4Z0BH

Crystal structure of the fab fragment of anti-ofloxacin antibody and exploration its receptor binding site
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
QVQLVESGGGLVKPGGSKKLSCAASGFTFSSYAMEWVRQTPEKRLEWVAYISTGGGSTYYADSVKGRFTISRDNAKNTLYLQMTSLRSEDTAMYYCARHNYYGGRIYSMDYWGQGTSVTTSSAKTSPPSVYPLAPVCGTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYDLSSSVTVSSSTWPSQSITCNVAHPASSTKVDKKIEPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fab Fragment of an Anti-ofloxacin Antibody and Exploration of Its Specific Binding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords antibody heavy chain
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0bH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0bH01
5HJ3A 4XVSL 3HZVB 4GAFB 3PABB 4KVCL 5DHYA 4YPJA 5I2IB 4Q9RH 2Q3AA 1MRDH 1U0QA 2P24B 5FO7B 2QR0B 4RAUA 4EQ2A 2X4QB 1LO2L 1D5BA 1T04A 3QHZH 5LVEA 1YEHL 3F7YB 5DUPH 3GMOB 4HUNB 4A6YB 5L9DL 3TZVC 4WI9A 2GUOA 4G8IA 4XCEB 5I15L 1NCAH 4O2EA 4F2MB 1BAFL 4LSVL 1KB9J 1IGYA 4PJEB 2D0GA 5GISL 3DOSA 1AD9A 2NY6B 1LE9A 2B7DT 3KYKL 4TVPD 2NW3A 1JHLL 4JM2D 2FBOJ 3NA9H 1QTYT 4PJFA 4JDZA 5L7XL 2D7TH 4JREB 4OD2B 5DC0A 4UDUB 3K3QA 4YEEA 5IFJA 1IGCH 4QRUA 2AJUH 4IOFC 3MV8E 3QZWG 3VXUE 3MLTA 3CDYA 2E7HA 4ZG1A 3FOLB 1A3LL 2DIAA 3FFCA 2YPKA 4GMTL 4UTBL 3ARDC 4HIXH 2DS4A 4XPBL 3R1GH 2IALB 1PZUB 3EDEA 4X6FB 3L5XL 2GITB 4JO1L 3K46A 1MFNA 2UWEF 3AS2A 3F62A 1UCBL 4R9HA 1PVHA 4PJ8D 1UZ6E 4OZIF 5F7YC 1TVHB 1ZANL 1PZ5A 4KUZH 5D72L 2OSLB 4JRXE 3GSNL 1FN4B 2VZUA 3ARED 2DQJL 2OX5A 4RX4A 5DQJB 2F8XC 1S7WA 4GXUN 4YFDB 5EU6D 2YD1A 1ZSDB 3WNNA 1J8HB 1GHFH 1HSAA 3AVEA 5J0BA 1ITCA 1CFTA 5EBWA 3OPZL 2JJUA 3LEVH 1I1RA 4YFLF 2MFNA 3HPJA 3VA2C 1M7XA 2NY2B 1MFDL 3IXAB 1Q94B 3SQOH 3WKMH 4CVUA 4Z8FL 5BVPL 2JCCE 3W11C 3BH8A 3C6LD 1MLBA 3R4DA 4MAUL 1GRWA 4XNUH 4PGJA 4EZMA 2ENYA 3E3QE 2BOBB 1K6QH 4ELMF 4CL7A 4KMTH 5EU7C 1AO7D 1ZANH 2H1PL 1ZHNA 5TQ0L 4OLZH 3ZHLA 1N8ZA 2Z8SA 4LP5A 1OTTD 2X70A 3H3PL 3BW9B 1DEDA 2YD5A 3IYLW 3KPOB 5DRNA 5ENWB 5MENA 4PG2A 1YNTA 3F58L 4WTXA 5FHBH 1S9WB 4B53A 3TN0A 5FYKL 2A9ML 4Z95L 4XVUD 3QWOB 1WT5A 5TDNB 3VD4A 1UWEH 1HWHB 4OFYA 4IOIA 4NRYB 4S1RL 4HXBL 4LPTA 3K4AA 5KTEH 4DUXA 1RZIA 5GRXG 5EUKB 3TNMA 3QUXC 1EK3A 5J1SC 4GRWB 1MUJA 3G5ZA 1LQSR 2WMPA 3QDJE 4J3XA 2YS4A 4KV5E 1XF1A 5DJ0B 4Z7OF 43C9B 3VMPA 2CLZA 3U46B 3FB5B 3BUYA 4KKNA 4JZNB 1GGBL 2AK4E 3S37X 3S4SG 3MROB 5F96H 3LKQA 2FCBA 1GGIL 3NACL 3OB8A 3ARXA 5JOFB 3QIUA 2XWJB 3VJ6A 3B2UD 1PSKH 1EH9A 4FQIH 2RAMA 3TO4B 1NKOA 1H3TA 3IETB 3IFLH 4PRDB 4N0CD 1FZJA 3ROLA 4HK3N 1MCNA 3C09C 5D1XC 1JGVL 1I9RL 2AJSH 3UYRH 3KYNB 5IM7B 3QPXL 4LSPH 1LD9B 2VDKH 4K9EH 2DB8A 1XF4A 2E7MA 5DC9B 3BIKB 5D1ZB 4Z7VA 2DQCH 1JPFB 1FNAA 3HS0A 1U92A 3WNOA 2QJDA 2WBKA 4N0UA 1YPZA 5E0QA 1NAMA 4DN3L 2NLJA 1UZ8B 1T7XA 1DLHB 4IM8A 3IS0X 2EE2A 4GKZB 4I8DA 3PP3H 1N26A 2OLDA 4HH8A 5TFSL 3LQZA 3U0WL 2I07B 5F9DC 4DQOH 3L7FA 4U1GB 3RUGB 3GJFH 1X5AA 1WZ1L 2PCPA 3S34L 1BJMA 4WI4A 3ARDA 1JNHA 1KXQE 4BJLA 3PWVB 2EIBA 3RZCD 4HJ0C 4POZD 5CEZH 1MHHB 5INDA 3L5XH 5GSRB 3DSFL 5EBGA 4NO5B 4OZGF 4NFBA 1FNGA 5KANG 1T0PB 4QLRA 1I7UB 2FX7H 2R23B 2HWZL 2HJLA 3ULSB 2BNQA 1A1MA 4YHPB 1KTDA 4GBXD 1R3JB 1WBYB 1KJMA 5CJQL 5HDQL 3EDDA 3FT2B 3QIWB 5JQ6H 1F11B 3MOBH 3BUTA 4U1KB 2A6DA 5E2WL 4ZPTB 3SBWC 4UT6L 2D9QB 2X4RB 5LXGH 5E2VL 1F58H 5DHVB 5EOQL 1FLRL 4ZSOE 3QR2A 2NY0B 1X6NA 1XGTB 2VZ1A 1DE4B 3VG9B 2X4SA 2V5SA 1GXEA 3G6JA 4YFLI 2DIJA 3PWNA 4S11A 4E5XB 4PBXA 3GMPA 3FQNB 3O2VL 5E8EA 2APXA 3V4VL 1J8HA 4ALAH 2J5LC 3PIQA 1RAMA 5C71A 2BRQA 4PJ7A 5D5MB 1T21A 1AR2A 4LNRA 1IAKA 3IJHA 4P57A 4NGHL 4OFIA 4I4WA 4NYLA 1G7QB 4JAMA 4LIQE 1M7DB 1PZ5B 3FB7B 2UWEA 3CJJA 4PJIA 1FLRH 2BY2A 3B83A 2Q6WB 2BVQB 2GUOB 25C8L 1ZV5A 3C5ZA 4S2SB 3DX6B 9CGTA 3GKZA 5D7LD 2EYSA 4PJBF 2AEWA 3BH8B 5SWSE 1A0QH 35C8H 4LAQL 3UJJL 5JMOC 1HE7A 3FQUB 3NN8A 1AIFB 5FO7A 1KGCE 1OWRM 5C0CA 1A7PL 1KJ3H 3T0ED 3RVVD 1AGFB 5MP6H 1F4XH 1U8PB 4WUKH 5EH1A 3S37H 1QFPA 3HZYA 1W2KT 2K1MA 2MPAH 1MEXL 2EECA 3MV9E 5D1QC 2DDQH 5CS7A 1A9EB 3THMH 3OQ3B 3ULVE 5C0AE 3I6LD 4RX4D 1I75A 2DBLH 3VFTA 4UI2A 3RJDA 3PWVA 5C0EB 3RGVB 2GITA 3S3JA 4PRIB 4PBWD 2FEEL 4I2XA 1QRNE 1JZ2A 5B4MC 4GW1B 1IAII 1Z0MA 2CLRA 3FOLA 4OZFG 4HCRH 1IAMA 5L2KA 3KYMB 3NCJH 1C12A 1BJ8A 4QF1A 2FD6L 2XA8L 1GC1C 3O2WL 4PJEF 4HMCA 4U49A 1SEBB 4LEOB 4DN3H 4N5EC 1UZ6F 1MNUH 2DQEH 1HI6B 5EORH 1AGFA 4D9RD 3VFNB 5DD0H 4BQCA 3MOBL 5FAAA 2Q8BH 3GIZL 4IIQA 3GBLA 4PRBB 3TT1H 4L4TE 3UEZA 4KDVA 3DUSA 3FRUB 1F90L 2ERJB 2ZJSH 4WWKB 1I3GL 1UH2A 4HC1H 3WDJA 5E8PB 1AGDB 3ZKQD 2M26A 3KLHC 4HUUB 3SJVA 4F15C 4TUJB 4X8JB 3CVHL 5ADOH 4F7CB 4DVBA 1HQ4B 2NXYB 1WTLA 4JQVC 5I19L 1BBDL 1X6LA 4XCFL 4Y7MA 1NGZB 2YBRB 4EBQL 5C0BB 2HYMA 1HSBB 1BBJB 1PEWA 4P2OC 1CE1H 5AYUH 2W9EH 3QDGB 5JDSB 4NHUA 4GFTB 4R6UA 5GPRA 4BUGA 4M93C 5BRZA 3BO8B 4EDXB 1UJ3C 3CMOH 4RNRB 1K4CB 1ND0A 4NKOB 3PWNB 2R0KL 4NKDB 1Q72L 2AV1B 4HKXA 4O02H 2EH8H 3EYVB 5IBUB 3RGVD 3LKPB 1UM6L 1MOEA 3O11A 5JR1H 4X5WB 4HC1L 1HHJB 1D6EA 5A2FA 2HTLD 2ATPB 3O81A 4OF5A 2VDML 1W8NA 5BXFA 3K4DA 3NFSH 2MQ0A 3S34H 4WFEE 1FAKT 3U7YH 1CLOL 1KCLA 