3TNMA

Crystal structure of a32 fab, an adcc mediating anti-hiv-1 antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
224
structure length
218
Chain Sequence
QVQLQESGPGLVKPSQTLSLSCTVSGAHYWSWIRQYPGKGLEWIGYIHYSGNTYYNPSLKSRITISQHTSENQFSLKLNSVTVADTAVYYCARGTRLRTLRNAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain of human anti-HIV-1 Env antibody A32
publication title Diverse specificity and effector function among human antibodies to HIV-1 envelope glycoprotein epitopes exposed by CD4 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 218
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tnmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tnmA01
4OFPA 1IQWL 1NAMH 5I1KL 4NUJA 3MBEA 5BW7A 1IAKB 5EZJA 5DJXB 1MCCA 4P46C 2XFXB 4XNUL 5AAMA 1DEEB 1ZT4B 1SMOA 3IDGA 4J4PA 4CVXB 4GAYA 2O5ZL 1BBJA 1YMME 2H3NB 2RCSH 1ZLSH 5CMAA 2DKSA 2MWCA 3O2VL 1T03L 4L3ED 2NY5L 2UZYB 3V8CA 3CMGA 4JFQA 4WO4C 3PQYB 1AGBB 2VTFA 4LVNB 3P4MA 4YHML 3QJHA 1WZMA 2YD2A 5D7KE 5L7XH 3HRZB 4Y4KD 3GMRA 2A9NL 4CU6A 3OZ9H 2CDFB 3VG0L 3GI9L 1E4KA 3BPNC 5I1CH 5JA9A 1JI1A 4ZQKA 3X17A 1RUMH 5DXWA 2KQMA 1FFRA 4XP4H 3BN3B 4WW2B 5KAQF 4WU5A 2ZUVA 1LEKA 3VD5A 3QB7C 1YYMH 1XGYH 1JYNA 2DWEA 1WTLA 4XZUA 4Y4FD 5M94B 1VDGA 5ETUB 1JWUB 1QD0A 1MRCH 4CVUA 4OGXH 2FBJL 3KLHD 5HI5C 1QNZH 1QYGL 4ELKA 4KK5C 3ZE0E 2A83A 2V7HB 2XQBL 4HGWA 1JZ5A 3DX8B 1TTGA 1Q0YH 4MAUL 5EU5A 1A4JB 3VXSA 3ZDXF 4S1SH 1K5NB 3Q1SL 5GQBA 2IADB 1BJ8A 2HFGL 1NBYB 2XTJD 1U6AH 5CSZB 4PRPB 4D0DA 4XAWL 1NGYA 4P99A 1LO3H 1YQ2A 5B3NA 3TYGH 1OTUC 3H6JA 3D18A 3IDNA 4U1KA 4Q58C 2XKNA 3EIFA 1R3IL 3HLAB 4FP8L 4O02L 1IL1B 4AEHH 2VQTA 4P4KA 5DGQA 3TN0B 1MCHA 2HLFC 4U3CA 4EI5C 3CUPB 3D3VD 2CXKA 2R4SL 5C08B 3EOAB 3THMH 4IMLB 3I50H 3DGGA 3MV8E 3PE9A 2BHZA 1DQDL 2GFBA 3PIQB 4GRWH 4XH2A 3TNNA 3NA4A 5I9QB 1DE4A 4BQ6A 1A6ZB 1BFVL 4M3JA 5BZDA 1N7ML 2X1PA 3SDAA 3V5KB 5BJTA 1BBDL 2ATPB 2VDQH 4NQEE 3VFNA 2DLFH 4MLIA 5IMOA 3GIZL 2W1NA 1FL3B 3REWB 3QHZL 2IANA 1DR9A 4GT7A 1CI5A 3SGJC 5F89B 1QFWM 1WV7T 4OLVL 3WIHH 2AEPL 3F12B 2H3NA 3OPZL 2A73B 2XT1B 2VSCA 4Z7QF 1N59A 1FYTD 1DQMH 4PRNB 2XWTA 2EXWD 1WZKA 2AXFB 2WUCH 4XXCC 2BVQA 4Z0BL 5F7WC 3C5ZB 3IFLL 3TH4T 2FL5A 1Z0NA 2DQDH 5GS3A 1BAFL 1J05B 5IBTL 2VUOA 3MNWA 5D7JD 1MQKH 5J4MA 1KFAL 5IROC 2VXTH 1U3HC 2UY7A 2O5XL 5D2NB 5GGRY 5CJOL 25C8H 3HRZA 1FN4A 2BSSA 1SJEB 1KB9J 2NY4B 4IRSB 3MOBL 1YC8A 1L7TL 4AT6B 1DUYA 1K8DB 2I5YH 3MLZH 1HSBA 2IPUG 4OZFG 4DEPB 4JRYD 3B9VA 4GRLD 2F58L 5JOPD 2AJVL 4WW2A 1X44A 1FLRL 3NIGF 5CEYB 1HXYA 1RIVL 4WEBL 3M17B 1W0WB 4WW2F 1YY8B 2ED8A 3AB0C 4HQQL 2BOBB 2W92A 3H3KA 1I8IB 1MI5A 1IARB 3QPXL 1TFHA 2HT3D 3KPQB 4OCXH 5FF6B 1I3GH 4HZAA 4NN7C 1SBSL 3GI8L 3GJFH 4ALAL 1VADA 2DYPB 1WAAE 4K9EL 1SJHB 4OSUL 3O2DA 3QUKB 1T83C 4MQSB 2HFFA 1KIPA 1NBYA 2Z35B 3FB7B 4P59H 1ADQH 2OI9B 1DFBH 2WUBL 4X7SL 3WXWH 2VXUH 4GQ9H 2C3GA 4JG1H 2FD6L 5D6CB 3SE9H 4MA7H 4P3DB 3NZHL 1NLBL 3QFJE 3B8YA 4NNYB 1TZIB 1W8NA 3K8KA 4XCFL 5J11B 4M9PA 4NM8H 4PP2B 2EC9T 2NXZC 1H3XA 5C08A 3QAZB 5F1KC 3T3ME 4EOWH 3BKML 4NNPH 3SO5A 4WFHD 1J8HE 3EOTH 8FABB 5BS0B 2P44B 1FGNH 5E8OB 5HYJE 4G8EB 4WHYG 2DIBA 3FHAA 4GBXD 4YDVB 3KLAA 5L2KD 2RGSA 3SCMB 2ZG2A 4Y4HA 2G9HB 2ICEA 1A6ZA 4YHOH 1E4WH 5TF1L 3V5KA 5IQ9B 1UWEH 1HILB 5GJTH 3MROB 1AD9B 1OGAB 3VFSA 3BT2H 4HT1L 2GIYA 2OR7A 4P4RA 3VRLF 3MLSH 2BHYA 4YDLC 3REWA 3RVXC 5DJAB 3MRJB 1MCWM 1OF2A 2P42B 5F89A 3V2AR 4MXWL 3V6OE 4NC1E 3DVFA 3RP1A 1NCDL 2ZCKL 4UOW0 1PGRB 2CGRH 2UUDK 5IEHB 3WFCL 3I6LE 3GIVB 3F12A 1W0VB 4I3RL 3RHWF 3V0VA 4LPWA 5DFWH 1TITA 1MCNA 4P9HC 1B2WL 3A67H 4PRNA 1A3RL 2AXFA 3L3JA 4HV8B 5A40E 2VLKD 4F7PA 4Z7OE 1CICD 3TV3L 4FQ1H 5C0EB 1EMTH 1I9RH 2ZUSA 4RIRB 4WUKH 5D2NA 3S7GA 3BDBA 4FFYL 3EJYD 2XWJB 1IGTB 3B2UD 2F5AH 3S3SA 1NGWA 4IRSA 2YA1A 4GXUM 2ZSWA 1K8DA 2GSIA 4RGOL 4EVNB 1HE7A 3CLFL 1A8JH 2Q3ZA 3QCTH 4I77L 2AAVA 4Y16D 3U46B 1QEWB 4NZUH 2R0ZH 3ARED 3LH2L 2FRGP 4MAYC 1QQDB 2NXYC 4NQUA 1WF5A 3M17A 4JDVB 1UEMA 1W0WA 1YY8A 5I2IB 2BOBA 1QBML 1MIMH 4XRCB 4MVBD 1A1NB 1I8IA 3R8QA 5FF6A 1M71B 3BUYB 4U1HA 3FQUB 4YLQT 4XC3L 4R2GD 1ZS8A 3T0EA 1MFDH 3NGBC 4PJAA 2B1HH 1KN4H 1T22B 2W9EL 5I73C 2VXQH 4YJZL 2W9DH 4PJAF 1NFIA 2J7LA 2FBOJ 1IMHC 5F96H 2BNUB 1VFOA 4WEUD 2Z35A 2D0HA 1IT9H 2YPVL 3CVHH 2KBGA 3ZYJA 2AJXL 5HVWA 4TSBH 3QUXB 5DURB 2NCMA 4MMXC 4P3DA 3BAEL 4WGWB 4Z9KB 4UT7L 5A2IH 1KG0A 1CDUA 1GYAA 1KJ3H 3GSNL 4G8GE 4PP2A 1HK6A 2K7QA 4ZUWB 2NY0C 1II4E 4G6AD 3QIUD 4IRZL 5FYKU 4NSKB 4MA1B 4JY4A 3VDCA 2A6KA 4G8EA 4HH8A 1P4IH 4MYWB 4F3FB 4YDVA 5C0BD 3NFNA 3HUJB 2JTDA 3SCMA 2R4RL 5H37H 4HLJA 4F9LC 3BW9B 1NGZB 2DIAA 2PR4H 3QDGA 1HILA 4JKWA 4KTDL 2A6JB 1GC1L 1W72L 3MROA 3PJSA 5DK2B 1OGAA 1MY7A 4XTRD 1CFVL 1KV3A 1Q72L 3LEVL 5J3HD 3EO9H 5MEOA 2OLDA 4KQ4H 5DJAA 1BFOA 5DUPL 5EBGA 3TJHD 3SDDC 3RUGB 5I1IH 4FQXC 4KZEL 4LNVA 3VG9B 1E0OB 1JGDB 4S1RL 1JYWA 4PRBA 3AMKA 4ELMA 4KKCD 5IEHA 2ZCLH 5D7LA 1L9MA 2VC2L 4ELMF 4XHJD 1TZHB 3BWUC 1BM3H 5HDQL 4JQVA 5CS7A 1GJIA 3QBTB 2APXA 2Z8VC 4PJDB 4IHOB 3BE1L 4NCC1 1T89C 2GT9A 4LCWB 4LASL 5HI4C 1ACYH 2NY2B 2YSSA 1P5UA 4NQVA 3WN5A 5T1LB 3IKKA 3K3QA 3FRUB 