1FJ1A

Lyme disease antigen ospa in complex with neutralizing antibody fab la-2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPSSLSATLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGNPSRFSGSGSGRDYSFSISNLEAEDIAIYYCLQYDNLQRTFGGGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYBRIDOMA ANTIBODY LA2 (LIGHT CHAIN)
publication title Structural identification of a key protective B-cell epitope in Lyme disease antigen OspA.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
total genus 47
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fj1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fj1A01
5HDBF 5HYEA 3MJ7A 3IDJB 3CSYB 4B7LA 5EA0H 2UYLB 3ULVL 4G5ZH 4IMLA 3NCJH 2NY7L 3B9KB 4XH2A 4EIZC 4JFXB 4BH7B 2GEEA 4WEBL 1HHJB 1EHAA 3CFKA 2ZUQB 3FO9A 4WUUD 5DSCA 5DTFB 1A1MA 1L9MA 2I25N 3JTSB 3CH1A 3GO1L 4XNQA 2J8HA 4Y5VA 3EBAA 5DO2D 5T1LD 2P7TB 1FVDA 1T6WA 4X6DF 1QSEE 3E0GA 3C60A 1H0DB 2P43B 3MOQA 1J1OL 3VMNA 5C9JA 1UENA 4ZDHA 4UILH 4K23H 1WC7B 1IC5H 3FCTA 1HEZA 3HCVB 4PJBA 3TT1L 2WWMD 1M7IA 1R3KB 4UIKL 3VWKB 1Q9WA 2XA8L 3QI9B 3GSVB 3MNZA 4X7EC 4OD2B 1PX4A 1JFQH 2AJVH 1TTFA 2I24N 1T66D 3CFJB 3T4YA 5I1DB 3F58L 5ACLA 4Y19E 3SKNB 4RAUA 2BOBB 4U0RB 1JPFB 5IJKA 2DQUH 5EOCH 2P5ED 5IFAH 3GIVB 2CR3A 1NMCB 2H2SD 4HDIA 1NANH 5DA0B 2R0WL 1PKOA 4FP8L 2NYYC 4XAKD 5SWZD 3TBVA 1TJIH 1ZA3B 4JQXA 4OB5L 1ZSDB 5D71L 4K3HA 3E6FA 4LPVA 4S1QL 3U0TB 2PXYA 4ELMA 3QNXB 3LMJH 1VGKB 3O6MH 3TT3L 4PY7B 4X98A 4XMLL 1FCCA 5E8OA 1EDQA 4LKXA 1P4BH 5J1TC 4HKJA 1U8JA 5B3NA 1RSFA 3Q6FB 3S4SB 5BO1H 4G9FB 5C86A 1ZLWK 1QA9A 1YYML 1INDL 1IQWL 1IC7L 1YJDH 3O4OB 5C0CB 2EYSA 1L6ZA 1A6AB 2CDEB 3DGGA 2VXQH 3SGEH 1BZ7A 3U7WL 5ANMB 2FIKA 3JSSA 1CXEA 1Z9LA 3SQBA 4YHML 4MA1C 4I5BB 1HXYA 4JN1L 4QGYA 1A7NH 4UINL 4H0GA 5F9WB 5EBMB 3SPVA 5JPNB 3WS3A 4TVPH 1ZKAA 3I9GH 2K9UA 4HIEA 4X4ME 3B6SB 2DQEH 5KS9F 3GI8L 2NY5C 1GGIH 4OM1L 3VA2C 3PJSB 1NGWB 5BRZD 1N7MH 3N0PB 2ESVA 3RWFA 4AT6B 4FQCH 4NHUA 1K3ZA 3PGFL 4Z77A 3O6LH 1ZT4A 5GGSY 4EUPA 3GB7B 3W39B 1KN4L 4HAGA 4MD5A 1LP9A 5IEHB 3QEHA 4XNMA 3IT8D 3QZWA 2X4RB 4O4YL 3V95A 4BQ8A 5EOQH 1UVQB 2OR7A 3FO2A 1EH9A 4JM2F 3MRIA 2X42A 1QRKA 3LH2L 1GC1L 2VZ1A 3V8CA 3PWJB 3SEPA 3HI5H 2BNRB 5DDHA 3RTQA 1ZHBA 1G7PA 5JW4Q 3P4MA 3WEXB 4OF6A 1BJ8A 4Y88A 4WWKA 4JO4L 2V9RA 4X9IA 3WFHA 1S7TA 1OVZA 2F54A 5L2KB 3H9ZA 5DJAB 1NCAH 4Z7NF 4G7YH 1YA5A 1T83A 1LE9B 4BUGA 3LKRA 3VWKD 3OBAA 1X5IA 5TJWK 1BQLH 1DLFH 2DQJL 1KEMH 3CCHA 3QI9D 4YDVA 1AP2A 4DK6A 2E8YA 3QDGE 3VRLE 4M48L 3TNMA 1E27B 4GW4B 3RIFK 3JWOC 1EMTL 2VKWA 3MCG1 3TBWA 4JZOB 3ARDB 4HCRA 4NO2A 1R5VB 1WBZA 3BDYH 2EYTB 4NRYB 4BSWB 1E4KC 4HH9B 2VC2L 5DD5L 4HWNA 4GLRI 2RHEA 4OCWH 4B41A 5DHVA 5GGSB 1CGWA 2NZ9D 2HKFL 5IMKA 3TZVC 4UTBL 1OGAA 1B0GB 2A1WH 3BH9B 3VXSE 2WUBL 4DKFH 4HW6A 1XGYH 2CLRB 1UM4L 1PLGL 3HR6A 5B21A 2H32H 5I2IB 4MS8C 4JPKL 2CLZB 4X7FC 3LEVH 3GK8H 4NCDA 2CDFB 5HGBB 1TETL 3FQTA 3VRJB 2E7HA 4UV7H 1CIUA 2P8LA 2NX5E 5EH1A 1G0DA 3M8OH 3MV11 1YQVH 1N2RB 5AYUL 2QQLL 3INUL 4G9FD 4PJGF 5HDQL 5LQBH 4I0PC 2YS4A 1I85A 5BOZG 3MODL 3G6AB 1QOKA 5C0CD 4KTDL 2A74B 4WJ5A 3T3MF 1GZQB 4KROC 5LCVH 4KKNA 1KIPA 5IHUH 1R3IH 4P46C 5DD6A 3WE6A 3ZE1F 3DVFA 4P59H 3PV6A 1AE6H 4ISVA 1S78C 5JMOC 4AYFA 5FECB 3DARA 2EDHA 5DUPH 3PWUB 3PXHA 4GG6E 2RQ8A 3BP4A 5EZIH 2VZTA 1KB5H 5CLWA 4BELD 3KXFB 4PJ9A 4KZDH 4JDVA 4ZUVB 3TPKA 3HA0A 3GZKA 2PYFA 2LABA 1U58A 1LO5B 3D85A 2AAVA 2YBRB 4QCIA 5I6XB 1Q94A 1MRDH 2ICES 4KDWA 2WQ8A 4JO1H 1ES0A 3NBNA 1MHEB 2Y36H 3CMOL 3GBMH 4CNIA 3QQ3B 1MJUL 2GT9B 1L4IA 5EC2B 1AO7B 5F88A 1UWEH 3QNYA 4UT6H 1NBVL 4BKLA 1ZS8A 5CZVL 5DD0H 5GISL 4U6VH 1QNZH 2XNAB 2WBJA 3FTGB 3IJYA 3OKMB 4ZFOL 5AD0A 2BNRD 1EK3A 2IC2A 1YC7A 5IFHL 4LKCB 4M6MH 3I02A 1ZHKA 1A7QH 4KJPD 3IXTA 4Q7DA 2IPKA 5D1QA 1N0XL 3TBSA 2V9QA 3P73A 5IB5B 1DSFH 2AJZA 5L2KD 3MV8A 2AJYL 1LEKB 5TFSL 4LVNC 2G2RA 3MV9E 5ICYB 1IC4L 4ZXBA 3I2CL 1GGCL 3NA9H 3UTZB 5L9DL 2G9HA 1D5MA 4Z7QE 1F4XL 5F6HI 3BKJL 5EO9B 3EYFA 4NZDA 4ODUB 1VGEL 2FR4B 1B88A 3ARDD 1UXSA 2OL3A 4K8RD 3VXTA 2VXTL 5F7LB 4GKNA 3WIFB 1NCWL 1Y18B 1SBBA 4QT5B 1WFNA 2G5RA 3JWNC 4PJHF 5IFJA 3RL2A 1EUTA 4YC2B 4XCYA 4WUKH 5E4IA 1QLFA 2HTLD 4S0SD 5CSZB 1TTUA 4QXUH 4U2ZA 4UT7H 5DT1L 2UVFA 4DAGL 1NBZB 5J3HD 5HHNA 3I50L 4L8BA 1R6VA 3TWCH 3KPLA 4G6AD 4NCC2 4OI8A 4ERSL 1A9BB 3S36X 4D3CL 5D4QA 4L8SC 4KKBD 4FZEH 4JRXA 3MJ8A 1RU9H 4MXVF 2C4FU 25C8L 3B43A 2AABL 4XX1E 5CEZL 2CXKA 5FYKL 4WHTB 4GKZA 4RMTA 3CFIC 3BAEH 7CGTA 3PGDA 1JRHL 1LK3H 1S7SB 2IQAA 3FB7B 4XBGB 1FGVH 2WLZA 3FL7A 3RY5A 4L3EB 1GVIA 4OGXL 4NJ9L 1G7JA 2A6JA 4PY8J 5T3ZL 4MD0B 1CD1A 3AUVA 4Y4KC 5C1MB 1JWUB 1L0QA 4RISH 4L4TA 2D7NA 4G3YH 1YNKL 2VDMH 4PJDE 5HGGS 5LBSH 2F15A 1TQCB 2B20A 4X80L 3BVNB 1FIEA 4H88H 4MAYC 4PRAB 3KXFD 3PL6C 1P7KA 2Q86A 4HGMA 1LO4H 1AHWB 3V6OC 3QEQE 3QRGH 1M7XA 5C7XH 4RGNB 3D9AH 3C2AL 1INQA 1U91B 4TULL 2M1KA 4ONFH 2E6JA 3MGOA 1YPZB 3ROLA 1AO7D 1MI5E 1F8TL 4IHOA 1BPVA 2KQMA 1J9CT 3NPSC 3VFSB 2VZVA 4QOKA 5H37H 1JZ3A 1T2QL 3L7FB 3U79A 4EUPG 1LEIA 3KPRB 5ACZB 3GIZL 4YPGA 3QHZL 4FQLL 4PP2B 4O2EB 1EHLH 1C12B 2Y06H 1BQHA 3U6RA 1CDGA 