2RFXB 3SKMB 4D0DB 3RL2B 1NC4A 1G0YR 3QQ4A 4OAWB 4PJAF 1KN2L 2B8OT 5BZWA 5BRZE 1MJUL 4WRLA 1JBJA 1MIEL 4E9LA 3HAEG 1GGIH 3NACH 4LCWE 3EAKA 4NNYB 1KG0B 2CKBA 5JQ6L 5JHDE 4GQ9H 4P46A 3IKCB 3D39E 2DQJH 3GSOA 3VD7A 1TJHL 5IHLB 3HMWL 1U91A 1V7NL 3LH2H 2RBLA 2AI0L 4MD5B 5D2NE 2I07A 1F3JA 5HYJA 4XH2A 3OGCB 3G6DL 4D9LH 3CU7A 4NN7B 5I1IH 2OP4H 4FQIL 2ZSVA 1YC7A 4JM2A 1MCJA 5CP3H 1U3HA 4WUKL 1KPRA 5C09A 5E2UH 3DURA 2E7LA 3FN0L 4DCQA 1AC6A 2X44D 5ID0B 4CJ1A 1IFHL 3X12B 3RDTC 4QRTA 5GSVA 2R0LH 2FATL 3DX6A 4GG6B 4FABH 2A6IB 3E6HA 3ZYIA 2I9LA 2XKSA 3DHMA 1MCRA 4M62L 1UCTA 4IS6B 5IVNA 5ISZB 1KCSL 4BM7A 1JMXA 4Y5XB 3HFMH 5IB1B 2NMSA 1J8HD 4AT6A 2VAJA 3S4SA 3D0LA 5F72S 3BPOB 5T1MA 4MA1B 3L7EA 4L9LB 3DBXB 3BDYH 4KTDL 3RVXD 1FRGL 5L8LB 1JYWA 1WUNT 2J7LA 3QIBD 4APQD 3ZE0E 1JCKA 1JUFB 2VITB 3QCUL 3NPSB 3P30H 5FYKH 1TZIB 5IMOB 1NCNA 5LAXA 2PO6D 1S7QB 2Y7QB 2HP4A 2XWTA 1X5XA 3FQRA 4WFHE 2GFBB 4QXGH 4QOKE 1HH6A 2QBWA 1UKQA 2G75A 2QV2A 4ZUVA 2OS7A 2ICEB 5TJWK 1QSFD 2A6JA 1BZ9B 5CZVH 3VRJB 3CPLA 1G7HB 1IJ9A 5I74B 5HVFB 5D93C 3VFMB 3MRDA 4TVPE 5KJRL 4PJDF 3GSUB 1J88A 2Z91B 3U1SH 2HT3D 5DFVD 5J57B 4K7FB 2H2SC 1IGCL 3HPLA 4ODHL 3B9VA 2BNQB 1VCAA 5BV7B 4WV1C 3STLA 4JR9H 3VXRD 5LGHH 1CE6A 3P73A 4H25B 1H5BA 4MSWA 2E8ZA 4D0CA 5GSRA 5HBBA 1NBQA 4G42A 3RIFK 4XP9H 5C07D 3DVNB 2WQ8A 3V4UL 5EUOB 1A6ZA 5IVZB 3VXME 3BP7B 1N4XH 3QEQD 4G6MH 5DR5H 3GO1L 1RUQL 4F8TA 5GS3A 4XNXH 5I76A 1S5IL 3VRLE 3KVQA 4PJXB 4I3SH 5FXCH 1Q9LB 2XZZA 3WNLA 3AREA 5IB5B 3B5HA 3PWJA 5T1LB 3RHWF 2NNAA 2DQDL 1OTUC 4P3CH 1TZHA 5MENE 3RGVC 2ARWA 1JPSH 1N7ML 1U8PA 3S35H 5IIEA 2V2TA 3VFGH 2DTMH 2X1PA 5I9QB 4HWBH 4O4YH 1CIDA 4LASH 2BVOA 3ZDZE 4X99B 3WNMA 1KPRB 5C09B 3LPFA 5DUBA 1AO7E 1I3RA 5L9DH 1U3HC 3HE7D 4CVZB 3FO0L 2KDGA 1M6OA 3SY0A 3GSRB 1NGPH 5F7EH 4JN2A 2E6QA 3O6KL 4OD2A 1PW3A 4TQEH 3TO4A 5DFWH 1WAAF 3GGWA 3E8UL 3W0WD 5I1HH 2AJYL 4XVTL 4K3DH 1QNZH 1KB9K 1E0OB 3G6AA 3OJ2C 3AREB 4LNRB 1IGYB 4PV9B 3HC0B 3P4MA 4HV8B 4ZAKA 4L8BA 3KJ6H 4KHTH 4PJEE 4M7JL 3X3GL 4LSQH 4M43H 1B2WL 4M7LH 4IDLA 1N4XL 4EJ1C 1HK6A 1GYAA 4F58L 1RZJC 4W70A 4JDTH 2VR4A 3HRPA 3MNVB 3DO7B 5HSFA 2EC9T 3IB4A 4KROD 3MRBA 4XRCA 3CFJA 5DVNA 1QR4A 4CVXA 4N8CH 2G60H 3QEQB 3VXUA 5BZDA 2M1KA 4BH7A 3M1BA 3WDHA 5KVGL 5JDJA 1RJZB 5DD3H 1G7PB 2Z31D 4OGYL 2ZCLH 3WL9B 4KTEL 2MMXA 4YHZH 3N1QC 1D9KB 7FABH 1NEZB 4G6JL 4LP4A 4PLJD 1C1EL 5CJXA 4LCCC 1LEGA 1OM3L 2D7NA 3OAZH 3EOBB 2GJJA 4DWHA 1CGUA 3VG0H 4QRRB 1KTKE 1DQDL 2JIXB 5DT1L 4DZ8B 4OIAA 4WJ5A 3LD8B 3NCJL 2HRLA 3U7WH 1A8JH 2XKNA 3MUHL 1MCLA 5JPMB 5E2TL 4WEBL 4U1SA 1INDL 5EUOA 5T3XL 5DD6A 5F93C 3L5JA 4FABL 3CFCH 1WFNA 2IH1A 4JRYB 4XNQB 4F37K 1ZSDA 3LMJL 4MQ7A 2YK1H 2EDOA 3E6FA 2W65B 5T33H 5FECB 4HHAA 5E1AA 3GM0A 1EO8H 2M2DA 4ZO9A 5FOJA 1DBJL 3HAEB 1MEXH 2FJFA 1WZMA 2F53E 3RI5K 3H7BB 2HFEA 2BNRE 3BWAB 4KZEH 1FRGH 3LSOA 4GSDL 1OVZA 1GOHA 3SE8L 4F9LC 1KEGH 1N59B 5SWZD 4JZOA 1KBGL 5T1MB 3BYTA 4KZDL 1FVEB 3D48R 2R15A 4ONFH 4FTVD 5FV1L 4ORZC 3MRIB 2EYTB 2QQQA 2IALA 3PL6D 1UKSA 1KCKA 4LCWA 4G7YL 3WBDA 4HUXA 3LB6C 1VFAA 4NJAH 3MUY1 4RAHA 5E2UL 4DKEL 1KXVC 2W9LA 4LPUA 3FQRB 2PF6A 4GRWF 1FNEA 2EEBA 3LQAL 2HT2C 4LSSH 4GW4B 3CZFA 3EUUA 3VWJD 1B4JL 2CLVB 3DROA 4G9DB 4NC2B 5I0DA 1AGCB 2R0WL 3VWJC 5DJXB 5L2KB 4XH2B 5IB3B 1VDGA 1KB5L 4RGOH 2O61B 3IETA 3OTTA 4AL8H 5T3ZL 3PE9A 4DTGH 2ZJSL 3DSNA 1MCPL 5FA3A 5CIPH 1UB5B 3TBVB 4R96B 2VTFA 4ELKB 5I71C 3MA7B 5EIQA 2JIXD 4Y5XA 1U93A 3VXPB 4RIRA 2EC9U 2DD8L 3QCVH 4U1MA 1AGBB 3BYYA 5C9KA 3AM8C 2WWMC 1ZLVH 3V7MA 4XP6H 3PDDA 3RY4A 1OB1B 5LJYH 1TZGL 3FJTA 1MAML 4H1LG 5I1GL 2RR3A 4JM2F 4UT7H 3EKCA 3BGFC 5T3XE 4JRYD 3SE8H 4LCYB 5HHOB 5DC4B 5J1TC 5B3JE 3ZE1E 2JK5B 3PWLB 1OAUL 4A2LA 1F2XK 4NOBA 2HKFL 3TT3L 5BJTB 4TPRH 3C6LA 3EW3B 3BZ4B 2J8UF 4KK5C 3ISWA 3ULUE 1N6VA 4NNXB 1FE8H 1LO5B 1TNNA 2UVFA 4Z7UE 2ZCKL 3Q5OA 1A6AB 5MEPB 4Z7UA 4ZUVB 3KS0H 3TJEL 2P49B 3QISA 4D0BA 4FQLL 1CG9B 4HF5H 3HNTH 4H1LH 1JI1A 1FLTX 1OCWH 2Y7QA 3QFDB 4HIJA 2DM2A 2FH6A 2P8MA 3QEHB 2QSCL 3LIZL 4LCCB 4NUGH 3T0EE 5ESQA 3JZ7A 2H32B 4JFED 1SJHA 5DJYB 2MKLC 5ICXA 1F02I 4MA7L 3OKNA 5HHOA 2RQ8A 2DLEA 5HHOE 4ZFFA 3U9PH 4CW1B 1MF2L 4B0MM 1DBBH 1C7TA 1V3JA 3D85D 5C08B 1KN4L 3CGTA 3ULVD 3RVUC 3RWIA 5E94A 3MOAH 5E8NA 2FYYA 4JQXC 5ITFA 5JIIA 2PXYB 1XT5A 5D7LB 4XBEL 1FGNL 1MWAA 1FO0H 3BRGC 5D2LB 1R0AH 5E00B 2OXGA 3L3IA 1T6VN 3ES6A 4JZJA 4Y16C 1CVRA 3VXTB 5IESH 1X4XA 4XPHL 3CXDL 1CYGA 2FL5A 4U7MA 1CFSB 3OX8B 4U33A 1T2JA 4K9EL 5E08H 1QEWB 3D6GA 1HQRB 3ZDXE 2NY3C 5DURB 5IIEB 3IDYC 4X9GA 4NUJB 1KNOA 1KELL 4DGYH 3ARGC 5DJYA 3C9NA 4PJ7F 3DV4A 3SPVA 4XXCA 3WFEH 5FDWB 1EEYA 4ACPA 1A7PH 1KJ3L 3GMLB 3OKKB 1RUQH 3KPRA 5HPMB 3TPUA 2J88L 1AGBA 5LBSL 3DIFB 3HI5L 2Z9TA 3QNZA 3QFJB 5DS8B 2GY7B 3LN4A 4MCYA 5ELIA 5FGBC 1CICA 2V5YA 4XWOD 4F33A 4BH8B 2I9TB 1MJ8L 1MJ7L 1FL3B 1OAYL 4X80L 2VDKL 3IFOB 2IAMD 4H20L 4L8SA 3FQWA 4H25A 2HA1A 1DBAH 5DHYB 3OJMB 2WINB 3HAEA 4XTRD 2DWEA 4NQEB 4D94A 4ODVL 3Q6FA 1P69B 2Y5TB 3ARBB 3PHOA 1E4XI 4N0YH 4FP8L 4LPCA 4CUCA 2HG5A 3KPNA 1O5DT 3ECBB 3EOTH 4PJBE 2VH5L 1RURH 4HUXB 3H3PH 1JNLL 1AR1C 3I85A 4HUVB 3BPCB 4L9DA 2X2YA 4OFKA 5AYQA 