4Z0BH

Crystal structure of the fab fragment of anti-ofloxacin antibody and exploration its receptor binding site
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
QVQLVESGGGLVKPGGSKKLSCAASGFTFSSYAMEWVRQTPEKRLEWVAYISTGGGSTYYADSVKGRFTISRDNAKNTLYLQMTSLRSEDTAMYYCARHNYYGGRIYSMDYWGQGTSVTTSSAKTSPPSVYPLAPVCGTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYDLSSSVTVSSSTWPSQSITCNVAHPASSTKVDKKIEPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody heavy chain
publication title Crystal Structure of the Fab Fragment of an Anti-ofloxacin Antibody and Exploration of Its Specific Binding.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0bH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0bH01
4G6MH 4ZUWB 5TGBB 4AL8L 1S7UA 2Y23A 4ORGB 3QO0B 4PRNA 4EUPB 4FZ8H 4MD0A 1OLLA 4L4TA 1LO4H 4OCLC 2R1WA 2DB8A 4OAWB 4OLUH 5D93B 2J12B 1HHKA 4P59H 1U8JA 2FH8A 4K71C 1FBIH 1N0XL 1CE1L 5CJOL 1JNHB 5AG8A 4ERSL 1MRCL 3R4DA 3TT3L 1U92B 2C4XA 3BE1L 3QCVL 3ZE2E 5E08L 1R3IL 1FNHA 1JIBA 3WYRA 5IBTH 3QDGD 4LNRA 4YFLF 2KKQA 4UAOC 3MV9A 3CCHB 1CYGA 1OM3L 1A1NB 3WIIL 1JK8B 1F4XH 4D0DA 2CH8A 1OF2B 5D2NA 3ZKXC 5EOQH 3RWJA 5DMYA 4HK0B 1TJGL 1WTLA 4LLMA 2DM4A 5IFHL 3EJZD 1IAKB 4XPTL 5DJ0A 4KAQH 5IFAH 5KVMC 1KTKE 2X4PB 4KMTL 4KHTH 2GFBB 1DQML 5IVOA 2P43B 3DGGB 4HJGB 4XP4L 1QBBA 5HGHB 2HRPH 3BP4A 3B6SB 4NFBA 1KB9J 2CLVA 3G6AB 5KVEH 1H8OA 1ZHKA 3HE6C 5E9DE 1UZ8B 4R2GD 4HWEL 3DO3A 1JUFA 2HFFB 5K9KA 5LG1A 1QA9A 3SKNA 1SJHB 2UY6A 5INDB 3G6DL 3SN6N 3QZWG 2X4OB 4H1LH 4JHZA 4N1CA 1FCCA 4XXCA 3JTSA 3P9LB 5J6HB 4JFEB 3L3IA 4UT7L 3MRKA 1KC5H 1KCUH 4TUJA 3L5JA 5IF0B 3OAZH 4TUKL 4ZFFA 2AJYH 2D03L 4R97C 5DURD 3Q6FA 3LVEA 4PJ7E 3KPRB 4G9DA 2YWZA 3GMOB 4ZD3L 2GJZA 4H0HB 5KOMC 3RDTD 2A77L 3RI5K 4PBWD 4D9RD 3GHBH 3STBA 4DKDC 1H0DB 4JZOB 4HG4J 4KUZH 3WFEL 1R5WB 3MJGX 1DJSA 5JHDA 4YFLI 5F7LB 3TBWB 1YJDH 4H8WH 5K9QG 3B4NA 4MHHI 4ZQKA 4Y4FA 2OJZH 4TRPH 4DAGL 3BI9X 1FFRA 5IUSA 1GC1L 1BBDL 1LO0H 1LDSA 2R4SH 3X3FL 5ESVB 4PRIA 1ADQL 1A9EA 1QG3A 5HI3C 2MJWA 3LPWA 2A9NH 5DO2D 2O93L 3EO1A 4LMQI 1NC4A 4KMQA 3KPLA 4TPRL 4GAFB 3CVHB 3QDJA 2FX7H 4XCEA 5BV7H 5KG9A 1KN2L 1HWHB 5DQDL 3NIFF 4WV1B 6FABL 1J1PL 2I60L 3KYKH 1HQ4A 2EYSB 4TNWK 3TH4T 3U0WL 4X8JA 4MXVE 2ESVD 3LHPH 1QR1A 1BHGA 1VFBB 3WNNA 3L6FA 1LD9A 2FNBA 3DVNB 1LE9A 3V0AC 1FFQA 4L9DA 3TZVC 1FFNA 1TJHH 3RHWK 3VA2C 3WXVH 4JFDB 1CFTA 2BK8A 5F6IC 2GKIA 3I2CH 3RVTD 3QIBC 1GGUA 1ROWA 3W39B 4L3ED 4P3DB 1T1YB 2GJ6E 3FN9A 3UDWC 3VXQB 2VXTH 1WWWX 4JPVL 4PY8J 1AIFB 3MACH 4XHJC 3DLQR 1T5XA 4DZBA 4QOKA 4ETQA 3FQWA 1BJ1H 1Z9MA 2IGFL 3MREB 3ZE2F 2R39A 2YEZA 3FT2B 2APVA 1C7TA 2IADA 2NY4D 5C08D 3P4NA 3MV7D 3RY6C 1IQWL 1U3JA 1NL0H 4ZSOB 3H7BA 4DOHB 5LGHH 1Y0LB 4ZUSB 2KH2B 1JVKA 2C7UB 2DLHA 4DN4L 2EIBA 2IG2L 2JK5B 4Q0XH 4XTRD 2E6PA 1UJTA 4M9OA 2O5ZH 5GISL 3VG0H 2X5PA 2KQNA 4KK5D 1X4XA 1EJOH 3ARBA 4JN1L 5BVJB 1XF2A 3MC0A 4MDIB 5DVKA 1WFOA 1MAJA 4ODWA 2MHAA 3GMMA 1KLUA 5FA4B 4F57L 3FQUA 4U1MB 4YFEA 4K3EL 2BNQE 1LEGA 3R06A 1F8TL 2UVFA 2FR4B 3BGMB 4OQTA 4R0LB 1GZPB 4MCZB 5D5MA 2ATKA 4FFZL 5T1MB 1A8JH 4IRJD 4XX1E 5GQBA 1FVEB 5I6XC 6CGTA 4Z0BL 5K9OB 1MIEL 2XZCL 3QNZA 1OW0C 5EC1B 1DUZA 4H26B 4YBQC 4QHKJ 4PJ7F 3RWGA 1A5FH 2W60A 2B0SH 1VFUA 4J4PC 4XNMA 2HTLC 5F1NB 2ADGB 3RIAK 5T3XD 3RHWF 4QTHA 1WBYA 1RIUH 5I9QB 1RJYA 4L4VD 4LU5H 4NQXA 2DTML 1AKJA 4Y4HC 2DWEA 4HJJH 1QQDB 4JZJC 2YPLE 2GTWA 2AK4D 1AC0A 1N2RA 4Y5VB 1GIGL 1KTDB 2XWTA 1YN6A 3EYQC 3U7WL 3HRZA 3KJ4B 3UJIL 5F3BB 3OJDA 4KY1L 4JFFA 5D96C 3NCJL 2AQ1A 2CSPA 4Z7VA 4O02H 1OSPL 2X4UB 2F19L 3DUUB 5IMOA 2EYRA 4BQ9A 2YPVH 3LKPB 4DW2H 4HLZH 1R5VB 1ZEAL 5C8JB 2GUOA 3SGKA 2WMPA 2NMSA 4OCYH 4XB8A 2VE6B 1Z9SA 4NWUH 4KRPC 3CH8A 4HT1L 1HWGB 3IRPX 1AGDB 1G7JB 4K2UH 2CGRH 1S7SA 3VXOA 3D3VA 5HGAB 5JW5B 4GBXA 1OOAA 3MOAL 3NGBB 4MXVF 2MFNA 1UB6B 2PUQT 2ESVB 4WI7A 4OLWL 2UYLA 2XV6B 2V7HB 4G42A 1INQB 4E41D 3TLRA 1I7ZB 2A83A 2JIXA 4OV6F 3A6BL 4X6BA 3ULUL 5DD5H 3UEZA 3QULA 1R3JA 2OI9B 2Q3AA 3D9AL 1W0WB 2UUDK 3WHE1 1G7PA 3QUMH 1L6ZA 1FL5B 2ED9A 2FD6L 1OD9A 4HWZB 4NFCA 2FCBA 3H9SD 4U1NA 1W0YT 5D4QA 4B5EA 2EEBA 1ZHNA 3D39A 3R0NA 1AGEB 2W0FA 3FZUD 1ZGLM 3MV7B 4HPOL 4LKCB 3RAJL 3LPFA 1I8MB 1QRNE 3RIAF 1U8MA 4P9HH 4NCC2 3GKWH 3JV4A 2APXA 1MELA 1OGAA 1A6ZA 3C8KA 3VFUB 3QDGA 3CMOL 4GOSA 1BF2A 4YXLH 3TJHD 5ACZB 1LNUB 4HMCA 3FB7A 5D7LB 1LVEA 4JDZA 1YNTB 5GIRA 2Q7YB 3O45A 3M1BA 4ZTPL 3ZHKA 3QXVA 5FECB 3OKDB 2EEDA 3DMMD 3BUYA 1ZT1B 4JFOA 1I3RA 1ZLWK 3BEWA 4IRJB 3I3DA 4I0CC 4D9LL 1XF3A 2V6HA 3FRUA 2FBJL 4Y16D 1A3LL 4NJ9L 4JR9H 5F71A 5CSZA 3EFFA 1EV2E 1CTOA 1OP5H 5CEXB 1XCQB 4ONGL 4MA1C 3VWJD 4YHNB 1BQHA 1DN0A 4PLJC 4OD1H 5ICYB 5JQHC 5KJRL 1X5FA 1WT5A 1RMFL 1X7QA 5SWSA 2QEJA 1RV6X 1S5HB 4P23B 5KVGL 4JFQB 3ARGA 3SDAC 4PFEA 4NC1E 5D9SA 3AUVA 3QT2A 3R8BB 5DZNA 4KK9C 5I17A 2VDRL 1OGTA 5GGSY 4XP1H 4GRWE 2ZPKL 4NM8H 3MYJA 5E2UH 2L4OA 1RZ7L 3RUGB 4UQ3A 1AFVH 4BFEA 4AQ1B 3O2WL 3NZHL 5I2IA 3ARFB 2YOCA 2AK4B 3RVUC 2VLRE 4UDTB 2E7HA 3HG1D 4YPGA 2Q20A 2VXQL 1LQSR 3MRPB 2D9CA 5JORB 3ISWA 5JPNB 2VH5H 4WO4B 4NHUB 1KB9K 1TTGA 4YO0A 1KJMA 2GIYA 1PG7L 5IHUH 2B2XL 2VZVA 1CDCA 