2AJZA

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 216
sequence length 216
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzA01
4FQPA 3X13B 1B0GA 2ZUYA 4JFXB 5F9JB 4HUXA 4JFFD 3WNLA 2VJXA 5KS9A 4V2BA 5EU6D 3U4EB 4MA1B 4KDWA 1ZA6A 5GGRA 3V0WL 3KJ4C 2J1KA 5EUOF 2JJWA 1IQDA 5FGRA 5T1LA 1J10A 1XF3A 5E2VL 2R2HB 4IMKC 3NAAH 4XPGH 4KV5F 3MCKA 4QO1A 1CL7H 2ZCKH 2BVTA 1RURH 5DJ2B 3ULVL 2ZJSH 3SJVA 3LKRA 5I76B 2IC2A 4DFIA 3OAYK 3I6GA 1ZLVK 3EOTL 4I77H 1FNGB 1U8IA 1U8HA 5MEOA 4OF0A 3RVUD 5C0RH 2A6DB 4G43B 1RUQL 3LRSB 4BUHA 1IGJB 4P2RA 4PJAE 4FA8A 5CD5D 3IGAB 3ILPB 3HLAB 5FYJE 4XNUH 2VXQH 2RFXB 5EU5B 4YXLH 5F9WB 3C08L 5D1QB 1FORL 3QIBD 4EKXA 4RQQA 1F97A 4L5FL 4HGWB 1X5AA 1YEEH 4L8BA 1AE6H 4X7SL 1ZS8B 3BT2H 1IC7H 2VZTA 4PJEA 4LPVA 5IBTH 4OGXL 1JWSB 3K4AA 4XX1G 3WSQL 5KVFL 1MJ7H 2MCPH 2Z31C 1UYWH 5JMOC 5CGYC 1XGTB 4NQEA 1RZGA 1FNSH 1HYSD 3NIGF 1ZHBB 5DJ0B 4GXUN 3SDDC 3HNVH 3LMJL 4PS4L 1NLDH 1HQ4B 4YAQB 3TBVB 4Z7WF 2A1WL 3NCEB 5GGVY 4WUUA 4L3EE 1WT5A 1ZGLM 5C07A 2GT9B 3O4OB 5F6HJ 1B4RA 5C0CA 5IEKB 1MPAH 2XT1B 3MREA 4KGJA 2V5SA 4OAWA 4QF1B 1XIWB 3AM8C 5T1KD 3ZT5A 1CK0L 1G9NL 1JGLL 2JJVA 4JKLA 1AP2A 5E6YA 1A5FH 2YK1H 5GZOC 2AQ3A 4KK9D 3QIUB 1A7OH 4NWUH 4PYHA 3IFNH 3PWVB 4Q6IB 5EORL 3CDGB 2ZSVA 3SO3B 5I6XC 1CU4H 1MUJB 3AS2A 1JPFA 5I18L 2FBJH 3SKJL 1IILE 1SEBA 1P84J 1WJ3A 3CUPB 3F6IA 3SHSA 5IMKA 3QZWB 2F58H 1KLGA 3KPTA 4G6KL 5L2KA 5DHYB 1JHTA 3TV3L 1AJ7L 2K7PA 4FP8H 4XRCA 1NGZA 2Q7YB 4XVJH 1XCTA 1M71A 5FECB 2X5PA 3HTLX 2WAHA 2AS5M 2NY3C 4KK5C 1DEEA 4OLVL 4YQXH 3QO0A 3LZFH 3D39B 2DTML 1QEWB 3U1SL 3NN8B 2M2DA 2I25N 3O4LD 1HINH 2ITDA 3UJJH 1OLZA 2A6IB 2D03H 2E9IA 4LVHB 1ZVSB 5T1MB 4LCYA 2R4RH 2CK2A 5IQ7L 2XZQH 3DRTA 3MPCA 1TXKA 4P49A 1BX2A 4WO4C 2XG5A 3KPRA 3DURA 4PTUA 3EO1A 4MAUL 2H1PL 4OTXH 1S7TA 1DQLH 3LHPL 5DZLA 5IJKA 4NQDA 3KPOB 2X09A 1T1YA 4V1DB 5IJVA 3MRPB 1RVFL 4HUKB 2VLKB 4JRYD 1HNFA 4P5MB 4Y19D 3WFEL 3LEVL 4U1GB 2QSCL 3GMRB 5F7DA 5A3IC 3EGSB 4RX4D 2PXYD 2GJ6D 3QEGH 4H5SA 2C7UA 3W9DA 1LGVA 4TOYL 3NA9L 3H42L 4U1NB 3OKNA 4MNQD 1IEAB 5IT2H 2Y5TA 4UT9L 1BZ9B 2PNDA 4KK8C 1T21B 2D4DA 2RBLA 3UBXG 2F5AH 4H0GA 3TN0D 1PG7W 3PHQA 4P5TC 3VWJB 1TZHA 5IW6A 3RU8L 3GMNB 1EZVX 3V0VB 2F19L 3MBEA 1QNZH 1VSCA 5CSZB 2PF6A 4ZUSA 5DJYB 1QRNA 5I16B 32C2A 1FZMB 3KVQA 1EJOH 4HWEH 4J3XA 5F7MC 1DL7H 4HWNA 4KK6C 4ZOAA 4FQLH 2NY1B 1WBZB 3IDNB 4JR9L 2BFVH 3ZYZA 3DVGA 3NTCL 4KJQD 3ZE2F 3MXWL 1UB6A 4I3RL 4D3CH 1TDQA 4F7EA 3BXNA 4Z95H 4JPWH 1OCWL 2YOCA 2DAVA 1NBZB 3QUXC 4OZ4A 1DLHB 5FCUL 3LQAL 5FO8B 3L3KB 4K3GA 4IS6A 4WJ5A 3CU1A 3CJJA 3TPUB 2QR0A 4Y4FD 5MHSD 3BKML 1L4IA 4RMTA 4X6DF 3MGAA 3GRWL 3V6OA 4NFBA 4JLRB 4K9EL 3P4NA 3TBYB 1E4KA 4OGAC 2A6KA 3GMLB 2XOTA 3T0EB 4H8WH 1FSKB 1NC2D 3MFFA 4KY1L 2B4CL 2GFBB 2ICCA 3L3GB 5HTSA 1MRCL 4JY5H 4M7LL 5DD5L 3NZ8A 3GI8H 1KT2A 1UKSA 5E9DA 1I1FA 4OCLC 5D8JH 4K7PL 4HIHA 1OTSD 3MLWH 2J5LB 2HJLA 5JZ7C 5J1AB 4G6JH 4GQ9L 4X98B 4LBEA 4LRNL 1J1OH 2PO6A 1NQBA 3RDTA 1F2XK 5EZLA 2VDMH 4G5ZH 4JM2F 1ZHLB 1N2RB 3F5WA 3C5ZC 3G6JE 3RTQB 1DBJL 3F12B 4RNRB 1G7HA 5B22A 1JF1A 4CL7A 1K4DB 4J3OC 3DV6A 4ODSH 2VH5L 1FYTB 3ARVA 4GRMB 5HD8D 1DP0A 1MVFA 3WIFB 3A6OA 5HI3C 5C8JA 4IRZL 3SDYH 3HNSH 3BEVA 4QRUA 1NAKL 4Y4KC 1ZT1B 3HC4L 4P2QA 5FYJD 3L9RB 5JOFA 4QRPB 4E41A 2ZUVA 3IETA 4MNGA 3OKOB 2R56L 5ADOH 1OGAB 1A0QH 1L7TL 4PJDA 4YPJA 3RL1B 1MFCL 5MEPA 4ODTL 3ZKXC 5GZNC 2BHZA 2X4NA 3U7WH 2XZAH 4MA7L 3EDJA 4FG6D 4UQ3B 4MAYD 1LD9B 5IM7A 1B0RB 4XPAL 4R96A 5IBUG 3MUY1 2BOBA 3DV4B 4KUCF 1JCKA 4JRXB 3T3ME 4U1MA 4FQXA 1BQLL 2RAMA 4M7ZB 3KLAA 4XXCA 1OT2A 3HE6C 1KCLA 4GAJH 1F3JA 1NBVH 3STLA 1ZLVH 3OJDA 4WW2F 4L3ED 4XNZC 5FHAH 5MEQB 2D4FA 1WUNT 2J8UE 1ZV5A 3SDAA 4O2FB 5HBBA 