1FJ1A

Lyme disease antigen ospa in complex with neutralizing antibody fab la-2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPSSLSATLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGNPSRFSGSGSGRDYSFSISNLEAEDIAIYYCLQYDNLQRTFGGGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural identification of a key protective B-cell epitope in Lyme disease antigen OspA.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
molecule keywords HYBRIDOMA ANTIBODY LA2 (LIGHT CHAIN)
total genus 47
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fj1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fj1A01
1A4KA 4PJHE 3QI9B 5E56A 3OL2A 3VGAB 1QSED 2OSLA 3MQIA 1AE6L 4WTXA 4APQC 3TBSB 3KYOA 3W2DL 4CVXB 4L8SC 3HPJB 1OF2A 2R4RL 4JY4A 4P48A 3TJHC 1I85C 1NCCH 2ZG2A 3BJLA 4DKFL 2EXWD 3CAFA 4ZS6D 3BIKB 2PTUA 5J89A 4PBWD 4MX7A 1QOKA 1HN1A 4G42A 1CICC 2ZNXA 4JPKL 3L3DB 2PCPB 5D1QA 2AK4B 4JN1H 5GGVY 4ZO7A 3GUTA 1RAMA 1UXWA 3W9EA 2HVKB 4RAHA 1S9WB 3VI3E 3UJJL 2A74A 1IGTA 5D7KE 3RWEA 3CLEL 4TUJB 1I1FB 3GM8A 2UVFA 1HQ4B 1MRFL 4P4KB 5DD3L 4YDVB 4K8RL 4OD2B 5IB1B 4NKDA 4QF1B 1HXMA 4QRRA 1CT8B 5T1LD 4JM4H 4HIEA 2VDLH 1BX2B 4GBXA 5D6DC 1CGXA 1I8KA 4R6UA 4IIQB 5EU3A 1XF5A 1D5IH 3V52L 1GGCL 1TJGH 3I6LE 2BNUB 4J3SA 5CJOL 1XGPB 2H9GB 3LEYL 4QHLB 5D2NB 3HG1B 3HMXH 2V7NB 2A38A 2NXYD 2V9TA 2XIDA 1Z5LB 5GSRA 5A2JH 3MV9B 2YUVA 4H20L 4KJQD 2QKIB 1W0VB 3O6ML 2NY2B 2Z91A 3FQNA 4O2CA 5SWZA 3O8XD 1Z5LA 3O8XC 1EZVX 1YEJH 1T66D 1NGQH 2VAJA 3ARDC 4F9PC 1RHFA 3QHZL 4ALAH 3G5YA 4JFHD 1CICA 3TM6A 1YEDA 3MRQA 3F58H 4Z18A 2D0GA 2PXYC 4R0LC 2VDML 2ITDB 2DAVA 1UM4L 3OG4B 4HUXB 3AAZB 5C7XL 3IFLH 3CNKA 4QXTB 1IGTB 3OKMB 4PGDB 2WBJD 1G9MH 1A6ZB 4NQEE 4NC0B 5J1AB 4LARH 3CX2A 4N90E 1JF5A 3WO4B 1P4BL 3RUGF 4X99A 4G6MH 3EDEA 2MFNA 3C8KB 3REWB 5C9JA 4OM1H 1F58H 5FKPA 4GAGL 3ZDZE 4E42B 2E9BA 1SEQL 4JGJA 5D4QA 3MACH 4ZQKB 2BNRD 4D8PA 3HE7C 1C08B 2YPLD 2OXGA 4K3JH 5HPOA 1DBKL 4FXKB 4FFZL 1AO7E 4RZCA 4NQCD 1MFCH 1B6DA 3P11H 2D7TH 2IPTL 3RUGE 1JBJA 3V0VB 1S7SB 5C07A 2XA8L 1L0YA 3KPNB 4MD4A 4F15C 3PIQA 4ONHA 2A6IB 3VJ6A 1Q9KB 1QKZH 2YD5A 3DNKA 3QIUD 1DBJH 4TOYL 1C16B 5FOBB 3B2UD 1M7IA 2DDQL 1U8PA 4OGXL 1MCQA 2HRPH 3OHXB 5D6CA 3WNMA 1HZHL 1U6AH 3ETBF 2YZ8A 4I0PD 1F4YH 3HI5L 3PJSA 5DRWA 1JL8A 4BZ2L 3V6OE 3T04D 5ETUB 2FX7L 1BQHA 1VFAA 1ZLUK 3BKCH 4YEEA 4NQTA 4X4ME 3JBG7 1AI1L 4RDQG 2BDNH 5K33A 3ZTNL 2FNBA 3FO2B 2F5BL 3DI3B 1E4JA 3GMNA 5E9DB 3UTOA 5DJAB 3G5ZB 1T22B 1Q1JL 3PGFL 4TN9A 5EIVA 3ZSTA 4U1HB 1OGAE 5F7EL 3GGWB 5I71B 5CSBA 5JO5B 2YEZA 2UZIL 1WWBX 2Q7YB 1JNHB 4NZTL 2QR0B 1AD0B 2WBWB 2G60L 1IKNC 2AEPL 5DJXA 4UOW1 5LBSL 3QUKB 3EO9H 3HNVH 1J18A 5ESQA 4MDJB 1LK3L 5HYFA 1MCWM 1HNGA 1SYVA 1T7XA 2IMMA 4MVBC 3L9RA 1WLHA 3K80A 5C08B 1ADQH 3TNNB 1U8JB 3K2UH 4YBQD 1AC6A 5AAWA 1IC4H 3O6KL 1CLYL 5GZNC 2XQBL 4HH8A 4WHYH 4R7DB 2C4FU 3ALPA 2R39A 3QUXA 1W8NA 2Y7QA 1HCFX 1EVUA 3HHRB 5FA4B 3DWTA 3RRQA 3ZKMC 3UTQB 1W0WB 5F3BA 2Q76A 3QSKB 1BHGA 2R1XA 2ZCKH 3TH3T 1DFBH 3IJHA 4ODTL 4DEPB 5I30L 2BVYA 4MYWB 1P4BH 1ORSA 4MMZC 4NDMA 5DRNA 3P30L 3U4EA 4DGVH 1QVOB 3CD4A 2XV6B 3SE4C 5FUOH 5B8CA 4YHML 1K3IA 2P5EB 5HI3C 1CE1L 4G42B 3RQ3A 3ZKXC 4XBGB 1T7ZA 1AGCA 5GGRB 5E8DH 2E8ZA 3MRNA 1LP9F 3RDTB 4GG6E 1DLHB 2AEWA 2B5IB 3MRIA 5EWIH 3S4SG 5EBWA 3L3KA 5FYJD 3TBSA 4F7MA 1JN6A 1DBMH 5DLML 4F7TA 4MA8H 4PJFA 1U2CA 3NFPB 1QSZA 1FLRH 1A6WH 1FZJB 1QRND 3HUJE 4JM2F 2J5LB 1GGUA 2XZCH 2QQLH 3BH9B 3B3IA 4YGVB 4FQ2H 2ADJB 2IANB 1IFHL 5JQ6H 5E03A 2AJ3B 2WUBL 3GDBA 4UBDC 4BH8A 1JIBA 4YXHH 3ESUF 4M93B 3MFFA 2JB5L 3SE8H 3MRKA 2IGFH 4S1SL 5FKAB 5HHMD 3DXAD 3QEGL 4UV7H 1HYRC 3CSYA 4JKMA 4BFGA 4S1DC 3FB5A 1U41A 4I13B 4MB4A 4JDTH 3U82B 5BRZD 5HHXH 2YUXA 3BEVB 4P5TC 2Y5EA 5MERA 1YMMB 4K7FB 2DQEH 3QO1B 4ZXBA 5MEQA 3QUYC 3LN4A 1D3CA 5D1ZD 1CDCA 3UEZA 5D71L 3F7RA 1QBAA 1K4DB 3NN8A 4L8BB 3MYJB 5AZ2L 5ICYB 1NGXB 4PJ8A 5IW1A 1YNKL 4X6CB 3C08H 2NY1B 4G9FE 5JDSB 5DMYA 4YC2B 3VXNA 5JW4N 2XKSA 1FNFA 1CYGA 4N9GA 1PG7L 5IEKA 5K59F 1RUAL 4TUOB 3T77B 1OAZH 3SGEI 3Q6GH 2HJLB 2OI9B 2YRPA 5DMGD 2SEBA 1AKJB 4LMQI 4M4PA 4TQEL 1KG0A 4OCYL 1HH9B 1TETH 1DVFD 4NNYB 4MA3B 4UILL 5SX5K 1ZVSB 5ALBL 4G8EA 35C8L 1Q9WB 3FB8B 5FB8B 4GBXD 2B4CH 1UZ8A 4H0HB 4QRRD 4P2QD 1E27B 3CFKA 5DFTA 5T5NF 1NCTA 4Y5YA 5K9JH 4X6DA 5DC9B 1EEYA 1B4RA 25C8L 3Q1SH 3SQOH 3H9HA 1E4XL 3PWPB 4JJHA 1RUQL 3QEQE 3DSFH 4KTDH 5TDNA 3RY6C 4LBEA 2EO1A 3UDWA 5H8DA 4L3ED 4P23C 1A3LH 2EIDA 3ZT6A 1H3VA 5EO1B 1F8TH 3RUGB 3BQUB 1UB5B 3IDMB 3WJLA 4Z7WF 4Z8FL 2ZSWA 3IS0X 5I8CB 1S9XA 1N3NB 4NKIL 4W4NA 3IJSB 1OCWL 2VH5H 1XF1A 4N8VA 3TN0D 4I48B 2P5WD 5E99H 5HI5C 3MLXL 3MBXH 3O2WL 4M9PA 2IH1B 3QO1A 1MLCA 3QHZH 4ALAL 5IT2L 1AD9B 1QFOA 4K94L 2G9HB 2CKBL 3BYYA 2GI7A 4Y19E 2NZ9C 2WP3T 4X6BB 3MV01 2EYSA 4KGLA 4UUJB 2BHYA 1Q0XH 1JPGB 1T21A 1ZT4B 3MRBB 4WWID 2NY5C 2KQNA 4XBPA 5CWSB 1EO5A 3D85D 4WW2B 2H2SC 1I3RA 4QLRA 4O58H 3CSGA 5EO0A 1H3PL 2J88L 3P77A 1TCRA 4N1CA 3RL2B 3VRIB 2XZQH 4K3EH 3TVMC 3IFPB 4J3OC 3VFGH 3CFJB 1AD0A 5EG6C 5D7JB 4HUMB 4JY6B 2HVKA 1NFDA 3D69B 3QQ9D 1Q38A 5DURB 3SDDB 2YD3A 3BPCB 1MWAB 3SHSA 3KNBA 