3ARUA 4RIRA 1A6AB 1CR9L 1NH6A 5CP3H 4DN3H 4R90L 1IGTA 2BNQD 1KCRL 4U2ZA 3BDYH 3VXMD 4YE4L 1P69B 1YNKH 5E4IA 3MGAA 1MFCL 3MRKA 3U6RB 1T4KA 1LEIB 1IM3B 5LG1A 1AO7D 3EYFA 1LE5A 1G7QA 5FK9A 3CIQA 4M7ZC 1BFTA 4JDVA 3AFLA 2HJFB 2FJHA 2GY7B 1XF2B 3E0GA 3HG1A 4FS0A 4XRCA 1A1NA 4FRWA 5I1GL 4QRQA 2FEDC 1TJGH 3LN4B 4JFFB 2ZKHL 4KVCL 1J1OL 5JQ6H 2PETA 1ZANH 4WTZG 1AGDB 4W81A 3PWVA 5FCSH 1TCRB 5IVXE 4BA8A 2EYTA 4WFFE 3MFGB 1ZVYA 4MJIB 2IBZY 3MO1B 4K23H 1K4DA 1KLFA 4XP5L 5HYSB 1OCWH 4UQ2B 4GG8A 2CUMA 3WIIL 1DLHB 5HHXH 5JW4M 3K1DA 4UILL 2AJYL 5E2WL 4QTIL 4XPGH 1EAPB 4KUCD 2R0WH 4S1DD 2FLRT 4OD2B 5CBEB 3VE0B 4WJ5A 5D7KD 1NGPH 3QEUA 4ZUWA 1GIGL 2ADFL 3GDBA 3X11B 3QRGL 2JKXA 2VLRA 4PS4H 4X6BB 4HS8L 1LE9A 1SBBA 4WVRA 4AIZB 1NGQH 2ERJB 2NX5B 3IYLW 1YY9D 3RDTD 4JQIL 2X4TA 4F3FA 4LLVA 3EDFA 3OF6A 5IHZA 1HHJB 1WGOA 2CIIB 1TCMA 5FGCB 1NGZA 5FUOH 4UT9H 5JDSA 3UTSE 1YYLH 4N5EC 5CSGA 3HKFA 3P0YL 3KLHC 2V17H 3MNVA 5DK2A 4PJGE 2X1QA 4JFHE 1JF1B 3N50A 3RUGA 3IJHB 1EAJA 1S7SB 5DSCA 5IVZA 4HWBL 1JGDA 4APQB 3RUGF 2VR9A 4XPBL 1E4XI 4Y1AE 1TZHA 1YDPB 2A6IA 1IKNA 3WEXB 4AENA 3E2HB 5H8DA 3PL6A 5C1MB 4PJDA 4IHOA 3B4NA 1G6VK 3OWEA 5T1MB 5CJ8A 4LCWA 3S36H 4V1DB 3U1SL 4PJDF 1S7RA 2XG4A 4ZUSA 3RVWC 5DVOA 1R5VB 5KSVA 3FRUA 5EU6E 2R29H 4QRPE 4RAHA 3D85A 1R3JB 5KS9B 3NIFF 2V6HA 3W0WD 5B21A 3QXTA 1H3PL 2O5YL 3U6RA 2FX7H 1GGIL 3MV8D 3ARRA 4LLDB 4LSRL 2OP4L 2E9IA 2OSLB 5ESQB 1SJXA 2WBJC 1EEZB 5DD5L 1UGNA 4F80A 2QSCL 4DKFL 1JHLL 2HJFA 4XVTL 1JGVH 2OL3B 3MRBA 2E27L 3GMNB 2KH2B 3CDFA 4OIBA 3WXVL 1T66D 4OLXL 2P49B 3FFCE 1VENA 3LN4A 3LHPH 4DGVH 1PG7H 4NQED 1P2CA 2NY7L 4CW1B 3V52L 3O6FB 2YD1A 5FCUH 4EBQL 4FQIL 4HIXH 4P5KB 4YQXL 3BZDA 4ESKA 3MO1A 2V2WA 3FMGH 3TPKA 5KSUB 3W81A 4KJPC 2D3VA 5J57B 4JY6A 1DLHA 4K07A 2OJEB 1PD6A 1WISA 3NA9H 5E8DL 5EBLB 1QSFB 3B2VL 5DLMH 1J7VR 4ZPTA 5TE4H 2W0KA 2E3VA 3BXNB 2AGJH 3TT1L 1T04A 1LK3L 2Z4QA 4RMRA 5D5MA 1B4JL 5CBEA 4P9MH 5D5MF 4DKEH 3TBSA 1DN0A 2CKBB 5CHNB 3LB6D 3HS0B 1JK8A 5FYKE 4PG2C 4YHLL 3BIKB 1A6WH 5B22A 4X6BA 2BMKB 2IPUK 3O45B 3SY0A 4QOKB 2VE6A 1YEJH 3K2MC 3RVTC 5E5RB 3IETA 3ZHKA 5E00B 3ARDB 1OB1B 1S7XB 2BCKB 3EYVB 1HHJA 5IB1B 3RWDB 3I02B 1UJ3A 1YPZB 3H3PH 2X4OB 5AYQA 3BN9D 3WNKA 4AH2B 2MQ3A 5IMMA 5BV7H 2Z31C 3BSZL 1ED3B 3K81A 3RU8L 1MHHB 1JF1A 3FO1B 2N56A 3IJHA 4JFDA 3SJVD 2HTLD 3IDXH 5JQHC 1RULL 2YA0A 3UX9B 4IJ3B 4APQA 1T2QL 3L7EB 4EUPB 3S35L 1Z9SA 4U1SB 4Q9RL 1VERA 3AM8A 3V0WL 1OGTB 3QDJA 5SX4H 3R06A 5JXEA 3MLUH 1RZJC 5DHXB 1YEDB 4V1DA 2OXGA 2NY6C 1S5HB 5LAXA 3RL1B 3U2SA 4WWKD 4OZFH 2Q6WA 1I1AD 2OMBA 4IRJA 2WWMC 1LEGB 3DROA 5IHUH 1PX3A 3P40A 1UM5H 1S78C 2NY1D 3UTQB 4XWOD 1PAMA 4U05A 4JM2B 3IAQA 1S9XB 4L1DA 1J8HD 2QQNH 2XZAL 5J56B 4LLDA 2LFGA 1XH3B 2OSLA 5IHBA 5HYJD 3FQXA 3MOAL 4UIKL 1T6WA 1EEZA 5DMGD 5KSAB 5FKPA 3IXTB 5CD5D 2OL3A 3WFBL 1S3KH 1EX0A 5IF0B 3HI1B 2ICWB 1D6EB 5DMJB 4Y5YA 4PGDA 4WTXA 3ZE1E 3QNZB 1RUQL 3O6FA 3DI3B 4XC1L 1NMAL 1X5FA 3BZ4A 3TZVC 3TO4C 3AAZA 3VH8G 1PW3A 4GMTH 1AC6A 5KSUA 3I6LD 1E27B 3S88H 4IS6A 1NMCC 4PJCA 1IZKA 4OJFH 4NRXA 5KSBB 1CLZH 3A6OA 4PJCF 3B9KB 5EBLA 1ZAGA 4MQXD 1T2JA 5EN2A 3WL9B 4YX2L 3RZCC 1F11A 1MJ8H 4PJXA 2IALA 3LKOB 3D39E 2OK0L 3B2UC 4JANB 5KVGH 4WHYH 2CKBA 4JVPA 5CHNA 1KCUH 4PJXF 1I8LC 2YPLA 3KPMA 4CNIB 4GJTB 3STBA 2YRLA 3AVEA 3I75B 3O45A 4X83A 4QOKA 4IOFC 2RR3A 2VWEE 4W6YB 4EDXB 4GFTB 5E00A 1I7TB 3ARDA 3FZUC 3RPKA 3EYVA 4KHXL 1T2XA 3I02A 43C9A 1YPZA 1ULVA 4P49A 4R4NC 4HUUB 1VACB 1IBGL 1S9KC 2EDJA 4AH2A 1YPZF 3P4LA 1FRGL 3SE3A 1T1XB 4Q7DA 3WNMA 1A1MB 3VXTB 1MHHA 5HHME 5ECJE 3MNZA 4G43B 1V7NH 4QF1B 5DK0A 1BGXH 3A6CH 3HB3D 4OUOA 3G6JB 4GS7C 2FGWL 1F13A 4EUPA 1KCSL 4CMHC 3NCJL 5IIEA 3PHQA 3KXFE 1JNLH 1OVZA 5I1HL 2EDFA 1WJ3A 1DQQB 1CG9B 3KYOB 5LCVL 2DTMH 4YHYB 5JORA 1EBPA 2I60L 1KJVB 4KZDH 1MRFL 3ET9F 4MNQB 2I25N 4Y5XB 3H7BA 1IKFL 5TH2A 1CXKA 5ESAA 3WJJC 4CJ1A 4M93C 1YEEH 5HYEA 3BPLB 2R2BB 3FO2A 3M1BB 4JM2A 3VRJA 3RIFF 2HRPH 1S9XA 5DA4A 1RJZB 2Y7QA 4GAGL 4JM2F 1XH3A 1AJ7H 2ICWJ 3CFEB 4ZUTB 4J8RB 4GKNB 5GGQH 1VHPA 4EJ1C 5E2TL 1V7MH 2V5YA 3OJ2C 4TUKL 4P57B 4R0LB 2EEAA 5FYLH 2PXYC 5C0AA 3UTPD 3WLWD 4L9LA 5KW9H 3MGOB 3MLXH 5ERWA 5SX5H 4XNXL 5IBLC 5T3XE 1P7QD 2ICWA 3ARTA 1VFAB 1EHAA 3G04A 4WEMB 4NHUB 5CJXA 4F37K 3RFZC 4OCYH 5I6XB 1DN2A 5DQJA 2FIKB 4U6HA 2NNAB 3P2TA 5HSFA 2D31B 3QEQA 6CGTA 2DBLH 2GITB 3QEHB 4KGJA 5ANME 5J7CC 4UOW1 5EC1A 1NBZB 4LPCA 1O5DT 1FORL 4QY8B 1BMGA 5KSBA 3L6FA 4HUXB 1P5VA 3TCXA 4XNUH 5EIIA 3B9KA 5KSBF 2HKHL 1H9VA 1KOAA 3WL9A 5SV3A 1HYSD 4BH7B 2O5ZH 1AKJB 5IEKA 4CU8A 4Z7NE 3O2VH 3LKOA 1T03H 2H45A 2NY5H 2GK0B 1S9VA 4CN4A 3T4YA 1FZOB 3IFPB 5I8KL 5I1JL 4CNIA 4Y2DC 4NNXB 5E08L 1SMAA 3I75A 3HPLB 1E6JL 5EC2B 3NCBB 4YHMH 1OP3K 3TVMB 2GTWA 2EXYD 1ZHKB 4Y4HD 3GJFB 4PRHB 1I7TA 3ULVE 2WWKT 3RKDD 3V95A 1E4XL 1FH5L 4NRYA 1JNHB 3LQAC 4JFOB 5DR5L 4MZ2A 4IOIA 1JGLH 4KROD 1Q9LB 1OP5K 3BHBB 4OLWH 5HD8D 4G43A 2AQ1A 3QQ3B 3SQBA 1AR1D 1F4XL 3G6JA 2FLBT 1AI1L 1JF5A 2FBJH 1MCWW 3H9SA 3RL2A 1WWAX 3G6JF 3IDIB 3CLEL 1QYGH 2MHAB 5F6IB 5D1ZB 1CF8L 1CG9A 1KACB 2XQBH 4N0YL 4LHUA 4FMFA 2F8VA 2R2EB 1AXSB 5I75B 1PBYA 4X99A 2VUYA 