3QDMD

The complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(26-35)(a27l) decameric peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
195
structure length
195
Chain Sequence
b'QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGGTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qdmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qdmD02
1MCSA 4XNMA 5IJVB 4X5LA 1NDGB 3L5IA 3O3AA 4PJXA 3VU2A 3VCLB 8FABA 1RIHL 3G5VA 3BDBA 5DS8B 3U30C 5D1ZD 1FVCB 4BUGA 1B4JH 5D7IE 1NH6A 1UEMA 1YNLH 5IVXE 4OF5A 3SDYL 1DLHB 4WGWB 3LKPB 3KXFE 4MHHG 1S9YA 3VW3H 2UWEB 1AE6H 1IGJB 3MRRA 1S7SA 3VJ6A 1V3JA 3SKNA 5TQ0H 1N8ZB 4K55A 3TNNB 4NT6A 3DBXA 2KQNA 3RWDA 5BCAA 3IAGC 5C0JA 3PQYA 1Q9LB 2Z93A 1F2XK 3RGVC 2O5XL 1CXHA 2P1YA 4G8FA 3FT3B 1AXIB 3VFGH 5DRNA 1YEGH 3QIBA 3RIFK 1HOCA 3NCFB 1I85A 4JQIL 1IC7H 4H26A 5E8PB 4WI3A 3RGHA 5F7LB 5JUEL 3U1SL 5JO5B 4MXQC 4H1LH 3V0VB 4CU6A 3QI9C 3OR6B 3C5JB 3MLWL 1K85A 5LWYL 1PJ9A 2GJ6E 2D4FA 5ABDE 5CEXB 2DLGA 1PQZB 2VLRB 2PTTA 1ZMYA 1D9KD 3DXAB 3QUXB 1F58H 3UBXA 4X99A 5CZXD 4O51B 4V1DB 1HI6B 3ULVE 3S4SA 3H8NA 3HE6C 1OW0A 2W91A 3I50L 4OLVL 4XVUD 1C08A 4NGHL 3X14A 3MNZA 1KCRL 4R8WH 1I1YA 5H35A 1QLFA 4LPXA 1FFNA 3U46A 3PL6C 2EDNA 1KPRB 2FX7H 1T5XA 4JDVB 3LQZB 2CMRH 5D8JL 5C6PB 1UA6L 1ZLSH 1YMMD 3RPIB 1O0VA 3QUYD 3U4AA 3QJFB 2AJ3A 2ZJSH 3MUY1 2AJVL 4GSDL 3ZE2F 1SJEA 7FABH 2BNRD 4KI5D 1PKQE 4KRLB 4YO0A 1MWAB 4RFNB 1CDGA 5E6IA 2B0SL 2Z91B 4CN4A 5HDQH 1XFPA 2WUBL 12E8L 2Q76A 1TZHA 1U6AL 1Q72H 1DL7L 1PX4A 5D9SA 4UDUB 2I60H 2WAHA 2V5TA 3VFTA 1ZA6B 2F54E 5KVGH 1QR4A 1CGWA 2XN9D 3OXSB 4LLMA 1Z0MA 4XVSL 1J8HA 4PIRF 2A6JB 3LRSB 3OGCB 4G7VL 5FUCC 5D2NB 4Q6IC 2H9GB 3K2UL 5D7LB 4LKCA 2ZSWB 4EIZC 3ARDA 4GQPH 5BQ7B 4YHOL 1LWRA 2J6EH 1T6WA 5D1QA 2HRPL 1T03H 2IADB 1JGUL 3KYNA 4PJDB 2CIIA 3K80A 4RA0C 5IM7A 4FXKA 2ERJC 2VC2L 5FKAB 4M03A 2GUOA 1ORSB 4G8GE 1JGLL 1CIDA 1L9MA 1DANT 4P23A 2HG5A 3VRLF 3CH1A 2J8HA 1WIUA 5BZDA 5C0EA 1J1XH 3AU1A 3IDNB 1J05B 3NZ8B 2XZAL 4QHLB 5D96C 3KLAA 3RNQB 3ROOB 5BJTA 3KWWA 1ZEAL 3KNBA 4XPAL 1U8KA 4JM4H 5DHVB 3VXQB 2VR5A 1D5XA 3Q6GL 2XKUA 5ELIA 5GISH 1QRNA 3O11A 1VPOL 3RWHA 2AEIT 2J8UA 1RZ7H 5C09D 2XV6B 1UH2A 4CVZA 4NO0D 3FN9A 4NKIH 3VI3F 3ARBA 4JHBA 1A6AB 1R3LB 1NFKA 3SDAB 1XR9B 3WXWH 4BFBD 2DTSA 2WBJB 2E9IA 2Y5TB 3FQUB 4L3EE 5DHYB 3T1FB 4HLZG 1BQHG 4P4RA 2FJFB 5F7DB 4X4YB 1UB6A 4KHXL 2W9DH 4X6CF 2E6QA 1V3LA 2QHRH 1EMTH 3BH8B 2R9HC 4XVJL 2DJUA 4R97B 1LK3L 1UM4L 4DKFH 2BHZA 1BQLL 3TNMB 2IH1B 3QHFH 3LKRB 5E6ID 2ZNWA 2VLJA 3EYSL 3G5ZA 4U6YA 5FEBA 1H15A 3WFCL 2DQDH 3HR6A 4LLWA 5C6TL 4P46C 4NJ9H 4GG8B 1RURL 2NW3A 3LQAC 1YN7A 3WFZA 1WZKA 4NQEE 1MQ8A 2H2SC 1C7SA 4XX1G 3QCTH 5C08E 5IB5A 1DBBH 4M02A 2XZQL 4ZFOB 2VDRL 5I9QC 1BAFH 4S11A 2X4UA 2AEWA 2AV7B 2A38A 3RWJB 3FO9B 3KVQA 2FECL 2VH5H 2UUDH 1ZGLA 1IM3A 1XCTB 1B0GB 3Q6FB 3MUHL 3O2DH 5DUBA 3O6FD 2CRMA 2E27L 2C1OA 4O2FB 4XP5H 5DURD 4JFDE 4NNYB 1HHJA 3HNSH 4DK6A 3BD5A 3SDDB 1FN4B 4QT5B 5CP7B 3VG0H 2VUOA 2Z92B 4DKDC 3ESUF 5BV7C 4P9HL 1K8DB 1R5WA 4Z7NE 1U8IB 1NCAL 3WYRA 1LO2L 4ONFL 3T0WA 1XGTA 2H32B 4J3WA 4I4WA 1SEQH 4O2CB 3WKNA 4DVRL 3VFWB 4JPWH 5I17B 4NPYA 5BRZE 1FAKT 4OSUH 2OZ4A 3DLQR 3F12B 1RJLA 5EO9B 4AIZA 3RA7L 2VISB 4WI9A 4MLIA 4S10A 5DHXB 5HYJB 1T7VA 3FT2A 4GAFB 2C4FU 5F1NB 2EIBA 4DEPC 2OTPA 4X6DA 4LCWB 1BLNB 3NZHL 2YPKB 3G5YB 3O3UN 3ROLA 1XF5A 3PHSA 1JUFA 3PDGA 1DQDH 3CFEA 4PJHF 5DF0A 1P5VA 4NZRL 2FL5B 4Z7OF 1Z3GL 2VOTA 2ID5A 1VADB 4Z78B 4E0RA 3ULUD 4MXVF 2Y6SC 5I1DB 1OSZB 2PUQT 2VMFA 3OGOE 4X4MA 4BZ2L 4NN7B 2IBZX 3GBNH 5GGVY 5J3HC 3TJEL 4XPGH 2XQBL 5E95B 3DTXA 2ARJA 3JWOL 4LVNB 5JNYB 5FDWA 1LGVA 3F58H 1N26A 5I8KH 1P6FA 4PV8A 3M8OH 5D2LB 5GJTH 2NY7L 1I4FB 4RRPG 2AJSH 1I9RL 1NGWA 4U2ZA 4BK4A 5CCKH 3QFJE 3BSZL 1OAYH 1W0WA 2Q3AA 1T2XA 3ZKMD 4TUOB 1MRCL 1CQYA 2HVKA 3O9WA 4DAGH 2FR4B 2OTUB 3TJHC 4OF3A 1V3MA 4Y8DC 1EHLH 1VHPA 1QBML 1X5JA 4Z95L 1ZSDA 1OAZL 3HR5B 2L7JA 2XRAL 1W0YT 2LU4A 4YFEA 5E5MB 1BQHB 3LQAH 5FO7A 1H3PL 5INCA 4Z77B 1WWCA 5EOQH 3QCVL 3P9MB 4O9HL 4OD1H 3OB0K 4FA8A 5LBSL 2DMCA 3O2VH 4AZ8A 3TLRA 4U0QB 1B4RA 3ORJA 1MHPH 1JF5A 4APQC 3T0EC 4HAGA 1QHPA 4QRPA 2VLLA 4EEEA 4CMMA 3SBWA 4L4TE 3MTRA 2BY0A 2Q20A 3WE6A 4EN3D 4BFEA 1V05A 5E56A 1RIVL 4UNVA 5IW1A 3B5GA 2A83A 4JHAL 2EDFA 1QBAA 4MD0A 4X80L 4NN6C 5SWSA 4LCIH 2DMBA 5C9JB 5IT2L 5MENB 4NN5B 4WO4D 4HJGA 5H37H 4X9BA 1WZ1H 2IFGA 5E1HB 4Y2DC 1JNHA 4S1DC 4LDOB 5ESAB 3VFMA 1S9VB 2HLAB 4KROD 4PRHB 1U93A 4N8CH 3BJ91 4NM4H 4ESKA 4PJ9A 4JFFB 1CZ8H 1G7HB 3B3IA 4HKXA 4M7KL 2RCSH 3O41B 1QR1A 1INQA 1B0RA 2YUXA 4J7RA 4MVBD 5F7EL 4ZMAT 3G5XA 4Y1AA 4ZFZB 3JTTA 4RWYH 4ORGA 4E5XA 4GRMB 2ZKHL 1IFHH 1EEZB 2ZSVB 5CFHA 1T7YA 1LP9A 4OFDA 3GI9L 3TA3A 4OZGF 1Q0YH 5GGSA 5TF1L 4PJGF 4S2SB 1WEJL 4OZHF 3VXSD 2BVEA 5FYKH 4ZYKA 1J8HE 4M5YH 2VXSH 5IB2A 4IIQB 1QOKA 1Q9OA 4NC0B 3ZYJA 2ZUTA 3IDGA 3IFPA 1FFOB 5KS9E 4RGOH 4O02L 4Y5YB 3BQUA 5JIHA 4KPHH 2OMBA 3KPNB 4QRQA 1N5AB 1HDMA 5BXFA 1QUNA 3CX2A 15C8L 2CKBB 2Q6WB 2UYLB 3IFLH 5LG1A 3L3IB 2P5EA 4PJ7B 4RNRB 2R8SH 4M48H 1P4BL 4LQ1A 4C4KO 1A1NB 3CPLA 2X09A 