3QDMD

The complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(26-35)(a27l) decameric peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
195
structure length
195
Chain Sequence
QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGGTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 33
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qdmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qdmD02
5FXCH 4PJ5D 4CMHB 3TO4B 3VH8A 3KG5A 2OI9B 3QHFH 4GBXA 4B41A 4HAFA 4N90D 2XTLA 3F7VB 3GMQB 5E8NB 5T33L 3TT1L 3BDXA 1PAMA 1CU4H 3MLSH 2MWCA 1XIWC 4MJ6A 2VJXA 3C9NA 4IRJA 4KKLC 4JM4H 5DI8B 5E03A 2HMIC 4ODSL 4P46D 3CIQA 4CNIA 5F1NA 2V9TA 3QZWB 3I6LD 4GKSB 3OMZA 2NQCA 1MVUA 2YWYA 2G5BB 3C60C 5DSCB 2EICA 1MRDL 2R2HB 1I3RB 1QFUL 1QRNB 1W2KT 3MR9A 5EOQH 4WY7L 2D7OA 2HVJB 4HUNB 3ZYOA 4NPYA 5F6HJ 5C9JB 3FQWB 2O5YH 2GFBA 4KKCC 5FM8A 3IJYB 5D1XD 4R0LB 3MX0A 5E1AB 1QHOA 1NFDB 2X4NA 3HAEB 1IT9H 2VQTA 4J23A 4Q9BA 1UCBL 3KPNB 4KHXH 6FABL 3I50H 2NY5L 4KPHL 3DO7B 3ARVA 1LEIB 2R0ZL 3LQZB 1LNUA 3KNBB 5MI0B 3GI9H 2D0FA 1PG7W 1J1OL 5L7XL 2BOCB 3CLFL 2XTJE 4NO0A 3FQRA 2VDLH 3FN0H 3LQZA 4LPXA 1Q94B 1DQJB 2HG5A 4CMMB 1H9VA 5D1QA 2DI8A 4ELKB 3M07A 2NXZC 35C8H 1NSNL 1ZGLP 4KGLA 3NIDE 4PRNB 5CZXC 2NTFA 2P8MA 3QIUB 3VCLB 4JFEB 4A2MA 2FYYB 2V9RA 1MFBL 2EE6A 1L9NA 4XTRD 2HJKB 1A1MB 3P30L 3WS6A 5ISZA 1XGPA 5KW9H 4H0HB 1HHGA 4N0UE 3IS1X 4QXUH 4XCFH 1ES0A 3MLYL 1FORH 1WWCA 2IGFL 2CR3A 1K5NB 4OGZA 2NZIA 5GZND 1QBAA 4ZNCD 2DDQH 4UTBH 5DO2C 3TN0A 3OAZH 5HHME 2QSVA 4X5LA 4CBPA 3UBXB 5IVXE 3G6JB 4FN0A 4FQXB 4NHUB 5CP7B 4LSQL 5CEZH 4AL8H 5IW6B 4Z7WB 5E2VH 1WWAX 1WF5A 3AB0C 5T1LD 2AJ3A 4R97B 5D9SA 5TDPB 1JWSA 2D4FA 2FO4B 1KXQE 3BN3B 3HI5H 4CRPA 3MV7A 5DRWB 4HWNA 1C5BH 5CMAA 1WFUA 4IIQB 4P46A 5FKAA 1TZIB 3MLXH 4NZJA 3ZKXC 5I1DB 3L3OB 3NCYS 3QUKA 4EI6A 5GS0H 4P4KB 4HT1L 2XPGB 1U3HC 1EEUA 2ENSA 4PG9B 2E9IA 4NKQB 2A6IA 1AGFB 1I85A 5EN2A 2A6KA 4M6AA 3VD5A 4R2GC 4FQLL 4CU7A 1IKNA 5IFHH 3K46A 1FG9C 1ODAA 2BVEA 1E4KA 2BXZA 1F6AA 1ZT7B 5I1IH 4P3CH 2E7BA 2VRAA 1IJ9A 3O81A 4YUEL 2V9QA 1WWWX 5K9OB 5LWYL 1U58B 3LS5L 3VFWB 5IMMB 4AEHL 1NCBH 3RUGF 2EE3A 3T1FA 4JRYB 5SX5K 4Z95H 4JFPB 5FO8A 2R4SH 2CPCA 4PJ8C 2CLVA 1EFXA 5AZEH 5L9DH 3LS4L 5KVEL 3OB0K 4K7FA 4G6JL 1RZGA 5I1JL 1I7RB 2BY0A 4GT7A 3O6LH 3ZL4L 3DUUB 3PWJA 2D31B 1CXKA 4KI5F 1J05B 5EFIA 4AIOA 4FNLH 5JXEC 4M48L 43C9B 1U6AL 3NPSB 4OQTH 2EDOA 4OIIL 2W07A 5C0AD 4O02L 4WW2B 5DWUL 2WANA 3CNKA 4LARL 2BCKA 4JG0L 4N90E 2UUDK 2OJEA 2HT2C 3RWCA 1Z9MA 3MRKA 1BM3L 3CFEB 3TVMC 4HKZB 5GRVL 3MRHA 3DHJA 2DBLH 4Y88A 1G6VK 2G9HB 3QDGE 2CK2A 4WU7B 3D0LB 1IAIH 4MNQA 3OAUL 3OJVC 4LLUA 5ACLA 1P5UA 2EKSA 5C0FA 3RDTB 2HA1A 1ZVSA 3INUL 2LU3A 4P2OB 2ADGB 1HSAB 2ICWA 2LABA 5DUBA 2DJ4A 3HZMA 4P9MH 4TSCL 4DGIL 5D6CA 4HV8A 3H9SE 2CLRA 4GQ9L 4WENB 1KPRB 2LV4A 3HS0B 3FCTA 4WWID 2WP3T 2X05A 3IJSB 1NUDA 1AHWC 1YQVL 2X6MA 2E8YA 4X6CA 2W91A 1BQLH 2C1OB 4ORGB 5IG7B 3W0WA 3X3FL 2P44B 3N85H 2GTWA 1VKXB 4M61A 1CDJA 3L3OA 4IIQC 2QTEA 3PP4H 4I13B 3PP3H 1YDPB 4KROD 1BBDL 4O5LH 3WUZA 2BDNL 3LZFL 4YFDB 1KENL 4XWOD 1FVEB 4GMSH 1UT9A 5HGHA 3MC0A 1QBMH 3FT3B 2ORBH 1INDH 4RWYH 4ZQKA 5DQ9B 5EOQL 4LRNH 1EZVX 4EOWH 2XNAA 5IW6A 1VACB 1O0VA 1PVHA 4I0PD 3O11A 3LS5H 4ZPVB 4YNYB 4HWEL 4U6HA 3Q6GL 5DJAA 4EN3D 2QEJA 4WEUD 2BSTA 5BW7C 1QLFB 3MO1B 4IRSD 1B4JH 1ZV5A 5HYIA 4HKBB 5CEXA 2ITDA 2ADFH 4NP4H 5J4MA 4FHBD 1DQMH 4X99A 2MPAH 2ZCHH 3G6AB 3WKML 4PGDA 5L2KA 1CFSA 1MCFA 1BJ1H 4ODVH 4X5WB 2NX5B 4HBQA 3U0PB 3VA6A 4F57L 1I3UA 3HI1A 3QIUC 4BSJA 2RGSA 3H7BA 5BV7C 4RA3A 1TMCB 4LCWE 1KTLA 5KJRL 1BP3B 1MJJA 1IEAB 3X12A 2W38A 3P0VH 1IGTA 1MRDH 1D5IH 2Q8AH 4NQEE 5DD0H 1LP9E 3BP4A 1KEML 4JY5L 4OZHA 1U0QA 4DGYL 4Z7VF 1J5OL 4TVPE 3IETB 2BK8A 3GRWL 4R7DB 3CMOH 3BO8B 5I74B 3EKCA 1ZLUK 1VGKB 4KZDH 1JGEA 2JELH 1LD9A 4HFUL 1B0RA 1MRFH 2K3TA 1WGOA 4JM2C 4MDIB 2CJUL 5AUMA 2W0LA 1RMFH 3RBGA 2XA3A 4WUUA 2HLFD 3T0EE 5L8LB 1AP2B 1S7SA 5KAQG 5DJDA 2OL3B 3QFJD 4MJIB 3PGDB 5BXFA 2E9BA 1P84K 5JHDD 2F15A 1U91A 2V2TB 3CK0H 5D1ZA 5H8DA 2PO6D 1I3VA 3QRGL 1MFEH 1ZWIB 1VEPA 3EJZC 2VZ1A 5EU7C 1A6WH 5BVPH 4Y5YC 1UVQB 1NJ9B 1B0GA 3QNXB 5DHVH 32C2A 4K07A 2IH3A 3QNZA 4LVEA 1HYRC 4MMXC 1F3JA 4CNIB 3LV3A 3FB5A 4K23H 1EHXA 5FEBA 3RY5A 1U95B 3UTQA 5L2KD 5DI8A 1J8HB 5ESAA 3SE3A 5HXMA 1VA9A 1L6ZA 4JQIH 3KPPB 4JM2B 2FHBA 5E5UB 4PPTA 2R8SH 4POUB 4BFGA 5KJRH 1BLNB 1EO8L 1QSZA 4HIHB 2CRIA 3QCUL 4G3YH 1DN0A 1JHTB 4XCCH 2VAJA 3NMEA 1FG2A 4JRYE 5DMGD 3E3QC 4J6RH 3CDCA 4NNXB 2L7UA 3T09A 3AS0A 1ZT4A 5IB2A 3S5LB 3SQBA 4UT9H 4BH8B 5F93C 4F8QA 4KV5F 4MQ7B 3ZHKA 2V2WB 5E8EB 5C09D 3PWPB 4X4MA 4IS6B 5DRXB 3EYVA 2ADJB 2VR9A 4JFFE 1TTUA 1U8NB 3VFPA 2GJJA 1KIQB 3TIDB 2HJLA 3HMWH 3WO3B 4ODHL 1JGDA 1Z9LA 2Z9TA 3DYOA 5I1HH 4NQCE 5IROC 4DCQB 4RNRA 1J0HA 4UB0H 4F7CB 1AKJD 1VFBA 4YXHH 3RWHA 1JPST 4G6FD 5F9JA 4EI5A 4WCYH 3ARFB 5E9DB 4YDLC 1U8IA 2EDQA 1U8JB 4NZUL 4X6EA 3FTGB 1A21A 4LVOB 3DLQR 1FYTA 4NRZA 4KJPC 1T04A 4D8PB 1HNFA 2BDNH 2DBLL 2ZPKL 3G5XA 4AY0A 2G75A 3SQOL 2VXVH 5FUOH 5AG9A 4YUEH 1A4JB 3BP6A 3QIWB 1CICA 3VXMA 5KSBF 