4O58H 3T0EA 3V4VH 4U1LB 1MFNA 1CK0L 1TVHB 4ODTL 1HI6A 2HRLA 3RVXD 3C5ZC 3DSNA 3BOVA 1S7QA 1IGML 5A16B 2FJFA 5EFIA 1UJ3A 3QNXA 3A6CH 3V2AR 1E4XL 5CJ5A 2O5YH 4YDJA 1FZOA 5C7XL 4JPIA 1INDH 1SBSH 3IKKA 5CMAA 4D8PA 4PR5B 1R3LB 2Z4QA 3VFSB 1FP5A 3W82A 2YPKA 4E42B 3Q5TA 4PJIA 4WFEE 1J8HD 3V6FA 3LEYL 1YMMA 3KYNA 3S88H 5L9DL 1M7DA 2R2BA 5HYIA 3MTRA 2GK2A 1FL6B 1B0WA 2BERA 4MS8D 5LAXA 3T1FA 4BSWA 3HZMA 5DUBA 4C4KO 2GCYA 4P2RD 4QRRA 4JAMA 5GJTH 3NZ8B 3G6JB 4HKJA 2V5YA 3MQIA 4PRHB 3R1GL 1BQSA 1WBZA 2CIIA 1I8KA 1NEZG 5FHAL 5L8JB 3KWWB 1CLCA 2FJHA 1JE6A 1QSFB 4WRLA 3SE4C 5BXFB 4G7YL 4MX7A 2X41A 5C0CA 1FZKA 4FXLA 5C08A 5IHZB 4EQ3A 1DQQB 5DHXB 1WJ3A 3WFHA 1BQUA 3B9KC 5FO8A 1MCLA 1T0MB 1JHTB 2NTSP 3N1FC 2JJSC 2LU3A 3QZWB 5KTEH 4AT6B 3CFKA 3CX5J 3O3BA 3GBNL 4JO2L 5K9JL 3RPIA 4RQQB 3V6OA 2DD8H 2NY6C 4GG6A 4XPGL 2G9HB 2DYPB 2G5BB 3QXDA 4LHUG 1ORSB 3C08H 1JL8A 4DQOL 5BQ7A 3RTQA 5I8KH 4HIJB 1B90A 4ONOA 4K3JL 4LVOC 3OPZL 1FG2B 2CDGA 2W65B 5FIEA 1X5GA 2EH7L 3ULUC 5E99L 1QSEB 1BPVA 3S5LA 3VFOA 1I7TA 3VWJB 1JF6A 4P4RA 5DRWA 3O3EA 5FV1L 1IGYA 2FYYA 4NYLB 3BZDA 1CL7H 5F96H 3EYSH 3GSUA 5MERA 3O8XD 1QFUL 2HN7A 3MNZB 3RZCA 4ZS6D 2B4CL 3I9GL 4GRWF 3VFVA 2CK0L 3S35X 1KTRL 1TZIA 2DBLH 2J8OA 4PYGA 4MJIB 5ANMA 1ZWIB 2OJEA 1A7BA 2AI0L 1NPUA 1V3JA 3DX9A 4XB7A 3STZB 4WI6A 5TQ2L 4M93C 1J7VR 5IW6B 1AXTH 2YBRA 2AEPH 4Q9RH 5DTFB 4ZODA 1ZGLP 5TE4H 1YDPA 1MFAL 5DVLA 3IS0X 3F58L 3REVA 3SKMB 4ODUA 5HGDA 1OP9A 1NLBL 2VXUH 3QB7C 1NCTA 4JKKA 3IAQA 1MREH 4OZGA 1EGJL 5E1AA 4KZEH 3QI9C 5LCVH 1QLRB 3H6JA 3MODH 3SDDC 4LLDB 3U9PL 1UKQA 4LDEB 3VE0A 1S3KH 2X9WA 3BEVB 1NCWL 3RU8L 1A7RL 4BJLA 3L5IA 4P46A 2X09A 3WNMA 4ZAKB 1F5WA 2IALA 4MD4B 5GGQH 3G5YB 3RWFA 1KENH 1K85A 2Q86A 5L6YL 1BREA 5F7MC 4PYHA 1S9WB 3F62A 3QDMB 5F6HI 4RIRB 1SY6H 2XY2A 2H26A 4NRZA 1BM3H 4FG6C 5FGBA 2X4SB 4OCRH 3ZKSD 3ULSA 1OQOA 2VC2L 3X13A 1Y6NR 5JZ7D 3GMPA 3CK0L 4R26L 4HCRL 1C5DA 3U36A 1V7NL 3OGCA 1CF8L 4K7PX 1T21B 4S2SB 3RX7A 4UQ2B 4UUJB 4JFFE 1I9JL 3F7VB 3S36H 4HUXA 4APQA 1UVQA 4EI6A 5CLWA 3EO0A 1QD0A 4RGOL 3MLVL 2X4QB 3PQYB 4KPHH 3I50H 3ARQA 4AEFA 1DVFD 1FO0A 1T22B 4NRXA 5I1KH 5IT2H 5GS0C 5GSVB 4KKAC 5EBGA 3H9SA 5E0QA 1JPSL 2AJXL 2HT3C 2FGWL 1W72A 1MFBH 4B0MM 3RVWC 3KPQB 1KN4L 1GGCH 2DMKA 3SDCA 5JDSB 3P0VL 2XI9A 1CFNB 3HFML 3GO1L 4LIQH 2CKBA 5BS0D 4OCXL 1HKLH 4LSPL 4QHUB 2A73B 4DUWA 3RWIA 5EU7E 3ARRA 2XACC 2XN9B 3NTCL 3CNKA 4R3SB 1LDPL 4S1SH 5GS3A 4I3RH 2AGJH 4NZTL 2R9HD 2VLJD 4R9HA 3N06B 3OV6A 1OVZA 1KPRB 5JNYB 2QQQA 4ODVH 1I7UB 4JFDE 4AEIL 3KLAA 4KI5D 3DMMA 1Q9WB 4IMLB 3V4PL 5HDQH 5KZCB 1S9VA 5KSUA 5IEKA 3HB3C 4PJAE 4PY8I 1QFWI 3X3GH 3ZT6A 1NDMB 4EDXB 2CLRA 3C8HA 2AP2A 5D1QD 5I1HL 4Y16A 5TDOB 2A38A 4ZXBD 2Y7QB 5IW1B 5H37H 5D8JL 1ZTXH 1CG9B 2DICA 3TV3H 5D7KD 3H2WA 5KSBA 1HILB 3QDGE 3U46A 3T8XB 1RZGB 1R3KB 3KYAA 4XBGB 4HS3A 2DAVA 2NW3B 1CD1B 4F15B 2YN5A 1XMWA 3HI6H 1VGKB 4ZSOE 4DOHE 3CFEB 1T2JA 1SEBA 4QT5A 1CDGA 1XF5A 3QQ9D 4WHTA 3QJFB 5IKCB 2CRMA 5ISZB 3QHZH 1YEHL 4D2NA 4KHXH 3MFGB 4H20H 3DARA 3ZSTA 5IMLA 3F7PC 4KZDH 2FEDD 2XZQL 4OGAD 4HKZB 1ZS8A 1F3RB 4LSDA 3D2UD 4LSUL 4EOWH 5GGTL 3KLHC 3QUZD 1KSRA 5KBNC 2R56H 5DQJB 1EAJA 2FLRT 4RCAA 3V8CA 3OKKB 1JI1A 4P2OA 4NNYB 5DHYA 4MAUL 4OZIB 3MNWB 4JHBA 3VXRB 4LFHG 3U7AA 2EDRA 2H1PH 3ECBB 4I3SH 4X4ZA 3ESVF 4QHKI 4XGZA 5I74B 3MUZ1 3O6FB 1NCCL 5D2LB 1Z5LB 5CGYD 4OI8A 2A6DB 2RFXB 5DJ2A 2X4NA 1NMCB 3RIFK 3VJ6B 2MPAH 4Z8FL 4L3CA 4L8DA 4D9RE 2B4CC 3WS3B 4L3AA 5JQ6L 3IJSA 2JELH 4MJ6B 3V4UL 4WTWA 1OL0A 1B88A 4PP1D 5A3IC 3CC5A 1NCBH 5E2WH 2AJZB 2F8VA 5EBWB 1SM3L 2ZCLH 3QHFH 4L29B 3REWA 4Q6IA 1J8HA 3GGWB 1CQKA 1W8NA 3L3OA 1M6OB 4JRXB 2VTFA 2HT4D 5ALBH 2EE6A 1DVFB 2LVEA 2PO6C 5F3HA 5E8DL 4LBEA 5EZOH 4U6YA 1RZFL 1YEKL 4JJHA 2O5XH 4MD0B 4DVBA 4L4TB 1NJ9B 1OHQA 5C9KA 1T66D 1VEMA 5EZIH 4XXDB 1U8JB 1HXYA 4LHUD 4E9LA 1NCAH 5BS0B 5F7HA 3OAZK 1TVBA 1PYWA 3ARXA 2GY7B 4RBPH 2BVTA 5F7YC 2F5AH 5J7CC 4TSCL 3OXSA 4X0KA 3L9RA 3P30L 4PTTA 3U4EA 4XMPL 5D1ZD 2NY1B 2ESVE 3JWDH 4ODHH 1PJ9A 1YZZA 4LNRB 1MHCB 4UB0L 5F1SA 2X70B 1XGPB 4K9EL 4NC0B 4PGCA 4K8RL 4CADB 4MNQA 3O4OB 3RBSA 3O9WA 3QUXD 4NQVA 1MCWM 4L5FL 1GZQA 2OLDA 4D0DB 3QNYA 1MFCL 3EUUA 1S5IL 5IB4A 2D7NA 3VW3L 4PJAF 5D2NB 4L3EE 5FOBB 3RWJB 3S3PA 3W9EA 4RZCB 1YPZA 4LLMB 5FYJD 3CXHJ 5FYJH 4L8BA 1RULL 4G5ZL 2BHUA 5DJ0B 1DUYB 4ZXBB 1NCDH 4UV4L 4U31A 4MDJB 1A7QL 1BIIA 2P49B 1ORQB 1A1MB 1N3NA 3DX7B 1L0YA 2P24A 1MAMH 1NMAL 1NLDH 1Q9KB 3RWCA 5E8PA 2CLVB 5C08E 1ZHKB 4X7TA 2V2TA 3MV7E 1S7VA 1PKQA 4MNGE 4NO5B 3FO2A 4QKXB 1Q94B 25C8H 2WUBH 3NAAH 3LRSA 4DTGL 5MHSD 1MAKA 4X5WB 2B1AL 1J1XH 3CLEH 3CX5K 2YD7A 3MNVA 2VZTA 3JTSB 3L3IB 4FXGB 1NKRA 1KLGA 1I85A 4TUJB 2KDGA 4KVNH 3O2DH 5IB5A 4ZFFB 2BVUA 1U6AH 3Q6FB 3NCYS 4P5KB 1JHLH 4KJPC 4QXUH 3BN3B 3FMGH 3CH1A 3K4ZA 3P0GB 4J8RA 1G0DA 3J7HA 4M43L 1FGVH 4RISH 5HPMB 4QTIL 5F72S 1K4CA 4XVTH 3ZDYE 5JHDB 1J88A 2PR4H 5EWIL 1AXSB 3QQ4A 3OR7B 3TWCL 5IV2A 3GSQA 3V0VB 1U8QA 4Y4FB 4WTZG 1KEML 2BSSB 1GPOH 1KLFA 4AYFA 4BKLA 4LAQL 5MEPB 3ROLA 3STLA 5I30L 1WQVT 1DANT 2VIRA 2H8PB 3QXAA 3G5ZB 4M4PA 5B38A 5E03A 5T3XE 4Y2DC 4EN3D 1NC4B 3KPOA 1P7QA 1T20B 