB 1KPRA 1F8TL 3V0VA 4QWWD 1KB9K 3HZVB 3MRNB 1XCQA 3LKSA 4GH7B 4GS7B 5EIIB 1ND0A 2VLJD 3BKJL 2EYSB 4LLYB 1UJTA 1V7MH 4JY5H 3C60D 2OQJB 4PJXA 3ULUD 2XWJA 3ECBB 4D3CL 5FCUL 4O02L 3JV4A 2CK2A 4K7PL 3QO0B 3VGGA 5F7UA 3L3GB 5T1LB 3I6LD 1BQHG 5ISZB 3RBSA 3GMNB 4LDOB 2C3GA 2UY7A 1HH9A 1HEZB 4H88H 5AZ2L 5B39A 1NPUA 4KK5D 2VH5H 3BKJH 1JNHA 5DT1H 5GGUB 1UM5L 3MJ8B 4GXVH 2W07A 1RHFA 1QQDA 4AIZA 2VLJB 3CFJB 1BOGB 3KDMB 3MLPA 3C60B 3GMQB 4PJCB 2P8PB 1WEJL 3DARA 1NC2A 1CGWA 2ED7A 1U6AL 3P4OB 1QLRB 3RX8A 1LO4H 4UINH 3QQ4A 3LN4B 2X1XR 2WWMD 4PJIE 2CO6B 2P7TA 1UM5H 1NLBL 5JA9A 4MZ2A 2GAZA 2ITDA 1VGKA 3HUJF 4PRPE 1BQHB 2ITCA 2OLDA 3L3KB 1U95B 5D6CB 2HH0L 4LKCA 1FVEA 1BX2B 1D5XB 1MNUL 3L5XH 1UXWB 5F96L 4Y2DD 3O2DL 4OD1H 1WICA 1S9WA 4X0KA 4D2NA 4RMWA 4OLUL 4ZXBC 5M7QA 3FQNB 1X5YA 1JMZA 3RUGE 2GTZB 2YK1L 3HE6A 1MAML 3SDCC 2A73B 2R2CA 2VXTH 1MJUL 4Z6AT 4NGHH 1MNUH 2QADC 4NN6C 2BVYA 3ZT7A 1PBYA 1KXQE 3WBDA 1K8DB 5DFVD 5FO9A 3SOBH 1IAOA 3VFSA 4BZ1H 2K9UA 3VGBA 2KKQA 5DD6B 4Y2DB 1IC5L 3QIUA 5I1IL 1FRGH 1LP9E 4PPTA 3T0DA 2YK1H 4OQTA 1MAMH 4OCXH 4KRPC 4U1MB 3D18A 5I19H 2FBJL 1EFQA 1X5GA 2Y07L 3MPCA 3P4LA 3UMTA 1MJ7L 3QDJA 5ID1B 2IFFH 4O4YL 4WUUE 1HHKB 1UKSA 3WN5C 2VXQL 3C6SA 3DX6A 3BKCH 3ES6A 3PWJB 2J8OA 4ODTH 5E1HB 1CXEA 1ETZA 5I1IH 1UYWL 3HNVH 2YWYA 2EIDA 1H8NA 3IDGA 1JPST 2FBJH 1WUNT 1X7QB 1CLOH 2BXZA 4RMTA 2Y07H 1OARH 3BJ91 4PY8I 4PR5A 4V1DA 4ELMA 5C6WH 1CQKA 3MLUH 3ARDA 3G6AB 1FFPB 5EU7C 5EBWA 2B5IB 3FO0L 3A67L 1BD2E 3SCMA 5LGKA 2OP4H 4NCC2 4UIKH 3LD8B 1LK3L 1SBBA 1CDYA 1MIEL 2XTJE 1ACYH 1V05A 4HKJB 4XZUB 2X44D 4F58H 4G7YL 4MNGA 3ZKNC 5C1MB 3QWOA 1S7UB 3FQWA 4PJ7A 3RY6A 2YN5A 3QRGL 1Q0XH 4JQVA 1CE1H 5I74C 3A67H 1KEML 2FATL 3TIDB 3F6IA 3DV6B 1DVFC 3BUYB 4ZFOB 4PTUA 2DBJA 3DLQR 4KAQH 2FYYB 1UJ3C 2AEQL 4Z95H 4FQ1L 1AFVL 4IRJC 5EOQL 4MAUL 1JUFB 3BESR 3MFFA 3QA3A 4AM0A 4MSWA 3QCUL 4HMCA 3P77A 3I3DA 3RVWC 4HQQH 1SJEB 1KIPB 4PGZA 3QHTC 5CUSH 3KPSA 1E4XI 4JANA 3EGSB 3LKNA 4D8PB 1NDGB 3CSYB 3T3PE 3A0OA 5C7XL 3B2VL 3NPSB 4P9ML 1YUHB 4ALAL 5BVPH 2AEQH 5GSVA 4U1HB 5EOQH 