1I1AA 2X2YA 5CGTA 3TCLA 3BJ91 1P4LB 1U3HB 2F53E 1Q0YH 5JR1H 3WDHA 4HWEH 1CG9B 4HGMA 2NLJB 3WJLC 4GKZB 5FHBL 4I2XB 4OF0A 4UNUA 1F4AA 1IM3A 5D7JC 4ZPTB 3FB8A 5FB8A 1G0XA 3ARYA 5D7KD 5HYJB 1PQZB 4FZEL 4DW2H 4MHHG 3MJGX 3MCLH 4NKMB 2ATPA 4MAUL 4J4PD 1KFAL 3W9DA 3V95A 1P5VA 4YJZL 1OCWH 2VH5L 4LSPL 5FA3B 5DDHB 4Z5RA 3GKZA 3VFNA 3VDBA 3HR6A 1YEIH 3F7YB 3MLWL 3RHWF 5FV1L 5GXBB 4IOFD 1D5XB 5IVZB 3VWJA 1INQB 4G7YL 2VXUL 1LDSA 3W9DB 1L9NA 3OF6A 4ERSL 2VDMH 3DSFL 3E1F1 3QNXB 4PJHF 5J12C 4CNIB 3HRZB 4X6CA 1GHFL 1KNOB 4JFYB 5MEPB 5CEZL 4DKEH 1BWMA 1WIOA 5FXCH 3R06A 4HK0B 2D9CA 4W6WB 5INDB 1WICA 3QUZD 4HS3A 1S5IH 3ILPB 5ECJE 1FC1A 1MCCA 4U1NA 4OB5H 4FFVD 3KGRA 2ARJQ 1DDHB 4D9RE 1WZKA 4OCWH 1KV3A 2AJSL 4UQ2A 5HXMA 3DX8B 4FQQB 4G9DB 3BPCA 2B4CC 2CO7B 1DCLA 3WFEH 4DAGH 5MI0C 1CFNB 1OLZA 3MBEA 4P57A 4XZUA 4HC1A 1IGFL 2Z8WC 1LK3H 1NJ9A 4NHUB 2YC1A 1JHKH 2DQTL 2V5MA 3PQYD 1ACYH 1F3JB 2AEPH 2WNGA 4YHKH 4HG4J 3JVGC 2PNDA 4FFWD 4ZXBD 4DN3L 1RV6X 4ZAKB 3OZ9H 3MJ9L 3P4LA 4XPBH 1YECL 3MLRH 1Y18B 3KPMB 4XPFH 5I1HH 4NPYB 3KDMB 4TULH 1N0XH 4HFUL 6CGTA 2B1HL 3L3OB 2CUMA 3GBLA 3NACL 3H3PH 4O4YL 3MV9A 3UCRA 5IWLC 1XEDA 5LGHH 3MNWA 3IKKA 4U3HA 3MJ7B 3TIEA 3FT2B 5JLZB 1N5AB 4K3DH 5TGBA 1AJ7H 1MCOL 3G6JA 5TF0A 4L8CB 3QCVH 4XNUL 3TO2A 1U8OB 2BNQA 1XCQA 4E41E 4RAUA 1HYSD 4H8WL 3MOBL 1X5FA 1XR8B 5KSAD 2VXSH 5DZLA 4L5FH 4NQCA 4K9EH 1MIEH 4XWGH 5A43C 4JHWH 5DWUH 3L3GA 4LSPH 2QL1A 3G5VB 5T3ZL 4L29B 2IQ9L 4R0LA 2BRQA 5JZ7C 2AK1H 4MS8D 3KXFD 4KV5F 2WWKT 4YR6B 5TH2A 4RGNB 5DZNA 1PQZA 1QSFE 4Z7UE 2EDXA 3B4NA 3VFVB 2VR9A 3T8XB 1NCAL 3L3DA 1U8NB 4KPHH 1U91A 2YPKB 3BIAX 1RZKL 4D9LL 4GG6A 5EU6B 3MACL 2R4SH 3ARVA 1FL5A 5M7QA 1QFWM 4QOKD 1H5BA 5A2KH 3RPKA 5ICXB 2VXUH 1SVZA 1P4LA 1VPOL 3EDFA 4ODSL 5KSVA 4BSVB 5DI8A 1T83C 4WEBL 3O3DB 3MV8E 4HIIB 4YIQB 1WCBA 1NDMA 3RVXD 5EN2B 4R96A 3T0ED 1KFAH 1HHGA 3FKUS 5JOFB 3V0WL 1FV1A 4WUUD 5ITBH 1F3RB 2GT9A 3C6SB 5AYUH 4ZMAT 1X5AA 1NGXA 3QNZA 4RNRA 5C0BD 1T22A 5SWSD 4PGBB 3RTQC 2EDRA 4J6RH 5KJRL 2R2CA 4Z95H 1WBYB 1OGTB 2HFFB 4X8JB 4G43A 2KL6A 5LGKA 4XH2B 4OZ4A 1HILA 2GSGA 4U1SB 4Y4HA 1ZLVK 1WFNA 2JCCF 3GK8H 1QEWB 4JDTL 3FQWB 4NBXB 4NYLB 4G9FD 4KK8C 3FQXB 2FEEI 4OSUL 3IJYB 2H6PA 3VD3A 2FECL 4NGHH 2HT3D 3DRQA 2FHBA 1CTOA 1RUPH 3HA0A 1FO0A 1D5IL 4JO3H 3QA3A 5ID1B 5MENA 1SM3H 1EAPA 3O4OC 1JV5A 4LBEB 3VGDA 2NY3B 5GHWL 3U2SA 3ARGC 4XNQB 5HGHA 2EKJA 1GAFL 3W39B 4PJFF 5IEHB 5ITFA 2XYCA 3PHQA 2HMIC 1TVHA 3MJ8A 4CJ0A 1UZ8B 1JUFB 1JMXA 4APQA 2D7NA 3OGCB 4PJ5D 5IMLA 3FMGL 1U58A 4M9OA 5GSVA 2DBJA 1FL6A 4F33A 5I8OH 4FHBD 1JCKA 1PDKA 4GRWE 3DSNA 3KS0H 2FEDD 3EYVB 3A6OA 1ZT7B 3L5XH 2LVEA 2JB6B 3HKFA 5I18L 3D9AL 3QCVL 4OFVA 4TUKL 2QQNL 4GAYA 5I30H 3HNTH 4KKBD 4POZC 3IRPX 4HUXA 2UY7A 5DDHA 3VFNB 2NW2A 4Z5RB 3S9DB 5J3HC 1AY1L 2IALB 4F57L 3PWVA 4N90D 5JPMB 1J8HE 4EXKA 4G6AD 3Q1SL 1ED3A 4JFXA 4HWNA 2CK2A 5FO7A 3EO0A 3QBTB 2V2XB 5B3JE 2PO6C 2P47B 4S1QL 4QRQB 4NM4L 3KPRA 3O6KH 4X4YB 1PW3A 4WFGE 5KS9E 4EN3D 1CG9A 1SEQH 4DCQA 5HGHB 3FJTA 2A0LD 3ARBA 3QG7L 5CBAB 4S1RL 2AAVA 1OHQA 4Y2DA 3U9PH 4FTVA 3EJZC 2YA0A 5GGUB 2P44B 3WL9A 4A2MA 1G7MA 1P4IH 3MO1A 3O8XA 1TCRB 3X11B 2VXQL 5I66A 15C8H 4ZUUB 3RKPA 3TA3D 1N6UA 3VXPA 4C54A 3ULVC 3QUZA 3RBSA 2B39A 1A7BA 3DO3A 2AJ3A 4M6AA 4G5ZH 4Y1AD 3F7QA 5E24E 1PFCA 2XTLA 2GJJA 3L5HA 2H3NA 1MHHA 3HG1D 4KK5D 3HZVA 4R4BA 4LGPB 4Z7QF 5DQJA 4TNVK 1FZKA 2DLFL 2HG5B 5AYUL 3G08A 5DQ9A 5INCB 3MRLB 4JGUA 5EZIL 3U30B 1QBMH 1UJ3B 5C86A 3PDGA 4ZUWB 4NRYA 1GZQA 4R9HA 4U6HB 1BBDH 2Z31D 3N1FC 4R26L 1HI6B 1R3JB 2BK8A 2IF7A 1ONQB 1J12A 4YQXL 1YYML 3DETD 1J11A 1KLGB 5I8OL 4Q0XL 1U8QB 3MRCA 3HPLA 2Q6WB 1UACL 3H9ZA 3I2CH 4Y4KC 3VFOB 3D3VA 3MCLL 4H1LB 4PJ8D 4K3HA 1BJ1J 1WAAF 2YUWA 1TLKA 3OX8A 4NQVA 3HS0B 3OAUL 2FIKA 3QT2A 3FZUC 4U1MA 5F9WB 4I0PB 4FQHB 5B8CC 4UIKL 5EBLA 5KSUB 4TTGA 2Z92B 5IHUH 3CH8A 4MQ7B 1CVSC 3K8KA 1YEJL 3QDJA 4KMQA 5JMRA 1N2RB 1A7NL 4B0MM 4X6EB 4U6TA 5JR1L 3RGVC 3WNLA 1KSRA 2FJGA 4XB8A 4R90L 3JV6B 3TNNA 5T3ZE 1D5MA 4YHIA 1SBSL 4LP5A 4UV7L 1AO7B 4HKBA 5HHME 1D9KD 5I75B 2AEIT 1R3KA 2OZ4A 5EU6E 3C2AH 4EVNA 1C5DA 1WBZB 1BP3B 4H0GA 4DKAA 2IBBA 4R8WH 3HE6C 2Y25A 3JV4A 4ZTPH 4BSWA 4BZ1L 2FB4L 3BP5B 1PAMA 2CJUL 1UKQA 2NY6D 4R2GB 2DIAA 3FN3A 3EGSB 1WAAA 2VL4A 2DI7A 5D9SA 3FN0L 4NRZB 3DMMB 5C0EB 4XBPB 5BS0D 2NY7H 2Z8VC 1EA9C 5CMAB 3MRDA 4NYLA 4NN7C 3WFHB 4X83A 4HHAB 2XOTA 1QBBA 3W11C 1YY8B 2J8UE 4G3YH 2VDPL 4FFVC 3HMXL 4LHQB 4FQCH 5FHAL 3VDCA 2BC4B 1B0GA 5DR5L 4ODVL 4GG8B 3U7WH 3KAAA 2H8PB 3EO9L 3OKLB 1T7YA 3QDJB 1P9MA 4JM2C 4M8VA 3MREA 2ENSA 2J6EA 1N4XH 4OIIL 5LWYL 1ROWA 3IB4A 4X0KA 4QRUB 1Z0MA 3RI5F 4RIRA 5TE4L 3VWJB 1I3GH 3QUXC 1E4XH 2VABB 4NO5A 4RGND 4KJYB 1DR9A 1F6FB 1HQ4A 1RUQH 3VFWA 3HLAB 2YPVH 5DJYB 3SKUD 1XGYH 2VLJD 3WXVL 4G9DA 4FQLL 5BRZB 5I16B 4KKBC 1HIMH 4OZGE 2Z8SA 4MJ6B 4JGMA 1DVFA 1ZANL 3AXLA 3HE6A 4MCYA 5FYKE 4EOWH 4MXVE 1GC1H 1XGRB 2ICWI 2P8MA 3WLWD 3ILPA 1S7TB 2X9XA 4YXLH 5I6XC 5JUEH 3QWOB 2FEDC 3NABL 5I74C 3SE3C 3ZDYE 1YNTB 3FQRB 5EZOH 4U1JA 4CVXA 4QOKE 1OD7A 2H1PH 4QXUL 3M1BB 2HP4A 3AXLB 2DRUA 3HE6B 4Y89A 5F89A 4F7EB 2LQRA 4RQQA 