5M7QA 1XIWD 5DEFB 2VLMD 3KPLB 1F2XK 1L7IL 2I24N 3QDJB 4XCEB 4RRPG 3K74B 5KG9B 3RUGE 4L4VE 1NANH 3O81A 1NC2B 3E6FA 2AK4E 1V3LA 1HQ4B 4ELMA 4M61A 3ZYIA 1UZ6E 1F58L 5FUCE 2Y06H 2J6EA 4PS4H 2G75A 3IT8D 5JXAH 1AQDA 3T0WA 4HIXL 4TVPD 2YD9A 1QR1B 3OX8A 2XZAL 1LD9B 3L6FB 3K80A 1ZK9A 1LE9B 3ZKQD 4Q9QH 3GUTA 1E27A 1FFNB 5EORH 1MRDL 1CFTB 4F7CA 4QHMA 4P4KA 3HMXA 3VWKD 3AY4C 1AD9A 3WFBL 1LGVA 1B0RB 3UC0H 1G7LB 1T5XB 2BNUA 5HYJD 4N8VG 4NO3B 4QOKB 4ETQB 1TQBB 5AYQA 4G8FB 3OAUH 2BY0A 1H3TA 3H8NA 4JG0L 5C0NC 1BIHA 2YEZB 1C12A 5E95B 2FIKA 4E41E 2NY2D 3FQRA 4PGZA 5IM7B 5IQ9A 1NUGA 5CILL 3HI5H 5KOVC 2IBZX 2BOCB 3K8MA 4XP5H 2UZIL 2ICWA 1WWCA 3IDXL 3HR5B 4DGVL 1VKXA 4ETYA 2VLJA 2BVPA 1FV1A 2XPGA 1BQLL 4M48H 4ZDHA 2X44D 1NQBA 1S78D 4GRLA 3ARBB 1XF2B 4IDLA 3BZEB 4PJFB 1NGPH 2MHAB 3GMMB 3H9SE 1KLUB 3NACL 4BFIB 3FQUB 2ZCHL 4HDIB 2NLJA 1IAIL 3PIQA 4I18C 2K7QA 1QR4A 3P2TA 3S97C 1LO2H 3T0XA 2MNUA 3R06B 3SGJA 2XRAL 4F58H 3IKCB 1AQKL 2WLZA 4G3YL 4PRHE 3VG9C 5CP7A 1CFVH 4DZ8A 4PRPA 3WL9B 5D5MB 4L8SC 2CPCA 1I75A 2WUCH 2J88L 1REIA 2DQTH 1R24A 1CFQA 4N8CH 2E7BA 3UTZA 4JVWA 1N59A 5FHBL 2A9MH 2DLFH 2PXYD 4LCWB 3RZWA 2A1WH 4RX4A 5FYLD 3BKML 1RUKL 2MOVA 3KPMA 3PWPA 3KDMB 2JE8A 4NQCA 4G6JL 4MA7L 2ZUYA 3L7EA 1AR1C 2A6KA 2ICEA 3EAKA 4LFHD 5DK2A 3OGOE 3TF7C 3MRFB 1WZ1L 2PYFA 4NJAH 4PLKC 2EE3A 3I6LD 2BVYA 1WBYB 3ZDYF 1WWBX 5IB1B 4IOFD 4DEPB 1RJYB 1F11B 4PGDA 1UYWH 1FE8H 4JG1L 4NQXB 3LQAC 3RGVD 5CEYA 3B3IB 3C6LB 2GTWB 3D2UA 4JY5L 3GIVB 5KSBE 2OL3A 2YZ8A 3GBML 4OGXH 4I77H 4UU9B 2SEBB 4QXGH 1IL1A 4W68A 1BP3B 2NZIA 4KU1A 4NC1C 4XP9H 4KTDL 5DK0A 4YK4B 4HZAA 4Z7VB 4HGWB 4JLRA 2ZNWA 2OTWA 5IMOB 1WICA 4EN3B 5HHOA 4MMZC 1XIWB 4HUNB 2GUOB 1IGFH 2NXZD 1NCNA 2V5TA 3PGCA 3RUGF 4O2EA 1GAFL 1UADC 2QHRH 4HUUA 2DL2A 4L9LA 4OI9A 3SDXA 4UTBH 5KN5B 4G8GA 4FQLH 3HG1E 3LAFA 1EZVX 1TJIL 1FCGA 1S7SB 4X7FC 3VXOB 5CIPH 3WJJC 2R1XB 1TXKA 2ENSA 3PWVA 1NEZA 2W0PA 5D7SH 4PJ8B 1QLEL 4G42B 1LEIA 5C07D 4M7KH 2YSSA 2A83B 4AIOA 4BH7A 1D5ZB 1UFUA 3AAZA 2V5RA 2DQDH 4JREC 1R3JB 4YC2C 5B8CA 3FO1A 2O61B 1OP5K 5HI5C 3QIWD 15C8L 1G7PB 4FQIL 4YHZH 4YXKH 1TCMA 4A6YH 4HW6A 5I19L 3P0YL 5IQ7H 4U1NB 4HWBL 3TA3A 1PY9A 2PW2A 4CRPA 2OP4L 3DURB 2AQ3A 1ZHNB 3D39B 4ZTOH 4PJ9D 4BZYA 4RA3A 1MF2L 5IVZA 3C09B 1NMBL 3IAPA 1IC5L 1J8HE 3JV4B 1KB5L 3RBGA 5D1ZA 1OGAB 1UKTA 1A6ZB 3C8KB 4FFWD 3X12B 4XMLH 5MENA 3I6KA 3HTLX 5TF1L 4D0CA 1J5OH 3HZYA 5GIRB 1RPQA 1I9EA 4M1CC 1K8IA 5CJXA 3M1BB 5T3ZL 4KDTC 4O9HL 1IZKA 1NGXA 5DFVC 4P2RE 3X14A 4UIKH 1Q0YH 3UTPD 1LK3L 5HVHC 3IU3A 4JFOB 2P5WD 5C2BL 3BEWB 3ULVL 1U8LA 1H5BA 1BLNB 5D6DA 1HXMB 1XF3B 5TFSL 2WSKA 4OI7A 1S7RB 1X6LA 1A7OH 7FABL 1NGYA 3EFFB 3QWRD 4TUOB 1U3HD 1CBVH 4ZS7L 5FGCB 1A6TA 3CPLA 3TO4C 2ZCKL 2R23A 5SWSB 1ACYH 2R4RL 3SBWA 3MLZL 4EBQH 4NBXB 3ARGB 2GSGB 4Y5YA 1OWWA 5D9SB 5EOCH 1CDJA 2F9BT 3PP4H 4JQVC 1MCWW 5CJ8A 5I17B 1OGTB 2I5YL 3AS2A 3MYJB 3FN3A 2FZ3A 1FZJA 4UQ3B 1SJVA 1ND0A 4IOIA 2P4AB 1VHPA 5I2IB 5F7DA 1RZIB 5KSBF 4YPGB 3K1KC 3F6IA 4YNYA 4QHLB 4YO0B 4XCCH 1A3RL 1KJMB 3H9HA 4JKLA 2ENYA 1DBAH 3B83A 2WWMC 3GEWB 1FPTL 5J11B 1JF5A 3TCXA 2H2SD 3I3EA 2E9WA 2FHCA 3ZMRA 3T0EB 3O0RL 5D1XA 2AEQL 3FT4A 4PGBA 1K8DB 2RQ8A 2V7NA 2Z35A 4L8CA 5BRZD 2Y1VA 3P11L 5DS8A 1S7QB 5HHXL 4WUKH 5C0AB 2FJFB 1INEH 5EFIB 1OLZA 1MPAL 3L7FA 5AYUH 3QNXB 1KJ2H 2D9QB 4YDJB 1FZOB 5BV7B 4JPIB 3GJFH 2EC9T 4XNQA 5D6CA 4D8PB 1NBYA 1X5HA 1I1FA 2Z4QB 3ALWA 3CFCH 2ZOLA 1I1RA 2VDQH 2YPKB 5IESL 3Q3GB 1RU9H 4LRNH 4V1DA 4F9LA 3TZVD 2QSQA 3C5JB 1PW3A 1E4WL 2Z8VC 2E27L 3V6FB 1IKNC 3MGTA 3BYYA 1YMMB 1T7WA 2F5BL 3FQXA 3QIWB 4Z0XA 2R2BB 4DKEH 4U0QB 5DF0A 3JVGA 4NKQB 4LCUA 4CW1B 3T1FB 4TNVF 3ILPA 2YWYA 3F5WB 2IAMC 5DUBB 1IEAB 4IDJL 3JV6A 4IS6A 2W1NA 1YMHA 3QR2A 5IOPB 4QRRB 4Z77B 4OB5H 2UZXB 4HKJB 2VXSL 1D9KD 5EPMA 1PKOA 5E5UB 4XBEH 2CIIB 3OKNA 1I8KB 5D2LE 2BJML 1Z6JT 5GS1A 5KW9L 5C0RH 1D3CA 1QBLL 2ZUQC 5K9QI 3BKYL 4MX7B 4LSQH 5C0CB 1J10A 2Y5EA 5IVXE 4MAYD 4X5XB 4N0YH 5FO8B 5SX5H 2W9EH 4XNUH 3KXFD 4KKCD 2QHLA 1OTTC 3TM6A 2GTZA 2V2WB 1EBPA 3UX9B 3CFKB 4MXWL 2CRIA 4NT6B 3O3BB 3UTTD 3RPIB 2VZ1A 4GG6B 5KSVA 1IBGL 3ABZA 3IJYB 3S3SA 2P5WB 1A1OA 1S8DA 4ZUVA 2BRQA 5BQ7B 5HGBA 3RTQB 1K3ZA 4WNQA 1JTTA 2LU4A 4GMSH 5EBLB 2B1HL 4HFWA 1N0LA 3QO1A 4AL8H 4LDLB 1R3HA 4K94L 2QTEA 2FWOA 5EU7C 4WU5B 4K3DL 3S5LB 1I7TB 1U3HB 5AD0B 5DRWB 3O3EB 4WU7B 5BS0E 2A6JB 5C0FA 3EYVA 4JM2A 2FYYB 2WIIB 4O2CA 5GGUA 4CAGA 1NBVH 5I75B 1ZHBA 3CLFL 5MERB 5IB3B 4FOMA 2HN7B 4LSSL 1L0QA 4YBQD 1N0XH 3SOBL 2FB4L 5CJOH 1MHHA 1UCBL 1ZANL 3HPLA 4XPHL 4ERSH 5HY9B 2VLJE 2PYEA 4HPYL 4J4PD 5D7JD 2OJEB 3BE1H 2HTLD 1T5WB 1MEXL 4Q7DA 3QCVH 4NP4L 3DX9B 4GFTB 5E08H 3VGAB 1I1AB 1P4BL 5ERWA 5F1IA 3TJEL 3LD8C 2DTSA 4HUVB 1MQKL 4KI5E 4Y4HD 3NFPA 5GRYA 5I15L 1AD0B 1OM3H 3D69B 3C87A 5EIVA 3WIIH 5F7EL 4OD2A 4PY7A 4OF0A 1OTSC 3REVB 1RI8A 4JB9L 5HGDB 4N8PA 3U6RB 1PLGH 5T3XL 3HAEG 1TJGH 3OMZA 4OZGB 3F7RA 4XPTH 5D7KE 4YDKH 3PWLA 3VXNB 3ZYJA 4PP2A 5BRZB 4KMTH 2OSLB 1DQMH 1K6QL 4X6EA 3UJJL 3VGFA 1A2YB 4LLAA 3EJZC 4C55A 5H94B 1DEDA 1B2WH 3RJQB 3RWFB 3S35L 5IJVA 4HWEH 4I48B 2WZPD 5EU6A 3JWOL 2Q86B 4HZLA 1ONQB 4J3TA 4DKFL 