3Q1SH 3VA6A 5GS0D 3OKLA 4XMPL 3EJZD 4KKLD 4MNQA 3RX8A 4F2MB 3ZKMC 3L95A 1A47A 1PKOA 1EVTC 4XAWH 3P30L 3T0AA 1WSST 4MJ6B 1T7ZA 4QEGA 4M7JH 3NBNA 2BSRB 1Q94B 1OP3H 4U1GC 3PXHA 2FO4A 4S1QL 5I15L 4JVUA 1BQHB 2D0FA 4M61B 4PJ5A 3S96B 4GRWF 2R2BA 2ZUUA 3M1BA 5JHDB 4GXVL 4XXDB 1R3IH 5HHQB 4O02H 1DANT 1M4KA 4ZUTA 4J8RA 4GKNA 1F5WA 1T7YA 4QHKI 4X4MA 3HE7A 2YD6A 3CNKA 1ERNA 4F7EB 3V8OA 4KI5F 4YHZL 3EOYG 2WV3A 1UT9A 5CCKL 4NKIL 1VFAA 1KJMB 5FFLA 4KDTC 5F1NB 3MYJA 1C12A 4I5BB 1BFVH 5BRZB 1U41A 2FIKA 4U33A 5C0ND 1N7MH 3MACL 4NJ9H 1D5MA 1VGEL 2QHLA 1CBVL 2IH3B 1MWAB 5EU4B 1NBZA 3MODL 2WBWB 4HXAH 3QI9C 3T3PE 3GIZH 4QY8A 3QHZH 4BM7A 1HDMA 4Z7VB 2Y36H 4HUXA 5GGRB 4OLVH 3HNTL 2XXCB 3SGDH 5BQ7A 1MCIA 2ZG1A 3ULUC 4BH7A 4XNZB 3U4BH 4NN6C 3OPZH 5CINL 5F9JA 3DSFL 2E8YA 1TXKA 2EDTA 2JE8A 4OKDA 4P2RD 2GK0A 5EU6D 1I9IL 4K8RC 4Q74A 4JFZL 3ARQA 4NNXA 3NAAL 4POZC 5DEFA 3RGVA 3WNLA 5EC2A 4OF0A 5D2LE 1KFAH 1M7IB 5DTFB 2O5XH 1NANI 2VQUA 3GJFA 5CJOH 1MCOL 1WIUA 1F4AA 3DO3A 4FA8A 4M5ZL 3MV9E 5JHLL 1HH6B 3B9AA 3O3EB 2RFXB 3IDMB 4NRZB 1A21A 2F58H 3BFOA 3D0LB 2AJVH 4JDZA 1ADQA 4DW2L 4M48L 1FLRH 4PJ9A 1Q9LA 3FFCD 3R1GH 5ACZB 1JYVA 3CCHB 4WEBH 5AUMB 2VL4A 1HWGB 4HQQH 3QQ3A 3CGTA 3SDXB 5E1AB 4M7KL 4LP4A 3UBXA 1FNGA 1SBSH 4ALAH 1FL5A 3ARGB 3QUYB 4LPXA 4KWUA 4U7KA 4I0PD 3FRPA 5D1ZA 4K9EH 1RJYB 2GJ6E 4OSUH 3VFRB 2VDPL 2R2EA 1FNAA 1R5IA 4GW5B 4EEEA 5LQBL 2WUBH 4X7SH 5JXAL 5HGBA 4BQ8A 3BRGC 2RIKA 1C1EL 2BC4B 3BJLA 3IKCB 2FD6H 2WSKA 3P4OA 4FQHA 4F9PC 4I2XE 4OZHE 1KPVA 1T1YA 1NLBH 3NZHH 5GHWL 2P5WE 4XXDA 4BSJA 4YBHA 1YA5A 4ZDHA 2OTUB 3RWFB 4OI8A 3WS3A 2VISA 1JPSL 4XCFH 2Q87A 3LKSB 4P2OB 2XYCA 1TTUA 1T20A 1F3RB 2DLEA 5HDBF 5HHOB 3UEZA 4F7EA 4FNLL 3MBEC 5BW7C 4QRTA 3IB4A 4KQ3H 4HLZG 5FM5O 1ZLWK 4LVOB 4U0QB 3O8XD 4GUPB 1KJMA 4LSPH 4J4PC 1UH3A 3BO8A 5BRZA 2X70B 5TF1H 3QDMB 1QACA 4PJEA 2F19L 5GS0L 2AVGA 2IH3A 5MENB 1S7TA 3LPGA 1CS6A 2F54A 4YDKL 4MWFA 2BXZA 5EU4A 4PJEF 4G6KL 5T3ZD 3SE8L 1U9KA 3NPZB 4HT1H 2VIRA 1ZLUH 4OF3A 3ZL4L 1I8KB 4HFUL 2HTKC 5GGRA 2OR8A 1JZ7A 3QO0B 2NW3B 2YUVA 2J8UB 2ILLA 4P23A 3SDCB 1E4KC 2QHRL 4GKSA 1B2WH 3H0TB 1A3RH 3DUSA 1K6QL 2FX8L 3DGCR 4JPWL 3MRCB 3SN6N 4M7LL 4O2FA 5I71B 1KB5H 2XPGB 3TV3H 3SQOL 4RZCA 5IWLA 1M7IA 5DTFA 1QRNB 3BI9X 4FFYH 2KUTA 4HDIA 4YC2C 2VYRE 5D7SL 5C0IB 3QUZB 1UKTA 5B39B 3NACH 1ZLWH 1OAYH 1JFQH 1RY7B 4NC2B 1S7WB 1F58L 1HH6A 2KZWA 3CLFH 2DN7A 2RFXA 2XZCH 3IDMA 3BEVA 1JRHI 1C08B 3CVHA 5ACZA 3IF1B 3CCHA 3LD8B 3OR6B 2IFFL 5AUMA 5T5NF 4B0MM 2EDXA 1ZHNB 5CEZE 4KGLA 5A2JH 3L3GB 2AK4B 3MR9A 4TULL 5E1AA 3HC3L 4XC3H 1X7QA 2NPLX 4L8BB 3GSQB 4MB3A 1ZVHA 2FX9L 3ARGA 3IJSA 2EYRB 3QUYA 4PGCA 2XXMB 4ZAKB 2W9EH 3VFRA 5GGTA 3U9PL 5SWZB 5E24E 4JKLA 4P4KC 4ZFOL 1WUNT 4UMGA 1A9EA 1G9ML 5SWSE 5DA0B 2X4RB 3D85D 3WJLA 4C4KT 2HMID 2AJXH 4Y8DC 4NBZB 4RFNC 3BAEH 1I7ZB 2C1PA 3O4LA 1LDPH 4UT7H 1UKQA 1FP5A 2Y06H 4KUZL 1AR2A 2WQRA 3C6LA 3LKSA 4BFIA 2X1WL 2CXGA 4XMLL 1BVLA 3SDAC 4P2OA 3AXLA 3SOBL 2QKIA 5F6HI 4MZ3A 1CT8B 4U3XA 5DO2D 3C8KB 1I85A 5HHOA 4IRZH 2A74B 4EIGB 4YBQC 4W70A 2CUIA 5IHLB 2X44D 5LGKA 3BH8B 4GUPA 2DICA 2R4RH 3MV7B 4UDTB 4Z78B 1RZ8B 3BIBX 3PGDB 3DETC 5HHMD 1F4YL 4CKVX 2WLYA 3HB3C 3WKML 2Q8AL 2CPCA 2BVYA 1CDJA 1GC1H 3VXSE 1W72H 5GRZA 5HHVL 5CGYD 2E7LA 1CFVH 1S7UA 2R2HA 3LEVH 3KXFD 5CP3A 5DUPH 4LVNC 1AQKL 1ND0B 5CGMA 3QO0A 2C3WA 3IU4L 4MGXA 2J8UA 4Y89A 4PJIB 5K9KA 5I74B 4L4VE 2VC2H 2J8UF 1P9MA 2F53B 1IQDB 4WFGD 1NCCL 5DD6A 3X3GL 3BE1H 4LASH 4WW2C 4JRWA 2HYMA 3O41B 1JPGB 1K3IA 4Y5VB 5IB3A 1QRNA 1BQLL 3ZE2F 1CR9H 2ITDA 4R90H 4TRPL 1KCRH 3QUZA 5B39A 5KOVC 4YE4H 3R0MA 1V3KA 4OZIB 4JFYB 1L7IL 3OB0K 2JJVA 5T3ZL 5FV2A 4HFWA 1C08A 3ZKXC 1IGJB 3OR6A 2Q7NA 4PJ7E 1ZHNA 1RI8A 3EYQC 1HXMB 2YR3A 3L3GA 4UTBL 4YXHL 3ZYZA 2MTPA 4G3YL 1YEHL 4HIJB 5JXED 1CLYL 4L8BA 4KVCH 1J1OH 2EYRA 4ZAKA 4AEFA 3MRGA 5CZXD 5I1DA 5FXCH 5SWZA 3BPNB 3K80A 9CGTA 2E5EA 3QSKB 3CDCA 4IRJD 2BVPB 3IDYC 1UWXK 4N0UA 4JKMA 3PQYE 4XP5H 1P7KB 4U31A 1YEGL 3WIIH 3H9HA 2Y9RT 2KL6A 2EDKA 1P53A 4TTDC 8CGTA 1RZIA 4XVJL 4QCIA 5A43C 1SVCP 2DQHH 1I7ZA 4CMMB 5AD0A 1BZ7A 5E2WH 4QTIH 5I9QC 1IZJA 3LS4H 3RX7A 4RWHA 4Y4HC 2CIKB 3B43A 5DUML 3NIGE 2BY1A 1RZGB 3GZKA 3U7YL 5EUOB 2EDBA 3KPRB 1GIGH 5ICZB 2ADFH 3LEXB 1J1XL 4QHUB 5D70L 1HNFA 1D5IH 2DRUA 4G8IA 4B7LA 5FM5M 1U93B 2A74A 2DI7A 4F15C 1PYWB 3VXRB 5KVFL 2VDRH 4BKLB 3OB8A 4UDTA 4H20L 1XZ0A 1RZ8A 2K3TA 3PGDA 5EO1B 4Z78A 3NFSH 1OSZB 1QUNA 2NYYC 5JOEA 4W4NA 5DUBA 3JUZA 2WINB 1U8OA 4XPAL 3P0YH 3N85L 3MRHB 5C7XL 5EPMB 1HH9B 2P5EB 3JXAA 2J6EH 4P2CG 1EXUA 1BOGB 3PWNA 5C86A 4NPYB 4PRPE 3GMLB 1T1WB 1EUUA 1GZPA 2X4UA 5D2NC 5TQ2L 4PJIA 3TIDB 2BXYA 5INCB 12E8L 2BX5A 2NY4C 4GAJL 4IRSC 4PJIF 4X0KB 1F2QA 3X13B 4ZTOL 2F53A 3CFDB 3IDJA 4ZTPL 4EN3B 1Z5LB 2I07A 3O0RL 2G75B 4XBGB 5C08E 1T0MA 3DVIA 4YZFF 3U1SH 1AD0B 1YZZA 4Z7UB 1JPGA 5D96B 4Y5VA 2PO6D 4FQ2L 4HPOL 1PLGL 1TIUA 2UYLB 4HS3A 1D3CA 5CAYB 1MEXL 2AEQH 4G9FD 3OXRB 3T0EC 5MEQA 1H3PH 3UP1A 4UI2A 1G9NC 2O5YH 3FB5B 4RRPG 3QIBD 4JFYA 4ODUB 3RQ3A 4HJGA 2OP4H 3OBAA 4P5TA 3RVVD 4F7TB 3ECBB 1E28A 2A77L 4TVPE 1LO5B 5DD5H 4DGIL 4LHQB 2QSCH 3DUUA 4P2QB 