3QZWA 3LQAC 3NCYP 3LCYA 4N0RA 3C5ZC 3LN9A 3ARQA 1MFEL 1HHJA 4NQDD 3DMMC 2CIIB 1CGSH 2DM4A 5J6GB 4JRYE 4XMLL 3THMH 1FLTX 2HYMA 3G5YB 1CIDA 2EYSB 5IJVB 4TUOA 1TNMA 3T77A 2QJDA 2R69H 2VISB 5I1GH 3QDGA 1KJ2H 2K7PA 3B83A 4XNZC 3PHOB 1T89C 4N68A 3B43A 1WCQA 1S8DA 1YUHA 3HC3L 4OT1H 4Z7NF 5E8NA 1TJHH 2Z93A 1SJEA 4ZUSB 5A1AA 3H3BC 1IKFH 3EBAA 4RBPK 4KKNA 3S5LG 4Q6YA 3ULUE 1SJEB 2ED8A 2IPUK 1ZK9A 3KNBB 1MRDH 2PUQT 4KRPD 4Y1AB 2XY1A 1RY7B 5D7IB 3WN5C 4BSWB 3TN0B 4KJPC 2E6PA 1HQRB 3C8HA 4JPVL 2QR0A 5KAQF 1QZ1A 4MXVF 2JJVA 4EUPH 1MCSA 2JK5A 5IFAL 5I1IL 1A21A 1KIRA 4P99A 4PRID 4PTTA 5F9WC 3TBTA 1Q0XL 2FH8A 5EOTB 1EGJA 2DWEB 4NCC1 2J5LC 2V2TA 4YDJA 5F9OH 1N7ML 2CLVA 3BMWA 1X5XA 3BPNC 2BNRE 4OBRA 2EDKA 4XNYH 1M05B 3DX7B 1U0QA 3D85B 1NC2D 4RAVA 2FBJH 1K5NB 4LCUB 3TZVC 1MCKA 1VFAB 1T5WB 1YQ2A 5ERWA 2IH1A 3LZFL 1IAKB 1V7NH 2N1KA 2Q7NA 1RZJC 5IMLB 1GXEA 3AS3A 3MLTA 2BFVH 4YHMH 1ETZB 3GMPA 4JFFD 4ENEC 2E9IA 2EDYA 2W60A 1R3LA 3RDTA 3HPLB 2H32A 3O2DA 4ODTH 3KHOA 3GMOA 4MAYD 1VHPA 3P73B 4C56E 1UT9A 5I16A 4R7NA 5BW7A 5HHOE 4YK4C 1U8OA 5HVGB 2AERT 5FM8A 4PJBA 3BZ4B 2YKLH 5IG7B 3LAFA 5CZVH 1J88A 3MA9L 5K9JL 4JFDA 3FO9B 3B8SA 4NIKB 2DBLL 3O3AB 4RISL 2BVQA 3CUPA 3C6LA 1NDGA 1KIQB 3RDTC 3GHBH 4AIXA 4H25B 4ODWA 3VXSE 4G6JH 4NJ9L 1J5OL 4M43H 2YPVL 4OF7A 4HIJA 4YO0A 3UTSD 3LKNB 3BZFA 1KC5L 3REVB 3U30C 2FGZA 2VXQH 3GI8H 4IRSC 2JKXA 3PL6C 1P4IL 3EYOA 4UQ3A 5LQBH 3PNWB 5C0ND 5BZDB 4D0DA 1U8JA 3MUHL 3OKMA 4P5MA 4HX1B 1X4YA 1CFTA 1R3IL 1AC0A 2AJZA 5D2LB 2B8OT 1H8SA 4RNRB 2IAMB 3QFJD 4YHNA 4U33A 4YFLF 1IGMH 2BSED 1H3TA 5F72S 1MWAA 4O51A 2VB5A 4KQ4H 4IOIA 1TTGA 2YXMA 4XHJD 4FNLH 1YNKH 5E5MA 5JW3H 3VCLA 4ORGB 5T33L 4ZFOL 4IOIB 3ARBB 4V2BA 5KSBF 5DI8B 3IT8D 4LCIL 3FB7B 3NPZB 2VITB 4X7TB 2BHZA 4I3SL 4NCDA 4L1DA 4X7FC 5HPMA 1HH6A 4ELMA 2AI0H 5IOPA 1JZ7A 1V3KA 5C09A 1JNLL 1QHPA 3IFOB 5DD6B 1MLBA 2XTJE 4HUVA 1ES0A 4GAFB 5IWLA 3VRLE 4ZAKD 2VDKH 3BKYL 2ICEB 3O3BA 2JCCE 3KPOB 3TCXA 1IEAB 1G7JA 2AGJL 2AJVL 1NCWL 1YPZB 3DRTB 4G6JL 3C5JA 5J4MA 1ZXQA 3MXVL 4M43L 4H25A 1KTDB 1QFWI 4JHZA 5JNYA 3OPZL 1VEOA 5I1EH 2ESVA 1FIGL 2LE9A 4WVRA 1F90L 4ZUVA 1OAYL 4FXGA 4FFZH 1U95A 4X6FA 5F3BB 2BSSA 4KHTL 3LV3B 4EJ1C 3PDOB 4Q6IA 3W9EB 4HXBL 2XXMB 2E27H 5TDNB 4PJFB 2ZPKL 3GJFH 5ACZB 5CKAA 3PWLB 3QUYA 4Y2OA 4YAQB 2HRLA 5DRZB 1A7OL 3STZB 1R3LB 1EEYB 1ZA6B 3OKKA 4ZQKA 7FABH 1KTLA 2Z35A 5GS1C 5E4IA 3PWJA 4PGCA 2AK4E 4AEFA 1Z9OA 5K93A 5CSZB 5I8KL 4Q2ZA 5JIKA 2GAZB 1RU9H 4Z7VF 1NFIA 1IC7H 5DJ2B 4YFEA 1A4KB 3V4UL 1MNUH 1T20A 2OMBA 4L8DA 3C08L 1ORSB 5D93C 2VDRH 1S3KH 5CD3A 4XC1L 3VWKD 3HI6L 1PY4A 4MB5A 3MLYL 4YXKL 4U6YA 4EI5D 4HWBA 5FOJA 3HC4L 3UYPA 4BQ9A 4J23A 5FO8A 5ISZE 5KW9L 4Z95L 4RIRB 2X4TA 1I7RB 5A40E 2CJUH 5GS1A 1QA9B 3ZE1F 5L2KA 3EFFA 4HLZG 5E8EB 1LO3L 1EBAA 2P8PB 2Y36H 1I9JL 2B20A 4QHKJ 4P9HH 4M8QA 4UV4H 4YX2H 3PF2A 1NPUA 4PREB 4FQPA 2OK0H 5HPMB 1NGZB 1ZGLB 5JXAH 2W9LA 5DUPH 1EBPA 2NZ9D 2R8SL 3FO9A 2VDLL 1HHKB 1WK0A 4OKVA 5E5MB 4NC1E 4H8WC 4WW2F 1NFKA 2YEZB 3H8NA 4AG4L 3T0EB 4LMQE 4R7NB 5EOCJ 1SYSB 1FH5L 3R1GL 5HI4C 3T1FB 5BS0A 1ZSDB 4OFPA 2AV1A 4X5WA 3O6FA 3G6AB 3ARPA 1N5YL 1UXSB 1GIGL 1CGSL 2R0ZH 2FD6L 1CBVH 1CD0A 1IQDB 5JTWA 3QUML 4L8DB 1A1OB 3QZWB 4EBQH 1S7WB 2I07B 3M17B 3TBWA 3DPBA 4M7ZB 4IRZH 5DRWB 1IQDA 1JHLL 3MYZA 4WI3A 5F6IB 1S7UA 4L29A 4R0LB 1KXTB 1UWXK 5FGBA 3KVQA 4NQVB 4ZOBA 4P2RB 2OCFD 3U0WH 3RFZC 4HJGA 3RKDC 1AGCB 3WSQH 4HFWB 3OKDA 5C0AB 3U46B 4G8GD 1TFHA 4KMLB 3UYOD 3O11A 5FYLD 4N9GB 4O5LL 1JPSH 1BWWA 3IS1X 8FABB 2B1HH 2HT2D 5GPRA 4XC3H 4G5ZL 3GMOB 4CN1A 4F8QA 4ZFFB 3OSKA 4G8IB 2C5DC 3Q5OA 4E0RB 3CXHK 3MGOA 1T1XB 1ORQB 4JFEE 3G6JF 1DEDA 4DUWA 5L0QC 1ZHLA 4NQSB 5I6XB 3SO5A 5LGJB 3NIFF 2EDBA 2IH3A 3P40A 2OL3H 5IW6A 4K7FA 4W81A 2W91A 2FYYA 4CN4A 2R0KH 4AH2A 4YLQT 1MLBB 1MVUB 2QQQA 4PJBF 1F4WL 1T5XB 4Y5XC 5DURD 3LZFH 2CLVB 4UB0H 2DLEA 5HVHB 4TVPH 2NR6D 2VLRB 2DQHH 3GSUB 4JZNB 1JVKA 4JPWH 4S0TD 3QPQD 3K4ZA 5C0BE 4M6OH 5FGCE 4X7TA 1CICB 1IAMA 3FFCD 3UZQA 5EN2A 5CHNA 1NQBA 1OSZB 2RB8A 2A73A 5D1XC 1BGXH 4YHZH 3BGMA 1OD9A 4Y5XB 2VTFA 4RGMB 3BP7A 2CIKA 4PB0H 3EFDH 3UO1L 5MI0B 3C5ZB 1YC8A 3BT2L 3GSWA 4M48H 1H0DB 4XPHH 4WCYL 3LS4L 4YHOH 4ZDHB 4WEBH 3MRFB 4G8GB 1I8MA 1TNNA 4MNQA 2C3HA 3S36X 3D39A 2NX5D 3FONB 4P2CG 1KPRA 1RZIA 3JWNC 2QQKL 1FSKB 3RZCC 3O0RH 1G7HA 3SE9H 4X6EA 4I3GA 2ZPKH 2D4DA 1J1PL 4MAYA 2IALA 3G5VA 1P1ZA 1KIQA 5BO1L 4L9LA 1UXSA 4XCCH 5KSAC 3WNOA 1WEJL 3C5JB 2CGRL 1MVFA 3LN5B 3WIHA 2MKLC 2WBJB 5HTSA 4YNYB 2VL5B 1A9BA 3CC5A 4N0FA 3EAKA 4AEIH 1I7ZA 2WIIB 1NC2B 1FYTD 4Z9KB 1YEGL 1QP1A 2ZCHL 1MIEL 4XWGL 1T6VN 1ND0A 1QUNA 3BUYB 1DQLL 1JE6A 3V6FA 1FGNH 1JUFA 3BT2H 1KCLA 2CDGA 1IZKA 4HJJL 1KCKA 4WV1C 5LAXB 3RNKB 1DVFB 2D3VA 4ORZC 1A5FL 4MNGB 4GW1A 4PJAE 1FN4A 3FO0H 4RFOL 4DZ8B 1RZ7H 3MNZB 4OBSA 1D9KC 4QY8B 3KPPA 3OKEA 1K6QL 4ETYA 2DS4A 4OZHB 1U8MA 1YEHL 2FX9H 4Y0GA 4GMTL 1IGJA 1S9YA 3OR7A 3MV8A 1AP2A 1NLDL 3X3GH 3WHE0 2LU7A 3VFMB 3VH8B 3MGTA 3X3FH 3MRKB 3ZTJH 3OKLA 4Y19A 3RY5A 4M7ZC 1F5WA 3FQUA 4D9QD 1RJZB 1CK0H 3LDBC 1A7RH 1OP3K 4P9MH 2VLKB 4CMMA 3MRJB 2NX5E 3ARTA 1A6AB 4LHUG 5IIEA 