5EU3A 5ESQA 1RJZA 3D85D 5LBSL 2H26B 5E4EC 5DRZA 2DQUL 2FHBA 3VXUA 4JFPA 4MNHB 1FC1A 3VH8G 3X13B 1F45A 4LLQB 2DIAA 4R0LC 2OTPA 3DX8A 3GMPB 3MLRL 5C0JA 2EDQA 4TUKH 3DIFA 4XPBH 1JNLH 2FECL 1B6DA 4OCNC 2D03H 1G6RB 4UINL 3VD9A 1EEYA 2C1OB 2A77H 1TQCB 4KDVA 4RAHA 4APQB 1OSZA 2UWEE 2P8MB 3EO0B 5CUSL 2ADJA 3H9YA 3U0PB 4OGZA 1D9KB 1C5CH 4PLOB 4A6YA 5D2LF 1FO0B 1CL7I 2PKDA 2F53A 1B4JL 4OM0L 5EO1A 4DAGH 3WHXB 1GC1H 3PWNB 2Z31A 3GSRB 1W72B 2VAAB 2CXKA 3CFDA 2R69L 3SDCB 3WD5L 5FO7A 1FYTB 5IVXF 5C0BD 4P5MB 1JZ4A 5CZXD 1I7RA 2BFVH 3MJ7A 1OTUD 2VDMH 3O11A 4NPYA 2CKBB 4N0UB 3CGTA 1A6WL 4UDUA 4ONFL 1XAUA 4OM1L 3BP7B 3RWIB 4TPRH 3KJ4C 4FZEL 2NX5B 3NA9H 2EO1A 4U0RC 4PGEA 4HH9B 3X11A 1KN2H 5DQDH 2CUIA 3GSNB 4K7PL 3TT1H 4P9ML 3IVKA 4JANB 4QY8A 4G8EA 2ITDA 4S0TD 1IAOA 1NAML 4X6CB 2LVCA 4M62L 4XCNA 3U0WH 3WXWL 5FKPB 2EDTA 3RL2B 2YA2A 5DJAB 3LKQA 1WIUA 3BO8B 1N5AB 3GJEB 1RUPL 4FTVA 3THML 3QCTL 1MLCA 1S9VB 3GHEL 1YN7A 3LOWA 4HJ0D 2WWKO 5F9AC 2BCKA 3HE6A 5E6YA 2CLRB 3NGBC 4U1SA 4R8WH 3LQZA 1CLYL 4UOW0 3TPKA 5H2BB 3ZDZE 4JPVH 3TBTB 1XGUA 1H3VA 3KR3L 5T1LD 4HF5L 2N56A 2IGFH 5I76A 3O4LA 3UZQA 1AGBB 1SHMA 1MSPA 1MY5A 4KK9D 3RVTC 3IDGA 5BOPA 4BSVA 2HMIC 1HSAA 1CI5A 2QQNL 4KI5F 3ARUA 5F7KC 4PRAA 5HPOA 1IQWH 4GQPH 3QFDB 3DPBA 3MRRA 3LRHA 4WHTB 2WM0A 3FQNA 5DRNB 1OARH 5FYJE 3QFJD 4RMUA 1AJ7H 5DJ6A 4DN4H 1JPTL 2IG2H 4C59B 4PJFE 2IJ0C 1QOKA 2NY4C 5SX4H 5IMLB 1P6FA 1A6AA 4JN1H 1T7ZA 2DWDA 1ZS8B 1ZLUH 4LEXL 1WBXA 4F57H 1A0QH 3L95A 3EBAA 2IANA 4XTRC 5LWYL 4IRSD 3U79A 3C5ZD 3UZVB 1F8TH 3PJSB 4PJCB 5MHSE 4KK5C 1RZJL 4P2OB 1G7QB 5DHYB 4F7MB 2I9LA 1XR9B 3U0TA 3L3JA 3T04D 4FFZH 4JJ5A 5JXED 5HHPA 4M5YH 2BSED 4Y4KB 3QPXL 4LCWE 2OZ4A 5JW4M 3SDYL 4XWGL 4XGZB 4CL7A 4FQHA 1P1ZA 2XZCH 5DLML 5DJ2B 1QFPA 4JO1L 2X4NB 3BXNA 3VD4A 3MR9B 3GJFA 4IRJC 4L3CB 4GKZB 2DN7A 3DSFL 4LQFL 5EOCJ 2OR8A 3RNQB 4LEOA 1GGTA 1A4KB 2AJVL 1NFIA 3CC5B 2AJ3A 3QDAA 3MRNB 2UWEF 3TZVA 4PJEA 4F9PC 4XC1L 4TSAL 2PN5A 3L3OB 5TE7L 5HYSG 1CICD 2DTMH 3QIBA 5JIKA 4K55A 3UDWA 2FJGA 2D4FA 5F3HB 4LBEB 4LSRL 2B5IB 1YEFL 1JTOA 4U6YB 1MHPH 3NVQA 3U7WH 1I3GL 4OT1L 4BH8A 4KY1H 1MCPL 2H9GB 3DUSB 3I84A 1DLFL 2VLME 4C54A 2VUOA 4WCYL 1JRHL 2Q1EA 1OSPH 5E2TH 1HXYB 2F19H 1FFOA 2YHGA 2XZZA 2BHYA 4Y19D 2VAJA 3VFGL 1TVBB 3RY6A 5C71A 1PYWB 8CGTA 3OXSB 1XGTA 4X0KB 1HH9B 3QRGL 3QIUA 4HT1H 4NOFA 3FFDA 4H88L 1CD9B 1ZLSL 4YHPA 4TVPE 4WI9A 5J6GA 2VISA 3MOAH 5I1EL 5JW4R 3GSXA 4PGCB 3KPTA 4MNQB 2DLEA 3O9WB 2WBJA 5BOZG 3BVNA 4X98B 3MA9L 5ESAA 1IGJB 3GI9H 1BOGA 1T1ZB 3T2NL 3W9EB 3MUJA 3ULUD 1YPZB 4NIKB 2HKFL 3ULUH 5DUPL 4L8BB 5HYJE 2D31A 3D9AH 3ZDZF 2DIBA 4JRYD 1YYLL 1BIIB 3D18A 4M8QA 2HKHL 1N3NB 4ONHB 4EXPX 1V8HA 3TYGL 4KQ3L 2B8OT 2P24B 2ITCB 5TPWL 3QEQD 2DQCL 3P4MB 3QWOA 5E8PB 3VRJA 1Z2KA 1QVOB 4PJ5D 2QADD 1JV5A 1T89C 1S7VB 3FB8A 4KGJA 4BQCA 1PKQB 5TDPB 5HVFB 1NBQA 2JTDA 3FO2B 4RFEA 4WW2F 4PJXA 4PUBH 2WLYA 3TH2T 3P77A 1CDIA 3RAJH 3MRGB 4K3HA 3SKJL 5FA3A 1FNSL 1D5IL 2LABA 3TCLB 1QSVA 1HIML 2BSTA 4NQUA 1LMKA 4R90H 5GGVL 4PJFF 4RGMB 2YA0A 3DECA 5B39G 1FJ1B 4YDVA 5IB5B 3SO3C 3AC0A 1U3YA 3CMOH 5HSFA 1BD2D 4Z7UB 4H5SB 4HSQA 3PUCA 5GXBB 3F7QA 1MJ7L 4J8RB 3OHXA 4QRPA 4IRSB 4HULB 1AO7D 4JO4H 3VRIA 2YUXA 4LL9A 1K4CB 4JDVA 1HEZA 2C1PA 2J5LB 3TJHC 1GHFL 4NRYA 2V9TA 3EZJB 1PD6A 5HYQA 4X4XB 5C09A 5I71B 4MCYA 2IPKB 4O51A 5IV2B 1RK1A 4IJ3B 5KANG 1U8QB 3B5GA 5ADPH 5FYLE 4YFDB 4NJ9H 5EN2B 5J0BA 4BKLB 1ZSDA 3MLYL 4ONGH 5DZLA 1FFPB 1TCRB 4QLRA 4AM0A 5F9WB 2D4DA 1B4RA 4K23H 3BJLA 5B38B 1RMFH 3IAGC 3BIKB 3I6LE 1N5YL 5KVGH 2IMNA 1T7VA 5TF0A 4NQDD 4MJ4A 3OG6B 2AS5M 4RMRA 2VDRH 3VWJC 3MLUL 4F8QA 4ELMB 1VGEH 4Z95H 5DMIH 5L0QB 3VFNB 1RZ7H 1D5XA 4KTEL 1ZA6A 1CICB 5HJ3A 3O2WH 2G75B 4JFZL 1AQDB 1EH9A 2BXZA 3J8F7 3OX8B 1DFBL 1RK0B 2IPTL 2X4TA 5CD3A 2EICA 1MCBA 2D0FA 1XGYH 3D87B 5EO0A 3ARWA 3DYMA 1BVKA 5FK9B 4KKAD 5F1KC 5GS0H 2HT3D 5CD5D 3T0BA 1B9ZA 1KT2A 4ODSL 4P4KB 4MD5B 1AD9B 1ZLVH 1IJ9A 1T0NB 1UH4A 3V6BR 5C0AE 2YD6A 2GHWB 4NUGL 1IGMH 2VQ1B 3W0WD 1K3IA 1C12B 5C07E 5E7BA 2FIKB 3FQRB 3RVXC 5IQ9B 1CFSA 3TNNA 4OD3L 1EBAA 3CDCA 4JPWH 3HZVA 5EA0L 3UTSD 3ROOB 1CU4L 4MQTB 4ZAKC 2BVPB 1FV1B 4N0FB 2P48B 4ZDHB 1YEDA 5ICZA 1N6QL 5IEHA 3HB3D 1E28A 4JRYB 2J4WH 4Z9KB 2YA1A 3SPVA 5L9DH 32C2A 3UBXA 1GGIL 2ADIB 5HHVL 3QEQB 5DJZA 4NO0A 1CGWA 4KMLB 3UMTA 3LN5B 1F4YH 5E24E 3HAEB 5CP7B 4PRPB 4F3FA 3GBLA 1FAIH 4OIBA 2NR6D 2NNAA 2YK1L 1J05A 4KRNA 4PB0L 5DJDA 5T1LA 4KRMB 1A9BB 1IQDA 1R24B 1MCNA 1CFQB 4KROD 3SDAA 4MS8C 3BD3A 4NQEA 1TDQA 3UTZB 1N59B 1T3FA 4HXBL 4G7YH 2HA1A 4XC3L 1NANI 3C2AL 3PWPB 1KPVA 5JTWA 4NQCB 5GRVL 1WFTA 1XF4A 3GSWB 3BISA 2WQRA 1KIRB 4U1GC 4M5ZL 3ZTJG 1U91A 4MGXA 5DK2B 3WFCL 5EB9A 5J1AB 2JCCB 3P4LA 1F97A 3UTPE 5I8EA 1T2XA 4DUVA 2PYFB 1MJ8H 2P5WE 2MCPL 4JO2H 1MCKA 3MLWL 4HMDA 4I5BA 2FLBT 4YBLB 5CEYB 3WE6B 1FZMA 2QBWA 3QXUA 4WI5A 3KG5A 1G0YR 1WAAA 4K3JH 3PG2A 2OL3B 4D3CL 3C5ZA 1IL1B 1CXEA 2OCFD 3EYOA 2B20A 3L5WA 4G80B 3DHJA 4Z76B 5E99H 3RA7L 1KYOJ 1BFVL 3QEGL 4O4YL 1MI5D 3S36X 2BVOA 5HHOB 2CJUH 4HV8B 3GMRB 3K46A 1QFUH 3PGCB 5SV4A 2HAZA 4O2EB 4X6DA 1KIPA 2B4CH 2J8UA 3IJHA 4QF1A 4TULL 5L2KD 2W92A 