2FX9L 1Q9LA 4LRIC 1RJCA 4P9HL 2LTQC 4P2OD 1MCOL 5E6IB 2FWOB 1TCMA 3EHBC 3T4AA 4K7PH 3GHBH 1XF5A 2KPNA 4PJ7B 1FBIH 4LIQE 2Z4QB 1QFUL 1T04B 2IPUG 5T5FL 3E1F1 3MRBA 1NUFA 3PWVB 4MGXA 3KS0H 3RPIA 1WJ3A 2AEPH 2WV3A 1SEQL 4HJJL 4I9WD 3ES6A 5JR1L 4RAHA 1IC1A 1IGJB 3HC3L 1HCVA 4NQDA 3PNWB 2ORBH 4CADB 4EQ3A 5H94B 3DI3B 3AROA 1X5LA 4RAVB 2XKNA 4NC0B 4YBHA 5FGSA 4HZAA 3AB0C 1V7MH 5FM8A 1OGTB 1UYWL 2AK1H 1ZEAL 2ED9A 2DD8L 3QXDB 4HX1B 3JVGC 5JLZA 2EXWD 1A6TA 4PRIA 2MQCA 3X11A 5A40E 3TH2T 1A7PL 1BREA 3FFCE 3G6DL 4NNYA 1XGTA 4OF3A 5CP7A 2YA0A 4I48B 3OR7B 4ZPTB 2O5YL 2ADJB 1I3UA 5ITBL 5D6DC 2DWDA 4AJ0A 3LEYL 3OTTA 4MQSB 3VXMA 2VIRA 1YEHL 3HAEH 3S97C 1CG9A 2HP4A 1CFVL 5GRXG 4GUPA 4PYHA 1FN4B 4ZOCA 4L3ED 5IBTH 1DEEA 1RJZA 3QIBB 1YEIH 1RK0B 5D1XB 1EFXB 2PETA 3UYPA 4RSVA 1U8OA 3LD8C 3GJFK 3P0YH 4FNLH 5EIVA 5E4EC 4YHYC 2BVYA 5D5MB 5J8OA 3ILPA 5DMIL 3OXRA 1IAKB 4OD1H 2V5RA 1RIVL 3IAQA 2BVPB 2VAJA 2ZKHL 4RGND 1RZKC 4O00A 3V4VL 5BVJB 3MNVB 4IS6B 3GM0A 2P8PB 4LEOB 4X6BB 4AIZB 4ORZC 2Y07L 4MB4A 2IANA 4H8WH 5A16B 3EYSH 3KR3L 4JDTL 4YFLI 1UCBH 1FL3B 1SJHA 4KI5E 4NZRH 3QUZB 4OCRL 5DD3H 3GMQB 1ZANL 1JI1A 5EORH 2ZPKH 4OZFB 2DRUA 3KPRD 4OCXH 2FJHA 2I07A 2L0DA 4OCNC 5TPWH 4MCYB 4NNXB 5D2NE 4Y0GA 4F7EA 3BKMH 3BT2H 1VKXB 1J1XL 1LD9B 2N4IA 5BJTA 3D0LA 4GAJL 2G5BB 1RZGA 1RMFH 4YHNA 2OJEA 4MMXC 1UB5A 4FQXC 4HQQH 5E6ID 2A38A 2EDBA 4OZIE 4WNQB 1K8DB 2J8OA 3QQNA 4M9PA 4LCYA 3MV7E 15C8L 3NTCH 2OSLB 1JNLH 5F3BB 3ZE0F 1WICA 5IJVA 4M1CC 3K46A 4LSTL 4ODVH 2W38A 4P5KB 4H26A 4PD4K 1NAMA 4OCYH 2X9XA 1R3LA 4LHUB 3UXFA 2G60H 1DBKH 4GAYA 5ITFA 1W8NA 1I8MB 4MJIE 3B83A 4NRXA 4Y5XB 3P4OA 2YUWA 3DX8B 4HCRL 5EO0A 3W82A 2FX7L 4LASH 4LGPB 1CGSL 3PQYB 1RJLA 3G08B 3MFGB 4GXUM 1JF5A 2P8MB 4YDKH 4MA7H 4JZNA 2QKIA 2CO7B 4HT1H 1I75A 4JHAL 4U3HA 1MH5B 3QIUB 4HXAH 1KTDA 1R3HB 5EZOL 3AY4C 3FQRB 3QQ4A 1KPVB 3GKWL 4LPWA 1GGTA 4JFDB 5CAYB 1DLHB 5DJ6B 3LCYA 5I1JH 4L8CB 3WBDA 4UTAH 3JV0A 4X99A 3MRRB 2QEJA 1U8IA 5L8LB 3V7MA 4I3RH 5L7XH 5LG1A 3QIBD 5E5MA 1GPOL 1WUNT 5D1XD 3LRHA 5AZEL 1EFXD 5MP6H 3VXRA 4KKLD 1ZGLA 5C2BH 1ZGLM 5BV7B 5BS0A 5I66B 2WUCH 4J8RB 2V5SA 4HJGB 3OF6D 4TTDC 4KK6C 3L5WA 5ICZB 3QEUA 3HC4H 5HI4C 4L8SA 1CBVL 3RKDC 5I1HL 5JA9A 4KZEH 4JFPA 3IRZA 3PP4H 4AENB 3QUYB 4LSVH 3BPOC 5C6TH 3ECBB 1BZQK 3RDTC 3PQYE 3TESA 1R0AH 2AJXL 3FAWA 5INDB 2E7LA 3QXAB 3HUJA 5C08A 1ED3B 3KLHC 1JVKA 4U6HB 2DLTA 5F93C 1S7VA 1I9JL 1FNLA 2CMRL 4UAOC 1T1ZB 1AD9B 1JNNL 4R2GC 4QRUA 2NTSP 1DQLH 4MCZA 3QUZD 3QWRD 4NGHH 5TDPB 2C3WA 5GZOC 4G6ML 5K9JL 3MOBH 5ECJE 2FHFA 3MROA 1BEYL 2ADIA 2XTJC 4JFDE 4WW1B 3SOBL 1AXTL 1AGEA 2ZOLB 4ENEC 1NCDH 3VU2A 1GOFA 4P4RB 2VQTA 2HTKC 4K3JL 4K8RH 2VDRL 1PKQA 4ODBD 5JUEL 3KHOA 1NFIB 4MAYA 5FHBL 4CU8A 4I18C 3PL6A 1LEGB 1A7OH 1IQDA 1GAFL 1HIMH 1ORSB 1BQHG 1YUHB 4Y16C 5DJDA 5SWSE 5I75C 3L3GA 3H3KA 1JMZA 1S9YA 3MRQA 3BZFA 2FCBA 4RMRA 4RGOL 4KGJA 5I1EH 3QEGL 3QR2A 4IRSB 1U8LB 4IOIA 4GOSA 4HUNB 1B4RA 3L3JB 5KSBB 4CN1A 1B4JH 2P42B 5J9PB 3ARPA 2NY2C 4P3DB 1XF3B 4JGUA 1ONQA 3HKFA 4NDMA 4KJYA 2W0LA 4LHUD 4DCQA 3S5LA 4ONGH 2XN9A 1IFHH 3PHQA 1WBYB 2C1OB 4PLJC 3VFGH 1NKOA 5TF1H 2BY1A 3EYOA 4JPVL 3MLXL 4URTB 5JHDB 1YN6B 3FB6B 4JANB 5IUSA 2OL3L 1XR8A 4BYHA 4P2RB 3PGCB 3PQYD 4RZCA 3PHOA 4LRIA 4XXDB 3CFCH 3E2HB 3C08H 3VFOB 4J4PC 2GW5A 1S9WB 1NDMB 3VA6A 1IEAA 4JFEA 3OXSA 3B2VL 5GHWH 3C5SA 1F6FB 3GSUB 5KVFL 2C1PB 1KGCD 3L1OL 1PEZA 3WSQL 5CJ5A 3L7EA 4X6CA 1SEBA 3QIUD 4OQTA 2L7JA 3ZYJA 2FB4H 2Y5EA 5DWUH 1JTPA 1CQYA 2WINA 3RFZC 3EJJX 4WI9A 4XWOD 3BDBA 1Q1JH 2P1YA 4KHXL 2IH1A 4OLUL 5I8EA 2WIIB 1RVFL 2HG5B 4JJHA 4QHMB 4OGAC 1N5YH 5FUOL 4K9EC 4FTVA 3LHPH 1MHCA 5JDSA 1BVKA 4BSVA 4KDVA 3KPSB 2ITDA 1EBPA 5DJ0B 4N0UA 4OFIA 5JHLL 4OAWA 1BD2E 4RMSA 5GRJH 1F5WA 5GS1B 2EDTA 1SYSA 3SGJA 4Q0XL 1CT8B 4NJAL 3CLEH 3QUYD 5HI5C 3NFNB 1CQKA 3NFSL 1EO5A 4ODXA 4WHCA 5C6PB 4HWEL 4PB9L 2ICWI 1MEXL 4AH2A 2P4AB 3CU7A 5MEOA 1VHPA 2HVJB 5DRXA 4JY4A 2Y25A 5F70A 5LXGL 2VLLA 2Z35B 3OJ2C 1XGQA 1AY1H 1NFDA 3UCRA 4U6YB 1YEDB 4KRPC 5FYJL 1XIWB 1S3KL 2CO6B 2GCYA 4NOBA 2BJML 1F58H 1XCQA 5T5NF 3R4DA 2ADFL 3NAAL 2A6DB 3ZKSD 4D8PB 1M4KA 1EPFA 3RIAK 3MO1B 3DMMD 3ZL4L 3UPCA 4M7LT 5HI3C 5C0JA 1IZJA 1OQXA 1PSKL 5I8OH 1TDQA 1VADA 2IF7A 1NAKL 4HFWA 1ND0A 2HT2D 4MA3A 3K7UA 4IRSD 1P9MA 5CJ8A 1BBDL 3SDCB 4L8DA 2NY5L 2BRQA 3GUTB 4EBQH 4PRPB 5IGXL 4NM4L 4YFLF 1C5BH 3OJVC 5DJ2B 1YPZF 3D39E 5E8DH 1KJ3L 4YDJA 1NJ9B 2BERA 3VI3E 1Z0NA 5TDOB 1XCTA 3NGBC 5MENB 5IWLC 4PRDA 5JHDD 1G7MB 1YMME 5FDWA 3V7AG 5C8JA 3ZKMD 3TYGL 4KVCH 4P2RD 3NCEB 4TPRH 1AGDA 3OJMB 3ARSA 4QRQB 3C5ZC 2FHCA 4LRNH 4FQXA 4LSUL 3FAXA 4NT6A 3FQXB 4QO1A 5TE6H 2Q1EA 2YD1A 5JXAL 4M9OA 1MCWW 1FIGH 3GRWA 3QPXL 2CK0L 1I1FB 3BUYA 4QYOB 5C0IA 1TIUA 4GAGL 2MPAH 4JR9H 2PYEB 2E6QA 3KDMA 1KTLA 2PKDA 5IB4A 1MIMH 1RURL 3PWPB 5E7BA 1CIDA 2R2HB 4PJ7F 1OD9A 3RU8H 3O6KL 2W9DL 5ISZB 1HHHB 5I30L 2OQJB 4XCNB 3K1KC 4KPHL 4ZFFB 4OLXL 1VSCA 4QHUB 3B4NA 4IEFB 2VSCA 3RQ3A 3ULUE 5K59E 5I16A 1LO3L 3I3DA 1KB9J 5CJQH 4M93B 3MCLH 3DX9B 4OT1H 2AV7B 2YRLA 3JWOL 4U6XA 4Z7WA 4Z76B 5IV2A 2BC4B 2JJSC 4LCIH 2K7QA 2EDWA 1IEBA 3KPSD 5DFVD 