4GW1A 1QSFE 3FQTB 1NEZB 3LAFA 5AAMA 2ZUUA 3D3VA 5J8OA 4Z18A 4H25B 1IAKB 4PRHE 2IPTH 1FAKT 5GS2D 4KROB 3FQXB 5T1DH 3K8LA 1D5BB 5SWSD 3B9DA 4PJBA 2DQHL 4X6DE 4KKAD 2BOBB 4XNQA 1PX4A 4XNZB 4RGOH 4XAWL 1FL6A 1H0DB 1MI5D 2CQVA 2E3VA 1NSNH 2KQNA 2R29L 1RHHA 2JKXA 3O3EA 4PV8B 3U7YH 5DF0A 1REIA 3AS2A 2QADC 4C55A 1S3KH 2Q6WB 1G7MB 4OCMC 3O3AA 4KJYB 4ZUTB 2B2XH 1FFNB 1MQ8A 1BHGA 1UXWA 3RX7A 2PCPB 5LBSL 1MREH 4IDJL 4LCYB 4FG6D 4QHKJ 3FMGH 2Q86A 3MLTA 4UBDC 2CXGA 5I1CL 3DIFA 3U9UB 4KMLB 5D70L 1QTYT 5LVEA 2IANB 1U3ZA 1UA6L 4H1LG 3S97C 2WWKT 4GO6B 4XVUC 4UU9A 5F3BB 4OD3H 2JIXB 3EJYD 3SO5A 5C6TH 4K94H 1CLCA 2GCYA 12E8H 2GQHA 4FABL 4YFLF 4Y4HB 1G84A 1BQHA 4PP2A 2C7UB 4UAOB 1NUNB 3U36A 2X7LA 1NL0L 2UUDH 5F1IB 4JFQB 1CN4A 4XVTL 4HC1A 3UTSA 3PQYB 4U1JB 5DC4B 1P4IL 5J13B 4UB0L 2A9NL 1DR9A 5JPNB 3RL2A 3IU4H 1KYOK 4KJWD 1MCHA 1SYSB 2RCSH 4R26L 5GS1A 2YPLA 4X7SL 1YNLL 2DYPD 4UV4H 4KK5D 1I1RA 4XPAL 1KFAL 2OXHA 5SX4I 1P6FA 1MCDA 2ZNWA 4LSVL 3VA2C 3JUYA 4QF1B 3LKOB 3L3GB 4OZFH 1CLYH 1JWMA 1YN7A 5C08D 1CQKA 1RUKL 4I3GA 4MXQD 4XP6H 5E2TL 4QHUB 5LGJA 3ZE2E 1U8MA 4X0KA 1DSFH 1Y0LB 4MX7A 4XPGL 3GUTA 2DB8A 1H3TA 2Y06L 5D2NE 1RUAL 1J10A 3BJLA 4Y16A 3GHBL 4KDWA 3QXDB 4P2CG 4NM4H 4JZJC 2F74A 3KJ4C 3B8SA 3H7LA 2YSSB 3R0MA 4KK9D 3BIAX 1G6RB 1HINH 3EOTH 1NCCH 3QXVA 3IXTB 3RVTC 4LP5A 4FMFA 1S9YA 5BO1H 3T3PE 4TVPD 5IHZA 4D0CB 4HIIB 1W72B 5CCKL 1A1OA 2DQJL 1ORSA 3KXFE 2HN7A 5HHMB 1AIFB 2BVPA 4YR6B 3P4LA 4QOKA 4XXDA 4NNPH 4I8DA 4N9OB 2AEPL 3CC5B 4P59L 1Z0NA 3GRWH 5DEGA 1FH5L 1CLZH 1IQDB 5F1KC 3OGCA 2NX5E 1S8DA 3ZKNC 1EH9A 3TNNA 4AH2B 4J3UA 1EHAA 1UM6L 4LHUD 4Q6IB 3LD8C 3LHPH 5GHWL 5JW3L 4HJGA 1M7IB 1B9ZA 4HJJH 5IT2H 5DZNA 4PJ8B 1RZKL 3QEGH 5KVFL 3JBG7 2AK4B 4NKMA 1XAUA 4OSUH 1W0WB 1DUYA 4U4BA 1K8IB 4ZNEA 4QRPD 3C09C 3KHOA 3E0GA 3U4EA 3NAAL 3PJSB 1LEKA 4G5ZH 4CDHA 4D9LL 3O2VL 3MRRB 2KBGA 3CLEL 1ZANL 5B38B 2XY1A 3FB7B 4DVRL 1MIEH 3WXVL 4MJ4A 2A6DB 1GGBH 2C4XA 1I85C 4OLWH 3IDIA 3TBVB 3I3BA 4WNQA 1CTNA 5C08A 1C5DA 4XC1L 1KPUA 5D8JL 2AXFB 2H8PB 1JNLH 1I1FA 3ULVE 1FFPA 3HUJF 2UZIH 5SWQA 5IBTL 1D5XB 1MFNA 3T65B 3J8F7 4ZXBC 3SJVD 4XNYH 4LQFH 5IQ7H 4PGBA 4G9FB 3WYRA 1JVKA 2MFNA 1YEIH 5ALCL 4JKPL 3H3BC 5GRJL 1WC7B 2VO5A 4JHWH 1JGVL 3WIHA 1UM4L 5CEYA 3EOTL 5ADPH 2XI9A 3VFTA 3E2HC 3O41B 4WTWA 4XPTH 1IC5H 5E8PB 1NMBL 3GNMH 3KDMA 2F5AL 4K94L 5D72L 4OV6F 1A7QH 4QTIL 3RPIB 1RU9L 1I1YA 4LVHB 3U0TA 2XWTB 4ONFH 1KJ2A 3EHBC 1CDHA 2C1PA 2YUVA 1OP9A 1J0KA 2DTML 3HG1E 2Y07L 5GGUB 1RZKH 1JV5B 4PRBB 5EC2A 4OI8A 2ESVA 4P5KB 2VZSA 3SY0A 1R3JB 4ENED 1DE4B 1H3GA 3O4LD 3OKEB 1IC7L 1J1PH 1CD9B 1I75A 1B4RA 2XZQH 1IC1A 3STLB 1MFAL 3B2UD 4Y1AB 1JFQL 4L3AA 3TCXA 5ETUB 3TVMB 2VQUA 3ILPA 4LSPH 2O5XH 4BQ8A 2VXVL 2EIEA 4PJGA 1FNSH 4P23C 1MSPA 2VDPL 2JE8A 4U0RB 3AUVA 2FJFB 2Z31B 2NY1B 4Z7NF 3CFJB 1UH4A 2IBBA 4M02A 2DTSA 1J0JA 3LN5A 5IIEA 1EAPA 4PTUB 5EZJB 2IAMA 1ZTXH 4UT6L 4Y4HC 1SEBB 1KTDB 1VFOA 3RKPA 2NZ9D 4DEPC 5I16B 2H2SC 1I8IB 1IBGL 4DFHA 4OGAD 2IH1B 2PR4L 3Q2CA 4MA3A 4NQVA 5I1KL 3U4BH 4EKXA 4S1DD 4N0YH 3SDXE 3ARQA 5D7IB 1EERB 5E6IB 4P9ML 5C0DA 1AGDB 5DEFA 2NXYD 1PW3A 4ESKA 4MWFA 2DKMA 3KWWB 5MEPA 2FHCA 3D85D 4L8CA 1V3KA 1EFQA 2WQ8A 4NQSB 4PG2A 2BSSB 3PQYD 5I8KH 4NWUH 2GHWB 1VADB 3P9MB 3HPJB 3U0WH 1N2RB 1RIVL 1S7WB 3PDGA 4ZUWA 4TUKH 3BUYA 3GSNA 1NCDL 5FYKD 1CBVL 3H3PL 4Y8AA 4XNUL 2UYLA 3VXOA 3A6CL 1BQUA 4YXHL 5GSRA 4AEHH 2WMPA 3VXRE 2LQRA 3O3DA 4NNYA 2GITB 3MV9A 2L7JA 4LLAA 1G7QB 2EO9A 2GK0B 5A2JH 3BXNA 1CI5A 2ZJSL 5DUPH 4E41B 4ERSH 3ZDZF 1TLKA 5IW3A 3W39B 4ZFOA 5HYSG 3BKML 1KCLA 4IHOB 2IBZX 2CUMA 2YC1B 1SQ2N 1SY6L 5EDXA 3QG7H 5IP4A 3ZE0F 4KRNA 2C3GA 1VFAB 5F8QC 3SGDI 4DN3L 1GGBL 1JV5A 5F88A 3LRGA 2Q3ZA 2IF7A 5CSZB 2J8UB 3SDAA 2YHGA 4RMUA 4U1IA 4CMHC 5HYJA 1FCCA 5C07B 4XMPL 4URTB 2OR8A 5CEZE 1BOGA 4H20L 3TT3L 4NN6C 1CK0H 1MEXH 4OCYH 1B6DA 3AU1B 2Q7YA 1MFDH 5FYLL 3MXWL 3KPSE 5E8PA 2IPKA 3QUYA 5KSAD 5JW3H 2DLEA 3K1KC 4HH9B 3WN5C 1XF4B 5CILH 4UINL 1FFOB 3RA7H 4C54A 4RQQB 3QHZH 4U1MA 3TIEA 1U8PA 4X83A 1DVFA 1UH2A 5C0ND 15C8H 3TWCL 5DHVB 5C71A 2DMBA 3MFFB 1H3UA 1IM9D 1OVZA 4RMVA 3SDAD 5J3HC 3FN0L 3HZKB 3TCLA 4DUXA 4N0FA 2DQJH 4MHHG 1T2XA 3QJHA 4KAQH 3L95B 1P7HL 1HZHH 3WFCL 2LE9A 2BNQB 1K2DB 3BP7A 2DQDH 3L7FB 1TVDA 4P3DB 2O26U 3IDIB 3TBVA 5EOCH 1CFNB 3W82A 3GMNB 1TETH 4S0SD 1TTFA 2NXZB 4YGAB 4YK4C 3MV9D 4LSSH 4X6DB 3RFZC 1GVIA 4R7NA 4UQ2A 1QFUH 1FRGH 1KC5L 3PJSA 2AJYL 4IMLB 2YPLE 3EYFA 1DUZA 4F7TB 3T0AA 3GRWA 3FFCD 3PWUA 3EDEA 4A6YA 2FBJL 5CGYD 4IOFC 4QRSB 2YRZA 3DVNB 4TUOA 2JJVA 3P3YA 3ZYZA 1LMKA 4UTBL 4AENA 5HVHB 4NRYB 1S8DB 4HWBH 5E2WL 3OGCB 3OKNB 2Y25A 3PWPD 5FCUH 1YPZE 3ZTNL 1FNGA 1JI1A 3P40A 3RP1A 1DQLL 4ZOAA 1XF3A 4P59H 1FVCB 4QOKB 2GUOB 1GZQA 5I17A 3TZVA 3NABH 3T04D 5I1HL 4QRUA 4Y89A 3H42L 4F7PA 1P84J 1F8TL 2EYRA 3MREB 5AAWA 2NZ9C 4DVRH 3EYFB 1FAIH 5IM7B 4KVCH 5CJOL 3UTSD 3BQUA 2AGJL 2KDGA 4ZDHB 4P46C 2ZZUT 3R1GL 1ZEAH 4Z0XB 3MLYH 7FABL 1KTRL 2QADD 1WBYB 1KNOA 2FH6A 4PD4J 3QXTA 5IOPB 2JB5L 3D2UB 1F2QA 4X4XB 1JZ6A 3GMPA 3SGKC 5CWSA 4Z7VB 2K7QA 1VPOL 4NDMA 3HN3A 4GLRI 1A7RL 5GRVK 3QEUA 