4HUUB 4L9LB 5GGRY 3LEVL 2ZOKA 4HIHA 2AI0H 4HHAA 4XVUD 5BO1L 3TVMD 3O8XC 3HE7B 1PQZB 3HS0A 4ZS6C 2CQVA 3MRJA 3O3DB 1LEIB 1EVTC 5D72L 5SWZA 3VXSA 1MFAH 3MRDA 1T03L 3F58H 3PHQA 4BH7B 1D6VH 5I1LB 4F15C 3AMLA 1LILA 4OJFH 5B8CB 4NZRH 3FO1B 5BRZE 4XBPB 1I1YA 5KS9A 1EGJH 3HC4L 3RL1A 1IGIH 4F33A 4KI1A 1G7IA 1JN6A 1DEEA 2EKSB 1NCWH 2HFTA 3RU8H 1A7RH 3IB4A 1F42A 3TA3B 3PGFL 3V52L 1H3UA 1U8HA 1JZ3A 1AP2A 3OKEA 4YAQB 2DQFB 4CVWA 2RHEA 3ALXA 1HHJA 4YGVB 3B9KA 2FO4A 3GB7A 43C9A 4H0GA 2JJSA 5L6YH 1U93A 1YEIH 2HJKA 2BRRL 3BESR 2CIKA 3BQUD 4QYOA 1W0VA 4PJEE 1JI2A 1IAIM 3BIBX 1M4KA 4GG8A 1S7XB 4OZFA 1MCCA 2VC2H 3CDYA 5MENB 1X5AA 1U8OA 4NWTL 3I6KB 2YN3A 4M8VA 1IM9A 4HCRH 4D0CB 3AXLB 1JPST 1V7NH 1JHKH 1CF8H 4U6VL 1K8IB 2NY5L 3KHOA 4CU8A 4HKBA 5I74C 1NGXB 5I1AA 3O6FC 2R0WL 3X14B 5A2JH 1P6AB 3MRLB 5JZ7C 5CLTA 3LKRA 1NMCC 4RGOH 5IBLD 2ZJSH 3MLVH 1PSKH 1H5BB 1U8LB 4BZ1H 1JWSA 5IFJA 3V5KA 3O2VH 4Y7MA 1XGQA 1FYTE 1NGYB 4UNTA 5E8EA 3DBXA 1JPSH 2AJXH 3P9WB 3BWAA 4PJ5A 2DDQH 2FGWH 4RWYH 1JWUA 4UIMA 3GJFK 43CAA 4NKOB 3KXFE 1A6TB 4N0UE 5CFHA 2H32H 2VQUA 1KCRH 3NIGE 4OQTL 2HJLB 2R23B 1DVFC 1CFBA 2M2DA 3MRHA 2Q76A 1NSNL 2BMKA 3HFMH 3TBYA 4KVCL 3UTTE 4OCXH 2VKXA 3BPCA 4LSPH 2W38A 4KJPD 1ZV5A 3NTCH 1EFXB 1BEYL 2VDLH 2FZ3B 2N4IA 2YMXL 4X6CE 3MXVL 2F58L 2DOCA 1ND0B 5F7DB 2XTJD 2D2OA 2XKSA 4ACPA 3QI9A 1J12A 3SDDA 3ZL4L 4O2FA 2BDNL 3H3PL 3H9HB 1G9NC 2DBJA 5ENWB 2J2ZA 1M05B 5DD0H 4EUPG 2KPNA 1JGLL 2R9HC 2QSTA 2NY1C 2DQGH 2VERN 1A14H 4PJXE 4PJHE 1L9MA 4S1QL 1UA6H 4Q58C 4X6FB 3MUHL 5HYSB 2V9QA 5GGSB 5I1HH 3FT4B 3SJVD 1VENA 3DXAB 3NH7H 1LK2A 5T33H 1PG7X 4L8CB 3MV8A 2X89D 1ETZB 2JKXA 3FFCB 5DS8B 3T4YA 2VDNL 4JHAL 3NIDE 5D2NC 5SX5K 1A4JB 3B9DA 2NCMA 4HUWB 2CUMA 3CFBA 1A22B 3Q6GH 5D1QC 2JJTA 3TVMB 4ZXBC 1OAZL 2ATPA 2B7DT 4CJ0A 2GSIB 5EOTB 1U8PA 3EOTL 4NQDA 4XNQB 4GKNA 2VLLB 1NBYB 4WI4A 4YXHL 3OZ9L 4JN2A 1RQ5A 3VD5A 4R96A 2ZOLB 2Y72A 3WUWA 3D5OF 1QFOA 4V1DB 2Y25A 5CCKL 1YEHH 1FNAA 1H9VA 5I18H 3WIHA 4KV5E 4HKXA 3PL6D 5DXWA 3FQXB 4CNIA 4HIEA 4U1IB 1V05A 1WEJL 2C4FU 3QQ9C 5GSRB 3L1OL 1Z9LA 4JGMA 4PJCE 2Z92A 4LCUB 4HFUL 3ILPB 1CGSH 2VLKD 1YMHB 1M7IB 2DKSA 2H45A 3BH9A 5D71H 5EPMB 4OGAC 4MAUH 5EZJB 1BBJA 4G6ML 3BRDA 1G0XA 3GSOA 3MROB 4C56D 1CTNA 4GW5A 5GS1B 4PJEF 1LWRA 4FZ8L 4AEEA 2ICES 3W0WA 1QHPA 3RWHA 3T0VA 1E6JL 1NCCH 1XH3A 2ZSVA 4FNLL 2HVKA 4OLUL 2ZP0T 1MJUL 2IH1B 3SKOB 4P2QD 5E8OB 1AH1A 4Z8FH 4QXWA 4BA8A 4X9FA 5E94A 3V4UH 1QKZH 5HVWA 2GTZB 3ARED 4C4KT 1FNGA 1HNFA 5CBEB 1HSBA 1SM3H 3ARPA 5CGYC 5F70A 3TN0D 3ZTNL 2EDDA 2EKJA 2LFGA 1HNGA 3K3QA 3QA3B 1EUUA 4F7EA 5KSVB 3ES6B 3BN9C 5DGRA 4CN4A 2Y36H 4CU7A 5CKAA 3EYUH 2VZ3A 3QO1B 5HHNA 4TOYL 2CUHA 3B5HA 1A02N 5C0BE 2NY0D 4P57A 3O6KL 4W6XB 1WVZA 4WJ5B 1YEKH 3MCKB 4F7PA 3VCLA 5C0FB 3NIGF 5GGUB 4O2CB 4Y1AD 2HT4C 3LS5L 5BZWA 1ZHBB 5T1DH 1UACL 4KHTL 3PNWA 4GMTH 4P5TA 4TSCH 5KVEL 2PYEB 4X6CF 3P30H 4PLKD 3I6GA 5FYLL 5ERWB 1J11A 4LLWA 5E9DA 2XTJB 5AZEL 4C83A 4UB0H 1X6NA 4K8RD 3VFWA 3LQAH 1TQBC 3CZFB 4OD2B 4PY7B 4L5FH 4PV8A 2K9UA 1S5IH 4PJXF 3VW3H 4PJHF 4I3GA 3WDJA 1LP9B 4WW1B 2AJYL 4LCIL 2BVQB 1RULH 2X10A 4G5ZH 1U8NA 4LCCC 3UYRL 2LQRA 3QUXC 4GRWH 1A7QH 1LO3H 3QQ3A 3NIDF 4WW2C 3FTGA 4X6EB 4PJ7A 1Q9LB 3OJ2C 1NMAH 4IRZL 1K2DB 1QACA 5IJVB 1YJDL 3ARBC 5EU6B 1IC7L 4HZLB 3QFJE 2BC4A 5ESQB 3I75A 4DTGH 1JGEA 4TRPL 5L2KA 2QKIA 1YNLL 3H3BC 4JO3H 5DRZB 2P5ED 3VXTA 3VXUB 3RNKB 4KV5F 1BZ7A 4Z7UE 1VFMA 5EO9A 3KPNA 4LK4A 5C0JB 4NN5B 4PPTA 3DIFB 1IKFL 4G9FD 1UB5B 3N1QC 2PO6A 4PJCF 5BV7L 1EEYB 5EBMA 1X3DA 1G7MA 4TN9A 2AXGA 4NKIH 4LARL 1IT9H 4M43H 3TYFB 3JUYA 4QTIH 5JPMA 4KQ4H 5DJYB 2ADJB 1EGJA 3KLDA 1SMOA 4P2YA 4GW1A 5EWIH 4MQ7A 3HZKB 3NFSH 1V3KA 2J8UE 3TWCH 2F53B 1SYSA 5K93A 1N64L 5CHNA 1AR2A 4JQXC 2Z31B 5ITFB 1TJHL 4Z6AT 2NXYD 5FO7B 2EC9U 2C5DC 4LAQH 1R5IB 3I2CL 5I30H 3MJ7B 3C6LC 3GMLB 4XRCB 2VXTL 2GT9A 3O11B 4NPYB 3VMOA 4UAOB 2BSRA 3MBEA 4UDUB 1KG0A 5DGQA 3AREB 1L7IH 4HWNA 2GJ6A 1WC7A 4L4JA 4PGEB 4WWKD 4WFFD 1ZLUK 5DFVD 4ELKB 3IVKB 2XQYG 5DEGB 3VFTA 1F58H 4EN3C 2VQTA 4E5XB 4LCYA 1XIWC 4ZYKA 1E4KC 5F7UA 1NL0L 3QEUA 3CSYA 5CGTA 5LGHL 3LKQB 2NY0B 3CU7A 3MO1A 2XZAH 1FL3B 3ZT5A 3OL2A 4FTVB 1P69B 4Q0XL 3W9DA 4AG4H 3LKSA 4ZOAA 5DRXB 3E6HA 4Y19E 2BCKB 2GITA 1MRDH 4IHOA 3V6ZA 4ZFGL 3LQZB 1EJOL 4M4RA 1FORL 4HD9A 1TZHA 4PJ8C 3WFBH 4JDTH 3SY0A 2HWZH 2I9TA 5AUMA 3P3YA 5T1KA 3U4BL 1G7HB 2WINA 1U2HA 3O4LB 3SE3C 1OQXA 3DJ9A 4JG0H 1EMTL 2BNQA 4EUPH 4EVNB 4BSVB 3T77A 4W6YB 3VWKC 2VZUA 3QAZB 3GNML 4FQQA 1X5IA 4PRAB 3MSPA 3EKCA 3MRRB 3LV3B 1VB9A 1UWEH 2EYTB 5CILH 3ULUE 4ZMAT 4HS6A 1KF9B 3S37X 5DD6A 4ZFZA 4Q2ZB 3O3UN 4EDWH 3IDXH 4N68A 3D0LA 4JRYE 4DGVH 3NPSC 4EI5B 4YHML 4M6NH 1BQLH 1H3GA 3VD7A 2NY2C 1RIHL 3QEQE 5AAWA 2B0SL 2DWDB 5F8RC 1N8ZB 5E6ID 1WBXB 3NACH 4PJ5E 1UXWA 4M1DL 5LGKA 3VFPA 2XRAH 4MA8H 4IIQC 4LU5L 1S78C 1KCVL 1ZE3C 2RJMA 4HJJL 1OD7A 2I9LB 2F15A 4JJ5B 4Y2DA 2J88H 4DFHA 3BSZL 1DQLL 3A67H 2WIMA 3JV0A 5FCSH 2YPLA 4WTXA 3V9FA 4Z7UF 5DWUL 1BD2E 1P1ZB 5CS7A 4RFNB 3BXNB 2NZ9D 3BKMH 1RUKH 1G1CA 3BPNC 4G9FB 4FP8L 4G6JH 2JCCE 4MA7H 2E6QA 1PGRB 5DHVB 3ARDA 4LEOB 1KEGL 1AO7E 4XVJH 2BX5A 5EULV 