1KULA 4KKAD 3ZL4H 4XCYB 1JYVA 4KTDL 4PJAB 5IKCB 1JZ5A 1ZT1B 3C6LC 3ULVH 2Y1VA 1MCIA 1FHGA 2IBGA 3CLFH 2LU4A 2OR9L 1I4FB 4CADA 3T3PE 3RX5A 5D70H 4YE4L 3FFDA 4I3RL 1S78D 4EUPG 1TTUA 2FH6A 5H2BA 4D0CB 3QIWD 1B2WL 4LL9A 2IFFL 2HFGH 3LSOA 3GB7A 4F57H 5KSVB 2Y06H 1YN7A 3QEUB 5CUSH 4MJIA 2R9HD 3BKYH 1RUKH 1MHPL 1H5BB 4GKNB 3QEHA 5B3NA 5C0AD 1MRCL 3GRWA 1QR1A 5T3XL 4KRMB 3L3JB 2OZ4L 1JNLH 4M62L 5HHVH 1IM9B 4JG0H 4XX1G 5EZJA 3U7WL 1HXYA 2ZOKB 3NA9H 4L9DA 3RWFA 4YHYB 3BW9B 1KTLB 1PG7H 5EC2A 1LEIB 3QZWG 4YR6A 4HUWA 4PJGB 3ZKNC 4LRIC 4L4TE 3FFCA 2BOBA 3EYSL 1U3YA 3VWJD 4S2SA 5DD1L 1B3JA 4X5LA 1AGFB 4JFHE 1EJOL 1B6UA 4XPFL 2SEBB 2CKNA 2GFBA 2QHLA 2O93L 5I19L 3BDBA 3WUWB 1T1YB 3IU3A 4JDZB 1KCSH 5HYJD 4LLMB 2A73B 2AKRB 5IFAH 1BIHA 1A02N 1U95B 4EI6A 1D5BB 3QDMB 4M3KB 3KPLA 4JB9H 4AL8L 5JXAL 2LFGA 4HKJA 3N06B 1NUGA 1FNEB 4FQXA 4X5XA 3V5DB 4V2CB 1BBDL 4OUOA 1KLUB 3SJVD 2WQRA 2H8PA 4YX2L 1T1ZA 5EORH 1IRAY 3NCJL 1OTSC 1AD9A 1MSPA 4RDQF 5EU3B 3OR6A 4PJIF 3EYQC 3SKNB 3CSYB 1AXSB 4WUUB 3MMEA 3S88L 3HNSH 1A6UL 3CK0H 4LLYB 1UYWH 1EEQA 1HCVA 3MRDB 3CVHH 4KVCL 2QSQA 1K6QH 4KZEH 3K8LA 5EZLB 2BRRL 2IFGA 3OAUH 2BERA 4P59H 3RUGA 4JN2A 4RMVA 1T66C 1NSNL 4PJBE 3GRWL 1IEBA 1NBVL 4HPYL 5DJ2A 43C9B 1HSAB 3ARGB 1S7SA 3T0DA 5HGDB 1HEZB 4KY1H 5JHDE 4Z77A 5GRUH 3WV0A 4MD0B 1FGVL 1JZ8A 4HFWA 3WUWA 1CD1A 4U1JB 3BIKA 5HDQH 4ELKA 5IVXA 3STBA 1AGFA 3UTTB 1EDQA 1EUTA 1V7NL 3E6FB 4ZSOA 5KN5B 3HAEA 1CF8H 4OCRH 4HK0A 5CD5C 1QSFB 5DD5H 1S7UB 2R4SL 4P23A 3KPQB 4LEOB 5E2VL 2V2XA 1RIVL 1H3WM 3SO3C 4UOW0 4MA7H 1IQWL 3O2DL 4KPHL 4XTRD 4Z7UA 3IFNL 4LNVA 2ZNWA 2P5EA 3ZE0E 2YA2A 4O2FB 2W9EH 4IRJB 4NP4L 3JWOH 2LU3A 1A9BB 5F3HB 4WIQA 4DQOH 2ZUQB 2LTQC 3E2HC 2APFA 5LG1A 1UACH 2D9QB 1KTDA 4P4KD 1AKJD 1CGWA 4X0KB 2C26A 4BQCA 1ZT7A 1VERA 4EDWL 1IEAA 2FIRT 1VSCA 3GBNL 5C07E 1UG9A 3OF6D 4PG9B 2ZG3A 4PJ8C 4D0CA 4QXGH 3G6JE 2J88H 1KF9B 4BYHA 1H3UA 2KZWA 2JJUA 4Z7WE 2XWBA 4M5YL 4F58L 3QCTL 4O2CB 5SWZB 3MLSH 1JYXA 5IMOB 5LCVH 1NFDF 5GS0H 1M7DB 2HTLD 5D1ZB 2DM7A 5FO9A 1IC5H 1EO8L 4IRSA 2MQCA 2HG5A 3P2TA 1U3HA 4NQXB 5IK3B 4ZXBB 3PL6B 1N6QH 1ZEAH 1BQUA 3HE7B 3BP7B 4GSDH 4PRBA 2ERJB 1BJ1H 4YHLL 2AABH 1BMGA 2P8PA 2VDNL 1X4XA 5KOVC 1GAFH 3ARFA 1JFQL 2E7CA 5CHNB 3P77B 5JOEA 4QO1A 1XF4A 5F9JB 2DYPD 2VZSA 3KS0J 1JZ2A 5D5MA 3BHBA 2NY2C 1ZHNB 1QEWA 1I1FA 4ZOEA 2VRAA 2VE6A 3W11D 1PKOA 2X42A 1G7LA 3UJTH 3V6OA 1DQJB 1T1WA 1G7IB 1MH5A 2CR6A 2GKIA 2YPKA 1P7KB 3TP4A 4D0BB 4X4XB 5EH1A 1X9QA 2EIZB 4WFEE 4AIZB 4ODWB 4ELMF 3LKRA 3GSNH 4LCCC 3ZE2F 3WS3A 1YNLL 1UZ6F 4FQXB 3V5DA 4BH7B 1T4KB 4JVPA 4K2UL 2V6HA 3LQMA 4GLRI 2R0WH 5DRZA 2GQHA 1DTUA 3FCTA 3BZEB 2Z31C 1U8HB 2HA1A 4OLUH 1INEL 2XPGB 4PRAA 4WFHD 4YIQA 4OV5B 3BUYA 3MPCA 2XG4A 3ILQD 5TFSL 1MEXH 1LP9A 1IT9H 4PRAB 3QXAB 1P7QA 4YNYA 4LCCA 5EU6D 3D9AH 1CE1H 1TETL 4JKLA 4XCFH 4P3WA 3TYFA 2XKNA 3GIVA 4CU7A 4RMWA 2ARJA 5BOPA 2FD6H 3D48R 3RWIA 5DMIL 5I74B 3MLWH 5DK2B 2HJKB 1UKTA 4MAYB 1MWAH 4XGZB 5ID0B 1NBVH 4I18A 5H94B 4WU5B 1KB5L 1XGUB 4WUUE 5IROC 3L7EB 1FRGL 1A6ZA 1BD2A 4FZEH 5GZOC 2X70B 2NXYB 4LSUL 4I77L 3LHPL 3QULB 4IHOB 5F9OL 1Y6MR 5CP7B 1RI8A 4S0SD 4PGDA 3NCCB 3CFIC 3Q6FB 3RX7A 1WT5A 4WV1B 4Z7VE 2DMBA 5CP3A 4ELKB 1XR8A 1AQDB 3LMJL 5HHNA 4WNQB 4LCYA 4B7LA 3QUKA 1DP0A 1K8IA 3NZHH 4Z78A 3C60B 4I9WD 4YQXH 1YEDB 4FFYL 1VFBA 4RFEA 1WC7A 4YGAB 2VAAA 3VFGL 3QAZC 5CJOH 4QGYA 2GUOA 3DURA 5JA9A 1E28A 3EFDL 3LRSB 2L4OA 1NC4A 5DEGA 3ULVD 3U9PL 3X17A 2IAMD 4KK5C 1GGBH 2ID5A 5ICZB 3V7MA 2P5WB 5DK0A 1GYAA 4HLJA 1BEYL 1FQ9C 4FQJH 3TV3L 4MA8L 4AH2B 5CGMA 1IMHC 5F7FA 5LGJA 5C6PB 2XWTA 5CD5D 3PWNA 1N6QL 1BF8A 4NQEA 4JFFB 1FE8L 5EBLB 5KSUA 4PJ7F 1EHNA 1YEEH 4QHUA 3VGFA 4BA8A 5MENE 2C3VA 4J3WA 1P2CA 4OQTH 2H2SD 3KPRD 1LP9E 3S8WA 3NAAL 4O9HL 1H3GA 4ONHB 2G75A 5L2JB 5E5RB 4M62H 1I7UA 1OB1B 5HHVL 2R9HC 4ZPVA 1I1CA 1J1OL 5HHNB 2ZKHH 4LGRB 3D39E 5T5FL 4F7PA 4GAJL 4NWTH 4JFOA 3UC0H 3VFPA 5FYJE 5LJYH 1CS6A 4Q6IC 1GGIH 3Q6FA 2G5BB 4YXLL 1QTYT 3SBWC 1YYLH 4EUPB 3E6FA 1BZ7B 5L0QB 1ETZA 1QLFA 1UM5H 3WE6A 2NMSA 3WYRA 5GZOD 4OCWL 1XGQA 3MRLA 5IVXB 4ZOCA 4PJGA 1VACB 1RK0A 4PRIA 4X99B 4KZDL 1L7TH 2D7PA 3GM0A 3EOAB 1KUMA 4OIAA 5DA4A 2D31A 4NN7B 5TDOA 2UUDK 3MR9B 1DN0A 1KPUA 4MA3A 4UILH 5T1DH 3SDYL 3MLVH 5I2IA 4TPRH 1ZSDA 5AD0A 2ITDA 3NH7L 4OCSL 5CWSA 2BOCA 3MLZL 2QSTA 5IMKB 1PX4A 4EBQL 4NWUH 3ULVF 3OXRA 4HPOH 3RIAF 4ODVH 3QWRA 4NSKA 4UT6L 3MV7A 4XBEL 3VW3L 1NMCC 4PY7A 1U8HA 2Y9RT 5D7IA 5A2FA 1YEEL 3IKCB 1BIIA 2DTSA 3VI3F 5GGTA 4JY5H 3H3PL 4GXUM 5C0EA 5C08A 2VLJE 4OB5L 5FO9B 4X7DC 3ZKND 2BY2A 4LDEB 5JXEC 3IAQA 5ILTL 3N50A 4OLXL 2IG2L 2E9JA 2FB4H 1TDQA 4PP1C 4Y4HD 5IR1B 1N59A 3BQUA 3N1MC 5KOMC 1WC7B 4LSQL 1NDMB 5HHXL 2X7LB 2XFXA 4R8WL 5ADOH 2VE6B 1NEZB 1WUNT 5EORL 5IJVA 1DUZB 4BK4A 2XN9D 4LHUB 5E6IA 4PPTA 2HT4C 2CKBA 2DDQH 4P0DA 3MLPA 1N8ZA 1SBSH 2IANE 1OAQH 3VH8A 1DBJL 3MV11 4HF5H 3VG0H 5DEFA 5DUML 1XR9B 1JGVL 1KPUB 3SQBA 3WEXB 3MBEB 4WO4C 5FYJU 4ZFZA 5D1ZC 5J06A 1MCDA 2QQLL 4BM7A 3AMKA 3SKMA 3RWFB 1IFHH 1U8NA 1A3RL 1C1EL 1VB9A 5CGYC 3TYGH 4P5TB 2P48B 4YPGB 1RZ8B 5E8PA 5JA8B 1TIUA 4MX7B 4G8EB 4QTIL 1BD2E 