2BMKA 2FJHB 5F9WC 3IAGC 1WQVT 5IEHA 4NZUL 2VSDA 1FORH 1KEGL 2PO6A 5E2WH 3HI1B 4L3CB 1MJJA 2FLBT 4NYLB 5D1XA 4KJQD 4O4YL 5IJVB 3S35X 4LLWA 2IANB 1VGEL 4HAGA 1WLHA 3HR6A 4OZHA 4OB5H 1MQKH 4O9HH 2NY5H 4OZIB 1P6FA 3WN5C 3WLBB 3P77A 2YSSA 5FKAA 4WDIA 4F7CA 1RIVL 4NQCB 4LEXH 4PLKC 1UACL 3KLSA 3QDMA 4LKCA 5C0CB 4LCWD 1YPZF 5I1KH 2AEPH 3O3BB 1RULL 1PSKL 5JHDD 4S1SH 2VH5H 3L3IB 4GAYA 3B43A 1LK3L 3MXWH 5JO5B 4L8CB 2OTPA 1PKQB 3QNXA 1EBAA 4G8GE 5CBAB 3FQXA 4MJIE 3E2HC 3VGAB 1A7NL 1NGXA 4G43A 5F7HA 4QYOA 1RFDH 2VDLH 1UH3A 5DD3L 1NEUA 3V7AG 4P5MA 1AJ7L 4PJFF 4XNYH 2XTJC 5GS0H 1F4AA 3SCMB 1KOAA 4X7SH 4PJ5D 2YPLB 2E7LC 2AI0H 1OTSD 4GO6B 3QEQA 2N1KA 4H8WL 5I18H 2DKMA 1AE6H 1FSKC 2XN9A 3BOVA 4MB3A 4XCCL 5F7NC 1U3YA 3MRMA 2A74A 1KFAH 3H9HB 5C0EA 2QHRL 4K7PX 3OKDB 5TH2A 1TQBB 1DQQB 3ARWA 3SE4A 3KLHD 5BOPA 3EJYD 3ILPB 5GIRB 3VGFA 2BXYA 4Y1AA 4D9LL 3CZJA 4E41E 1WCQA 4Y5YB 1XCTB 5DJDA 1KCRH 1IAOA 1PG7X 4UQ2A 1KIUA 4PV8A 4XXCC 5CILH 2A74B 3BMVA 1QLEL 2GAZA 4P9MH 4JFYB 2VQ1B 1D5ZB 1G6RB 3FO9B 1ZT7B 4LKXB 3NPZB 3EFDL 3CSBA 1HH9A 5DHVH 3T77A 2X41A 3FCTA 2YA0A 3B9KD 5IMKA 4QOKD 5FGBA 4G42B 2EXYC 2YPKB 4YBLB 2H6PA 5D7KE 3QPQD 4OZGA 4JGJA 3JUZA 2W59A 4L3EB 4HQQL 4LK4A 4L3ED 4DEPB 4F3FA 1ZGLB 2HAZA 4JFHE 4NFDA 3UYOD 1E6JL 2ORBH 4KVCH 3ESVF 2R9HC 5FUOH 3WE6B 2BVYA 4R8WH 2NY1D 3BZFA 5DDHA 5EZJA 1RPQA 4E41B 1U8OB 4YDKH 5HDBF 2ADIA 2APFA 1H8SA 1Q9WA 5FUCC 3VGBA 4FQXB 4G8GB 3MRDB 3UROR 1S5HB 4CGTA 3MUGB 3MRFB 3U4AA 2JB5H 1VADB 2X4NB 4M1GL 2C1OA 4MA8L 4K94C 3MTRA 2MSPA 1I3RB 4HIJB 5E99H 4Y5YC 3X3FL 1GIGL 3QIWC 5D6DA 4QOKA 1U92B 4M5YH 3QDGD 1E4KC 1CE6B 3W39A 3LS5L 5HJ3B 2W92A 3QO0B 4MNHB 5HI4D 3VXQB 4ZNCD 3EYQC 4PJ5B 4I0PA 3U2SA 4FFYH 2V9RA 2OTWB 4NCDA 1I7ZB 2W9EL 3FT4B 3U30B 1FZJB 1JPST 4RRPG 4OZHF 3N1GC 1FVDA 1WFUA 1R3JA 2HG5B 3KPNB 4UQ3A 4N9GB 4LCYA 4NQCE 3I75A 1IGML 1EDQA 2Z8WC 3MYZA 2F53A 4U6YA 1HH6B 4BSWB 3EDJA 3RVWD 1EFXA 2DRUA 4J3WA 2DBLL 3WD5H 5DWUH 2C4FT 1S7QA 3UX9B 1F4HA 1INEL 4PRNB 4L4VD 1JUFA 2JJSC 1KFAL 3W0WE 4OLVH 3RHWK 4YUEL 5GGSB 1QFWI 1PGRB 2FD6H 2BNUA 5EU5A 4D3CL 2VYRE 3OV6A 2K7QA 1P1ZA 4GKSA 2VQUA 1Q1JL 4XCNB 5F89A 3V7AE 3GFUA 4G9FE 8FABB 3KPPA 4GBXC 1ZWIA 3GI8H 3ILPA 1BGXH 4HFUH 3QCTL 3BKYL 4L4JA 5C2BH 4YAQB 1NC2D 3K0WA 3WNKA 3ROOB 1ZHNB 1RUAL 2HFGH 3ZDXF 4C83B 4TNVK 5JLZA 3KDMB 4ZOEA 2P7TB 3BN3B 4OCRH 4UAOB 3WKNA 1FNHA 2O5YL 1NDGB 2RCSL 2WUBL 4TNVF 4QNPE 2EO1A 1WCBA 3MBEB 1CFVH 3X13A 3HC4L 4MAYA 5TGBA 2Q6WA 5TF1L 4PJDB 4UTAL 1N59A 5IMMA 4NQXA 1EHLL 3HC0A 4OV6F 3WYRA 1FJ1B 3SDAB 3FRPA 5HHVL 2CR3A 4YGVB 4NO3B 1HHJA 3SGJA 3UJTH 1UXWB 4PRHB 2OYPA 1RJCA 3QQ9C 2J6EH 3EYFA 4LAQH 4NNYA 1INDH 3PGDA 4G6FD 5EBMB 3MCLL 3CUPB 4IRJC 3QHZL 1TMCB 1UWGL 1HCVA 1ZOXA 4LRNL 1FH5L 4O51A 1INQB 3DJ9A 5J1AA 5JPMA 5ADPL 5DMKB 2FJGB 4XP6L 3STBA 1NCWL 4WENB 5KVEL 4F9LA 4U1LB 4GKNA 3UJTL 3FMGL 1LEGB 5IJVA 1G6RA 4HIHA 1T1XA 4HIIB 4MNQA 2FSEA 4FG6C 1CF8L 4N0FA 5D2LE 2WWKO 5CJQH 1OQXA 1MRCL 3RWHA 3IDNB 3JWDH 3ZDZF 4KK6D 3QXAA 3MRHA 4U4BA 5C08E 3FO2B 5D8JH 1EERB 3HCVA 2QL1A 3N85L 2P5EE 3BEWB 4JO4H 4Z7QF 3BP7A 5J56B 4TRPL 3MRCB 1QQDB 5DGRA 5E9DA 4U1GC 3SDDA 4L8BB 1SEBA 3IFNH 4PRAB 3RUGF 4CN1A 3JV6A 4P2RD 5ILTH 2P5EB 3T0XA 5BS0D 1YMHA 3VXNB 3QIWD 2AJVH 3JUYA 1NGZA 4HJGA 1RZKH 3T04D 1QSED 3RNKA 5GRUL 2FR4B 4GLRI 3G5VB 3MLZL 1W72A 1S7XA 2B4CC 3ZKXB 3LRHA 1OAXL 3REVA 2VKXA 5C0IB 3RGVA 3WFCL 3NOIA 2FIRT 1YECL 2DTML 4RFOL 3VI3F 3LQMA 4JY6A 5DUBB 3TYGL 5AWNL 3P3YA 3TPUB 4NKDA 1XF5B 3QO0A 4MNHA 3UTPD 3V52L 3PQYD 3U4BL 2ITDB 4RGOL 2O93L 4K23H 4G9DA 5E70A 2OMNA 1R5IB 4ZUUA 5JNYA 1PAMA 5FYJD 2W0LA 2HRPL 3CNKA 4OTXL 3SOBL 1WBXB 5DEGB 2GCYB 4WO4C 1OP9A 4HCRL 4RMWA 4YBLC 2VL5B 2P5WA 1S5IH 1FHGA 4BZ2H 1Q38A 1UFUA 1XF5A 4H88L 2XZQL 5GGQL 5I8OH 3FQUA 3NN8B 4MDIA 3QIUB 3ARZA 4FFYL 4JY5H 3SJVB 3F7YA 1LO0L 3FN9A 4YWGH 3K8MA 3THML 3TF7C 3SDAD 3D2UD 3CDGB 4HUWA 5CBEB 1CDYA 5E4IA 4GAGH 5D6CB 4JHBA 2F53B 4JFEE 3DXAE 1TPXC 1OL0A 1T7ZA 3A6CH 1T66C 1FGVL 4YPGB 2NXZB 4WV1A 2F8VA 5D5ME 3RKDD 3CVHA 1N64L 5HHOD 5INCB 3DSFH 5L2KD 1YEFH 4Q6IC 2XTLA 5KVFH 3EO9L 3O2VH 5IQ7H 1FBIL 3CMGA 1TJGH 2CQVA 4YHLH 1NFDE 1F3JB 1JRHH 4ODUA 1A7QH 4Q9QH 2P8MB 4LCCA 5DD1H 5I1HL 1S9WA 4NSKA 1ORQA 3MLSH 3FO2A 3RA7L 1DSFH 1HILA 4WHYH 4BH8A 3KDMA 5MHSD 1A2YB 1Z9LA 5T3ZD 1FZOB 5KOVC 4NNPL 3OKEB 4P23C 1K8IA 2G75B 1LEIA 1M4KA 2LU4A 5I71B 3DX7A 4JPVL 3GHEL 5EIVA 5FF6A 1T22B 1X44A 1F13A 4LVEA 4MQSB 1C5DA 3A6BH 4HD9A 3LMJH 3F58H 4E0RB 5IHZA 1JRHI 3NZHL 3AS3A 1WBYA 2ICWI 2J1KA 3O6FA 1I8LC 4KUZL 2DQDH 2A1WL 4WGVB 4O2FB 5A40E 1WFOA 1O0VA 1KV3A 1NC2B 3P40A 1TTUA 1NCDL 5JXAH 2NZ9D 2PTTA 1U8IA 4Q6YA 1NGXB 4G43B 4QRRE 4M5ZH 1IAIH 4FNLH 1U36A 2FZ3B 2X4RA 1C08B 4KRPC 2E3VA 2PW1A 4L8SC 1I8MB 3EJZC 3GUTB 4WI5A 1L7TL 4UV7H 4ZYKA 1S7TB 3DRTB 3V6BR 1BGXL 4HFUL 1I1AB 1KJ2H 2APBA 1GZPA 4NWUL 3TBWB 3S9DB 2BHYA 2I5YL 4C56B 1MRFH 4H8WH 5I18L 2CD0A 1A22B 5JORB 4U1JB 3MA9L 1U6AL 4U2ZA 3PP4H 3OKNB 1GIGH 4XVUC 4TUKH 1K3ZA 2JF1A 4NN5C 1SJXA 3M8OL 4ZTOH 1A6TA 4JDTL 3FQNA 1KJ2L 5BOZG 2H32A 1BF2A 5GJSH 5CJOH 1EO8L 4K3HA 3L1OH 1A9BB 2F58L 2CMRH 4QXUH 2ESVD 3ROOA 2V2TB 1IEAB 4MD0A 