5EUOF 1U8NA 1KENL 2CLRA 1S7QA 3OTTA 1S8DB 1A4JA 1L6ZA 1E4WH 3IKCB 3H8NA 2ZUQB 4HUXA 4P3WA 1K3IA 2CH8A 1IAIM 5HD8D 5IK3A 1N5YL 1FZMB 3LRGA 3MRLA 5IJVB 5A16B 2PYED 1NCAL 5IOPA 1XF5A 2HJKB 1IZJA 5DJCA 1JNNH 3ISWA 4F57L 5E2WL 4MNQA 5I18L 1DFBL 1H3GA 1G9MH 3EYVA 4NQED 2GI7A 3ZDXE 4XVSH 2CXKA 1PW3A 5D2NB 1KCSL 3OX8A 5KSVA 3NZ8A 4PJBE 3TJEL 4HK3N 3RGVA 1OWWA 3WEXB 1OM3H 4PJ9C 1S78D 4X6CA 1HHJA 1PSKH 2PYEB 1BWMA 3LKRA 4ZFZA 3U4EA 4S1SH 1E6OL 4ZUWA 3MV8A 4PJFA 5DK3A 1KCSH 3GK8H 5KW9H 1RZ7H 5DYOA 3AC0A 3V6FA 5I17A 1S9YB 4Y16D 4NQEB 5IHUL 2R23A 5IW6A 3W39A 1IQWH 4BSVB 2V2XB 5EOCL 2Z91A 3UTSE 2AJ3A 2QSVA 5HHPA 4NHCL 1YEKH 5B38G 4UUJB 4NJAL 3KPRE 5MP6H 4ODWB 1T4KA 1L0YA 5CIPH 1FBIL 3K2UL 4K94L 1QLEL 2F58L 2GK0A 2OTWB 3MODH 1EMTL 1BQSA 1HXMB 3QEUA 4PJAA 4JGUA 1UZ8A 2FBOJ 4JFDA 5HGDB 4Y16B 3OKLB 4O9HL 1YYMH 5ABDE 2UZIH 5F1NA 3EYQD 2DWDB 4NWUL 1NBYA 2R0ZL 3Q3GB 5CS7A 4ZSOE 4ZDHB 3ZKXC 4CKVX 5D9SA 1BZ9A 3D69B 2ATPA 3W82A 1FBIH 3K2UH 3KJ6H 1MQKL 4QYOA 1A1NB 1DANU 3AS1A 1FGNH 4GMSL 2XYCA 4XI5C 4YDLB 3ULVL 2Z31C 1PKQE 5B38B 1QSEE 4O9HH 3D85D 3MV9E 5BXFA 5KBNC 3NAAH 2VZTA 2CLVA 2JK5B 2MQ0A 3C6LA 5DJZB 2I07B 1K3ZA 1OD9A 3UTTA 4G3YL 2R0ZH 1NMAL 1JPTL 6FABL 4KXZH 1NC4D 4P2OC 1RZKC 1IGTA 4WI4A 1I8LA 1CTNA 3IT8D 2BVEA 5IM7B 4X9GA 2I9TB 1TDQA 4P5TD 3S36H 3CK0H 2D7TH 3VFNA 3WFEH 4D0DB 3UJTH 3EHBD 2J6EA 3SJVA 4G3YH 5T1KA 5C8JB 2EDNA 3D85B 4HMEA 2FJFA 5DJ8A 2GK2A 2L4OA 4BQ6A 1EIBA 2BRQA 4EI6A 1NC4B 1NGYB 4UNUA 4LRIC 1SBSH 4JZOA 3IAPA 3PP3K 3JWOH 2UWEB 5FXCH 1J5OL 3KHOA 4LHUG 3LQZB 4P5TB 2YA0A 2P45B 3TIEA 3VXUA 2AK4D 4QNPF 3VXQB 4XVJL 4LHUD 3LKPA 3MLYL 2FHBA 3BWAB 3LQAH 3BYTA 2R2EB 4OFYD 1U2HA 1Q0YL 2AJZA 5F88B 5EIQA 3NTCH 1WWBX 1VSCA 3E6FA 2WWKO 3QPQC 4NZRL 2JJSC 4S10A 5JDSB 4LSQH 3QNYA 3KWWB 4Y5YB 4H26B 4XVJH 4KRMB 3WLWC 4XWOC 3X14A 1WC7A 3E6HB 1JWSA 2AK4B 3QH3A 5F1OB 4Z7VA 3DURA 4LHUB 2A38A 4N68A 1OGTB 3VD4A 4GKSB 5E6YA 4ZXBA 1SJXA 4HX1B 2MWCA 1OAKL 4LVHC 5I2IA 3WFDL 3PDOA 4MDJA 4YHKL 3SDCA 3WFBL 2ARJA 5FM5M 2XPGB 3NVQA 3VXME 1I8KB 3SDXE 3BVNA 1A6TA 4OB5H 4X4ZA 