4YDJA 3VRLE 1JHLH 1JL8A 2B4CL 4XVSL 4XVTH 1IGCH 2OI9C 2E27H 1HHIB 4Z77B 3OKYA 5E9DB 2EH7L 3ZKNC 5IB2B 4OLXH 3DARA 2EYSB 1QSEB 2IG2L 1U3HB 1S9YA 1CGYA 2NY7H 3S4SB 3OG4B 1CWVA 2ESVB 3V52H 5C6WH 4HXBL 3QIWB 4FQIH 3MLPA 4NFBA 5ISZB 4YQXH 1BREA 1S7VA 1U92B 1KEGL 5HJ3B 1H5BA 3RWEB 3LDBB 5IB4A 2BVPA 4KXZI 2XKSA 5FDWB 1U36A 3QAZC 3VXPA 4RGMB 1UB6A 2K1MA 1P7KA 1MY5A 3P0GB 1ZHLB 5D2NE 4RCAA 3AB0B 5E8DH 5JUEH 4CMMA 4MD0B 1LK3H 2I24N 3SCMC 4DCQA 4D94A 4UBDC 2P46B 1B4JH 1HKLL 4JM4L 4L4TB 3T8XB 3MLYL 1RZGA 2ZWLT 4OFYD 3QQ4A 5ICZA 3LEXA 4LEXH 4QHUA 4YHLH 1ZTXH 5IQ7L 3ARBA 3ES6B 2G5RA 4KAQH 1N0LA 1R5WA 3U0TB 3WO4C 5IFHH 4RGNC 3RZWA 2GSGA 2IAMD 5GXBB 5ESVA 1KN2L 3STZB 4FABH 3MZGB 3DV6B 1CFTB 3OL2A 4NDMB 4JG0L 1OSZA 5L8JB 3BGMB 1CCZA 4JQVC 3MRHA 1T5WB 1NFDF 1VFBB 1HH9A 3JWOL 4OZFA 1GGYA 3BKJL 1IM9B 3STLA 1YJDC 1BOGA 4NPYA 5EU7C 1OAKL 1CIUA 3GMLA 5D1QA 2VDNL 1XGUA 4JE4B 1B88A 1RULH 3MRFA 2BK8A 2AJ3B 1T2QH 2Z91A 3IRZA 5GRYA 4YK4B 1RHHA 3X13A 2R9HD 1JZ6A 3CFDA 4QXTA 4MX7B 2NR6C 3IFNL 4EN3A 1Z5LA 4L4JA 1JRHL 2G75A 4HKJB 4U1NB 4ODHL 1AD0A 4M6OL 4JHAL 4AEIH 5BS0E 3TBTB 3NCYS 2A0LC 1J86A 3TA3A 4ZD3L 5FYJE 4YDLB 5F7MC 3DXAB 3OXRA 4E41A 1A14L 1XGTA 5JLZA 1NMBH 3B3IA 4HS6A 4ODUA 2AS5M 5I19L 5DC4B 4G80A 3ECBA 3DBXB 4NQCA 3MOAH 1JN6B 3F7YA 4P2QA 1LHZA 1KJ2H 1OGAE 1FFQA 1PVHA 3QHTC 5GRUH 1B6UA 2VLJD 2NY3B 3H9SD 1RV6X 4MA8L 4F7CB 1HHIA 3WFBH 5B4MD 4Z77A 4ISVB 4X5XB 5E9DA 5IB2A 2EYSA 2H2SC 3HHRB 3MJ8A 4ELME 1JV5B 4KRPD 5A3IC 5J6GB 1EFXA 4QRSA 2VERN 1NMAH 3QIWA 1T1ZB 3FJTA 5KG9B 2XG5A 1JPFB 1U92A 5HJ3A 2CR3A 2R1YB 4UZGA 3PHOB 5HYIA 3BP5B 2EE2A 1Q9KB 3KPSA 4MAYB 5J89A 1MCFA 1ZHLA 4PP1C 1P84K 4NQDB 2B1AH 4N8VB 3IGAA 3EBAA 2YD5A 4PJBB 1HOCB 4MD0A 4YX2H 2CJUL 3HE7D 4LSQL 3HZMA 2FGZA 4YPGB 1BIHA 4B5EA 1Q0XL 1Q38A 2OK0H 4KI1A 2X9YA 3NGBB 4LSVL 2H32B 3VGFA 2P43B 5E8EA 1X4ZA 3ES6A 3MUZ1 3UO1H 5F70A 3U0TA 1M1SA 1D5ZB 1OQOA 2OTWB 3QPQC 4KHXH 2BNRA 5D4QA 3STZA 1CFTA 3DV6A 3CC5B 4X5WA 1KUMA 5E56A 1IBGH 4QXUL 3ROOB 5F7KC 3BGMA 3OAYK 1DVFB 3LVEA 4LQFL 4HKXA 1U8MA 3PDOA 5GGSY 1T5WA 3PL6C 1VFBA 2D2OA 1N6VA 4H8WC 4PPTA 4TSCL 4WDIA 4O51A 1WK0A 4JRXA 4XVUC 4OCMC 3UYRL 1NAML 2AJ3A 1Q9OB 2FGWH 1KCSH 3NCJH 4J23A 4ZS7L 4HUNB 3MLTB 3SKUD 3ARFA 2XN9D 2HFEB 1EZVX 1L0YA 3BMVA 4GW1A 3RGVD 2MQ0A 2G5BB 5LCVH 5A16B 2WW8A 3S37L 1IC7H 4HKJA 1RZFH 1T0NB 1MRFH 4U1NA 1AXIB 4IEFB 4FTVB 4UQ3B 1IKFH 3PWUB 1MLBB 1J87A 3TBTA 4C56A 2AV1B 3EDJA 3PV7A 2OMNA 1I3RB 3B83A 3MOQA 3DXAA 2AXGB 3GBNL 3SDDB 3HUJE 4FQXB 1EEYB 1KSRA 1KTKE 3BVNB 5L7XL 4GAGH 5A2LH 4ZUUB 3DBXA 4G5ZL 2Z9TA 3NCCB 5IB5B 5E2TH 3WHXB 5I1CL 2P45B 3JTSB 1U3JA 4TUOB 4O2CA 4TUKH 1CQYA 2HWZH 4F7CA 3QXDB 1CFQB 4XP4L 5DRWB 3VFPB 5ICYA 1XGPB 2L7UA 4XNXH 4X5XA 2B5IB 2IMNA 3RUGE 4OZ4B 4QO1A 1JV5A 5J6GA 4EXPX 3LN5B 1BD2B 1T1ZA 3V6FB 1Z9LA 4OGXL 1R3KB 3RI5F 2WIMA 5DJZA 1G7JB 2R1YA 5C09B 1QNZL 4PJDE 4LLYB 4LCWE 1F4WL 3HZYB 1J0JA 4X4XB 2Z93A 1Q9KA 3MUGA 3W11D 1U42A 1U6AL 4JO2L 4PJBA 2BJML 3PWJB 2HKHH 1CE1H 3QO1B 4PJBF 1UXSB 3UJJL 4X9BA 1UJ3C 4NZJA 4DVBB 4QHNA 4RX4D 5IT2H 2DDQL 4GG6A 5ID1A 5I8KH 5I1JH 5E08H 4GG6F 3BIAX 1E6JH 5KVEH 2PYED 3C8HA 1OTSC 2O61A 4MSWB 4N0CD 4U1IB 1QFUL 5IMLA 1IGYA 4ORGB 4L3EB 1U8IB 4RWYL 2VAJA 4APQC 1ONQB 4JFFE 4G8FB 1MLCB 4YR6B 2DOCA 1E4XH 2F54D 3CC5A 3WIFA 3DWTA 3AM8C 3ROOA 3X14B 3SGEI 5JXEC 4OCSL 3E2HC 2AJZA 3GFUA 4MJIE 5T33L 4ZOBA 4RAUA 2D9QB 4Y4KB 2R1WA 4QRRD 1GAFL 3FOMA 4NM4L 4XNQB 3GKWH 3MA9L 2PTTB 1F4XH 2IFGA 1E6OL 2DLFL 4IRJC 4N9GA 4RA3A 3DI2B 4MB5A 4ONFH 1G9EA 1AP2B 2VZTA 2FO1A 3CSYA 4XNYL 1MCRA 2EC9U 3PQYD 3WIHL 4QNPE 4FG6C 3OHXB 4TNWF 5F71A 1TQCB 4Y4FB 4A2LA 2I9LB 5DJ8B 5KTEH 4B41A 1JI2A 4WTZA 4XMPH 5J1AA 4FTVA 2A6DB 4UQ3A 5D8JH 3P30H 1K9TA 1PEWA 1PDKA 3KLSA 3QYCA 3K4DA 2AV1A 4LDOB 4BK5A 2NX5E 4Y88A 5I15H 1F3DJ 1I3RA 4H5SA 3UZQA 2AXGA 1MQKL 3QG6A 4Y5YC 2VXTL 3KS0H 3BVNA 5J13B 3PNWB 2XTJB 5DFVD 3O6FC 5FGCE 4C4KO 3C09C 5GRXG 4OGYL 3DRTA 3O6ML 3WHXA 1O0VA 5HGDB 4NWUH 4TUOA 1IGML 3MRIB 1ZSDB 3OKNB 1CU4H 3GUTA 3K4AA 3QXDA 1CFQA 2EIBA 5DRWA 3VFPA 1XGPA 3ILQC 4YHZH 2VKWA 4NKOB 2VL5A 5CCKH 2DMBA 3O3UN 4NKIH 2H6PA 3AS2A 3SKMB 1G0XA 2Q3AA 4HIIB 3LN5A 1A6PA 1BD2A 3MACH 4PRPD 3QDJE 4JQXA 4Q6IB 5ABDE 1VGEH 1CBVH 3BYTA 5C09A 4HIEA 2IQAA 4NKMB 3MODH 4V1DE 4JZJA 5ICXA 1BOYA 3ROLA 3W2DL 3O4LD 2IH1B 1D9KA 1HZHH 5B8CA 3FB6B 5HY9B 3HNTH 2YUZA 1CD1B 4ODBD 5I76A 3LKRB 3TN0D 3PWJA 1DFBL 3ARDC 5KS9E 3WXWL 1M7XA 1UXSA 1QBAA 5CINH 4OUUA 3ETBF 3N1QC 2IJ0C 3DSFH 3Q6FB 3H8NA 1I9IH 4JFZH 4YO0A 3SE3C 1MFEL 3A0OA 3FQNB 4JZNB 3NAAH 4ZNCD 2I9TA 4DUXA 4MSWA 4U1IA 4DUVA 1PFCA 4QGYA 3W39B 4ORGA 4ZXBD 4EOWL 1MCOH 3FQRA 1FYTB 2VQ1B 1U8IA 4PRIA 4IJ3C 4JLRB 2VITB 5E2UH 1ZGLP 5JHLH 2FDBP 5EOCL 3X14A 3VFMA 3RHWK 3SE4A 3GK8L 1A7NH 1U95B 1IILE 4Y4KA 2DS4A 5FM8A 2JB6B 4XX1G 4KRLB 5HPMA 4KY1H 1GH7A 1EO5A 2P7TB 3BT2L 4M7KH 4OCNC 5C2UB 4JCMA 2QLVB 1QSFE 5DHYB 2E7CA 1AIFA 1DL7L 3GSNB 3C5ZD 3UXFA 4JM2C 1REIA 5FAAA 1D5XA 4HBCL 3OHXA 2EIDA 2Y07L 1OL0A 5SV4A 2AJUL 3RY4A 3RWJB 2I9LA 5DJ8A 4HKZA 5GS1A 2D7MA 3A67L 5ADPL 3MRQA 5JXAH 3BQUA 4QOKE 1AH1A 3G6DH 4L9LC 1FL6B 4OGAD 4LK4A 2YBRB 