3CDCA 4LMQI 3HC3H 5E0QA 7CGTA 4KAQL 1MCDA 1RFDL 1WQVT 2V7HA 1W0VA 3MRIB 4MD5A 1YEFH 1N64H 3Q1SL 2JJVA 3R8BB 3VXRD 3DHMA 2D9CA 4YIQB 1I7RA 1R3HA 1NUGA 4FXGB 5DK2B 5H2BA 4YHIA 5KSAD 2EXYC 4G9FA 4M7LL 4X6CA 5EU3B 5FYJH 1LEKB 5CEYA 1BQSA 2Q86A 4K07A 4QRRB 2PNDA 3GUTA 4RFNC 2R1XA 4TUKL 1MIML 2R4SL 1OCWL 4LAJH 4O4YL 2E7BA 5LXGH 4OF7A 5D5MB 5HYEA 1OTSD 4P57B 3QEGL 2ZJSL 5C8JA 3BKYH 1EBAA 4ODUA 4N5EC 2WP3T 1QA9B 2IH3B 5T3ZD 1DQJB 2FNBA 3DUHA 3GSNH 4XP4H 5BZWA 2H3NB 4NOBA 3PV7A 3W11C 5BW7A 4M8QA 3HKFA 5TE7L 5DT1H 1U8PA 4EDXB 1EEYB 5EZJA 5GZOC 1FH5H 3GRWL 2WQRA 1JRHL 3QJHA 3MYJB 2NY3B 4LGRB 5CEZL 2M8XA 5KVDH 4OIBA 1OQXA 1CS6A 3ZDYE 1KBGH 4JN2B 1IM9A 1HHKA 4QXGH 4MJ5B 2MJWA 5ICZA 3VFVA 3KHQA 3P77B 4Y4HA 3GSOB 3MJ7A 3NIGE 4CVXB 5HHOB 1AKJA 2F74B 5DTFA 1N3NA 3L5XH 2C1PA 5FK9A 2CLVB 5F1IA 5LCVL 2WQ8A 2PXYD 3L6FA 5DEGA 4J3SA 5IBTL 3RUGA 3TO2A 4GRLD 1AXTH 4ZUVB 3O3BB 1CF8L 1I7TB 2A73A 3TCXA 3DARA 1R24A 1XGPA 4NQDD 3FB7A 1RUMH 4PJHA 4Y16D 1CGXA 3OKNA 3HE7A 2BFVH 1AI1H 4FFWC 4HFUH 1WBZA 3O3EA 2IEPA 4N90D 1LO4L 4NFDA 1A6TB 1U8MB 2X1WL 4KJWC 3HI6L 5JXEC 5A16A 2A9MH 2BRRH 1JV5B 3DYOA 5EZLA 4XTRC 3QEQD 1BZ7B 3U0TA 5DRXA 3LKSB 3VXNA 4KY1H 1P7KB 1FC1A 1JZ6A 4YPGB 5FUZL 4JRYB 4X6DE 1CTNA 4XVTL 4L8BA 1WVZA 5F7FA 5CBEA 3RVUC 3DV6B 1S7RA 4UV7H 4GH7B 1DUZA 2H2PC 2G5BB 3DO3A 4YHKH 1EMTL 1FG9C 4GKZA 4PRIB 3LAFA 4J4PA 4WV1A 2ZCKH 4L5FH 3KS0J 3CXHK 4Y5VB 4QOKD 3O6KH 1NMCC 4KK8C 2OL3H 4OM0H 4XGZB 3S35L 5EOTB 4X4ME 4WRLA 2YD7A 3D18B 1T3FB 1WAAA 4JAMA 1D5MB 4LIQH 4WTXA 5I30L 3FONB 4PJ8A 2R0WH 5ENWB 3RP1A 4NKDA 3LOWA 5DD1H 3TCLA 4ZG1A 3SDDC 1FVDB 1RSFA 4NUGL 1MF2L 3BGFB 5CGTA 4POZD 1PFCA 3GFUA 3RQ3A 3EYVA 4KK6D 4I5BA 5KSBE 2A74A 4WUUE 1IGIL 2A0LC 4TQEL 4JKMA 3BZ4B 3VXUA 1JNLH 2I5YH 4NSKA 2A6IA 4TRPL 3AXLA 3KPRD 1TJIH 1HN1A 3QIWA 1MAMH 1NBQA 1QLEH 2FEDD 2LFGA 1CLYH 5FM5M 4XP5L 2X1PA 1KIRA 1OP5H 3Q5TA 3IETA 4Z8FL 4PJFE 1S5IL 3D69A 4D3CL 3DSNA 3FFCD 2CDGB 3IGAA 4M1GH 4U6XB 1A1OB 3RBSA 3SY0B 1C5CL 4JFPA 1EFQA 3JUYA 3QPQC 2JIXA 3NACL 5DHVH 4QRPE 3U7YL 3MV7B 3QDGD 2FRGP 3GSQA 1DUYB 4XXDB 5JIKA 1AR1C 1M1SA 1I3UA 1KG0A 3H9ZA 5SX5K 4XI5D 3OF6A 5E5RB 2AXGA 5SWSE 3KG5A 1SMAA 4RFEA 4JO3L 3UTSB 5E8EA 4R2GD 2HFEB 4PJGA 1EDQA 5F88B 2N56A 5GGQH 5D1XA 4MAUL 4NQCD 2VE6A 4PJAB 2HT3D 3S98A 5EUOB 4ZOCA 3BI9X 1T5WB 2R29H 4MNQA 4F8TA 1IAKA 1MJ8H 4JPVL 4U0RC 3U0WH 1J88A 4HDIA 5ALCH 3RL2A 3O6LL 3TO4A 4ZPTA 4Y1AE 3UMTA 5HYFA 1GJIA 3EUUA 3IXAA 1CG9B 3RWGA 1GVIA 1TIUA 5FA3A 1A9BA 3CSYA 4HGWB 1LP9E 1P1ZA 1MRFL 3MRGA 4R96A 4I9WE 3MBEA 4O58L 5DJZB 3QIUC 4URTB 2Y72A 1MY7A 1S78D 2QSTA 3VE0A 4PGJA 3LD8B 1OAYL 4OB5L 5E03A 3WUWB 3WL9A 6FABL 1U8OA 2GHWB 5IFHL 1RQ5A 3U2SB 2V2TB 3WNLA 1NFDA 1BBDH 4FFZL 1J0KA 3E6FA 3V6OA 2EC9U 1TVDA 4HQQH 1S8DA 1ZWIA 4CNIA 5JR1H 4PJCF 2VTFA 4MNGA 2YPLD 4JPIB 1XGUB 4L3CB 1BD2A 3L95B 3NFNB 4PR5B 1MHHB 3TGXA 1F11A 4G6FD 3MACL 3O2VL 1ACYH 2XPGB 3MGOB 4XP6L 4PREB 3CC5A 2PN5A 1OM3L 1KJ3H 4YE4H 5DZNA 2P5EE 5J9PA 4CMHB 1M6OB 3HC4H 2NXZC 4K71C 4H1LA 1FDLL 2BX5A 3ZE0F 1X5IA 4OLXL 1MVUA 5EH1A 4ZAKA 3GSUB 5F89A 5C07B 3QXTA 2CKNA 4WFED 4HS3B 3NPZB 1ED3A 4PLOB 4ZUUA 2OR8A 1KCLA 4ODXB 4BFIA 5BV7L 5JLZB 2WW8A 1DQMH 4LMQE 5JW4N 1BP3B 4XWGH 2GTWB 1MCNA 2B2XL 4DOHE 1AP2A 4Y4FA 4G9FE 4X6CE 2QQLL 1EBPA 4NKQB 4N0YL 1BZ9B 4WFGD 4GW5B 2IJ0C 4LPYA 4NRZA 3DRTB 3QQ9C 3QNYA 3DYMA 3ZE1F 4R3SA 4PLJD 1R0AH 5J89A 1GGTA 5DD3H 3BW9A 4QHKJ 3SKJL 3C8DA 1CGSH 1NUDA 1YEHL 2NX5B 4PJBF 4R7NA 3UTQB 2HKFL 4HX1B 5E8DH 1NC2D 4K7FB 4MWFA 2BNUB 3L5WA 5IHUH 2JK5B 3MJ8B 4FZEL 3UROR 4PGBB 5AG8A 5B38B 5EFIA 3ARUA 4QRUB 3WJJA 3SCMD 5IWLC 2GW5A 2HT4C 4WEBL 3MFFA 4X8XA 1LD9A 3RTQB 3BZFB 3TM6A 1M7DB 4LSPH 2HH0L 1TVBB 3PE9A 3THMH 5T1KD 5MHSE 5GRVL 2KUTA 3W5MA 1IILE 4ZS7L 3T3ME 5SWQB 4NKMA 3QEUB 4HLZH 2COQA 4F9PA 2DYPD 3GRWA 2E9JA 1ORQA 2IANA 3CH8A 1YPZB 5KG9B 5KW9H 2QEJA 3BP4A 3VRJA 1YZZA 2GJ6D 4XMKL 4YEEA 1PSKH 2XNAA 2YEZA 3HC3L 3DX8B 2J6EA 4K3DH 4DN3H 2OJEA 1OT2A 3RUGE 4N0UB 3B2UD 2ENSA 3JTSA 3NFSL 5D7KD 2NW2A 3ULVD 3P4NA 4GT7A 4GRWB 3PWVB 2DQHL 3RGVA 5K9QI 3HMWH 3WO4C 3G6AA 4BH8A 1P2CB 3FO0H 3GB7B 5HPMB 5FYJL 4HF5L 4Q97A 3MLSL 4QHUA 3U79A 3BKCH 5ACZA 1MFCH 4JO2L 5BS0B 1MH5B 2D7PA 3N1QC 4PD4J 4YPJA 4JR9L 1I1AD 1UADC 3HZKA 2YBRB 4FQXD 3BEWB 3BO8B 5D93B 3FB5A 3GMNB 3RZCD 3QQ3A 1NAKL 5ERWA 1WWAX 4MX7A 4OT1H 5B22A 3O4LB 5IUSA 3OJVC 2R0LL 5HGHA 1PY4A 3SE4C 1KUMA 3HE6A 4A6YH 4FNLH 5GGTH 2UZYB 5ID1B 1EAPB 5EWIH 4HWUA 4U6VL 1N0XH 4IDJL 4MA8L 3QH3B 3O45A 4RA3A 1TZIB 1ZTXH 1I8KB 1PEWA 4R4BB 1SBSL 1AHWC 3PL6A 4FZ8L 5K9OA 2F54D 4YXHL 5LAXA 1WAAE 2F53E 3I2CH 3LIZH 3SOBL 2FLBT 2VDOL 5ID0A 3ALPA 5GRUL 1DE4A 1JGVH 3WNKA 4WHTA 2GITA 1A0QH 4IOIB 4YH6A 1GHFL 2DQFA 4W6XB 3MLRH 4EQ3A 1WBYA 4Y19D 1A7RH 4K23L 1BFVL 4Z76B 4KK5C 5F97E 3TZVD 1IEBA 4MYWB 2EKSB 3CU7A 2CKBH 3MR9A 4PJIE 3HAEG 2AK1L 2ZUUA 4LFHG 2W9EL 3VXUE 4RQQA 1U2CA 4KQ4L 4GAGL 3S34H 4AL8L 4IMLB 2DQEL 4PJ5E 4WJ5A 4GLRI 3QG7H 1NBYA 2J4WL 5FFLA 2XTJD 1IGTA 3M1BA 5EU4A 4Q2ZA 4QHMA 1FZJB 3NABH 5F3BB 3FN0L 3BRGC 4FTVE 4ELME 2YD6A 3T4AB 4B50A 1WWWX 2VXUH 3CVHH 2QLVB 