3DVGA 5IVZA 3O2DH 1T80A 4LPWA 3MFFA 5GGRY 4QRRB 4JFDA 5HHNB 2K1MA 4JO2L 3WFHB 4YE4L 2AXJA 4RQQA 4JY5H 3MACL 2NY1D 1J5OH 1S5HB 2GTZA 2JJUA 5TE6L 3O9WB 5FO9B 1OAXL 1JZ2A 4ALAH 2MNUA 4WUKL 3EYQC 1A6AB 1S9VA 3G5ZA 4Y7MA 1UWXK 2ZSWB 3JWDC 1KB5L 1KCSH 4UT7L 3BEVB 4WU5B 3MRMB 4G8FA 1G1YA 4H8WH 4M6OL 4GG8B 3A6BH 4G42A 5IKCA 3V79C 1FO0L 2YS4A 3MRMA 3VW3L 1K4CB 5E94A 2F53E 2D4DA 1S78C 2QADB 3U36B 2J8UA 1KUMA 4PFEA 5SWSA 5F7DA 1E4WH 3IAQA 1MFCL 2ZUVA 1R5VB 1UENA 5GQBA 4RA0C 5GGRA 3C60A 5DHYA 5LCVH 3WE6A 4OZIE 1TITA 3KPLA 3UPRB 1KT2A 4OQTL 4J4PC 1EJ6A 1HHHB 5CJOH 4QHNB 5D2LE 3UPAA 1YY9C 2OP4H 5IVZB 3M1BA 4Y2DA 4KUZH 1S7QA 3JTTB 5C0RH 5FB8A 2P43B 4WI2A 3W11C 4KZDL 3MV11 4DAGL 5SWZE 2O93L 1AFVL 3GJEA 1DQDH 2FGWH 4YHYC 1G7HB 2QQQA 5EBGA 2FD6H 3N06B 4WI9A 5J11C 2ID5A 1ZT1B 3RKDD 3TN0D 1RHHB 3VRJA 2F53A 3I2CH 1JF1B 3DJ9A 4YHYB 5KOVC 5KS9E 3DXAA 1RK1A 1F58L 4OT1L 5IM7A 3KWWA 4HCRA 4O2FB 3FQUB 4FMKA 2VL4A 4YDJA 2BOBA 2O5XL 4GXUN 1MJUH 1OP3K 4NWUL 3GZKA 3LKRA 4JFYA 4D0DA 2H1PH 5BV7B 4WI7A 4NQVB 4ZS6C 4ODBD 1NEUA 1BZ7B 3MCKB 4H0IA 4MXVF 4OUUA 3LKNB 1YNKL 4AENB 5C0AB 3QULB 1KTDA 2D7TL 2B0SH 1DEEA 4ODWB 3RVWD 1IQWL 3VRLF 1ZKAA 3RDTC 5TGBA 3WL9B 4Z5RA 3MXVH 2H41A 2FJFA 1OF2B 2Z93A 3BSZH 5E08H 4HWBA 4GG6A 1MHPH 4UV7H 3R8QA 4HBCH 1AXTH 3HZVB 4RRPG 3AS3A 5DLML 2NNAB 1U8JA 5K9KB 5JOPE 5IBUG 5E9DA 3LD8B 1INEL 3GSVB 1Q8MA 1KB9K 1AGBA 5IESH 2KL6A 4C4KT 5GGTA 4P5KA 3MCG1 5IB5B 1NBZB 2E7CA 4BM7A 1ZVYA 2WIIA 3SBWA 4C57C 5ID0B 4HZLB 1FIGL 1INQA 1BFVH 2YOCA 4KGJA 1FGVH 2WM0A 3CFCH 1T2JA 1BJMA 2FGZA 3GKWH 4JANB 5GGVY 4ZTOL 1RK0A 4UDTA 3VRIA 2DM4A 1S7TA 5KBNC 1R3KB 4HC1L 1DFBL 3HMXA 3PL6B 3QDME 1FE8H 2Z92B 1HHIA 5CIPH 4P5TA 4D9RE 3STBA 3FFDA 1OSZA 1HHIB 2A0LC 5C0IA 3O45B 4RIRA 4NUJA 1FAIL 3ARGC 3REVB 2I5YL 3TLRA 5GZOD 1LWRA 2IPUK 3L6FB 2BP3A 2AVGA 1D5XA 1CGXA 3KGRA 3KPPA 4JM2A 1HWGB 1X5FA 2WK2A 1UEMA 3F6LA 4NUGL 1JTTA 2ZNXA 4HGMA 4MYWB 2H8PA 1DBJL 4DW2H 4AM0A 1AJ7L 2P42B 3GSVA 4IRJC 4L8DA 3RVXD 3MUHL 3C2SA 2P8PA 1X5YA 3RZCA 2A6DA 1PG7H 4P2QE 3K7UA 3TJEH 5I9QC 4XPBL 1MI5B 2UWEA 1ORQB 3H9HB 1UVQA 1M1SA 3MRNB 5FF6B 5B3JE 2AEIT 3DV6A 1NFKA 5HGAA 4OUOA 2IMNA 2O5ZL 5J1AA 3U46B 3S88L 5CUSH 4XPTL 1JP5A 2CIIA 4QHMB 1UJ3A 5BXFB 1DEEB 4ODWA 4WV1B 1CFVH 2Q3AA 1O7SA 5DJ0A 4XWOC 4NHCH 2CGRL 1YY8A 2FD6L 4E42B 2QQNH 5CEZL 3Q3GB 5MEPB 2L4OA 4G80A 3MMEA 2DQUL 3UYRH 5GZOC 3SDCD 5C0NC 5I2IB 3U48A 4KTEL 2V5MA 5KSAA 1DBAL 1U92B 2ARJQ 3LQAH 2MKLC 1S9YB 1P1ZB 5HTSA 1DP0A 4I48B 3VXSE 5HDLA 1H15B 2HWZL 1WCQA 4LLQA 4U2YA 5HHPB 4FA8A 4QRQB 4RAHA 3VWJB 2P47B 2YK1H 1IEAA 1W0VA 4X6BA 1JNNL 3IKKA 2CH8A 4D0BA 1AO7E 2D03H 1GAFH 3LZFH 4QRTB 4YZFE 1C5BL 2XG5A 4X8XA 4KDTC 5F7HA 4WI4A 4M6OH 1JNJA 4GRLA 2CXKA 1OM3H 4X99B 1I8KA 2FBOJ 2H26B 2A2QT 4YBLB 3TVMD 3UJIL 5E2UL 4L9LC 2DYPA 4WFHE 2ZOLA 3SKOA 1N5YH 4PV9A 3I85A 1MJ7L 3K3QA 1SBSL 5HVWA 1LE9B 2HT3D 5EORL 3U82B 1I1AD 4S1SL 2IALB 2ESVB 5MI0C 2OSLA 4QTHA 5E56A 4L9LB 1PLGH 3TFKD 3G04A 2MQ0A 4O4YH 5JUEL 4OGXL 3L3KA 3QIBB 3PHQB 4C59B 5CKAA 5JPNA 5DJ6B 3V6BR 3D6GA 4MVBC 1G7PA 4PGEB 4X9IA 2SEBA 4HS6A 4U1JA 1NEZG 1BVLA 3UTSB 3PE9A 3KYMA 4UZGA 5F7KC 2CGRH 1P4LA 1PQZA 1CL7I 2VDNH 5DRZA 3VD7A 2GJ6A 2VDOH 1IT9L 2I9LB 2X42A 3L1OH 2DQTH 5DQ9A 2Z91B 5HGGS 5EZIH 4Y4HA 3ZYJA 1BD2E 4NQEB 1WAAF 4LLMA 5B3NA 4ZOBA 4TRPH 4UQ3B 1A7NL 1Q38A 5ACZA 3IDNB 3R0NA 3L3IA 1BD2D 3WFEH 4IJ3C 5IQ9A 3ARSA 4K9EL 4GQPH 2GTWB 2QJDA 5FHBL 3A0OA 5EBWB 5IEHA 3K1DA 3SOBL 5MEND 5DXWA 5DJCB 3OR7A 4Q6IC 2PR4H 1LK2B 4JQXC 5EU5A 2W60B 3QZWG 4JZNB 3UJJL 2ESVE 3SKJL 3BKCL 4WW2C 4KAQL 3QQ4A 4M3KB 2UZYB 2FIKB 1TVHB 3L7EA 3Q5YA 2VKXA 3LEXB 4ELMF 5FDWB 1WBYA 3IGAA 5B38A 1JHKL 3IDUA 4FQCH 1UC6A 4JRYD 1UCBH 4PRIB 3H2WA 1R24B 4FQJL 3UO1H 5FYLH 3AREA 3DX6A 3QDMB 2C4FU 1PDKA 4JN1L 4XP9L 2ESVD 3X3GH 3WDIA 3ZYIA 2LU7A 1NCDH 4HKZA 5FUCE 3T0BA 4YHOL 4HWZA 3TZVD 2GUOA 4M43L 1MCJA 4MSWA 4JFFD 3C5ZC 5DQJA 1BZ9B 4HS3B 3EOBA 4ZFGH 4LDEB 2WW8A 4R8WL 1CXEA 2MQCA 4ODHH 5FDWA 2P5ED 3P0GB 1FZOA 4QRSA 3FRUB 1XCQA 4PJEE 1JGLL 1A4JA 1S78D 2D31A 3RIFF 4KHTL 1AGEB 1S7RA 4L4VB 4LLVB 4QNPF 5IFJB 1UWGL 5IHZB 4GW5B 3TYFB 2FATH 2MKWA 4NO3A 1DBJH 1XF1A 4JZNA 1LK2A 1D9KB 1NC4A 3VGAB 1QBLL 1INEH 1PYWB 2FSEB 3ARRA 2WIMA 4K7PL 3N9GL 4LSRH 4OLEA 5DMKA 4CN4A 2XKUA 4JFPA 5J12C 5FO8B 1RZJH 3HC4L 4XB7A 3E2HB 2YD6A 1IM9B 1ZOXA 2EC8A 2PXYA 2VXQL 4PJBF 5F9JB 5FUZL 1CFNA 3CMGA 3NCCB 5DJ2B 5J9PA 4RNRB 1I8LC 3MRFB 3T08A 5KSBE 4DCQA 2VUOA 2R23A 1QSFD 2DWEB 3GDBA 4YPJA 1DCLA 3KS0J 1T1WA 5BMFL 4P4KD 2PO6A 4ZXBB 5F71A 4JREB 3HMXH 1F6AB 2L0DA 4U1KB 4PB0H 1FE8L 4WWKD 4JCMA 3LN9A 3IFLL 4IS6A 5DUML 3ROOA 3QUXA 4NKIH 3T4YA 4MQ7A 4XCEB 1NAKL 3QH3B 1I7UA 2DQEH 1A14L 2APVA 1OAKH 5DJ6A 5I6XC 3HHRB 1T0NB 4K7PY 4L3CA 5D70H 3QIBA 3KXFA 1A9BB 2XN9B 5KTEL 1SJVA 2P7TB 2IPKB 2DJSA 1D5ZB 4OZGF 3TBYB 1JTPA 1CG9B 2VIRB 2QHRL 4HFWA 3KS0H 3HRZA 5DD3L 3VXSD 3DURA 3UC0L 1M4KA 4K3DH 4PJHB 5ITBL 5JIKA 5KVGL 4XBGB 5CJBA 4CUCA 3I6KA 1Z5LB 2QBWA 1J0IA 4KWUA 1JK8A 5AWNL 5LAXB 1N0LA 5JORA 1JHKH 3K74B 3UBXA 1F3DH 3GB7B 4U1LB 5HJ3A 3DIFB 1CGSH 4U6XB 2FNBA 3BXNB 1W0VB 