1EBPA 1CICD 3SE8L 1FH5L 1X4XA 3MA7A 5HYJA 4JHBA 4QRQA 2DQGL 3S36X 3VXPA 2DQTH 1EH9A 5CD5D 1AJ7H 1FFNB 1SEQL 4XCEB 5DA4A 1ITCA 1NJ9B 5B22A 4CDHA 3BMVA 3SN6N 3OXRA 1HK6A 5T3XD 4HZAA 1J12A 5KZCD 5GS0H 5SWQA 1EGJL 2KPNA 2HLFC 3WN5A 5GGTA 3NOIA 2V5SA 1BVKA 3B9AA 1A1OA 1MI5A 3HR5B 2B2XL 2NY1C 3UEZA 3U4BL 1CICB 1SEQH 4DTGH 2AJXL 5ACZB 1R3JA 2OJEA 3RWIA 4X7TA 3FB7A 1I4FB 1WCBA 4JO3L 4G9FE 3JV6B 1F45A 1W0WA 1YMHA 4WW2B 3RTQD 2UV3A 4L4VA 5C0RH 1MCRA 1TZHB 1KN2L 3TZVC 3EDEA 4KI5C 5KZCB 3B2UC 4NC2B 1JZ4A 1WBZB 1CD1A 3EBAA 1VFAA 4JREC 2QR0A 3G08A 3HI5H 4MX7B 3Q6GL 3QIBD 2BOBB 3MRRA 4YE4L 4K23H 4JO3H 1UENA 4WV1C 3DGGA 1CR9L 5HHOD 1NUGA 3FFCE 4JG0H 4Y2OA 1UWXK 1NBZA 2ZKHL 3F62A 1KN2H 1ZLUK 4I0PC 4HG4K 3OKNA 1I3RA 5C6TL 1LEGB 3RTQB 5DRWB 5DZOA 2H6PA 2O5YL 2CKBA 5IB2B 2DQJH 3MJ9A 4YX2L 2XY2A 5FCSH 4OGYL 3PHQB 1LNUA 4XX1E 3EOAA 1DVFA 4NRXB 2BNQD 4J3OC 5CZVH 2EC8A 1FC2D 3BZFA 4HIHA 3ARGA 3D6GA 1MRCL 1UJ3A 2F53A 2Z93B 3QIBB 5EU6D 2ATKB 5DD5L 3PV6A 2P5EA 1CFNB 4IRJA 5HHOB 3FAWA 3NABL 4BKLB 4ZFGH 3UO1H 3MV7D 1U93B 3OKMA 5I8EA 4YX2H 1ZLVH 4NO5B 4OGYH 3KYOB 3Q2CA 4TSCH 4OCLC 1MHCA 1BJ1J 2RBLA 3HPJB 1ZLSL 1NL0H 1P5UA 2CIIA 4LSPH 1KB5L 4HGWB 1RURL 4I18B 3UPCA 4Z7UF 1GPOH 1MRCH 3VI3F 1ZMYA 4OIBA 5LWYH 1MWAB 2BNQB 2OTUA 3RVXC 4WWID 5IQ7L 3DWTA 3VRIA 1RIHL 2XY1A 5FM5O 2YA2A 3TBWB 2EECA 5EU6B 2Y7QA 1RK0B 1JTTA 1PY9A 2WUBL 2P5WE 2GQHA 3IDNB 4GG6A 1WIPA 3KPMB 5C0ND 1WWWX 2LAGB 4OCRH 1HE7A 2OSLA 2E27L 2VR4A 4YDJA 4PREA 3MV7B 4Y0GA 1ZT4B 2Y5EA 2LE9A 5CJOL 5EC1B 3K1DA 4E42B 2ICWB 2JKXA 3MC0A 4EZMA 5FGCE 2IAND 4U3CA 2FWOA 4OCSL 3QHFH 2VABB 1RIHH 1IEBB 3V7AE 5DXWA 3WUZA 3EOBB 2WUBH 3C87A 3QJFB 1PYWB 1HCVA 2A6KA 1SJHB 4IRZH 4NZTL 1MREH 5JO5B 1RSFA 4RAUA 1IGFL 5CBAB 1H15A 4PJ9A 3ARFC 4WTXA 3K80A 1VADA 4X5LA 4FS0A 4NQSB 4AJ0A 2IANB 1VFBA 4HUUB 2BY2A 1AD0B 4UOJA 2N7BA 1A6AB 1UEYA 2DQDL 1YN6A 4XAWL 4Q6IB 2NY7L 3E0GA 2QKIA 3KYNB 3FOLA 1KJMA 4D0CB 4G6JL 2PTUA 4OZFA 5ESAA 3K8KA 5DDHA 1ZHNB 3R06A 1KXTB 2AAVA 4JPVL 1N4XL 2QSTA 3IFLH 2ERJB 5BV7C 2CIKA 4R9HA 2EICA 4LDLB 2GKIA 4Y19D 