3MRNB 2X4OB 2D9QB 3FRUA 4P5TC 3ZKXB 5JW4N 2P24B 2DBLL 4ZO9A 3O3AA 3OHXB 3T0EC 5JOPE 2X6MA 1JI2A 1QR1A 2FRGP 4R0LB 5CS7A 3UJTL 2D0HA 3BP7B 4APQA 1KCUH 4XVJL 5IOPA 3QFJB 3DIFB 1VB9A 2W9LA 3D69A 3DTXA 3TIEA 4B7IA 2M8XA 2V5MA 1I1AA 5CMAB 1ZLUK 3AY4A 5EBLB 4KAQL 2FO1A 2ARWA 4J6RH 4HUVB 1B2WH 4JFYB 1FVCA 1TVBA 4JAMB 2IAMB 1BQUA 3PWPE 2VDOH 4L3CA 3TIDA 1W72B 3LOWA 1FG9C 3EOBA 3MQIA 4G80B 4OBRA 1M05A 4ZYKA 5IMLA 3E8UL 2DTSA 3RWGA 4G8GB 1EIBA 1TENA 2AI0L 4WCYL 3CFDA 2NY1B 1F2QA 5AAWA 3QJHB 4LAJH 1RZIB 3DUUA 4U05A 5DRZB 4G43B 3W5MA 4BQ6A 2MTPA 2YA2A 4K7FB 2LV4A 3IAGC 3BKYH 5J6HB 4YXHH 4YHPB 3VI4F 3IJSB 2LU3A 4JM4H 5D5MF 4F15C 2GAZB 3S34L 1ZA6A 3GI9H 3SHSA 2FO4B 2Z93B 2VDQH 5DVLA 2I9LA 1TFHA 3L5HA 3KNBB 1FCGA 3IDNB 3A6OA 3SDCD 3VD9A 3FN3A 4HK0B 3TJEL 5HHQB 4PJCA 5D8JL 5FUZH 1F90L 1V5JA 1WGOA 2VZSA 3BPLC 2H3NB 4LGSB 4J3VA 4PRPD 5K9QG 2Z8WC 1MLBA 1CK0H 3CDYA 3QPQC 4XZUA 2D7MA 3HNTH 1F6AA 4N8VG 3F5WB 5IIEB 4WI4A 5MEND 1D5XA 2YUXA 1VEOA 3RA7H 3KYAA 4ZTOH 3S5LG 1NAML 4EZMA 4QY8A 3CZFA 3K8KA 5E95B 5FO8B 4I18A 4KJQD 2GK0B 3W11D 3CLFH 2GTWA 5JXEC 4Y16A 2BMKB 1T5WB 4I2XB 1ACYH 1UXWB 5FKPB 1ZHLA 1QEWA 2YD7A 1NL0H 1WWBX 5GJTL 2BSRA 2PYED 4OZGB 5DC9B 1YY9D 1Z9OA 3EDDA 5KW9H 5JNYB 3BI9X 4XNYL 5DVKA 4HBCL 3T8XB 2HLFC 1XMWA 5IMOB 1F4WH 2AXGB 4TSBH 4ELKB 2VITA 5ISZD 1FLTX 4M7JL 5FIEA 3WDIA 5KSVB 3VWJC 1K5NB 3M17A 4PIRF 4HS3B 2OM5A 3W0WE 5EZJA 1SYVA 4XPTL 3HZKA 5IBUB 4OUUA 4L1HA 4Z7UA 4YHLH 4Q97A 4JG0L 1DCLA 1K2DA 1RD6A 4LVOB 4QXGH 3LKSA 3KPOA 1CVSC 1KJVB 3TVMC 4O51B 4L1DA 2NY3C 2A77L 1A0QH 4J4PA 2VE6A 2DKUA 4Z9KB 5HHVH 2Z92B 4OZFH 3U0PB 1FZOB 1XEDA 3PWNB 5T1KA 4LCUA 3QFJD 2ZWLT 4MZ3A 3QP3A 1A47A 3GNMH 1ZTXL 5A3IC 2DQHH 3ALWA 4I2XE 7FABL 1G9MC 5GZNC 1SBSL 4U1KB 1AGFB 4PRHB 4TRPH 2KDGA 4Z8FH 2A73A 4HIIA 2FEDD 3NMEA 4UQ3B 5F3HA 2UZYB 1MJ7H 1JHKH 2K3TA 4QTIL 2BDNL 4G8GD 1JPSL 2FEEL 5E9DA 3BJ91 1T6VN 5DURB 3ULSA 2NY1D 3NABH 1CDBA 5IMMA 3ZDXE 3FKUS 1T22A 1JGVH 2D31B 1IGIL 2NTFB 5JW3H 5KSAC 3KS0J 2QQNL 3WN5C 2N1KA 4U3CA 4LVHC 2EEAA 2RIKA 4XNZB 5H2BA 1UB6B 1IM3A 3ZSTA 1OAQH 4ETYA 4EI5A 5A43C 4W6WB 4D9LL 3IU4H 3ESUF 3DV6A 5ICXA 3WNOA 2OCFD 2Q7NA 4TTGA 2Y72A 3I6LD 3NIFE 2GJ6B 43CAB 4Z0XA 1HXMA 1I8LC 5M95B 3LB6D 2OXGA 5J1SC 4FFVC 1BVLB 2QSCH 4M6AA 3VG0H 1YYLH 4NN5C 2NCMA 3PABB 1I7UB 4OBSA 4X5XB 3CK0H 4HIJA 4ODTL 2CIKA 4OKVA 5I74C 1DFBH 1QHPA 3FT2A 2CR6A 4CVWA 1OTSD 3ULVE 3U48A 4NQVB 5EPMB 1EEUA 5I1KL 4F58H 4GXVL 5SWQB 5BV7H 1RHHA 2BVOB 4AEFA 2UWEA 1C16A 2ITCA 3FMGL 4KQ4H 4A6YB 5J13C 1FPTL 1A14L 1AQKL 2XPGB 4HIHA 4LP5A 4QRPD 4R4FH 3ARTA 4LVEA 1UM6L 4Q6YA 5KSBF 1REIA 5CBAB 5FOJA 3RY4A 3G5YA 3IDGA 4R4BA 5IQ7H 4LLUB 1RUKH 3MOAH 4FQIH 4WO4A 1DQDL 32C2B 3BIBX 3QDJB 4OQTL 3WO4C 5IWLA 4HWBH 2GJ6E 3GGWA 1CL7I 4OTXL 4PG9A 2QHLA 1OF2A 2VL5B 3D25B 3C5ZA 2Z0BA 4XRCB 3OR6B 3KWWB 1P7QA 5C0RL 5HGDB 3MUGB 5DS8B 2CRMA 4PFEA 3BIAX 4WU7A 4TNVF 1FRGL 4YDIL 3VD5A 1D3CA 2FZ3A 2IPUK 1KENL 2JB5H 5D96C 2CDGA 5DYOA 1TCRB 3LKOB 4M43L 2F5AL 2DLFH 2EO9A 1DUYB 1N5AA 5K93A 5DGQA 2P44B 4WEUD 4DKAA 3VFTB 4JZJA 1PG7X 1KELL 1FNEB 1VFUA 5FF6A 4PRHD 1MCFA 3AS0A 2DDQL 5DRWA 1F00I 5HDLA 3OX8A 5HHOE 3X3GH 5CEXA 1I3GH 4I4WA 1T0NA 4YO0A 4QHLB 1GGYA 4QRTB 5BVPH 1I3RA 3P4NB 4JB9H 1OAYH 5DURD 1FL6A 5TGBA 4P5TA 4JFFA 5DMKB 1WZKA 4PJDA 3T0EA 3ARBB 4ZUWB 4ZOBA 3SDXA 5DVMA 3STZB 3QIWB 1D6EA 4NQCA 3EGSA 2NY6B 4JM2C 3HE6B 3UC0L 1Z5LA 2FSEB 3TFKC 4XTRC 5F7DA 4NCC1 3WNPA 5TH2A 3T65A 3PWLA 2W0FA 3WLWD 4C83B 1U8MA 5FHAH 4YX2H 1O7VA 3K4AA 3OAZH 5L0QC 2BOCB 4Y4HA 1RZKL 5I76B 4GQ9L 4HLZH 1KSRA 3VI3F 1OLLA 3H7LA 1V3MA 2OYPA 4HEME 2R8SH 1NCNA 4F9LC 1HH6A 4X8JB 4LCWE 5I19H 4D94A 1U3HB 3ARFB 1ZLVK 4QGTA 3HZVA 1A6ZA 2R56L 2B2XL 2BNQB 4LHJB 3MRPB 4XPAL 3VFNA 4R90L 4HLJA 3GHEH 4KK5C 1FL5B 4L9LB 4NKIH 2CKBB 1NBYA 3MLRL 1HQRB 5J12C 2O5ZH 1B0WA 4DGYL 4FFYL 4FHBD 1QSVA 4NQEB 5B22A 12E8H 1MPAH 4NQXB 3FB8A 3VFRB 5B8CB 1JWSA 2JK5A 3TBYA 4OFYA 2R29L 2XRAH 1WFUA 4R8WL 3M1BA 4YHOL 3BDXA 4UUJB 5DEGA 4K2UH 3MACH 3ARRA 3BPCA 4LQFL 3QO0B 4WY7L 3GRWL 5F96L 1B6UA 2EDKA 2N7BA 3O11B 4HEPG 3N85L 4LAQH 5JOFA 1NMBH 3Q3GB 5GJSH 3UTQB 3QWOA 1RZ8B 4ZPVB 3QDJD 1ZLVH 3RZCC 4LSPH 4OIBA 2AKRB 3UPAA 1MVUB 2VR5A 3IETB 5DFWH 5IHZA 4KRLB 4XPFH 4OCSH 1RJYB 2OTWB 2OZ4H 2VQUA 4CW1B 2VXSH 1A6VL 2MJWA 4FABL 1MAKA 4GW5A 3IFPA 1VFBA 2R1XA 3DETD 3NN8A 1Z2KA 5JXEA 2ZCHH 4KMLB 4PS4L 5DD1H 3OKEA 5AAMA 1CDJA 2F58L 2QADB 4ZUTA 4Y5YB 4G8IA 4RGMC 3EW3B 2X4UA 5ADPH 3STLB 1GHFL 2FGWL 3FFCA 4V1DB 3TBTA 4H5SB 1OARH 1B3JA 3PF2A 3SKOB 2EYRB 3DRQB 5J56B 2BRRH 3VWJA 1IKFH 1K3IA 2DQDH 4XNUL 3BFOA 2Y7QB 5T1DL 4OLYL 2X41A 4BFBD 4UV4H 1I1YB 1U8NA 3BW9B 5DMGD 5B38B 1GCFA 5ETUA 5AUMB 3AXLA 5C09A 1IGML 2GTZB 4O5LH 4Y2DB 2X89D 4PJEA 3O9WC 1L7IL 1A7BA 5HPOA 1P1ZA 5EOTB 5E08H 1FH5H 1Z0MA 2E9IA 1A2YA 3NOIA 2FBJH 1D6VL 3ARBD 1NDGB 1RUPH 4P3WA 4M62L 4PGEA 1HQ4B 6FABH 2FEEI 3IDXL 3QIWD 4NUJA 2YC1A 1XR9A 2UUDK 4RRPG 3HE6D 5JMRA 3WXWL 5F6IC 1OSPL 3TLRA 2B1HH 4QHNA 3V4UH 1I8IA 4RQQB 5CCKL 2ZCLH 1Z9MA 1YEFL 1OB1A 2X10A 1P2CA 4MNHB 2ZG1A 3S35L 2XZQH 3VH8B 3IKKA 4WFFE 4PR5B 4AG4L 1XGRB 4RNRA 4X7CC 1X7QB 