3BKYL 3M17A 3DRQA 32C2B 4N0YL 3FB8B 5I6XB 1BVKB 2R1YA 4WFHD 2LTQB 3NA9L 3ARDB 5DS8A 2HTKD 1KXTB 4RAVB 4FZ8L 2V7NA 4M6MH 4ZUSA 1H3PL 5BVJA 3AAZB 4J12A 4LBEA 4Y2OA 3QIBD 1G0XA 4PYHA 4OZFB 4X6FB 3SQOH 2OR9L 3E8UH 3WD5H 3PDDA 4MAYC 3QUXD 3D69A 3MLZL 3JVGC 3MLRH 1G7LB 1VERA 4X6FA 1ND0B 1UJ3B 1AGDA 4KKCD 4KMQA 2E5EA 5JZ7C 3HB3C 5BVJB 1D5BA 2BMKA 2EE9A 4NCDA 4RDQF 4XP5L 2IFGA 5DS8B 1KFAH 2CKNA 4H25A 3UEZA 5IMLB 3FB8A 4RFOH 1K3ZA 2GY5A 4X7TA 3T2QA 2HTKC 2AEPH 1A7OL 3MRIA 3FQTA 3NA4A 4A6YH 2JJSA 3VXUA 4D3CL 1QFPA 2P4AB 3WLBA 3CXHK 4X6DF 4P2OC 3RU8L 4ODXB 5GS0L 1NC4D 4TPRL 4AM0B 1PKQB 1BAFL 3HI1B 1OD7A 1S7VB 4OZGE 2VMFA 4NQED 2AXHA 1P4BL 3EJYC 3MNWA 3G6AA 5IMOA 1EFXD 2H6PB 1V3MA 3L6FA 4E0RB 1GOFA 3STLA 5ILTL 4HD9A 4NZRH 4GXVL 5GISL 5IROA 2DQTL 3HRZB 4DKDC 1RIUL 3CSGA 4MNQD 3REVA 2VIRA 2XTJB 5E7FA 5EC2B 4K7PX 3BMVA 2W0PA 4OM0L 1V7ML 1IAOA 3N1GC 4NNPL 2VDMH 5SX5H 2GSIB 2C1PB 2BNQE 4G7VH 4KDVA 5I1AA 1T2QH 3P4OA 4KJQC 1RK0B 2YPVL 5EPMA 4U0RC 3VE0A 1YEGL 3VDBA 3S36X 1VACA 1FP5A 2Q20A 4HUXB 5DGQA 2YEZA 1B2WL 4YGVA 3LIZH 5HDOA 1DDHA 3WNMA 5IGXL 2YN3A 4CN6A 4OLUH 4YXKL 3NCYP 2BHYA 3BPNC 5FA4A 1FYTE 4JHAL 1DN0B 1F6FB 3B8YA 2LFGA 4NM8H 2PYFA 4KI1A 4ZO8A 4TVSa 1GGCH 1FRGL 1K8DA 4DVBB 3WSQL 3D1MC 5DJXB 1WFNA 2RQ8A 5GRXG 3VXMD 1QUNA 2VH5H 3E6HA 1WLHA 2MHAA 1FFPB 4JDZB 4LEXL 4NO3B 3RNQB 2DQGH 2VDLL 2OMBA 2XICA 5IFJA 2QR0A 1UM5L 5E1HB 2OMNA 3S4SB 1C5DB 5E8DH 1H8NA 4H8WC 1CVRA 3FB5B 1KB9J 4MGXA 1KGCD 1KULA 3WMSA 4XVSH 2VQ1B 1BZ7A 3MCKA 3QUMB 5FDYA 5C6WH 2OYPA 1S7XB 3U1SL 2QQKH 4EVNB 5J89A 3LS4H 4JKMA 1TZHB 1K8IA 2CUIA 4HWZB 4YFLI 3WFDH 5EA0L 2HFGH 4EUPA 1FFQA 4ISVA 1F4HA 3P4NB 1MY7A 1MI5E 3TH4T 5INCB 3V95A 4M5YH 4ZFOL 3DXAB 2OTPA 5D7JC 4MDIA 3ZHLA 2VZVA 2F53B 1ZK9A 3FAXA 1RULH 4LBEB 3MLUH 1LD9B 1JGEB 3QO0A 1LEGA 2BERA 1GZPB 1FO0B 1T89A 4HIJA 4AT6A 2FEEL 3H3KA 1IC4L 5C0GB 4Z8FL 5A2FA 3BDYH 3MLSL 5JW5A 5HYFA 2RHEA 2F58L 4HHAA 4PJDA 4AMKH 3QIUD 1Y6NR 1GGTA 5K9QG 4NSKB 3M1BB 3IU4L 3DSFH 4PS4H 2EH8L 4HWEH 1IGIL 2XA8L 4X4YA 5DA0B 4QKXB 2RBLA 2QLVB 3KLDA 1KYOJ 1Z5LA 1P4IH 4GKNB 3ZDYF 3GHEL 2D2OA 3LDBC 2WUCL 3UZEA 2DI7A 3OTTA 2Z91A 3GSQB 3TP4A 4D2NA 4IRSC 1FV1B 3GM0A 1PQZB 3D9AH 1QBLH 5LWYH 4GG8A 4G8FB 4XMKL 5GRUL 1AGFA 4S11A 2CLZB 3IKCA 2ZSWA 4P3CL 4I0PC 2P7TA 2RIKA 3V6OC 3VXNB 4EI6B 4ZG1A 3OF6A 2WAHA 2GTZB 1S5HA 5TDOB 1ZAGA 4K94C 2IGFH 2GAZA 5D7JD 3EJZD 4PJ7A 4HUUA 4X5XA 3I75B 1RAMA 1NGZA 5GGTH 3L9RB 5I1JH 3ROOB 5TDPA 1HQ4A 5EBLA 3WNOA 2DN7A 1NMBH 2DYPB 3GNML 5M94B 4E5XB 4YHKL 4B5EA 2X7LB 5TQ0L 3I84A 1VGEL 3ALXA 2EDRA 4Z7WA 3A6BL 1WZMA 4Y8DC 5B22A 1C7TA 3QDAA 4M8VA 1A6VH 5J9PB 1NFIA 2DM7A 4K8RL 3SDDC 5TE7H 1RVFH 4UNUA 4EUPH 3ZE1E 4GUPB 2N7BA 3WEXA 2YA1A 5B4MC 2E7LC 4P2QA 4CVZB 2QQKL 4MA8L 4FQPA 4Y5XB 4NRXB 1SJXA 1TJIL 4JKPH 1PYWA 1K5NA 2FSEA 1ED3A 4MZ3A 1J1PL 3TGXA 4QEGA 3SE9L 1UXWB 1XGYH 4JG0H 4I48A 1T0PB 5F6IB 4HV8B 5C0RL 1GZPA 1XEDA 4N0CC 1U8KA 4WFGE 1LEGB 4F7PB 5ID1A 4P49A 3MYZA 5DUBB 4XWGH 3FRUA 1MIEL 4POZD 4YLQT 2AABH 2HJKA 5FGSA 1IZJA 2EKSB 4E42A 4Q9RL 4G5ZL 3ZSTA 4KI5D 4CW1A 1DVFD 3JTSB 4U6VH 2G9HA 1ZHLB 5GRWA 3WXVH 3W2DL 4WVRA 1EIBA 5EULV 5EZIL 5D2NB 2CIIB 4OLUL 4RDQG 4FTVE 4MNHA 1N6VA 5A16B 1OP5K 4XP9H 5DLMH 3V9FA 3X3GL 5FF6A 3FQRB 4AL8L 3BN9C 3QDMA 2XFXB 2BOCA 4DN4H 1GHFL 3D3VB 3QCUH 1P6AB 4CVXA 2R4RL 4OFVA 3T2PA 1MIMH 1LEIA 1JPGA 4XNYL 3DO7A 3W0WE 1VENA 4Z7QE 4OM0H 3ZTNH 3CSBA 4P3DA 2HFFA 3TO2B 3SKJH 4U1GB 3CXDH 4OCRH 4FFZH 3OAYK 4L1HA 1C5CL 3L3JA 4X6EB 5DJCA 5I18L 1CGVA 4K7FB 4RMRA 5BVPL 2GFBB 5EBWA 1RJYA 2G2RA 3G5VA 3JV4A 2EXWC 5DJXA 2F5AH 1D6VH 4JG1H 4P9HC 4EI5D 5I30L 3FN9A 3QI9A 4R4ND 5IQ9B 1SEQL 2Q76A 1KN4H 3FFCE 2AJYH 2ZSVA 3IT8D 4W4NA 2M1KA 2VE6A 1FFOA 2ZOKB 2PW1B 4R97C 4NBYB 3B2VL 5HGBB 4OI9A 2HJLB 3DUHA 3LIZL 4YDIH 5GRZA 5DD1H 3VFPB 5JTWA 3VGHA 3VE0B 1MCKA 4PP1D 4HPOH 1N64L 1R5WA 3LEYL 3HPLB 3U9PL 4JANA 5I1AB 3F7VA 5E8NA 3ZT5A 4PJ5A 2SEBB 4HS6B 3V8OA 1QG3A 1KXVC 4RBPH 3BPOB 3QNYA 4QXGL 4KH2A 5GIRB 3WXWH 2WIIB 3G04B 2AEWA 1FG2B 4JVPA 3V7AE 4BFEA 1CGWA 2FWOB 5DRWA 1QEWB 5C3TA 2BNUB 4OF5A 4TN9A 1T7XA 3DTXA 2NY2D 3QYCA 3BPNB 1I1AA 2GK0A 2DI9A 2HTLD 1G7IA 1G7QA 1YYLL 1Q9KA 4G6FB 1S5IH 2R1WA 4XNXH 1HXMA 1IFHL 2DKSA 4OD2B 1WCBA 5GSRB 5CP7A 1OF2A 2Z93B 4MD5A 1R5IA 5SWZA 4ODXA 1HZHL 4CDGC 1IRAY 5MENA 4JY6B 1R3IH 3RNKA 3VXUB 1A6UL 3HPJA 5BCAA 2J8UF 3QULA 4F2MA 1IMHC 3AGVA 3LDBB 3VWJD 3LKNA 5HHPA 1X5JA 4J3OC 3KVQA 3WCYA 1XR8A 2X1WL 3QP3A 3LVEA 1P1ZA 5LQBH 2AJSL 4MA8H 4EI5C 5C0DB 2X70A 3CH1A 5I2IA 4FQHA 5CZXD 3KPQB 4LPUA 1X7QB 3H0TA 3Q3GA 1G1CA 2EO1A 3QUMH 3DV4B 4WUUD 1I8LA 3F58L 3QAZB 2AJUL 5FYKE 1OY3B 4PJCE 2VLKA 4Q58C 5JA9A 3EBAA 2VDRH 2AABL 3CSYA 2D0HA 1YN6A 1B0RB 2EDYA 5D1QB 1TCRA 4MJ5B 4FABH 4M8QB 4XAWH 3WO4B 2ATKA 1YNKH 5D2LF 3FO2B 3OBAA 4EZMA 4HW6A 1FL3B 1KENH 1QHPA 3MRNA 1F6LL 4MA1B 4HX1B 2R1YB 5F21B 3TA3B 2AAVA 1L0XA 2FX7L 3CDYA 1YJDL 3EUUA 4JFDE 5EOCJ 5HVFB 3FOLB 3JV5A 4HUWB 1I7ZA 3TVMA 4N1EA 3BKYH 5FYJL 5HYSB 1E28A 3BN9D 3P2TA 1O5DT 5AZ2L 4WRLA 2XQBH 3JWOC 2Z0BA 3GMMA 3NIDF 3OB8A 4NCC2 3KPRE 3BQUD 4HG4J 4JQVA 3ZKND 1T1XB 