3OGCA 5DSCA 1NH6A 4LRNH 4YUEH 1DBML 5DLMH 4CVZB 1U36A 3CVIL 5FGRA 2CDGB 3MNVA 4DZBA 5IFJB 2BSTB 3TJHD 1MNUL 4LCCB 5C70A 4OZHF 3KHQA 4JO3L 3QQ4B 1RIHL 3IF1B 5FUOL 1IBGL 3S4SA 3NVQA 5H2BB 1NC2A 4LLUA 2HTKD 2VYRE 2X4UA 1ITCA 3BRDA 1MAML 4HUUA 4WCYH 2OI9C 4FXKA 3UXFA 4HMCA 4PJ8B 3GRWH 1REIA 2P5WE 5DFWH 4OZIA 3UP1A 5FF6A 3IXTA 3NN8B 4TVPE 2NY0D 2XACC 4R4BB 5F9AC 4AENB 1G7QB 3ME0A 5F9DC 4OLUL 3GO1H 2RQ8A 3TWCL 2ERJC 1A1OA 1U92A 4ODHH 1KYOK 4PBXA 5CJQH 4M7KL 4UTBH 5EOCL 4U0RC 2EDLA 3BH8B 3HR5B 4ISVA 3KYNA 4G8GA 4DVBA 1I8MB 1J0IA 1LHZA 3QG6A 1QLRB 4YHPA 1PY9A 2HVJA 3FB7A 3VWKC 1FNEA 1OSPL 3VXMB 3HZMA 4PJDA 3OKNB 3LEYH 1FYHB 3WD5L 5DJDA 4IS6A 2CXGA 1UJTA 3OJDA 5D7LD 3IU4H 3IDUA 1VEMA 4XNUH 5DA0B 3ZDYF 4NOBA 2G60H 1VFBB 4HWBL 2I9LB 3NH7H 4OCSH 4HWZA 4RFEB 2PYED 4S1RH 4NUJB 4LLWA 3D18B 3RWHA 3U36A 5DMKB 4Q9RH 1CXIA 2VZ3A 4E5XB 2DTML 5MEOB 5FYLE 5HI5D 3DYPA 4LNRA 1CI5A 1JYNA 4HS6B 3EHBC 3MRRA 4TYUA 2AJSH 5DC0A 1JTTA 3SJVB 3H9SE 1DLHA 1N0XL 4HX1A 3AY4A 4JFZH 4JFEB 1FAIL 3THML 3GJFB 3OXSA 1YMMA 1HSBA 1KJ2A 3EYOB 4IMLB 1XGUA 5C2BH 2WW8A 5DHVA 3UBXA 1G7QA 5I73B 4LVNC 1BVZA 3LN5A 1INQA 3VXME 2QLVB 2QQNH 1CDIA 1XCTA 4GKSB 3VXUB 1QFUL 4GXUN 1F11A 1VKXA 2EDOA 3WXWL 4OGXH 2ZCLH 1P7QB 1QKZL 1U8LA 1IBGH 5CEXB 3QIBB 1OAZL 4TVPD 4D94A 4RWYH 5JOPD 2O5XL 1RSFA 5IGXL 3EOTH 4MSWA 2VLKE 3HC0A 4ZFOA 2E5EA 5E8OA 4DFIA 4R97C 1GRWA 1AR1C 3FCTB 4HAGA 1EEZA 2UZYB 3P11L 2DF3A 2EDDA 1L7IL 4NO2B 1U3ZA 3ARED 5AZ2H 1QLFB 3QWOA 1FH5H 4I0CC 1PKQE 3U4BH 1RIVH 1KCVL 5HHPA 3HI1B 1AIFB 1RJCA 4UIMB 2R2HA 4QYOB 1Q9WA 1HKLL 5HYSG 1G7IA 3AC0A 3WEXA 1KTKE 1OP9A 3QIWB 3QJHA 5IB3B 3EKCA 1IL1B 4JQXC 3RTQB 1MHEB 2DIJA 2NYYD 4TQEH 4L4VB 5DS8B 3DYOA 1CQYA 2FJHB 5FDWA 3SCMA 4K3EL 4QXTA 3KYMB 4NQDE 4ZYKA 4AM0A 4K23L 2C3VB 5E6IB 1KIRB 1KG0B 2UY6A 1S7VA 5D1XA 2NY2D 3MMEB 2LAAA 3O8XB 4NQEB 2ZP0T 2XNAB 4RFNB 1VCAA 5DHVB 5I1CH 1MVUA 4KXZH 4EKXA 4UAOB 5C6WH 1FFQA 2PYEA 1YPZF 3RWGB 2FX9L 1FCGA 3S3PA 1ZLVH 3BYTA 4KZEL 4Y4FC 5F44A 3GO1L 3SPVB 5KAQG 5T3XD 4PJ5E 4X6DE 3QH3A 4OAWA 3MBXL 1TVBA 5IFHL 2N7AA 3L3OA 3P0YH 2XXCB 3GIZL 3WNPA 3FN9A 2UVEA 1B88A 3LQAL 5INDA 4R96B 1F4WH 4LPYA 3QDGB 3HRZA 1YJDL 1MAKA 4LAJH 2WM0A 1T1YA 1ZHBA 2OL3L 1LO2L 3WFDH 4WO4D 3SE3A 4Z7QE 2E7MA 2OYPA 5IM7B 3TPUB 3R4DA 1MI5A 3MV8B 4PJ9B 3VRJB 1UB6B 1CWVA 5JDJA 4L4VA 3ECBA 2W92A 5EC2B 3QXUA 4XVTH 1G7PA 1LEIA 1FZOB 4CRPA 5B3JF 5E7FA 2MSPA 3VXTB 3LKQA 1FFOB 4DN4H 2JCCB 2CDFA 3BPNB 4HK3J 4YFLI 1NBQA 3D2UB 1KPRB 1RZIB 4HJ0D 4HZAA 1QRNE 4YDKH 4F7TB 3VXTA 4FMKA 1YNLH 4KMTH 5MEND 3EZ8A 3ECBB 1IC1A 2A77H 3MROA 5T1MA 1ZA6A 3CUPB 5EUOF 3WS6C 2X44D 1AY1H 1KB5B 2FIKB 2D0HA 1FFPA 1VGEH 1SJXA 1TZHA 1M6OB 1TQCB 4WUKH 3EUUA 3O6FC 4YAQA 4DGVL 1U93B 3VXSA 2F5AH 2X10A 3P4NB 4IM8A 4M48L 5I18H 1D5ZA 1JWUB 1FJ1A 3FB6B 5T1DL 3FFDB 1F2QA 4BSJA 1T2XA 2NY3D 4Q9QL 3QIBD 3BI9X 3P0VL 3CFJA 4ZO8A 1MQ8A 2IPKA 1X44A 4HLZH 3ZKQD 1QBLL 1A6TA 1KENL 1N26A 2KZ1B 2PETA 3VA2C 4E41B 1GZQB 3CSBA 5ICYA 2YN3A 3L7FB 2DQIH 1N5YH 5KVGH 1QLEL 5C0BA 1MFCL 4PJHB 2PW2B 3WKNA 4LGSB 3CPLA 4I3RH 4S1DD 1AXSA 4WUUA 1VEPA 5JORB 2AJUH 2XN9A 4AG4H 4XP1L 1IGYA 4OCLC 1EHLH 4KC3B 2MWCA 1B0GB 1MHHB 4HCRA 1PLGL 1WISA 3S34L 5K9OB 2F9BT 2AXHA 1UH4A 2DQTH 4PJ9A 5IBUB 5C0IA 3DMMA 4DOHE 2WWKO 3LRSA 4NFBA 1SYVB 1CXKA 3V9FA 4W6YB 4PRPA 4PB9L 4LNRB 4LHUA 1KIPA 5GIRA 4FFYH 1LDPL 3RWEB 3TA3C 2I5YL 3DUUB 5CIPA 3T0EE 2D7MA 4HWZB 1S9WA 3VFRB 3GEWB 5MP6L 4LF3A 3P3YA 3UBXI 4ZO6A 1JF6A 1NKRA 1UWGL 3WLWC 1HOCA 4I8DA 5D2LA 1KT2A 2HFEA 3R06B 2L0DA 4WU7A 3T3PF 2AXFA 2V7HB 2FWOA 4HG4K 4PFEA 4NN6C 4H0IA 4HUKB 5IMMA 2CO6B 2EDWA 3PNWA 4Y5YB 4UOJA 3K46A 3F7VB 3AM8C 1LE5B 1D7FA 1FSKC 3UPCA 1YMHB 3IDGA 4OD1H 2VL5A 3CC5B 2OMNA 4N8VB 4YO0B 4OCYH 3VD5A 5CEXA 4QRPE 3VXRD 1T03H 4TSAL 5FK9B 5IBLD 5FF6B 3DX6A 1OL0A 3RA7H 3QJFA 3F62A 4PS4H 3LMJH 2WBJC 2F74A 2XA8H 3O6FB 1Q9OA 3FT3B 5CBEB 4LU5L 2Z8RA 5TQ2H 2DM2A 2O61B 8FABA 2LVCA 4F7EA 2RCSH 3G6JB 5TPWH 3G6DH 2EXYD 4PV9A 4KVNL 4XVTL 1NUNB 5DD6A 3U7YL 3UZEA 4K71B 5FYKU 5B38B 4P23B 1F90H 1FFPB 3EJYC 1OF2B 3GSNL 4KGJA 3TBVB 3UTTA 3KPRE 4XCYA 5C6TH 4L9LC 3VFPB 4D0BA 3NMEA 2FGWH 4V1DA 2CDFB 3HE7D 5I1JL 2AK4D 5J7CC 3A67H 1H9VA 4TTDD 5MERB 2R1WB 3STLB 4N9OB 1JYWA 1FZOA 3GMQA 2IMNA 5FYLH 3VRIA 4JFDE 1EIBA 4HK3N 1ITBB 1MEXL 2WQ8A 1JNJA 3VE0B 4NQDB 1EFXD 2NY1C 4JCMA 4UMGA 2CXKA 1R5WA 1C7SA 4LDLB 4PJXF 5I66B 4FQ1L 4BH8B 5TE7H 5BZDA 4XP6L 1CD8A 2QADC 4WW2C 1U8IA 3LKPA 4JO4L 2XWJA 4I0PC 3T2NH 5JQHC 4AEHH 4XC1H 5HVHC 4PJFE 3P9LB 4UB0L 4JY5L 4DTGL 2VLJA 3FOLB 2P43B 3V5HA 3S3JA 5GQBA 1NGYA 5IF0B 5LAXA 5F88B 1S9XB 1TCMA 3LQZB 3SDCD 3TH2T 3RZCD 3L5IA 1P5UA 4PJ5B 3PWUB 4MQXD 5I15H 4QXGL 2PXYA 1VPOH 2EIBA 5J11C 1S78C 5E8EA 1JK8A 2AKRA 5FYKL 1WBXB 3C60A 2P46B 1NCDL 3EO0B 3UZVB 1RK1B 2OJZL 2ADFH 4NDMB 5D93B 2O26U 4PYHA 4LIQH 5I0DA 4RWHA 3D87B 1B4JL 3QQ3A 43CAB 1GC1L 4GUPA 4DQOL 4WTZA 4NUGH 1ZEAL 5SWZE 5IJKC 5I8EA 2ADIB 2CD0A 3H42H 5DJ6A 5CIPH 5C0FB 3IFNH 4O02L 5DYOA 4NN5C 1KACB 2JCCA 3MLSL 3O45B 4Y5VA 1INDH 1FP5A 2PCPA 4L1HA 4P5TA 5D1QB 3GUTB 4U05A 4AMKH 2ZKHL 1HHHA 2J8OA 1RULH 2IADB 4ZFZB 3DJ9A 