3EAKA 3CXHJ 4Q6IA 4MQTB 5B8CB 1MFBH 1ZT7A 2WP3O 3MA9H 5CZVH 2DQCH 5IKCB 2ZOLB 5DJAA 1QSEB 3G04A 2F8OA 5K33A 3V0WH 3OKMB 1S7VB 4JKKA 1ULVA 3D0VB 5T3XL 4Y5VC 1TFHA 4K8RL 4QGYA 1DJSA 4G6JH 3C60C 5DJ8A 5ETUB 1PZ5A 1VGEH 1FYHB 1A7QL 1INDH 3MBXL 1YNKL 3T77A 4R6UA 4UNUA 3QAZC 1RD6A 2X7LA 1II4E 4MNQE 1WC7B 3BGFC 2NNAA 3N9GH 1AQDA 5T5FH 5DUPH 5JHLL 2EZ0C 1FNSH 4OIIH 4Q74A 3D3VA 4ZO6A 1AJ7H 2VITB 1XF3A 4LU5L 1DEEB 4AEFA 4NRYB 1R3KA 4PJCA 5F9OH 2ZCLH 1RU9H 4KWUA 4ZTOL 4W81A 3F7YB 3I6KB 3KPOB 2X70A 4H5SA 1DBAH 3GMMB 5IOPB 5HYQB 2NLJA 1G7IA 4M6MH 5GJSH 4EUPG 2NYYD 3VFNB 1LO3H 1L7TH 4PJEF 1IEHA 1K4CA 3WIIH 4HZLA 4NQED 5TE4L 3C2AL 3VXTB 1U91B 5D7IB 1GGBH 5C08D 4ODSH 3HS0B 1QLEL 1EHXA 2ADIA 1NFDE 3OKOB 1J0IA 2HYMA 4ZUTB 5ILTH 2NXYD 4HV8A 3V6OE 2X4TB 2ZCHH 3KXFB 4FG6C 3NN8A 4AENB 4TNWF 3W39B 4PYHA 3O8XD 3I75A 2J5LB 5DQ9A 3TIEB 4UTBH 2VXVL 1BD2E 3IAQA 3ZYZA 5IMMA 2BC4A 1OP3H 1CVSC 1NL0L 4OCRH 3JZ7A 5I1CL 2F5AH 4GO6B 3LDBB 3RWCA 1BPVA 1P9MC 3CCHA 3WSQH 1IJ9A 4HEME 5EPMA 2BVQB 1WUNT 3S3JA 1CBVL 3QWRA 4BYHA 4LNVA 2XACC 1MUJB 2XYCA 3L3KA 3DURA 2ICEA 4PJBA 2ORBL 1G9NL 2BSTB 4BSJA 5I8CA 3V8OA 4YZFF 3B2VL 5F70A 3UTTB 1A3QA 3CZFB 4AEEA 3C2SA 1CFSB 3AY4A 1OTUD 5EC1A 4F7TB 4PGEB 5GGQL 4GKNA 4OFIA 3VGAB 2H26B 5JPNA 3MNVA 4P3WA 4MB5A 4OGAC 3BDYL 4J23A 5GSVB 1A6PA 4P5KA 2P7TB 3D39E 3L3HA 5D6CB 1CU4L 1OGAE 3Q3GB 2VABB 1J86A 3ETBF 4N68A 4NJAL 3PXHA 3SJVD 3V6ZB 4DQOL 2KH2B 1T66D 4C54A 2F15A 3SQOL 5T1LA 1WCQA 1E6OH 4WFFE 4I0PD 3GNML 5FYLL 2IPKB 2NZ9D 3V4PH 4KKAC 4JY6A 3WD5H 2GEEA 4ZFGL 1PYWA 5TQ2L 4OUUA 2VDKH 3MZGB 4Z0BH 3GJFB 3QFJD 1PKQB 2FBOJ 3WMSA 2H45A 2R69H 4GG6B 4F7CA 1NSNH 4JFED 1XR8B 4PLKD 4R7DB 4ETQA 5JZ7D 3BN9D 4FN0A 3DSFH 3HUJB 4LEXH 3MO1B 2IANE 2HFGL 2PETA 2YUZA 3I85A 2AV1B 4OAWA 5DO2C 3D85B 4L1DA 4WU5A 2CLZB 4BQBA 2DI7A 1CN4A 3MA7B 5FO8B 3MJ6A 5FKPA 1ES0B 4QNPE 3UC0H 3C9NA 3KDMB 4HJ0D 4WI2A 4X8JA 5B39G 2MNUA 1JTTA 1KJ2B 1UM5L 5I75B 5IFAL 5J1AB 4L4TD 1GCFA 5GGUA 3PGFH 1JNNL 5LQBL 5I1KL 1GC1L 4GAJL 4G8GB 4LCUA 1S7WB 4UU9A 2D0HA 2GJZA 3DGGB 5HPOA 4PB0H 1D5BB 3SDCB 1UWXH 1R0AL 2GAZA 5DD3L 1DQLL 5CD5C 1EFXA 1UM6H 5HGAA 3CFKA 5EIQA 4RIRA 1W72L 4APQA 1FYTB 2N1KA 3U9PH 2GK0A 2PO6D 4F7EB 1OAKH 1HKLH 4XNXL 5SV3A 2NY6D 3QXDA 4HBCH 1TJGL 2AJUL 2Y4SA 2V2XA 5T1LD 4U1LA 2UZIH 3GSNA 3IDYB 2LQRA 4UTAH 4Y2DA 5DYOB 5DK0B 1GAFL 1GGIH 2KZ1B 3ARGD 3MRNB 1ZHKB 4L3EB 1HH9B 4M43H 4GMTH 1ZT4A 4R4FH 4LLQA 2BXZA 1IAOA 4GBXC 5D1ZB 1DVFA 1N8ZA 4ZO8A 2J8OA 4JVWA 2BNQA 3K2MC 5J12C 1TPXB 1A3LH 4Q9QH 4EJ1C 2AAVA 1CFVH 2EO9A 3TN0B 5KSVB 4LEOA 1ETZB 1CR9L 5ANME 5HGDB 5K9JH 5EBWB 1JI1A 4DN3L 5E8PA 5C3LD 4ZO7A 3X12B 3FB6B 5I74B 4B7LA 4GKOA 1S7XB 4LPVA 1QLRB 4KK9D 5GZND 4X98B 1J18A 2Q3ZA 2X4RB 3SKOB 3G08A 5F6IB 4XP1L 2HTKD 4P5MA 3DRQB 4X5XA 3LSOA 5FUCE 2NY0B 1G7PB 3MRFB 35C8L 5KJRH 5T1DL 2RIKA 3IF1B 4J3TA 4QTIL 1Z0NA 1XCQA 1FSKB 4JANA 3U4EA 5KTEL 4YK4B 4JFDB 1QSFA 5I1IH 5IQ9B 2AS5M 5DMIL 2YXFA 5KZCB 1N6UA 3QDJA 2X1XR 2AEPH 3KJ6H 1YEEH 3EYUL 3OKKB 4AH2B 5L2KB 3O6MH 5IG7B 1HXYB 1RZKC 4YWGH 5D6DC 1NBVH 2RHEA 1E0OB 3QUZB 4MCZA 5BRZB 2JCCB 2PYFB 1N0XL 4EI5C 5F9JB 1IQDA 2PYED 4Z7WF 5HHME 3NBNA 1FRGL 3D3VE 2NY4B 1DDHA 4G5ZH 1CDUA 3RWIB 4KVCH 4X9FA 3E6HA 3GSRA 3QUYB 5A3IC 4S1QL 2A9NH 1XF2A 4KKLC 3TYFA 3MROA 4LLAA 3EJZD 2FIKA 2DWEA 2C4FT 2OL3A 4XNMB 2Z8WC 1S3KL 2WWMD 3O3AB 4PJXB 4NQSA 4HJJH 8FABB 4M3JA 3G5VB 3MLYH 4HXAH 3BZEA 3RL1A 4Q7DA 5B8CC 1HZHH 3CVIH 1MNUH 4NO2A 3LHPL 3MSPA 3EOTL 4EI6A 3P30H 4QXUH 4ZTPH 2WMPA 4AIOA 5JOEA 1CGVA 4MB4A 3ES6A 1H3UA 5A2FA 2RFXA 1S9YB 4FHBD 3MRDA 5E9DA 3NABL 3MRRB 3VJ6B 1S7SB 3SKNB 1MCWM 5ACMA 2NY2B 4EBQL 4NT6B 3DBXB 3CVHL 4Z7VE 1J5OH 3RWDB 4MHHI 1IGYA 3BPNC 1BM3H 3RIFF 2GKIA 5C0JB 3PQYB 4LCYA 2Z93B 4PRPA 4J3UA 1QQDA 4G8FB 2D7NA 5C1MB 5DRNB 5ADPL 3QIBB 3X3FL 1HOCB 1Q8MA 4XPFH 4H26B 4XPHL 1F6FB 3MJGX 1TJHH 1F90H 2APBA 3I02A 2EE9A 5FYJU 2PTTB 5DSCA 4HH9A 4BZ1L 3UBXB 4X99B 5DJYA 1KCUH 3OXRA 3P4MA 1M7IA 4OF8A 2APTA 3L9RA 4YXLL 4OZIF 5C0BE 3H42L 3S4SB 5IHLB 3W82A 3MC0A 1K3ZA 1T2JA 1C08B 2DMKA 3X14B 3MLZH 4LGSB 5BVPL 1AJ7L 3BPOB 5I19H 2PTVA 3MNZB 5E2VH 3K4DA 1I1YB 2YS4A 5H35B 3AS1A 3BP5A 2F8XC 4K8RD 1QLFB 3ZDXF 2YWZA 3MCG1 2ATKA 1FFNB 3CLFL 3U46B 5L6YH 1AC6A 1CXKA 1T5XB 1RZKH 3TH4T 4KQ3L 1YYMH 4LSRH 1LO5A 4MJIE 2PW2A 5E08H 1QSZA 4UV4L 1U2HA 4ERSH 1IC4H 5JQ6H 2AJ3B 1CDIA 4YNYA 4IRSC 4LQFL 5FCUL 1LEIA 3LDBC 2XXCB 1A9EA 3HFMH 1SJEB 3T0BA 1UYWH 5I8EA 5J6HA 1BF2A 5DC4B 1QNZL 4WI8A 4LNRA 4WUUD 2DLHA 4W70A 4YO0B 5FYKE 5E6IB 4ODWA 1I3VA 2Q76B 2HAZA 1SY6H 1TZHB 5D9SB 4L4VE 3VFTB 5A2LH 4FRWA 4MS8D 3QEHA 3OG4B 4TYUA 3BJLA 4H20H 4LLMB 1J8HB 1ZGLP 4K7PX 3VGAC 2EIEA 3G6JE 2R1YA 4NUJA 1ZA3A 4EKXA 1OSPH 3O3DA 1XIWC 2G60L 3VMNA 4YGVB 4LKCB 1MI5D 2V5MA 3QNXA 3ARDB 2VDPH 1NKOA 1JPGA 4HK3J 4OD2A 4E42A 4OLUL 5D1QB 4HUNB 3CJJA 3GK8H 5F7UA 3KYNB 3W0WE 4HIXH 4X7SL 2CIIB 3VFSA 5IM7B 4FXKB 2GUOB 3G9VA 2BY1A 4YDKH 1G7LA 4YHZL 4IRZL 3V7MA 4P23B 2HG5B 1F42A 4KU1A 3CH1B 4K3JL 2D7TL 1SVZA 5FIEA 5FYJE 4DUWA 4UNTA 5C0EB 5BZDB 3AU1B 3QCUH 1BJ1J 2I9TA 5GPRA 2Z31A 2VZ3A 4LBEA 3KPSA 