1FZKB 2CJUH 3WUWB 3ARFD 3FZUC 1RUMH 4JFZL 1AQDA 3JWDL 5K9QI 2IWGA 3C6LC 2BNQD 3G6JA 2IBZX 1MOEA 3TN0C 2FLBT 3H3PH 3HS0A 2XWBA 3SBWC 5LGJB 1N4XL 1MFEL 3EJZC 1SJVA 2PR4H 1UZ6F 1S7XA 1A1NB 2AJSH 3WN5A 4NQED 4O9HL 4PLNC 1DBBL 1QFWM 3GMOB 5D70L 4DVBB 1X5GA 5C07E 1EGJA 4OZIA 4NP4H 1E4XI 2YD4A 3UJJH 1HI6A 3NZHH 4YBLC 1SM3L 3ZT6A 5DJZA 3CH8A 3QWQB 2QSQA 5F7FA 1T7ZA 4QXWA 5CFHA 1KIQA 5E2WL 1G84A 1FE8L 1I8LA 4DKDC 5DO2C 2Y9RT 1T4KA 2X4QA 3BISA 5IB3A 1QBAA 3RWIB 1IM9B 1MJ8H 3IS1X 4PV8A 1UQSB 5C0EA 1CFQB 1KNOB 5DJXA 1TZGH 1DBAH 5HGHA 1U0QA 1MRCH 2EZ0D 2WWMC 4TUKL 4NC2B 3SE8L 1JGEA 4G42A 4HUXB 8CGTA 1W72H 3CFBA 1EAPB 2HWZH 5CUSH 3GKZA 4P48A 1CE1L 3C5JB 3VXNA 5EUOE 1G7IA 2QADD 1T66C 3L6FB 4AL8L 3S3PA 1LVEA 3VJ6B 4C56B 1X4YA 1CDCA 1W0YT 4V1DD 1DQML 2Y6SD 2F53E 1A6WL 4PJAB 3PP3K 4OZGF 1DR9A 2DI7A 2VLKE 4V2BA 5CD5D 5T3XD 5HXMA 1DBMH 2H2SC 3MRHB 4GKSB 5DJYB 4FFWD 2VLJB 5I73B 8FABB 3K0WA 3B9VA 5DUMH 5MI0C 3TNNA 2JB6A 4JFOA 4YQXH 4Y2DD 3FFDA 2YA1A 5I1IH 5KG9A 3JUYA 3O3EB 3C2SA 1X4XA 4YEFA 4K55A 5CEZE 1Z6JT 2YZ1A 5FYKE 1LMKA 1KIRB 2GJZA 2CIIA 3BD4A 5JW5A 1IGCL 1FDLH 4XCCH 5EU3B 5EB9A 3IDYC 2GUOB 3P11L 2VUOA 5MHSD 4KY1H 5A2IH 4XH2B 5T3ZE 1JN6A 1A3RH 3SQOL 4Q6IC 1KJMA 2E6PA 3G5XA 1JYWA 2KZWA 1G7HB 3QCTH 3CFKB 1OPGH 3FO9B 5A2KH 4O02H 4S0TD 3SJVA 4M6NL 3CH1B 4XNQB 2P5WD 4OGYH 5IVZA 4XC1H 4UU9A 4PTTB 1ADQA 4GS7B 5DJ8B 5F1NA 4LF3B 5E99H 4RX4D 4YUEL 1BFTA 3C60B 1QLEH 4ODWB 3DXAB 4ZDHB 4WTXA 2VLJE 3BGAA 3RVWD 4KKCD 4OM0L 1N8ZA 3IFLH 1HEZB 3IGAA 5ADOL 3HRZB 5FKAB 1Z3GL 3QDMA 1Q9WB 2R1WA 1AGBA 1DE4B 3MXVH 3HE7B 4JQIH 1QP1A 1CL7H 3TO4A 3DV4A 4UBDD 3UZEA 3ZDZF 1TQBB 1JTOA 3T4YB 3VXUB 1FYTA 1EO8H 3B9KC 4POUB 2BNUA 2H32A 4L9DA 1FNHA 3KPMA 2R2EA 2ZUQC 5IESL 4M8VA 3ZMRA 3U46A 1C7SA 4ORGA 2FGZA 3OKOB 2E8ZA 4HDIB 5J1AA 1BLNB 4F9LA 4XGZA 1AXSA 3TBVB 1UACL 5DLMH 4HSQA 4KXZI 2PCPB 1IM9D 4H8WC 1G7LB 2C7UA 2ZCKL 3E6FB 5IEKA 1FNGA 4JRWA 2XXCB 4WV1B 4W4OC 3ARGB 1MUJA 3UO1H 4X98B 1KT2A 5GGQH 1I9RH 4Z5RA 3VWKC 4HUWB 4ZUUB 3DROB 4JJ5A 4DGIL 3QI9C 1CU4H 4YGVB 5DQDL 4EJ1C 3KYNA 2CUHA 1U8JB 1G6RL 5SX5K 5L6YH 3EUUA 2AJUH 1NUNB 4PJBE 1H5BA 4C56D 3EFFA 1QA9B 4H25A 4LSSL 1ODAA 4U0RC 5ABDE 5LGHL 2OX5A 1JGLL 1YMHB 3BYYA 1T3FA 3EYVA 5BW7C 1BZ7B 1VACA 1NLDL 2DIBA 1NMCC 3TM6A 2FATL 5TE7L 2FIKB 1ZV5A 4MZ2A 2EIEA 2NZ9C 3E3QE 2VLJD 4ODSH 1UG9A 3V6ZA 1HXYB 3GO1H 5D7LA 2YRZA 3SKJL 3A67H 4PREB 2YXMA 1I7TB 4HIEB 3O81A 3RX5A 3HNVH 3U9UB 1QO3A 1U93A 4N8CH 3FT4A 5E1AA 2DM7A 3MRGB 4LARH 2NLJA 2CSPA 1YNLL 2ESVB 1OAXL 4UIKH 5SX5H 3RWFB 3OKNB 4ELME 4NHUB 2LU4A 4Z77B 2HFFB 5KANG 5CKGA 2A83A 1BFOA 1LP9B 4GW1B 3QEHB 3O4OC 1FAIL 3QZWB 3L5XH 1HZHH 3BIKA 1H3UA 3FO2B 1I3VA 3RL1A 5D93B 3KPNB 5B4MD 1GOHA 3MRCA 3RTQB 4E5XB 3LQAH 4YZFE 2IFGA 3UTTA 5F9WC 4CDGC 3GMPB 3H42H 4KV5E 2HVKB 1FFPA 5K9KA 3UBXA 2PN5A 3C60D 1EO7A 3D48R 3O9WA 4XPGH 4A6YH 4PJFB 1S7TB 1X5AA 1A3LL 2F54B 3DXAD 5HPMA 4ZD3H 1YEEL 2UV3A 4DUXA 5C0DB 3LKRB 1G0YR 4AEHL 5IF0B 4N0YH 3NFPA 3HMXA 4YDVB 3HE7D 1S9KC 4OF0A 1JNJA 1TJGH 4Z7OF 2VDNL 3T2PA 3KGRA 1M6OB 2W9EL 2ESVE 5C0AB 3VXUD 2YKLH 3OJDA 4H0HB 2NR6D 4JQVC 4NO2B 3SKMA 1WBZB 2ZSVB 5E2UL 4K3DL 3WCYA 3HG1B 4NKDA 1S7QA 3MMEA 2CKNA 4N0FA 3KJ6L 4JRYA 1S9XA 5DHVB 5B3JE 3THML 5IMKB 3WJJA 4YHMH 4KJPC 1NEZA 3GSNL 2ADGB 3D39A 2EC9T 2MCPL 1DZBA 5EULV 3O41A 4YE4L 3FQWB 4J12A 1DUZA 3ARGD 4QRSA 2XV6B 1Q9OA 1H15A 3GSRB 3SGDI 4F8QA 3U4BH 2ED8A 1VFMA 3AS1A 3FQTB 5IVXB 2F54E 1AFVL 5EUKA 2Q8BH 5CP3H 1NGPH 4U0QB 2HN7A 3MNWA 3PGFH 2I5YL 4PJHA 3ARDC 4K8RC 4XC3L 4DFHA 3CDCA 3SDYL 1UH3A 1K6QH 1PY4A 3K2UH 1F13A 4X7DC 1JPTL 1BX2A 4WUUA 3UPRB 2VISA 4KUCD 1OAZH 2B0SL 3CFEA 4ISVB 2QQKL 3GMLA 4PGCA 1T21A 5T1LA 5F72S 4EN3A 2J88H 4QEGA 4Y8AA 4KTEL 5D2LB 5J3HC 3BP4B 3FO1A 1NSNL 4UT9L 3S37L 1MJJA 3KYKH 1U3ZA 3R1GL 3SGKC 4D0DB 3OKDA 3WIHH 4PJ9B 3SDAB 4AMKL 3EOTH 3EOAA 4FQ1H 1NGZA 2HYMA 4KKBC 4R6UA 5D7SL 3ZE2F 1OGAE 4PY8I 4LSRL 4EI6B 1XGUA 2PYFB 4BQ9A 3LKQA 3DX7A 1Q94B 2BSTB 4FS0A 2W60B 3KJ4B 5B39G 5EIIA 2QQQA 5EA0L 4D0CA 4CNIB 4G5ZL 4BQCA 2X4PA 4F7CA 4JG1H 1I9IH 2JCCA 2IFFL 5HYQA 3NCJL 1LWRA 3HLAA 1Q0YH 3VDAA 2K1MA 3QNYB 3V5DB 4CKVX 3HR5B 3VGBA 3MCKB 2L4OA 4PJ8B 1K4DA 2CKBH 4YXLH 4FQJH 1T1WB 4LBEA 5EC1A 5KVMC 5AD0B 1XZ0A 1FAKT 1K8IA 5CZXD 4JEGB 5A2LH 4HUUB 2XZCH 3LY6A 5SWZA 5HI5D 1E4XH 4I13B 3RTQD 4AM0A 1D5ZA 3DURA 5KN5A 4HUKB 1ZHKB 3PXJA 4E0RB 4UILL 4JPIB 4QXTA 4I8DA 5D1QB 4K23L 1IC5L 3P73B 2AJZB 1NCBH 3OG6B 5ERWA 2F54D 1I7ZA 1PLGH 2Y23A 3V6FA 2PO6B 3AS2A 4G8EA 2GY5A 2X4NA 3RGVA 5I6XC 2YWZA 1JUFB 1JFQL 2AJVL 1CE6A 4HG4J 4TVSa 2OJZH 2ZUVA 3T3PE 2W0KA 4F37K 1X6LA 1IGTA 2WQRA 2MNUA 3RVTD 2I60H 5C0AD 2DQUL 1UXSB 2OL3B 4JKKA 5EOCL 5IFAL 3PE9A 3VXTB 3BXNB 3QULA 2H9GA 3OPZH 3VFMA 1X9QA 4Y2OA 2GJJA 3HG1D 4WFED 1QFWL 5D7IE 3RL2B 3H7BB 1TJIL 3IRPX 4FXGA 4HF5H 4CU6A 1QLFB 3LEXA 43C9A 5FA3A 4DFIA 3CXDH 1U95A 1RY7B 3EO0A 5DMYA 5ESAA 3H9SB 1DBJH 3LMJL 3O6ML 4PJ5E 2XWTA 4L4VA 2IQ9H 4WHDA 4LU5L 3G5VA 3HAEA 4CN6A 1IBGL 3S9DB 5T3XH 5BRZA 4TUJB 1P4BL 3O0RH 1F4YH 5F7WC 3LRGA 5BO1L 3D0VB 5K9OB 1CDHA 3MR9A 2OP4H 3MV8E 4GMTH 4GKZB 1YJDL 4MD4B 4DKEH 1MFNA 