4MQSB 4O2CA 1YY9D 1YNLH 2IG2H 1QYGL 2OI9C 5GGUA 3IJYA 3MV8E 1OAZH 5ESQA 1N3NA 1TPXC 4K3EH 3DURB 3GHEH 3GMRA 1MHPL 1JZ4A 3VI4E 1K4CA 5HDQL 2XRAL 2XZZA 3VFRB 3RPIA 1U8LA 2LTQC 2EDEA 2W0FA 2G5BA 2KKQA 3BEVA 4WU5A 4U6VL 2X9XA 2F19L 4G9DB 4PS4L 2ZCKH 2JCCF 2YD2A 4OCWH 2ZP0T 2Z31D 4QY8A 5EU3B 4OLYH 1T0NA 4L3CB 4FFVC 1NGYB 2EEBA 5ICYB 3G6DH 2CRZA 2E9WA 1AY1L 3W9DB 1FORL 3G9VA 4CADA 3GBNH 1NBYA 1EUTA 3BJ91 1XGYL 4UMGA 4U1KA 4R8WH 4IBLT 5E00A 2VDRL 3QDJE 3WHXB 1S3KL 1F3RB 3C8DA 3D39A 2CMRL 1P7QA 1M05A 4NN5B 5GRUH 5FGCB 5CGMA 1EMTL 4AIXA 2BFVH 4V1DE 3PDOA 2B4CC 4GAGH 1MAJA 1JWUA 5L6YL 5IOPA 1FPTL 1EXUA 4LHUG 4GRWB 1EO5A 3DSFL 3FB7A 3LPGA 4JN1H 1N8ZB 5E2VL 1CF8H 4LIQH 4P2RE 4ZDHA 4DGVL 5E9DD 1F02I 3FCTB 4F7EA 3MGTA 4XRCA 4LL9A 3RVWC 2EXYC 1AGEA 1S7RB 5KG9B 4LSPL 3FHAA 1DUYB 2Z35A 1MCIA 4J8RB 3OZ9H 1RIHH 4WDIB 5D5ME 3TZVB 2APFA 3KXFD 3SDCA 2OJZH 4ODUB 1L7TL 4P2OA 3S98A 3QEQA 2AV7A 1OGAD 3OKNA 4XX1G 1KIRB 4HS3A 2OTWB 4XMKH 1T1YA 1BZ9A 3F12B 3GFUA 4PJXA 5CJXA 1R3IL 4ZAKB 1UXSB 4KDTA 5FGBA 1N7ML 5AYUL 5CFHA 4UBDD 1RZFH 3O4OB 1GC1H 2GSGA 4NKDA 1W72A 1EHLL 3HCVB 4YBQC 2FIRT 3MZTA 4JHAH 3I3EA 5ANME 2WQRA 2XXMB 4JN2B 4YHNA 3TA3C 2VWEE 1PJ9A 1R24A 4G8GE 4PRIA 1T03H 4POYA 5H35A 2YSSA 3PWLA 4XNMA 2ICCA 4C83A 2R8SL 4I9WE 5IK3B 1MCBA 3PXHA 3X11A 4Y16B 4P2QD 4HKXA 3T1WA 4N8CH 4ALAL 3LQMA 3RGVB 2XOTA 3GMNA 2HWZH 5HGDB 4RFEB 1X5XA 3F62A 1ADQL 3GJEB 1ZSDA 3ILQC 2XQYG 3RWIA 3TPKA 3TV3L 3OR7B 3HE6D 4OLWL 5B21A 3I50L 1LE5B 3CFBA 2R9HD 3LKOA 3RUGB 3TZVC 1E27A 3O3BB 4UIKH 5BZWB 1VB9A 4KQ4L 5DHVA 5HPOA 3ARDC 1J8KA 2OTUB 1V3JA 3GJFK 3CUPA 5LCVL 2B1AL 5DHYB 2Y7QA 4TRPL 1NPUA 1AI1H 4PJFA 5GS1B 4JPKH 4LLMB 4PB9H 3C2AL 4YWGH 5CLTA 4Y19A 2XZCL 4HH9A 3HC3L 3RQ3A 4KVNH 3QDJB 4RX4A 4NT6A 1NFDE 4K3JH 1C5CH 1NBQA 1NLBH 3LH2H 5T5FL 1AO7B 5GGSY 4OTXL 5JOFA 2HT4C 1E4XL 1GJIA 1D5MB 4MJIE 2ARJA 4NIKB 3L3KB 1A6AA 5LXGL 3U7WL 1II4E 3NGBC 4Q7DA 2FR4A 3ARDD 3KPOB 2R0LL 4R4NC 3S35L 4P46B 1UZ8A 2ILLA 2JIXA 2OSLB 3EOAB 4HMEA 5FKAB 4RZCA 4AQ1B 4RSVA 4FQXD 1UB5B 1D5IL 3DI2B 2Q8AL 4R26H 4GMTL 3HG1D 4KMTL 4LMQI 4PBVC 5D6DA 1GC1C 2F53D 2H26A 5A2IH 2JF1A 2J12B 4IMKC 4LAJH 2VLRD 3UZQA 2B5IB 1NGWA 2PCPA 2BJML 4G6KL 1MPAL 2W9DL 5DFWH 3DARA 5GS2H 3H8NA 5D71L 1G7MA 1IFHH 2OM5A 1EHNA 3HUJB 35C8L 4GMSL 5IR1A 4X6BB 1N0XH 2BVOA 5I8CA 5MEQB 1T5WA 5GJTL 5ELIA 2BSSA 4PJXF 4PRPE 1H5BA 4PUBL 1H15A 5F72S 5ICZA 3O0RH 5JIPA 4OQ1A 2P1YA 5FK9A 1A2YB 1SJEA 5D1XB 1F90H 4PJAE 2DLTA 4IDJH 4JLRB 4QRUB 3FMGL 3MUGA 1ONQB 4Z7NE 5J3HD 3DX7B 1GZQB 4N1CA 1F00I 1Q9LB 3MMEB 4RFOL 3RIAK 1BJ1J 2BSRA 1ZA3B 1FNGB 3CMOL 3DUSA 3FO0H 4MA3B 4MA1C 2DJUA 3C08H 2VXQH 3WJLA 1LO0H 3BDBA 4FQ2H 1BWMA 5I16A 4NN5C 4JFHE 3PWVB 1CICC 3O2WL 4PRDA 1EAPB 4PTUA 5I8EA 5IFAH 5IJKC 1NMCC 2EECA 3HE7A 2VC2H 3EYOB 4HCRL 3GMLA 2G75B 5I8KL 1MVFA 3MLZH 3A6OA 3OJDB 5JDJA 5BS0A 4Y5YA 2OXGA 4XPGH 1ZHBA 2D7MA 3H9HA 4J3SA 1ORQA 2VISA 4U31A 4KQ4H 1KBGH 4DWHA 4M7KL 5T1MA 4R7NB 2Y6SD 5TH2A 5CIPA 1TTGA 1W0YT 5DVNA 3BE1L 3KLHD 4ONHA 3O8XA 5C0BD 1FC1A 3L5WB 4L8DB 2YBRA 3QXAB 3VD4A 1YNTB 1CZ8H 1R3JA 3NCMA 3RX8A 5E5RB 1K2DA 4UTAL 2O61B 4X9HA 1D6EB 4TNWK 1GGUA 4ZTPH 4ERSL 2Z8WC 1TPXB 1ZTXL 1BF8A 1RZ8B 3T0VA 4ZMAT 4AEEA 3UAJC 5C9JA 1ZGLB 3E6FA 2GW5A 2GYSA 2OZ4L 4FQJH 3UO1L 5T1KD 4F33B 2Z31C 2QQNL 2V2WA 4R4BB 3TIEB 4V2BA 3VXSA 3OPZL 3A67H 4AIZB 3IS0X 5GSVB 3O2DA 1YC8A 4GKSA 1P53A 5IB2B 3FFDB 2AJXH 4YQXH 1BIIA 1XGQA 4H26A 4DZ8A 3ESUF 1A14H 1AI1L 1WC7A 3OSKA 1CE6A 1HOCA 4G9FD 3I9GH 4XMPH 3PGFH 4KKBC 4PGBB 5E8OA 5C70A 3K8MA 2Y36H 5E8OB 5I76A 4D9QE 4Z9KB 4NJ9H 3T2OA 1RIHL 5CBEA 1K3IA 2HLFC 3BISA 3QAZC 1I1FB 5MHSE 4MAYD 5HVHC 3P9LB 1K9TA 1QRNE 5HPMB 3IAGC 1E4WL 4N0UB 3BP5A 3RA7L 3HZYA 2J6EL 3QNZB 4BYHA 2NNAA 5EBMA 5GSVA 1BOYA 4JQXA 1JGVH 3R06A 4GG6B 1QO3B 1XIWD 1C7SA 4LOUD 2E6JA 4I3SL 2EIZA 2Y5TB 4F9LC 5C0AE 5BQ7A 5L0QC 1QVOA 3ZKMC 2CMRH 3RVUD 4UOW1 3T77B 2AK4A 4NKMB 3N1FC 1QNZH 3JZ7A 3QB7C 1MLCB 4BZ2L 2PW2A 4OLVH 4OM1L 3BKCH 4JFOA 3WNLA 1IQWH 3NFSL 2O61A 2A77L 3SDYH 4FQLH 3MJ8A 1DQTA 1IL1B 2N7AA 4U1GC 2Q8BH 1JRHH 3O8XB 2P5WD 3P4MB 2Y07H 4JFYB 1NGXA 4OKVA 3RUGE 3J7HA 1PEZA 3LKRB 1BEYL 4I2XE 1I3GH 4PBWD 2PTUA 5CIPB 5JIIA 4OLYL 2DBJA 3ET9F 1VPOH 4I5BB 3GSRA 5EU6E 3VWJC 3VFNB 3BO8A 3OG4B 4M1GL 5IB3B 3IXTA 2X4PA 3MRCB 3F7RA 4M9OA 3BP4B 4PG2C 4UNTA 4OLXH 4G6ML 4WFED 4C56B 4M43H 3GMLB 4CVWA 1YMMD 3EYOA 3HE7B 1Z3GL 1YYLH 5I8EB 1AO7D 3BD4A 1QFWH 4LU5H 5T1KA 3MRPB 5CGTA 3H7BB 5JXAL 5CZKA 3VXQB 5DFTA 2VITB 2CKBB 3F7YB 4FQ2L 1OPGL 3OKKB 3SKNB 3JWNC 2X4SA 2LVCA 4O00A 2NY0D 3EFDH 1BF2A 2CK0H 5CINH 3TJHD 3LN4B 1F4XH 4G6AD 4BZ1H 1AC0A 3DX7A 2OL3L 4GRWH 3H9ZA 2VZTA 3BZ4A 1E4XH 2W59A 4DKFL 4HQQL 3EYSL 5E4IA 3G6JE 3HMWL 4QWWD 1YJDH 4TNWF 1KBGL 4PUBH 3U2SB 2NR6C 4GG6E 3C8HA 1QLFA 3EZJB 3MNZA 3KLAB 4Q2ZB 2XY2A 4YBLC 3QCTH 3AMLA 1J9CT 4BUHA 1BZQK 3HUJA 3IDGA 5JR1H 5C3LD 1MF2H 3LEVL 2COQA 1F5WA 3O9WD 1AHWB 3PXJA 2RFXA 4ZPVA 3S37L 3ME0A 3GM8A 3MV01 3PQYA 1JF5A 1I1YB 2AJUH 4GAFB 1KN2L 4BQBA 5HI4D 5JW4R 1NGWB 5F1IA 2DIJA 1EO8H 3VFOA 1QR1A 1J86A 2OZ4H 1MQKH 1KIUA 4OI7A 5F89A 3VWKC 