1KC5L 4HCRL 3S97C 4BH8A 1FNHA 1ADQL 1ERNA 3EZJB 4YHIB 5C86A 2IH3A 4CU6A 4A2MA 4EKXA 4G6JH 4CVWA 2EC9U 4OZGA 3CUPA 4CN4A 3PWVA 5CJ8A 4HKZA 4RAVB 3KLDA 4JPKH 2CQVA 1BBDH 4M7KH 3VI4F 4F7PB 4P3DB 3TNNA 4HCRH 2DQFB 3A6BL 5FYLH 3MYJA 1FNFA 1YY9C 3TF7C 4ODBD 1RJYB 4Z7WB 4N8VA 1S7RB 4Y19B 2BY0A 2HRLA 4R26H 3X13A 1JGDB 2D4FA 2DRUA 3DV4B 3WE6B 5F3BB 4FFYH 4Y8AA 1C7TA 2Z31A 3V79C 4RGMC 1RZJH 4KPHL 4OAWA 1AO7E 5EZOH 2YPKA 4P57A 3CVIL 3A6BH 2EDBA 4KTDL 3JV0A 2HFTA 1FVCA 2CKNA 3ZKMD 4XBEL 4P2OA 2VN4A 3F5WA 2MOVA 3NFNA 3HPLB 3IU3B 3D25B 4Z18A 2IBBA 1GZQA 2Q76B 2WBWB 1NFDB 5DO2C 3VFPA 3HMXL 2IPUG 1FVDB 2AK1H 4GW1B 1I1RA 4XBEH 3LEYL 4L3CA 1WGOA 4NDMB 2FR4A 1ED3B 1A3LL 2NY2C 5FYKD 3ZHDA 5JPNA 4LRIA 5HHQA 1G7LA 1KCRL 1FZOB 5DJ6A 2BSSA 4HWZB 5IEHA 1GXEA 4RAHA 4JVUA 3HMXH 4PV8A 5F1KC 3BP4A 4JDVA 5TQ2H 4M1CD 5FYLE 4WWKC 4N0UE 43C9B 4XMKH 1MFDL 2ADJB 2XTJC 2C4FT 5SWSD 3MZTA 3O4LD 2OX5A 3HZYA 4U1GC 4L1HA 3T0WA 3KLHD 2YEZB 4JPIA 1WFOA 2JJSA 2VLLB 3V8OA 1JPFA 4NOFA 3PL6D 1P2CA 1D7FA 4G6KH 5E1AB 1MFDH 1NMCC 4D9QD 1JGEB 1J1OL 4LCCB 4MWFA 5C09D 1NCNA 1J0ZA 5SWSB 3O4LB 5I73B 3BH8A 1ZEAH 3CPLA 4PJDB 2YPLD 2H9GA 5JHDD 4ODXB 5CINH 4LAJH 5DJ0A 1AE6H 3PL6B 1U8PB 2VB5A 5F44A 3BPNC 3RIFF 3UYRH 1NKOA 3ARBD 1BZ7A 1IC4H 1A47A 5DHVB 4TUOA 3DX9B 4U1KA 3GUTB 1DDHA 3M17B 5C09B 4MXVE 3LB6D 4ZUTA 3CMOH 1G84A 2D0HA 1QTYT 5EZLB 1J0HA 2JIXA 4YR6A 3HNTL 1UXSA 2YPLB 2Y4SA 1UB5B 5JHDB 3WKNA 1IBGL 2X70B 1VB9A 2OM5A 3D0LA 1UWEL 3BIAX 4KZDL 3TH4T 3CDGB 1WJ3A 1FFQA 3ARBB 3ARVA 5SWZE 1IL1A 1MJJA 3WSQH 4NQCE 4P4KC 4PRID 3OKDA 1UM6H 5F7DA 3BW9A 2XI9A 4PJXF 32C2A 2C3VA 4YFLF 1T0NA 3GMPB 5C0GB 2AJYH 2HFGL 1RJLA 3DTXA 5HGBA 3CU7A 4ZTPH 5GRYA 5TE7L 5DMIH 2YC1A 1S7WB 4ZQKA 2WLYA 3TZVA 5CP3H 4J3XA 4K8RL 1NGZB 1CDUA 1FN4A 5GS3A 2MHAB 1XH3A 1J18A 4APQC 3JV5A 3JZ7A 4JJ5B 1NAMB 1P4BH 1U0QA 1RUAH 1KSRA 1BIIA 2R69H 1V3KA 4ZUUA 3QHZL 2EIEA 2V9RA 3MNZA 2NXZD 3P30L 4WU7B 5J12C 3O8XD 5CJQL 4PRIB 1TVHB 4WV1A 5TE7H 3B4NA 1KELL 5J9PB 2VL5B 4I0PA 3FT2A 4XHQA 3U7WL 3G6JA 2HP4A 4OD3H 3VGAB 2FHCA 1MCHA 4Z7OF 4PRBB 5L0QB 