3N1FC 2D0FA 2HKHH 3P9LA 5GGVY 3RL1B 1Z5LA 1ACZA 1MCQA 5JQHC 3QQ4B 4OAWA 5ACMA 2ERJC 2D4DA 1HHGB 3NZ8A 4JKWA 4M6NH 3BGMB 2IH3A 4OJFH 3X11B 4OB5L 5H2BA 3P73B 3ZTJH 3O2DL 1YMHB 4J4PC 3EO1A 2OJZH 4YHPA 4YDLB 4NT6A 1AC0A 3V4UH 3MV8D 1BD2D 2IPKB 3VCLB 3L5WA 1CFQB 3PL6C 4I18B 4O02L 2YD8A 1VKXB 5EA0H 3EOYG 3VXSD 3R0MA 2OR7A 1JGVH 1I9RH 2AJSL 4LGSB 2P48B 1MRFL 4NKMA 3HE6C 4G8GD 4HWEH 3T2QA 3ROLB 4OFPA 5CSZA 3RY6C 4QRRA 4GW5B 1BVKA 2ARJQ 3GJEB 1PG7W 5JOEA 1BQLL 3BAEH 4ZDHB 2PR4H 1MWAL 2QQKL 4LLYB 3QB7C 2P5WB 1GC1L 4YGAB 1RMFH 3RVVC 4ENED 5EUOE 3A6CL 2R29H 5CP3A 1IEBA 5KVMC 3RZCC 3MV9A 2ID5A 4U6VL 3FB5A 5FM5O 2SEBB 3MJGX 4QOKB 4U05A 3U48A 1KLUA 1R24A 2G9HA 2QKIB 3TH3T 1A14H 1CD1A 3K7UA 5F7EL 1CDGA 1W0VB 2Z4QA 3RU8H 5I8KH 5J13C 4M1DL 3OKMB 3NCEB 4IBLT 3WIIL 1HCFX 2AABH 1EMTH 5JZ7C 5KSBB 3P4LA 4DN4H 5MERA 2E9BA 4MXVE 3C5ZB 4S2SA 4LLDA 5FOBA 5JUEH 2PW1B 4H0GA 1ODAA 4KXZI 1AKJA 2XZCH 3HE7C 5DJCA 5I1AB 3S88L 3GNMH 3MO1B 3DURB 4TSCH 5D72H 3Q1SL 3MUJA 2V2XA 1KCRL 1I9JL 1I8MA 4HZLB 4YHOH 1ZGLA 5D5MA 1M6OB 1U42A 5C07A 1CT8B 3M17A 4HFWB 4F15B 4K07A 4N5UA 4OZIE 2X9WA 3BHBB 3K2UH 3D3VD 4CMHB 1VGEH 4OUUA 2CUIA 2IANE 1NJ9A 4XNXL 1JFQL 1MCHA 4MQTB 4JFHD 2HMIC 1N3NB 2ED9A 4JM2B 2E9IA 4RBPK 3BKJL 2I60H 2VC2H 4C83A 2VLKE 1IKFH 4HKZA 1ZA6B 3SKOA 3VFVA 1ZS8B 3DX7B 5A16B 5ESAA 4M1DH 3BE1L 5HPOA 5D2NB 4KGJA 2XICA 5L2JB 5SWQB 1JHLH 3P0VH 4LDEB 4Y4HD 4ZSOA 1OLLA 2DOCA 1SBSH 3IFNL 5CAYB 4BYHA 4Y4HC 1HXMA 4H26B 5FF6B 5GS1A 2YUWA 4JFZL 4NO0D 2UZXB 4LLVA 3VFSA 1U8JA 1ZA6A 1NAML 1KCUH 3QIWA 5D6DC 1Z3GL 4AEHH 2YRZA 2QSCH 4NUGL 4ETQA 4PGDA 1LK3H 1YUHA 4YEFA 5IK3A 3OAYK 4TTDD 4ODVH 1KJVA 4JO2L 2FECI 3NH7L 3KPLA 3T0BA 2X4UA 3U7YL 4FQ1H 5LQBL 3K4ZA 1OAKL 4CBPA 2AXGA 2C4FU 1KEMH 4QXGL 5E8NB 4PJIB 3V52H 3PWUB 1K9TA 4ODWA 2ZUSA 3TV3H 1TJHH 1CK0H 5BV7C 4WV1B 3N9GL 5EU6A 2DQHL 1M71B 1A3QA 2CDGB 1IT9H 2R2HA 1G9NL 3F6LA 1R3IH 4UBDC 5B39B 2BOCA 2DF3A 4P2CG 2XPGB 1DQLH 1BF8A 3BEVA 1QBML 5BRZB 3D85B 3X13B 2CGRH 4F33B 1IL1B 1KN4H 3QHFH 3QDMB 4LKCB 5D7JB 5LCVH 5L6YH 4GW4A 2X4QA 4X6DF 1SYSB 4K3EH 5TQ2H 5E9DE 1LO3L 3WCYA 4XI5D 4TOYH 4D0BB 5ETUB 1W8OA 4ZTPL 2AGJL 1TJIH 1YPZE 3V0VA 5IESL 2A6DB 5FYLL 4PJFB 4NN7C 1MCPH 1MVFA 1JZ5A 1F8TL 4ZUUB 2JCCA 4Z9KB 1FGVH 4PJ8C 5DK2B 4Y0GA 4A6YH 4IRZL 1OPGL 3H3BC 1Y6NR 4Z7WE 4BFIA 4TUJA 4X8JA 4OCWL 2CJUL 2BOCB 1F00I 4KU1A 3NGBB 4Q2ZA 5DF0A 1ZLUH 1D7FA 3RWEA 5I6XC 1WGOA 4OCRL 2WP3O 4WCYL 5A2LH 5DMGD 1H15A 3WUWB 4C54A 3GIZH 2KL6A 3MRPB 2AJZA 3BKYH 4CADA 3PP3K 1CFQA 1T20B 4C4KO 4X0KA 1WISA 4OF0A 4D8PB 1EAPA 1JGLH 3UPCA 1HINL 3ARFA 3JWOH 4K3EL 3T0EB 3UTTE 4JKLA 1URLA 4UQ3B 3V8CA 1VACA 3PJSA 1WF5A 3TVMC 1LDPH 2KZ1B 2Z91A 4ONGL 4TNWK 1DBMH 1NGWB 4MVBD 1QSEA 4QWWC 1CFBA 4PRHE 5CP7A 4PJFE 4PY8J 1OY3B 4LLUA 5HHVH 3L6FB 1ADQA 4TNWF 4YXKL 4I0PB 1P7QA 4CAGA 5KZCB 2DIBA 2X4OA 1YPZB 2NY3D 1CFNA 1DLFL 1YJDL 3KPRB 3T4YB 5HPMA 5E8DL 5SWSD 2X89D 1A2YA 2DM7A 3OXRB 4M6AA 4M4RA 5IW1A 2PYFB 3QZWB 5TDOB 3WXVL 5TDPB 3O3EA 3BZ4A 3KPMA 5IK3B 1FH5H 4H1LA 32C2B 3MCKA 2BJMH 4OCSH 1CD0A 1MH5B 3L3GA 5HD8D 4B5EA 4DKEH 3IDXH 3Q5TA 3HR5B 1JRHL 2BVTA 4P5MB 3MRRB 5AZEH 5KSAA 4FFZH 4HIEB 3QG6B 4J7RA 1BFTA 3O6LH 4QHNA 5E00A 1ZLUK 1FL6A 4MJ6A 3BXNA 3WNPA 5M7QA 4X4XA 5I30H 1T21B 3IDXL 4Q6IA 2PXYA 4OLUH 4ODXA 3C6SA 5EPMA 3QDHA 4JFQA 4XCFH 5EIIA 2PTTB 1BIIB 2Z92A 1QRND 4PRPB 5KN5A 5DD6B 5C6TH 3TBYA 5HTSA 2EE3A 2XKNB 2V6HA 1DQML 3UBXG 3MRGB 4EDXA 4GRMB 3KJ6L 3UYPA 4MA3A 2WK2A 4I0PC 1QSEE 4J12A 4JN1L 2LTQC 4TOYL 3D2UB 3GI8L 4HX1B 3ZSSA 4PFEA 2VQ1A 4Z7OE 1PG7H 1I9JH 2GIYA 4JG1L 1ZA3A 4WWID 1G0XA 4ZSOB 1CZ8H 4P99A 5EOQH 1JF6A 3RBSA 5F7DA 2E27H 2BNRB 3SEPA 1UQSA 4HW6A 3CFIC 1F11A 2I60L 2VLMD 3UTPE 2VLRD 4XMPH 4HUVA 3WN5B 2MCPL 3RRQA 1E27A 1EHLH 4D0CB 1EEZA 2ZSWA 4HH9A 4XBGA 2J8UB 1CT8A 1DDHB 3M17B 4HFWA 2H26A 5GRYA 5IVOA 3FB8A 2PN5A 1MHHA 4W81A 1Y0LB 5JXED 3OAYH 4YHYC 1AD0A 4NPYB 1P53A 3O3UN 4R4ND 4X8XA 2NX5B 5DMIH 2I26N 2OQJA 4O2CB 1RZFL 1X5IA 1FFOB 1AKJB 3ARFD 3WFHA 1JNNH 5MP6L 3T2PA 3DYPA 1MLCA 4GBXA 4XCYB 3GSUA 1BQLH 3OSKA 5TE7L 5FM8A 5IROA 1YYLL 1EUUA 2B1HL 3VFRB 2R0ZH 3C8KB 2KH2B 1KCVL 2X5PA 3EYQD 4YK4C 3QUMA 3CFBB 4HWEL 3DXAD 1BD2B 1CQKA 3VXQA 1P5UA 1DVFB 5F21B 3O4LB 3T65A 1YJDC 2QKIA 3ARGA 1S9YB 3ULUF 5FYKU 3HKFA 1V7ML 1GGYA 1WBXA 1MCFA 3QHFL 2Q8AL 2Q86B 2OTWA 5KS9E 1ACYL 1OF2A 2NZ9C 3G6JF 5EOTA 3JTTA 1LO4H 5DQ9A 1UENA 1I1FA 4UT9H 3BH9A 1ZLSH 4HPYL 3SBWA 4C56A 4I0KA 3MRBB 3EDKA 4PJXA 4JJ5B 4XRCB 1UG9A 4B41A 3PG2A 1J9CT 2B5IB 3KYNA 5IM7A 3ESUF 4UU9A 1BQHB 4XAKD 5KSAC 5KN5B 1CXLA 2AJYH 3C5JB 4XCYA 4RMRA 2F74B 2LQRA 3OB0H 3MRFA 4DGVL 4JB9H 5DZNA 1R3LB 3RUGE 3IFLL 3IF1A 3RTQD 3I2CH 4R2GD 2Z8RA 5J9PB 1HIML 4OGZA 1Q9WB 1V3LA 5A1AA 3BKCH 1RJYA 3ZDYE 2DQFA 5F44A 3OPZH 3QIBC 4APQC 5I8CB 4Y89A 3L5IA 3QFJD 3D25B 3TPKA 4NDMA 2AXHA 3C08L 4U6HB 3PV6A 4UILL 5GGRB 2YC1B 5L8KB 2E9JA 3QDAA 3FO9A 4LKXA 3OR6B 4LHQB 1GH7A 5GGSY 2BP3A 3SGKA 3O3EB 3SGJC 4LOUC 3QUMB 5C8JA 2B20A 1IAOB 5HXMA 3CLEH 2IC2A 3OXRA 2IGFL 1U8QA 3D69A 4JEGB 4V2BA 2BHUA 3BDBA 2VC2L 4XTRC 4Y1AB 3T3PF 3AB0B 4PJXE 2BCKB 1DL7H 1QKZL 3C5SA 2FZ3A 2ADJA 1P7QB 1FP5A 