5C0GA 4XZUB 5HI5D 4IHOB 3ARGB 2XZCL 2R1YB 2YEZB 4HFWA 4RFOH 1U92B 5BCAA 1TENA 1JK8A 4PJGB 4Q58C 1TCRB 4WY7H 1H8NA 4L9LA 3QCVH 5GIRA 1RV6X 5DK2A 1PW3A 3RWDB 3LKPA 5E4IA 2YA1A 3K2UL 1QQDA 1TQCB 5BS0A 1NGWA 2JLLA 2ZUQB 4TVPL 3S34H 1AIFA 3LRGA 3KYOB 3FQRB 3B83A 4ZXBC 4MS8C 1N6QH 3KPNB 4EIGB 1QYGL 4EVNB 2IPTH 4XPHL 3AAZB 4M00A 4Y5YA 3IDIB 1PG7H 2JIXD 3ARSA 4W4OC 1B88A 4LHUG 5HVHB 2MKLC 1PLGH 3OAUL 5E8DH 4JFZH 4NN6B 4OD2B 3DTXB 1A22B 1UKTA 1JPGA 3AS3A 1NFIA 5ICZB 1QSFA 5DQ9B 4M61A 2R1XA 4LASL 4YHLL 4I13B 1MJJA 4NCDA 1CLOH 4ODUA 3EDDA 1VADB 5FKPB 1BOYA 4HC1A 5E99H 3WDIA 2EIEA 4BFEA 4POYA 1JTTA 3RGVD 4X99A 4YWGL 4HSQA 2O61B 4YDJB 1KCKA 1IAII 4DKEH 4XCNA 5D2NC 4KVCL 3RBGA 4AMKL 4K94H 5L0QB 4GW1A 1RFDL 1BLNB 4LCCA 4OBRA 5CUSL 4L1DA 4KJPC 2O93L 4GKSA 2WBJC 3K8LA 1ZLUH 5BMFH 1Z9MA 4PJEE 1TPXB 3QDAA 5DURB 2FGWH 2HA1A 1VACA 3VE0B 4LNRB 1UXSB 4O00A 5MERA 4FFWC 4QNPF 4R2GC 1I1YB 1OAZL 2E27L 4UDUA 5DO2C 2OBGA 4Y7MA 4ISVB 4E42A 1XF1A 3RVXC 3CFDB 3UDWA 1CN4A 1WWBX 1A9EB 1QBMH 5HHOA 4OCYL 2ICWA 1AKJA 1FRGL 5C0CE 4Z78B 5GISH 5DS8A 2E9WA 4YE4H 3G6DL 4G9DB 4XMPH 4Y2DC 1B9ZA 1MJUH 3D9AL 2CKNA 4KRPB 4Z7QE 2HVJA 3AU1B 2FX8H 1AQDA 4YHNB 2DQIL 4LPTA 3QEQB 2BRRL 2X4RB 4WV1A 2V5TA 1YEDA 1AXSA 3QIWC 5C9KA 5L2KE 3ZT7A 3P4OA 5HJ3B 4O5LH 3UJIL 2AEQL 5I8KL 3GGWA 5TE6L 5BW7A 5DUMH 5EUOA 3G5YA 2ZCHH 2C26A 3EYFB 5LAXA 2VN7A 2D7NA 1MVUA 1OP9A 5J4MA 1IC1A 1GL4B 4YGVA 5KSAA 5EBMA 1MCPL 3BO8A 5EA0H 1JYWA 2DI9A 4BZ1L 2JELH 1NUFA 1N8ZB 2H32B 3CU7A 3WUZA 2VWEE 1LVEA 3P2TA 4FXLA 4K3HA 4Y1AE 4DW2H 5CEYA 4CBPA 1NCWH 3D0LA 3L3HB 1DBKL 3BD5A 3O9WB 1FVDA 5SWSB 4Y5VB 3SKOA 5IG7A 1QLRB 3MRQA 4XWOD 3ARFC 4JN2A 3MLTA 1YYML 4IMKA 1J1XL 4ZAKC 3KPRE 4N8VA 4PY8J 5CMAB 2EH8H 3SN6N 3RA7H 4CVXA 4NQDE 4G9FB 3BESR 1O5DT 5FF6B 4OZGB 3GSUB 5D6DC 4O58H 4CMMA 3BKYH 1BBDH 2JTDA 3ARDC 2YPVL 3MLRL 4OZIB 1T5WA 3PL6D 5E8PA 5JXAH 1UB5A 4Z7WA 1XF2A 4WFED 2D7MA 1F6AA 1MHEA 3QQ4A 2XRAH 1NBQA 2LAGB 2O5YH 1UWXK 5IMLA 4EZMA 8CGTA 2YPKA 1JWMB 3KAAA 4S2SB 5ISZB 4O02L 1F4XH 2Z31A 2CK0L 1F6LL 2EDRA 2E5EA 4PJHE 4D9RE 2EDJA 4OM1L 5GGSB 1ZHNB 3SDDA 2ERJC 1S9YA 4AG4L 5JPMA 3RVVD 3RWCA 4DQOH 2FWOB 3BPLC 3OJ2C 4Y5XB 4GUPB 1CI5A 2HVKB 1MF2L 3MNVA 4K8RD 3V7AG 5I19L 5DTFA 1LO2L 3REVA 5INCB 3AM8A 3EOBA 3DX8A 4MJ6A 4XP9H 5IMMA 1IAIH 1WICA 5F7KC 5DFVD 4HJGA 1FO0H 1R0AH 4UIKL 2NXZB 1C08B 2WIIA 2AK4A 2X2YA 3D25A 1DE4B 3RVTD 4RAUB 4DKAA 4M7KH 5J0BA 1Z0NA 1HH6A 3HRZA 1OY3B 2HKHH 1DN2A 3QSKB 1RJLB 1UACH 2ENYA 3SGDI 3V6OE 3U4BL 4PUBH 1UWGL 1P7QB 4NZUL 3EYQC 4LAJH 1A6VL 1A14L 2HG5B 3O3BB 3DI2B 2P8LA 3ULVF 1MIML 1AHWC 2GJZA 4TUJA 3EDFA 4X8JB 1T0MA 1T7ZA 4XCYB 3MRIA 2N4IA 3QNYA 5E9DE 4ORGB 1KTDB 1JYNA 4QGTA 1YUHB 4OIBA 2HT3D 1I8MA 2VOTA 3BQUD 4NQXA 4JVWA 5HHQB 3KPSB 3GMOB 4DVRL 3OKDB 2NY2B 1FV1A 4I5BB 1CXEA 3FCTB 2E7CA 3ETBF 3UPCA 3BSZL 3TT3H 1R5VB 4LGRB 1LEIB 3IDXL 1KG0A 5GS2D 4EEEA 2FSEB 1MRFL 5F96H 1FGVH 5FUOH 1IGFH 2CXKA 1CFSA 4YEEA 2BXYA 2DIJA 4RIRB 5I15H 2BY2A 4TUOA 1F2QA 25C8H 1PY9A 4YLQT 4H1LB 4F7CB 1VESA 1JV5B 4ONFL 3BIKB 2CGRH 5I75B 1OAXH 1AGDB 3BWAB 2EKSB 3D1MC 4MDJA 5FB8B 1P9MC 5DRWB 1MEXL 4P2QE 1RHFA 2CPCA 4JO1H 3VFUB 4ZNEA 1JZ2A 4X9IA 4LSSH 3AXLB 2OX5A 1TETL 3WJLC 1FH5L 3DSFH 5IESH 4BKLA 2BNUB 3PIQA 3FO1B 4FTVB 2YZ1A 2BSSA 3VGAB 3I6KA 5C71A 3MTRA 2NY7H 3QRFM 1TTFA 5IW1A 3VXQB 5DC0A 3SE9L 2YD1A 4MD4A 5I17B 1OQXA 4P5TA 4P3WA 5JUEH 4MCZB 5GRWA 4LVNC 5IF0B 3F7PC 2DDQH 4RGMB 4P2OB 1T7WA 2Y5EA 2HRPL 1PX4A 1HH9B 4U6TA 1YECH 4WUUD 3J8F7 3LPGA 4PTTB 5C0CD 3RWFA 1X5XA 4HK0B 1NMAL 4OCMC 2DLEA 2FGZA 3ZKMC 3PV6A 3MNZB 2ZUTA 1CDGA 5FIEA 5E94A 1DQQB 1OSZA 1FIGH 4PP2A 3FQXA 1KCSL 1PJ9A 5BV7C 1KPRA 4WDIB 3H8NA 1ZT7B 1OWRM 3SKNA 4K71C 2A0LC 1N3NB 