3ZKQD 1U3ZA 3KLAB 5D7SL 3T0EE 1BIIA 2JB5H 5BJTB 4L3AA 3KWWB 3KNBB 1U8KB 1MCQA 4D9LH 1E6OL 4XP9L 3GSVA 4YDJA 4RAVA 3IDMA 1IQWH 2MPAL 1D5XB 4YBLC 3RHWK 3C5SA 5I0ZA 1MJJA 1QRNB 1JHKL 3O11B 3RWHB 4CJ1A 1W72A 2J8UB 3GSWA 5DVMA 5FM5O 4TOYL 3RDTD 4DW2H 1B6UA 4WIQA 4CVZB 5CIPB 4LP4A 5C71A 3ARBB 2YKLL 3A67H 1J1OH 4X4ZA 1A7NL 3P0GB 4OLYL 1GZPA 2XKSA 3BPCA 2UWEE 4P4RB 4Z7UF 3B9KA 2YMXH 3PP3K 5HGGS 1TCRA 3BZDA 1TTUA 5MP6H 3TYGH 2OQJA 1UB6B 5FYLD 2BNQE 4N9GA 5C86A 1FLRH 3GMLA 5DUMH 5GRWA 5JA9A 1KN2H 3TVMA 1FGNH 4UOW1 4XHJD 5JHDA 3TFKC 3QQNA 1K4DA 4RMRA 2GJJA 5JW3H 2VLJB 3G5ZB 4U6YB 2QQQA 2X4NA 1SHMA 3QIUA 5SX5H 4LLWB 1QACA 3RKDC 1M71A 1IKNC 3QXWA 2NW3B 3S96A 5IF0A 1YN7B 1CLZH 3FHAA 4YBQC 1H5BC 1BWWA 1ZVYA 3CUPA 5IB5B 2WNGA 3DXAE 5IVZA 3PGFL 3MZTA 2X4UB 3D48R 2DQIL 1KCVL 4V1DE 4R4NC 1EEQA 1UWGH 2OLDA 1ZGLB 1IM3B 2AXFA 2XFXA 3H0TA 4WWID 3KLHD 5DUBB 4U2YA 2LTQB 2Y9RT 1OPGL 2ADFH 2EE6A 2C1OB 5BMFH 1U3HD 3HAEH 1HHJB 4LDEB 1G0XA 5MEPA 3MRHA 1BFSA 5JIIA 4OQTH 3NA4A 4KJYA 4OLWH 3MUJA 1R5WB 1JP5A 3ISWA 2QSCL 4EN3B 1XGTB 2QQNH 2XXMB 5ALBH 2LAAA 3S36L 5FDYA 1T1XB 5DJ6A 1ZLWK 4I4WB 1HKLL 1N59A 3UPRA 3ARSA 1ACZA 3MLXL 4ZXBD 2UY7A 1XEDA 5D1ZC 4NPYB 1Q0XL 3ARED 5C3TA 3AC0A 2NY5L 1TETL 2DLFL 2NY1D 1HEZA 1RJLB 2WV3A 4NWUH 4AIZB 1NLDH 2UZIL 4FS0A 1UENA 3FT2B 4UTAL 4EZMA 4A6YA 3WHE1 1WBXA 2KPNA 1S7UA 2FGWL 3EYFA 5GRJH 4M62H 5TPWH 3GJFH 4X6DB 3EFDL 4RFOH 4KRPB 3ROLB 1XF5B 1JUFB 1R6VA 1JPSL 2VZUA 3CFEB 4DGVH 5IHZA 3E3QC 5F6IC 5MHSD 2D3VA 5CP3H 4E0RB 5C92A 4LIQE 3OX8A 5D2NE 2Y07H 5TJWK 5D7LE 2PTUA 3ZKSD 3DTXB 2ARJB 1KLFA 4M1DH 1TTGA 4OLZH 5FDWB 1J12A 1G1CA 1RIUH 4XCNA 2MFNA 4NFCA 4YK4C 3W9DA 1D9KC 4PV8B 4YDIH 2DJSA 3F62A 4K9EH 5E9DE 2E3VA 1HQ4A 3QUKA 1HYSD 5CZXC 1NGWB 1DANU 4OFVA 5IWLA 1Q1JH 3NMEA 1QG3A 4KUZH 5DD0H 3EZJB 4OZIA 1W0WB 3RVTD 4XRCA 4PY7A 1OAXL 4EUPH 2HVKB 3O9WB 1F8TL 3DMMA 1QYGL 1MY5A 4P5TD 1NCCH 4OFYA 3U4BH 1PVHA 1ZSDB 1JZ8A 5ISZA 4KTEH 4MGXA 3CVHA 4DWHA 1TZGH 5FO7B 4F9LC 1CLOL 5CHNA 4NZTH 5INCB 4YLQT 4WFHE 4P3CL 3HNTH 4J12A 2J2ZA 1MCBA 5CILL 3LRGA 1J1PL 2CDFA 2XZCL 3QUYC 2G5RA 3H9YA 4YWGL 3GBMH 2CXKA 3HMXL 5KSUA 4QRPB 2VLLB 4CMMB 1YEJH 1OQOA 4YFDB 2YD5A 4KI5C 3WE6B 5E4IA 2F5BL 1QA9A 4LVOB 2A83B 1GZQA 3A6CL 4GMSH 2FWOA 2Z8VC 4MD0B 2D4DA 3IKCA 5SWSB 1E4JA 3QRGH 4YXKH 4AEIL 2H1PH 4HJGB 2VDQL 2DQGL 3BKMH 4JY4A 5F6HJ 1BREA 3DX7A 5C0CD 1JNHB 4H8WC 3I9GL 5LJYH 3VFMB 4UMGA 4XMLH 1U93B 1FORL 1QFOA 5CGYD 4PJ9B 4CN6A 3B3IB 4HKXB 3W5NA 1QR1B 1I9JL 1INQB 1B0RB 3L5HA 1AFVL 1EEUA 1HZHL 3C87A 4U7MA 1MNUL 3G5XB 3SE4A 4FQLH 3JTTB 2J12B 4ORGB 4E5XB 2IF7A 2ESVA 4JDTL 1LP9B 3TA3B 4EVNA 3QIBC 4MAYD 2BERA 3EDFA 3NCJL 1OARL 5GGSB 1ADQL 2VQUA 1BX2A 4PJ5D 4BSWA 3UYOD 2BVOA 1AHWA 3KGRA 5F72S 4ZYKB 1BM3L 5KVFH 4WW2F 5IB2B 4DGIL 4FTVD 1Q9OB 1FL3A 2X4OB 2DQTH 3H3PH 2EEAA 5DVLA 3IDGB 3IFPB 1ND0A 3V2AR 4KUCF 1U0QA 3OBAA 3FQRA 2APVA 4ZODA 3BQUB 1JZ5A 3DMMD 1TJHL 5CJOL 4QRQB 1MFAH 2CJUH 1U92A 1HDMB 3K3QA 5BXFB 4EQ2A 2Z4QB 1Z9MA 2EC9T 1BVZA 5E2UH 2B5IC 5ADOL 2P5EB 4OBSA 2AJYL 3CPLB 5KANI 5DLMH 4C55A 5CINL 2BDNL 1A6ZA 6CGTA 5E1AA 4Y16B 1UEYA 4K2UH 4HIJA 4NCDA 1CLCA 3W2DL 1MRDL 2V7HB 4LSQL 1W0VB 4MD5B 4Z7UA 5AAMA 1OB1A 2FSEA 3T4YA 1RHHA 1EGJH 4F37K 1I7RB 1R3HB 3KPSE 5H2BB 4DOHB 4G9FB 3LPWA 4X6CB 1N5YL 1FFQA 3BUYA 5CEYB 4JHWH 2Q86B 2MQ0A 3NIFE 3GUTB 2R1XB 5E6IC 1F4XH 3ARQA 5IQ7H 1KELL 2VJXA 1T7XA 2HKHL 3C60A 1L4IA 4RGND 1G6VK 5DFTA 5C8JB 3T0VA 1QO3A 3B4NA 4JJ5A 4NKOA 4ODUB 4ACPA 3FZUC 3UJJH 3E8UH 2VQ1A 3PHOA 4F57L 8CGTA 4Y4KD 1W8OA 5D2LE 3CFBA 2WK2A 3P11L 4JE4B 4H8WH 5BZWB 4E41A 2HJLA 4EOWH 3V4VH 2X2YA 4M8QB 1IGCH 1U8PB 4PV9A 5IB1A 5EZJB 3O6FC 1A1MA 3NIDF 3IS1X 1YEIL 3EYQC 3GKWH 3V52H 2CUMA 3C8KA 2D0FA 1NDMA 2VQTA 4UT7H 3QJHB 3STBA 3G6DH 1ZOXA 4X9GA 1NCDL 2FHBA 4U3XA 3DUUA 3VWKD 1WZLA 1WIOA 2BJML 1OGTA 1YJDL 4UT6L 2VDPL 2OP4H 1IM9B 1HHKB 4EIGB 3VFVB 4JKPH 4G42A 5EU7C 1A2YA 3GK8L 1A1OA 1KEMH 4Y4HB 5DA0B 3MJ7B 4HIXL 4DCQA 2BSRA 2IG2H 3MRJA 4CADA 1GGCL 1AKJB 2VYRE 5DTFB 2B4CC 3P0VH 1N3NB 2C1PB 5LGJA 5FK9B 5F1IB 3QWOA 1T4KA 3L6FB 3CK0H 4MQXC 5I66A 5DEGB 32C2A 2EDHA 3RUGB 4ODVH 3TO2B 3OB8A 1IE5A 5F3HA 3I6LE 5MENE 2A73B 5EZIH 1HHGA 1R24B 3IT8D 4JM2D 1XGPB 4XX1E 3FB7B 1KIUA 2VXQH 4PJHB 3EGSA 3D39D 3OKNB 2CO7B 3HE7B 5HDBF 2OJZH 1F4YL 4AEHH 3KR3L 1OGAD 1JTOA 2EEDA 5HDLA 3ULUC 1RVFH 4HS8H 5E00A 3STZA 1WBZB 4KZEL 3MJ9H 3O3EB 4JB9L 4DJMA 2DDQH 4XNYH 3H2WA 5A16B 3OTTA 3R0NA 4HUMB 1F4HA 2FH8A 3PDDA 5EZLB 3OJDA 4HAFA 5JDSA 1KTRL 1CE1L 3U0TB 5DRXB 3VXNB 2GY7B 1D7FA 4XCFL 3FB8A 3WNOA 3T0DA 3QDMA 4L8BB 1QPPA 3ZKMC 3V0AC 5MP6L 5CBEB 1L6ZA 4OJFH 1S7RB 5E2JA 2IFFL 5HI5D 1DUZB 4GKZB 4WV1B 5F6HI 5BO1L 2FGZA 2JJWA 4ALAH 1UGNA 5AG9A 2W0FB 5FA4A 5H94A 5E2TL 1QFUH 2EE2A 1I3GH 4JAMB 3D2UA 3K4AA 1JPTH 4PJ8B 4M9OA 4ODHL 4NWTL 1KYOK 5D7JA 4NKDB 5TDNA 1FP5A 4WUKL 3TCLB 2HWZH 4JREC 3QXUA 1HCFX 4UT9L 3OHXA 1NCBL 4KV5F 3EYVB 3SGEH 3VMOA 4I5BB 1KCSL 2A74B 4I2XA 1IL1A 4EN3C 3VWJD 5I1EL 3VXUB 4NSKB 4X9HA 2A6IB 3BE1L 3AXLB 3Q5OA 2P4AB 3QIWB 5L88L 4Q0XH 4Y89A 1H8OA 4GXVH 4WO4C 1KIRB 3GMQA 3WKMH 