5EZIL 4LSQL 5GRWA 1J10A 1MCOL 3AXLA 4Z7QE 4HIXL 3GO1H 4PV8B 3LEYL 2OTUA 4GRLB 3ZT7A 2ADGA 3VWKC 1I1CA 5SWQA 5I6XB 2HT2D 3VDCA 4FMKA 1II4E 2VITA 4R8WL 3GJFA 3VI3E 2Y36L 3CSGA 1AE6L 1RIVH 1A7OH 1V5JA 1QHPA 3QDJB 2BHZA 1DQTA 4HH9B 5C0DA 2H9GA 1MLBB 2ILLA 3SN6N 4O5LH 2F19L 1M05A 1ZVSA 2YPLE 3KS0J 1FO0B 5F7WC 4GRWE 5DQJA 3LV3A 1FL5A 1DVFD 5HYIA 1EAPB 2XWBB 4KAQH 1IKFL 4X4ME 4K94H 4XMPL 1FFPA 4GS7C 3DRTA 4IRJD 4RGNE 1GHFL 5DMGC 4LASL 2VE6B 1RZ7H 4PV9A 2R2CA 1GGTA 3D9AH 3QIUC 1U8QB 2HFFB 4S1SL 2VWEC 2OSLA 3MNWA 4I3RL 3MO1A 2VB5A 1CN4A 2A77L 5DJAB 2Z35B 4HX1A 4WI6A 3VDBA 2ATKA 4XVJL 4AEEA 1P4BL 4MVBC 3GNML 1JZ4A 2VOTA 1H3PH 4M7ZB 3AB0C 2YD9A 4WHTA 2CR6A 4JO1H 3VA6A 1QSFB 1I85C 4E0RA 5SV3A 5I73C 3SDXE 4XHJD 3LHPL 3H7LA 2C3GA 1BFOB 4KI1A 2UUDK 1C5DB 4QTIH 3QUML 3W39B 5GRZA 3NCMA 3TWCL 4UDUA 3HI1A 3GMNA 2Y07L 2R1YB 5CUSL 4GAJL 4EI5C 5DTFB 4HUWB 1KT2A 3M8OH 5CBEA 1J1XH 4PYGA 5IG7B 1I7TB 2A9NL 5SX4H 4U1KA 3AAZA 3D39B 3Q0HA 1OSPL 2F54D 1AP2A 2KPNA 4GKOA 4ODUB 3O0RL 4LIQL 1U8HB 1OTSC 4PJBB 4EXKA 2HN7A 2WW8A 2XTJD 1DQMH 4HK0A 1CU4H 3WFEL 4MQ7B 2NTFA 1I9EA 2QR0A 3MV8B 4RAUB 5I1KL 1EFXB 1H5BB 2D2OA 2J5LB 3EYOA 3DECA 3O4LA 2D7TL 2Q1EA 3MJ6A 1A7RH 3QIBB 5DA0B 5DVMA 4APQB 3GSNB 3JV0A 5C0RL 1CGWA 2J3SA 1MJ8H 3CFBA 5F9OL 3W11D 3HPLB 3RBGA 5HHQB 3EO1B 4K71C 3SQBA 3S98A 2VZTA 2CRYA 3FAWA 3HE6D 2FRGP 5E95B 3ARDB 3A6BL 3B2VH 1BVLA 2DQGH 4P2RB 5IBUG 5D7IB 3O8XA 5FYKD 1NL0H 3RWHB 3TN0B 1MJUH 1QA9B 3MOQA 4JPKH 4OLXH 3H42L 2JE8A 4BSVA 4DGIH 3EYUH 5D93B 4UT7L 3W5MA 4X7TA 5F1SA 2VAAB 2ZCHH 3ZT6A 1CDCA 4W6WB 3D3VE 4PREB 1XF2A 2VDOH 4QTHB 5JMRA 2UWEE 2BFVH 3GMNB 5EG6C 4XZUB 5BZWB 5ID1B 1FPTH 3MPCA 1LDSA 2VLKD 1NC4B 1YMMD 5IQ7L 2VWEE 1QPPA 1I8KB 2IG2H 4NC0B 4HUUA 1BJ1J 2EYTA 4UT9L 3T08A 3ES6B 1U3ZA 3MGOA 1A5FH 4NRXB 5F8RC 1OAXH 3SHSA 1B88A 4PG9B 4WWKD 5I19H 2YWZA 3GBNH 4PJ9A 2OZ4L 4KKLD 4LLQA 1J1OH 5CIPB 2Y06H 4C58B 3DMMD 4NO2A 3GM8A 1NBVH 4GLRH 2EKJA 3VXTA 2EXWC 4MQXD 3WS6C 3GGWB 1A5FL 4XI5C 2DLGA 1X5ZA 4HIHB 4F3FB 5E7FA 3HUJA 5GISH 3PUCA 5ID0A 4OQ1A 3MRJA 4ELME 3ARQA 1JWSA 1ZE3C 5D71H 5L8JB 5DMKA 1CLCA 3MXWL 1CDHA 3EGSB 1JWMA 5D8JL 4U3XA 2FHBA 2EH7H 3HNVH 4YH6A 3AREC 5F7KC 4WY7H 3BQUA 3TJEH 5I9QC 1IILE 1R3KB 4KZEL 5EZLA 5CINL 2XRAH 2XXMB 5DD1L 4U6TA 4HS8L 5CEXB 2BNRD 4QHKJ 5I1CH 1QRNB 4W6XB 4HUMB 4NQUA 1GVIA 4H5SA 5SWZE 1AD9B 4QXWA 3ZT5A 4L29A 3ZTNH 3AXLB 3RPKA 4KV5F 4LCUB 3H9SE 1GAFL 3GI9H 1SMAA 3L3OA 1EZVY 4HKZB 5BZDB 4RZCA 1MH5A 3L3GB 2IAMB 3SKMA 2LTQB 2YUXA 4WO4B 1MVUB 2FGWH 3U30C 1NDGA 5HHXH 2VDNL 4QWWD 1EFQA 5EUOF 1LE5A 5AG9A 5JHLL 4FQJH 4OUOA 4NN5B 5DYOA 3N1MC 4HZLA 4NDMB 4NQDA 1D5IH 3VFSB 5JW5B 3O6LL 5CWSA 4P5TA 5H37H 1NMBH 5AD0A 1UXSA 5SWSB 2D9CA 2X6MA 3W9EA 3MFFA 3G08B 2WINA 2IQAB 3KG5A 4M7LT 5I8EA 4G8FA 3LKPA 1DANU 2Z93B 4NQXB 1VEMA 2P8PB 1XCQB 1ZS8A 5A16A 2WV3A 5E1HB 4OCWH 3AU1A 4IHOB 3LQAH 4CU7A 2NLJB 3Q3GA 1HEZB 1DUYA 2X7LB 1B2WH 1T80A 5HYJE 1LO0H 1V05A 3BO8A 4YWGL 5BMFH 3LDBB 3NIDE 5T3XD 3FMGH 4JRYE 3MRPA 2H45A 5IFJB 1QFOA 4U6YB 2BSRA 4ERSL 1OAUH 5I8OL 1DR9A 2CLVA 1VFOA 1DBML 4JO3H 4G80B 3IDIA 3MRIA 3MV01 1Q1JH 5JHLH 1W72L 3PL6B 3MLRH 4ETYA 2NNAB 2W38A 3QUXB 1NCCL 1HDMA 3KPQA 1CXIA 2DICA 2WNGA 4ZXBA 1FVCA 3REWB 3FT3A 4UT6H 3TYFA 3PDOB 4S0TD 1ZHLB 4HZAA 4MWFB 4K3JL 3H0TA 4PJ9D 3ARUA 3JWNC 4ZYKB 2ICWJ 3FKUS 3RQ3A 1JYVA 4JRXA 1OARH 2VDRH 4PRBA 3QRGL 4PB9H 1AR1D 3LN5B 2LVCA 2Q7NA 1YEIL 1YMMA 2UWEB 5CKGA 2GW5A 1JTPA 3N85H 1GOGA 5C08A 2XTJB 5INDB 3TO4C 1NQBA 1R3HA 5GRJH 5F88B 2MPAL 4LF3B 4F8QA 3JV6B 2ZPKL 3CLFL 1AY1H 3TESA 3MLVL 4LSTH 2R56L 3CFEA 4L8SB 4IIQC 2XACC 1FVDB 4JFYA 4RQQA 3F65A 1BQHG 5D1QD 3CVIH 3MCG1 3TVMD 3LDBC 2RGSA 1XCTA 5DJAA 2DWDA 5B3NA 3SO5A 2GK2A 4QHMA 4U7SA 2CDFA 4F57H 5HHPA 3MJ9A 4K3DL 2VMFA 2XNAA 4P2QB 1FDLH 1LEIB 4ZAKC 1UC6A 2DI7A 1IEAA 4ONFL 1A14L 2GSIB 2ZG3A 1PY4A 1JPFA 3AGVA 2G60L 3ARPA 3B5TA 4TSAL 1D9KA 4JHWL 3L3KA 3PGCB 3U83A 3FO1B 3V5HA 4WO4A 2XWBA 3T2OA 1KJ2A 5C7XL 4EXPX 4JANB 4BA8A 3TH4T 1MREH 1S7RB 1QSVA 1MWAH 2QQKH 5E6ID 1SBBA 2R2EA 4UOJA 4YDJA 4TPRL 4YHIB 1KLFA 4OLYL 3CCHB 3OHXA 1MIMH 4WW2A 1QLRB 4LQFH 5FUOL 1A6PA 5E2TH 2EKSB 3N06B 2BVQA 1T2QH 3FOMA 5L6YL 4QHUA 3NH7H 4XNUL 5CSBA 4M3KB 4LHUD 4QY8A 1Z0NA 1YEJL 1YY9C 1CR9H 5GGTL 3ZKSD 3LRSB 5J12B 1FZMA 1A1OB 2QHRH 1HKFA 1JWUA 4G7VH 3VXMB 1JWSB 2B2XH 1KLGB 1J18A 2R39A 2WZPD 3GB7B 2VXVL 1U8LB 2ATKB 4I48A 3RTQC 3GSNH 4P3CL 1B9ZA 1RZGA 1QO3A 3FQTB 1NANH 4N1HB 4I3GA 5CILL 5C0BA 3MZGB 2PYFA 3QZWA 5ANMA 2D0HA 5KSAD 4Y5YA 5DJDB 1KCVH 4PJIF 3HAEH 2BRRL 1ZLVK 3GUTA 3ULVL 3MLWL 3RGHA 1L7TH 5C92A 2IPTL 5A2KH 5C86A 2BC4B 1XZ0A 2GQHA 1T5WA 4M8QA 1QVOA 1PQZA 3LVEA 4HLZG 4PUBL 1T66D 1G9MC 3QDJD 1T1ZA 2O5ZL 5F1IB 1D5BB 1QFUL 1FVCB 1T04B 4WWKC 5GGUB 4NQCA 1ZGLM 1IQDB 5F6HI 1VACB 2ED7A 4PTTA 4BK4A 4PYHA 5GS0C 3OWEA 1S7VA 2J12B 3H42H 2DWEB 2WAHA 1EJOL 3LZFH 3BUYB 3IRPX 1CDJA 2OTUB 4TULH 1NGYB 5IWLC 4NZTL 2PYED 2AABL 5D7IA 5I15H 1YEGL 1PKQE 3Q3GB 1WWWX 3PV7A 1PEZA 3AU1B 5FYLD 5FHBL 3E1F1 3HLAB 3IU4H 3WLWD 5K9JH 3RU8L 2ZUUA 2RHEA 2V7HA 3BP6B 2B0SL 3TJHC 5K59F 5DHXB 4MJID 4NZRL 3MV7D 4TVPL 4M62H 1HDMB 3KPQB 2CUHA 3Q2CA 