2VERN 1JMXA 2EYSA 1K8IA 3KYKH 4DK3A 3QUXA 5EIIB 2VZ1A 3CDFA 4HBCL 4NN5C 5DD1L 1Q72L 2VXVH 5FO7B 4Z8FL 3I2CH 5L2KD 1HIMH 4DN4H 3MCLL 3OV6A 3MGOA 2ARJA 1N4XH 3QQNA 3MR9B 4I0PD 4Z7VE 2ZKHH 3U79A 3W81A 3MOBL 1IVLA 4OQ1A 4Y4HC 5DEGA 2HJFB 4N1EA 3P9LB 1DEDA 4OBSA 3EFFA 4U3CA 4OFYA 1EAJA 2HFTA 5E24E 3F58H 3MRDB 2QV2A 1F4WH 3QDJB 4Z5RA 4Y1AD 4P4RB 5ERWB 5GSVB 4JM4H 1CICB 4OCSL 4LIQL 5JW3L 2AJVH 1C5CH 3B4NA 1T0NA 4R4NC 4UILL 5HYJA 2EZ0D 1F11B 2OL3H 4POZC 4NN7B 4Q0XH 4MQTB 2ED8A 1HYRC 4OLWH 3BAEL 1SJEB 2XG4A 3KPRD 2AXGA 3NZHH 2CKBH 3HCVA 4Y16B 4LARL 3SGDH 3VFRB 2FR4A 1ZSDA 5HGDA 4NQDD 4PB0L 4IMLB 3MRNB 4YHYC 3FB5B 4E0RB 4Z18A 1DSFH 2D0FA 2EIZB 4N8PA 3L7FB 3BGMA 4P23B 1OP5K 5GS3A 1H5BB 2F74A 3JTSA 4Y4KA 3TO4D 3TP4A 1H3WM 4AT6B 5LQBL 1UJTA 3WLBB 4FXKA 4JZNA 2IADA 1FLRL 1E4XI 3CZFA 5AYUH 1CE6A 2FH6A 1G7IA 2CUIA 2DYPA 3PDOA 3D2UD 5GRJH 4YFEA 2DQCL 1IC5L 1Y0LB 4ZPTB 1IGTA 5LCVH 3TZVD 1RIHL 2V5YA 4ALAL 1X5LA 2P5WB 5JXEA 1DBBH 4HIEB 1A02N 3ZKQD 2F5BH 2WBWB 5K33A 2XNAB 5KANI 2CQVA 4JVPA 3MRFA 4D9RD 4CADB 4QXGL 4NDMA 3MBED 1EEUA 1FZOA 2YSSB 1GAFH 4QWWC 2ADGB 3PP4H 1R5IA 2Y72A 4WFHE 2IANB 5EO0A 1PEWA 5D2LB 4EI5B 1Z9SA 4AL8H 5IBLC 1JNJA 1CTOA 4WWKC 3B2UD 3A6BL 3LKNA 5GGVL 3PABB 1WWWX 3QHZH 4PJFA 2FEEI 4OZFG 1WITA 2CRZA 2WUCL 1I8KA 3BKJL 4ZYKA 5CD3B 3RL2A 4JQXC 5EU7E 5FO9B 4YPGA 3MA7B 1DVFB 4RMRA 2HWZL 1MCHA 4XBPA 5EUOE 5C3TA 4RMSA 5GSRB 5IHUH 2H26B 3B9KB 1UWXH 3OB0K 4MQ7B 3U0PB 4NGHH 3ZE0F 1IM9A 4UIMB 1QBLH 3D6GA 4O9HH 5TQ2H 1BF2A 4KV5E 3V8OA 4C59B 1CLZH 5DDHA 5E08L 2NY4C 1MFDL 3V6FA 5C0BA 3B9VA 3WKML 2VIRB 1M05A 5L7XH 4U1KB 4KTDH 2ATPA 3M07A 3FT3B 3FQNB 4ZXBA 3HNTL 4HS3A 4MCYB 2H2SD 3MLSH 2BOCA 4N1HB 1GC1L 5LGHL 2VDKL 5E9DD 5IROC 4ONHB 2R2EB 5EU4B 2GI7A 1UJ3B 3VFNB 2HFFA 3MJGX 3CVIL 2FJGB 2R69L 1A1MA 4JHAL 3RWIB 4WFFE 3U0TB 3MSPA 3FFDA 1QLEL 3RDTD 5EO9A 3U36B 3OR6B 4N0CD 1XGUB 1TITA 5L88L 3VMNA 1W72H 1J1PH 1U8LB 2NX5B 4N9GA 1MAMH 4KKBD 3O8XA 2VZOA 3ZL4L 3QDME 1W0VB 4QRTA 4NOBA 1K4CA 4LLVA 2DIBA 5F71A 4RFNC 1LE5B 1BFVH 4RISL 1IAMA 1OAKH 1FL6A 4HWBA 4NO3A 4UINH 3NIGE 2J6EL 3D69A 3OAZH 5C08A 1HHIA 4KC3B 3KS0J 2IAMD 3VWKC 3BH9B 1BIIA 4OLUH 3QA3B 3GSWB 3JV5A 2X9WA 5D2NA 1PAMA 2P42B 4ZPVA 1MHPH 2FIKB 4QHNB 15C8H 3FQUA 3HE7C 4P2QD 1KC5H 4Z7WE 5T3XL 4UDTA 2WBJA 3P0VL 1F4YL 1D6EA 3ZDXF 2ZSWB 1KEMH 1VEOA 6FABH 1YY9C 4FMKA 2BVUA 3QB7C 2FHFA 3UTTE 4EN3B 1H3XA 2FYYA 2JB6B 4YHOH 5HGBA 5DVKA 2IPUK 5DI8B 2Q7NA 4AIXA 4GRLB 1TJGH 3NCYS 2P24B 4M3JA 2Q86A 1RUAH 2AGJL 3NABL 3BKCL 4MB4A 4BK5A 4FQXD 3TIEB 3QUZB 4IEFB 5FDWA 1LK3H 4PGCA 4Q9BA 3CFCL 4GRWB 5ILTH 1ETZB 2LVCA 4ODWA 4A6YL 2ARWA 2WWKO 2VAAB 4MX7A 4NQCA 3EYUH 5SX4I 5BZDA 5A16A 2AK4E 3SDAD 3DOSA 2NY5C 1G9MC 4TNVF 4YK4C 4O51B 1E4XH 5F6IB 4L8CB 4TSCH 4F3FB 4D9LL 3Q5OA 4U6VH 4KTEH 3IKCA 4NZRH 2C4FU 5LXGL 1K3ZA 3QIWA 3O3UN 4QOKA 5J11B 3QT2A 3RNQB 1LEGB 1NAMA 1G6RH 3DPBA 3AS0A 4KUZL 2XKNB 5C1MB 4GG6B 3LN5A 5F89B 5BS0D 3IFOB 5I0ZA 1AD9A 2NW3B 3W2DH 1BWWA 4BQ9A 2EDLA 3DWTA 3AB0B 1IGCL 2VUYA 3AREC 1RHHA 4PRPE 3C5JB 1N6VA 5EFIA 1JHLL 4CW1A 3RKPA 4K23L 3CXDL 2OTWA 4G6AD 1BZ7A 1RQ5A 3VH8A 4WHTB 1T1XA 3WDHA 4CVZB 2X4TA 1BIHA 5AWNL 4MJ5A 5J6HB 1C16A 5BVJB 5FV2A 1XH3A 2D31B 5C0FA 3RWHB 3DGGA 3ARFA 4UT6L 3PQYE 3H3PH 1ZEAH 3JV6B 3KDMA 2GTZA 1NJ9A 2GUOB 1YYLH 4GBXA 4ZAKA 1CGTA 4I8DA 4JFEE 5A2KH 2OYPA 4GOSA 3OGCA 4W68A 4OQTA 4O2CB 5K59F 1QA9A 5D1ZD 4XB7A 3T65A 5J89A 3F8UB 4KKAD 3WEXA 3BPOC 3LAFA 4JGMA 4NCC2 4OUOA 1MFEH 3GIZL 4S1DD 5D6DA 3VG9B 2YD2A 3KWWB 4PG9A 5EN2A 2CUHA 1M1SA 4NM8L 3ARDA 3IDJB 4RGNE 4BZ2L 4X4ZA 4A6YA 1EO5A 1T6WA 1OARL 3MV7E 5FA3B 2F15A 2I5YH 4DVBB 4CUCA 1J5OL 4KROC 4P59H 5LG1A 3ZE2E 3WFBH 1LDSA 1TIUA 4MVBC 4HKZB 2QLVB 4WI3A 