3RWJA 4KMTH 3O9WA 1C12B 1FVEA 1H5BC 4KVCL 4J3VA 4UU9B 5F3BA 1JGUH 1J8HD 3ARGA 5ANMB 1NDGB 3DXAE 2R0ZH 4JFDB 5HHNA 3DI3B 2DWDA 2VDML 2RCSL 5IB1A 5F9AC 5J57B 1CT8A 3QEUB 5AZ2H 1YEKH 4BH7B 2FBJH 3K81A 4LSUL 1RJLA 5SWQB 4M1DL 1AKJA 2XT1B 1IILE 4PY7A 3V6ZA 3ZMRA 2A83B 4ZPTA 3GMPB 3RVTD 3P73B 1HSBB 2AXFA 5GJSH 2VXTL 4KJYA 4M7JH 1IKFH 3KYNA 1Y6KR 2HP4A 2ORBL 3TESA 5ERWB 4W6XB 1U3HD 5IF0B 1ULVA 4O51A 3UTPE 1NCWH 3B5HA 3QRGH 4G8EA 1XR9B 1GGCL 2Y7QB 3IFPB 4OLZH 4LLUB 4GMTH 1I9JH 3O4LA 2A1WL 3D0LA 1BQSA 1JIBA 1QA9B 1WJ3A 4DKAA 4OZIA 1QLRB 4M1CC 1XGTB 4L4TA 3T8XB 5I9QB 5HY9A 2BNQD 4L3EE 5K59E 3H42H 3UP1A 1MREL 5C8JA 3RWCB 1OQOA 1XF3B 3LN4A 4PLKD 3VFMA 4XBPB 5F9DC 4Q6IA 3IAPA 1F90L 2BZDA 4J4PD 4X4ME 4OZGB 4N8VB 2VYRE 3VXQA 1CFQB 3DX8B 5DEGB 3S6CA 1NEZA 3TJHC 1NMCB 4OIAA 4K3DL 3DVNA 4TUOB 3V4PL 1HHKA 2IC2A 1CICB 5JHLL 5IK3A 2KPNA 3BP6B 5DK2B 1ZLVH 2EIDA 3OAZK 3MLRL 3NCFB 4C56A 2O5YL 2Z8VC 1HHJA 3PWUB 5E70A 3RVVC 3T3MF 4Y5VA 3RWEB 5BRZA 1EEZA 3BGFB 3HNTH 3BYTA 4PLJD 1FHGA 2GSGB 1EHLH 1R3LA 3VGEA 3VXPB 1MCEA 3RWDB 3QXDA 4OKVB 2F8XC 1G6RH 1ZEAL 4ZAKC 4N8VA 43CAA 5GS0D 3UTTB 1IL1A 4F7CA 4ZUVA 1M6OB 1PY4A 1KIRA 4MAYB 4PGCB 1FFRA 2AV7B 3ARYA 1NAML 5T3ZD 4XBPA 4NBXB 4XPAH 1NLDH 3RU8H 3L95A 1C16A 5DVOA 3MGOA 3SCMB 4OFDA 1YJDC 3TBWA 3UJTH 1I7TB 4ETQA 2BSED 1QVOB 1KLFA 1OSPH 3EFDL 3PWPA 1OGAB 5T3XE 15C8L 3ILQD 5FCUL 5T5NG 4S1QH 5FM5O 5IW1A 5B38G 4WWKB 2YPLB 4GLRH 3TBSA 1J1XH 3QHFL 4PJ9D 5HI5C 3B43A 4I0KA 3WHE1 4RWYL 1YEFL 1IGFL 3KYNB 3L3DB 4LLDA 1EMTH 4Z7OF 1YPZA 4ZO9A 4PREB 1CTOA 1SVCP 5CLWA 2A83A 4ZPTB 1OOAA 3NA9H 3V2AR 3VGFA 2CUHA 3WHXA 5C07A 3I6LE 3MJ7B 3Q0HA 4X4ZA 1BQHB 2E27L 4PP2B 5GGTL 4R90H 1JN6A 4LASL 5TDNA 3CU1A 5ESAB 5MHSD 1IVLA 1EUUA 1M7DA 1TNMA 3RL1B 4DZ8B 2Y36L 4WV1C 1LP9A 1WAAE 5DDHA 1F3JB 5JPMB 4OB5H 1T3FB 4Y16D 3O6FB 1MJUL 4FXGA 5GS1C 4OAWA 3GI8H 5H37G 1OAUH 5IESL 1NCAH 4GJTB 1IEBA 4JJHA 3HA0A 1TENA 1RI8A 3WFDL 1ZWIA 4JO4L 5KSVB 3OWEA 1AQDA 3O3EB 1NL0H 4LCWD 2DQHH 5H2BA 4HJ0D 1Z3GH 3GMOB 1RFDL 1T4KB 4XH2B 5C07E 3U0WL 4K8RD 3MLWH 3MXVL 2I26N 5C07D 4LLYA 4RWHA 2AW2A 5KZCD 4P5MB 3HFMH 1KCRH 1KCVH 3GIVB 4I18A 4BQCA 1OL0A 4KRPD 4O02H 3RTQD 5HD8C 5GGSB 2AI0L 2M8XA 3E3QE 3TBTA 2YKLL 2VISB 5KN5B 3VGAC 2ZKHL 4TVPL 1BQHG 5I0ZA 5EWIH 5CJQH 3OJDA 3IJHB 2CKBA 4DK6A 2VN4A 3IB4A 1ZHKA 3B83A 4UDUB 4M8QA 1X4XA 4JFFB 1XGRA 1W72L 5FOJA 4NC2B 5JNYA 2IAMB 1UJ3C 2DF3A 4XP1L 3QIWA 3O2VH 2VLKB 3NZ8A 3DYMA 1IGYA 1ITBB 3VGBA 5I75C 4H8WL 4ZSOE 5IB3A 4OSUL 4WUKH 4GW4B 1RUPL 4OIBA 4KHTH 5IGXH 3LRHA 3FQWA 4NPYB 2M2DA 5FYKU 1FZJB 3UBXG 4L8SA 4EI5B 1L9MA 4MMZC 4LLYB 1ZA6B 3D85B 2YPVH 3SGDH 4TULL 4NFDA 4Y2DD 4WI6A 3MO1A 4LQFL 5IQ7L 4ETYA 5LXGH 2PW2B 1IGCH 5IR1B 2XACC 4PJHE 4JY6A 4WO4D 3CPLB 2VDQH 1CS6A 1QPXA 2JIXD 4G7YL 4X98B 3P77B 3C5SA 3ULUH 5EH1A 1ERNA 5A2KH 2V5RA 3NH7L 1DLHB 5EOTB 4JO3H 1MJ8H 1QO3A 2P5EA 4MNQE 5DTFA 3P9WB 4OD2A 2YA2A 4NN7C 2R1WB 4F9PA 1NMAH 2BRRH 2VC2L 3TO4A 2BNRB 1KACB 3EO1B 1A1NA 5EOCL 3DTXB 3KR3H 2VDNL 4FFYL 4LKXA 5ADPL 3B9VA 5E2TH 1DVFC 5FCSH 4FFWD 1UZ8B 3S9DB 4M1DH 1SJHA 4HIHA 5F70A 5D96C 1VKXA 1VHPA 3UCRA 3V7MA 1RZJC 1D5MA 4LGRB 1FNAA 1AD0A 1C08B 3TEUA 4HLZG 2XQYK 5CZVH 5I1EL 1FH5H 4FOMA 3V4UL 4XCNA 1QP1A 5D6CB 5FOBA 1SYVA 2AV1A 1I9RH 4JKKA 4H26B 1YEJL 4NT6B 2EYTA 3EZ8A 5HGBA 3U6RB 2PYEA 1FLRH 3ULVH 4Y19B 1WV7T 1CL7L 1GOHA 4QXUL 4XCFL 3X13A 2Y4SA 5CJ8A 2AJVH 2F8OA 1J0YA 3AXLA 4JO1L 4PJIA 5EUOF 3TFKC 3UTZA 3FJTA 3QI9B 1NCWL 1CE1L 4H1LH 1Z0MA 1PKOA 3B6SB 1W0WA 2AEQH 4LIQE 4PB9L 4YWGL 5CJ5A 2HFTA 2YK1L 3CFEA 1IGCL 1QSEB 3BH9B 5BJTB 3QG6A 5CD5C 1P2CB 1D6EA 3F8UB 4WEMB 4EDXB 2AJSH 2BCKB 1MCCA 4PGCA 1J1OH 1XH3A 1YNTA 2APXA 4OF3A 4BZ2H 2GJ6D 1OCWL 5FHAL 2GKIA 3ARFD 4HGWB 4YR6A 1KIPA 2X1QA 1CIUA 2RJMA 1LO5B 3ULUF 3WLWD 1EV2E 3FFCB 4HIIA 1CD0A 4D0CA 3IETA 3TT1H 2IQ9L 4OZHB 1X5GA 1FYTD 1KF9B 1G6RA 2NPLX 1A7PH 3HCVA 4MNHB 1EFXB 2FL5B 3V6OA 2H32A 5I71C 3O6FD 3QBTB 3EO0B 3TYGL 1A22B 4JPKL 1ZHLA 2XZCH 4XVTH 2VKWA 3MOAL 4RFNC 3QT2A 1U8MB 1T1YB 3C5ZA 3F12A 4PJXB 4X0KB 2VXTH 2OTWA 5FGCE 1CVSC 3NTCH 4WW1A 3QQ9D 3VFWA 3C5JA 1G9MH 3ULUL 4MB3A 4ODUA 1Q9LA 4M48H 2DM3A 1NDMA 2J88L 4MCYA 4BQ9A 1YEHL 1CGYA 1LO4L 4ELMB 2QHLA 2F54A 4QGYA 4WI5A 3TV3H 2HRPH 4OZIB 4F7EB 1MWAB 3MA7B 2ZUQC 2X4RB 3IFPA 3RVUC 4HQQH 1OGTB 1JRHI 4PB0L 3CFDA 4H5SA 2R0WL 2R1XA 1KCRL 4KRPB 5EU6A 3RTQB 1YA5A 5J12B 3VFGL 4K2UL 4GUPA 1JWUB 1A5FH 5C0EA 2EDNA 3B9EA 3DBXB 3S35X 1HSBA 4MLSA 1KJVA 4APQB 1BPVA 3GI8L 1L7IL 5D9SB 3HG1B 1HYSC 1MFAH 3HUJE 2C7UA 4R9HA 5BOZG 5CBAA 2AK4E 5I73B 1G0YR 2DWDB 1MFDL 4OD1H 2YA0A 4LVHC 1DN2A 4HUUB 3QSKB 2YD7A 1WQVT 3G6JA 2Y23A 1NGYA 1FSKB 5ADOL 3IDJB 4ZYKA 3KPOA 5DURB 4OM1H 4Z77B 5FKPA 2FH8A 2W92A 3RVVD 4FFVD 1A4KA 3K80A 4KK6D 1IBGH 5F6HI 4NBZB 3RAJL 5DMIL 1P69B 2WINB 2B4CL 3EO9L 4DN4L 1CDIA 3GMRB 5DJYA 2Q6WA 1N3NB 2MCG1 3OAYH 4EDWL 1N6QL 4PJ8D 4PR5A 2ICWB 4J6RL 4M7ZB 4PBXA 4Z95L 1JPTH 5JQ6L 1T7VA 3C5JB 4TUJB 4GKNA 3OAUH 1HCVA 3CUPB 2FB4H 3MXWH 3H9YA 1ADQA 3SDXB 1CFBA 4H88H 3ARBA 5JOEA 4TVPH 5HYSA 3RY6A 3O3BA 1JGLH 5KVDL 3RUGA 2FL5A 4CMMA 1TZGL 1BGXH 