1T0PB 2UYLA 3IFOA 1MJUH 3PGDB 1UADC 3CC5B 5FYLD 4ZG1A 2VXQL 4AQ1B 1YEKH 3VXOB 5I0ZA 4F57H 4JFXA 4BH7A 1KEGH 3MLZH 5AG9A 5DTFA 2DTMH 5GISH 4YC2C 1RHFA 1OCWH 1A7NL 5TQ0L 4TVPL 3I9GL 4S1SH 5C92A 4L4TB 2Q76A 2DQEL 1C1EH 1MCBA 3RNKA 3W0WA 1H0DA 5GIRB 1GGIL 4ZQKB 1WC7A 1U6AH 1N7ML 2EXWC 4W4OA 4PJ9D 1XH3B 3SDAD 1P7KB 3HCVA 3OAUH 3FHAA 1FFOB 4FQCL 2APVA 5E2VH 3QI9A 4LLMA 3U0WL 4OD2A 3I6GA 3GJFA 3CFJA 2WWKO 1F4XH 1A8JH 3ROLB 2BOBA 4JRXE 4G6FD 3DYOA 3JTTB 2IBGA 4PJ8D 4QOKB 4HS6A 3N1QC 4K71B 3RAJH 4C55A 3HI5L 3F7VA 5TDNB 1U41A 3BD5A 4IDJL 4PJAF 4NO3B 5C6WH 4D9QD 1RULH 3ALPA 2Q8AH 1ZA3A 1P4IH 5HYSB 3ILQD 4XMKH 2Y5TB 1B9ZA 5D1QD 3HPJB 3U6RB 2NPLX 1IAMA 1NCAL 3QNXA 1VGKA 3J8F7 4PY7A 1AHWC 2R4RL 2PO6D 4L4TE 2UVEA 1DLFL 3T4AB 4RGNC 1KEML 6CGTA 3UBXG 5IBLD 1Q9KA 3VFWB 5I1GH 3CVIH 3Q6FA 3S4SA 4G9FA 3S96B 2DQGH 4KQ3H 3BDYL 3HNSL 4RWHA 5C0CA 1HNGA 5FYJE 1A6AA 1JRHH 2CDEA 3QO1B 2N7AA 3D2UB 3ES6B 4IRZH 4BFIA 5ANMA 4OQ1A 3A6CH 4OCWL 5DK0B 3QXVA 4DW2H 4F9PC 1JPGB 4NQDB 3LIZH 5CIPB 4DKFL 4I5BA 4M03A 1XGYL 4QOKE 4LSQH 4RBPK 4PJXA 2BHZA 2FJGA 5EBGA 1EBAA 1YNKH 1MREH 3H9SD 1BOGB 2GKIA 1H3XA 1PBYA 3B8YA 5E6IC 3F62A 3PJSA 3IS0X 2C3XA 5DF0A 3LEVL 5L88L 1FG2A 1NEZG 2D7QA 4UV7L 3P3YA 4XP1H 1ZLSH 4RFEB 3O2DA 3M8OL 1YQVL 3QAZB 5LQBL 3WDHA 5BQ7A 3GB7A 3W39A 4R9HA 5IEHA 35C8H 3WNKA 2P48B 4PJIA 2X4RA 1UVQA 3QB7C 5LCVL 3UX9B 2D3VA 2DOCA 2VIRB 1R3IL 1J86A 1CG9B 1F8TH 3GFUA 1UKTA 5D7JA 1AE6L 4UNVA 4GUPB 3NACH 5I0DA 1DEEB 2AXFB 5DUPL 2BNRA 2VH5H 3FT3A 3F12B 4FQLH 2W65A 4L4TD 5EZIL 4WFHD 3WEXA 3WHXB 1KB5L 4CMMA 3MBXH 3B2UD 1JPST 4KZDL 4NQDE 1OP9A 5DRNB 3BOVA 5L2KA 4P57B 3TA3B 1A9EB 1L6XA 1X5KA 4NPYB 2JIXB 4OLZH 1MRDL 1CFNA 1MCOH 3EO1B 4JO1L 4GBXB 2Y36L 3GBML 3SE4A 1J0KA 5H37G 1UWEL 3QJFB 1E27A 4GW4A 4PRIE 1NPUA 3ARDA 4MMZC 1MCSA 5DD0L 4D9RE 1R5VA 4NRYA 5TF0A 2EYTA 4BSWA 4U6VL 5DEFB 3T0VA 1QNZL 4HH9A 4QOKD 2IALB 3WNMA 3FQUB 1LGVA 3WXVH 3QIBC 3FOMB 4M6ML 5GGSA 3O8XB 5D1XC 4EVNA 3RVUC 3VXME 1A7QL 5KANI 4KKLC 4F7EB 1B0GA 2H8PB 3BH9A 2VXUH 4KUCF 5BJTB 1DSFL 1MHPH 4RFOH 4LFHD 2WNGA 1TLKA 4YHNB 3HN3A 1ZEAH 4P2CG 4AQOA 1P69B 5I2IA 4TQEH 4XP5H 2CLZA 4TOYH 1N64H 3F6IA 3BN9D 5HVGB 1PFCA 3NA9L 3O3DA 3SDDB 4LCYB 3F8UB 4NKOB 3G5ZB 5GRUL 1N2RA 3UTPD 4JLRB 3LSOA 2O5YH 5IJVB 3G6AA 5E6ZA 2A74A 4MXWH 5FB8B 3D2UD 3VGGA 3QUZC 2IANE 4WUKL 1LP9F 2XQYK 3N1GC 5KVGH 4NQDD 4XCFH 4QXUL 4UT7L 4D0BA 2F8OA 5I1CH 4W4NA 1NANI 4M1DH 2B5IB 3TWCL 4ETQB 1MCJA 4I3SH 4XVTH 2DQFA 4NQUA 4YIQA 1R5WB 3KXFA 4FZEL 4RCAA 2VZ3A 3KYOA 5CJOH 1PVHA 3T0AA 5CBEA 2AQ1A 4F8TA 2C4FT 1LO5A 4F2MB 4PJFF 2DQTH 1MQKH 5HVHB 4PGDA 2EDEA 3D1MC 1MHEA 3V4VH 3BAEL 3QQ3A 3EKCA 1LK3L 5EC2A 1AO7A 1S8DA 4O2FB 5FAAA 3MLVH 1FGVL 5F9JB 2GI7A 3OAYK 4F33B 3AM8A 3OKMA 2XNAA 2AV1B 3FTGA 3NCYS 4RISL 1IEHA 4G3YL 1ZANH 2VDML 5ESQB 5LBSL 1BJ1H 4Y5XC 3MREA 4KK8D 4K9EH 3VXRB 1ZGLB 1M1SA 3V7AE 3RBSA 4H88L 4JO2H 5CILH 2IMNA 4PV9A 3H8NA 3L3OB 5IB5A 3WFEH 1LO4L 1MCCA 2DLIA 3TP4A 3LKNB 4P2OA 3QRGL 1T20B 5C7XL 3TA3D 3D9AL 3QHTC 5JPMB 2JIXD 5TE4H 2XY1A 2AJ3A 5ICYA 2CH8A 4GBXD 2Z91B 3VD4A 4ONFL 1UH2A 3UTZA 5CINH 3W2DH 3QIUC 3TC9A 4ODUA 1GGUA 2FR4A 3OAYH 2AQ2A 1FYHB 5IVXF 2Z31B 2OS7A 3S36H 3W9EB 5EN2B 3WIFA 4LSTH 1Y18A 4XWOC 1J0YA 4QT5A 1DL7H 4TSAH 3IJHA 3VXPA 4KDTA 3IF1B 5IP4A 3MROB 4MDJB 2ADIB 3O8XD 5CSZA 1EHLL 4G6KH 4E41B 1AGEB 4DN3H 5BV7C 2J1KA 1FJ1A 5HHPB 4CJ1A 3Q48A 1Q8MA 1P84J 1PKQB 1E0OB 4JFHD 4JREB 4K7PL 3GHBL 1IQDB 3B9AA 3VXRE 3CVHB 3QUYC 1FBIL 4HKZA 4DJMA 4EIGB 5BS0E 5DJDB 1YNTB 4TUOB 3HFMH 1A1OB 5EU6B 1N59A 3SDDD 3BZFB 5DHVH 1R3JB 2JELH 5GSRA 1ZWIB 4MNGE 4WHTA 4Y1AB 2B1AH 1KBGH 1U3YA 2AEPL 5F9DC 1S7SA 4GXUN 4H20H 2NY4B 3FB7A 4XBGA 3HUJE 3JBG7 5C08E 3PDGA 3S4SG 4L3EA 3Q6GH 5D9SB 2ORBL 3ZHKA 4DCQB 3I84A 2DWEB 1AD0B 1GPOH 3MZGB 5GGTH 3U36B 3MGAA 1KCRH 4JDZB 3DO3A 1HHKB 5FYLH 4RZCB 2JJVA 4PRNA 3RI5K 4KK9D 4FG6D 1AHWA 1MCEA 4JY5L 4EDWH 1OLZA 4JFEB 2D2OA 3O2VH 1OOAA 5HD8D 3C5SB 2HT2C 4IRSC 4X6CB 4P9ML 1YPZA 4F7TB 1SEBB 3WFZA 4FZ8H 4X4XB 1C08A 1OWWA 5IBTL 1J11A 4GG8B 3L7FA 4QWWD 1MFCH 2LVCA 3RUGA 1YEIL 1H3PL 3WFCL 3KPRA 5ACZA 4F9PA 4PP2A 4HFUH 2FD6H 4G6MH 5K9JH 4PBXA 4O2EA 5I8KH 3BPNB 3CX2A 4TNWK 1BEYH 1CZ8H 5HHMD 3P0YL 4FNLL 5FGBC 1MHCB 3ZKMC 1C12A 3VXRD 4ZUSB 1BVKB 4NC1C 5GS2D 5F8RC 3MRLB 4UIMA 4OKDA 4H1LB 4OD1L 1ZGLP 2EE2A 2XN9E 3DLQR 2K7PA 4K3JH 2Q20A 2ZUYA 5E6IA 3FONA 2FWOA 4WWID 1SYSB 4QRRB 2WWKT 2YPKA 3WL9A 4PJ7A 4PG2A 2CRIA 1WITA 4H8WL 2Z4QA 3U2SB 3EYSL 4X5WB 3TJHD 1UCBL 1CS6A 5MEOB 1CDUA 2RGSA 4JY4B 4FQQA 2Z31D 1QRNB 4NHCH 4NZRL 1WBXB 2VLLB 5DD3L 5EUOA 3U30B 5C3TA 2ZPKL 1J8KA 4X6CE 4OCXL 4BK5A 5TPWL 1IGJA 1V7NH 3RHWK 1LO2H 3PNWA 4GJTB 2D0GA 2F53A 3BKML 3BT2L 4N0RA 1G7QA 4XT1C 2APXA 3BE1H 1XCQB 2V2XB 2J8UB 2VLKA 5CEYB 4BJLA 4E41D 3ROOA 5C0ND 5ILTH 1OGTA 1RMFL 5DFVC 2OL3H 1JHLH 4Z0BH 4HQQL 3QXDA 1NGXB 1MAMH 4FTVE 1JHTB 2BVQA 5GS1C 3UAJD 2X4TB 5JDJA 4NKQB 3X14B 1H3VA 5EU6D 3NTCL 2IPTH 1LK2A 4N0UE 1ND0B 1JNLL 4MA3B 4UNUA 3OR7A 4Y1AD 4ODVL 5GSVB 4L8DB 4GRWE 2VAAB 2NY4D 3D3VE 2G60L 1DBKL 3UBXI 2FLRT 3U4EB 1FN4A 2J6EH 2A9MH 1XIWC 2XZZA 4XAWH 3OKKB 1KG0B 