3M17A 2QQLH 5DJAB 5E8NB 1BGXH 3SE8L 3STZB 4HUUB 1JUFA 2VB5A 5HHOD 4EQ2A 3MLZH 4GS7C 3M1BB 1AKJD 4DCQA 3HI5H 1A4KB 2P8MA 4X6DE 5H94A 1DQDH 1ZGLP 2GK0B 1FFNB 4NM4H 4WFHD 4N8CL 1T22A 4Q9QH 3FO0L 3MC0A 2HYMA 4XB8A 3ARBB 4OSUL 2Y6SC 4APQA 5IQ9A 3NACL 3V0WH 5F6HI 4MGXA 2GITA 2KQNA 4DEPC 2VLLB 1GZPA 1OP5H 2NR6C 3B43A 3BEWA 4EI6A 3BH8B 5E2VH 1U3HC 4QYOB 4OKVA 4NNPH 3MLUH 3ULUC 3ULVH 3IDMB 4PBVC 5HY9B 2H8PB 3KYNA 1DDHB 4UTAH 2E9BA 1G7MB 2PW1B 3H9SA 4NBZB 1X5JA 3MRKB 4ODXB 4MA3A 2GY7B 4GG8B 4PLOB 4CN6A 3KPQB 1J0ZA 1G7QB 1AHWA 3ET9F 2NY0C 4WI7A 1F3DJ 4OCRH 5KSAD 1YY8B 1UXWB 4Y0GA 3C6SA 4OGYL 3U82B 3ILQC 3GM0A 2G75B 3JWNC 1MI5A 3C08H 3D85B 4ACPA 1V3JA 1FORH 2P44B 4L5FH 2MCG1 2IH1B 4LP4A 5BV7L 1OPGL 1U8JA 4X7SH 3I9GL 5SX4H 1SJVA 3GIVA 5EBLA 5DEFB 3O3EA 2F8OA 1JWUA 4OGXH 4FZ8L 3ULSA 1BREA 4CDHA 3WSQH 4L4TB 5KVFH 4WFFD 4NHCL 2F53B 1CGSL 5JQHC 4F15B 4RAHA 4TNVK 3JTTB 1I1AB 4UNUA 4HD9A 1SM3H 4KAQL 3K4ZA 3LMJH 4PS4H 3LDBC 3OQ3B 1HXMB 3QDMD 4XMKL 3E1F1 1ZWIB 2A1WH 3WE6B 4PRHB 3O3DA 3VXSB 5L6YL 1H8SA 3GSNL 4TNWF 2E8YA 4R8WL 3GKWH 4C55A 1MY5A 3OB0H 1UFUA 4F80A 3H2WA 1G9NH 3FONA 1JGLH 3L3JB 1KTKE 5I73C 4W6YB 3VXMA 5EORH 5EZJB 1A7QH 4L29B 1K9TA 1P2CB 4GAYA 5I18H 5D7JC 3SKJH 3IXAA 2EE9A 5DFTA 3D5OF 2W60A 5BRZB 2YN5A 2D9QB 4G6KH 1YA5A 1M6OA 1KIQA 3BZEA 3TV3H 1AJ7H 4KJYA 1UZ8A 3N1MC 1AR2A 4Q2ZA 4B50A 4MQXC 4NUGH 2L0DA 3SDDD 2O5ZH 5ENWB 3VFPA 5C6TL 1JJUA 1MHHB 4EIZC 3DBXB 2OJZL 4MSWA 5GRUL 1CFQA 2IH3A 3CXHJ 2MNUA 5GGSY 3BGAA 4LSPL 4OLVH 1KUMA 3BN9D 2DTMH 1IT9L 1PZ5B 3U1SH 1U93B 3WIIL 4NSKB 5KJRL 4N68A 1KV3A 1HXYA 4KI5C 5DC4B 2AV1B 4PJBB 1OSPL 4ZSOA 5GZOD 3INUH 5I8EA 5I8CA 2ENSA 3P4MB 2AK4D 5K93A 1NGYB 3PJSB 3BUYB 4XCCL 5HGHA 2V2TB 5IQ7H 4ODHL 4RA0C 5TJWK 1E27A 2Y4SA 4QGYA 4OZHB 4Z0XB 2VQUA 3TWCL 4MAUH 2H1PH 3HR5A 1JHKL 5E5UB 1DUZA 3STBA 3LHPH 3CZJA 3UTZB 5SV3A 5IFAL 1KIPA 5D7IB 4EOWL 4HIXH 3U9UB 4LAQL 2A83B 4YHML 4MHHI 4Y4HA 5EBWA 3WFEH 3LEVH 2QSCH 4MNHA 1GIGL 3LH2L 4FOMA 5D1XC 5EG6C 3GSNA 1QFWL 1OAYL 4TSAL 4PRPD 1KCRL 1VFBA 4TOYH 1Z5LA 3DX7B 2FX9L 3NA9H 4I3GA 3H42H 3RTQC 3UYRL 2P8PA 2D2OA 3MRRB 3E3QC 2ESVE 4NNYB 4UT9H 3ORJA 3DVNB 3F7VA 5C09E 1BWMA 2FHCA 2APBA 5F44A 1JGUL 2X4UA 4OLYH 1OOAA 3GMMB 3X14B 1ZK9A 3U9PL 4FQ2L 4MDIA 1AXTL 1KYOK 4R97B 4YNYB 1ZGLA 3V5DB 4R90H 4JZOA 2GCYB 2F19H 4HKJB 1U8MB 4JFED 4QNPE 3MV9E 4WTZG 2IQAB 5I30L 3WFDL 1P7HL 4BH8B 3QUKB 1T66C 4YFDB 1N59B 3C60B 4YHKL 3X17A 2FBOJ 3VDAA 4HEPG 1NC4A 3VXTB 1AQKL 1IZJA 2AJXL 5EOCL 4MWFB 1CLCA 5DRZB 1R24A 5M7QA 3GSQB 3QYCA 5FUZL 3SY0B 3NIDF 4NUJB 4JR9H 2F54B 1IRAY 3NTCH 2EXYC 4M5YH 5FKAA 3MXWH 4RGND 4LCWB 4I3RH 4M93C 1PYWB 2YXFA 1OCWH 3V5KB 5I1GL 4KK8D 1F3RB 5FCUH 2Q8BL 4HIIA 3HHRB 4P99A 3S35L 3S3SA 3V4UL 5IFJB 5GGTL 3BKMH 43CAB 3OPZL 1D9KC 3GRWH 2DQFA 4K9EH 2GKIA 3L3OA 4HXAL 2L7UA 4UOW0 1IL1B 1S9VB 2HJKB 5DK0B 2BNRA 4JZJB 1CFTB 1VB9A 4NQVB 3DXAB 5IEHA 5BQ7B 4KY1H 3QI9C 2B4CH 1X5KA 1YZZA 1I3RB 1MRCH 3E6FB 4M7LH 5DD5H 4WWKA 1BP3B 3GJEB 4RAVB 1UM5L 3CK0L 5E5MB 1RSFA 4ZUUA 3VI3F 4GQ9H 1XZ0B 4LPCA 4TSBL 4LRNH 4LSTL 2VLJE 5ICXA 4TNWK 1ZAGA 5EIQA 1D5ZB 3FOLA 4JQXA 2GSGA 2OXHA 3OB8A 4M43H 4PLJD 3IU4H 1J86A 4UU9B 1DBJH 1MLBB 3FOMB 4U6HB 4JAMB 2VH5H 3PWLB 4PJGF 5B39A 2BX5A 1N64H 3VGBA 5FGSA 5HVGB 4S10A 4JM2D 3LV3B 1HSAB 1IAKA 4IRZH 4XCEB 3JV4B 4G6ML 4PJIA 3LKSA 1NAKH 3HC4H 3NOIA 3MUJA 2Y1VA 2R56H 4IRSB 2VNCA 1G9ML 2WUBH 3VGGA 4ZMAT 5IROA 4JFDA 4JKMA 4U1HA 1MFCH 1FNLA 4HV8B 4ODTH 4XNQB 1JI1A 5BO1L 3TCLB 1TNMA 3BP5A 1JGDA 3BPCB 4MA7H 4PYGA 1A6WL 3LEYL 3W5MA 2D3VA 1H15A 5CD5C 3QDGA 4XPAH 3NCMA 3CIQA 4YX2L 3C87A 1I85C 1L0XA 2XN9E 4U2ZA 4LDLB 1J0JA 5GGTA 3UMTA 3SDCB 3VD9A 1KPVB 3QIBC 1BQLH 4LCUA 1P7KB 5BOPA 3MBXL 3VWKA 