3FAWA 4ONHA 1N6QL 4KFZC 4MJ2A 2OCFD 2YN5A 3H9SA 2EDYA 4MXQD 2FBJH 2A6DA 3QI9D 4AQ1B 2EDEA 4HWEH 4KROC 3U83A 3FQXA 1QBLH 2V9RA 3IGAB 4ZD3L 3WDIA 4QRRE 3C5ZD 5MI0B 1KTDA 1MWAL 2VLKD 4JFPB 1BECA 1ZV5A 4MVBC 2JIXB 2QHLA 4LPUA 4XBEH 5D5ME 1JF1A 2AQ2A 3GSQB 3KJ4B 1FGVL 4F33A 4LDLB 1JVKA 4TNVF 1KG0B 3ARXA 2AXGB 4M62L 4RFEB 3LQMA 5CIPH 2ATPA 5E8EB 3HMXA 5EO1A 3MUZ1 4PJGB 4Q6YA 3MOBH 3H3BC 5DVNA 3DETD 4QYOA 1VEOA 5D1XB 2VE6B 4QHNA 3ULUH 5SWZD 5C0GA 4N0CD 4MNQB 4UIMA 3JWDL 1IAKB 4UIKH 4KMTL 5I1HL 2OK0H 4XB7A 2OXHA 4HDIB 4XC3L 4CDHA 3RL2B 1M7DA 3TO4B 4ZPTB 1MEXL 1RY7B 2OX5A 3CFDA 3LS4L 4UQ3A 3IXAB 3RWGB 5E8NA 1CTOA 5FA3B 1A9BB 3CSYB 1P1ZB 4LAQL 1OAUL 5J13B 3MRGB 4R96B 3MBEB 5EUKA 2VDLH 3FRPG 4TVPL 1Q1JL 4HWNA 1GRWA 2NZIA 3VE0B 5HHOE 5F9WC 4JFHE 3JV6A 4QWWD 1VFBA 3WL9B 4M93B 1U8OB 4HWZA 2VL5A 1I3RA 4GBXA 4ZPVB 1NFDB 4DTGH 1ADQA 4PTTA 3E6FB 1EJOL 1T0NA 5KSAC 1ZWIB 3AFLA 4CNIB 1BGXH 3MV8A 4MNGB 2B39A 2Q8BL 3LV3A 4HGMA 4LVOC 4NZTL 1BD2B 2IALA 3UJTH 3VFPA 3IDJA 1F11B 2HLFD 1U8QA 2EYTA 3Q0HA 3CC5B 4PJDF 4FP8H 5J9PB 1CXEA 1OTSC 4QRSA 3LCYA 4H1LB 3PIQA 3HRZA 1MVUB 4ZAKB 3UTZA 5K59E 1INEL 4S1SH 5F89B 3QXVA 2QR0A 1SM3H 3MLTA 1JGEA 3VDCA 1ZLVK 1CL7H 2OZ4H 5J1SC 1ED3B 4ZUUB 1RZGA 2UVFA 4YHPA 4BFIB 1AY1H 1RUKL 4P9ML 4A2MA 5HHMD 1AP2B 4Y4FB 4YBHA 4Z7QF 3INUH 3F8UB 1WIPA 4XMLL 4BJLA 4GJTB 4L9LC 4IBLT 4NRZB 3QP3A 1IC5L 1Q9WA 2DBJA 3QNYB 1SQ2N 4ZFOL 1UB5A 4M1CD 4RX4A 4R3SB 5HBBA 3QUMH 3L7FA 1JPFA 3BW9B 4HMCA 1YY9D 2K1MA 4PRNA 3U7WL 3ULSA 2NR6C 5D6DA 5E99L 2O5ZH 2YK1H 4R7NB 2DI8A 3WXVH 1ITBB 3LMJL 4EI5A 2DKSA 4MWFB 3L5WB 4E41E 1OOAA 3FFDA 3BQUC 1RIHH 1X44A 2PXYC 2D7OA 3I3BA 5EFIB 3TIDA 2W38A 3WLBA 4GRLC 1E28A 2W0LA 3C6SA 3D6GA 4NZJA 2VN7A 4OM1H 3SDYH 1NC4D 3MFFB 3DO7A 4LHJB 1LD9B 5EZOH 2VAAA 4D94A 1SY6A 4G8EA 1JMZA 4Y16C 1FBIL 4P46D 4XAKD 1UJ3C 2AP2A 1EZVX 3ZT7A 3U30B 2C3WA 1MFAL 4NKMB 2BMKA 1K5NB 2VL4A 3H3KA 4POYA 1KTKE 5B8CA 3HHRB 4PPTA 1ORQB 2IANB 3AM8A 2O5XH 3VFUA 1W8NA 3QB7C 3BP4B 3MCKA 2D0GA 3VRJB 3KPMA 1SEBA 3OMZA 4NC2B 4F7MA 5EU6A 2CLRA 2XNAB 2YEZB 3B6SA 4JQIH 2OJEB 5JUEH 2E9BA 1PLGL 4LCCC 3NCEB 3JTSB 2NW2B 5C0BD 3MLWH 5LWYH 3DNKA 3UTSE 1A14L 3P4NB 2HFFA 4TPRL 1EGJL 4JQXA 1KPVA 5L8LB 3G6AB 4BH8B 4QGTA 1A6UL 3FO2A 1P53A 2OI9C 4QHUB 2HJFA 5EUOE 4OI9A 1IAMA 5F1OB 5ACZB 1RJYA 3I50H 4KTDL 4P0DA 4OLVH 4P2OA 5SX4H 5C2BL 4RBPK 3HZKB 4HUKB 3VGBA 4NGHH 3RU8L 3S6CA 3ZT5A 1VEPA 4X83A 2WZPD 5A2IH 1KCRH 3FB5B 1NMBL 5GS3A 3QQ3B 4GS7B 4MJID 4Y5XC 3QRFM 5FM8A 5ERWB 4X7CC 4MX7B 5JPMA 1V7ML 2EH7L 4POZC 2DRUA 4KK6C 1I8LC 5HGHB 3K81A 1EZVY 4YHML 1P7QA 4RX4D 3HE6B 5D8JH 1UA6H 3ARFD 3I84A 1H3XA 3TP4A 2BRQA 3DYPA 3VA2C 2DTML 2P47B 4NRXA 5I1GL 1DBJL 2AJVH 3RVWD 2FEDC 4GSDH 3O45B 2W65A 2BCKA 4N0FA 2IMNA 4L4VD 3PL6B 3V6FA 5K9OB 5LAXB 5JORA 1D5ZA 3LN4A 5ID0B 2B0SH 5HY9A 4F15B 2WUBH 1DE4B 4FMFA 4WHTB 12E8H 1U6AH 2GITB 1DL7H 2OP4L 1CICD 2DQFB 3RJQB 4IRSA 4LK4A 1WBYB 2ZUYA 4XVSH 4P4KD 5J7CC 1AGEA 4G7VH 2O61A 4P99A 1IEBB 3BH9A 3MR9B 3P0VL 3Q48A 1TTFA 3QZWG 4RQQB 3K2UH 1B2WL 2CSPA 4LHUD 5C07E 3NOIA 4XI5C 3IVKA 1T1ZA 1MFDL 3W0WD 3GO1L 3TJHD 3X11A 4WJ5B 1C5DA 3FO1A 1NBYB 3HZMA 4P9HC 3STLA 4YHOH 4R2GC 1IGTB 1X4XA 5EU4B 1R5VA 4Q2ZB 4QHMB 4K7PL 2HRPH 1FCCA 2L0DA 1JGUH 3H9SE 4LKXA 5SV4A 1NGXA 3NGBC 4P2QD 2VC2H 1DN0A 4K94L 4Q6IB 5IEHA 2MTPA 3HAEA 1ZT7B 1EVUA 1JGLH 1XIWA 1P69B 3HG1A 2RB8A 5C0AA 3T0ED 3LEYL 2K9UA 4LLVA 3GSXA 5DJAB 2WUCL 4QKXB 3G04B 2IPTL 1KYOJ 2XZAH 1AO7A 5DWUH 5DD5L 5AZEL 2EIDA 4YUEH 4P2OD 1VFAA 1ZEAH 4XPAH 2ZG2A 2CPCA 5DJ8B 2R2EA 4PS4L 2R2HA 1PZ5B 4HKZA 1D6EA 4ZUSA 2IMMA 2X89D 3Q6GH 1IBGL 4JQVC 3C09C 2ED9A 4S1DD 3T77B 1VPOH 4KGJA 4QY8A 3DWTA 1C5BL 2X7LB 1BIHA 3BP6A 2NNAB 4ALAL 1AQDB 4Y88A 2WINA 5D96B 5DK3A 5T5NF 3D3VB 1PZUB 1XF3B 3BEVA 2SEBA 1XF1A 4PGZA 1R3KB 4PJCB 3PWPA 1OD9A 1OD7A 3OKYA 4P2RA 5FGBC 5CP3A 4FABL 1I9EA 4KHXH 2EDOA 2X70B 4XH2A 4JRXA 4H5SB 2OMNA 2NLJB 1G7IB 4XVJH 1L7IL 4Q9RL 5DJCA 4NBXB 3PHQA 1LK3H 1YPZE 3HI5L 4U7KA 3SO5A 1K4CB 4HWBL 1LILA 3UX9B 4HZLB 3H7BA 4RMUA 1UCTA 4KJPC 1I9IL 3WFCH 5FO8A 2O26U 2VLRD 2J1KA 3DXAD 3QUXD 4DFHA 5C6TH 4N0UE 2ADIB 4L9DA 1RURH 4V1DD 4HV8B 4ZS6D 1JHTA 2FZ3A 3NN8B 5ICXA 3GIZL 3I75B 3MV8E 3AGVA 2XZQH 5DQ9B 2VDRH 4EUPA 5IMMB 2VUYA 2BC4B 1P5UA 4XNUL 2FDBP 1KFAH 5DJ2A 2AQ1A 1DP0A 3FOMB 4PJ7F 4X6BB 3RWCB 3VXMA 3CCHB 2B4CL 4PLJC 2E27H 3OPZL 5EPMB 5J8OA 1H5BA 3U36A 3T09A 4TSCL 4Z6AT 2AK4A 3L3KB 3DURB 3SDXA 4P9HH 2ICEB 3PABA 4PJBB 1ZVHA 4ZQKA 5I8CB 3O4LE 1QFWM 1NCAH 4ONFH 3MV9A 1FPTL 4JVUA 4MA3A 3DIFA 2QSVA 3MOBL 4DVRH 1FQ9C 5EC1B 4GKNB 5GS0L 4HPOH 2LE9A 3G9AB 3T65B 2VSCA 2WM0A 3ULUL 5JPNB 3MNVB 2P5WA 3RA7H 43CAA 5BV7B 4U7SA 4ORZC 4GW1A 1YNTA 4P5KB 4YDLC 4M93C 1N6VA 3L3HB 3BT2L 2DM3A 3LKOA 2I27N 3IKKA 1KXVC 3LH2L 3EFFA 2NY6B 3RVVD 5T1LB 4I77L 3S9DB 2OR9L 1NAML 4UB0L 1Z3GH 2CXGA 2ITDA 1ZLUH 4JY6B 3ZDZF 1A02N 1WWBX 1PYWB 4OUUB 4BZ2H 4DEPB 4PP2A 3TJEH 5GZOD 2XQBH 1HH6A 3B2UC 4U3CA 3JWOH 3D1MC 5F21B 2DM4A 2M1KA 3PGDA 1F4WL 3P4OA 1S7XA 1L9NA 4F7CB 5GHWL 2NY7H 2FX8L 1I9RH 4ETQB 4JZJA 3CSPA 5DR5L 3DRQA 3ULUF 3UJIL 1J0YA 