3QIBA 5IHBA 4P0DA 1BWWA 4A2LA 1EFXA 4ZOEA 4XP9H 4LASL 4FMKA 4PRDB 3IDIA 2C3VB 1NFDE 3P0VH 4LLQA 2RBLA 3RRQA 3U7YH 5I15L 5JZ7D 1AGDB 5D5MA 3VXQA 3OF6A 4X0KB 1IAKA 4MA7L 1J05A 4WFGE 3QHFL 4NT6B 2FYYB 4LPYA 1UKQA 4NO5A 1QSEB 4TYUA 3JV6B 4MQ7B 4JFED 5BVJA 3BUYB 3TYFA 3BYTA 4PP1C 3OWEA 2P8PA 4X6BA 2EECA 3S7GA 2BY2A 1GIGH 4HXAL 2HJLB 3SDCC 1KTLB 4PRBA 5A16A 5I1JL 1AJ7H 5C0GB 1UJ3A 3FO0H 1IVLA 4YFEA 5KJRH 4ALAH 1FL3A 4I3RL 5ENWA 5L7XL 3QUZA 3QWRA 5LXGH 1VENA 3GMQA 4M4PA 1NCCH 2YK1H 4Y19B 4OI7A 5MP6L 2AS5M 4IRJB 4XP6H 4MCYA 5C2BL 3QH3A 2BJMH 1DQJB 5CGMA 4XNXH 4U6XB 2WUCL 1LD9A 1VKXA 4CL7A 4WU5A 2G5BA 1RFDL 1OM3H 1WT5C 4J3UA 2DJUA 3HC4L 5JIIA 4KJQC 4M6OH 2FJFA 4G6JH 4LSVL 3O3AB 3W11C 5C6TL 2IGFH 1WZ1H 1R0AL 4UDUA 2HMID 4QRRD 4HXBH 5JA8B 4K3GA 4WNQA 1K8DA 4KMTH 2XG4A 4APQB 3LS4L 1YY9C 3TIEB 2A6KA 1ETZB 1I1AB 3FB5B 2R9HD 1AKJB 1NLBL 5FA4B 1FV1A 2X2YA 3W9DB 3IU3B 1G9MH 1QRND 1DQLL 4ONHB 3Q1SL 3MOBL 4LHUA 4X6FA 3T1FB 1DJSA 4JY6B 3VCLB 1HDMA 4U1IB 3N1PC 2YN5A 3TIDB 1E4JA 3WUZA 4M93C 3EOBB 4IMKA 1CXFA 1M05B 2IADA 5IMLB 3RWGB 3OKLA 3DX8A 4K8RL 1DVFB 1HSAA 1P5UA 3CFDB 1A7OL 3ZKXC 1HIML 1YDPA 2P8MA 4Z7WE 4UDTA 4P2QD 4R0LC 1MFBH 5I1EL 1QBBA 2OK0H 5CIPH 1ZA6B 2EE9A 3QPXH 2VLME 1MH5A 1B4JL 1R3HA 3FQRA 1KPVA 1EEZA 1DLHA 3GSWB 4LDEB 5DJ6A 3Q5OA 3MRRA 1RZ7H 2W9DH 2FEDC 2IAMC 3C8KB 4GRMA 1DANT 1OQOA 1IFHL 3VFGL 1NFKA 1B90A 5TF1L 3ALXA 3VFUA 4KRNA 5T5NG 2ED7A 4KVNL 3BEVA 3LRSB 4J3SA 4JKLA 4J8RA 4K3EH 3CFCL 4HJGA 2NY1C 4QY8B 3C08L 3CZFB 1LNUB 5ICZA 2FNBA 4MWFB 4DQOH 5FCUH 4W6XB 4Z95H 1ZVHA 2ZG3A 1GJIA 1PGRB 3QUYA 4AENA 1QSED 5GHWL 4OSUH 1A3QA 1CTOA 4JCLA 1J10A 2ICWA 5INDA 1JTTA 2AK4A 3QXAA 5SV4A 5FO7B 1QEWB 1ED3A 2BSRB 2FB4L 4U6HA 5E1HB 5HYJE 5DWUL 5DZLA 4NRZB 1BFSA 3HZMB 1Q1JL 4UZGA 3P0GB 3QDGB 5TDPA 3M17B 1S7RA 4HMDA 4J1UB 2CUMA 1N5YL 5EZJB 3LB6C 2EIDA 1BBJB 3DECA 3LHPL 3HZKB 4Y19D 4PJCE 4IRJD 5DJCA 5ID0A 4Z7UB 2R69H 2AXHA 2ZOLA 4BZ2H 4NNPH 4P4RA 1K2DB 4F7PA 3VD3A 3DMMA 4MLIA 3KPOB 5GRJL 2XTJE 1NFIA 2AI0H 4OLVH 1ZHNB 3B9KD 1LEGA 3CLEL 1CYGA 4IIQB 3VXSB 4HC1H 1FC1A 1YUHA 4APQD 4JVUA 1OTSC 5T1KB 5F9AC 4MDIB 1KPRB 5KSUB 1PW3A 2X7LB 5FO9B 1I1AD 3L3JA 3KPTA 1AKJD 1CLCA 1AY1L 5BZDB 4P3DA 1XF3A 1MCWM 3VFVB 2NX5B 3DSNA 1YECH 2A73B 2IMMA 3WKNA 4HIIB 2ARJA 1JZ7A 4MVBD 1F58L 5F3HB 3B5GA 2OI9B 2ZJSH 4XPHH 1CLZH 4NZJA 1WBYA 4QNPE 3ZDYF 1FZMB 5DVNA 3V79C 5JHDA 3AU1B 4LEXH 3FB6A 1F3JB 3GMMB 2RJMA 4HKBA 4JANA 4YBQD 4A2MA 1DVFD 4P2RA 4LVOC 5E9DB 4X8XA 3ULSB 5I8OL 4XXDA 4Z7UE 4MAUH 4WI3A 3VFOA 3BQUA 3WIIH 4PUBH 3BMVA 3EYQD 4RIRB 5FGCE 4GG6B 2KQNA 1S9WA 1NDMA 4HMEA 1D5BB 4WVRA 4CGTA 2B39A 2R23B 4MJ2A 3R8BB 1U8HB 2C1PA 4MB5A 2V7NB 5H2BB 5ALBH 4EBQL 1CD8A 2EDJA 1WAAF 4EI5B 2IG2H 5F44A 1C5BL 3NCFB 5E8DL 2GY7B 5FK9B 4OD3H 5JO5A 1KB9K 2HKHL 3BZ4B 1KCSH 1JWMB 3U7AA 4QHMA 3HC0A 3O45B 4O2CA 3BWAB 3OGOE 1K85A 4R7DB 1MAJA 4KVCL 4TPRL 3MA7B 1RK1B 2HT4D 5LWYH 3KPSA 1IGFH 4HIJB 4LRNL 4NBZB 5DJ0A 3MLTA 5TE6L 1FIGL 4YK4B 4OIIH 3MJ6A 2HJKB 4GRLA 2VDLH 1F6LL 3FT2B 4YFDB 5E9DE 2MPAL 3NFNA 2X40A 4JR9L 4EDXA 1H9VA 3B3IA 2EXYD 4XNZC 1K4CB 3MLYH 5GS2H 3LDBB 3RU8L 4Y8DC 1C16B 1M71A 3MV9B 2HVJA 2OZ4A 3WLWC 1YEGH 1FVEA 1OT1A 2Z35A 3EDFA 1JF1A 5F7EH 1UCTA 1IMHC 2H45A 2IBZY 3QDGD 4U6YA 4HIHB 1YEDA 2RAMA 2NXYB 4QTHA 2ZSWB 5CJQL 3MCLL 1L9NA 4OT1L 3AGVA 3G5YB 3IDGB 4LCCB 4R4BB 4G9DA 4N90E 4WO4B 1QFOA 3VFPB 4LCIL 4HS8H 2EO1A 1T5XB 2A6DA 3U9PH 5BXFB 2P49B 5D7IA 4OZFG 1FNSH 3MO1A 4PG9B 2NQCA 1LILA 1KCUL 2P45B 4WU7B 3VXSD 1EXUB 1OAUH 5DA4A 4PJ5A 3GSOB 2FZ3B 2WBKA 5GRVK 3LQAC 5T1KD 3RY6C 5DYOB 4IDLA 3SDCA 2EKSB 4J6RL 1B2WL 3LN4A 4XHJD 3EJYD 3GUTA 4OGZA 1S5IH 4NM8H 2A0LD 5I1AB 4KRMB 4JZJB 4PGZA 3CX5J 5K33A 2VDOL 4X6CF 2NX5D 2HLAA 3CVHH 1V3LA 2BZDA 3Q0HA 2UWEE 4DOHE 2VO5A 1FO0B 4PBWD 3HZYB 5MENA 5TQ2H 3WJLC 2I9TA 4MX7A 3CD4A 4LHUG 1T0NB 4F80A 1OHQA 1TPXB 3IXAB 1GSMA 4QRQA 5E9DD 1WT5A 2X9YA 4CVXA 3BKYL 4YXHL 3MLUH 4JFFB 1C7TA 3FQXA 4JM4L 3DETC 4LP4A 4PJDB 4RFNB 1DN2A 3GI9L 1I1FA 4N9GB 4Z7VA 1J18A 2VDQL 3DRTA 4QYOA 4CBPA 1QBLH 3EGSB 4FRWA 2PYEA 1Z5LB 1MRFH 3QEQB 5A1AA 4JKWA 5DC4B 4FOMA 1WWCA 5FUZL 1SMOA 1Z9SA 5TH2B 3T65B 2Z8VC 4OV6F 1HHHA 5ISZA 4EI5D 1CK0L 1MFAH 2OQJA 4XCNA 4ZFFA 5F7UA 3BRGC 3BSZH 4Y4HB 3HNTL 4CVZA 3UTSA 4HGWB 2PW2B 1CF8H 1MI5B 4MHHI 2BXZA 1XF1A 3STBA 5JORB 3DX9A 5DMGC 4ZS7L 2AV7A 5DR5H 3RA7L 4Z76A 2CGRH 4ZTOL 2QHRH 3VE0B 5IW6A 1OTUD 3HZVB 4G7VH 3MRNA 2V9TA 1A6ZB 2X4OA 1VFAB 3LPFA 2XKSA 4XWGH 2J8UF 3CLFL 4F7MA 4WI5A 3ARBC 3I6KA 1NBYB 3IDUA 1KN2H 1HILB 1L7TH 4R0LA 1ACYL 3BP7A 3QIWC 1NL0L 5C71A 2NY6C 5F71A 3HE6C 3QFJA 3DIFA 5KW9L 1CXKA 3FB8B 4JFFE 1JWSB 2JK5B 2XTLA 3GMNB 5CMAA 3T0EE 5BCAA 4DEPB 3TBYB 1F4WL 4JHWH 5EBLA 4H1LH 1KC5H 3SDXE 3MV9D 1ZOXA 4NQCE 1BJ1J 3BPCB 3UZVB 4JAMA 2NXYD 2XWJB 5GGVY 3MRDB 1W72A 2R39A 5JOFB 4YHLL 3QWOB 4CMHB 4WO4D 1WQVT 2APFA 4QXGL 1U3HC 3ARFC 4G8GA 2OR9H 3ZO0A 5IHZB 4P3CH 3G9AB 4EQ2A 1A0QL 3QJHA 3RWCB 4LLDB 4M7KH 1RZIA 5HHVL 4G43A 2W0PA 4L9LC 4U2YA 4K7FA 3IFPB 1WF5A 5J6HA 1VFBB 4YHPA 2R1XB 4HJ0D 3IJSA 4XB8A 5LAXA 3RJDA 2GAZA 3MFFB 4DGVH 2CQVA 1EV2E 2FO4A 3ARYA 3OKEB 4HIXH 