3O6ML 3U7YL 1UVQA 3OWEA 1YQVH 4Y4KD 4I2XB 4QXTB 3RUGA 3HE7A 4YH6A 1FPTL 5HVFB 1CBVL 5E03A 2XZCH 4F37F 5F1OB 1EEZB 4YHPB 1E6OL 1J11A 2VDRL 3GSVB 2PCPA 3T1FB 5CSBA 3VXPA 2O5XH 1Q9KA 5JPNB 5BZWB 5JXED 2BY3A 1N5AB 4J2XA 3K2UH 1ES0A 1KTRL 5JIPA 1FCGA 4MJIE 5KAQF 2VR4A 3PGDA 4YDVB 4TVPH 3SGKA 4KK9C 2XWJA 1R3LB 2A73A 3CFBB 3HMXH 4J3SA 3A6CL 4DOHB 1WTLA 5I66A 2QADB 5KN5B 1QYGH 4IJ3C 5E2TH 1IEBA 2NY6D 3KPPA 4XH2B 3HG1A 1S3KL 4XPHH 1I1RA 3VXRA 3FAWA 5H8DA 2C9AA 5B8CC 1EO7A 1A7RL 4CVWA 3TVMD 1A6TB 2J4WL 2ZWLT 4S0TD 1R3KB 4PGDA 2CSPA 4HUVA 3TYFA 3H9SE 1ZLSH 4YHLH 3I85A 4WUKL 1T04A 1X7QA 4RDQF 5ETUB 3X13A 3G5XB 4FQQB 2AJ3A 4X7TA 4B7LA 5F7HA 2P48B 3U4EA 1BJ8A 1D5BA 2CXGA 4YWGH 5C0BD 4LLWA 4FNLL 1MFAL 5BJTB 4R7NB 4NNXB 3AREA 2FJFB 2R4SL 5DRNB 5LGKA 4KVCH 3UPRB 1RFDH 5CUSH 1N0XL 4N5ED 2P7TB 4EDXA 5DJ2A 1ZT4A 5SWZE 5E7BA 5KG9B 5I76A 1LNUA 3FJTA 5DD0L 1OGTA 4JREB 5E8OA 4Y2OA 4WHDA 2A6DA 4G43A 4DGYL 2WSKA 1NKRA 3W0WB 1KBGL 3LRSA 1OAZH 2E27H 2MQ3A 3ULUL 3N9GL 5C0EB 4P3DB 1FL3B 5C09D 3D18B 2IQ9L 2YWYA 1BQHG 3C6LB 3O8XD 2RFXA 3PWJB 2YD5A 4TTGA 2PXYC 4OCYH 5SX5K 2VZ3A 5H35B 1FRGH 4MNQB 3MV9D 1BVKB 2R1WB 1VFAA 4P3CL 3VW3L 3ARUA 3QPQC 3CVHL 4ZTPL 1Y18B 3G6DH 1T2JA 3UZEA 3TN0B 3ECBA 3MACL 1JWSA 4OZGF 4Z0BL 3U6RB 4J6RL 2BERA 2BHYA 4H26B 1AGBA 5I8OL 3D9AH 3QJHB 4ZO8A 2WWMD 5DJ0A 5ALBL 3Q1SL 4JFYA 5B3JF 4LLUA 4Y8DC 2M26A 2L7JA 4U1JB 1HQ4A 1NCDL 1WBYB 4OZIF 3TA3B 1AO7B 3L3DA 4F33A 4R2GD 4FQIH 4R7DA 1JP5A 3UJIH 2GT9A 3QXVA 4LSQL 5I8KH 5IEKA 3D3VA 5TE6H 4LRIC 3ALXA 1RUPL 2AEPL 3FQTA 4HQQL 4J1UA 2X1WL 3L3IB 4UV4L 3MLYH 1MWAA 2BC4A 1NMCB 5HDOA 1L0QA 2EDYA 3QO1A 4L4VE 1YN6B 4KJQC 1MCPH 1FO0B 3PWVA 3GBNL 4BZ1H 3CDGA 3DUUA 1RULL 4L8SC 3VRJB 4C83B 1LILA 1CGUA 5KSBB 4YC2B 1DBKH 4NRZB 4RGOL 4PV9B 1Q9WB 3VFOB 2V7NB 5K9KB 2OSLB 1MH5A 2ADIB 2DICA 1NFDB 1LO5B 5I1IL 3C9NA 4AZ8A 1J1XH 5LBSL 2VLJD 5DA4A 1CFBA 3QIWD 5DSCB 3MJ7B 3VXNA 4GXUM 3D39A 1I3UA 1DZBA 4FABL 2IG2L 4F37K 1P6AB 2J3SA 3OXRA 1OTSC 2AERT 4KQ3L 4OD1L 1A64A 3QH3B 4W6XB 4YBLC 1H3PL 4LQFL 3HUJB 5EO1B 3QUML 2YRPA 2K9UA 3CVHA 4HS8L 1K85A 2EDNA 4ZTOL 2YPVH 1CF8L 2FO4A 5TE4L 4HW6A 5FHBH 5HYSB 3FT2B 1U8KB 4IDJL 1VKXB 1U0QA 2EDKA 3V95A 2O26U 1GRWA 1WAAF 5HD8C 3ARFD 1J8HA 3LKOB 4O02H 3DO3A 2CIIA 3PQYB 5CEXB 2CK0H 4GBXD 4ZAKD 3UTSE 4P5MA 5F88A 4JPKL 4YJZL 3GMRA 3EGSA 4AG4H 12E8H 1QTYT 2XN9D 1INEL 4NJ9H 2YC1B 4WW1B 4U1NA 1Q9OB 2E3VA 3QFDA 1IEAA 1MF2H 4AIZA 1OP3H 3VGAC 5I19H 2VZSA 4KVNL 1LO2H 3PUCA 2CO6B 4MAYB 4G7YL 4YO0B 3MV8A 2EYRA 3HPLB 4FG6C 2Q8AL 1I9JH 4HJJL 4UIKH 3VWJA 1U8PB 3O81A 3GMNA 4KDTC 3BP6B 4Q6YA 5FYKL 3S36L 5D7JA 4PJ8D 5IHBA 3MV7B 2DQDH 5GQBA 1HHHB 2HLFD 1H0DA 3F62A 5I16A 1TLKA 3U4BH 1FZMA 1UWGH 4NZUH 2E7MA 3GJFA 3CX2A 2DLTA 4ZFZB 2R23B 5DRXB 1JN6B 1MIMH 3MRBA 4JJ5A 4MJID 3H7LA 3P3YA 4U49A 1XAUA 1MRDL 5HI5C 3S8WA 2G5RA 1S7SB 5K9QI 1MREH 4N0FA 2H2PD 3FO9A 3QUMA 1T5XB 2VL5B 1NBZA 3O2DL 4JN1L 5FOBA 4CNIB 3TBSB 1DLHA 5CZKA 4DVRH 4HWUA 1YPZB 3DRQA 5JORA 1AC6A 1T20B 4G8EB 4APQD 2R15A 3BSZH 3ZHKA 2YD9A 4KKCC 4JLRA 4TYUA 3ARTA 3IDXH 1FL5A 3LQZB 1TQBC 3FN0L 5I1LA 3GMLA 5D7LE 3S35X 1MRFH 3BDBA 2HKFL 2OS7A 2GFBA 3L3GA 4G8IB 4FQCL 4FZEL 4QHKJ 3H9SD 4G42B 3PXJA 3LB6D 1I7TA 2C3HA 5GS1C 3CX5K 5FV1L 1MEXH 1CIDA 1GGCL 3QWRA 2P49B 5D1XA 4HAFA 1MI5D 4X0KB 1TETH 1ZHLA 1FH5H 1CVSC 2HN7B 2OL3B 5ID0A 3RTQA 4PJCB 5IR1B 3F12A 4QT5B 4RNRA 2GSIA 1K4DA 5SWZD 1FYTA 2CKBB 4ZUTB 1A7BA 2HLAB 4DFHA 3DYMA 2CDGB 2FB4H 3SE9H 3WIFA 3RGVC 5JHDE 5JOEA 2W9EH 3ZDXE 2X4QB 4NO5A 5KOMC 4J7RA 2B1HL 3EO0B 4NZTL 3L9RA 5ELIA 1CE1L 2HRPH 1OGAA 3BJLA 3C8DA 4JDVB 4U6XB 4PD4J 4HUWB 1NMAH 3RUGE 2VXSL 1A1NA 1EA9C 5A2FA 3KHOA 4LCIL 3VFVA 2JJTA 2APVA 3O2DA 2EXWD 1KCSH 1EVTC 