4NCC2 5ITFB 4MWFB 2AV7A 4LAQH 1I7TB 2VZ1A 2DMCA 2F54E 3O4OB 2UZIH 1QACA 1CFSA 3BIBX 3S98A 1RZFH 3F65A 4UNTA 3E3QE 3TBYB 1EXUB 4AYFA 1UQSB 1WT5C 3MRGB 4LLQB 4J7RA 4XI5C 1EAPB 4QRRE 4U0QB 3TO4C 1OB1A 5T33H 3NACH 4OLZH 4LHUD 5EBMA 5EA0H 4URTB 2YPLE 1LO0H 1RURH 4JFPB 3FFCE 1N7MH 3SGEH 5INCA 4WI6A 2VXTL 1E6OL 3LVEA 1F58L 1CE6A 3FQXA 3OV6A 5C9KA 3RPIB 1T04A 1BVLB 1IGIH 1A5FH 1JGEB 3ZE2E 3HN3A 4IMLA 2ZUUA 5CJXA 1JHKL 1LWRA 5DUPL 5ETUA 1G9NC 1BVLA 3JUYA 3B8YA 5F1SA 1G6RB 2BZDA 5IOPB 1S5HB 4U7MA 3BOVA 5ICZA 4G80A 1MREH 3LPGA 4UV4L 5EU7C 2GY7B 2BVQB 2YRLA 4ZFGH 4XVJL 2F19L 4LSVH 2ADJA 2IANA 2CLZA 2R2EB 2VUYA 3Q3GA 3DXAB 4LLMA 1IM9D 4FQ2L 2DBLH 3WL9B 3V6ZA 1FZJA 3BX7C 1VA9A 3KXFE 2Q8BH 3BP6A 4OUUA 3CX5J 4I77H 2W0FB 1MCPH 3VXSD 5KW9H 3O11B 1OWWA 4QCIA 2XICA 5DD1H 2PF6A 3EW3B 1VACA 1LQSR 5GRXG 3ZDZF 2BVOB 2Q3AA 4PS4L 3LKSB 2WLZA 3BN3B 4MCYB 3C9NB 4CJ1A 4LFHG 4F7PB 3TF7C 1KB9K 1RD6A 3PABA 1I8LC 2X4OA 3BPOB 4WJ5B 5FUCC 3TO4B 5EFIA 3CXDL 4WU5A 4HKZA 1VFOA 1ZKAA 1IT9L 1MCJA 2UYLB 4MDIA 4JLRB 2MPAL 4MCZB 3T2PA 1OLLA 3CVIH 1YEKH 1KIUA 4OFIA 3I6GA 4KQ3H 3W5MA 3BGFC 2AW2A 3NGBC 3OQ3B 5KTEH 1P9MC 4JM2A 3KJ6H 2AK1L 1J05A 1NGWB 3TT1H 1KEGL 6FABL 5DC4B 2H45A 3B6SA 3QIUC 4EN3B 4PLOB 3TGXA 2G5BA 3MJ7A 2EH8L 4E42A 5IBTH 3E0GA 1FVDA 3O6LH 5DJ0B 2FHCA 3C8KA 4E5XA 4IRZL 2H41A 2DQFB 2PR4H 2HH0H 4KH2A 3V2AR 2VIRB 4KU1A 3HB3C 1JNHA 5E9DE 4HBCH 1ZVYA 5E08L 1ZS8B 1T0MB 4OQTL 5JXED 4HMDA 4X80H 3OJ2C 1QR4A 1XR9A 3AU1B 3K2MC 1EERB 1A9EA 3N85H 5GGTH 4AM0B 3MFFB 1DBAH 5JW3L 1W0YT 3M07A 2H2PD 2ICCA 4M6NH 5E99L 1HHJB 1MHEA 1J0ZA 2H32H 2WUCL 3RAJL 1RZFL 4LQFH 1JGLL 5T5NG 1R3IH 3VFUA 3HE7A 2HJFB 2GEEA 4KI5E 5I0ZA 3O9WC 1CIUA 4AENA 5JORA 3QFDB 1Q94A 2C4FT 4IRSB 4GJTB 2NY4D 4QXUH 3WNNA 3STZA 3FO1B 2F53A 4HQQL 1LO5B 1G6RH 3PP4L 3HMWL 2C3XA 2MHAB 5DJZB 2ED7A 1A1NB 4LPCA 4F2MB 5HYSB 4LSDA 3FB6A 1SQ2N 2X4RB 4ONFL 5DRXB 2OLDA 1NAML 1DQDH 4JKWA 3SKOA 1BFVH 1H5BC 4LCYB 4F7CB 4U7KA 3MBEC 3JTTA 4WO4B 1OARL 1Q72H 4WV1A 4DUXA 2VQUA 2BSTA 3OKDB 5C0AA 3U46A 1MJ8H 3CLFL 4S2SB 5T1MB 4K7PL 2WIMA 4P2RA 4FA8A 3QULA 4IHOA 1A3QA 1FNSH 1UCTA 1UEMA 2M8XA 1MFAH 2VN7A 1AHWA 4OLWL 2GY5A 3FONA 4Y5YC 5BQ7A 3SEPA 4Y5VB 1BOGB 5DMJB 5GRUL 2MQ0A 2NY0C 3HZYB 1U3HC 3PHSA 5C09B 4R2GD 1YEIL 1RJLA 5FECA 1ZHNA 3PHQB 2X89D 3UTTD 2DWEA 5DJ8A 1S7XB 5KVEL 2HTKC 1BOYA 4ZUUA 3VXPB 3RNQA 1WEJH 2A83B 1AHWC 5ANMA 2VLKD 1WIPA 4QTIH 3NA4A 2RBLA 5A3ID 4CADB 1N5AA 3CDGA 1T7VA 4ONGL 4BELD 3HI6H 2QKIA 1ZHKA 2IJ0C 3OKNA 1P84J 2VLRA 4H20H 1TPXC 3P4OA 3V4UH 4GXVH 2QBWA 5DFVD 4LSSH 2KH2B 1NL0L 4M61B 3D0VB 1L6XA 1OAQL 2EICA 4QGTA 2AQ2A 3UJTL 5L8LB 3TZVA 1QRNA 3MRMA 7FABL 1LO4H 3L95A 1V3JA 2FGWL 4OZ4B 1G9EA 4BFBD 2JB5H 5DF0A 4HHAA 2G9HA 4YPJA 1EJ6A 4AL8H 5DK0B 2E7LC 4JM2B 3FQUB 1NANI 5HHOB 2X5PA 1ACZA 4XRCA 1JFQH 1FAKT 1YEFH 4K8RH 5DO2C 5DS8A 4LVOC 1NJ9B 2YPLA 3O3AA 1I9RH 4TUJA 5GGQL 5KG9A 3SCMB 1A0QL 1I1AC 1HHIA 4XMLH 1UXWB 1QLEH 1AGEA 3IETA 3OB0H 4N0YL 4P4KC 4L4JA 2DQFA 4X4MA 2IBZX 4ONFH 1KENH 4BSVA 1DDHA 3QPXH 2AJVH 4PRHD 3RZCA 3HI1A 3NIFE 1TPXB 5IFJA 2APTA 3SDCA 1NCCL 3EOBB 3L5JA 3MROB 3VGEA 4LLDA 1KELL 5HDBF 1A3LL 1JHLH 4LCWE 5KS9B 4R2GC 4OLWH 3AB0C 1H8OA 1XMWA 2PO6A 2K3TA 4M02A 2EDEA 1NMBH 3VG9C 4L8SB 2KDGA 4H1LH 4O02H 4MJIE 1CCZA 1F11B 5DHYA 4XC3L 4GT7A 1BAFH 3H0TA 4L4VD 3UTPE 5EOQH 5SWZD 1UM6H 1JPSL 3DHMA 4WHDA 5DEFB 1QQDB 2I27N 4JRYD 1EFXA 1FAIH 4MJ2A 2FR4B 1E4WL 2HJLA 5D70L 5EOTA 1XCTB 1Z9MA 5IQ9A 3RVVC 2CKBB 3T0EA 5IEKB 1MCEA 4JG1H 3F6IA 4MQSB 3G04B 4JRXA 1X7QA 1CZ8H 3WIIL 1BFTA 3GSXA 1SJHA 4OIIH 5TE6L 5DJCB 3BDYL 3QUZC 3VFSA 4KROD 2A6DA 2AVGA 1PEZA 2VMFA 4N8VG 4R3SA 1UJ3A 2OTUB 1FGVH 5C08D 1OTSD 2C1OA 5KZCD 5GS0C 1NL0H 1Q94B 1UGNA 1NEZG 1RUMH 3SGDH 4X4YA 3R0NA 2NY0B 1EK3A 1WFTA 2L7UA 2EYTA 3B2VH 3CFBB 3H7LA 4U2YA 4WHYG 5EDXA 5F7WC 4MQTB 4W4OA 2VLKA 1QHOA 2GYSA 3T4AA 5CIPB 4MJ5B 4YC2C 3KXFA 4Y19D 4ZNEE 4ACPA 5FKAA 1N64H 2WBKA 1EO8H 5IB4A 5DQDH 2FX7H 2FJHA 5FDWB 2OJEA 2YC1B 1KN4H 1H15A 1GHFH 4K55A 3GI9H 7CGTA 4H5SA 1G6RA 4I1NB 3MSPA 3VE0A 1T5XA 5EU6A 3VXOB 4Y16D 5C07D 1TZGH 1QSEA 1KELH 4Q2ZB 3TZVD 5AYQA 1YN6A 5IK3A 1CE6B 3WHE1 1EFQA 4ESKA 1HKFA 5I1JH 1FG2B 2FCBA 4AQ1B 4F7MB 5C08E 4OF6A 5SX4I 1HKLH 4GUPB 2ZSWB 5H37H 5E6IC 4PGZA 5GISH 1I8LA 3KJ6L 3CMOH 3LD8C 1OPGH 3MRHB 3JWOL 4QHNA 2Y23A 3G6DL 3ZE0F 5BO1H 3MRGA 4XBGA 4KVNH 2MCG1 5F7HA 3TO2B 1I7ZB 5JPMA 4U6HA 4RBPH 1F45A 4GRMB 1HK6A 3IDIB 5GHWH 2FR4A 3WLBB 3QA3B 4OGYL 4PUBH 4NBZB 2I9TB 2Y5TA 1W72H 5E1AA 1WJ3A 2X1WL 1NGPL 2E6QA 3O3EA 2RIKA 1JGVH 3SCMD 3GSVA 1G6RL 4FABH 4G6FB 4AIZA 4XNMA 1NKOA 3LS4H 1FNGB 1MRDL 1QFUH 2HMID 4FMFA 3S7GA 1FL6B 3MXWH 4ZS7L 1NANH 1Y18A 5FCSH 5KVDL 2O5ZL 3LKSA 4F9LA 5IMMB 2OJEB 5J0BA 4KI1A 2FJFA 3GZKA 4EIGB 4LLVA 4KUCF 1YPZE 3SDXA 4HT1H 1O5DT 5EUOB 3SN6N 4PLNC 5I1GL 1ZHKB 4HFUH 3QNYA 5TF1H 4CKVX 4LF3B 5EIIB 1FDLH 4KKLC 4JZJB 2CPCA 5T3ZD 4O51B 1YECH 1FZMB 3MLRL 2ADFL 3I75A 1WTGT 4IS6B 3VRLF 5JPNA 2H2PC 5D7LA 1S9VA 5D8JH 5T1KD 4F3FA 5EUOA 4LKCA 1FN4B 2IAND 3DVGB 2YWZA 1W0VA 3QXDA 4FZ8H 3BDYH 1A7OH 4DK3A 3EO1A 3D6GA 4EI5A 3DTXA 1EHXA 4JM4L 5F7MC 2WMPA 