1YN6B 3PDGA 3ARVA 2APVA 4OBSA 4PV9B 4FQ1L 4D9QE 1KELH 5EO9B 5GHWH 3B9EA 1EMTL 1I9RL 4WUKL 4RFOH 5CJXC 3L3OB 1EIBA 1RHFA 3GB7B 1YPZE 1W72B 1X3DA 2F5AL 2RJMA 1OD9A 2JK5B 5I17B 1CD9B 3RIAF 4PLNC 4Z7WB 2QSQA 3OG6B 3OKNA 3MA7B 4FNLH 2VZ3A 4C83A 5DRXB 2DYPD 4NJAL 1G6RB 4QWWD 4I13B 3E6FA 3B9KC 3QEGH 2ADIB 1U91B 1MIML 3D3VA 1DQJB 1T21A 4HIIA 2QADC 5T5FL 1B0RA 3VFWB 4Q6IA 2F19H 4K71B 1CXLA 5GS0H 1ZGLB 3KVQA 1MFDL 1KB5A 4G6KH 4GBXB 3SE8H 5L2KB 4XP6L 1FJ1B 2R9HC 5EH1A 4LRIA 4BYHA 3FAXA 1WVZA 1BX2A 4KK9D 1CD1A 3B5HA 1RZ7H 3U48A 1KXTB 5AWNH 3TNMB 1BECA 3RWIB 3SEPA 2XNAA 3VXUD 4E42B 2IF7A 2X4SA 1RMFH 2CLRA 2QHRH 3P4NB 4HWZB 1QO3A 5BS0D 1R3LA 3U30C 1K6QH 1W8OA 2FX8H 4JPWH 5FYJD 3TZVB 4M7LH 4RMVA 4JZNA 4ZPVB 5I0ZA 1HHKB 4TSAL 2CH8A 5FO8B 3F65A 3D25A 1UG9A 2APWA 2MCPH 3T0XA 1FG2B 1NMCB 4G7YL 4ENEC 3ZT6A 1N5AB 4JLRA 2EZ0D 2XI9A 3DMMD 5LXGH 4PLOB 1P4IL 1CICB 1H8OA 3SKOB 1KT2B 5D7JA 2FEEI 3VWKA 4X6FB 4F8TA 4RISL 2IFFH 1FVEB 5TDNB 3MUJA 5DC0A 3O3DB 4LSTL 5IK3B 1EO7A 3VGDA 5E4EB 5KSBE 4JDTH 1EEQA 2P7TA 4TULH 3HC3H 1NCUA 3CMOL 5DEGB 4JRYA 3NN8B 4Y16B 3G5XB 4GRLA 3EO9L 4HUMB 3AREB 2C3HA 5FO7A 5C0CB 3K2UL 3LEYL 4I9WE 5B3JF 3TT3H 1EHXA 3U9PH 2V5TA 4LDEB 4NQSB 1CL7I 3RWJA 2ZCLL 2QL1A 4HJ0D 5DZNA 3VFGH 1G9MH 1SJVA 3FAWA 4KI5C 4R2GB 5DZOA 2DAVA 2PW2B 4YHIA 4H26B 4LKXB 3OJVC 3VH8A 1FL6A 3T65B 1YN6A 3QDHA 4HG4K 5TGBA 5JPMA 2XQYG 3V79C 3KG5A 5EO9A 1TVHB 3IVKB 4A6YH 5F88B 1S7QA 3CD4A 3TO2A 3GB7A 4KUZH 1FBIL 1W72A 2NZIA 3BGAA 1TETH 2JK5A 5I17A 4P48A 4JR9H 1YNKL 4FOMA 5ALBL 3SOBH 2DBJA 3JWDC 1JMXA 4Z7WA 2JELL 1RIUH 2Z8SA 3MFFB 4WFED 3GMOB 4Z7WF 5DRXA 5DMYA 3BUTA 3I2CL 3CFIC 1XF4B 4KFZC 3G6JE 5CJQH 1FZJA 3V9FA 1DQJA 5DJDB 1H3WM 3SKNB 5IGXH 2HN7B 1I75A 1CDBA 3HTLX 3WKMH 5A2KH 1TJGL 3QIUB 2Q8AH 4LCUB 3QXUA 1QKZL 4Z76A 4LCCA 2W91A 3QUXD 5JQ6L 5HHVH 1NAKL 4GBXA 2YMXL 2XWBB 4NIKB 5L2KA 5C0FB 4MNQE 2Y5TB 3O81A 1X5YA 3F7RA 3WFHB 1J18A 3QQ9D 3TVMC 1CDCA 2VAAA 1P7HL 5FYKH 3U79A 2PXYB 1QVOB 4MDJB 2YPKB 2ZSVA 4C59B 1OCWL 3LV3A 4E42A 4M8QB 3VU2A 1VFUA 1G7MB 3OKEB 5DT1L 1SYSA 3QNYB 3TWCL 2FNBA 2AKRB 1JWMB 3X3GH 3OKKA 3IXAB 4X4ME 1JPST 4PJ9C 3SBWA 1A6VH 5KVDL 1KPUB 1F2XK 1NGPL 3V7MA 3TBYB 4K7FA 4D0CB 1FG2A 1A9BA 4D9LL 4TRPH 3WDHA 4CVZB 1N5AA 2J3SA 3BKYL 3LY6A 1XF5A 5CIPB 5IOPB 2VLKA 4X6CB 1CICA 5DVKA 1L7IH 3SKOA 5FKAB 5D1ZC 4PJFB 2QQLL 2DMCA 2OQJB 5I75C 2B39A 5F7EH 4X9GA 3UTZA 1OSPL 3K7UA 1KXQE 1QBBA 2BNQB 4JHZA 3VXMB 3HE6D 3E6HB 3VMPA 4UTBH 4Y2DB 5FEBA 1E4JA 1R3HB 4NUGL 2A1WL 3MXVL 4YXHH 1GGTA 2PW1B 4G3YH 1JGUH 1YEHH 1YMHA 3NN8A 4Y16A 2V7NB 3G5XA 5L8KB 1CLYH 4ZO7A 5DVMA 4RMSA 1AO7B 3AREA 2H26A 5CWSB 3VFUB 3F7PC 1FO0H 4ERSH 3DYMA 5F1OB 3HZKB 4KMQA 4O5LL 5FYJL 3T2QA 5T1LD 5CJBA 1B0GB 4ZNEA 1J0IA 1KGCD 3L9RB 3PWPB 5L8LB 2BSED 2W0FB 2PW2A 3ALPA 4AG4L 3T65A 4XHQA 3F7VB 2GTZA 2AW2A 4KKBD 4PRHE 3KWWB 5F9AC 4GRMB 3U0WH 3V6ZB 4K7PL 4ODWA 4N0CC 2AV7B 3D9AH 3DYPA 4JFEB 1KIQB 3N1GC 1NUDA 1ORQB 5DUMH 2J6EA 4X6DA 3G5ZA 1WIPA 3Q48A 3FTGB 1T0PB 5D70H 2DD8H 4X6DF 4ONGL 3KLDA 1EFXD 4Y8AA 2VABB 5J9PB 1BVKA 1XF4A 4HZLB 5C3LD 2KDGA 1OAQH 5KVFH 32C2A 4U1GB 5DJDA 4H20H 1NEZB 3SKNA 4KC3B 5DF0A 4P23C 1FCGA 2EDLA 3QIUA 3QULB 1TJHH 3KPSD 3LQZB 3N85H 5CD3B 2XV6B 1MCKA 3RDTB 5FCUL 5C0BA 1WFNA 4LPTA 4J3WA 5C0FA 4YHNB 4DGYH 5CLTA 3ARWA 3Q5YA 4O58L 1P1ZB 1RZJH 3T04D 4JKPL 2AJSL 1NANH 5IWLC 4HKBB 1QVOA 3MGTB 3BGFB 12E8H 1HI6B 2ADGB 4M8QA 3UAJC 1G7MA 5JHDE 1CN4A 4U1JB 4BFBD 4ZTPH 2AGJL 2BY0A 3L5IA 3O0RH 5HDBE 1AQDA 1UJTA 1PY4A 1OTTD 4ZSOB 3LIZL 3CSPA 5FGRA 4DKEL 4EI6B 3TLRA 2BNRD 4R3SB 3HNSH 4M1CD 4ZODA 4FQ2H 1T3FB 4NC0B 3QI9B 4HK0B 3TYFB 5IJVA 1CGWA 3HCVB 1IAII 4CVZA 1MEXH 2WK2A 1Z0MA 1AC0A 3KPNA 4U0RB 1S8DB 4N0FB 4R96A 5CIPA 3QUYC 3ARGC 5EZIL 4X8JA 5BRZE 2PYFA 2FSEB 5FKAA 4MJ5A 2A77H 2ICWI 2OQJA 4NN6B 4WCYL 1S9WA 4XCEA 4DGIH 1LGVA 2DQFB 4Q0XH 5IFJB 3H3PL 1I1FB 1NBVL 2BNQA 4XVSH 2FECI 1XGRB 2V5SA 4PGZA 2MCG1 3WJLC 3CFCL 2C1OB 4YIQB 1KTDB 1R3HA 2BFVL 4Z7VE 3ARFD 4LF3B 1PZ5B 1PX4A 2EH7H 5CUSH 1PG7W 1RPQA 1R0AL 2IG2H 4YFEA 5DK3A 1AO7A 2WIIB 4KTEL 5LVEA 3VFUA 4D0BB 4BZYA 2VSDA 4HXBH 5C0GB 1RZKC 3BISA 2F74B 2C7UA 3HZKA 1I7UB 3C6LC 5DRZA 3MRPA 4KV5F 4C56D 2X4NB 4QTHA 4P2OC 2E9JA 3H7LA 3L9RA 1WCQA 4S0TD 1X5AA 2DKMA 2W0FA 1I85C 2AABL 3MLUL 1G0DA 4XNMB 1LP9A 5IP4A 3QNXB 1T6VN 3CX2A 1QLRB 1LP9F 3KWWA 1GZQA 4GRMA 4LVOC 5HHNB 2R8SL 2AEIT 5T3XH 2DI9A 4WI5A 3WNNA 4JM4H 1JGEB 1L6XA 3MLYH 1MPAL 3FCTA 4JB9L 2Z8RA 3FTGA 1UVQA 3SPVA 1GCFA 35C8L 5IQ7H 4GLRI 2E7LC 2YWYA 3N06B 3TPUB 5FECB 2J5LC 2VABA 5F21B 3SO3B 1CGVA 3SDXE 4HZLA 3BPOB 4KUCF 4GAFB 2Q76B 1KN2H 4Q97A 1F90L 3MRDB 3GHBL 3G9AB 3DV4B 1U8HB 4Y19D 3UTTD 4QXWA 4JG0H 3QULA 1P9MC 1LD9B 4LLQB 1NUNB 2ID5A 3JWOH 1KYOK 3BKJH 3WUWB 4LOUD 4RAVB 4YHNA 1G7IB 3UYOD 5I71C 3FOLB 2C4FU 4R7NB 2VDNH 4JFPB 4HIHA 3ESVF 3S3JA 2CLZA 3MC0A 4C54A 3O2WL 5T1KA 4NUJB 3S88L 5ACLA 3QUZC 2EO9A 4OJFL 1MCJA 5GZND 5H35B 1CLZL 5AEAA 2DWDA 3V4UL 3ULVH 2FEEL 2FATL 3IFNH 4OD1L 3SJVB 1TENA 1JRHH 1BBJB 4UV7L 1MJ8L 3VD7A 4D9QD 3T08A 3ZE0F 4JHAH 5HHOE 5DJ2A 4DOHB 1A4KB 2D9CA 4HK0A 3TYFA 4JFQB 5GZOC 3UC0L 4ZD3H 4L8CA 