4C59B 1C8PA 1FAIL 1MRDL 2VWEE 4LCYB 4M6OL 3GMRB 3H9HA 5ENWB 1J8HA 4M93C 4F33A 2LVCA 2H32A 3AGVA 1S7TB 3A6CL 2NXZB 2IH1A 3O8XB 3F7YB 5DK0A 1LO0L 5EB9A 1DN0B 3VXRE 1G9MC 3HAEA 1LK2B 1MRDH 4NKMA 4TNWF 4Z7NF 1JYWA 2PYFB 3TPUB 4XPBH 4LEXH 4MD0A 1QRNE 2GY5A 3I3EA 2C1OB 2RB8A 4NBZB 2EZ0D 1JBJA 4R3SB 3V4PH 4J6RH 5D5MB 3W9EB 2GTWB 1E4KC 5HYSB 1BBJA 5D7IE 1FIEA 5JW4N 2XG5A 1ZHBA 3MRHA 1EV2E 2ILLA 2ZUXA 1LDPH 3U48A 1N0XH 3T77A 5F7WC 4NQVB 2NX5A 1JNLL 3VFUB 3FQXA 4ZMAT 3RY4A 1IAIH 5TDPB 5CZXD 5ESVA 5CLTA 3MV11 5I76B 4YAQA 3HFMH 1G0YR 5E5UB 4PUBH 1T5XA 5EU3A 2VQ1A 4BUGA 1CXHA 1ORQA 1BM3H 1G9NH 4HXAH 1R3HA 3WXWH 4M61A 3D39E 1OLZA 4MS8D 4JFOA 5T1DL 2HTKD 2EDXA 2RR3A 4FTVE 2RQ8A 3ARFA 4JO2L 4ELMF 5TGBA 3O6ML 3P0VL 3BAEL 4LAQL 4F2MA 4R7DB 2D0GA 3G5YB 4P2RE 5JHLH 4AEEA 2X1QA 1DBAL 1EEQA 5ICZA 1N64H 5D1ZC 5EA0L 3SDDD 3QUYC 3BP6A 1D6EB 3CMGA 3SQBA 1IGCH 1AGFA 5DQJA 3B9KC 4PJIA 3EJYD 2ICCA 3MXWL 3SE3C 4XP5H 4PRPA 2UZYB 4WI9A 5KSAC 4Y5XC 4PJ7F 4KVCL 4GAYB 4ZUVA 3RVVD 3BGFB 4TQEL 2Z0BA 3L9RB 2AV1B 3MRJB 5EA0H 5FKPA 4V2CB 1JZ6A 4PGDB 4GAGL 1FZJB 2VO5A 3O3EA 3SDDB 4WFEE 4EVNB 5GZOC 2EYTB 3S37L 4KKBD 1AP2A 3RUGA 4L5FH 1HINL 5FB8B 2X7LA 4JFYA 3OKOA 1A14L 4HIJB 1AGEA 4MZ3A 5DJ2A 1U91A 3CC5B 4F7TA 1SEBA 4X6BB 3WNMA 1KJ3L 2APTA 3BHBB 2FJHB 4NBXB 3JWOC 5CEZH 5FOBB 2Q3AA 5IHBA 4RWYL 3QXVA 1FG2B 1HINH 4AENA 1DBJL 1LP9A 1Q9KA 3MLXH 4KJYA 1Z3GL 4OFKA 1B4JH 3LQAC 3RIFK 3GJEB 3DUSA 1OAZH 4WUUA 2OL3H 3UP1A 4TSBL 1U3JA 4X9IA 2LTQB 5MHSD 4Z7QE 5J1AA 3TCXA 3E8UH 4DN4L 4HBCH 4WFFE 4W4NA 1UH2A 1UWGH 2DDQL 3ZHKA 2ICEA 4UZGA 3P9MA 1I8MB 1OD7A 1CL7L 3HI1A 1FIGH 4X98A 2D4DA 5FA4A 3RL1A 2NY5H 2PF6A 1VACB 5JQHC 3BPOC 3OAZH 4WU5A 3D5OF 4JZJB 3IDXL 4N8CH 1V3MA 3GEWB 1A7QH 3OZ9L 1AKJD 4X6CF 1BD2A 1EAJA 5TQ0H 4WWKA 4UILH 5J1TC 4Z8FH 3L3IA 3MRPB 4YNYB 3T3ME 2EH7H 4PJFF 3TBTB 3TNMB 2VDLL 2ZUWA 1B3JA 4JKPL 5CEZE 5AUMA 3P9LB 3OZ9H 3P0YH 4G9DB 1MCWW 4XVTL 1INDH 5EO0B 2MQ3A 4HK3J 1AKJB 5AD0A 1QPPA 5INCB 5I75C 4PB0L 5E6IC 5GS0C 2VDLH 2FZ3A 2AEWA 2J8HA 4N0YL 5J6HB 4JKPH 4BSWA 2W91A 1SYSA 4PJAF 