5GRJL 3MJ9H 2AJ3B 3K81A 5C0GA 4PLNC 2PXYC 1H3XA 5IK3B 3UYOD 1RZKC 3H3KA 4NBYB 4JFED 4CMHB 3DTXA 5KVFH 1U95A 1T83C 4DK6A 3BPOB 4JG1H 5DC4B 3QIBB 3FQTB 4JY4B 2J8UF 4YEEA 5DJXA 3AY4A 1DLHA 4JY5H 5C2UB 2Q6WA 4NKMA 1G6RL 1KPUB 3KPRD 3UO1H 2VLKA 4OZHE 4BH8B 4IOFC 2NXYB 1P7HL 1JTPA 5DJCA 5DD5L 4KTDH 5EUOB 2Z91A 1AXIB 4W6WB 1FFOB 1YC7A 1JWMB 3TBSA 1YECL 1FO0L 4OLYL 2X7LA 1XGTB 2DLGA 4WWKB 5EIIB 5J3HC 5I66B 1KULA 3C5SA 5J11C 3QIUB 4OTXL 1RSFA 4NDMA 1W72L 5FFLA 1GXEA 1NUFA 2NYYC 1KCSH 3SCMD 2R2EB 2VDPL 1KXQE 2VISB 5J6GB 4OCSL 3S98A 1WISA 3VGGA 3CSBA 3GSXB 5SX4I 4J1UA 3U83A 1DCLA 4W4NA 2H6PB 1QLEH 1Y6KR 2CKBL 2WBJB 4P9HL 3BVNB 3S7GA 3IDNA 3O6LL 1DBML 5DMKA 4I18A 4PJDB 3CVHH 3TBVA 2XWJA 1QRNA 3GSNL 2HTKC 2ZKHH 4FHBD 4L8SA 1MLBA 2VDKL 3LMJL 1WK0A 3D18B 4FQIH 2ED7A 4M8QB 5FXCH 1U8KB 5I6XB 5BZDA 3IDYB 1AGFA 5I19H 2FDBP 3HA0A 3PHOA 3QWOB 3HNTH 3F8UB 3VRJB 1Y18A 3MRIB 4HWBH 4WGVB 2OP4H 5KSAB 2BZDA 4JFDD 4RFEB 1HHGA 3QIWC 5CSBA 4X4ME 3P77B 4OFPA 2XG5A 1UM6H 4IM8A 5TE6L 3UTSE 3ULUF 2Q87A 5FA3B 3MXWL 3OKMA 5CINH 1RD6A 1IC5H 3WDIA 2X4RB 1QRKA 1OTSD 4Z78B 2Z9TA 5LVEA 1F3DJ 4PJ9C 4EQ2A 5JW4N 4ISVA 4N1HB 5TF1H 5EDXA 1FLRH 4I0PD 1IARB 5E6IB 3VMNA 1TNMA 4GLRH 4NUJA 5T3ZD 4WWID 5T3ZH 1ZXQA 1VERA 4XP1L 4FFWC 1ZLVK 2C1PB 4BZ2L 1NBZA 2Y9RT 3BHBA 2R1YB 3QG6A 4MCYB 4YHKL 3ULVD 1H3PH 1I8IB 4O51B 3ULVH 1WZMA 2KUTA 2LV4A 5TFSH 2VH5L 3FT3B 2PW1A 3DVIA 2VLRA 7FABH 5IHUL 1QLFA 4RGNB 3S96A 1ZSDB 4KRPB 5JHLL 5HI4C 2P8PA 2Y5TA 4AM0B 4ZS7H 2JCCF 5CWSB 1SVZA 2ZUXA 4YLQT 4OFYA 2ZCKH 3WJJA 2R4RH 3MLZH 3RJDA 1HINH 4MJ5A 2YC1A 1U3HC 3CFJA 2P7TA 3OF6D 5F88A 1D5XB 3OQ3B 1ZA6B 2O5YL 3N9GH 3HPJB 1INDL 1SBSL 3HC3L 3U48A 4JKPL 2VABA 1HHIA 1D6EA 3AVEA 4QRSA 5CD3B 2F54D 5BVPL 4OZHF 5SWQA 5EO0B 1DQJA 3PABB 1A3RH 3PXHA 1MI5E 1XFPA 1BVKB 1WFUA 3WLWD 5I1CL 5INCA 1FPTH 3VGAC 3DXAE 1I1AC 4BK5A 5IMMA 1T4KB 2EE2A 4I8DA 3O0RH 5L2KE 4C58B 3FFCE 4TVSa 3WS6C 5ACLA 1C08A 2AEIT 5HHXH 2H2SC 3SCMB 4D0BA 1RZ8A 5GJTL 1MPAH 5J9PA 3ORJA 2G5RA 4NCDA 4OCWL 5J89A 4LLUA 5C0EA 1IEHA 5CEZD 1ES0B 4KDTA 3TO2A 3HZVB 4LHQB 4MSWA 4YGAB 5IESH 1WLHA 1YEDB 5IHLB 1E4WH 2AV7A 3G08B 5FKAA 3C9NA 2E27H 5IEHB 1JNNH 3TEUA 3SPVB 3UBXB 1TPXB 5FGBC 4G8IB 3WBDA 5DJZB 4B7LA 4NZDA 1CDHA 4NKDA 2YKLL 3TO4A 4F3FB 2VL5B 3EOBB 1S9XB 3QEHB 2NNAB 2VXSH 3QUYB 2HMID 3VXMD 3IGAA 1ZT4B 2KZ1B 5IROC 5FUZL 5TGBA 4ZUWA 4BFGA 3BP5A 2BJMH 5KW9H 4ORGA 4NQEB 3NBNA 4JQVA 1KB5B 1T3FB 1JZ5A 4I13B 5DR5L 1D9KC 3EYSL 1XF4B 4I0PB 2ORBL 1JNHA 1EHLH 3OKLA 4LSVL 5ETUB 2DBLL 2XFXA 3EOAB 3SDCC 1HKFA 3UTQB 2AAVA 4MAYC 1OP3H 4J3XA 4I5BB 1IBGH 1AXTL 3T08A 2AEPL 4WUUD 3CCHA 3A0OA 4KKCC 2D7MA 4MYWB 4UOW1 4LKXA 1C1EL 4HX1B 2B1HH 5D7LD 3MBXH 4K94H 3K2MC 4YUEH 3IU4L 3WJLC 4K3DH 4HK0A 4K3GA 3BDBA 1MREL 1P4IL 1IAKA 3MFFA 5LCVL 1G6VK 3CLFH 1S3KL 3V0WH 3SOBH 2FB4H 1E4XI 4X6DB 2XKNB 3NCEB 1KIPB 4M3JA 2GFBA 3IJHB 4QF1B 1UCBH 3DGGA 1ZANH 2CMRL 3F7YA 5HGHA 4XPHH 5JUEL 5JLZA 3B6SA 3TP4A 2AV1A 1KGCD 9CGTA 2Q3ZA 3G6AA 4HPYH 4AMKL 2XTJE 4HIHB 4R7DA 4NP4H 1KENL 2AK1H 3MJ9A 4TQEL 1IKNA 1JGDB 3TJEH 3HNVL 1MQKH 4XCYA 2W0LA 4P23D 4DWHA 5I15H 2F54B 1LEKB 4OCRL 5J6HA 5D7JC 5F7EH 5SWZB 3MRDB 1LP9E 4JB9H 3PHQB 3GMNB 3HR6A 2HLAA 1FSKB 2IAMA 5T3XH 3MJ6A 3SJVE 5IF0A 1NFKA 2EH8L 1C5BL 4GS7B 4R4BB 1IVLA 3HHRB 2YD3A 2A74A 5GGRA 4NHCH 3ARFD 2J6EL 3RL1B 3KPSD 5FF6B 3JXAA 1G7IB 3SE9L 2DM3A 3D48R 3S36L 3IXAA 2X42A 3GI8L 1M7XA 1H0DA 1K6QH 4WO4D 1BWMA 1WV7T 3UJTL 1WITA 3OB8A 1UWXH 1U8HB 1AP2B 3OKEB 4KPHL 1YUHB 4W81A 3TBWA 4PJBB 3GZKA 1HHJB 3HUJB 1ODAA 3B9KB 3GB7B 4DKFH 5EH1A 43C9B 5I1KL 1KJ3L 1ZT7B 3HMXL 4LLYA 5MP6L 2HJKB 5LBSH 3WCYA 1GGCL 2DQUH 3PHSA 3GK8H 4OZFB 1FIEA 1JPFA 1MCIA 2NY6B 1T6VN 1R0AL 3MLRH 1U8OB 4P2OC 5IG7B 4LIQL 2YD1A 4HMEA 3HNSH 1HKLL 3DV4B 4JHWH 4JFYA 4Y4KC 2APBA 3CVHA 2VLKE 3E8UH 1Q38A 4ZUUB 4I3RL 4URTB 2FEEL 2PTTA 4NN6B 1Q1JH 1KCKA 2EYSA 2HFGL 3MJ8A 4C56E 5CUSH 3JTTA 1JWSB 3VXMB 5EG6C 2APFA 4ODVL 3GKZA 3NCYP 1XGQB 1BVLB 4HWBA 3DBXB 2PCPA 3UZEA 3BWAB 4P2QE 1JWUB 4UIMB 3BGFB 3AGVA 2R69H 4JFDA 3WD5H 4FQCL 4X9GA 3V7AG 3MOBL 2N7BA 4M93B 4RFOL 4YHLL 3MRHB 4HGKC 4P3DA 1L4IA 2Q76B 2BMKB 1UM5L 3VXQA 3TBYB 4PJAA 3B9AA 2VITB 1AIFA 1A6WH 4Z5RB 3BPCB 1GC1C 2B5IC 4PRHD 4ONFH 4WDIA 4HIIB 3MREA 5JOPD 4FZEH 3IFLH 1P2CB 1MCFA 1QSFD 1TETL 5DT1L 1YQ2A 4ZOCA 4C57C 4K7PH 5CZXC 4P9MH 3HI6L 1OTUC 1MRFL 4WUUB 1F2QA 35C8L 4M62H 3SDDB 4ZSOA 1KBGL 2CLZA 3IFNH 5E2VL 4HUKB 1Y0LA 4ZUSA 4Y1AE 3IRZA 1K5NB 4GAYA 2JK5A 2FIRT 1NFDE 1QFWM 2PNDA 3GHEH 3G5VA 2K1MA 3O3AA 2DYPD 1BWWA 2X40A 4KZDL 5BVJA 4MDIA 3QXTA 1LK2B 2JB5L 5EZLB 5FA4A 4CVZA 3KR3H 1U58A 1RHHB 4OZ4B 2OL3L 3RX5A 2R56L 3G9VA 2FR4A 4HJ0C 3ZE1E 4OKVB 3BGMA 4GKSA 3CFBB 4R0LA 1QSED 1VFAA 4OV5A 4DCQB 2ATPB 4IEFB 2QQNH 3DX6B 4H1LA 3U7YL 1FVEA 1MCOH 4GKNB 2FL5A 4I3SL 1LP9F 4YJZL 1B0GB 3I85A 1P9MC 5FCUL 2EDLA 3WUWB 4MQSB 5T5FL 2V5MA 4P99A 3ZO0A 3EDKA 3E3QE 4MA3B 1NAKL 1DTUA 1K4DA 4FXKA 2ZSWA 4MJID 4H26A 3MMEB 2MPAL 4HKXB 5I8CB 1EHXA 5EIQA 3ALPA 4DGIH 4U6HB 5D7IE 4FFVD 3RDTA 3KPSB 3KYOA 2ADGA 2Z92B 3B8SA 4YBHA 3BAEL 3QHFL 4RGMC 2HFEB 2E7CA 2OR9L 1PFCA 3IDJA 3FB6A 5BMFL 3F12A 2R29H 