3VWKA 3QG7H 3HB3D 3PGDB 4X8JA 1S7RA 2ZSVA 4K94C 4NOFA 5D96C 4AMKL 4OKDA 4U1IB 1O7SA 4YBLC 3GBML 3MA7B 4DOHB 1Z9SA 4JQXA 2QTEA 4ZS6C 5E2WH 3W5NA 4M1DL 3I84A 2F5BH 4EOWL 3PGCA 3TPKA 1CD9B 1X3DA 4GMTH 3GMMB 3MA9H 4F15B 3KLHD 1FIGH 5AD0B 3H0TB 2B4CL 3KJ4B 2EECA 3L3GB 4RA3A 1ZVHA 4IJ3C 3SDXE 2A6IA 1SY6L 3QXVA 4LIQL 5E08H 5IB3A 2DMKA 2O5ZH 2GIYA 2EE2A 4KTYA 2Q20A 4JDZA 4XAWL 2X4OB 4WJ5A 1T2QH 4LASL 1EVTC 2EDNA 5I1LA 1KCUL 5DVLA 3L5WA 4XHQA 1MAMH 4V1DE 4HBQA 2FATH 1UA6H 4PJXA 3MOAH 5B39G 2VNCA 3SY0B 5H35A 1T80A 5C0JB 1J1XL 1RUAH 2J1KA 1A47A 1EEZB 3CJJA 4P2OA 3PG2A 4YDKL 5C0NC 3L5WB 1J0HA 3GSNA 4KMTL 5DGRA 2FBJL 2CIKB 3BE1H 3OJMB 3R8QA 4N0YH 1IM9A 5EZJB 2EXWC 4AEHL 5IHUL 1P6FA 3D3VE 5SWQA 1XIWB 1Z0NA 2YS4A 3FTGA 4G9FB 1VENA 4PJEB 4UU9B 3S37H 1YEKL 4YDJB 3QIBC 3HFMH 5E4EC 3VRJA 1GOHA 5D5MB 5FYKD 4HSQA 2DYPA 5HHMB 4P46A 1HE7A 1PX3A 4Q9RL 4J1UB 4FQIH 4CU8A 4C58B 4L3CB 2NQCA 4Y4HB 4NZDA 4A6YH 1T3FA 1WZ1L 3HCVB 4KRNA 5F7KC 2VWEE 1B0WA 1BQHG 3IVKA 5TGBB 4KY1L 1T03L 4L8CA 5D7SL 3D0VA 1U3HD 3IFOA 4V1DD 3RBGA 3U0TB 3VXRE 3PWUA 3ISWA 2R15A 4PRDB 3QR2A 5CBAA 4PJIA 4PYGA 4RMTA 1QNZL 5HDOA 3T3MF 2EKSB 3LKOA 1BVKB 5CCKH 4ONGH 1J8HD 1L9MA 5E8NB 3O4LE 1FFNB 2FO4A 4OV6F 2A0LC 1S9KC 5MEOA 4EI6B 2NX5B 4PJIE 1B90A 4JKKA 3U0TA 2MJWA 5IHZB 1NCNA 5FO7B 3AS0A 4PG9A 2BNUA 1S3KL 1EH9A 4XVJH 3RVTC 4CAGA 3QWRD 1AFVH 4JO2H 3MUJA 3UTSA 2OP4H 2W9DL 4JZNA 4LU5H 3V4VL 3S37X 4K23H 1LDPH 1QQDA 5JW4M 4OD2A 2BJML 2HKFL 3MR9A 2ICWB 4OZGB 3A67L 3NBNA 1WZ1H 4YWGL 3JV6A 5BCAA 1OTTC 3P30H 1OTTD 2FEEL 4Z7NE 1MF2L 4KRPC 4TRPL 4PJCA 3LD8B 3L3JA 4LP4A 1FNGA 1U42A 1E4XI 5KS9A 3O9WD 2ARJB 5E6ZA 4DW2L 1T0PB 2DLFH 3JUZA 3QEHB 4APQB 4XMPL 2H26B 5HD8C 2ADIA 3FHAA 5HHOD 5L9DL 1J7VR 4OZIB 4EN3A 2HKHH 5CZXD 1E4WH 2IPUG 5DVMA 3B6SB 3TPUA 1A3RH 2ITCA 1PZ5B 4KK9C 4U1KA 4XPTL 4RAUB 1OAYH 4FQLH 5ENWA 3FQTA 4Y4KA 1BQSA 2X4QA 3BSZL 3S4SB 1JK8B 4OCNC 4Q0XH 1YJDC 4NO3B 3BEWB 3VXSB 1NFDE 2O5XH 3RHWK 3T2QA 4NNXA 4P2QB 2VABA 4NO5B 1FO0B 3TIEB 3H2WA 1MOEA 1U9KA 3IJHB 4PRPD 2ESVB 1IZJA 5BJTB 3P4MA 2E7HA 3QUMH 3VXRA 1RZJH 1P53A 3S5LB 4NPYA 5BZWB 4S10A 3UTTE 4O4YH 1MH5B 1RMFH 2H3NB 1OGTA 4XP5L 3ELAT 2BVOA 3DVFA 5CMAA 2J4WH 3T2NL 4PBVC 3H9SD 1ZLSH 2CRIA 1KJ3L 2CR3A 1H15B 3R1GH 5D1XB 2D7QA 3H3KA 3IXAB 1S9VB 3MOQA 2HLAB 1JGUH 4X80L 2I24N 3MV7E 3TC9A 1GCFA 3KLSA 1JZ4A 3I02B 4OZHA 2FDBP 3GMLA 3B3IB 4M7JH 4W68A 3DV4A 3DV6A 4Q9QH 3ZHDA 1UQSA 4LLQA 4LVEA 1LO2H 3WFDL 3CZJA 3RNQB 4IOSD 3QHTC 4L4TA 3I6LD 2EH8H 5TE6H 1CLCA 1PJ9A 2NNAB 4A6YB 1OSPH 4M1GL 3TBVA 3GKWL 5ALCL 4JREC 4DAGL 5KVFL 3G5ZA 2UZXB 4TNWF 4KROC 5F1NB 3INUL 4X6BA 2OBGA 1ZAGA 4WWKD 4ODUA 4ISVB 4DVBB 1NLDH 3ARWA 3P0YL 4XP1H 4KDVA 3X3GL 1F4XH 5C0RH 3IVKB 3BW9A 3K0WA 5HYQB 2A9ML 4HC1H 5B8CB 1QYGH 5H94A 1X7QB 3FT4A 4MNGE 4OF5A 5F8RC 4HS8L 2X9WA 3NCEB 4FG6C 4LPTA 1CT8A 2VR5A 1JMZA 2R56H 4JHBA 2PW2A 4JZOB 3C5ZD 4WFGD 4NQUA 4ZTPL 5I1CL 5KVDH 1NBZB 1I3GL 1XGTB 3K7UA 1M7IB 4UU9A 4OM1L 3RTQA 4LSTL 4NZJA 1V3MA 1IAOB 4OTXL 4IRJA 1MF2H 1L0QA 3WLBA 4HUUB 5EFIB 4NO0D 3CDCA 3L6FA 2P7TA 3BEWA 5JXEA 1NFIB 2AK4A 2AJYH 1DSFH 4OZFG 3P9MA 5EPMB 4KDWA 2NTFB 5CFHA 4H88H 4Q58C 3RWCB 3UPRB 5F97E 4MXWH 3FQRA 4PGJA 1I7TA 3MRHA 3U0PB 2VLME 3U48A 4WU7B 1DFBL 3OBAA 2V17L 3ZO0A 2VLRD 1R3HB 3MYJA 2X4SA 3NFNA 3DO7B 3GMPB 1INEH 5IF0A 3KR3H 4UIKH 2VITA 3QI9D 3SGJA 3UAJD 5FUZL 3FRUA 4XNQA 4NKOB 3RWJB 1MFBL 1OARH 1Q72L 5BXFA 1LNUA 4Z7OF 2R0LL 3ARGA 4HEME 1R5VA 3DROA 3U1SL 3CDFA 1RJZA 2DICA 5SX5H 5BW7C 2DQEL 1LEKA 1X4ZA 3DX7A 1YYMH 2ENYA 4LKXB 4KI5D 5CAYB 1IAII 1MI5B 3LS5H 1OAXH 4N8CH 3LRGA 3QXWA 4HQQH 1FL3A 3OR7B 3OAYK 1LD9B 1RIUL 1QPPA 5FV2A 3D5OF 1H3PH 5KSBB 4OD1L 3V5KB 2XZQL 2Y4SA 2JK5B 2XZAH 1I1AD 5DVNA 2DKUA 3T65B 4M5ZH 4UTAH 2P5EE 1TZIB 3DECA 4CMHC 2Q1EA 5C1MB 1MAJA 4KKCC 3WFHA 3NFPA 2VJXA 3TFKD 1JGUL 3IDJB 2CLRA 5JW5B 1X6LA 3A6BH 4IRSD 1T0NB 3RP1A 2UWEA 1Q1JH 2JELL 3PGFH 3LHPH 1WWCA 3L3KB 1D6EB 2VZOA 3VFSB 2D03H 5GJTL 5JHLH 2VDQL 5CINL 1BBJB 4KQ4L 3BGFB 4FQXC 3BKCL 2I9LA 3MCKA 3QDGD 3HAEH 5F7LB 2ATKA 3RA7L 1AQKL 1OW0A 1QVOA 4DKFH 1X5LA 2WBJA 4RZCB 2N7BA 5TQ0L 4QRRB 2B1AL 1ZA3A 1RFDH 4JO1H 3BD4A 1KB9J 2VR4A 4K8RC 4PJ9D 1C8PA 4OTXH 1MQKL 2H26A 3S34H 2VZVA 3MBED 3W81A 4PP2A 4YDIL 4B41A 1TQBB 2X70A 3WFEL 3ARFD 1FVCB 2PO6B 4NBYB 4GW4A 5F71A 4X7SH 4M00A 5C0FA 3PWJB 4BK5A 2BMKB 4W6XB 3NFNB 3DO7A 1EEUA 1MI5D 1XGYL 3OPZH 5E1AB 4GRWH 1HH9A 5L2KE 4XCNA 2NY3C 3O2DH 2DOCA 2YXFA 2G2RB 4NQCB 2EDJA 4NWTL 3JWOC 2XTJD 4Y5XA 1NFDB 3D69A 5T5FH 3AY4C 3PDOA 4KK6C 3S3SA 1WWWX 3K8MA 4MLIA 5MENB 2YMXH 5J3HD 3IETB 3GMLB 3ULUD 4YBLB 1VGEL 1ZT1A 3RGVD 3LIZL 1NBZA 4MHHI 4YDLB 2D2OA 2H6PB 3B9AA 4GFTB 4LOUD 4WW2A 2X4NA 3TVMD 1A14L 2DLIA 3AMLA 4XPGH 5J6HB 4DTGH 3D0LB 4J2XA 4NM8L 3O3BB 1BD2D 4PRDA 5C92A 1M1SA 3ARXA 3PWNB 4JO4H 3HZVB 3ES6B 3OKYA 5FDYA 4MXQC 3DUSB 4RAVB 2WINB 1AXTH 3NCYS 1T1ZB 5D71H 1CGTA 4H5SB 4K07A 2NYYC 1FPTH 2R1YA 1BECA 5CEZH 4P23D 3O6MH 3NTCL 3QEQB 3MRRB 3ZKMD 4NNPL 1DQML 1F3JA 1I85A 4HWEL 3K74B 3WJJA 2XZAL 3X12B 1TJIL 2GCYB 1WV7T 5E2UH 3VG0L 1BFSA 1O0VA 4XNXH 4EEEA 2X1PA 3CDGB 5IBTL 1AGDB 4WUKL 