5E7BA 3VFOA 1MRCH 5IB3A 5CLWA 4HK3N 1I1AC 4MB3A 4Y4FC 3A6BL 1QBMH 4OAWB 4M6OL 4LSTL 4JFZL 4WU5B 4Z95H 3RZCC 1D9KA 5K93A 1OAZH 1UCBL 3PF2A 5FKPB 2XRAH 3D9AL 2JELL 3C9NB 1H3PH 4X8JB 3CX5K 3OAYK 3QCVH 4O9HH 2DL9A 5LBSH 1ITCA 5GGUB 4GQ9L 4LPWA 3LZFL 1XMWA 2QL1A 3HLAA 4M3KB 3SDAD 4XC1L 1X5XA 3TBVA 3VG9C 1MHEA 2WBJD 4ZUWA 3QT2A 4LCUB 4UU9B 2BY3A 4L8SC 4F9LA 1RIVH 2GJZB 1HILA 1EGJA 4JHAH 4X80H 5B39A 3GM0A 4KJWD 5JXED 1I7UA 2GAZB 4C4KT 1YMMA 3B5HA 5IT2H 1EFXB 3QUYA 3CFKB 1G7MA 4RIRB 2G9HA 4XTRD 2C7UA 3NFPA 4APQB 1AQKL 3QG6A 3L7EA 4ELKA 3MLUL 2BNRA 2R2CA 2GK0B 3WFDL 1MQKL 1WF5A 1MCJA 3EO9L 5F1SA 3FT4A 4M7KH 4QCIA 2H2PD 3QXDB 4NN6B 5F7EH 4F9PC 3H6JA 1ZANL 4G80A 1AGDA 2V2XB 5BVJA 4U1LB 5I6XB 3GSNB 2ZKHH 2XTJC 4OM1L 1LK2A 4Y2DB 2QADB 2XN9A 5EZOL 3GI9H 1NCWL 1ZT4B 3AS0A 5TF1H 4LLQB 1IAOB 1DVFB 1WEJH 2F8VA 4HGKC 1AD9A 1NKRA 2Q8AL 2BNQB 1ERNA 4DUXA 1FNGA 3EOAA 3HN3A 4LOUD 4LEOB 2A0LD 5E2WL 2F58H 1DSFL 3KPLA 1S9XA 1CD9B 1NBZA 2XQYK 3CXDH 3UBXI 4O02H 1GL4B 1MREL 1ZHNA 4YX2L 4PRDA 5FAAA 1L0QA 1EX0A 3MLVL 3FTGA 2PR4L 3UTTE 4RDQF 2Q7YA 15C8H 3BVNA 3G08B 4GS7C 2MCG1 1VFOA 5HYJD 4P5MB 4X5XB 3LSOB 5M7QA 2R4RL 4OLEA 3MYZA 2CGRL 1P4BH 3NA9L 4UINL 1G9ML 4F7PA 4OI8A 1F3DJ 3GGWA 5DEZA 1AC0A 3IDIA 4KAQH 4LCWD 1QBBA 1WISA 1RFDH 1CYGA 1XCQB 4QEGA 4JANB 3U4EB 1YN6A 1QSFB 5T3ZL 3Q1SH 3WDJA 2WLYA 1AR1D 5I2IA 5L0QB 4XPBL 3QDJB 3IXTA 4M7LH 5C09A 1F02I 3MJ9A 4KHTH 1HIML 3MPCA 4NO0A 1JHLL 1M7XA 4TUKH 5B4MD 1MIMH 3BESR 2R4SH 1OCWH 4F15C 4OD3H 5ITBL 2BVPA 4O4YH 4PJAF 3TT1L 4MCZB 3SGDH 3QEGH 2Y5EA 5B3JF 1IQDB 3PWLA 4M7ZB 4FQ2L 2NXYC 4L29A 2MHAA 4GG6E 1DDHB 3O8XC 2LABA 4UOJA 1UG9A 1NGYA 2FIRT 3E6HB 3GSRB 3HA0A 5MEOA 4ZOAA 1XF2B 3REWA 2CR6A 3TYFB 3MROB 1NMAL 3JV5A 1JL8A 3HUJE 1Z6JT 4JRXE 5L9DL 2FIKB 5TE7H 2DWEB 2OL3B 4HIHA 2DLEA 1JIBA 2VXTL 4NQSB 3BZEB 3RL1B 3GRWH 1FHGA 1JRHH 2D7MA 4OCSL 2V5SA 1KJMA 4NO2B 5LGHL 1PG7L 3QWQB 4YGVA 5CEZH 4EI6B 3VI4F 3TT3L 1LQSR 1I8IA 3ES6B 3EDDA 2RFXB 1H8NA 1FNFA 3MRDB 1OTUC 3O6FA 5E9DB 3C6LD 2GTZA 4G9DA 3R1GL 1XGRA 5C6WH 1IGYB 5MEND 5LCVH 3NCYP 4E9LA 4LCYB 4PRPB 1IGFL 3IU4L 1QQDB 5IBTH 5C0FA 3RI5F 1OWWA 4ONGL 3KYOA 5E4EC 1CF8H 1IAII 3ECBA 3UEZA 2P24B 4PRHD 3SE3C 4D9QD 2G2RA 2G75A 1T66C 5DWUL 1UXWA 3SDXE 4JFFD 1FYTE 1I8MA 4I0PC 3I02B 4YUEL 2Q7NA 2O5YL 2IAMA 2NZ9C 2VLME 5DSCB 4HH9B 2ZP0T 2QQKH 1U8LA 4JG1L 4LLDA 5DJYB 3P4MB 3OXRB 1M7IB 1VDGA 4IDLA 3L9RB 1LO4H 2VDNL 3B9DA 2IPUK 3HI6H 1KJVA 2X05A 4PBXA 4NO5A 5CIPA 3TC9A 3UPAA 5ICYA 2X41A 3A6OA 3DOSA 4CAGA 1S7QA 4PLKC 5JZ7C 4YFLI 3BN9C 5FUZH 3BP5B 4YHLL 4XVTH 1S5HA 1UZ6F 2AKRA 4Z0XA 5IVNA 2ATKB 4RISL 1NLBL 2ENYA 4M6NH 2OR7A 1YQVH 2R2BA 1B9ZA 1LO5B 2PW2B 2Y06L 3ARVA 1REIA 1T7ZA 3S35H 1P4IL 1WK0A 3DX9A 5E6ZA 4YNYB 1X7QA 5T1MA 4W6YB 1LEIB 2FATH 1A9EB 1NAMA 5I30H 5I8EB 2ITCA 5J6HB 1CXLA 4LNRB 5I18L 2A77L 4NUGH 1MF2H 4BK5A 4ODWB 3X3GL 5HHQA 1JNJA 5JW5A 1NMCB 4EDWL 1IGIH 3QEHB 4TQEH 4JFYA 4TRPH 1KFAL 5ITFA 1MCLA 1RAMA 3HC0A 3AY4C 1E6JL 3MXVL 3QSKB 1JFQL 1N2RA 2R1YB 4NUJB 1ZA3B 4QRRD 3O3DB 4Z8FH 4H88L 5CSZA 1S5IH 4D3CH 4JG0L 2EXWD 3QNXB 2CUIA 2IQAA 1JPGB 2PO6C 4KDTC 5FHBL 4OD2B 1Z9LA 4E42B 4EN3A 4GRWF 5L2KE 3IRZA 4LL9A 4HC1L 1T1XA 4KKNA 5EIIA 1C5CH 2NY6C 3VFSB 2X42A 4PYGA 1U95A 4HPOL 3NACH 4WO4A 3KYMB 2JCCE 3U7YH 2XQYG 1MCWW 4PFEA 4X0KA 1G7LB 2IAMD 2GSIA 3VRIB 1V7NH 3ARGC 3F6IA 5IMKA 1YMME 4JO3H 4CGTA 5HGBA 2I9TB 2Z31B 1UVQA 4LBEB 2X1OA 3KPSB 3K7UA 3RHWF 1BIIB 4MAUH 2BNRE 4KI5E 3GSVB 1PAMA 4YDJB 2NY3D 3QUMA 4RAVB 3IDMB 4PJXE 4X7EC 5GS0D 1D5IL 4JPVH 3C5SB 1KC5L 5C0IA 1EO5A 2R56L 1MJJB 3VXOA 1W72B 3GSWB 1IKFL 1MSPA 1T0MA 2DQUL 3O6LH 4J3OC 3CX5J 1K8IA 1PD6A 4A2LA 5HHOD 3VXSA 5HHPA 4JFHD 4KK9C 1KB9K 3N85L 5JXAL 1MRFH 1ZKAA 2HTKC 2ARJQ 1GZPB 3BPCB 4O58H 3B9KB 3EOBA 3AB0B 4U0RB 1TCRB 4KTYA 1EJ6A 2OQJB 1A7BA 2DICA 5GGSY 4OB5H 4N9GB 4AYFA 6FABH 3U0PA 3PQYE 3GMLB 2JE8A 4F2MA 4WI5A 5IFHH 4KK5D 3TVMB 4CJ0A 5JHDB 4FFZH 1K4DB 1YECH 2X4NB 1FNLA 2OSLA 4WEMB 4G3YL 1QP1A 3QIUB 3T2QA 4HZAA 3GDBA 4PBVC 1P7HL 1M71B 3S96B 5IF0B 2HJKA 3LKQA 4K3EH 3MACH 2D2OA 2PCPA 4XP6H 2YWYA 1NANI 2YC1A 3CUPB 1OM3H 5IVZB 1XGYL 3OAZK 2MWCA 3VXRA 4M8VA 3UYRH 1FDLH 4OLXH 2UUDK 4JRYD 5KSAA 2AXFB 2XFXB 3EO0A 3S37X 3H0TB 4PY8I 1CGYA 4M00A 3UDWC 25C8L 3BPLC 5MEPB 4PRID 3MRHB 5BV7H 3LKNA 4KJYB 5DJXA 2B2XH 5I6XC 3EJZC 2QQLH 2NXZB 2QADC 3LN9A 4N5UA 4KXZI 4K71B 1JYWA 2YSSA 4N0YH 2WWMC 3BGAA 3HNVL 3UTPD 2HVJA 3T3PF 1J9CT 1ROWA 1PX3A 4RSVA 5DJ6B 4MA1C 1N59B 3UPRB 1J0JA 1DVFC 2VZOA 1A3RL 1P84K 1HK6A 5M95B 1HEZB 2JTDA 2E9WA 3SKJH 1WTGT 4PP1D 5IMOA 2EZ0D 1CE6A 4A6YB 1YEHH 3QDAA 1WBXB 1S7UB 3EYFB 4OGYH 2HKFH 3U7AA 1SBBA 2GT9A 1MCPL 4L9LA 3OAUL 1UZ8A 3RX7A 4FZEH 4MCYA 2D9QB 1J0HA 3O81A 5IHZB 4GUPA 3MRPA 4TSAL 4M61A 1LEGA 3MREA 1A4KA 3OX8B 4WEBH 2X4OA 1YMHA 4NFBA 5B3NA 1OL0A 2F58L 3CDGA 5D7IF 2HH0H 3CXDL 5E70A 5IVXF 3ULVL 2JKXA 4XCNB 1LDPL 4F58H 2FYYA 3GI8L 4ZS7H 2PXYA 3W9DB 4HIEA 3RIAK 3MV7D 2Z4QA 1EV2E 4WY7L 1HQ4B 3QUKB 4JPKL 4GRLA 2YR3A 5L0QC 4OV5A 4OZIB 5IEKA 3F5WA 3FQNA 3NH7L 3S88L 2UZXB 4XRCB 4NQDA 3UTSD 2YUVA 4PY7B 4XMKH 5A2JH 