1RMFL 1LO3H 1UCTA 3DV4A 3K8MA 3SCMB 3FQWA 3QXAB 2EDOA 4JRXA 2FIRT 1BQSA 1JZ7A 4M48L 4HBCH 4XP6L 1NGPL 5DD1H 1Q72H 4Z8FH 2MOVA 3O6FD 4LL9A 1A6AA 4WTXA 5MENB 3MCLH 1D9KA 5ANME 1JZ4A 3MOBH 5AUMA 4XZUA 4NWTL 1QZ1A 2QSTA 5DWUL 3O11B 3WCYA 4L4VD 4J3TA 3I50H 3QI9A 5ITBL 1II4E 1U92A 1LK2B 2X4OB 3MNWA 4QRQB 3T0AA 3ZKMD 2J88L 1JF6A 1X5IA 4FFZL 1ND0A 3RFZC 1KB9K 3RPIB 1SJHA 1GGIH 3RWDA 5D2LF 1JTOA 2A38A 4CGTA 1IGYB 3H9HA 1ZKAA 4LIQH 5JW3H 1DUYA 4YR6A 3I3DA 3G04B 4UILH 3EYSL 5I71C 3TIDA 3T2QA 3VXUE 3KYOA 3BAEH 2Z91B 4DWHA 1WV7T 5CJQH 1FP5A 5HGAB 5KVGH 4LARH 2EDQA 2OXGA 1IAIM 1EDQA 3RAJL 4PJ5B 1JNHB 4PB0H 2XQYK 3PDGA 4X4ME 4JFFA 5E4EC 1JGEA 3QG7L 4K55A 4HG4J 2MWCA 4XWOC 3QNZB 4HGMA 3HI1B 2DQGL 1CDUA 3DTXA 3I6LE 5LQBH 4NT6B 2EC9U 4E5XA 5D9SB 5ICZA 2N7BA 1W72B 3PWPB 1U41A 2QL1A 4K3JH 1YEJH 2VLME 1A4JB 3MMEB 3OF6D 3QAZC 3FB6B 5E1AB 1IC5H 35C8H 5FKPA 2YXMA 1KULA 5C0DB 1RIHH 4EUPG 5FM5O 3KLDA 4YDJA 1I7UB 1DANU 5F3BA 1HHJB 3UTSD 4NRYB 1BLNA 4M6ML 3T77B 3MRHB 4QXGH 3QIBA 3PL6C 4RMUA 1RZ8A 5EUKB 4LHUA 1BD2A 3ZYIA 1PGRB 2XWBA 3MJ8B 2GAZB 4LNRA 4XP5L 2FHBA 5DD6A 1A1OA 1I1YA 3HS0B 4L3CA 4P46B 3A6BH 1LP9A 4ISVA 5IVZB 2NZ9C 4LVOB 2WUCH 1FN4A 3BKJH 5CBAA 2CDFB 1CDBA 3BW9B 1RZJC 1A9EA 5EZOL 3H9YA 5D5MA 1I4FB 4WI4A 5FA4B 4PJ9D 1S5IL 3SPVB 3EZ8A 2HWZH 3HAEB 5TDPB 4K3DL 1ZHKB 5KANG 1V7NL 1VGEL 4ELMB 3L95B 4K8RC 4D8PB 1MCBA 1RZKH 1RJZB 3N1QC 5T1KA 3VFTB 1PKQA 4XMLL 5E08H 1MFDH 3P0GB 3WKMH 3K1DA 4WFGE 5IHZA 1HSBB 1O7SA 3PGCA 2H6PB 2MKWA 4QWWD 1NCBH 4MYWB 2UWEB 2YUWA 3HNTH 3W11D 4LSDA 1EGJL 1KLFA 1GC1H 2XTJB 2VDKH 4WWKD 5LGHH 1T0PB 2APXA 3TO2B 2RR3A 4I18B 5EB9A 3UJTL 3NH7L 3K46A 3CVIH 5B8CA 3AROA 4GRWF 4FFVD 4KPHL 2R69H 4JHAH 1MCNA 1HOCB 5E5RB 3L6FB 1QLEH 1MHCA 1WC7A 1KXQE 3BN3B 1S9XB 5BVPH 3EHBD 3D39E 3KPLB 5D7LD 3WN5C 5HHMB 1WZMA 4HX1A 1OTUD 1PSKL 2IGFL 5ESAA 3ZL4H 1I7RA 1B0GB 2UZIL 4HFUL 1DCLA 4HUXB 1NBYA 2HT3C 3BQUC 5KS9B 4KRNA 4RISH 1R3HB 1SY6L 1IGIL 1ZA6B 3L3HA 5GGRB 2NY4D 3MOAL 2I9TA 4QHMB 2J6EH 3O9WA 5SWSA 5DGRA 3WYRA 3QQ9D 5T1LB 1Q94B 2W65A 5ESVB 4GG6F 2H32H 3MCKB 3ROOB 5T3XH 3SJVB 3LKRB 5J1TC 5CMAA 1FC2D 3I6GB 1U8HB 4D2NA 4JFDD 5MEOB 1S9WA 1Q0XL 5F3HA 4H25B 4V1DE 4G9FA 2P4AB 3CFKB 4P2RB 1ORQA 2ZUUA 5DZOA 2VLKE 4AQ1B 3NMEA 2YUVA 5F9DC 4PGJA 1M4KA 4C58B 4JRYA 4Y19A 2W1NA 3GDBA 2CJUL 2AGJH 2E7HA 4RQQB 4RX4A 2YS4A 3NABH 3BKCH 4NPYB 2GJ6A 4HHAA 4OZIA 4JFQB 3FFCB 4Z9KB 4TN9A 4M5ZL 3CFCH 4RMWA 4A6YH 4JY6B 4NQEB 2FEDD 4XBGA 1EGJA 1YMMA 4YIQA 5L8LB 3G5VA 8FABA 1KPUB 4KI1A 3KR3L 1WCBA 4Z7UB 3LD8C 5GGSA 1OM3L 2NLJA 3UYPA 4D9LH 1YJDL 3IS1X 5J06A 3WIHA 1QP1A 3RJQB 4WUUB 1HKLL 2YPLB 5C07B 1T83A 4S1QL 4ZUWA 4CMHC 1HILB 4GUPA 2B0SL 2DQUL 1EFQA 1UG9A 5FYJL 3CLEL 1MIEH 1QUNA 4LRIA 4KUZH 1AP2B 5INCA 4KDVA 3IDGA 5C2BL 4AIOA 4XPFL 2VRAA 3ZYJA 2ZSVB 4P4KD 4ZFOA 1SY6A 1IGCH 1G0DA 1DE4A 4MXWL 5ICYA 1I3GH 4OCWH 5J8OA 4L8SA 3CXDH 3GNML 5IMKB 5GS0D 3U30C 1KLGB 1AD0A 3VFWA 1BFTA 1JHTB 3IDYC 2YUZA 2OTPA 1RJLA 3S36X 1A3LL 1WBXA 2AABL 4XRCB 1A7PL 1NGZB 5CZXD 1YN7B 4WWID 4UT6H 1M71B 3T0EE 1QO3B 4I0PC 3CGTA 5AAMA 1QFOA 2JCCB 2P5EB 3QO0B 4F58L 4PB9L 3BP7A 1JIBA 1UCBH 1OTTC 2ORBL 5GJTL 1YNKL 2MQ0A 4F7PA 4KMLB 2ITDB 3G08A 1YUHA 2AI0H 5HHQA 3FTGA 3KPSA 2C3GA 2VUOA 3OKDA 5IP4A 2VWEC 4I5BA 2DQTL 3E6HA 5HYFA 3GIZH 5J57B 4LCYB 1R5VA 3ARED 5B3NA 1IAOA 4NM8H 3WJJC 4BZ2H 1BX2B 4M1GH 1T4KA 2UYLA 2EZ0C 3E3QE 3T3PF 3EO1B 4F15C 2DKMA 1WQVT 1OARH 2BMKA 3DO7A 5D96B 4RIRA 4I0CC 1FYTE 3RWJA 3VMPA 2YKLL 5IJKC 1JV5A 2YD8A 3BIKA 3PWUB 2VLMD 1A7NL 1AGDA 3BWAA 3GSOA 4YXHL 4UBDD 2C3VB 4DJMA 4Q9RL 5F7DB 5FB8A 3GHEL 2DMBA 4JCLA 3SE8H 4PJAA 4QRPE 2GIYA 3W9DB 4H5SB 2C7UB 2R2BA 5HHNA 2FNBA 2W0KA 3TO4C 3CNKA 1O0VA 5C3LD 4H1LH 