2G60H 2HFEB 3CCHA 3SKOA 4NPYA 2FX8L 5CWSB 1CFVL 3ALXA 3RNKB 2J88H 4Q7DA 3UDWC 4BK5A 2VAAA 4BZ2H 5K9KA 2QTEA 4OD2B 5B4MC 2F5AH 5DD1L 3FFDB 3UBXG 4NOBA 4JRYD 4A6YH 4FQHB 4PB0H 3MGOA 3VXOA 4I48B 3ZYJA 5GIRA 4ZAKD 1LWRA 1JHTA 3T1FB 1QR1B 4UIMB 1PLGL 4TNWK 3NCMA 3RA7L 3MOQA 4MD5B 4KKLC 4OF8A 1Z9MA 1IGMH 3H9YA 3OKEB 3DI3B 2JTDA 2JCCB 5I0ZA 2I5YL 5IBTH 4HJJH 4OLVH 1NQBA 2DTML 4LLQA 1WTGT 1JF1B 4NRYA 1A6WH 4JRYB 3IDYB 3LIZH 1X5LA 1BQLL 1CDGA 4M6NL 5CCKH 4NCDA 2JB6B 1DBBL 1N59B 4N0CD 3OF6D 4ZAKB 3UBXB 1I3GL 4P4KA 3MRFA 3TN0D 5HDQH 1T7WA 3WIIL 4RNRB 4RGND 4X80L 2BNRE 1T1ZA 4HGKC 4PJBA 3O41B 1XR9B 5A40E 2XZQL 3GSRA 4XGZB 1T22B 2O61B 1DE4A 2YSSA 1FNSH 4MA3A 4APQA 1I9RL 2J8UB 2VE6B 4KROD 4AT6A 5J6GA 3ULSB 4I2XE 2XIDA 3TN0B 5T3ZL 4HZLA 4NQUA 3IJHA 2EIZB 4RGNB 1CCZA 1QFOA 3HMWH 4KKAC 3CXHJ 4Z76B 1J10A 3T1WA 3FN0H 2Y06H 3IDJB 5FA3A 4GRMA 3KPRA 5FIEA 1PVHA 4YWGH 3GMLB 4WO4D 5HGAA 4OUUA 5DMGC 5FOJA 5IVXB 1L7IL 2X1OA 4KROB 2DLHA 5F7FA 1N2RB 4MGXA 3TO4D 1EFXA 3IETB 4FQJL 4YDVA 3C8HA 4Z7VF 5IB5B 4ZS6C 1A22B 1CXIA 1M7IB 2AV7B 2OR8A 3CFKA 5BZWA 2FIRT 4TVPL 4Y4HC 3RX7A 4IOFD 5DEGB 1Y0LA 4ZSOA 3RDTD 2ED9A 4AH2B 3J8F7 5JNYA 4PJEB 4J8RB 2A9NH 5IHLB 5KVFL 1MCOH 2H8PB 5LKNA 4FQJH 5KAQG 4WO4B 1Q9LB 1OGAE 3EFFA 1PKQA 5IMKB 1QSEA 3QZWA 2MJWA 3TO4B 2BOCB 4ORGA 1EO8H 1E4KA 1CK0L 4RRPA 3MGTB 4EBQL 3T2NH 4XMPL 3MRMA 3TBVB 3BH9B 4MCZA 4RMSA 1YQ2A 1C5BL 4Z9KB 3R0MA 4NJ9H 3QSKB 3GDBA 3X12B 3RDTB 1KTDB 4BQ9A 5DK2A 3U79A 3V5HB 2W65A 4U7MA 4XH2B 5DTFA 3VH8A 1IAMA 2FX7H 5DUMH 5KS9A 2ZP0T 1IM3A 3KPOB 1A9BA 4MXQD 5CAYB 3QDGE 1GGYA 1ITBB 5AYUH 5DMKA 5I1GL 1C5BH 3IFPA 1RULH 5CIPA 2ZPKL 4U33A 5BVJA 1TITA 2J1KA 2UY6A 2A83B 1WF5A 5T3ZE 4XBGB 4N9GA 1T1XB 3MRIA 4PY7A 3KYKH 2Z8VC 1OAQL 1VCAA 4HWEH 3DVGA 1KPRB 3V5DA 1XCQB 4GFTB 2YPVH 3UTPE 2ZPKH 1T7ZA 5D1ZA 4NQXA 4HS6B 3QUYA 3GSWB 4LKXA 3SPVA 2XWJB 1E27A 1J0YA 1CXFA 1RZJC 2X41A 1XF2A 3B9KA 2VDRH 5EG6C 4JFQB 3LZFL 3SE3A 5KSAA 4MA1C 4Y5XA 5B39B 3B9DA 3KLAA 2DL2A 4KJWD 5IV2A 5GGRB 4G42B 4MDIA 3W11C 2RFXA 3QO1A 4AIZB 1CDHA 4UV4L 4KI1A 2KH2B 