2EO1A 4UBDD 3DMMB 4Y16A 3MOQA 1RULL 1T2QL 2VZSA 1UJ3A 5EOCJ 3T0XA 3NFSH 1BOGA 1RZ8A 5ISZB 4K8RC 1I7ZA 3CVHB 2DQHH 4M7ZC 5CHNB 4XAWL 5AUMA 3JV0A 3ZKXB 2FB4L 3EYOA 4U6HA 3TESA 4HF5H 4LLYA 4KHTL 3JXAA 4HIIA 3MLSH 1KENL 2CDFB 1QKZL 3QEQA 4JO2H 4OD3L 1MIEL 4LCCA 3F7PC 5L2JA 4JR9H 1QRNE 3VH8A 1KN4L 5KSUB 3QO1A 2J8UE 4NQUA 3ULVF 5KN5A 3MNWA 1B90A 2AJXL 3WFEL 1NAKH 3WO4B 3EHBD 1GZQB 2FWOB 4G6AD 2R0ZL 1CT8A 4N1HB 2EDTA 3IKCB 2R0LH 4QOKA 5I1AA 3ULUE 2I07A 3I3DA 4XHQA 4JY4B 1D3CA 4MS8C 3DX7B 1MCOL 3BWUC 3OKDA 1KJ2L 4P2CG 4U6VH 4IDJH 4MA8H 4Y5XA 3QR2A 4X5WA 4KKAD 3V6BR 5GS1A 5DZOA 3MODL 1SBSH 1U41A 2VLJE 4LVHC 3CLEL 4FZ8H 5K9QG 1QVOA 4YXHH 1I8LA 2X4SA 3P73A 3SOBH 1NUFA 1FJ1A 3IDXL 4IMKC 2ADGA 3TEUA 2VDOH 2JJSC 2A2QT 4OCXL 5GRUH 1RUQL 4WENB 2ESVB 4LSUL 3L1OH 4EVNB 1GHFH 3KPRA 5AYUL 5C07D 2FLRT 1OTTD 4K23H 1BFVH 3ILPA 1BX2B 4BSWB 2X40A 2BVOB 1AHWB 2AK1H 2W9EH 2OTWA 2FECI 5EIVA 4KQ4H 4RBPH 4GAGH 1CVRA 4AL8H 3FFCA 2DQEH 4W68A 1FL3B 4ZSOA 2FHCA 2J4WH 3O0RL 4D0BA 3F7VA 1ND0B 1G9NC 4OBRA 2K7PA 5GGRY 1KLGA 2I9LA 3FQRB 3FN0H 1TQCB 2I24N 1QFWI 1HSAA 3QDGA 4WU7A 4HG4K 3L5JA 1U92B 4XMPH 3WIHL 3KAAA 2QQKL 2EE3A 2NX5D 3RDTC 5ACLA 5JQHC 2ZG1A 4C57C 1HHHA 1A6ZB 5E1AB 5K9KA 1X6NA 4HIJB 5T3XH 4NQCA 4HC1A 4F37F 4K8RH 3DVGA 3IRPX 1VCAA 1ONQA 4Z7UB 5IR1A 2UV3A 1XF4A 2XA8L 3QHZL 1EVTC 1OB1B 2FSEB 3T4YB 1RHHB 2ICWA 1LVEA 4M6AA 4UILL 1A7QH 3MBXH 1YNKH 1RZFL 3BUYB 3RTQD 4M6NL 3GHBL 5F96L 2F9BT 1YQVL 4AQOA 4XHJC 2H8PA 2DQJL 2W0FA 4OKDA 5JHLH 4G7YL 5IP4A 2E6JA 3KPQA 4LU5H 3MLPA 1TITA 3C60B 4PUBH 3HB3D 3OL2A 1ZE3C 2FATL 1QO3B 4JJ5B 4NKOB 1OT1A 4JQVA 2VQ1B 3PHOB 4ZTOH 4I3RL 5DJDA 3QAZB 4L8DA 3CFBB 2L4OA 3BIAX 2FJGA 2DWDA 2I25N 4E41B 2HJLB 3BP7A 1IARB 2XWTA 5TE4H 4PV9B 3C2AH 3W9EA 5IB1B 5J0BA 2YPLA 4JO1L 3KLHC 3EJYD 1A1MB 1JPST 4P48A 1KV3A 3MRLA 4XNQA 4X6EA 5FGBA 3C8KB 1E27A 3LRHA 2WBKA 1NDMB 4PB9L 5GGRA 5I16A 1YUHA 2BVYA 5FGRA 1WZMA 3B9VA 5BS0D 3DUUB 2VXVH 4C56A 4J2XA 5FM4A 1OGTB 4MQSB 1NL0H 3S97C 3D0LA 3WFHA 5I1CH 4TULH 3WHXA 4W4OC 1GC1C 4G42B 4ZXBC 2Z31C 1A2YB 4I1NB 4DCQB 3BIBX 1ZT1A 2BSRB 3MRJB 3WEXA 4CADB 3MOAL 3O4LD 4NNXA 1RUAL 2NY1C 5HD8C 1CBVH 4D0CA 3ZE2E 5LGJB 5M94B 3QWOB 1T4KB 1KB9J 1N7ML 5CD3A 5I66B 1E4XI 3DVNA 32C2B 1OAQL 3PWNA 2ORBH 1V7NL 1G9NH 4OZGA 3B2VH 5F3HB 5I1JL 5FHAL 3BHBA 1BEYL 4MXWH 1HHGB 4U1JA 4TNVK 4OZHA 4Z7NF 3EGSB 1U8HA 4ZO9A 4KKBD 1KOAA 4OF0A 1JZ2A 3B9KC 3BDYH 5E00B 3STZB 3AB0C 1RPQA 1FAIL 3AVEA 4QF1A 1FFRA 4NNPL 3OJ2C 2Y7QA 4P59L 1NC2A 3UTOA 1A7PL 1MJ7L 5IVXA 3GIVA 1CU4H 5DD6A 5HI3C 3TVMC 2EYSA 5AZ2H 4NJAH 4RGMB 3OJDB 4DQOH 5I15L 5JDSB 3SCMA 3SQOH 4CL7A 3FB8B 1E4WL 5FYLH 3GNMH 4HUXA 1Y6MR 3FRUA 3WS3A 4UAOB 3QDMB 4LPCA 3HPJA 3RVTC 1DLFL 5T1KA 4ZFGH 1CD1A 5TQ2H 1T04A 4P5TC 3VRLE 4UDTB 4QXTA 3MCLL 4ZPVA 5FA4B 5H94B 5GIRA 2DYPA 2FX9L 1A4JA 1UKSA 1YECL 1UQSA 3P0YL 1HHIA 3D2UB 5AEAA 1WTLA 3NPSB 5D7JB 5TDNB 2GJ6A 4FFYL 5FGCE 4K3EL 4LF3B 1F97A 1QSED 3IJHA 3OHXB 2Z8RA 4RAUA 2HFGH 1YEDA 1P84J 4IHOA 4I2XB 3UYRL 1IL1B 4C56D 1JZ3A 2VO5A 1U3JA 3VI3E 4OTXL 1RZJL 4KJQD 1KIPA 3T8XA 3NTCL 5TDOA 1UM5H 3ARRA 1IEAA 3GMQB 4ODBD 1OP5K 4ONHB 5IFAH 3D25A 1I1FA 1I1AA 4H25A 3H9SB 1JNNH 5LQBH 4FQXA 2A6DB 4QLRA 5I1KH 1GC1H 4OZFA 5F7YC 3FQXB 4GAJH 3O2WH 3RZCA 3BMVA 3FMGL 5CGYC 5IESL 2APXA 2EDJA 1CGTA 3EDEA 3MV01 3QEQE 1E4KC 3B9AA 1KTDB 2AABL 1DQQA 2AI0L 1RV6X 4G6KH 2BK8A 1EA9C 1JF1B 2YD8A 1DQLH 5FOBA 1KEGL 1WCBA 4F33B 1TQBC 5TH2A 3MRCA 1W72H 4MAYC 1EHAA 3JVGC 2EDDA 4RWHA 4I0KA 4OGYL 5FXCH 2ATPB 2CRYA 4QOKE 5EO1B 1HNGA 2CUHA 3UAJC 4L8SA 3V7AG 4QYOB 4XNXH 2F54A 3N1GC 4QHNB 3KXFD 3RAJL 5C0GB 1TJGH 2AJUH 5JDJA 2DM7A 4UIMB 4ENEC 3OZ9H 4Y19A 1GAFH 1YYLL 2C3HA 2ZOKA 3V9FA 3CFIC 3LEVL 5DQDL 2AGJL 4HBQA 3CFDB 3TZVA 3DMMC 2ZUVA 2KQMA 4UQ3B 5C70A 4I3SL 5E8NB 4F58L 1AGBA 3FCTA 4RMSA 1K5NA 4BKLA 5F44A 5EUKB 3IJSA 2AEQL 4NP4L 1JF6A 2YD2A 3JV6B 3ZKXC 1YEKL 1VFBB 1T1YA 1CR9H 4G6ML 1FO0L 1C1EL 4HWZB 2VL5B 3FFCE 4DVBA 1IAIL 2QKIA 2GSGA 1I3RB 4GBXB 3ZL4L 3GHEL 4PTTB 4QRTA 5KS9F 2N7AA 1T0NB 1HCVA 2YPVL 4BM7A 1L0YA 2C3VA 5J12B 4TVSa 2DLIA 4XP1H 1DR9A 3V4UL 5I76A 3MV8B 3LV3B 3FRPA 2IALB 4PJHE 5I71C 35C8H 3VFPB 3IDJB 3RPKA 1U8QB 4PTUA 4Z7OE 1DQTA 3ZHLA 2DBLL 4KH2A 2EYTB 3OSKA 5T1DH 5I8OL 4MXVE 5DFVD 4QTIH 4WHYG 3QPXL 4RGNC 4QRSB 5KTEH 5D71L 3HCVA 3PIQB 4P3DA 3ZSSA 3GMRA 3HRZB 4N9OB 5DMIH 3UTZB 4LRNL 4MNHA 2QR0B 3MLTB 1JGEB 4Y4KC 2BOBA 1FZMA 3EYUH 2ZWLT 5J6GA 2CK2A 3C08H 1RZGB 2HN7A 4YHPB 2OBGA 5EG6C 2YD1A 2WANA 1CFNA 3WNPA 3GJEA 1SJXA 2EDLA 5GRXG 5CJ8A 2RBLA 1HXMA 4YQXL 2KDGA 5EORL 5D72L 1Q9WB 1JGDA 1FRGH 1UB5B 4D0DA 3TV3L 3WN5B 2A1WL 3L7FB 1KULA 3SPVA 1JPFB 4PRNB 4HKJA 3ULSB 4S1QH 1FZKA 4NQEA 2UY6A 4U1IA 2I26N 4PGCA 3HPLA 3L1OL 5C08A 3D85D 4FOMA 4FQJL 4DKEL 1D6VL 4EI5B 3OKEA 2EH8L 5EBMA 1S3KH 3DGCR 2BSSA 3BKJL 1TQCC 2BOCA 4FQ1L 3FFDB 4R26H 2ICCA 1YQ2A 3TIDB 3O8XA 4LSVL 3N50A 4J1UA 2YPLE 3ZYOA 4YFLF 3WLBB 1F2QA 4JO4L 1E28B 3LHPH 3C6SB 3EOTH 3RWEA 1P6AB 3PP4L 3DO7B 4NOFA 4NDMA 4HUUA 4IM8A 2VAAB 3IDUA 2HT2D 4G8EB 4P4KB 4G8GD 3TH2T 2WIIA 2IQ9L 4DGYL 3ZDYF 4EBQH 3SDCD 4CU8A 