4XGZB 1FYHB 1XGPA 4FHBD 2Y5TB 1QFWI 2BVPB 2VITA 5DJ8B 3NIFF 1EHXA 4N8CH 1FZKA 3TZVC 1SEQL 1RZ7L 3PHQB 4OSUH 2WQ8A 3NACH 3TH3T 4JRXE 5E2JA 1JRHL 4WEMB 1IE5A 3QPXL 3MBEB 4KDTA 5IF0A 4HPYL 4ZDHA 1MCDA 1MCRA 4RBPK 2PUQT 1GZQA 4ZUSB 4J3VA 3DX6B 1QRNB 32C2B 2AEWA 3VI3E 1MCKA 5IGXL 1OB1A 3ARRA 1H3GA 4NBXB 3B2VL 3WFCL 4L3EA 4X80L 1XIWD 3MNZA 3B2UC 3DVGB 4GSDL 4WHYH 4DGVL 2XWTB 1UB6B 3MJ9L 4EXPX 3QIUD 4GMTL 5EOQH 3SQOL 4F7EB 4RMQA 3BXNB 4TRPL 1T2QL 4FXGA 4OGYH 4PJGE 2BJML 4WFGD 3B5TA 4OZ4B 5IWLA 1KGCE 1M7DB 5FYJU 1FQ9C 4OI7A 5EIIA 4H8WC 2OJEA 5IVXB 1OPGH 3DUSB 3VD3A 3RIAF 1E4WL 1CQYA 4KQ4L 2BXZA 1M7IA 1GH7A 2D0GA 3CD4A 2A6KB 3V6OC 4FZ8H 4PJBF 1E4KC 2N1KA 4UB0L 3N1PC 4NHCH 3MFFB 1CGSH 4RWYL 4ZFGL 4JKPL 4U0RC 3WNMA 3D39D 4KAQH 1KT2B 1I1FB 3B3IB 4NKMB 1FVEA 2H2SC 3IDUA 1H3TA 2DLHA 4HIHB 1YNTA 3BRGC 2JIXA 4XMKH 5J12C 3T2OA 4OZHF 4LBEB 4XHJC 5L6YH 1CDJA 2PO6B 3GSNH 3NPSB 5GS1A 2DLGA 1G7LB 4R8WH 1CDCA 3RDTC 1FVCB 4N0CC 4QHLB 4ZO7A 3MV11 4WI2A 4R26L 4ESKA 1FFOB 1G7HB 3TLRA 1HI6A 1S7WB 5F1IB 1AGCA 1FFPA 3GB7B 2EE2A 4X9GA 2RQ8A 2IWGA 1KIRB 5EC1A 4IMLA 5DYOA 3MRNA 3U83A 4E0RA 4QCIA 2EIZA 3L7FA 2VLKD 4QRUB 4P57B 2IAMC 4W6WB 4JPIA 5JOFB 1H5BA 4E41B 5IV2A 4MNGB 2PYEB 4AT6A 5C6TH 2Q76A 5DC9B 5EBGA 4PJDB 5LKNA 5GRUH 5MEPB 3BMVA 3QWQB 1HWGB 1G0XA 3MJ9A 1IT9H 5EWIL 2X4NB 3WIIH 5KJRH 1U9KA 1EX0A 4ZPTA 4X7CC 3MRLA 3WUWG 5IM7B 3EIFA 1C12B 1OSPH 3WO4C 3VWJD 1L0YA 3G9VA 1MCSA 4X5XB 1F3DH 4U1MB 5HDQL 3GMPA 4HH9A 3L5WB 1X44A 5CEZE 4ODHH 3S4SB 3KLAB 1C1EH 2V5RA 2DLFH 1VCAA 2YSSA 3OKEA 5IVOA 3RGHA 1RJCA 3OJDB 5D2LA 3DSNA 3TWCH 4QLRA 1JHKH 3G5ZB 3V52L 1U3ZA 1KJ3L 2CRIA 5IFAH 4EOWH 4BFIA 5C0GB 4LAQH 3WKNA 3SDAC 5B39G 3B6SA 1I75A 1YNLL 4YHMH 2VDPL 1AGEB 3PABA 5D93C 4MD0B 1C5DA 1NEZG 1GIGH 3LH2H 3QEQE 1U3JA 1JK8B 3F7QA 4DKFL 2W07A 1QFWH 1OAYH 4TSAH 3RVWD 5GIRB 5J6GA 5FO9A 3LKPB 5JHLL 4L9LC 2FX9H 1E4JA 5TPWL 3UYRH 4KI5D 1V5JA 5JA9A 1QQDB 3FB7A 5BS0B 1RZJL 1QVOA 1FNEA 1NGWB 3U0PA 2YD4A 1UM6L 3OKLA 3AVEA 3NCFB 1AIFB 1JGUH 5B38G 1EFXB 3T0ED 1AXTH 1CZ8L 2VIRA 4K8RL 1A3RL 2FX7H 4EXKA 4PJXF 4F7MB 3O2VL 3FQNA 2I27N 2GK2A 2MQCA 5I30H 2YA2A 4G6AC 4MHHG 3WFDH 1LO4L 5SWSE 5KSVB 5EU4A 1FG9C 1NCCL 1UJ3A 4NC1C 2Y7QA 4YHKH 3VFNA 4X6BA 1CGXA 1AQKH 5EOCH 1JPGB 3U0TA 1P5VA 3QWRD 4JQIL 5D1XD 5DLML 3IXTA 5FUZH 1QSFB 4U05A 4XNMA 4UUJA 1XGUA 2ADFL 1CFNA 3CSYA 4PRDA 1QLFB 1SYVA 2GEEA 3P77A 3RTQD 2M1KA 4ODUB 3SKMA 3K3QA 5DQJA 1W0VA 4OZGE 1RAMA 3SDCC 5D1ZC 5I1GH 3D0VA 2F9BT 4LLYB 1FYTD 3E8UL 1JE6A 4KKAC 4X99B 5HSFA 3RZCB 2Q8BH 3HI6L 1DQMH 4KU1A 3S35H 3V4UH 2OMNA 1FNFA 5B3JE 3PGFL 5GGTH 3OPZH 4GW1B 3RIAK 3QA3A 3GSWA 5CIPA 5DMIL 4GKSB 4OZIE 4KGLA 5KVEH 4HZLA 4LCCC 1DJSA 4ZS7H 5IHLB 4QRPD 3PL6A 1HHGB 1X5FA 1NGXA 2W9LA 5E6IB 1OGAD 4LMQE 3TEUA 1VACB 2QJDA 4I77L 1T66D 3S5LB 2OZ4A 1DFBL 1H3VA 4G80A 4TPRL 3WO3B 1WIOA 4LHJB 4LPWA 5ISZE 2OI9B 1EV2E 4UDUB 3R0MA 1JPTL 2HFGL 2JB6A 1UM5H 5TFSH 1CIUA 3CK0H 5DI8A 2EXYD 3HN3A 4GRLA 2P24A 4TSBH 4LSTH 5HHOB 4G8GB 3UDWC 2VL4A 3FO2B 4ODVL 3PHOA 4JRXD 3MRCA 1U8QA 4N90E 4ZQKB 3C5SA 2QADC 4PIRF 5EOTB 1F5WA 2VAAA 4F57L 2HVJB 3WFHA 5CINL 1AQDB 3Q6FB 1VGKA 4G6MH 4O51A 4L8CA 4HPOL 4GQPH 4F3FA 1NUNB 3ARGD 4GRWH 4B53A 4WV1C 1G9MH 3RJDA 1KGCD 3GGWB 5EU7C 3G5YB 4FMFA 3RNQA 5JR1L 5LAXB 5BO1H 5EDXA 2R9HD 2XKNA 3HMWL 1ED3A 4YGVB 4IIQB 5F89A 2AQ2A 3IFOA 2VYRE 3K80A 4NWUL 5EBMB 1A6WH 3IFNL 1EXUB 3BO8B 1U6AL 3LEYH 5KSAC 2CIKA 4YX2H 3FZUD 3C5JA 3WN5A 1D5MA 1EZVY 4ETQB 3IKKA 3KPSE 1WFOA 3D0LB 2F58L 5SWQB 1RUML 3BQUA 4RBPH 1S78D 4CVZA 3MRQB 1S8DA 3MBXH 3KJ4B 2B8OT 5IVNA 4JN2B 2D31A 2C1OB 4HWZA 2QBWA 3O6MH 4LEOA 3ZSTA 3JV6A 2EDDA 3U7YH 4N8VB 1L9MA 4BSVA 3EO9L 4X9HA 1FPTH 5EC2A 4DKDC 1YEKL 5D6CA 