2P5EE 3N0PB 3GSOB 4GW5B 3QPXH 3WLBB 1KTDA 4IRSC 5F3BA 3IFOA 2XA8L 2O5XL 4XWGH 4G9FE 1VADA 4XPFH 5KANI 2HVKB 5C0DB 3T1WA 3MCLL 1TZGH 4JO1H 4G6FD 5ID1B 4ZAKD 4N9GA 5E5RB 5JXEC 1FQ9C 3DSFH 5E94B 1R5VA 2C3HA 2VJXA 4IJ3C 4LQFH 5C1MB 4Z7WE 1DZBA 3FOMA 5DI8B 1FNGB 5IJKC 3QDMD 4YQXH 4YHIA 4HG4K 2EDOA 1U8IB 3ZKMC 5HTSA 1A6PA 3JWDL 4ODHL 4F7EB 1G7JA 3KNBA 5F9WC 5CAYB 4S1DC 3D1MC 4XC1H 5HGAA 4TSAH 1EK3A 5TE7H 1UB6A 3DI2B 2ESVA 2FX9L 1EFQA 5HHNB 1SYVA 1CE6A 4P57B 1INQA 4CN1A 1YEFH 2R2HA 5EUOE 1I7ZA 4WENB 4F7PB 3VCLB 1I3GH 4OT1H 4UNVA 3T3PE 1CICC 5ITBL 1DLFH 3AB0C 4WCYH 1UGNA 1JRHH 4L3EA 1NCDL 5GRZA 2VN4A 3PQYD 3H42L 1FL5A 3VFGH 4QNPE 4WFFE 3WN5B 3LEXB 1NLDL 4HWZA 4P5TB 1GGYA 4MB4A 3LN9A 1MNUH 3QRGH 4FQ1H 2HG5B 3DWTA 4H88H 4TYUA 5FB8A 1ZLSH 4P4KC 5D70H 3QCUH 1NAMB 2WUBL 3NAAL 4LLWB 3OB0H 4C83B 3MV7A 4LKCA 3MLSL 2QQKH 1I8MA 4PJDE 4R4FL 4MNGA 4PV9A 5C6TL 2XWBB 2YD5A 1F13A 1NFDF 4K7FA 4PV8B 2XN9D 3MA9H 3Q2CA 3WSQL 5MEQA 3HCVB 2HKFH 2PTVA 3C60B 1U6AL 1LNUA 4X99B 1U8NB 1II4E 3S4SA 5D7LA 4RSVA 1YYLH 2HKHH 3ZE1F 4RISL 4PJ7B 4KQ3H 3TYGH 1AE6H 5JW4Q 3OKDA 4XVTL 3UCRA 3TPUA 1MWAB 2E9JA 2PR4L 5KZCD 5LKNA 3P9MB 3QUKA 3PDOB 3RWDB 4IRJA 2BC4B 2QKIB 4LGRB 3ZKNC 1CT8A 1GPOL 2NY7L 3SKJH 1FNSH 1D5IH 2VDOL 1D5MA 2V9RA 5GGVH 2QADC 1RUQL 4YHNA 3KPNB 4WHDA 1TTUA 4F9PA 2ZWLT 5ICYA 5D7IF 3VXPB 2DL9A 2GAZB 2E7LC 3RQ3A 3SE8L 5DD1L 1YY9D 2BNRD 2C9AA 4JVUA 1G7MB 1MJ7H 2AXGB 4GT7A 5H8DA 3WO4C 4FFYL 1H3WM 5ISZD 1JP5A 3RUGA 4L4VA 2Y06L 1GHFH 2FGZA 5C86A 3PF2A 2FATL 4LGPB 4GW1B 4PS4L 5JXAL 4MQ7B 2AK4A 4UDTA 4UT6L 2CKNA 3BKCL 3VFRA 3MRPA 1SYSB 5CHNB 5JPNA 4Q9QL 4NHUA 4XP6L 5IIEA 1HQRB 2LTQC 3H7LA 3MLYH 2QV2A 1G9EA 1WWAX 3B2VL 4G6FB 4YBLC 4Z7WF 1EXUB 4U1LA 4A2LA 4CJ1A 3UC0L 2DI7A 3IF1A 4WEBH 3MBEB 4P3WA 4JFEE 1N5YH 3DI3B 1Z3GH 1PZ5B 5J13C 3VXRD 2GJ6B 3GRWL 2AABL 2A0LD 5ILTL 4YDLB 3MLUH 5IR1B 3O6FD 4Y5XB 5DK3A 2M8XA 4KTEH 3KPRE 2XQBH 3P40A 4LCYB 2VR5A 2EDBA 3IDIA 5E1HB 1JJUA 3CSYB 4KJYA 3HI5L 2MQ3A 4FMFA 4PR5A 3MO1B 5EUOF 1DFBH 4E41A 2IPTH 5DMJB 3OXRA 4L9LC 4E42A 3BMWA 1MVFA 3W9DB 1A7NH 4F7TB 5B3JE 3VFMB 3LKSB 3T3PF 5HDLA 3EDJA 2GITB 4M48L 4BK4A 2O26U 3MOQA 1HH6A 3V6ZB 1T89A 2AJUH 3ZZ1A 3CSGA 3HE7C 4FQXD 4I2XB 5GRUL 3QUMA 1U42A 1TZHB 3RKDD 1CZ8L 4JRXD 4QNPF 3BFOA 3SY0B 2I9TB 1LO2L 2CR6A 3WEXA 1NH6A 2WINB 1J0KA 3TIEB 5J4MA 5CD5C 5B8CC 2HH0H 4L4TD 1RIVL 4PJDF 4PRHA 1YNKL 2DQTL 4KTYA 4N5EC 4JZNA 3KWWA 2JJVA 1H8NA 4HS6B 2WWKT 3G04B 4ZFZB 4BELD 2A1WL 5EA0H 4P2CG 1CU4H 2ARJQ 3EYFA 1JYWA 1G9NH 1ZVYA 4PRDA 3EGSA 1DQQA 2NY1D 1N6QH 1F3JB 3WV0A 2NTFA 5HDOA 3EW3B 3QZWA 4YHOL 2I25N 3E2HC 1AI1H 1UEYA 1GGIH 4AT6A 3FOLB 1E4JA 2L7JA 4UV7H 4RQQA 3VFPB 2GEEA 2YD2A 4OLXH 4BQBA 2G9HA 2GK0B 2F74A 2YRLA 2G5BA 3WIFB 1WCQA 4HIJA 4R4NC 1CXHA 2YK1H 4PB0H 5IGXL 5F9OH 4H0IA 1FVDA 2W65A 5J1TC 4ZG1A 1CLOH 2YPLB 4Y8AA 3NFNB 2UV3A 1MHEA 4HXBH 4XC3H 3VWJA 4WFGD 3ARZA 2F8XC 2AKRA 3C2AH 4NYLA 1YEEH 2NR6C 3S37L 5T3ZE 1DL7L 3BPLB 1H5BC 2FH6A 3ARDB 3FO0H 2BNRB 4KROC 5C0GB 1UQSB 1XR8A 3LKNA 5FDYA 3PE9A 3L5HA 4HBCL 2EC8A 1AHWB 4JGUA 1ZWIA 3ULVE 2EIZA 1JFQH 2JLLA 3STZA 1DQTA 2N1KA 4UT9H 1EVUA 5IW6A 3HG1A 2Q6WB 4NKMB 5DTFA 4PGJA 1PX4A 3HC0B 3SKMA 4Z18A 1WIOA 3KYMB 2IH3A 4JY6A 4A2MA 1BFVH 5FUOH 1BQHG 4O4YH 5JHDD 4PJGB 1XCTB 4YHZL 3DVFA 3TBSB 1QLRA 2XXMB 4LLDA 5A2IH 4HC1H 5FDWB 4A6YL 3BZ4B 4Y4FD 3SO5A 3B5TA 4TULH 4RMVA 1FRGH 3C5SB 2XIDA 4ZO9A 5HHQB 3V7MA 3LEVH 4XAKD 2CR3A 2R0LL 4MD4A 5BO1H 4PRID 3G5YA 2VWEC 3T09A 5JW3L 2F54E 3BN9D 1S9WA 4Y0GA 1NC4D 5B3JF 3QDJD 3L3KB 4XH2A 3TBVB 2XWJB 4BQ6A 3DVGB 4XVUC 1IAII 1NC2D 1KIQB 3TVMC 1J0JA 3DETC 3LZFH 4FQXB 1J5OL 4L8SB 1U36A 3VGBA 3HC4H 4UQ2A 4UUJA 1S7UB 2RGSA 3F7VA 4UIKL 2IPUG 4PJBE 4PRNB 1Y18B 3HUJE 3O41A 1YA5A 3BDYL 3PGFH 4N0CD 4P2RA 1UM4L 2R1WB 1FIGL 5CEZE 2EXYD 5AZ2L 1HHKB 2KQMA 1QNZH 3KS0H 1MCRA 2HVJA 4M7JH 4XPAL 3JVGC 1XF1A 3MLXL 5EUKA 2BRRH 4QOKD 3KPPA 1CBVL 3LQMA 5JDSA 1IFHH 1CFNA 4QRTA 4ISVB 5GZND 3U30B 1KNOA 3MV9B 4QHUA 4U6VH 4HQQL 3N50A 3BQUC 4NUJB 1OAUH 4JPKL 1UEMA 4R3SA 2EDKA 3G9AB 2XQYK 3O6MH 5ADOL 2BY3A 4YDIL 3VXME 2DMBA 3MRMA 5ALCL 1NBZB 2LU7A 2Q8BL 3K2UL 2R8SL 3BHBB 3FAWA 4YHYB 3CVIH 3BKJL 3NA4A 2RAMA 4FABL 2HT2D 1EA9C 3ARBD 5JNYA 1RUAL 4XCCL 1QYGL 1I7UA 5IWLC 2G60L 1RJLA 2VLRB 5DYOA 1BVZA 1DBAL 1GGBL 1QLFB 3NMEA 3S96B 4XAWH 2ERJB 3VGDA 1Q9WA 4IMLA 1T80A 3BP4B 2EECA 1IRAY 1JMZA 2BHZA 1OB1A 5IBLC 1CDBA 1NDMA 1BZ9A 1A7PL 4OQTH 1JUFB 3O8XA 5K9KB 1QA9B 2Y7QA 3SKNB 5IW1A 2OQJA 3U9UA 3UPAA 4KVCH 3V5DA 1CIDA 1CG9A 3FL7A 3LDBC 1HILA 3ULVF 1A6VL 2OZ4L 4GH7B 3T8XA 4MJ5B 1R3KA 1WUNT 4WUUE 3SQOH 1INEL 3MRKB 5AYUL 1CD1A 1HN1A 2YMXH 4LCWD 5M94B 3MXVH 5D7LE 1VGKA 4BUHA 2MWCA 1NGZA 4OFIA 2VABB 4QRSB 4G9DB 3QJFA 2GJZB 5SWQB 5IKCA 2BDNH 1FC2D 3H3PH 3NN8A 1N4XL 1RU9L 3LS4L 4LRNL 5HHMD 1CLZH 5INCB 4LRIC 3S5LG 1JGLH 3TNMA 5IMMB 4S1QH 2XTJC 4DKEL 5DSCA 1AKJD 2D7TL 2Q8AL 3C6LD 1KGCE 4HKZA 4M6OL 4FQJL 4IMKC 4X4YA 4ZQKB 5I1IL 4JHAH 5DQJA 2VXVH 4PRIB 1RZ8B 1A9EB 3PP3H 2R0ZH 4OB5L 2DRUA 3QBTB 4BUGA 3W2DH 3MNWA 1OAZH 3CDGA 3GM0A 3EO1B 5A2KH 1SY6A 5F21B 1OP3K 1QBML 3ECBA 4YXHH 4UTAL 3OZ9H 2R0KL 4LSQL 4GLRI 