8FABB 1IAIM 2ZUWA 1JNLL 3KPRB 2FATL 2FEDC 4IJ3B 4JRXE 4NO0B 2D9CA 1FGNL 2DKUA 4Z7UB 4CL7A 1JMXA 2WV3A 4TNVF 3BZDA 1W8NA 3C09B 4A2LA 5JW4M 4RFEA 2V17L 1NH6A 1LO5A 5L8KB 4U05A 3QO0B 2F54E 3CSPA 3DRTA 1AC6A 4KJWC 2ZJSH 3UX9B 2D9QB 1PGRB 1X9QA 4KC3B 3VXRD 4LRIA 3CU7A 2AK1H 5FO7A 3HI5L 4NQCD 3UTTD 5JW4N 2HT3C 5J56B 4EDXA 1Y18B 3FTGA 3BVNB 3MBEB 4RMWA 4FQQA 4QYOB 4F9PC 1IC5L 4HIEB 4Y2DC 1A3LH 2CLVB 2X70B 3VWKA 1U8IB 3FO9A 2IMMA 2MQ3A 3IFNH 2IQ9H 3ZKXB 1QRNA 2DLIA 3GBML 4EVNA 4JQIL 3AXLB 1Z9OA 3ZE1F 1MHHA 1S9XA 5EUKA 4NQDA 4UILH 3RAJH 4OV5B 4JKWA 5BS0E 3X13B 5C2BH 5JLZB 2XQBL 5HI4C 4JKLA 2V5TA 5IBTH 3RNKB 3SDCB 5F1NB 2NMSA 2VTFA 4EN3A 4HMDA 4G8IB 1KJ2L 4BSWA 4UTAH 4IRJB 3S4SA 4LF3B 1UB6A 2Y5TA 3C9NB 2WLYA 3D48R 4U1HB 5GGQL 2DQCL 3MGTB 3V4VH 5EN2B 4BH8A 1WZLA 1MFEL 1PZUB 2CR6A 4P4KA 5KVDH 4YDLB 4R6UA 3MYJB 3VW3H 3QHTC 4F7MB 3JV6B 5GJSL 3PDOB 3MV7B 4YO0A 5GS3A 3RPKA 2XG4A 3ALWA 4PRPA 3EO1A 1A5FL 1ZLSH 5E00B 3QNYB 5E99H 2IEPA 4OCXL 4W81A 3W0WD 1QOKA 3VXME 1WK0A 4YGVB 1VESA 2NW2A 5J13C 1WTLA 5DTFB 4JFED 4CADB 1T0MA 4U3XA 2CJUH 3VMPA 2QKIA 4NHUA 4BJLA 3PL6D 4XC1H 4JDTL 4P0DA 4GAYB 1DQLH 4M4PA 5JQHC 1MAMH 2J88H 4UIMB 4G9DA 5E8DL 3PHOA 3HE7D 5C09A 2YXFA 4ZFGL 1S9KC 4YHIA 2Y5EA 1BVZA 3D85A 1YEEL 1RV6X 3GHBH 1MCWW 1CXIA 3FO9B 4NM4L 3UPCA 1OAYH 4OCSH 3VD3A 4QYOA 4QRPA 3L3JB 5EZOH 3BVNA 4MJIA 1A1MA 1I9RL 2AGJH 3REWA 3G9AB 3WNKA 1KEGH 4WUUB 4Z7VE 2HFFB 1BAFH 3TO2A 3GMMB 3MA9H 2HT2D 1FLRL 4JHBA 3ULVL 3EW3B 2V6HA 4WTZA 2AXGB 1E28B 4ZS7L 5KANI 5DT1L 3ELAT 1XGRB 4L29B 5HBBA 4X7TB 1ZHKB 5T1MB 4Y19E 1UM6H 1NANH 1ADQH 4QOKD 5C2UB 4R7DA 2PYED 3TA3A 3MV7D 4LNRA 5D1QD 4F3FB 1MJ7H 4KTEH 8FABA 3HNSL 1I9EA 2XN9E 1MELA 4AQOA 5ILTH 1OD9A 2FX9L 2BY3A 4KHXL 4GRWF 3MPCA 3EOYG 3B2VH 4QNPE 1F4YH 1U93B 3QO1A 2XWJA 3HTLX 2X4NB 3QA3A 2A74A 4XHQA 1Q1JH 1AD9A 1AQDB 4JVWA 5D1ZD 4U6YB 1DQML 1GIGH 4P9HL 3WBDA 4ZUSB 5ID1B 2ZCHL 5C6TL 1G9NH 4MDJB 3BGMA 5D1XA 3ARDA 5FK9B 1IEBB 4G8GA 4PRIE 5DD5H 3KYKL 1MCPH 4WHDA 4NWTL 4OAWB 3K4ZA 3DRQB 3M17B 4CN1A 4UIMA 5FKPB 1LQSR 5JPMA 3OXSA 4YK4B 5F9WC 3CFIC 2GY7B 4ZYKB 3D0VA 4UILL 4OKDA 5HHVH 5SWZB 2JTDA 5LAXA 1T03L 3T0EA 3I6KB 4OF8A 4DGYH 1T0MB 1N5AA 4WUUE 4Y19D 4F37K 2NY2B 3UTOA 4YDIL 1CGUA 4PJHA 4R96B 3S37H 4ZQKB 1XFPA 3BRDA 2WNGA 3MV8B 1FN4A 3Q6FB 5D5MA 1NCAL 5JA8B 1KJVB 3Q48A 3V0VB 4NO0D 1YPZB 4WJ5B 2OR9H 4HIXL 4NC1E 3CVIH 2X4TA 2CRYA 5C0EB 1EZVY 1Q0YH 4F15C 3KPRD 1TQCC 5D6DC 1RJZB 4M00A 1KB5B 2AERT 3CH8A 4UIKL 5TPWL 4WFFD 5I1CH 1L4IA 2MPAL 4X80L 2DQIL 3SGEI 3VU2A 1BQLL 1I7UB 5IW1B 1CD1B 1YEDA 1MWAA 2H1PL 3MA7A 3UTTE 3DGGB 1U8HA 1R3HB 2C3XA 2ZUYA 4QT5A 4LPYA 4BSWB 3HZMB 1TJIH 3OGOE 2PO6B 4ZXBA 6CGTA 1A0QH 3QDJA 4K71C 1NGQL 2ADGA 5J11B 2VSCA 4LCIH 3S34H 2ZOKA 5JLZA 1NAMB 4RRPA 3DROA 3MRFA 3SDDD 4P57A 1MHHB 1S9XB 4HEPG 4EQ2A 3BSZL 3CJJA 4LVOC 3MJ9A 3ABZA 1IM9A 2PXYB 4R0LC 5EIQA 1G7JA 5ALBL 2H3NA 4NSKA 3MRHB 5D7LE 3VFGH 1PZ5A 3IFOA 4D9QD 3CFBB 3VXPA 3QEQD 5IB4B 3BW9B 4P2OD 5JW5B 4PJXE 1EVUA 3QEQE 4LSTH 1G0DA 1FO0A 3QPQD 4V2CB 3WIIH 1U8QB 1TJGL 3NFSH 4M6NL 4Q0XH 1RHFA 3EYQD 3D3VD 3RKDC 1UADC 2VR5A 4U7SA 3FL7A 1FIGH 5EB9A 2E6QA 3BWUC 1JRHL 4Q74A 5M7QA 1XH3B 3NFPA 4H88L 4HF5H 4HS8L 2ZPKH 3T0DA 2A73B 1CDBA 1F42A 4MSWB 1QKZH 4NQXA 3JVGA 3KPRA 3P4NA 5C7XL 4P4RA 2P8LA 4HCRH 2ED7A 1VSCA 3C6LB 5IB4A 1YMHA 4XNUH 3B6SA 4MAUL 3VG9B 2PUQT 3D87B 2F19H 2EZ0C 4KKAC 4IOIA 4B50A 3JTSA 1JHLH 2WUBH 1MY5A 1T1ZB 3P0YH 1I4FB 3Q1SH 4G6AC 1X5KA 3QEQB 5HHVL 3AC0A 2FX9H 3V52H 4IEFB 4F37F 4YXKH 2XA8H 3NPSC 5DO2D 1RUQH 1UM4H 1U8KB 1H8OA 4HGKC 4ZTPL 3ZTJH 2W9EL 3AROA 4TSAL 2R2BA 9CGTA 2YD8A 1LO2L 4R4FL 1MHCB 4RISH 1XGUA 1QLEL 5IEHB 3VI4F 4U3CA 3LPFA 4CVZA 2WWKO 5LG1A 3EFFA 1MWAH 2AI0H 1KELL 1Q0YL 1RJZA 1SJHB 3IDJA 4L4TE 1DZBA 3DSNA 1WIPA 2HRLA 5ACZB 5HYEA 2CRMA 5D4QA 1HYSD 1AQKH 1PBYA 5FA4B 3C6LD 1DQQA 2UY6A 5J1SC 3MV8A 3TYGH 2JK5B 4JFDD 1N6UA 1FL5B 2R56H 5T5NF 3OX8B 3L9RA 3CXDL 2NY0C 5E4EC 1NGZB 3P4OB 2KUTA 3BKJL 4NN6B 4BUGA 2GSIA 5TF1H 2AQ1A 4X98A 5EU3A 3IDGB 2X4OA 5GHWH 2E7LA 2DQUH 5IJVB 3QUZA 4XVJL 3QFDA 5KS9F 4YBQD 2IALA 4KRMB 2VLME 2VOTA 4S1SH 4F9LA 5DD5L 3BGMB 4OCXH 3SOBH 3AS1A 2FX8L 3HNVH 4E0RA 1LVEA 3IDYB 3SDCC 3MA9L 4E41D 3K2UH 4Z0BH 4EXPX 4MJID 1XGPB 2IAND 3HLAB 4HUVA 4LDOB 3B9KB 1RU9H 3DXAD 5IMKB 3ULVC 2FYYA 2YUXA 1F4YL 4FQ1H 1FZKB 3FRPG 4TPRH 4X7CC 4L3EA 5JNYB 2AKRA 3DO3A 4P5TC 1H3VA 3QJFB 3VWJA 3HNSH 2PF6A 4Y4FC 2EDWA 5IMLA 3O4LE 2IANE 1UZ6E 1RZ7L 3MRCA 4F3FA 1JNHB 5ALCH 5KN5A 3WIHH 3MRJA 4MD0A 3KNBA 3FFCA 4HIJB 4I5BA 3I02A 5D2NC 4I18B 3LSOA 4EBQL 1A6TA 4G80B 4MXQC 1WWBX 5CD5D 3NOIA 5DA4A 3LRSA 3D69B 4PJHF 1Q0XH 2IADA 3MJ8B 1YZZA 5DJ0B 1QFWL 4LU5L 4PRPD 2CO7B 1T4KA 4XH2A 5EUOB 3NZHH 5E1AA 5K93A 5H37H 3QG6B 2HH0L 2JJTA 1TCMA 3DGCR 3MRDB 5DD3H 4CU8A 2V7NB 3IF1B 3K4AA 4ZO7A 3C6SB 4M3JA 3BYYA 5F6IC 3OKMA 1UA6H 1KELH 1ZS8B 3EJJX 3BOVA 3KJ4B 2B39A 4K3HA 4N5EC 3QZWA 3V5HA 2FX8H 2V2XB 3HNVL 3MLPA 3BP5B 4GAYA 2JCCE 3QDMD 2P8PB 4GSDL 1CR9H 4N0UA 1LP9B 5ESVB 3WV0A 2DD8H 3DVFA 1SYVB 3WFBL 5JORB 1R5IB 2X89A 5TE6H 3SDDB 4JCLA 3SE9H 1SMAA 1IM3B 5BO1L 