2GCYB 2I27N 2X1XR 3CDYA 3QJHB 5FDYA 1S8DA 3MQIA 4ZAKC 3GMRB 4U1LB 3QDME 5I19H 2WNGA 3AMLA 1F6FB 2W9LA 4WWKB 4OV5A 1CL7L 1I1AB 5MENE 4ZO6A 2DQFA 5IFJA 1I1FA 4ZQKB 3W0WA 1XGRA 3OJDA 2C1OA 2MPAH 3SHSA 4YIQA 2DQJH 3IAGC 4WU5B 5DDHA 3GBLA 4LF3A 1LEKB 5IG7B 3MV8A 2RHEA 1FC1A 2ENYA 2OR9L 2J8UE 3JV6A 4H0HB 5GJSH 4XZUB 4ORZC 3A6CL 1U8KB 2F74A 1OY3B 3C9NA 1I7UA 4F8QA 2EDWA 4YXLL 1JIBA 4U7SA 2MNUA 4ELKB 2ED7A 2A83B 3KYNB 1F02I 4HGWB 4NQEA 3I9GH 3ZE2E 4LGSB 4XNMA 2HFTA 5E03A 1MCDA 1HCFX 1GRWA 4ZFGL 2J1KA 1J10A 2Y6SC 1QLEH 1QRNE 3QNXA 4G6MH 1QLRA 4XPFL 3RWCA 4D0DB 2DJUA 4HJJL 1P84J 5KSAD 5DVNA 3LN9A 4LSQH 3MSPA 3RTQD 1Q0XH 2JF1A 1YEEL 1JGEA 5GGSB 4BSVA 2MMXA 3D5OF 3LQAH 1JCKA 2BHUA 4I0KA 2AI0L 5C0RL 4LNRB 4UU9B 1A3LL 3BZEB 2AK4E 1HHGB 1ZVSA 5HI3C 3OKOB 4MS8D 1WLHA 4PJ8D 5I74C 1I1RA 1O7SA 1U8HA 1JTTA 3IS0X 3VGAC 5SWQB 4RFNB 4HWNA 2APTA 3TNNB 1WBYA 3RVUC 4LLQA 5SWZE 4OCYL 3CFKA 3WUWA 1FFOB 5BZDB 1BJ1H 1G7IA 3SDAB 4GOSA 3ZYOA 4I3GA 1QLFB 5EDXA 3FOLA 2DBLL 4R7NA 1VESA 4TSCH 4I9WD 4Y5VC 3O9WD 5F93C 1B3JA 3UYRH 1VEOA 5IMOB 2DQEL 1NJ9A 1DANU 1MQ8A 4J7RA 1HYRC 2IANB 5H35A 4ZS7H 3WS6A 3VD9A 5IW1A 4XAKE 2BOCA 4H0IA 4P5TC 2DL9A 2R56L 3C2AH 4P0DA 2IQ9L 3SJVA 1FAIH 3S37H 3TJEL 3EKCA 1N59B 1GVIA 2GHWB 4L8DB 4PRID 2XWTB 1A6UH 5C6PB 3EO0A 2BVQB 2DKUA 1A4KA 2FL5B 5ACMA 2YZ8A 4NO2A 3R8BB 3U4EB 2GCYA 1MRDL 3MNWB 3GBNH 3GGWA 4BFGA 5FB8B 3MV7E 1FN4B 3IT8D 4U1LA 2BSSB 4WWKA 1JWSA 4G5ZH 1XR9A 4BJLA 1I1AA 1VKXA 4FXKA 4NCDA 1DUYB 1H5BC 1HSBB 3NCFB 1JGLL 1J8HA 5IG7A 3EYSH 5IROA 1HXYB 3AS0A 3EZJB 3MBXH 4OLWL 1ZV5A 5GISH 5HYJA 4PJIE 5C70A 1MI5B 3BH9B 1U8KA 5BV7C 5DJCA 1TZGL 2R0KH 2F53E 1TQBB 2YD3A 4Z0XB 4DFIA 3BQUD 4H1LG 1VADB 2W0LA 4PYHA 3TBVB 1F4WH 1P7QB 3KYNA 3ARBC 3ZKXB 1OT1A 2HFFB 4XPTL 4K8RH 4RA0C 5C8JA 1KIPB 4JO2H 2BJMH 5E8PA 1INEL 4U4BA 3V6OA 4M7JL 1FVDA 4KMTL 4OI7A 3UJJH 3OXSA 4OZIE 3AC0A 2DDQH 5GGSA 3ZYIA 1Y6MR 5I1LB 2BZDA 3QXWA 4LNRA 4UU9A 3IDYB 1QFUH 3BZEA 5D1QC 1AXTH 1HHGA 4Z7OF 4NZTH 3IDUA 4RWYH 3OKOA 2OZ4L 5ADOH 1U8NB 4XI5C 2X4PB 4AY0A 1F3JA 1TVBA 2ZCHH 5SWQA 1BEYL 3KLAB 1FZKB 4OCSH 4QYOB 5E99L 4B50A 3JWNC 4S2SB 5T33H 4Y4HB 4EN3C 2ICEB 4KJWC 1B9ZA 1FFOA 2H9GA 4F7MB 2EKSA 4NJ9L 1QLFA 1GAFH 4NM4H 4D8PB 5D96C 3W9EA 3IJYA 5AYUL 3MA9H 3VFSB 1E6OH 2B2XL 1CK0L 4HXAL 3TA3C 4U1MA 4P4RB 1IAIL 5C9JB 4F15B 1OF2B 4XNYH 2ZOKA 2Y36L 4X4YA 3GHEL 4K3JL 3GJFK 1EH9A 1F8TL 5J8OA 4LLUB 2RAMA 1I3VA 2MFNA 3U4BL 3V0VB 5EUOE 5MHSE 4LKCB 4PRHD 3KPRE 5DMKA 4L8DA 4DTGH 1EA9C 2FECL 4TYUA 5KN5B 2HG5B 5F72S 3L3JB 3PG2A 4F7PB 3U4EA 5IM7B 3JV4B 3VXRE 2Z0BA 5CEZH 5FB8A 3VWKD 1ZLVH 4RNRA 3QIWC 1NGWB 2X7LB 4K2UH 4OGYH 5ELIA 2ZSWB 3O6MH 2GSIB 4KXZH 4WV1B 3LDBC 2P5EE 2W65B 1IGMH 4G42A 4PGBA 4RGMC 4S11A 3MCG1 1IAOA 4U6VL 3QDAA 3R1GL 2A2QT 2HVKA 3HFMH 1RUAH 1JUFA 4KK6D 3BH9A 4POYA 1X5KA 3LKNA 4RMUA 2F8OA 4U1HB 4LDLB 5K59E 1ZS8B 4Z0XA 3T0EB 4PJAB 4TPRL 3TBVA 3VI4F 1P7QA 5E6ID 5JHDD 3W2DH 4Z7UE 1NFIB 3UDWA 3GSXA 1FIEA 1NKOA 3ORJA 3KDMA 3Q6GL 1YEFL 3ILPB 3LZFL 4KH2A 5DYOA 4HAGA 2NW2B 4CN1A 2JJSA 5EWIL 5BMFL 4J6RL 4TOYL 3DURA 1KG0B 1MFEH 3QP3A 4P2QE 3S5LG 5I1LA 4JPVL 1UQSA 4EDWL 3F5WA 5E9DE 4P2RB 2HP4A 1QSEE 5LKNA 1KEMH 1U8NA 4IDJH 4JY4B 2X4PA 2A6KB 3EAKA 2ESVE 4KQ3L 4ZFOB 5EOCH 1MCQA 3ARFC 4YK4C 1FZKA 3NFNB 3MJ7A 5ISZE 4QYOA 5TDOB 1IAMA 4LSPL 5MEPA 3GK8H 4ONOA 4S2SA 1CDHA 2IBBA 3VFOA 4RRPA 3SKJL 5HYSG 4F7MA 5C07D 4OB5H 3KPLA 3QDGB 1SYVA 1F6LL 4I18A 1NDMB 2VRAA 4D8PA 5JMOC 3PJSB 2H2PD 1KNOA 5IBUB 1SEQL 4KJQD 1CXHA 3F7QA 1EPFA 5C9JA 1NGXA 1GHFL 1DUZA 5MEOB 4PJHB 3WO4B 1DL7H 1BFOB 1X4XA 4RGNB 1I8MA 4HBCH 4PRBB 4ELMB 5F7HA 2Y07H 2AJUH 4LLUA 2HT2D 3G5YB 4GH7B 4L4TE 5D7LB 5IVXA 2KZ1B 1A7RL 4LKCA 3HMWL 2H8PA 3MLWH 2XOTA 1GSMA 4HULB 3HPJB 3OTTA 5ADPH 2GW5A 5IVXF 3EZ8A 3FT2B 2G60H 3ABZA 5KN5A 2G2RA 3ARZA 2HG5A 2NY3C 3VW3L 4F33A 1BZQK 2GT9B 1KB5L 1T5XA 2YSSB 5IM7A 3JV4A 5FM4A 3HN3A 4NQVB 3WN5B 4C58B 1WC7B 1UZ6F 1MVFA 2NY5C 4U6YA 4D9RD 7FABL 3UTOA 4WUUD 2X7LA 1BQSA 3NACL 4G6FD 1OAYL 1JFQL 1RK1A 2EDYA 4WV1A 2C5DC 2W65A 3MRKB 1T4KB 2XZCL 2R0LL 3V7AG 3UJTH 4YBLB 2HA1A 2V9RA 3EYFB 1LE5B 1G7QB 3EGSB 4NJAH 5FK9B 4OCLC 4JAMB 2F15A 3GBML 2FJHB 1MH5A 3NIDF 4YHPA 3HG1B 1KPRA 3CAFA 4NQTA 4QRQB 5T5FH 1UFUA 1HKFA 1V3MA 4TTGA 4YFDB 4OF5A 3KYKH 3PWVB 4JZOA 3MRRA 4ZUVA 2EYTB 3O8XB 4XP6H 4QRUA 3EYUL 3TFKD 3L3HA 1BZ9A 1K4DB 1ACZA 4YUEL 4J3XA 2X89D 3ILPA 4GG8B 4DK3A 3DXAE 4ZO9A 2PF6A 1QRKA 1MHCA 2NW2A 4FQCL 4ZMAT 1LDPL 1DVFC 1A2YA 2Y06L 2YN3A 4WJ5B 4OF6A 1A6TA 4TSAH 5JTWA 3QEUB 3QDMD 2EDDA 4PLJD 5DVLA 4OI9A 4G7YH 4P2RA 3MJ9L 2VLRB 5EU6A 4D3CL 1LE9B 1IC4L 1F6AA 2GAZA 4HEME 3GEWB 5HYFA 4ZFOA 2X4TB 4LLVB 4M43H 5IHZB 4N90E 5TDOA 2NZ9C 4KK8D 4RISH 5JDSB 4LSTH 1ZT7B 1NDMA 2W07A 4OFDA 3MNVB 3SDCD 4NFDA 3CMOH 4NQDE 5JW4R 3ARYA 2ICCA 4PJBE 4PJHA 4HMEA 2UZXB 1J8KA 2ZNXA 3FFCA 1IJ9A 3H42L 3K2UH 5DSCB 5IVZB 4PJHF 3LEYH 1ES0B 5KANI 2Z8WC 1JHKL 3G5YA 4LPYA 4XPHL 4NYLA 2A6IB 3HPJA 4AENB 5C9KA 4RMTA 3FT2A 4CADB 3PL6B 3N1PC 4NWTH 4I0PA 2N7BA 5IR1A 3GO1H 2YC1A 5GRVL 2B5IC 1S7RB 4FQQA 4ZUSB 1GPOL 4QXGH 1DBJL 1WC7A 5KSVB 1K2DB 4HG4J 5E0QA 4M62L 3Q2CA 1FBIH 