4K94H 5BZWA 4ZUTB 3GNML 1VPOH 1M7DB 5B8CC 4OFDA 2DQHL 3KNBA 4XMPH 2X4UB 1J0HA 3IDNA 2FL5B 4HK0A 3FFCB 5HHQA 4TRPL 4ZOAA 5GS0D 4Z8FL 4LSDA 2KUTA 1UEYA 2H3NA 1N6QL 2R0KH 4MQTB 2PF6A 2J4WH 1A6PA 1MJ7L 1JHKL 4BQBA 1HKLL 3F5WA 1CLOH 5IIEA 1A4KB 3KPPB 2ERJB 2DICA 3KLSA 1U8PA 3NABL 1JP5A 5EDXA 1IE5A 3FRPG 2EZ0C 5FO8A 1JGVL 1A02N 2X5PA 2B2XH 2GK0A 3BEWA 2F19L 4JFFD 4PGEB 2BMKA 3L95A 1T5WA 4FXKA 1KLGB 1UXWA 4NUJB 2QADC 4B0MM 4Y5YC 5D72H 1EZVY 1UA6H 3W5NA 3QEQD 4S1DD 4NFCA 1EUUA 4HLZG 2Y6SC 2YD2A 3T8XA 2R4SH 4QHNB 4ELKA 5CD5C 5KSVA 4HK3J 4QRPA 2ZOKA 2DL2A 1NCUA 1K5NA 4YXKH 1HH9B 4Y4HD 3QG7H 1YN7B 3VGFA 1S5HA 2H2PD 2VABB 1MI5D 2QSCL 4FFWC 1YYLL 3CK0L 1QFHA 4LL9A 4RNRB 4Y2DC 1U92B 1AQDB 4M7ZB 1KJVA 1DFBL 5IG7A 5D2NB 4POYA 1E4KA 3BH8B 3HS0B 4LMQI 2Z92A 5C09E 1JV5A 4FABH 4PGBB 5CGYD 3TPUB 4PJEE 1FZOA 3HB3D 3PWNA 1S7XB 4F58L 5BV7L 4XPBH 1QBMH 1BAFH 5FOBA 3TZVA 4KQ4L 3F65A 1K9TA 3ZYIA 5KVDH 4OZIB 4OFYD 4HHAB 1F2XK 1HI6B 4R4FL 4U1KA 1XF4B 3MJ9H 1N3NB 1AGFA 5DJZB 3MV7B 4UQ3A 5IQ7L 1RUKL 3MOAL 4FQIL 3BWUC 5GGRY 1KIQB 3GJEB 4WENB 4HWBL 5IB3B 3CU1A 4XBEH 1CDYA 4I0PA 5D6CB 4MJIB 2HFEB 4RA0C 5DJXB 1MIEH 3RVWC 3PHSA 4KKCC 5IW3A 1A64A 4EEEA 2D31A 2NTFA 1KXTB 4P46A 2JB5L 1NGYA 3MBEB 4FQHB 1AGCA 1OP3K 1MFDH 4JN2A 3G6JE 1U42A 4R26H 2DLFL 1G7IB 2ID5A 4UBDC 1EERB 1A4JA 5HDBE 1HWGB 1E28A 4Q9RH 3FFCD 3WXWH 3O4LE 3EOYG 4DUWA 1WV7T 1JYNA 1UWGH 5I8CB 43CAA 1WK0A 1I3GL 1WIOA 4XXCC 3LAFA 3MRFB 1BVLA 3REVB 3ZTJH 3VRLF 2V2WB 3TNNB 3A6BL 5BVPL 3PABA 4JB9L 1ITCA 4X6DE 1OAYL 3AREB 4X5XA 4AG4H 3P9LB 3I85A 5KG9B 4JFZH 4Z7UF 3V0VB 1BOYA 1T1YA 4M1GH 5GGRB 1OP3H 3MLSL 5E8PB 4QF1B 1T03H 1ZVSB 1ZMYA 2CK2A 5EPMA 4FMFA 3O6FB 4NQTA 1Q0XH 1AC0A 1KCLA 3K2MC 4YX2L 5FHAL 4A6YA 4BZ1H 1F45A 1VDGA 1FZJA 3EFDH 1NGQL 1JN6B 2N56A 1G1CA 3G5XB 5IKCA 3V9FA 4TVPE 2R8SL 5CBAA 4Z18A 3SJVB 2LU7A 4LLUA 3BHBA 5I19L 4N1HB 5I73C 3AMKA 1QKZH 32C2A 3QDJA 5IVZB 5D1ZB 3F7YA 4HZLA 4UU9B 1JZ2A 4KI5D 1SQ2N 1QVOB 2VL5A 3GHEL 1PG7H 5HSFA 3D25A 4NKIL 3ZSSA 3WLBA 4S11A 1OAKH 3KWWA 3OR6A 2D4FA 2O5ZL 1N8ZB 2VLRE 5HGDA 4XB7A 5IQ9B 2EDQA 1CXHA 1MPAL 1GZPA 5DK2A 3P9MB 1QACA 2BY0A 4L5FH 4E9LA 4BM7A 3TO4B 3RVUD 2XRAL 4GG6F 3QUMB 3P4LA 5SWSB 1IAII 4K2UL 3MACL 4NQSA 3VFTA 4GMSH 1H3TA 1FNEA 4YDLB 1DQMH 5J6GB 3MV7D 4LAQL 4MNGA 3KPMB 2V2TB 4U1LA 1NMBL 5B4MC 5GJSL 2YPLE 3QCUH 4ZSOE 1N0LA 4ORGB 2O93L 4LSPL 5J1AB 5E2TH 1S7UB 4GS7C 4XPFL 3KVQA 2OZ4L 3DHJA 4QHLA 3C60C 3VD7A 3IKCB 1PY9A 2NXZB 2VXSL 4Z6AT 3SJVE 5IEKB 4MJID 3NIGE 4HV8B 4P4KB 1EHXA 3C9NB 5KS9E 5IM7B 3SCMB 2HFTA 2ZCHL 3ARBA 4ZUWA 2KH2B 1KT2B 4W68A 2GITB 5DD1L 5CWSA 3MBED 2O61A 3HE7C 4Y4KA 1EJOH 3SKUD 5ADPL 3HE6A 4JO3H 4GFTB 1TQBC 1H5BB 1OARL 4XP4H 2NR6C 3QDME 2VQ1A 2BRRL 4KUZH 4RMVA 4C83A 2DQDL 2CXGA 3MA9H 1T3FB 3V6BR 1VACB 3V6OA 4S2SB 5I76A 3SQOH 5F8QC 4UV4L 1FYTE 4FA8A 2EDDA 2X1XR 1MSPA 4X8JA 4O5LL 1H8SA 4JQXC 4Z7QF 5GGUA 4LDLB 5J4MA 3ARED 5E08L 1FH5L 4DN4H 1BFVH 4AEIH 2BNQA 4Q9QH 4WV1C 4N8VA 2R0LH 3MRPA 1U93B 2FBJL 1TVHA 3ARGC 1RUPL 1FL5A 2CKBA 6FABL 5E1AB 2ATPB 4Z7NE 1HQRA 4OM0H 4P23B 1HHGA 4P5MA 4NQXA 1F02I 3O6FD 1BD2B 1CFTA 3VFRA 5B8CA 2B1HL 2A83B 3L3DA 3MYJA 1BFOB 3V4UL 4E42B 2GSGB 4UOJA 2X05A 3H0TB 1XF2A 2ZCLL 2Q6WA 1R24B 4UUJA 3QO0A 5MERA 4U31A 2R1YB 4X4ZA 1QQDB 1BIIA 2BXYA 3U4AA 2XZQL 3O11A 3SJVD 5FV2A 1QPXA 3UTQA 4ZPVA 2AEQH 3LV3B 5AZ2H 1HYSD 2CJUL 5D1ZD 1RUML 1MVUA 2AGJH 2RB8A 3IETA 1T80A 1FFPB 2VJXA 5K9KB 1RJYA 3JXAA 5IBUG 3H3PL 3V8OA 4R4ND 3T1WA 4JFDD 2GFBB 1FFNA 5D7LE 4XBPB 2AXJA 1WZMA 4ZODA 2AJSL 2VERN 4B50A 1QTYT 5EU4A 4YGAB 3QUXB 4HPYH 4Y5YA 4DGIH 2MWCA 2E5EA 1F4AA 4PJDF 4YHZH 3TO4D 4P99A 3STLA 1QLRB 5J0BA 3NZHL 3L9RB 3JV5A 4V1DA 4YLQT 1UJTA 5SWSD 1XAUA 3ZTNH 3SKOA 2EYRA 3DRQA 3BRFA 1KPUB 3T3ME 3JVGA 5D93C 5LJYH 2Y7QA 3P77A 5CZXC 3ZE1E 3PIQB 4NKDB 3MMEB 5IT2H 2XKUA 3ET9F 4N0FB 1WSST 1MJ8L 1FSKB 1S9XB 3BW9A 3D3VA 3RTQC 5B38A 5AUMA 2V6HA 2GTZA 1YQ2A 3D39B 1TZGL 5C0BE 1DBAL 4U6TA 2DLEA 2ATKA 2NXZD 5CZKA 5D6DA 5GS0H 2YEZB 5EOTA 4NWUL 4P4KD 1SJEA 1DUZB 3SCMD 1W72L 3UTTE 1T83C 1Q9OB 2HWZL 1H15B 1NDGA 1ULVA 1YMMB 2YHGA 5CUSL 1HQ4A 1FLRH 1FO0H 4DZBB 3FOLB 3LS5H 5EUKB 4U7MA 1EEQA 3RVTC 3QCVH 2QR0A 1DBML 4RQQA 3RWHB 1BQSA 3OQ3B 4RDQF 4LLYA 3O3BB 2P5WA 4Y7MA 3VH8A 1T0MB 4PGCB 1T21B 4YQXL 3CDFA 4PR5A 1CXLA 4EN3B 3T2NH 1XGRA 1X7QA 4RX4A 5I1IL 1FZKA 3WUWA 2CRYA 1MJJB 1T7XA 2HT3D 4JRYE 3EOAB 4O58H 1NGZB 1J1PL 5LGJA 4NYLA 1FDLL 3LKQB 2ZUTA 1C5CH 4P23D 3VGHA 4XCCL 1W0VB 1EHNA 4WGWB 3CXHJ 1RIUH 5T1MB 1BD2D 1QYGH 3GMOA 4D0CB 4NBXB 2YPVH 1PEWA 2JCCB 1A5FH 5HYQB 4KY1L 1I85C 3UYOD 2VDNH 1A3RL 3QQ9D 3QCTL 3QUKB 1OPGL 4O02L 3PV7A 5EC1B 4KI1A 3MRMB 4PJHE 4OGYL 4X9BA 4XC1L 1B0RA 5E8EA 5E99L 2VDKH 4AM0B 4C57C 5EO1B 4LK4A 3RWIA 1QLEL 5KN5B 3LN5A 4WUUE 5IB2A 4L29A 4PYGA 1EEYA 4QXTB 1CFQA 4KJWD 2EC9U 3KPQB 4YR6A 3IFLL 1OL0A 1IILE 4LIQH 3N50A 4PJ9C 3SDAC 2J5LB 4S1RH 4N8PA 4YE4H 1O7SA 3V6FB 4DVRH 3ZZ1A 4U1SA 3V52H 3S88H 3P30H 4HUXA 3RVVD 4C54A 1EAPA 1H3WM 3O2WH 4JQIL 4LPCA 4PB0L 3RGVB 1CL7L 3C5JA 3KJ4C 3N1FC 3DUHA 4MXVE 3QUXD 4BH8A 1SY6H 3R06A 1ZT7B 4OFKA 4KKAC 4I0KA 3VJ6A 2E7MA 