3GMQA 2R2EA 1RUQL 3MJGX 5DD1L 5IEKB 2R4SL 5CEZD 3G08A 4QCIA 2XKSA 3MJ7A 3BHBB 3MQIA 5D7LB 1FLTX 4MQXD 3TWCH 3BI9X 2OBGA 2X41A 5F7FA 2H9GA 4YHMH 3WIFA 3MODH 4OGAC 5DRNB 3GIZL 4LCCA 2FWOA 3S7GA 5ITBH 4NO2A 2K7PA 4NYLB 4YEFA 2NLJB 3QIBC 5GIRA 2ED9A 4R3SA 3O6ML 3PNWB 3D25A 1N7MH 1DDHB 2BFVL 3SKUD 1T22A 3KPTA 3IXAB 3TC9A 1LHZA 1OLZA 1TETL 2F8VA 2WBJB 2Q8BL 2B1HL 2E9JA 3PL6C 5EPMB 1SY6H 5ITFA 5IV2B 4OZIF 2BC4A 2NY6C 4LF3A 4U1HA 5F7MC 1X5LA 4DKEH 3KAAA 4OCLC 1VEOA 3TBWB 1BGXL 3VJ6B 1WEJH 4Z7WE 4HZLA 5E24E 3NPZB 25C8L 5FYJD 4ODTH 1XF5B 3HR5A 2VE6B 1U8OB 5KSUA 4OV5A 1OGAE 5TF1L 4FQXC 4L8BB 4FRWA 4G6JH 4AEFA 1CLOL 2YUZA 4K8RC 3SKMA 3L5WA 1S9WA 4PJ7E 5T33H 3ES6B 3RZWA 1WSST 2IBZY 3I2CL 3KPSB 2ZCKL 1F11B 1Y6MR 1CBVH 5D7LD 2H6PA 5CILL 1AXTL 1MCLA 2ITCA 4WFEE 1D9KA 3W5NA 5FUZH 3BAEH 3I6GB 1ITCA 1OW0A 2EH8H 1HHJB 1PKQA 1RQ5A 1IGYB 4ZFZA 4O58L 3CVHA 2DIBA 4EN3C 1DBBH 1K6QL 5JR1L 5C0AA 2I60L 3HFML 2NY4C 2Q7NA 3ZL4H 4Z7UA 3DUSB 2DIAA 5DQDH 4NKIL 3CFCL 3MBXL 4OJFL 2I25N 1GPOL 1QFOA 4HT1H 4TSAH 1XMWA 3UDWC 1JYVA 1ONQA 3GJFB 1MCSA 5HY9B 4P4KC 4DTGH 5FUOL 3HE6C 1ROWA 1KV3A 1A2YA 1RK1B 3O4LB 5HHOB 3GMOA 4OZFA 3AY4A 3ULUE 1IGIH 1HE7A 2JJSC 4J1UA 4XP4L 1BECA 2I9TB 5HI5D 2EEAA 1ETZA 1QSFB 2VLJB 5CP3A 2YR3A 5J06A 3MACH 5CKGA 3ECBA 4HK3J 4P99A 4PY7B 3GBNL 5EU5B 3UJJH 1JZ3A 1BVKA 4KQ3L 3KYOB 3BZEB 4NRXA 2GT9B 1SHMA 5DT1H 2XIDA 5FYKL 3VI3E 1FGVL 5HYJD 4PJAB 5BW7A 5MP6L 4YDVA 1YQ2A 2B0SL 1JYXA 3BH8B 5I8OH 1NDGA 1JCKA 3PV6B 3KPLB 3UPRA 4OLZL 4MCZA 3C60B 4UQ3A 1JN6B 3W5MA 5E5MB 5CBAB 5IHBA 1UWEH 2WSKA 4UT6H 5SWSB 5DUPL 5CGYC 1IAII 4I1NB 4NM8L 5JOFB 3L5HA 1I8MA 3O8XD 1DBKH 1Q0XL 2IG2L 1RMFL 4PJ7B 2GAZB 4PJ9C 1NCBL 3ORJA 2RFXB 3VGDA 4W4OC 4YPGB 1MRFL 1S9VB 1GSMA 3G5ZB 4LOUC 4UAOC 3QCVH 5HHMD 4PJDE 2HFEB 3WHE0 2PXYC 3O9WC 4Y4FA 4S1QL 1Z2KA 1TJHH 5D7KD 4NWTH 1X6LA 3T4YB 1EEYA 4LGSB 3FT2A 4XPHH 3WFZA 4ZS7H 1H3WM 2XV6B 4N9GB 1FDLH 4KU1A 1I1AC 4NO5B 5I15L 4O9HH 3SDAC 3OKYA 4OFIA 5B39A 3HNTL 4X4XA 3F7YA 4KK5C 43CAB 5DJ2A 3I3DA 1RD6A 5FGBC 2OK0H 4N0CD 3ETBF 5D72H 2V7HB 1NMAL 2BY2A 2HKFH 5I71B 1RUML 5K59F 4IOFD 4DFIA 1AXSA 3VFUA 3IVKB 5DMKB 3NZHL 3LB6C 4WY7H 4Z0XA 2VDOL 3D18B 5F97E 1JTOA 4F57H 2Z8RA 1R6VA 1WUNT 1VCAA 5EZLA 5H94B 5C0GA 1RUKH 3EYSH 4L4VA 4LLVA 1U92A 4K3GA 1B0WA 3GK8L 4HZAA 4XMLL 3B4NA 1DBAH 2ERJB 1HHKB 3BRGC 1NGXB 1WFTA 3MNVB 2R0WH 3WIHL 5F3HB 4DOHB 4TULH 1X44A 5ENWA 2I24N 2EC9T 3EOBB 4NQDD 4YE4H 1MCPL 4OZGA 1LDPL 3QHZL 5MERA 5INCA 3PABA 4N8CL 2WZPD 5EO9A 5B8CA 5I1LB 3Q6GH 2IBGA 1MLCA 3QWQB 5C8JB 3MRQA 1QSEA 3UC0H 4WDIA 3ARZA 5CCKH 3T77A 4MNGE 1NBVH 2W65B 3X14A 4D94A 4LCUA 4C56D 1WZ1L 4MLIA 3WD5L 2QHRH 3B9KD 4JZOA 3UTZB 3OR6A 2ZG2A 4Y5VC 1S7UB 4IMLA 5IBUB 3R06B 4JO1H 1CFVL 1A7NH 2X44D 4WGWB 5I30H 3N1PC 2VAAA 3HZYB 5EG6C 3U6RA 4O9HL 3ARFC 1MUJB 4CVUA 4S0TD 3ZT6A 5ERWA 1DFBH 3QQ4B 2BX5A 4P5TD 3BPLC 4XCNB 3CCHA 2NY0B 1IAMA 2BNQA 1MCOH 4JO2H 1AKJB 4G7YH 2VXSL 3V6ZB 1E6OL 1F3DJ 1X5IA 5AD0B 4QHLA 2UZXB 3E6HB 4N0FB 1H3XA 3GI9L 3TCLB 4BH7A 4XCYA 5DK0A 3R8BB 4HFUH 4DVBA 4GBXD 2EC9U 1K85A 1B3JA 4YHZH 1MH5A 3BQUC 4NGHL 1RZIB 4U1MB 3M45A 4M62H 4PD4K 4EUPG 1NC2A 4KY1L 1C12A 3MRLB 3GBLA 4OF7A 5IBLC 4QY8B 5EO1B 5JOPD 1U3YA 3FT4B 3WUWB 4CGTA 2VDKH 2I9LA 1ZLWH 3T0XA 4LHJB 4HUXA 2W0FB 5HDBF 5I1GH 2Y06H 4F58H 2NY3B 5IVXB 4RGOL 1C1EH 1DLHA 3PP4L 1BOGB 1SEQH 4M1GH 3C5SB 2HMID 4XPBH 5HI3D 4N8VG 3RWGB 2VDQL 2VZUA 3D39E 4GKZB 5DVMA 4L5FH 1HEZB 2DLFH 4DN3H 3QIWC 1XCTB 3MNZB 1XF2B 4CKVX 4L9LA 1EK3A 1NBZA 1ACYL 3SE8H 4LLWA 1OAQH 5EWIL 3O6LL 4YIQA 4YAQA 1T1XA 3OXRA 5J6GA 2AS5M 2VB5A 3QXAA 4ZD3L 2B2XL 2FO1A 1KCUL 4ZFFB 4L8SB 3K2MC 4J2XA 5E6YA 5FYKH 5K9KA 1BFSA 1KJ3L 3MNWB 4O58H 3WS3A 5IMOB 5K33A 2XTJD 1KTKE 5DJZB 2I5YH 3W2DH 1KG0A 4JE4B 1AQKL 4ORZC 4Q97A 1URLA 3GBMH 3QWRA 4D0BB 2VLLA 4LSDA 3GSOB 5JQ6H 1YMMB 4WHTB 3WLBB 1FNEB 1HIMH 1MHEA 3ARWA 4LKCB 4NZUH 4HK0A 4U1NA 1T5XB 3BGFC 4OUUB 2C3WA 2FJGB 1UJTA 3CD4A 2MCPL 1DSFL 4ZTOH 4GRMA 4LP4A 4P23D 4P2RA 3GKZA 4TSBH 3T2NL 4FQHB 1WISA 3TO4C 4TSCH 4DGIH 1PG7L 4WGVB 3FHQA 5E6IC 3MBED 4GAJH 4TQEL 4P5MA 2QSTA 3MJ6A 4V1DA 4FFWC 2BVUA 4OZ4B 4X9GA 4PJCF 1YY8B 1QPPA 2ZUSA 4PTTB 3T4AA 3PHSA 4GG6F 4YJZL 2VZOA 5I8CB 5MEQA 1CIDA 4C4KO 4RBPK 4BK4A 4X9BA 1YUHA 5MENB 4FXKB 5JHDE 2CSPA 2P48B 2VLLB 1F4WL 5FAAA 4M5YL 3DV6B 3MTRA 4MD5B 1NC2D 2JB6A 2Z31A 3MUZ1 5DJZA 3AREC 2FEDD 3M8OL 5LGKA 5D5MF 4PJGB 4YHLH 4FXGB 1HXMB 3ILPB 5TQ2L 2K9UA 3JTTA 1VGEH 1OAXH 1EGJH 1V7NH 4P3WA 4O2EA 4Y2DB 5DR5L 4L3ED 1KLGA 5DDHB 3W11D 1UWEL 1P5VA 1AFVH 4MQXC 1UB5A 5HPMA 1KT2B 1MRCH 1QEWA 5TDNB 4M7LT 3MFGB 3DX9B 4LLWB 4KRLB 4UI2A 4OIIH 1XF2A 1FVDB 2Y9RT 5C6PB 1DBBL 3RWGA 4J3TA 3WFEL 2NYYD 3U0TB 3DMMA 1HOCB 3S37X 3MZGB 2H2SD 3ZE0E 5D2LB 3TBYA 4U7KA 5EO0A 4XNXL 4MXWH 4EIGB 5C0IB 3MCLL 5EA0H 1BIIB 1OSZB 2BVQA 1U3HB 1KLUB 4N5ED 1I9IH 2W1NA 3MRLA 4L4VE 5ALBH 5GRYA 1U41A 4YDKH 3RHWF 2APTA 2OTUA 4NC1C 4UDTB 3VRIB 5E08L 4DUWA 5EU7E 4KTDL 4G9FA 4JY4B 4O4YL 5EU4B 3E6FB 2HLAA 1BD2A 5JZ7D 5TJWK 3T65A 3MGOB 2DDQL 4MHHI 5LQBL 3GSNH 4JAMA 5IB5A 2R23B 4PJ5E 4DKEL 3QUXC 5C0CD 4ZUVB