4MVBD 5D2LA 3DYOA 2RFXA 3MA7A 4IBLT 3VJ6A 1F4WL 2AV7B 3KPSE 4FS0A 2RIKA 4NZUL 3D3VD 1X4YA 3EFDL 3ZLQC 4MJ6A 4NQSA 1QO3A 4HXAL 4EIGB 5IVXA 1WEJH 2BP3A 4X8JB 4G6KH 2AJZA 2AW2A 1E6OL 4PJ8D 1J18A 3L1OH 4TVPH 4PJBF 3M8OH 3HUJF 5FM8A 1P7KA 2JIXD 3WKML 3PL6C 5A2LH 1M6OA 1OAYH 4PREA 3MCG1 1DVFA 3IGAB 3BWUC 5KVDL 2WV3A 3RFZC 2X1XR 3BP5B 5ACMA 2AXFA 4UBDC 4DZBB 3FQWB 3UP1A 4GXVL 3T2PA 5K33A 1NJ9A 5IBUB 1E6JH 4FNLH 3SGDH 1NBVL 1MJUH 4XXDA 1FNEA 2CDFA 5BS0A 3D39D 4W4OC 2IADB 4NZJA 3P4NB 3OKLB 5FYKU 1N7MH 3H7BB 4EIZC 2Z31C 1FDLL 1X5YA 2FX8L 2XFXB 1WZLA 3ZTNH 1T7YA 4MXQD 4BYHA 5B4MD 1OGAD 1DBJL 5F89A 5FM5O 1MHCA 4MLIA 2X70A 3TFKC 4LKXB 4N0RA 4PD4J 1XGPA 4CADA 1UWXK 3AREC 4ODWB 4TOYH 2EDWA 3TN0C 1VPOL 3O6KH 5L88H 4KC3B 1PLGL 3AFLA 1LEGB 3INUL 5FOBA 3K8KA 1V5JA 4RZCA 3G6JE 5D1QA 3MFFB 4YDKL 1DR9A 4I0KA 3LS5H 4ZXBA 1DUYA 1ZVHA 5JOPE 2ATKB 4MDJA 1QSFE 2NY0C 1ORQA 1UACH 1A1MA 2WK2A 3DX7A 3F7YB 4LSTH 5JLZB 1Q9KA 1OAKL 2AV1B 3KJ6L 4R7DB 1B2WL 2KZWA 1RZKH 3QNZB 4NO5A 4X7SL 5BJTA 1DUZB 5FYLH 3W81A 3GFUA 1Q94A 3DYPA 1G9ML 4LHJB 3RWGB 5AZEH 5SWSD 4X5WA 4XCYB 2W60B 1OWRM 3ARGD 4XNMB 1JZ6A 2Z8RA 5HHMB 4Y89A 1O7SA 3N1MC 4FXGA 1N26A 2HLAB 4I9WD 3T0AA 5F6HJ 2IAMB 4CUCA 4QTHB 4XPBL 4YPJA 1ZGLA 1JNLL 4ZFOA 1SBBA 1HZHH 1U0QA 3RP1A 1I3UA 4LCIH 3QAZC 3BH8A 4M1GH 4K9EC 1AKJB 4K8RC 2DWEB 4P5KA 2A74B 5GGRB 3UYRH 4NNPL 2EDEA 4YEFA 1N2RB 5EU5A 1QSEE 1Q72H 3IXAB 2XWTB 1YN6B 4YR6A 3QUZA 1OPGH 2ADFH 2ZUQB 3HRZB 5HPMA 5GRXG 4IRZH 4CGTA 4EI5C 3OJDB 3ARTA 4JFFB 5J3HD 2C4FT 1C5CL 3E3QC 1AXSA 2C26A 2UWEA 4HC1A 2NYYD 1DSFL 5C9JA 3OR7A 2EYRB 1QFHA 1S7TA 4PIRF 1IC7H 3T0ED 5HBBA 3N85H 1CGYA 1Q0XL 3V0VA 4LLYB 3L5XH 4MJIE 1YNLH 2BSSA 5E70A 4WHCA 3BX7C 2FRGP 1JPFB 2DLIA 4ZNEA 5MEPA 2WP3O 4ODBD 2BFVL 2H8PA 5C0AD 3G5ZA 2VDML 1NGQL 1TFHA 1IKFH 3D3VB 4GRMA 4P3CH 4GBXB 4YWGL 4JFYB 2HTKD 1T20A 5DEFA 1ZMYA 4NM4L 3NA9L 2MSPA 2UYLB 4HBQA 3JUZA 1N6VA 5DA4A 1NC2A 4U3HA 3TT1L 2PTTB 4LARH 4RFNC 2JIXB 4FQ2H 3MJ8B 4X6BB 3QULB 3JTTB 2UY7A 1YMMD 2ARWA 3RKPA 4WHYG 1NKOA 1N64H 3WFZA 1UT9A 2PCPB 1TNNA 4CMHC 4NGHL 1EUTA 4BSJA 4R8WL 3BPOC 4Q9CA 1F4HA 4LHUA 5AWNL 3QDME 4QRRD 3UYPA 4PJAB 2W0FB 3LD8B 4MWFA 1B0RA 1G7LA 2VN7A 1RJCA 4NO3A 5FYKL 4WDIB 2OM5A 1EHNA 2L7UA 1U8MB 3Q0HA 3VU2A 4G8FA 2NXYC 4NO2A 2DKUA 1EO8H 4KJQD 1TIUA 3IDUA 4GXUM 3QDGB 2W9DL 4M7LL 5C0CD 1MCEA 3KHQA 1J1OH 4LCCA 3FB7B 3RI5F 2C3GA 3QUXA 4OUOA 5IM7A 1OARL 1XT5A 2CLZB 1Z0MA 4JDZB 3O45B 4WWKC 1AJ7L 1J86A 2BOCA 4WW2A 3QIUC 3P4OA 3L3DA 4GAYB 2H3NA 3G6JF 4I2XE 4U6XA 3HR5A 3PQYE 1ULVA 3G5VB 4CKVX 5IHBA 3I3BA 1DBKL 3BUYB 3O3AB 5HI4D 3VI4E 4ZFGH 2NPLX 3BZEA 4PJFA 1I3RB 1X5XA 4NC2B 1FORH 3RTQD 2WBJC 4CVZB 1A0QL 3LH2L 4YE4L 4BFIA 4HDIA 1U58B 2RBLA 3FRUB 5E4EB 3U4BH 3FKUS 5CSZB 3IKCA 3PXJA 4GKSB 4R2GB 3KS0J 1VFAB 4TNVK 1EMTH 1BQHB 1DN0B 3WL9A 3IXTA 4OV5B 5CJBA 4U7MA 4M5YL 4POZD 4H1LB 3S6CA 1X7QB 2XN9E 3GNMH 2FECI 2FL5B 5FV2A 3RZCD 3IDYC 3C6SA 2PTUA 4LCWA 4DVRL 3O2DA 5F9JA 1K4DB 4FXKB 2ZSWB 4PB9H 3U82B 4HS8H 3KDMA 3CXHK 4TNWF 3SEPA 3RRQA 5KSAC 4YHMH 1S9KC 1C7SA 5D93C 1X5KA 1MFEL 5DURB 4GQ9L 1I1AD 3H0TA 2B39A 3RDTB 1RIHH 4AEHL 3KYOB 3MRFA 2FHFA 1T1XA 2XY1A 4G43A 4JQXA 4M1DH 5IB1A 4WVRA 4POYA 3IDJB 3FB6B 1F11A 1ZKAA 4KUCD 5I1DA 1KCVH 1ED3A 3F12B 3B3IA 1YYML 2K7PA 3C6LA 5E6IC 4ALAH 3GIVA 3CZJA 1MHPL 1DQLH 3BSZH 4UU9A 1HI6B 2SEBA 3IFOB 4OSUH 1L7TL 4U3XA 4U0RB 3FCTA 3OB0K 1YEGL 1VADB 5DWUH 4AJ0A 2Z93A 4HGWA 4P46D 3ZT7A 2BNRE 2DQHH 3BMVA 5E2TL 4N9GB 1UJ3B 3L3HA 4LP5A 4FP8H 4EN3A 1M71A 1YQVL 1XIWA 1E4KA 1KEGH 5ISZE 5GRJH 2WAHA 3FOMB 5CMAB 1Q8MA 1DQDL 5CEZL 4YHIB 4RGNC 4M7ZB 4LDOB 4XMKH 5KN5A 2NZ9C 3F6LA 3KNBB 4PJIB 3IDMA 4ZOBA 2OXHA 4QEGA 1G9MC 3EIFA 5I1GL 1I9IH 5FOJA 5GHWL 2R1XA 1ZHLA 3CMGA 4Z7QE 4PJ8A 3KYNB 1J0IA 1SYVB 3NABL 1M7DB 1P53A 1UWGH 1CE6B 2D7PA 1G6RH 1JZ8A 3MUGA 3VGHA 2R2HB 3GI9L 2HLFC 3G5XA 1JGVH 1JPGA 5LAXB 1D5ZA 4GSDL 4PJGE 3SE3A 1WTGT 4BSWB 3HZMB 5F8QC 4APQD 4OZIE 2GCYB 5ICXA 1UG9A 4LAJH 4S10A 2O61A 5I8OL 3VXRE 4L3EB 3KGRA 3GDBA 3VWKA 1UH2A 3OAYK 4JAMB 5B38G 1LE5A 1YECH 1WBZB 5HYJA 1FO0H 2FJHB 4OLYH 3V7AE 4N1EA 4OTXH 1W72H 3DURA 5FB8B 1FZKB 3SDCD 1FYTD 4XNXL 4PUBL 1T7XA 1EEZA 2NY4B 5C08B 1CGTA 2VDPH 2CD0A 5HYFA 3WFHB 4OCSH 4MNGB 4PV9B 2CKBH 4OLEA 4R90L 4K7FB 3O6LH 1DBMH 2NX5D 2KL6A 2P46B 3S34L 5MEQB 3QQNA 4PG9A 4JRXE 3SCMC 3X12A 3VI4F 4IIQA 3GSNH 5HD8D 1I9RL 2IBBA 3QXDB 2LAGB 3S4SB 1KOAA 2VDKH 3LMJH 2IMMA 4DFIA 4GAJL 2CDGB 4L4TE 3C8DA 4JO4L 1MQ8A 3FN0L 3TPUB 4WV1C 3VFOB 1NUDA 4ZPTA 1F90L 4XNZB 4P4RB 5CKGA 1IGYB 3QUKB 1BLNA 5E7FA 1HXMA 3GSUB 5ADPL 1S7RA 5TE6H 1TPXC 4RNRA 1CE1H 1CT8B 3RZCB 4XI5D 3MXWH 2PXYA 1D5MB 4D94A 3VFVB 1MRCH 3TT3H 4TUOA 1TZIB 5ANMB 1UKSA 3MV9E 4K23L 1T83A 5L8LB 2DQEL 4LVHB 4PD4K 5CZKA 1R3IH 3QUYC 3T3ME 1CGXA 2YBRB 2GSGA 4KK6C 5D2NE 4J3UA 1YDPB 2HYMA 4ODUB 1VGEL 4Z95L 5DMIL 4MZ3A 1KJVA 4L4VB 4BZ2H 2YUVA 2XNAA 3RGVA 1H8SA 4OIIL 1F02I 5H37G 3WIHL 4BQ8A 1RZIA 4I0PC 4YHKH 5IFHH 5E1AB 1AY1L 1JRHI 3VFRB 3VE0B 4QHLA 3QJHA 4WFGE 1YY8A 1XGYL 4X7DC 1BMGA 1VSCA 4RA0C 5IIEB 5GJSL 5GS0L 1FN4A 4XP4H 1UENA 5JHLH 4P46B 5EC2A 4BM7A 1J0ZA 3ULVC 2IALB 1FGN