3WFHB 2JCCB 5KVFL 4DK3A 2AJ3A 4NQSA 4G80A 5C0CD 3CSYB 4OZHB 1I8IA 4Q0XH 4N0YL 1TQCB 2PETA 3U0TA 5CGYC 3B9AA 4GMTH 3C8DA 1F6FB 5FCUL 3L3JA 3O0RH 3VXUB 3WSQH 4POZC 2BOBA 3ALPA 5I16A 2GFBA 4FQQB 4K7PH 4LSUL 3O2DA 4LBEA 2PO6B 2FJGA 5CJXC 1E27B 4GH7B 1X5JA 5DZLA 1Q9OB 3IFOA 5CGMA 1RU9H 4KUCF 2HTKC 1AGEB 3E0GA 4JRXB 5SX5H 1ZT1B 1YNKH 1P4IL 1V3KA 4C59B 4P2OD 2PW2B 3UTTA 1LK2A 4XXDB 2IMMA 3MUGA 2JB6A 1DFBL 1J8KA 4LSUH 5DJZB 4ZNEE 2GT9B 3RDTB 1PKOA 3MLPA 3RDTD 5K9OA 1L6ZA 1GPOH 1EA9C 2W60A 4M43L 1MSPA 3ECBA 3RWJA 2AXFB 2GCYA 4DCQB 1NGQH 3P9MB 1CR9L 5GGTH 1A47A 3LKNB 3NIDF 1BQSA 2IGFH 3O4LE 3BQUB 3PGFH 1ED3B 4L3EA 3HRZB 1IGIL 1K6QL 3O45B 4WFFD 1C7SA 3QXDB 4XGZA 2R4RH 3JTSB 2EICA 3S3PA 1HEZA 3MJ8A 4KK9D 3GSOB 3SCMD 5D2LA 4HPYH 3T2NH 3GRWH 1MWAB 2N7AA 3MV11 2VJXA 3QI9A 5ITFB 4K3JH 4JDZB 2NX5E 3ZZ1A 3NFNB 2F5AL 3NPSC 3DO3A 3P4OA 4HKBA 1QBLH 1NCUA 3O4OC 1E4JA 4LGPB 5ANME 4DVRL 3QQ3B 1P9MC 3J8F7 4JFDA 5BV7H 2ZUXA 2HLFD 3CFDB 1MCSA 1HYRC 1I1AC 3FB8B 4OSUH 4RWYL 3CCHA 4JG1H 1KNOB 3HUJE 1U58A 1JGLL 4J4PD 5KSBF 4Q9QL 1WT5C 1T7VA 1WVZA 5IOPB 1QG3A 4LHJB 4HS3A 4AIZA 3OJDB 4CDGC 1Z9OA 3QDGE 3RI5F 1RK0A 4X9BA 5AG8A 3QEHA 1DUZB 4EOWL 4XP1H 1BPVA 1ORSA 1RI8A 1AQDA 1D6EB 1IC4L 4KQ4H 5D7LE 3C5SB 5KS9F 3O11B 1U41A 3P4NB 3WO3B 1D5XA 4Y4FC 4R96A 4LLAA 3B4NA 1YC8A 5ILTL 2VDQL 2R1XA 1I3GH 1QSEB 3ALXA 2I24N 2OCFD 4JRWA 2XIDA 3JWDC 4Y88A 4FFZL 1ZTXH 4JCLA 1HYSC 5K9KA 3T0VA 3TZVD 4BQ9A 2Y72A 4G6FB 4F37F 1CL7H 1J11A 25C8H 5DMIL 3WJJC 5ICZB 3LN9A 4NP4L 4GUPA 4L4VE 4R4BB 3MJ7B 5ADOL 2X1XR 4Z7UB 2Y4SA 5FO8B 4NGHH 3ZKXC 5F3BA 4XC1H 5FYKE 1FVEA 4Z7VF 5CZXC 5D1XB 4PJBA 3QG6A 1ZHKB 2WBJA 4JGUA 2V17H 2VIRB 4L4TB 1OARL 2VDRL 4Z18A 4HK3J 4YHNB 1BVLB 2W0PA 1VESA 1UVQB 3EOAB 1IBGL 3QXTA 5IGXH 3VXOA 4LPWA 4JANA 4ONGH 1WCBB 3MBEA 5B21A 4D9RE 5GZOC 5IG7A 4YHKH 4PJXF 1LHZA 1YYMH 3O8XD 2RCSH 1E4XL 5DD5H 3QH3B 3RA7H 1F4XL 2NXZD 3ARGB 4DW2H 3CH8A 3F7VA 4IMLA 1E28A 4HWZB 2NXZC 1WAAE 5E6IA 1KACB 3CK0L 3HMXH 4V1DA 5BW7A 5HYQB 5EO9A 2KUTA 1KENL 2NYYC 3VW3L 3L9RB 3BDXA 4FQCH 3LIZH 3GEWB 4WO4D 1HOCA 4U1HA 4JZOB 2R56H 1F6LL 1EEQA 3BEVB 3BP4B 5IROC 4I2XB 4R2GC 4MNQE 4PD4K 4YHKL 3PWPE 4LARH 3H9YA 3EJZD 2XPGA 4WFGE 1F4YH 2PYEA 2VL4A 1OTTC 4P46D 5GGRY 1UEYA 1NAMB 1DDHA 5HHMB 2X40A 4X0KB 4UDTA 1C5CL 5ECJE 3OKDA 3PHQB 4BQBA 5LAXB 4JHAH 1XGPB 4R0LA 5DD0L 3L3DA 5I1CL 3GMRA 3HA0A 1RJLA 2VDOL 4DW2L 1HHHB 3VWKA 2YRPA 3GKWL 4YE4L 5CD3B 3ARSA 2JIXA 3I6GB 4Z7WB 3P4MB 4HV8A 4ZAKB 4MCZB 5HHXL 4JZJC 4Y16A 4U1JA 1MAMH 1I7RB 2EIEA 3S7GA 2VLLB 5DJ8B 2Q20A 1BEYH 3H9SD 3UTZA 2GKIA 1FFNA 2AV7B 2F5BL 3AUVA 3VJ6B 2ATPA 1IAIM 4MHHG 5D71L 3CDFA 5HD8C 4H5SB 3O4OB 4M4PA 5F3HA 2ZCLL 1N0LA 3V0VB 3G5YA 1LP9B 1CBVL 5C0BD 4ZQKA 4XWGL 2R69H 5EZLB 2P5ED 3VH8G 4OQTA 3V4VH 2KKQA 2D03H 2R1YA 2P46B 3D3VB 2H6PB 4LFHD 3CFJB 5IVXA 2G5RA 2AEIT 1JF1B 3QQ9D 3GMMB 3OR6A 1JI2A 3HRZA 3VRIA 2AK1L 2G5BB 1WWAX 1K4CA 1ND0B 3LRSA 4NKOA 1XAUA 3NAAH 4V2CB 1Z6JT 4NQVB 1VADA 2X4NA 4P2RE 1JIBA 2P8PA 5HVGB 5BS0E 3DX8B 4FMFA 2COQA 3PGDB 4ZOAA 4FQXA 3ZLQC 4ZFOB 2ADIB 2NQCA 4AEFA 3T4AA 4X9HA 3CH1B 1UADC 2AJXL 1KULA 3BZFB 1A0QL 35C8L 1DVFC 4ZNEA 1Q9LA 4NO2B 5JXEA 1JK8A 1A6AA 1DQQA 3E8UH 4NQDB 4XXDA 5TQ2L 4R90L 5CMAA 1SMOA 2KBGA 5CSZB 4PG9A 2GJ6A 1C5BH 5HHMD 4KROC 4UU9B 3PQYE 2YZ8A 4PRID 4ENEC 4LBEB 1FL5B 2WWMD 4YR6B 3C60C 4PJAB 1PLGH 4AH2A 5F6IC 3VXRA 1S9XB 3B3IA 4L3AA 4RMSA 1G1YA 2AGJH 4IOFD 2W9DL 4XC3H 3I3BA 2JJTC 3N50A 4KMTL 5F70A 4PJCB 3QNXB 5F7UA 5B38B 2ZCHL 4S1QL 4RDQF 5DT1H 3OAZK 1ZVYA 4FQHA 2ZNXA 1NSNH 1K3IA 5I17B 1MHPH 2CIIA 5TF0A 5FA4A 1I1YB 3VFTB 4N90D 5EC2A 1CL7I 1G7MA 1AO7A 5CCKL 4NM8H 2FWOB 3HUJF 4MJ2A 5GJTL 2F8OA 1NCBH 2JJSA 4HCRA 1FFOA 4C55A 3BH9B 3TBTB 5AZ2L 3CSPA 4NHUB 1AD0B 3ILQD 4JQVA 3CZFB 4EUPG 4NCC2 2NTFB 5C0AA 4NT6B 3IKKA 1WZLA 4N0UB 4FQ1L 1XIWC 5LQBH 1PBYA 3PDOA 3ELAT 3PWJB 5T1LA 2HN7B 3INUH 4D9QD 4J2XA 4POUB 1KPVA 5J6HA 2AQ3A 2DQGL 3S4SB 1T0MA 4PLNC 2VIRA 4L4TA 3QI9D 5C0JA 4PP1D 3VWKB 2F74A 3HZKB 3NFPB 5MEOB 3U2SB 3ZL4L 2A83A 2XA3A 4YBQD 3RZWA 2DMCA 3WS3A 1QNZL 4NC1C 5IMLA 4XPFH 3CLEL 5B3JF 2VERN 3HE7B 2BFVL 2BSED 4NIKB 3VXMD 4PJ9C 3RNKB 2AQ1A 2P1YA 4UV4H 4HHAB 1WFTA 1BM3L 4QRSB 2PYEB 4GS7B 4U2YA 3TWCH 1JZ8A 2VN7A 4EQ3A 5DJ6A 5D7JC 5T5FH 3SDDB 1B90A 4DN4L 3C87A 5HGBB 2EIZA 3GJEA 3P0YH 3VRIB 4GJTB 1FZMB 4ALAL 1EFXD 4E41A 4IEFB 4ODSL 1QR1A 2BMKB 1IEHA 3VXSB 1VENA 1P7HL 2V7HB 5CLTA 5I1EH 2EXWD 5JW5A 4QRQB 3RKDC 4ONHA 5LGJA 4TYUA 5BQ7A 3MGTB 4XNZC 4X6BA 4NFCA 2FATH 4HEME 3DV4B 3SPVB 5GRVL 3ZL4H 1KTLB 5EWIL 4DOHB 1P9MA 1CLZH 4FZ8H 4JM4H 5E5RB 5C6WH 2GJ6D 2HH0H 4YHIA 3U4EA 1RJZA 5KOMC 3IFPA 4GKNB 3KPSE 1M05B 1ZVSB 1SJEA 4LRIC 2ICCA 2GTWB 4HBCH 1HHHA 3B2UC 3FQWB 4G6AC 4P23B 1HHIA 4P23D 4JVWA 3WIHH 4J8RB 4KTYA 3OGOE 4TUKL 2X89A 5TE4L 5K9QG 3R8BB 1T1ZB 5F1IA 5CD5C 1MFEH 2ADGB 2R8SH 3FFCD 1FNGB 3HMWH 5D6CA 5H35B 1DP0A 3P11H 5FB8B 3C08H 1MCKA 4XPAH 1CFNB 4HBCL 1MPAH 3U6RB 1RZ7L 3ARYA 3KXFE 4LLUB 2CDFB 2HT4C 3MA7A 3FONB 2ESVA 2O26U 3MV7B 2DKUA 2HH0L 3S36H 3SDAA 1J0IA 2UVEA 5MEQA 4OT1L 3BZEA 3V0WL 5CZVL 2AJUL 4NUJA 2GSGB 2HT3C 2K3TA 3OF6D 3DRQB 3UDWA 2VDPH 