5ECJE 1N5AA 1E4XH 4C55A 5HHMD 1JYXA 1GGTA 1DLHB 2CPCA 4HV8A 3PWUA 4GQ9H 3BP5B 2VZOA 1H3PL 4EXPX 4ODHH 3VXMA 1C08A 2GAZB 4MCYA 4NKQB 3L6FA 2ITDB 1VGKB 2NY3D 2ITCB 5DEFB 3SKMB 3BZ4A 4MA8L 3KXFE 3JUYA 4QLRA 2R2HA 1DQTA 1BPVA 1E28A 4XXDB 1KLUA 3CFBA 3P2TA 3QIUD 4XHJC 3TPKA 3O3DA 3L3OA 3AAZB 5HHMB 2EEBA 3ZTJG 3QDMD 5HGHB 1PDKA 3VFMB 4PRNB 2W38A 4RIRB 4GG6F 4EEEA 4XCNA 3PNWA 4XP6L 5E99H 4JKLA 2A74A 3T4YB 4JAMB 1GGIL 4PJHA 3TA3C 4OFPA 5LAXA 3ZE2F 2DM3A 2NY3B 5CSGA 1JWUA 1ZA6B 4H8WH 4YXLL 2YBRB 3QDHA 4OCWL 1IAOB 4R0LC 4UMGA 2VXUL 4F37F 3HC0B 3QISA 4WGVB 2F54E 1M4KA 1OTTC 3FMGL 3QIUB 3MZGB 3X3GH 4G9FA 5C0AD 3QDMB 3JWDH 1K2DA 5BMFL 5KJRH 3D18B 4V1DD 4GRWF 1UQSA 2WIIA 4P5KA 3NIDF 4YDKL 3ARDD 5E2TL 4FABL 4OCWH 5CP7B 3MJ7A 5ANME 1HDMA 2ZZUT 2JELL 5HHVH 1OLLA 4IDJL 3BDYH 3RPIB 3FMGH 1ETZB 5HPOA 3QEGH 3QFDA 5IT2H 3FFCA 3IDGB 4NCC1 4EOWL 3L3DA 2PN5A 4KQ3L 5C0AB 1OAYL 1P1ZA 4PR5B 4E41E 4WFHD 5I6XC 4KK6D 4V1DB 5FV1L 2VWEC 3HC4L 3ARYA 3ARDB 1ZGLA 1RIUL 3STBA 4QNPE 5GGVH 4F7CB 5E6IA 5TF1L 2WIMA 1CXLA 4OZGF 4KJQD 3TM6A 1WZLA 3NFSL 3WJJC 4FQLL 1KCKA 2ZCLH 4MNGB 5KSBE 3UDWA 2HLAA 5D8JL 3UPRA 1HKFA 1JWMA 1T7XA 3FQWB 4TPRH 3KPQB 3FT3B 3KPSD 1K5NA 3VG0H 2Z92B 4M48L 4L8BA 1Y6MR 2GUOA 4I9WD 4R8WL 3ZDYF 2P44B 4FQLH 4PTUB 2P46B 2P5WA 2VLMD 5D8JH 2AVGA 4YK4C 2O93L 5MI0B 4KJPD 4KHTL 4AM0B 3DRQA 5CILL 3CZFA 1MRFL 4XP4L 1CGTA 3GKWL 5HHXL 2C4XA 1X5KA 3K4AA 4JFHE 1U36A 3KPSB 2V7HA 3LKNB 4JANB 3RWCB 3TJHD 2N7AA 3JTSA 4R8WH 3NCYS 5D70H 4JPWL 4L8SC 1G1CA 1S5HB 4LF3B 4D9LL 3RVUC 3QULB 3HR6A 3AM8C 5GSVB 1OF2A 2XQYG 4OBRA 2P49B 2A6JA 4BYHA 2CLRB 3RKDC 1S7QB 5J7CC 1MRFH 1L7TH 4HUXB 5I8KH 2CDEB 4XNZC 5HVWA 5F7LB 1DQQA 4X6FA 4NO3A 1XIWD 4Q0XL 1ZGLP 4B50A 2YD7A 1OCWH 4FXGA 4B53A 2QHLA 5DJCB 2UVFA 4LLVA 1G6RL 2CLZA 3MV8D 1QO3B 3C5ZD 3EYUH 2VDOH 1U58A 4MA7L 1U41A 2VZ3A 1YECL 2NZ9D 4X4YA 4ZTOH 1XGQA 4YQXL 4AIXA 3HG1E 4G8IA 4NO2A 2CMRL 2AABL 4QCIB 5E4EC 3MSPA 1NCTA 2HKHL 1QD0A 3QNXB 1YYLH 4WI8A 2GCYB 1XIWB 3QUXC 5HI5D 1HHJB 3L5IA 4YXKL 2KZWA 4MA7H 1EUTA 4YPJA 1ZHLA 4ZUWB 3MV8B 5C2BL 3C5ZB 