1LNUB 3D85B 1YC7A 4JQXC 2VDKL 2RQ8A 2AK4D 2XACC 5FA4A 5ALBH 4YFLI 4K94L 2JELH 1B6DA 4HK3J 4U2YA 2X4QA 5J12C 1N8ZA 2XZQL 2PTVA 4JZJC 3C6SB 3EGSA 3BRDA 3TEUA 3I2CH 1D9KC 2DQTL 4JAMA 5B8CC 2HT4D 1LO0H 3GSWB 4WI7A 3MRBB 4TNVF 3C60D 5FGSA 1QKZH 4BH8A 3QJFB 1P2CB 1NAKH 2YMXH 3UPAA 3O8XA 4FTVE 3V0AC 2V2WB 3DYOA 5F9WC 3KPOA 1YMMD 4JY6B 5DT1H 2LQRA 3A6BL 4K9EC 1B4RA 5JDJA 2DQHL 3TWCH 3WE6B 4ZPTB 1PJ9A 3SGEH 5I8OH 4W68A 1X5HA 1T04B 3SE4C 2E6QA 4S0SD 2Z4QB 3LS4L 5D5MB 2E9BA 2YKLH 4QHKJ 1FYHB 4Y4KC 5KVDH 3MV7D 3TBSB 1DN0B 5K93A 1JPTL 4MHHI 1JK8B 2FB4L 4KKAD 1NCBH 4D9LH 3ZTNL 1D5IL 1FO0A 3SY0B 3BKYH 4CAGA 3MJ6A 4PLKD 2VE6B 2BVOA 3IETB 4R4BB 3HRPA 3EHBD 1C5BL 3N9GL 4LGRB 1BD2E 1MFAH 5BZWB 2VDRL 2QQLH 4FFWD 3W5MA 3ZT7A 4Q2ZB 1TQCC 5DMIL 3RBGA 4Y4FC 5FHAL 1UJ3B 3NFSL 2YUXA 1XIWA 1J9CT 5C09E 1OSPH 5T1KD 1EK3A 5GS1C 4ZG1A 4PG2A 1FFPA 5IMMB 1ZT7A 3QG7L 4NUGH 2A1WH 3MXVH 3BQUC 3MLRH 2J6EL 5JIKA 2ZPKH 2HKFL 5HBBA 3GMMA 3ZDYF 2BSTB 4JFDB 1YEKL 1ES0A 5J13C 3H2WA 3I85A 2XTJC 3CZJA 4OT1L 3T2PA 2ENSA 4O5LH 5FYJH 4DQOL 1LQSR 3QDJB 3CZFA 3R06B 2OYPA 4P46D 4CADA 4PBVC 3S34H 4AG4H 2XIDA 4L29B 5EO0B 5LAXB 4L3EE 2Q7YB 3U2SB 3OGOE 1K2DA 4K7PH 2Q6WB 4IRJB 2CRMA 3MV11 3DROB 4PTTB 3CU7A 1URLA 1LNUA 2APBA 4JHWH 2AEQL 4Q6IC 4N5UA 4WO4D 4IIQB 3T0BA 1N64H 2IPKB 4ONGH 2AK1L 1V5JA 1AGCA 3FQXB 5EG6C 4AIXA 1TDQA 3C6SA 4P2YA 5DJ0B 3KHOA 2OXHA 5FKPB 1YJDH 2ZUWA 4H1LH 5DS8A 1IGCL 3GSWA 1J11A 3QXAA 3VI3F 1DEDA 3GJEA 2V9TA 3I3EA 3NABH 4K3DH 5DFTA 1XFPA 5E94A 4Y5YB 4PGDB 2CRZA 4JO1L 3QJFA 2ARWA 2VZUA 4OTXL 3BZ4B 1EZVY 3C09B 5I16B 3AAZB 5KZCB 4O58H 2CMRH 4JKPH 2AJSH 5BCAA 1ZWIA 1UCTA 4IS6B 4PJCB 4Z5RA 5MHSD 3KPRD 4NRXB 2EXWC 4KK5D 3DX6B 2MJWA 2XTJE 3WE6A 3KXFA 3RY6A 5EN2B 5JUEL 4BZ2H 5D7JC 1D5BA 2EECA 1X4YA 3VWKC 1F11B 4MCYA 3LIZH 3VXRD 4PJXB 2IALB 1ZEAH 2DLGA 3W82A 4XBPA 3IAPA 4OM0L 5I1AA 3GSRA 5JPNB 1SEBB 2YPLB 3KPMB 3V5HB 4LEXL 5MERB 3GMQB 1ZTXL 2JIXA 1CGTA 4L5FH 4B7IA 5F7YC 4GRLC 4KAQL 2P5ED 4R4BA 5IFHL 3RWHA 5EZIH 4EI5D 3QR2A 5EB9A 5BZWA 1AHWA 1OAUL 1QOKA 4WCYH 4Q2ZA 2PO6B 3EDDA 4FABL 43C9B 5LBSH 1G1CA 4Q9CA 1NBVH 2HT3C 3MXWL 4JN1L 5LWYH 3AY4A 4G9FB 4HUWB 5K9JH 3CFCH 4OLYL 4PY8I 2BFVH 2F9BT 3VWJA 1R0AH 1CQKA 3MNZB 5KJRL 4KTEH 2BSTA 5IFAL 3B9DA 5DK0B 1MHEB 3UZEA 3B5TA 1GC1C 2BVTA 1RSFA 1WEJL 1F97A 5IIEB 3PHQB 1TPXC 4E0RA 1D7FA 5ANMA 3WSQH 2AABH 5JORB 3T4AA 4L29A 5EO0A 3H7BB 1FYTE 2H41A 2EIZA 2Q7YA 3QFJD 1QBLH 5ESAB 5TH2B 4AEIL 5HDLA 2GQHA 3J8F7 4LSSH 4PTTA 2R8SH 3OAZH 4QHMA 3L3KA 4J3SA 1IEAA 4UIMA 1MPAH 3FO2B 3BP7B 4JB9H 4K71C 3VRJB 4BFEA 4LCCC 1NBQA 4IIQA 2Y7QB 3E3QC 1NMBL 35C8H 3FO9A 2C3VB 4GBXC 3O6KL 1U3HD 4EZMA 2IPKA 1NL0L 3FO0L 1NAMB 3V4PH 2A38A 5DJ0A 4PBXA 1KJ2L 5GRUL 4H8WH 5C0AB 4UT6L 1D6VL 1F90H 4L9LB 3GHBH 5JOPE 5ERWB 5B3JE 2MKLC 3K4ZA 2NTSP 4X5LA 3ULVF 3F6IA 5KOMC 4HC1L 2QR0A 2FJFB 3G04B 2EO1A 3B6SA 3MREB 1JMZA 3MLVL 5DQJB 5I16A 4U6HB 1NQBA 3SBWC 1HQRB 3UZVB 3QEQB 1KYOJ 5ENWB 1FGVL 1BQHG 4BQCA 5JOFB 2YZ1A 5EC1B 1J88A 3O2WH 4L4TD 1CDIA 4GKOA 3L6FB 4PRAB 2EEBA 5JZ7D 5HHPB 4U3HA 1VA9A 2B1AL 5EIIB 4JY5L 3DX6A 1RU9L 1CICC 2VO5A 3V4UH 2DTSA 2FWOA 1DCLA 2FATH 1MCEA 1I1CA 4GXUN 4OD1H 1IVLA 4NQXB 2QADB 5IEKB 4RQQA 4OKVB 4UV7H 1BVZA 4DUWA 4Z7WE 3EJYC 4MA3A 3VDAA 3G6AB 1QG3A 1S9VB 3T4YB 1U8LB 5JPNA 1SEBA 3V5HA 1AGFA 5MERA 5E4EC 3GMQA 4N68A 4ONHB 4M1GL 3BPCB 4IMKA 3UC0H 2Y23A 4JPIA 3UO1L 2SEBB 4Y16C 2X9XA 5F1SA 1TVDA 3AREC 2GTWB 1WITA 1IM9D 1UZ8A 4JO3L 2NXZD 4LRNL 2COQA 1U8JA 2W60A 4R97B 2XZZA 1CL7H 2PO6A 4MVBC 3E3QE 1V05A 4NRYB 1GGBL 1X6LA 3U30B 1BWWA 4G9FA 4HUWA 5L2KE 5EIVA 4O2EB 1QSVA 3FT3A 1CYGA 4R2GC 2R1XA 4IOIB 3QIBA 3RJQB 3QFDA 1YECL 2OR9H 1FE8L 1C7TA 3LRSA 3FT4A 3IRPX 5SX5K 1EGJL 2HJKB 1MHEA 1RVFL 5IMKB 3L5JA 3RL2B 3H9SB 4YXLH 1FIGL 3HR5B 4J3VA 3RVXD 5EZLB 4KRPB 4LHUB 1CFNA 1DQLL 4X99B 5F7LB 4ZFGH 1IC7L 4MQ7B 1RZFL 3OKLB 3HI6L 4XPFH 4LFHD 5FV1L 3L95B 4Z95H 5D7IB 1PQZA 1N5YL 4HJJH 5EOQH 3L7FA 4GRWB 1RJCA 4G8GD 2FO4B 1ZE3C 2X10A 5GS2H 4PJ5B 2C4FT 4G6AC 3QIUC 4WU7A 3BP7A 1BHGA 4XCYB 3L1OL 2EH8L 3RNQB 2WANA 1HINL 2C3VA 5C0DB 3RI5K 4OIAA 2AI0H 5C0RH 1NAMA 1A3LH 5IVOA 3HE7B 5BVPL 4KMLB 5D2LA 4N90D 1S5IL 2HWZL 4MXVE 2CO6B 4OFYA 5D2LF 4PIRF 4PFEA 3T2NL 3ZHDA 5C0CE 2J8HA 1WIOA 4XTRC 4RBPH 1XCQA 3WHE0 5J3HC 2FJFA 2NXYD 3MYJB 3TBWA 4NQDD 3TJHC 1C12B 4ZS6D 2X42A 3MREA 4JGUA 2IAMA 1O7VA 1D5MB 2J4WH 1HQRA 4KKCC 3U7AA 5ENWA 5JOFA 2WAHA 3SGKA 4XHJC 5EU3B 2DQEH 4DAGL 5EBWA 4EQ3A 5ID0B 4PRAA 4FFZH 1HDMB 5HHPA 3NTCH 1UYWL 3VGHA 5BQ7B 3GSOA 2R56H 2IQ9H 1CE1L 1OAXH 4NQXA 2GJZA 1SM3L 3PXJA 4OKVA 1KTLA 3S6CA 3VXQA 3TJEH 4OCWL 5GRJH 5F9JB 3G6AA 1XGQA 4LARL 5BOZG 5IT2L 3FQTB 1U8LA 1OARL 1A7QH 1NUFA 1B90A 1XCTA 2XN9B 3BJ91 5I18L 4LVHB 1EJOH 4ONHA 3BPCA 5DEFB 5TQ0L 1MRDH 1H0DB 3MTRA 3RGVB 2SEBA 3ZKQD 5KVEL 1KXVC 1W2KT 5JIPA 1WCBA 4I2XA 3W9DA 1W0YT 1RK0B 2ATKA 1WQVT 3RJDA 2NY0D 5C3TA 3O3AB 1Q9WA 2IWGA 4TNWK 4OZGB 1LILA 4L3CA 1OAZH 1P6AB 2Q1EA 3JSSA 4O2EA 5IV2B 2FR4B 4JDZB 5KVMC 4PJ9B 4WI2A 4N8CL 4IDLA 4KJYB 1HHHA 2HJKA 4X7CC 1H8NA 3GKWL 5JW4N 5IMKA 4WFFD 4ONFL 3UBXB 1TZGH 1FNGB 2VLJA 3HZVB 5CSBA 2VZ1A 3B5GA 