5DXWA 3FFDA 4GKZA 4H20H 4KK6C 1BD2E 1UYWH 5E4EC 3Q1SH 4I9WD 1G9EA 5KANI 4MDJA 2BSSB 1B0WA 4PTUA 2ZNWA 3BIBX 3S97C 1UGNA 4JG0L 3X14A 3FFCB 4OT1H 3TBWA 1T20A 1T89A 3U82B 4ZMAT 5K9JL 1RV6X 3RWCB 3S5LA 2IADA 3L1OL 2Z92B 1BP3B 3SJVD 1OW0C 1FGNH 4Y2DC 3CXHK 3BD3A 1NKRA 4CMMB 4JY6B 4LFHG 5IB2B 2DQCL 3C6SB 3RWEB 3ZE0F 2EKSA 2FX9L 1KC5L 3HTLX 1FFNB 2AV7A 4NNPH 4GRWH 3B9DA 1H8OA 1P2CB 3QWQB 3MA9H 1CLOH 4MCZA 3WXWH 4WDIB 4MDIB 3MR9A 5JIHA 4XHQA 1ZHKA 4WIQA 2WUCL 15C8H 3BJ91 5ALCH 1JNLH 4P0DA 5BXFB 1ZLWK 3CXDH 1A6ZB 5T1KB 1KIRA 3A67H 3NIGE 5T5NG 4IOSD 4PR5A 1W0YT 4IMKA 4BSVB 2CMRL 1HN1A 2X1OA 3C2SA 5D7SL 4OF6A 5TDOA 4XBEH 5J11C 3SCMC 1HQ4A 1G7IA 4FTVE 3BD4A 3MRKB 4PJGE 4OM1L 2R2BA 3I2CL 3QSKB 4OF7A 2QQNL 3SDDD 3ZDYF 3BEWA 2ZOLB 4EDWH 4ZFZA 2FJHA 1EV2E 4OD1L 5JIKA 4TSAH 5D1QB 4XP4H 4FQHB 4YQXL 3B6SA 4LVOC 4ZFGL 4R90H 4FFVC 2WBWB 1T5XB 4FFWC 1L7IL 1IM3A 4RNRA 1VKXA 4AY0A 1D5MA 4QRPD 3QCUH 1YDPB 4Y19D 1RD6A 2R0ZL 2BSTB 3EYSH 2FO4B 3CPLB 5EU6B 2DLIA 4HJGB 4OI9A 3GHEH 1OGTA 2ICEA 2DQFB 4EEEA 2YN3A 3T0EA 3UBXB 4WFFE 4EUPA 4QT5A 4I2XE 2BJML 3QPQC 4AG4L 1QP1A 5K9OB 3B9KC 3VD5A 4M6NL 4FN0A 2FGZA 1B0GB 1A7QL 3NA4A 2ICWB 1U2HA 3VE0A 2MQCA 3QO1B 1RURL 5JTWA 4YXKH 1U58B 2H2PD 3TT1L 3DUSB 4OGXL 1RVFH 1TVBB 4NQTA 3SDYH 1T0NB 3VGGA 4KH2A 1MNUL 4JPVH 2XFXA 3GJFK 1I4FB 1M71A 5C0FA 3U0TB 3WE6A 1ONQB 3F12A 3JTTB 1IRAY 1TTFA 1BIHA 2DQTL 2D7QA 2PXYC 4YXLH 4AEIL 3UBXI 5IQ9B 3QI9B 2OXHA 3SDCD 1NBYB 1EBPA 3UTSD 3RWCA 3NCYS 2XZAL 1N3NA 2OL3L 1DEEA 4X99A 3DVGB 4JN1H 3QAZB 2PXYD 2PTUA 3NCFB 1BZQK 1A4KA 5JLZB 1T3FA 4JY4A 1FYHB 4J3SA 4PRPA 5DO2C 4K55A 5I17A 4M7ZC 5T3ZH 1XGUA 3JVGA 5GHWH 1MI5B 1ZT7A 4L4VB 1C08A 2D7PA 3QWRD 4Y4KB 1VB9A 2CDEA 3WJLC 4F7EB 5EIIB 3TBSB 1F4YL 4F7TB 1EVTC 1MQ8A 3KNBA 1AY1L 2B1AL 3GRWA 1A3RH 4HLJA 2HFFA 1S7VB 1FE8L 4P49A 1P6AB 1PG7L 1Y0LA 3OKLA 2W65A 3VFUB 2DI9A 4Y16B 3AMKA 3SDYL 2V7NB 1MJ7H 4Z7NF 1GAFH 3GI9L 4Z76A 5IR1B 4JRYA 3IAQA 3GMRB 4PGZA 2IG2L 5IV2B 1TVDA 5IVXE 5ESVB 4ZTPH 1XGPA 5GXBB 4OI8A 4V1DE 3HPJB 1I7UA 1NCAL 1RK1A 2ZUTA 1LDPL 2IF7A 2C3WA 4PGDB 4KMLB 3WIFB 1F97A 1YY8A 2IMNA 4WU5B 2WBJC 1FCGA 1AXIB 1D6VH 1NMCB 4QHKI 3SCMA 1Q72H 4XB7A 2Z31B 3VG0L 1LNUB 2DJSA 1LO5A 2EE9A 4N9GA 2LABA 1F3RB 4IDJL 3NFSL 3GIVB 5T33L 1G7LB 3RUGA 2YA1A 1FBIH 3V0AC 4UBDD 5AWNH 4YO0B 3EHBD 3B6SB 3LS5H 1JN6B 2ZKHL 1IC7L 3BGAA 4NZJA 4C57C 1EIBA 5SX5K 2UYLB 1JPTL 4PJ5A 4M7KL 4PGEA 1CFVL 2C1PB 3G6JB 3ME0A 1B4JH 5GRUH 2A0LD 1FC2D 1H0DA 3QEUB 3IF1B 2ZKHH 1QLFA 1J0KA 3EFFA 3F7RA 3FZUD 4EOWH 2BK8A 4ZS6D 1LWRA 3T3MF 5E24E 7FABL 3C5JA 3RWJB 3EYSL 5EO1A 4IJ3B 4OFVA 5K59E 2IAMC 4XPTL 3BN9C 5HYSG 2V5TA 4LU5L 1VEPA 4WFGD 1PX4A 4MJ5A 4AYFA 4PRHD 2ORBL 4MXQD 4PGCB 2XXCB 2A9NH 1JZ7A 1KJMB 4KKBD 5E8PA 2X1WL 1I8LA 2XG5A 4DGIL 1PDKA 4KI5C 1OF2B 3GMQA 3JWOL 4FFWD 5IHUH 1MY5A 1OAQH 2BY0A 4NRZB 1ZAGA 5L88H 1I1FB 1MFBH 4P59L 5D1ZA 3DETC 1KLUB 1R24B 4Z5RB 3L5WB 5E5MB 5FYLH 3WD5L 2EDTA 1I8IB 1WBZA 5ICYA 5JW3L 3ZE2F 3Q6FB 1A1NB 1J05A 4LPYA 4NRYA 3O41B 5FO9B 1Q9KB 2P43B 4FG6D 1U8KA 3QUKA 4FXKB 4X7EC 1S5HA 2XA8H 2ZUYA 5AEAA 2FWOA 4HPOH 1KYOJ 2ZWLT 2HVKB 3MCLH 5B8CA 5B39A 5FA4B 4NPYA 1ROWA 4P46B 4OZHE 3P4NA 2YUVA 3QCTH 3GSNA 3GRWL 1J7VR 1FFPB 4JFZH 1ORSB 5F9OH 1BX2B 5EBLA 1P4IH 2BDNH 5IFHL 2WLZA 5LGHL 1E4XH 3HCVB 4KPHL 5ALBL 3SE9H 3DUUA 4M61B 3ARDD 1N0XL 5F1OB 2R2EB 4YDJB 2CJUH 3WO4C 3MNZA 3EO0A 3W82A 4R4NC 1GZQB 4JFPB 3IFPB 3QEGL 3ALWA 4KQ4L 5J8OA 4PB0H 5I66B 4M7LL 1NGQL 4U31A 3ZYJA 1GZPB 2MWCA 5HYEA 4PJ5E 4IS6A 5EU6E 1K5NB 5C2BL 3N9GH 3MREB 5D7LA 4F9PC 2Z31A 3UJJH 5FO8A 1K8DB 1OWWA 4L5FH 4X6DA 4L8CA 2NY0D 2FX8L 1A4KB 2KQNA 2LAAA 5C2UB 4Q9CA 1QR1B 2EZ0D 4JR9L 3T4AB 1VPOH 4HDIA 4M6OL 5J1AB 1QO3B 3GHBL 3O45A 1BFOA 4O9HL 3BFOA 2J4WH 4X4MA 3SQOL 3WKML 2H32H 3EZ8A 2BERA 4I77L 5J4MA 3EIFA 4OUUB 5E56A 3I3DA 2NYYD 4E41D 5E8EB 4Z76B 4R4FL 1P4LA 5JHDA 4JFOB 5HYFA 1DQLL 1INEH 2CK0L 5HGDA 3DPBA 4E5XA 4WUUE 4OLEA 1BOGB 3BRDA 5C9JA 2V2XB 4YBQC 43CAB 1F2QA 1JPSL 1CK0L 1N7MH 2OM5A 3S35L 2R2HB 5IB1A 5AD0B 3MNWB 5CJBA 5C0NC 5IMLB 4NZRH 2ADFH 1NUFA 1DBKL 4IJ3C 4MB5A 1CWVA 1B0GA 4LHUG 1IC4H 1WIUA 3IXAA 1HHIB 2IFFH 4JLRB 2CRIA 2ENSA 5D7IE 1CGVA 1S7RA 3IT8D 2OP4L 2JK5A 1U8JB 3INUL 3ZKND 2NY1C 5D1ZC 1XF2B 1NBZB 2LAGB 3GZKA 3HB3C 3TLRA 3QUYB 3T0AA 3KAAA 5LKNA 5GS1B 5DRWB 1U8MB 4X6BB 2YPVL 3NIFE 1NAKL 3FRPG 3S96B 1BOYA 3EBAA 2EYRB 5E99L 1EGJA 1KF9B 3EYVA 1Q0XL 3QP3A 4QRQA 4M03A 4UZGA 3RVTD 4F58H 3HG1D 5HDOA 3HG1B 4IRSA 4JGMA 4K71B 3BKJH 4FHBD 1KXTB 1UA6L 4X9FA 3MRQB 4K94L 3TC9A 5C8JB 1IAIL 1ORQB 3ARFC 3VGHA 4EI5D 3KWWA 1GGCH 3O9WC 1RULH 4K3GA 2V9TA 2DAVA 1H5BC 3L3HA 3LAFA 3HZVA 3EYOB 2OJEA 4I18A 2ZUQB 2N4IA 2VUOA 1ZT4B 3HE6A 1P5VA 2JJVA 3ARBA 3PHOB 2XZCL 1J5OH 3JV5A 1T4KA 2K9UA 2VN4A 2EDEA 3WJJA 3O3DA 3HE7A 4HUKB 1XIWD 4RISH 4R97C 4ZD3H 4U0QB 4K8RH 4RDQG 3MRCA 5CBAA 1UA6H 4WFHD 2A83B 4UB0H 3ETBF 1CDIA 4Z7WF 2IBZY 4N5ED 2EEDA 3IVKA 1LK2B 2BC4A 3MBEC 4WWKA 4PP2A 1QSFE 4XMLL 3VXOB 2EYSB 2P45B 2EDWA 2BY3A 3N1PC 4ORGB 2Q76B 5K93A 1VPOL 2IFGA 1AKJD 1DSFL 4DGVH 2CKBH 2J8UE 2FNBA 1KCSH 5AUMA 3BSZH 3HZMA 3H7BA 2AEQL 4DUVA 1QFUH 1RZKC 2P5EA 