1F45A 4CW1A 2BMKB 4XMPL 4WFEE 5GSRA 4AMKH 3NIGF 3VFUB 1KLUA 2BP3A 5I73B 3MCKB 3KPMB 1FYTD 4R4ND 1SEBB 5LGKA 5ADPH 4OV6F 3B9EA 3X3FH 1I1CA 4F7MB 5EU6B 2CLRB 4HPYL 3B6SB 2EICA 1NGQL 4XPHH 2ZUXA 2DB8A 4OZGE 1MJUL 3BPNB 4XXCC 2HFFB 4PJGE 2FHFA 4OZHE 4N0RA 1ZHLA 1KPVB 4WWKA 4BZ1H 5HI5C 4OGXL 5IBLD 4ZNEA 4B41A 3FO2B 4YXLH 2D03L 4FQHA 3RZWA 2HJFB 4L3ED 2H41A 2Z35A 3H42H 5EC2A 3SE3A 3SJVA 4NQVA 2GFBA 1KSRA 1RJYB 3ALWA 4P2OB 3QO0A 1KB5L 1T20A 4I0PA 5BVPH 5JW4Q 1MHCA 1OLLA 4PUBL 1H9VA 4ZOEA 3RY6A 3JV4B 1O7SA 2R0KL 3CLFH 5CMAA 3TN0D 5JPMB 4LSSL 2FEEI 3WO3B 4CVUA 4M7JL 3SE8L 4D9RE 2XWJA 2WWKO 4KQ3H 1P7QB 2VERN 4P49A 4X6DF 3QFJA 2QJDA 3WFBL 1FFPA 3UO1L 3VWJC 4UV4H 4JY5L 3TBTA 2AXJA 2FJHA 4IOFD 4JFEA 4NRXB 4LQFH 5FCUH 2W65B 3I6GA 2BCKB 1CFTA 2NY0D 4O5LL 4N0FB 1QHOA 3LB6D 1LO0L 1G6RL 3V6FB 1QNZH 1MCFA 3DROA 5JORB 1D5ZB 3LN4B 4MNGE 5HY9B 3PUCA 3C5ZC 4HT1L 4BSVB 3RVXD 4JFDD 4YEFA 1JK8A 4TULL 3MRQA 4IRSB 5KZCD 1P4LA 3FOMA 4X6BA 3X13B 2YRZA 5D7KE 1T21A 3OKLA 5KSBF 2LU7A 1AGEB 5CJQL 1M05A 2O61B 4WTWA 3BH9B 4L4TA 3DUSA 2ZUSA 4GXUM 3CMOL 5L2KD 2G60H 5L7XL 3IVKB 1T1ZB 2BSED 5MERA 1HINL 1A5FL 3X11B 3AUVA 5AD0A 3QUZD 1C5DB 3FO1B 3HZMB 5BRZD 4NHCH 3STLB 4HXBL 1HSBA 2YA1A 4OLUH 4PJFF 1R5VB 3DETC 5GGVL 4MXWL 1HQRA 4GW4A 1RUPL 4LKXB 5EN2A 3RNKA 4X7SH 4RGMC 1NGXB 1X4ZA 2NY4D 1DN0B 4U05A 3T65A 4N0CC 3ZTNH 2FD6L 5IEHB 3HAEB 4PG2A 2LVCA 1XIWB 3QZWA 2NY5C 3HG1B 4UAOC 3EJJX 4YHZH 5C0AB 4IRZH 5F7HA 1NGPL 1ZS8A 4WWKD 4K3JH 2PO6A 4KDTA 2D7TH 4LLVB 3GSXB 1GXEA 3DPBA 1AO7B 5AZ2L 1BFOA 5DA4A 5D7SH 4OQ1A 5FECA 1VFAB 4XP9H 1EIBA 2R2EB 2R2HB 4HKZB 1D6EB 4U1GC 2Y23A 4ZUSB 2MPAH 1MCRA 3QFDA 4QWWC 1CD8A 3NPSC 5D7JC 4C58B 3ARGA 2ARWA 3CSBA 1JHKH 4MQ7A 4QY8B 1MFEL 4TOYH 5CUSL 1U8JA 3BP6B 2E7LC 5EDXA 3KS0H 4FQCL 2WINB 5HHXL 4AG4L 2NY2D 2YKLH 5IW6A 5KS9A 4Y19E 1A7NH 2SEBB 3BEVB 4OLYH 1JE6A 3PWPB 3PQYD 1WSST 4MMZC 4P2RB 4UI2A 4YBLB 5C9KA 2HLFC 1UKTA 1DBKL 5DXWA 1LP9F 4RMVA 4XH2B 3L3DA 3QIBD 4JRXB 4OKVA 4JGMA 3IFNL 1NGZA 4HFWA 5DJCB 2V9TA 5J1TC 3PHQB 3PV6A 5CKGA 1MLCA 2XTJE 5CEZE 3H7BB 2VN4A 1RZIA 1KXTB 3RX5A 3VDBA 1KGCE 1WFNA 3EKCA 3HZYA 3CU1A 3NAAL 4MDJA 1JHTB 4FQPA 2FZ3B 3QDHA 5ICXB 5HVWA 1FO0A 4EUPB 5CAYB 1XH3A 1OP3K 4CBPA 1FV1A 2DQIH 1KCVH 3SE9H 1R3IL 3O2WL 5DJ2B 3VXMB 3R0MA 4M1CC 1U8NB 3Q5YA 2B20A 1OPGH 4G6KL 4DN4L 3F6LA 1YY9C 5IIEA 1H5BB 4WW2C 3U36B 4DFIA 4HH8A 1A8JH 2AK4B 5T33L 2PKDA 2HTLD 1TMCB 3SDXB 1A6WL 2ZZUT 3PABB 1RJZA 4NHUA 4XPTL 4ZQKB 3S37L 1NCTA 2QSCH 4JGJA 2PYEA 3MV9B 4MA3B 3MMEA 3GZKA 3DIFB 3S36H 1OLZA 3GMPA 3MLXH 4RZCA 3IFOA 1KT2A 4UUJA 3UDWA 1Q0XH 2NY5H 1TETH 1F5WA 2DLFH 3CGTA 4KZDL 2P5WB 4XWOD 4MA7L 43CAB 2CD0A 2CO6B 3OZ9L 2XIDA 4GW1B 2CK0L 4U1NA 1YNTB 3SKUD 2FGWH 3BAEL 1J8HD 2YRLA 3T2NH 3FZUD 1KNOA 4NO3A 2B1AL 1R5IA 2B1HL 3EFFB 3LKOB 2CIKA 3EFDH 3K74B 3OB0H 2QBWA 3FL7A 1A6VL 1IC1A 1JPSH 4XCEA 5EA0L 3CDYA 3OAZH 4FMKA 1JYVA 2P8PA 1CDYA 2ITDB 3O4OB 1UXSA 4U1KA 1Z5LA 3ARDD 1X5LA 4CU7A 5D1QD 4FFVC 4DZBA 3FQWA 4GLRH 1FG2A 2IWGA 4PP2B 3EYQD 1HH6B 5T5NG 3QXAA 3PGDB 2Q1EA 3P4OB 1AIFA 3ZTJG 1QFWL 2X6MA 5CJBA 4HS6A 1J0ZA 3QULA 4JFQA 4JZJB 5FUOL 5TE6L 4P23D 1IMHC 4X4XA 3T3MF 5CJ5A 3VFOB 5DI8A 5IB4A 5E94A 5CSBA 5HYSA 5IB3B 1OAXH 4LASL 5MEQA 1F8TH 1UACL 5KBNC 1QYGH 1FIGL 3E2HC 2W60A 4IRJA 2W0KA 2V2WA 1JN6A 3KHOA 1D9KB 4I18C 1BJMA 4MQXD 1F6AA 2EDKA 1FNEA 4QTHA 1CLOH 3RUGF 3RRQA 3PJSA 1UWEL 1QRND 4P3CH 4LARL 3WN5C 1RK0A 3C08L 5AWNL 5AAWA 3LPGA 3ARFC 3N1PC 5CILH 1J1PH 1RK1A 2IGFL 2XZCH 4HULB 3HI1A 4PJEA 3ARBD 3BMWA 3SQBA 4ZNEE 4OCYH 3HLAB 3H9HA 3HMXH 3RVWC 1AH1A 3TBVB 4MD4A 4M5ZL 1MHEB 1U58A 3TBWA 3BIKA 3SJVE 4ZUWB 4JN1L 1Y6NR 1FE8L 4KVNH 2VWEC 2F5BH 1HILB 2HA1A 3A6CH 5B39B 1UWXK 1EO8L 2KBGA 3SGKA 4PJCE 1I7UB 1YMMB 4AEIH 5C0RL 2VDQH 2DQGH 5C7XH 1G7MB 2G9HB 2C7UB 1CICC 3NFPB 5IK3A 2EDQA 2VLJD 3I9GH 1KB5A 1VERA 3QG6B 4P4KC 3VMPA 3BOVA 1KCKA 2XWBA 2Y36L 3L7EB 4HHAA 2BNRB 4X7TA 4NM8H 4ELKB 1XT5A 5KSBA 1FORH 4HKBA 1IT9L 4WUUA 3ABZA 2NMSA 4R26L 3ZE0E 3FT4B 4QCIB 3FKUS 2R1WA 4JFEE 1I9JH 1AFVH 4XCCL 3TWCL 4G80B 5FF6A 5HHVH 1AGDB 1HWHB 5BVJB 3AM8C 4NCC1 5DQJA 5I73C 1LK2B 2XN9B 4JDTH 4PJFA 1A7OL 1WAAF 1YJDC 1VACA 1OARH 3NCJH 5B21A 1ADQH 4JFXA 1YY8A 3REVA 1PKOA 1SYSA 1AD9B 3I3EA 2MCPL 1G9EA 1G6RA 1MI5A 4AMKL 1EHNA 3V5HA 5A1AA 4IMKA 4DGIH 4JQXC 1Q9KA 2JJSA 3ET9F 1FNGB 3OQ3B 3ZE1E 3EOAB 5CS7A 4PJIF 4GOSA 4OCWL 1E4XL 4NZUL 3KPLB 4WTZA 3C6LB 3MGTA 2P24A 1S9XB 1NBZB 2IBZY 3RI5K 1ZHNB 4W4NA 4P2OC 4PJBE 4PRDB 4ODTL 5EOCL 3T2OA 3FTGB 5CJOH 4TSBL 4IRJD 2Q7YB 3MRMA 3BVNB 4ELMF 5ADOH 4XCYA 2AJYH 1IRAY 4Z18A 4F7PB 4YAQA 3GGWB 5CINH 3V8CA 1AGFA 2BDNH 3IDIB 3BX7C 4C83A 4KRPD 3ZKND 2DI9A 3W2DH 1B4JL 1MRDH 1N4XH 4BQ9A 2WSKA 4LSQH 1F6LL 4HSQA 1YN6B 1YNLL 3MRBA 2B5IB 5I2IB 3WLWD 5HI4D 3IXTB 5C09B 1N5YH 3VW3L 3RDTA 1AE6L 3CSGA 1CK0H 4NO0B 5TQ0L 1QFHA 1K9TA 5GS2D 1G1YA 4ZDHA 1KELH 2BVPB 3QUXC 4K3HA 2HKHH 3EO1A 2EYRA 1FZOA 3VFGL 3PWLB 3R4DA 4L29B 4ZS6C 1TVHA 1YEGL 2MHAB 3E0GA 4F57H 4DZ8A 1IC7L 1F00I 4YR6A 3O9WD 1NGYB 5DRWA 3P11H 1H0DA 5MEOB 5C0DA 1JZ7A 4ZFFA 1S7TA 3REWB 5KANG 3FJT