1UM6L 1FL5B 3HR5A 3GRWL 3OR7B 5EZLA 3SDDD 3PP3H 1VPOL 4FQXD 4FQJL 5KTEL 4XPTH 1H3TA 1M05B 1KCLA 4MQ7A 1R5IB 4J1UA 1JTPA 4I1NB 4S1DC 2Z92A 5D8JL 1INEH 5D7IA 2P48B 4KMTH 5HGBB 3F6LA 3HC0A 5D7IF 3CSGA 4FQHB 4X6CE 3FN0L 3P4OB 3S37X 3RX5A 4GKZA 1KPVB 1T1YB 3KPTA 4PJFE 2UV3A 4XCYA 5HI4D 5BOPA 3RNQA 4LIQE 4PLKC 4ZDHB 2R23B 1YY9C 3RDTC 3WS3B 5C0DA 2VISB 3MV01 1T7WA 2BNQE 3VXME 1T20B 3DHJA 1M6OA 4NWUL 3F8UB 3I6KA 1CU4L 2OZ4H 3WIHA 4PREB 2HAZA 3BGFC 1N4XH 4OV6F 5DJYB 4QRTB 1AO7E 1UCBL 1AE6H 4X7TA 3UTSD 1BEYH 3GSUB 4KV5E 2PYEB 3FL7A 4OD3L 5E99H 4JFHD 5K9QI 3BO8B 3PWPE 5EORL 4PJEB 1S7TB 1OD7A 2FIRT 2F54B 2FEDD 4MWFB 4JJ5A 5AYUH 1LP9E 3D69B 5EU3A 3ME0A 4FMKA 2B2XH 1CK0H 1MJ7L 2VIRB 4P9HL 1IAIH 4Y1AD 2YD9A 3CPLA 1MFBL 3WMSA 5ID0A 3DIFA 1HZHL 3GHEH 4PUBL 4U0RC 4RDQF 4K3JH 4JFEE 1F8TH 4QRRB 2ORBH 1NSNL 4TQEL 4P23B 3K8MA 4DFHA 4GKSB 2EE3A 1C5CL 1UACL 4H25B 1J0HA 3DUSB 4XCNB 3FQTA 5JA8B 5SWSA 3PGCA 4QRPD 2XN9A 5JW4Q 1SY6L 3HMXL 4O2FB 2XRAL 3X3FL 1H0DA 1U3YA 4MNHA 1JYXA 4RZCB 4TN9A 5E7BA 2M26A 4MLSA 1FSKB 1H8SA 3QHFL 1UWGL 4HDIB 1N3NA 1RK0A 5HVHC 1HEZB 2L4OA 4HEPG 4E5XA 3FQWB 5DI8B 3O3AA 3VFTB 5E2UL 2DQUH 2GYSA 3CXDL 1T66C 4OZGA 5IV2A 4R7DA 2FR4A 3BEVB 4OZGF 4U6VH 3CVHB 1A7NL 3PHSA 2AEWA 4JGJA 4JVWA 5A2FA 4PY7B 4KJYA 4KY1L 3MR9B 4LAJH 4N5ED 5CILL 1U8QA 3ZO0A 4ETQA 3HZVA 2J2ZA 1X7QB 3VGBA 5EOCJ 4PGCB 3IJSB 5HGAB 3HI5L 3BZFB 5D9SB 4TPRH 3OR7A 3BDXA 4ZSOE 1ZMYA 4GLRH 3RIAK 1KF9B 5EULV 3LKQA 3CH1A 2CDEA 5DJ6B 1M05A 4KRNA 4NCC2 1A9EB 3SO3C 4NGHL 1ZLUK 4R8WL 3Q6GH 3W5NA 3BWAA 1YEFH 3BPOC 3LZFH 2YD7A 3G6DL 4X98B 3LB6C 4PGJA 2CD0A 2NLJB 1AY1H 4L4VA 3ULUE 1KELL 2C1PB 3O4LB 5EWIH 5FYKD 5BMFH 4J6RH 4TOYH 3M07A 4BZ1L 4R9HA 4RFOL 2R23A 3RVWD 5EBMA 3ZSSA 3C6LB 4BFIB 3W0WE 1BVLB 2VZSA 3AXLB 4JPVH 1QA9A 2QKIB 4EDWH 3FN9A 5D1XA 4RX4A 1BFSA 3GSVA 3BN9C 4PREA 3LSOB 4JREC 1RUPL 5DJYA 1MCLA 3WS6C 2WBJD 3GSUA 5F3BA 3QEGL 2PYEA 1BIIA 1YQVH 1L6ZA 4O00A 4ZXBB 2HTLC 3SKJH 4QKXB 3PWLB 4PJ7A 5KANG 2DF3A 3D69A 3U4AA 4BK4A 1SEQH 1IAKA 4PJ7F 1S7UB 2R2HB 5DJXA 4KDVA 1GHFH 4HK3N 2J5LB 4J2XA 2XFXA 1QFHA 4WHTB 3KJ6L 1DEEA 1ZT4A 1GGCL 1RZ7L 4CVXA 4QRRA 5AWNL 3C87A 1ROWA 5K9KB 4D2NA 2EEDA 3BKCL 4R26L 4WWKC 4KJPD 1SQ2N 1A7RH 1I1AC 2FHBA 1RMFL 3HMWH 5LGHL 4H25A 2VH5H 2NY1C 4XCNA 3ISWA 4XWOC 5DD6B 3VW3H 5D93C 3JTTB 1AGBA 3PQYA 3JWDH 5DD3H 5CEXB 4WTWA 5IB3B 1NC4D 5DMGC 2ITDB 5T1DH 1UH2A 1XIWD 2MCPL 3U36B 1HEZA 7FABH 2CDFA 3VA2C 5CD5C 3FQWA 5DI8A 4GMSL 3VFTA 1OM3H 5LXGL 5AZ2H 3RVTD 2R0LH 1CGXA 1NEUA 3LMJL 4HFWB 3AS1A 4L3AA 3LKPB 3DPBA 4JPKL 4M1DL 3GBMH 1ZXQA 4PY7A 5BO1L 4UOJA 3PF2A 3V6OC 4BELD 5JO5B 4DZBB 2EDHA 4NC1C 4JDTL 5ETUA 1JWUA 1DBAL 2Z31D 5TE6H 5HGAA 4CU7A 4XB8A 3BZFA 3SJVE 5D9SA 1MCBA 2V7HA 4X6EB 5JZ7C 1A7OH 3DX8A 3P0VL 1A4JA 3MRGB 3TT3L 4M9OA 5I1DB 4MQXC 1K5NA 5C6TL 1LO2H 1MFNA 2IADA 4Z6AT 5M7QA 5DJ6A 4DOHE 3VFGL 5CSZA 3EYUH 5TFSH 4PRPA 1HSAB 4N0UB 4YH6A 4YUEH 1BF2A 1C16B 3DO7B 3H9HB 4X98A 2E7HA 3LOWA 1NC2D 1Z2KA 2NLJA 2XICA 3D39D 4TUJB 1RZIB 3DX9B 4QCIB 5DWUH 5EUKB 4MHHG 4FQCH 5AD0B 1BZ7B 2NY6D 3HLAA 3ZTJG 4A6YL 3DOSA 1IL1A 1I9JL 3TN0A 3NMEA 3CUPA 2WWMD 2YD4A 1TETL 3VXUB 3MX0A 3EOAA 4U6XB 4JR9L 1S78D 4PGEB 3INUL 5GRVK 3CXHK 4IMLA 1RIUL 5H2BB 3MJ9H 4D3CH 3S4SG 2D03L 3LSOA 4G8IB 1IC4H 1KCVL 1KCKA 1UADC 4DN4L 3PIQA 1G0YR 4FFVD 5CJQL 1XZ0B 4ZXBA 3VD3A 5IGXL 4ZFFB 3PWLA 4WHCA 3ZDXE 5DUBB 2ATPA 1U8OB 3DHMA 5F97E 3VGEA 3DMMB 4OFVA 5CJ5A 3DRQB 1OOAA 1FL3A 1EXUB 2FHFA 3PWNB 4NO0D 3RKPA 3CFBB 3Q5OA 4WHTA 3UMTA 3TZVD 3H42H 5GSVB 1GZPB 3TO4D 2X4UB 5FYKL 1KIRB 1JHKH 1KIUA 4OFIA 5JR1L 2A73A 2BERA 3EFFB 4XPHH 3VGAB 4MNGB 1YEIL 4N8PA 2JIXD 2VDML 3IDJB 4YWGH 3C5ZA 2I07B 3D48R 4H1LB 3JTTA 2DM3A 1J05A 1MWAH 1T0MB 5L6YL 3RZCD 1A6VL 1VGKB 5DQDL 1GPOH 1DBJH 1AGEB 1A22B 5CEXA 4HF5L 4HUVB 4M62H 1SJEA 3U36A 3DTXB 4HS3B 4AT6A 2VDKH 3WLWC 1TQBC 3MPCA 5MEQB 4U6TA 4K94H 2B8OT 3VWJD 5CKGA 4IOFD 1J5OL 1NCWH 4HJGB 4P5TB 1E28B 2XZQH 5C0CD 5T3XD 3LKPA 5CEYA 3FZUD 4YDJB 5F7EL 2DQTH 3DUUB 3UDWC 4ZS6C 2P47B 4MJ2A 2X41A 1CFBA 4JKKA 4R4ND 4DZBA 5JO5A 3KPQA 2IANE 4H0GA 2VXVL 1IE5A 3DVNB 1JGUL 1EJ6A 4MCZB 2UUDH 1S9YB 2DYPA 2JJSC 4Z7QE 3TESA 1FO0L 1SJHA 4X7DC 1NUGA 4X6EA 3WFEL 4ERSL 3QUKA 1IEHA 1PKQB 2BY3A 4OFKA 1S7VB 5BXFB 5DZLA 1OWRM 1H5BB 1HYSC 5IB4B 1HSAA 3FB7A 5I0DA 3VXPB 1YNLH 1UB6B 2BDNH 3H9ZA 1C16A 3DO7A 3MMEB 3A6BH 4LFHG 4TUJA 5D6CA 5EUKA 1G7LB 3DX9A 4NOFA 3U0WL 3ZDZF 4NNYA 1MNUL 5D72L 1JE6A 1TZIA 4DCQB 3D9AL 2EXYC 5BV7B 3GM8A 4UNUA 3QRFM 1FHGA 4UINL 1X5ZA 2LV4A 2GUOB 3VXUA 3RKDC 4U6XA 4NFCA 5GGTH 1QFWI 4PGEA 4NT6B 1I7RB 2BY2A 1JPTH 2YK1L 3QQ4B 4I18C 3ULVD 2LU7A 3BMWA 2FB4H 2DD8L 3ARBB 5H2BA 3ZTNH 4AEEA 5BS0A 8FABA 3GNML 1KTRL 5E8OA 1R5WB 1MI5E 4KROC 2EE6A 1C5BH 3N9GH 1INDL 2GSGB 3QCVH 1OAQL 1MAJA 2VZVA 3GMPB 5ESVB 3UTPE 2G9HA 5HD8C 3VI4E 5DMIH 5FHAH 1JZ2A 5TDPB 3S8WA 4HGKC 1MOEA 1QHPA 2PXYD 1AR1C 5IQ9A 1UC6A 4ZFFA 1RZKH 1NFDB 5L88H 1TJHL 3V6BR 3MRMB 4W4OA 3ZLQC 2ZOLB 3KGRA 1AD9A 2A9ML 3DMMA 5IBLD 3QG7H 4J3UA 4NP4L 4N8VG 4OZFB 2GJJA 3DRQA 3STLB 5C2BL 2HKFH 4DGYL 3MRJA 4LPVA 1UXWB 1RZJL 5D1QB 3CFBA 2X5PA 1XGUB 5GSVA 1YEKH</