2FHFA 3P2TA 3KR3L 2G2RA 1QRNA 2IANA 5T1KA 4OKDA 1FAIH 3EOTL 4QHLB 5KAQF 3IDUA 3LKOB 3IU3A 2D31B 3VXRE 5C0GB 1YDPA 1EGJH 1WEJL 4FQ2L 1BBDH 2V5MA 4HULB 1FYTA 3GSQB 2FBJL 5GS2D 2VISA 4JFEA 4K9EC 1Z2KA 2X4SB 5DDHB 3KHOA 1BIIA 3BPOC 3CUPA 3BP6A 1UB6B 3S3SA 3HHRB 3PWUA 4ODWB 2NZIA 2Q7YB 3IU4L 1HYSD 4NNXA 5E7BA 3X12A 4JKPH 1JV5A 2CK0H 5KJRH 5J3HC 2YMXL 2NW2B 3DUHA 2VSCA 3T77B 5MEND 3BN9D 3GK8L 3GSWA 4I0CC 1P7QD 1TQBC 5GS0D 5I1GH 1PYWB 3L95B 1ZHBA 4BK5A 1DUZA 3SJVE 3BPLB 3CAFA 4GRLC 5FGCE 3QCVL 3MRLB 2WLYA 4JFDB 3SDDC 2BVPA 4WU7A 5IV2A 3SGDH 3QUZB 2AJXH 5BVPH 2ZUVA 5BQ7B 1XZ0B 2R69L 2VZSA 4OBSA 1LVEA 3IJSB 2F58H 1ZWIB 4UTBH 4XPBH 1M1SA 4X7TB 3U36A 4P5TC 4YDLC 1XGQB 1BJ1H 5M94B 5C7XH 5DGQA 3MLVH 4LSTL 3CC5B 2UY7A 3NAAL 4UNTA 1JZ3A 5D2NA 4Y4KA 1IM9B 3EZJB 4NQVA 4KJQC 3UAJC 1ED3A 3X17A 2W1NA 4PJCE 1REIA 1A1NA 5BO1L 2R4SH 3UAJD 3ARFB 4MA3B 5JORA 1B3JA 2DQUH 5IB4B 1NJ9B 2GJZA 1QFWH 5I8CA 2NXYD 4LSRL 4KQ3L 2APVA 1KTLA 3TBYB 1AXSB 3HMXL 4R3SA 2XN9D 2W60B 4KJWD 4TRPH 5CCKH 4YDIL 3FQXB 3V5KB 4PJHA 2F5BH 4QY8B 5C0AD 3OG6B 2D4FA 1KBGH 4U1MB 4OCXL 4Q2ZB 2QSVA 1H8NA 3DMMC 4Q74A 1A6VL 1B0RA 2AV1A 5A2IH 3PWPA 4NJ9H 4OKVA 5IT2L 4JO3L 1QBAA 1SYVB 3BP5B 2EDBA 2LFGA 1RUKH 1MQKL 2YWYA 4EIZC 3IU3B 1A4JA 4XPGH 2NY4B 1NCTA 5DQ9B 1ZT1A 4PRNA 3RKPA 5E5UB 5FKPB 1K4DA 4S10A 4HDIB 5EORL 1YMME 5EU3B 1DE4A 5CINH 3L3KB 3PGCA 5DUPL 3WHE0 5IHUL 1NDMA 4L4TD 1J0HA 4BKLB 3L3JB 5ABDE 4HG4J 1Y18B 4AG4H 4N8VA 3BKMH 4LOUD 1CTOA 3MREA 2PUQT 4MB4A 5HHPB 2W0FA 4LU5H 4GXUM 3O8XB 4YZFF 4LSDA 4JFFB 1BWMA 3TZVA 2N7BA 1PFCA 1SY6L 1YN6A 2DQUL 1YEFL 5D96C 2QADB 3U9UB 5DSCB 5IKCB 4OD3L 4ESKA 2I27N 1MHEB 3BESR 1LNUA 4G5ZL 1ZT4A 3MLZH 4WNQB 2B1AH 3Q6GH 4I0PD 4IRSD 4PRAA 2WUBH 2ZUWA 3TVMA 3HNVL 4KGLA 4OZGB 4KJPC 4OD3H 4U0RB 5KS9A 3WJLA 4EN3C 3WS3B 1H15B 3VFOB 3WUWA 1WIOA 5TPWH 1X7QB 1CGTA 2I9TA 3QRGH 1N5AA 3HZKA 5LBSH 5C0DB 3L7EB 4L9LA 2QADD 2EXYD 1I9IH 4PJCA 5EC1A 1ZMYA 4FQLH 1D6VL 4J1UB 3KNBB 3MLXL 5D1ZD 4LRNH 4HKBB 1DLHA 3BX7C 4MAYD 5I1DB 4MNQB 4KRPB 1UWXH 1PD6A 3TEUA 4HT1H 4V1DD 4YC2C 2IADB 1QEWA 1F8TH 1T89C 2P5WD 5DUMH 5SV4A 3T1FA 3TYGH 4YHYB 3E2HB 3UTQA 3BI9X 4JFXA 2GJZB 3UZQA 1P7KA 1M7IB 2NY7H 3FZUC 4H0IA 5L0QB 4Y2DA 5CGTA 5D7JA 4PJCF 4BZ1L 3WEXA 4QGTA 4WEBH 4NJ9L 1Y6MR 4KY1H 3RZCB 1S7XB 4UAOC 1CICC 2FEDD 3VI4F 4LPVA 5JXEC 3D39D 4KUCD 4QHUB 3W0WB 4E42B 4JFQB 2C3HA 2XWJA 1EXUA 5C0FB 1UWGH 4XBPA 2JCCF 1S78C 1E6OL 3MACL 1RIHH 4HWNA 1I85A 3OF6A 1TVBA 5F96L 1RUAH 1S7UB 3VWJB 2BNQD 4JKPL 3DMMB 4Z7VE 2AXGB 5TPWL 1NC2A 2QLVB 1KJVB 4U1NB 3SGDI 5CEZD 5D9SA 5GZNC 4KFZC 4D3CH 4EDWL 1NH6A 2IPUG 1L0YA 5IMKB 2UUDH 3DV6A 3DX9B 4L1DA 5IHZB 5CMAB 3NABH 4KHXL 1JTOA 4JPWL 3G5XB 1X5LA 2AJ3B 3WFDL 3WL9A 4L3CA 1G9NH 5F89B 4Y16D 2ITCA 3I84A 1G7PA 2V2WA 4OIBA 1EPFA 4Y5VC 1OSPH 4DFIA 4Y8AA 3BD5A 4NM4L 4X9IA 5HYQA 3J7HA 1VA9A 1XF3A 1YQVL 2MHAB 5HVHB 4JO2H 4MAUH 3V9FA 2QEJA 2GYSA 3RVXC 5E2VH 3VFOA 2EDHA 2VR5A 1FYTB 3GSQA 4FQXD 2QADC 2F5AH 5C3TA 3BHBA 3D3VA 5K33A 3MRJB 3AY4C 2BY1A 2OQJB 4ELMA 5IEKA 3CDGA 3LKNA 4I18C 4LIQH 5DJ2B 3RWGA 3G5YB 1KIRB 4WNQA 2C26A 2FB4L 5DWUL 4HG4K 4ZS6C 4YIQA 4BELD 4UV4L 4HIEA 1KPUA 1YNKL 4O5LL 5JW4N 1U95A 1MFAL 1UYWL 4TVPH 5DA4A 1AQKH 5HI5D 4HGMA 4U6VH 1U8KB 2EE6A 3QUKB 5DI8A 3OG4B 3QUXA 5FGSA 1KIPA 4J6RH 3CFKB 5D96B 5DK3A 4HC1A 2ZUQC 3MGOB 1Z5LB 4QTIL 4PGBA 1KB5B 4P2OB 4X7FC 1FNSH 4QEGA 4H0HB 5ICZA 4FRWA 1KPVB 5J6HB 1EMTL 5JA8B 5C07E 3F5WB 1VHPA 4KI5D 1KSRA 4HAFA 2D3VA 2Z8VC 4NC1E 1F4WL 3JVGC 4EN3B 3QXVA 4Z7NE 5TE4H 1XMWA 2ITDA 5FYJU 3L3HB 2ARJA 1AJ7H 5GS0L 3DRQA 3KJ4B 5AZ2H 3PNWA 4YHNA 1T5XA 2FX9H 1R6VA 3JV4B 1UCBH 4MA8H 1BAFH 1DUYB 2X7LA 2P42B 4PUBH 4A2MA 4P5KA 1BVKB 3D0LB 2HLAA 3W9EB 3WS6A 1X7QA 4XMKL 4PJHF 4NKMB 5KS9B 2DLHA 4X6CA 3TA3B 5E6IB 4Q58C 2J2ZA 1U8IB 3DHJA 5C0RH 4IMLB 3BQUC 5KBNC 3UYRL 3SGEH 1A7OL 5JIPA 1NFIB 3MXVH 2GTWA 4I3SL 3SKJH 3TM6A 2IBZX 5H94B 3QUYD 4M48L 1L0XA 4YDVB 1C1EH 2NW2A 2VXQL 5JW4Q 2V2WB 1DL7L 1QKZH 4JQXA 3MLWH 1NEZA 3NABL 3VXUD 2BX5A 1A64A 1BFSA 4OM0L 3P4OB 5B4MD 5T1DL 1CG9A 3VDAA 2C4XA 2GJ6B 1G0DA 5MEPA 1I7TA 4LGRB 1Y18A 1LEKA 3MRKA 2IAND 2L0DA 4GUPB 4JAMB 3GMLA 1BFVL 3OKKA 2VDLL 2Y07H 4OF3A 3IDGA 4F57L 2FSEB 3MZTA 12E8L 2BSSA 2HKHL 4R2GB 3WSQL 4N1EA 4M1GH 2C1OB 3A6OA 1EGJL 3IDMA 2A9MH 2KQMA 1VEOA 4WEMB 1F3DJ 3D5OF 4PB0L 4BFEA 1A3LH 2E9WA 3EFDH 1RZFH 1VSCA 2WSKA 3RFZC 1JJUA 4ZPVA 5IP4A 4QRSA 3MXVL 5IJKC 2AXFA 4LVOB 4ZTOL 4JB9L 2AK1H 2PYEE 2OR9H 3IXTA 4P4KA 1ADQH 1SM3H 4DAGH 1OB1A 1EXUB 1IGTA 1RZJH 2J8OA 4YZFE 4F7MB 5FYLE 5FIEA 2YKLH 5IMMB 4X6DB 2D03L 4ZQKB 3C6LC 4JREC 1Y6KR 1D5XB 5HDLA 3VXPA 4GQ9L 3V79C 5HI3D 5FFLA 3DTXB 4HXBH 2Q8BL 5B39G 3RTQB 1UB5A 3TBVA 4JJHA 4ONOA 4UB0L 2I25N 3MRRA 5KSAB 5HVHC 3MLYH 4JFEB 3K8KA 1AFVH 4QRUB 5ID1A 1NFDA 4ISVA 1B6UA 3K2MC 1NCCH 1K2DB 1IGJB 3IDIB 3FB6B 4X6EB 3IDMB 1MCCA 2HJLB 1ONQA 5FK9B 3P9MA 1U91B 4L5FL 1C8PA 1EAJA 3H8NA 5L0QC 3S8WA 5IF0A 4OLYH 2WIIB 4LCWB 3NFNA 3HZMB 3LEYH 3OR7A 4PJ7E 4X6CB 4OCYH 5GQBA 1R0AL 1ZLSL 4WHDA 2JB6B 5IBTL 4A6YA 4UNVA 2CUMA 1MLCB 1XCQA 2PCPB 4GRLD 3FRUA 5ALBH 3MGAA 4MZ2A 3SE9L 4BSWA 1JTTA 5HYSA 3QAZC 2AXJA 3JBG7