1RZJH 4C56A 1EO8L 1ZT1A 1INEH 1OTTD 1IGTB 3P2TA 2DJ4A 5JQ6H 1JGDA 4PJAA 2AEIT 4PJ8C 4OV5B 3VFMB 2BSSA 2DIAA 3WFBH 2JCCE 3MRHA 4ZFGH 2DI9A 3GMRA 5SV3A 3CUPB 5DJYA 5DLML 3NZ8A 2P5EE 3ILQC 2H6PA 5FV1L 5D1QC 1AC6A 3D39D 1C5DA 2HRPH 2XWTB 2NY0B 4L4VB 3UO1L 5SWZE 5GGQL 1I9RL 2PO6C 4KI5F 5J7CC 2A9NH 1YMMD 3LPWA 1CU4L 3KYMB 5IBLC 3CDGB 3D6GA 1XIWD 4NZTH 5L6YL 2AJUL 1BGXL 3HI6H 3MR9B 5EU3A 2UY7A 2RCSH 4N1CA 1GGBH 3IFOB 3U1SH 4XVUC 2GUOA 2IFFH 2Q3AA 5GGVH 1G7HA 5HYJA 3V0WH 4OZIF 4RA3A 5HHXH 4ZAKB 4ODSL 3RDTA 2F5BL 3A67L 5L2JA 5DMJB 3OMZA 4PTTA 1YEJH 4PP1D 4EN3D 5DJ8A 4LF3A 2Q76B 3HNVL 4W81A 1BM3H 4N8CL 3RNKB 3W0WB 3ULUD 4ODWA 2YMXH 3DXAA 1CR9L 4LARL 1FFQA 3DI2B 3HRZA 4UB0H 2V7HB 4GAFB 5FKAA 1J12A 3VRIB 2JJTC 1DE4A 4L4VE 4LLMB 3HE7A 1T7VA 2DQIH 5F7HA 1CGUA 2EKJA 3I6GB 3GJFB 4KGLA 4WTWA 5BRZE 1FP5A 3L5XL 5JOPD 1CICB 1HZHL 3DGCR 1JZ6A 3VXUA 5J89A 1SVZA 1R5IA 4HS6B 5DUBB 2NW3A 3G04B 5J11B 3F7VB 3LQZA 3OKOA 3LQAL 3TV3H 1BLNA 1QFWH 3H42L 5EZLB 1IAIH 2PCPA 1JYVA 3PUCA 4XPGL 4A6YL 2ARJQ 1TMCB 1G7LA 1EGJH 1P5VA 1BIHA 4NN6B 3B2UC 3PWPD 5ALCH 4ZD3L 5L8JB 5MEPB 4WV1A 3BP6B 4XI5D 3I75A 3T2QA 2X1WL 2KL6A 3ARGA 4U7KA 1WVZA 1I4FA 4LU5H 1F3DH 1IBGH 1TZIB 4HUWA 4ZUUA 1ZVYA 3DROA 4GT7A 3MRKA 4N0YL 4IM8A 3RGVD 4KFZC 1Q9KB 4YGVA 1TJGL 5EU5B 4J7RA 2MOVA 3MRJB 2YKLL 1IGYB 3WHE0 3NCCB 2XQBL 5ESVB 3S98A 1YMHA 4K71C 1F4HA 2EDLA 4CDHA 4BFIB 3T2OA 4LNRA 4YPJA 4MSWB 4LDOB 4PREA 4PJXB 1I7TA 5TQ0H 1MNUH 2FJGB 1KFAH 2W59A 3NIGF 5E94B 3U9UA 2OTUB 2NY0D 4L4VD 1WFTA 1JK8A 2DM2A 3B9EA 1RUAH 4JFQA 5B38G 3UYRH 1OSZB 4MJ5B 2XICA 5CKAA 3MRGA 2MMXA 1CGYA 1FG2B 3U4BL 3BN9C 1DN0A 2IAMD 2GSIB 3V0AC 3HHRB 2Q8BL 3OKNA 1NGPL 2ICEA 1RUQH 3RWDA 1TJHH 1ZLWH 3U0WH 1U36A 5BQ7B 4ZO8A 2HFFA 4NO0A 2VMFA 4GW1A 4ZFZB 1K6QL 4AK1A 3K2UL 4Q2ZB 4PJIB 1U8QB 1MELA 3IVKB 5JIPA 2PNDA 2CLVB 2JJWA 3R0MA 1OAZL 4RRPA 5D7JB 3H3BC 2BCKA 4G9FE 3QSKB 3KPNA 1CWVA 4Q74A 4ZAKD 2J88L 5C0CE 1D9KB 4E5XA 2BX5A 3FT3B 4IDJH 1KYOJ 2W65B 3GMPA 3KYKL 2J12B 2HVKA 1DQQB 4NN7B 3N9GH 2EICA 4IJ3B 5ANME 4CMMB 4N0CD 3W0WD 3WIHL 3ARVA 4PJFA 2KKQA 2PUQT 3EOTL 4FQ1L 3VH8G 2FX8L 3RIFF 5F7MC 1D5IH 4PJXE 5C0DA 4HG4K 4X7TB 2R4RH 1CFNB 4NBYB 3WUWG 2GQHA 4PTUB 5IF0A 4LPXA 1VA9A 3QAZC 2QTEA 1I9IL 4JG1L 1NC4B 1ADQH 2G75B 3JV4A 5FCSH 1Q0YL 4POZD 1G9NH 4WW2B 1IL1B 1CICD 1M6OA 5C0AA 1UM5H 3DSFH 3ZE0E 4BK4A 2CKBL 4YXLL 4FQJL 2ZSVA 3HNSH 2HH0H 5KZCB 4ZS6D 3K3QA 1NC2A 4HWZA 3HG1A 1F3RB 2XZCL 1JF6A 1E4XL 1U8KA 4PJIE 3OSKA 1DTUA 3DVGB 5I17B 4EVNB 4KK8C 4NZUH 3QUMH 1N6VA 2ADGA 3S35X 1NCBL 4U1MB 5HHOB 1J8HA 2BNRE 3FQWA 3TCLB 1W0WB 3TA3C 3R0NA 4YNYB 1KCVL 3GSRA 3EDJA 5L88H 4GBXC 5MEQA 2OJZL 3T0DA 3O3DB 3AMLA 3MXWH 5IVXA 5L2KE 4U4BA 2A6IB 2PTTB 5GGTA 4NWTH 1T1XA 1E6OH 2I60L 1P4LB 1VERA 2WAHA 3LSOB 1G6RA 1RIHH 3OPZL 2CRZA 1VEPA 4YWGH 5IB1B 3X3FH 3QA3A 3UPRA 4HF5L 5EBWB 3QG6B 5CD3B 5HY9B 3QXTA 1NCTA 3O8XC 4DTGH 1CVRA 1QHOA 3CXDL 4U1HB 4D0BB 1LO0H 5D2LA 1DBJL 3SO3B 5INCB 2IQ9L 3VGAB 2V17H 2DQFB 4D0DA 5T3XL 3RX7A 2XZAL 4YIQB 3O0RL 4TNVK 3SDAA 3KYOB 4LCWB 4R97B 1F4YL 4EI6A 5CBEB 2EDYA 2O5XH 5AEAA 2NNAB 3OAZK 3SDDC 1MWAA 2BSTA 2OP4L 2W60A 4GMTL 4PGDB 4ZNEE 2HFGH 4UOW1 1X6NA 2YOCA 4DKEL 1GH7A 1A6UH 1YEKL 1I9EA 2JJSA 1S8DB 4F57L 3V5DA 3HR5A 3MCKA 4M3KB 4XCEA 1KEGL 3MLZL 4PJ8A 3MLWH 3ULVD 3WKMH 4NUGH 1YC8A 4M5YH 2DTML 4OZHA 1T1WA 5I1LB 3L3KA 5D7JD 1OCWL 1LE5B 5DQ9A 1Q72H 3B5TA 4S1SL 4HUUA 1EA9C 1D9KD 1C1EL 3MREB 2EH7H 1BZ9A 3DWTA 2X70B 1ZK9A 2B5IC 4E0RA 3J7HA 4JPIA 1MCLA 1FQ9C 4PV9B 5E00B 3H9YA 1U6AL 4KK9C 1E6JH 3OAUL 3SY0B 4FG6C 3NIDE 3V5HB 4P2OB 1JGUH 2PO6A 1CD0A 3WD5H 4ZNCD 5BOPA 5E2VL 2GJ6D 4R7NA 1CLYH 2AJ3B 1JUFA 5HD8C 3WO3B 5HVHC 5CHNB 1VCAA 3H2WA 1XGPB 4EOWH 3KXFE 1SVCP 1NC4D 4HUMB 1TTGA 1JZ8A 1MF2H 2IH3B 5GRUH 1KJ2A 4OJFH 3BXNA 1AR1D 3RAJL 1C8PA 4EXKA 5KZCD 4HPOH 4QWWC 3QNZB 2ZUXA 3RNQB 1QG3A 3IJHB 3EO9H 3VXPB 4JKPH 5JW4R 3DO7A 1RULL 1AO7E 4MA8H 1QSFA 3H7BA 2Q8AL 1P4IL 3K8LA 3ZHLA 3V4PH 3HMXH 4XMKL 4I1NB 1S9VA 4OIAA 2WBWB 1KLUB 3H9SA 1FJ1B 5IW1B 1QFPA 5HHOD 4Z78A 3GSNA 3BKCH 4TUJA 5I1GL 2J6EA 3F6LA 3ULUF 4HKZB 5K59F 3V5KB 3CVIL 2JJTA 2ZZUT 2E7LC 1N59B 3D0VA 5K9OA 4NKMB 2ILLA 5HVWA 2DQGL 4KQ3L 5GSRB 4OZ4A 3TJHC 4LLAA 4MD4A 4YHKH 5EWIH 4ZTPH 2WP3O 3CC5A 2Z31C 3VXOA 4Y89A 1Y0LB 3OL2A 4IRZL 3L3IB 3A6CL 2DYPA 2R0ZH 2SEBA 3ELAT 3X12B 2JCCF 4DW2L 1AIFB 3EYUH 3LIZL 3EZ8A 3EAKA 3BGMB 4J3TA 2D7TL 3CGTA 5IROC 2DQCH 4LSQL 1CFSB 2H1PH 2MKLC 2EIBA 4I9WE 3VGEA 1MREL 5C0NC 4YHIA 5GIRA 2LQRA 3QFDA 5DHYA 3C09B 5E8NB 4ZQKA 2D7PA 5GS3A 4JREC 2WZPD 4PRNB 1G1YA 3UAJC 1XH3A 3GBNH 4LCWD 1FFOA 4XP1L 1ZLSL 4OFVA 3HI1A 4R96B 4FN0A 4FFZH 3GSQB 4M8QA 2LVEA 3EDKA 3TF7C 35C8L 3SE9H 4UI2A 2XQYG 2ZP0T 2B4CH 3RPKA 4K07A 3ULUH 3O3UN 1LDPH 1C08B 2NY4C 2PW1B 3T77B 3JTTA 4FQ2H 3TVMA 3NACL 3ZKND 5JOEA 2NW2A 2HJFB 5C07B 5TDNA 3RUGB 3CPLB 2D03H 2VH5L 3QZWG 4LMQE 4LLWB 4NO3A 4GH7B 3OB8A 3X13B 4GO6B 3DVNB 4B5EA 4ZFOB 3BP5A 1L0XA 2NY6D 3IFNH 3MBXL 5HYSA 1JZ5A 3WFDH 1MCDA 4Y4FB 2Y5TA 5JZ7C 4L3EE 1QD0A 3HPJA 4UIMB 5I71B 2OMNA 3AAZA 2E7CA 2O26U 5F1IB 4OLZL 1KF9B 3K4ZA 3ME0A 3FONB 3QXUA 1DEDA 1YY8B