4JZJA 3ZDXE 1U2HA 4M93C 1J0JA 4ZNEA 4CBPA 2Y36L 3SE8L 2A77L 2BNRB 2J6EL 4DK6A 1PZ5A 2W0KA 3DVNA 1W72L 2EDFA 2WUBH 3HZKB 2RGSA 4R3SB 3U0PA 3U4BL 3HPJA 3ARUA 3RZWA 2BXZA 2Y6SD 4LRNL 1V5JA 4YUEL 4ZFOB 2OSLB 1J87A 2YKLL 2WIIA 5L9DH 4JZJC 5D7IE 4CNIA 2DL2A 2DB8A 2VKXA 3LEXA 3QDJD 3QIUB 4Y16B 3U9UB 2Z4QB 4QRPB 4ZSOE 2CK0H 1A4JA 3I2CL 4WTZG 1E0OB 1QFWH 5BJTA 4NKIH 4FQHA 4KJYA 3Q2CA 5L6YH 3NA9L 4L5FL 1JGDB 4JRYA 1DN0B 3RVUC 4WENB 2BJMH 1G9NH 1JWMB 4NZRH 1SYSA 4MD4B 5C0AE 4R7DA 4Y7MA 4HPYH 3EJYD 3GSOB 2OP4L 2W9DH 5D2NE 3X13B 4M03A 3RVXC 2GJ6D 5HYJA 3OG6B 1MCFA 3C9NA 2EYRA 2PO6D 5I71C 4ZPTA 4PRIE 4HGWB 4LPWA 4KV5E 5IV2B 3SDAD 1VGKA 5CJXC 3WDJA 4Z76A 4NUGL 5GS2H 3G08B 3W0WD 5E2WL 1CLOH 4LRIA 3K2UL 4XB7A 1KJMA 35C8H 4HULB 2A1WH 3VCLB 2MQ3A 3HG1A 2J6EH 3OZ9L 3K4AA 5L2JA 3BEVA 1KGCE 5C0CD 5E70A 4QWWD 5D7JA 5F6HI 4PJGF 4HAFA 5TE4H 1G7LB 4MZ3A 3GKWH 5ALCH 2IQAB 1A1MA 5J13B 4UDUA 1HINL 5GS3A 4CVWA 1GGYA 3X12A 2VSDA 1R5WB 4KTEH 4D2NA 5FO8B 5J9PB 3TBTB 1CXLA 1XF2B 2M2DA 4NNPH 3FQWA 1S5HA 4PJEA 2QSCH 4LFHD 4FQQA 5GGRY 3BD3A 4BKLA 5IW6B 3TZVB 4M7KH 1G1YA 4UTBL 2UWEE 5B38G 3LKNA 5I17B 2VIRA 3BQUD 1JPFA 3KWWA 3BE1L 4K71C 5J11B 1G84A 5EOQL 3BD5A 4X5XB 4U1MB 4NQSA 3RU8H 1CR9H 4HIHB 1UWEH 1X5YA 1C16A 5DWUL 4DN3H 2EDTA 3JVGA 4RWYL 3V6FB 4ZFFA 4UT6H 3U6RB 2YD2A 3IDIA 4ERSH 1KJVB 5ACZA 1FJ1B 4HV8B 1WCBB 1K8DA 3BKJH 2F5AL 3MUZ1 5IP4A 1WTLA 1AE6H 3DETC 5ANMB 1YZZA 4GBXB 3UROR 4TPRL 3WMSA 5CBEA 5AEAA 4NKDB 4QF1A 2YD9A 4JRYB 3WIHH 4M1CD 1IGCH 2E8YA 1OT1A 1CU4L 1KB5A 2ZUVA 3NABH 4Z7WB 3I6GB 1DVFC 3MZTA 1RJLB 5FECB 1GIGH 3MLTB 3WUWG 1SEBA 2ADGA 3ZE1E 2BVTA 1MJJB 1MFBH 2F58H 5LXGH 2HTLC 2BNQD 3O45A 3Q0HA 2CRMA 3PGDA 3PP3H 5FGSA 4OQTA 5I1DA 2OJZH 2X1OA 1ERNA 5HGBA 1IAIM 3DTXB 3WE6B 1H3XA 1QG3A 3B9DA 1L4IA 1H0DA 3QDGE 4ZOAA 3ALWA 4NO2A 5KN5A 5IM7A 5D7LE 1PYWB 4U4BA 2EE3A 5J56B 5SV3A 2KPNA 4F3FB 1NEZA 4FS0A 4UNVA 3EYFB 1HEZA 4OCXL 2HKFH 3CIQA 2OK0L 2ATKB 2CLZB 2R2EA 1UM4H 1HHIB 4GLRH 2PXYB 5EO0B 5EZIH 4LSTH 4FTVB 3V4VH 5DJDB 5B21A 3UDWC 1CL7H 2GW5A 3T0AA 2EKSA 1PBYA 3QH3B 4NN6B 4PJAA 5IKCA 5ILTH 4L4TD 2BRRH 4LLAA 2EIZA 2XTJB 4AT6B 2MTPA 2PW1B 4YZFE 3BP4B 2ILLA 3T0XA 1MJUH 3D25A 4K2UH 5T1LB 5ABDE 4YXKH 4JPIA 1JGEA 1KTRL 4XMKH 1SMOA 4GRWB 1UZ6E 5F21B 4GO6B 5CEZE 2CDEB 2HT4D 2JJTA 3O81A 5FYLL 3IAPA 3QUZB 2DWDA 3JWDH 3L7FA 4HXAL 5TDPA 4CDGC 2QSVA 3ARFB 4OZHE 3QIWA 3QJHB 1RZGB 1IKFL 4OZFH 3LRHA 3O41B 1A6VH 5E00A 3EYVA 1LE9B 1JWUA 4OZIF 4C56D 5ENWB 1FNSL 4YBQC 4OLXH 3FZUD 5I19H 4H26B 3NCMA 1UWXH 1KCRH 1YY9C 2G2RA 3GSQB 1GPOL 4GW1B 4JREB 1FVEA 2F58L 5IB2A 3RGVB 1A7QH 5E7BA 3TA3B 1R0AL 3MNVB 1CFQA 4DZBB 3IDNB 2J8UA 4P5KA 3CMOL 1HHHB 3RZCB 3AS1A 5C0RL 1KEML 4KDTC 2HN7B 4XPGL 1MWAL 5I1AB 3FL7A 3NFSL 3A0OA 2NXZC 2AXGA 1FFOA 4R26H 5C3TA 1JWMA 3ZKSD 5DJYA 2FX8H 2VXSL 4XCFL 4JG0L 1C5BH 5F93C 2NW3B 3I9GH 4PR5B 3HS0A 5HDBE 5ESVA 2P24B 5TQ0H 3DMMD 2E9WA 2KKQA 3RY4A 1Z3GL 2HLFD 4RMQA 2PTTA 3PQYE 5CP3H 4OZGF 2ATPB 3KPOA 3QUXB 2CQVA 5E2JA 4F33B 1HSBB 1KBGL 2V2WA 4B7IA 1D6VL 2GSIB 4PJ7A 4JEGB 4PLKC 2W65B 2ZOLB 3E3QC 3ZHKA 5IVOA 3T08A 2BHUA 3AVEA 2HKHL 2F8OA 4FNLL 2NLJA 4M1DH 4XCEA 3C8DA 3LQZA 3QDJE 1EV2E 1IJ9A 3QFDA 5A2LH 1LK2B 1W72B 4G6KH 4MQXC 4U1GB 3HUJB 2YK1H 5IQ7H 3CVHA 3PUCA 1JV5B 3KPMA 5LBSH 3VXOA 3DUUA 1RPQA 3S35L 3NAAH 4O9HH 4PY8J 3G04A 1F3DH 4WNQA 4TOYH 2HVJB 2ESVE 3GK8L 3DBXB 2ARWA 3KYNB 2XKUA 1DE4A 5DJAA 4XMKL 4NO0B 1PZUB 2DI9A 3GHEL 2GK0A 2XFXB 1FLRL 1ZE3C 3G5XB 2C9AA 1F42A 2W9EL 4V1DB 4HT1L 2APXA 1UM5L 3OKEB 4XP9H 2GJZA 1FYTE 4J3XA 1KPVA 5HBBA 3GSVB 1Z3GH 3O3UN 4IEFB 1TXKA 3HNTL 2X4NB 4HJJH 3QEQD 1DUYB 1G9NL 4OZIE 4R4FL 1C5BL 3RWCA 3UPRA 4ZUTB 3HAEG 4P2QA 1OAXL 1RIHH 4MSWB 2NPLX 3UAJC 2O61A 1CVRA 1HYSC 4ZUTA 1D5ZB 1KJVA 3NCFB 2MMXA 1MPAL 3H9HB 4Z6AT 4GBXC 5FK9A 2X6MA 5EUKB 4FTVE 3UTQA 1BREA 1I9IH 3OAYH 5I1DB 1FG2A 3F7YA 4OM0H 3IDYC 2J2ZA 1CDYA 1TQCC 4B5EA 1PG7W 3BPLC 4BFIB 5IW3A 5F7DB 1XZ0A 4CN6A 4UINH 5ACLA 2WZPD 1C1EH 5D1QD 2BC4A 1NAMH 3PWPE 5E0QA 3D1MC 3ORJA 3BWAA 1ADQL 4H88L 2FWOB 4PP2B 2AGJH 4OI7A 1K5NA 4LCUA 1WGOA 4JFFE 4Y2DD 4NRXB 1SBBA 4P5KB 3VMPA 1UB6A 3ARBD 5J9PA 5AUMB 2PKDA 3B9KD 4KJPD 3MGTB 1GGCH 1TJGL 4OD3L 3DVGA 1DEEB 4TNWK 3OMZA 4BQ6A 4GXVL 4UDUB 1TJIH 4KI5F 1LO3H 2K9UA 4ZPVB 2DQJL 4P57B 1AGEB 4XZUB 5FGCB 2VAAB 3BRGC 4XI5D 3W82A 1E6JH 5GRJH 3OJDB 5DT1L 1FNAA 4HS8H 5BV7H 3IXAA 4MA1B 3MFGB 3VXMA 3S97C 2I25N 3FHQA 4YE4H 3SKJH 4TULL 3N1PC 1ULVA 5IMOA 5T1KA 2V17H 3HMXA 1BIIB 1JRHH 1KN2H 3LN4B 3KPRB 5E8DL 3EOYG 3ABZA 4DGYH 5AG9A 4XT1C 2GSIA 3RWGA 3MGAA 3BESR 1QRNB 2XI9A 4OCXH 2AJXL 4XBEH 4ZAKA 4Y4FB 2DQCH 4EQ3A 4HIJB 5IESL 3MLZH 1IGYB 5D1XD 4O2EA 1FNHA 3O6LL 1JZ6A 2QHRH 2W0PA 4JQVA 3CPLB 1CK0L 2ZUYA 4U6YB 2JJTC 1P1ZB 4LIQE 3VD4A 1ZGLM 5SWQB 5EO1A 2PTVA 1FDLL 1C5CL 1JI2A 4OLYL 1T20B 2P4AB 3LY6A 2JLLA 1EXUA 2J4WL 5KTEL 1Q9LB 3H42L 3QIWC 3BXNB 3F7PC 2BY1A 3D39B 1YEHH 1KYOJ 3KPSD 4JDVA 1DQDL 4CL7A 3SGDI 2OR9H 3NPSB 2BCKA 3MRPA 3B2UC 4HJGB 4EUPA 5GS0L 2MCPL 5EBWB 1HDMA 3IDNA 1MIML 1TZHB 1ZLUH 3SDCB 1LEGB 5B38A 5ALBH 1BM3H 3IDYB 5FGBC 3WIHL 1MQKH 2APBA 1NCDH 4JFOB 5A16B