4OLYL 1EEZA 2NPLX 4PV9A 5AZEL 4JFDD 2P47B 2E9IA 4Y4HA 3W39B 3PGDA 2H2SD 5JORA 4DVRL 1MCFA 1JV5A 1UM4L 2V7NA 4U0QB 2AJ3B 5HHPB 4CVXA 1G9NC 1HZHH 1V8HA 4U1JA 4ZPTA 4WI3A 1BFVH 2QSQA 3QEQE 4NN7B 1I1FA 2UVEA 4LLMA 1U8IA 5DRXB 3T8XA 1AO7A 4M6MH 3FRUB 4U6HA 4XPGL 4MB5A 4JFDB 5IWLC 1UM4H 2BHUA 4OZIB 4NNYA 5DQ9A 4LPCA 3TH3T 2BY3A 2GFBA 4CVZA 1KOAA 2FGZA 1OP5K 3ZT6A 1BZ9B 3IVKA 5CEXA 2ATPB 1Q72H 3CVHB 1Q9OB 1QRKA 2DTSA 1I7TB 2E5EA 1R5IA 4QYOB 4XPAH 3CZJA 4Z7UE 3GNML 5IFJA 1MFAL 5LGJA 1KLFA 4CN6A 4R90H 2CLVB 4FQ2L 2VKWA 3KPTA 4Z78A 3KHQA 1JZ8A 3UBXI 3O0RH 4LSUL 3O6KL 3T2QA 5HHNA 4JFFE 1IZKA 1TXKA 4F37K 4XCYB 1IGTB 4Q9CA 5F97E 4HCRA 4KI5F 1YNKL 5E2VL 2DD8H 3VXUD 3W81A 4HUKB 2LABA 3VFTB 4N0UA 1INEH 2VL4A 3VFNB 5CLWA 1I1CA 3ULUH 4KHXL 4TYUA 4PLJC 4HS8H 5E00A 2P8LA 1AQKL 4U49A 3O6KH 1PG7L 3RWHB 3NGBC 2WBJC 2FJFB 1CGXA 5DJ8B 4X99A 1LO3H 1EA9C 4JFXA 2VZSA 1ZLWK 3P4MA 1U3ZA 3G6JF 5L8JB 4GMTH 1VKXB 3RL2A 2WINB 4CU8A 4FFWC 1IVLA 5C6PB 4KHXH 2Z35A 4OZ4A 3MLSL 1CVRA 1NSNL 3PWNB 5FYKU 3VXUB 1JMXA 1C7SA 3MRDA 1N6VA 2I9LA 1XF1A 1TENA 4P59L 3Q6FB 2AJZB 4KDVA 4QRPE 1AXTH 1TQCC 2DWEA 3E6FB 4KV5E 1A7PH 5JW4R 3FONA 2W60B 1IKNC 3QNYB 2NY5C 1E6JH 4HK0A 1IGJB 1Z9LA 5DWUH 3AREC 4HXBH 3X14B 5C0EB 1ES0A 5FUCE 5HPMA 3QH3B 4NQDD 2Q8BH 3FO2A 5GGVY 5K9QG 3OR6A 1SVCP 3HMXA 4F80A 3V6OE 3K81A 5DJYB 5D7JC 4PJCE 4JGMA 4X8XA 2AXGA 3ULUE 4JN1L 1U8QA 2HT3D 3I6LE 1X6NA 2J4WL 1ZV5A 3PDOB 3RHWF 2Y5TA 3LDBB 1XF3A 3MUY1 3TA3A 2EDLA 4OSUL 4NN6B 1AI1H 4X9BA 4FQIL 2Q7YB 3BVNB 1MI5D 5ID0A 5SWZA 3WS3A 4R0LA 5D1QC 4U1IA 4N0FA 2JJWA 4KU1A 3LPWA 4NQDB 3VFWB 3JTTA 4GOSA 4QRQB 4NP4H 3C5JA 3VXPB 3ROOA 2QQNL 3MCKA 1K8IB 5IKCB 2J4WH 2BX5A 2OCFD 3VMOA 1ZVHA 3OXRB 3OSKA 3P11L 3T0EE 4O58H 4WFGD 4JFZL 4AEIL 1A7OL 4AZ8A 1KLGA 4M3KB 4G8GE 3CXHK 3WN5B 4F7EB 3MMEA 4XNYL 1BVKB 1MI5B 3F7VA 3WHXA 3SY0A 3ZDZE 3WO3B 2R4RL 4GKZB 1MHPL 2OJEB 5ADOL 3RWIB 4YEEA 5E7FA 1TCRA 3P11H 1MCQA 4DKEL 5I1DB 4PJIF 1MY5A 1B6UA 3SO3C 3QUZC 1FGVH 4N1CA 4OUOA 1RUKL 4KK9C 1CD1B 3LS5H 2EE2A 2GW5A 2X4UA 4PGBA 2GJZA 1JIBA 5JOFA 5ADOH