1W0WA 4CVXB 4DZBA 1CBVH 3Q3GB 3OKMA 1X5YA 2CMRL 4O2CA 3WHXA 2ICES 4JB9L 1E6OH 2VDRH 1NDMA 2NNAA 4XVTL 2VAJA 5F8QC 4I1NB 4JFHE 3MYJA 2V7HA 4CMMB 4AM0A 5IUSA 4WNQB 2Z4QB 3N1FC 2DQJL 3ZT6A 4B7IA 2GQHA 4P48A 3M8OH 1P4BL 1S5HB 4LDEB 1UB5B 3UBXI 1MHEB 3QQ4B 3R1GL 4FTVE 1RZFH 5I1JH 4P9ML 4LHUD 3A6CH 4URTB 1BD2D 1YEGL 5JIHA 3MODH 5JW4Q 3VFSB 1S3KH 2Z31B 1NPUA 3QZWG 1QFUL 5DJAA 5E8NA 2PR4L 3K81A 1A7RH 5CGTA 4JDTL 5IB4A 1NMCC 2J4WH 4B41A 1FZJA 3MA9L 2C4FT 5HPMB 4OKDA 3MNVB 5CEZD 4I3SL 4WUKH 3BN9C 1WTGT 4NKDB 2GK0A 5IB2A 3EOBB 1E28A 4MJ6B 5IMMB 3ZMRA 1TMCB 4HJGB 4O4YL 1GXEA 2KH2B 3ARBA 1URLA 2WIIB 5I6XB 3D25B 4FNLH 1MFAH 1KEGL 1U58B 4KRPD 5CILL 2R4SH 5I9QB 4XPBH 4FRWA 5T5NF 1HH6B 3HRZB 1GGTA 1N0XH 5T3ZH 2HTLD 4BQCA 2H3NA 3K0WA 4C56B 5DD0H 1G7MA 2P8LB 3GHBL 4ODXA 4DGYH 1U91B 4TUJB 2BFVL 1KBGH 1UA6L 5KSBF 1QPPA 4I0PA 3KPQA 3ULUH 3N9GH 2WWKT 3MRIB 2NY3B 3QNYB 4ZD3L 1ZLUK 4NQTA 5A43C 2XI9A 4RMVA 3QCTL 1NFDF 1I8MB 4X5LA 2VDOL 4NQXB 3D85A 4M1DL 3QDJE 4I48A 1FV1B 1RJYB 1SYSB 2IH1A 1ORSA 3S3PA 4P3CH 4Y1AA 3O9WD 3IJHB 5SWSD 3CVHH 4FQHB 5DEFA 4ZTPH 4HK3J 1KG0B 1MCIA 3MACH 4Y89A 4Z0BH 1LEKB 5FFLA 4J6RH 3WJJA 4WO4B 4X5WB 5I8OH 4XPTL 1X4XA 2QHRL 3RX7A 1BECA 3HUJF 4GH7B 2W9DH 4JY5L 1I8LC 1C7SA 3Q1SH 5ALBH 1VFMA 2VLRB 3JWDH 3TNNB 4G9FD 3CH8A 1NCDH 4M1CD 1ZWIA 3VXSA 1J1OL 4LSQH 3LIZL 3CLFL 1RUPH 2J12B 4M8QA 4HQQH 2VDML 4UV4H 5JDSA 3TO4A 3L3JA 1BJMA 4BKLB 4H0HB 2FD6L 3LN4B 1X5ZA 3GBNH 4RGNC 2BSSB 5DFWH 3MLVL 4M6NH 4PJ7B 3I6KB 4L29A 1RULH 1P2CA 3D2UA 2D7TL 3QPQD 4LFHD 2AJSH 4L3AA 2P5WE 2EIDA 4MD4B 1J0HA 3TZVA 5ISZD 4R9HA 4P5TB 1YMMD 3JUYA 4LSUL 4RGOH 1IC4L 3TM6A 3RHWF 1WZKA 4UOW1 3HFML 4PJHA 1KENL 1JNNL 1KXVC 5LBSH 2BNQB 3DBXA 2IANE 1A2YA 4UZGA 5D2LE 1T3FB 3RWFB 2J7LA 5A2LH 5E1HB 4N90D 3PV6B 1QRKA 3BVNB 4NQUA 2IG2H 5E94B 4NSKA 5IIEA 4KZEL 4PJBA 5E00A 4PP2B 3FQXB 4KQ3H 5DHXB 1H3PH 4LQFH 2A74A 3QUMH 3SKNB 5DVMA 3NFPA 5A2IH 2EYSB 2Y07H 3QUXB 4HS8H 3VJ6A 1CF8H 2FLRT 4DZ8B 5TE4H 3MFGB 4AH2A 4PLJC 4FQJL 2OR9L 1NBVL 4IDJH 3VFGL 4GKNB 4Z0XA 1JL8A 4MXQC 2UY7A 3X12A 1XGYL 3UPAA 1N7ML 2ADJB 2Y25A 5D7IA 5DR5L 4WEBL 5DEGB 1DN0A 5TDOA 1YPZF 2EYTB 3GSRB 4X6FA 4JM2C 1MNUL 4MD5A 3EFFB 4JPKH 2KQMA 3DETD 4MB3A 5GPRA 3UP1A 4Z5RB 3DX7A 3KPSD 2NY2D 2ICWJ 1CXIA 3CSBA 2G2RA 2V9TA 2DQHL 4LPUA 5HYJB 2DWEA 4QHKI 3S34L 4G7YH 5KBNC 2NX5E 3C5ZB 2X7LB 3GMMA 3X14A 4HJJH 1N6QL 1B4JL 4YNYA 1VHPA 2LTQC 3V5DA 2X4SB 5CSGA 2GCYA 5HGDB 2I9LB 1U8MA 5ADPL 5FYKH 3S36H 4U6YA 2IQAA 4OI8A 1DBAH 3C09C 4AEFA 3BGMB 3N85L 4PJCF 2EEDA 1N59A 3IAPA 2F74B 3JTSB 4LSVL 2IAMA 4Y4KB 5CBEB 4MWFA 4JFHD 2W91A 4FXKB 2D7PA 3U2SA 3GSQA 3CZFB 2VTFA 4NUJA 3S37L 3DYPA 5DUBB 2DYPB 3WNPA 1EBAA 1MRDH 3AS1A 3BGFC 4J4PA 4FTVD 4O2EB 1SVCP 4LGSB 4WW2C 1OAQL 3O2DH 4JN1H 1FNHA 3T2NL 4OV5B 2X70B 2QTEA 3PG2A 4R6UA 4X7FC 3TF7C 3LS4L 5I1AA 2RJMA 5F9OL 5JXEC 5IFJA 2ILLA 5DMKA 4LKCB 1T80A 4WTZA 3W9EA 1P5UA 3K8KA 4HC1L 2AEIT 4NDMB 3TFKD 2OQJA 2ZUXA 3FN0H 2HJKA 1GPOL 1PY4A 4P2OD 5EO0B 1G7JA 2Y36L 3EJJX 4NQVA 3HE6B 1FFRA 4GRWE 2HKFH 2NTFA 5BQ7A 3EFDL 3VRIA 4XNZB 3HZVB 4FQCH 4FZEH 5GJSH 2NY6C 1WFUA 3IJSB 2D9CA 3I02A 4PJFB 1UQSA 2IBZX 4WI8A 5K9QG 4ZYKB 3UC0H 1I8KB 1NCNA 5E5MA 3RL2B 4Z6AT 3DROB 1GGCH 1L6XA 4GW5B 4YPGB 1D5ZA 3TVMC 2Q87A 2ZP0T 3V4PL 4UU9A 2BVQA 1MLBA 4GG6E 1V8HA 1IM9B 3FOMA 4U6HA 1Q0YL 1KJMA 3OG4B 5DDHB 4KKCD 4PLKD 5C0BB 1BOGA 2Z92A 1M05B 2ATPB 4M6OH 1K6QL 4ZXBB 2V2XA 4HS3B 4Z7VA 3AC0A 5J13C 2BOCB 2NCMA 3RHWK 1OWWA 2A77L 4N5EC 3GZKA 4OF7A 1CE1H 2HFFB 3WHE0 1AFVL 2XFXA 5DUML 1A1MB 3V6ZB 4XNQA 4G3YL 4UV7L 1ZOXA 3REWA 1CICD 1NANI 5EO9B 2VXSH 3BPCA 4N9GB 4LCIH 1KCUL 1KNOA 5EA0L 4YBQD 5KAQG 3PHSA 1JZ6A 2XPGB 2EDWA 2NZIA 3O8XC 3SDCA 1KPVA 4Y16D 5D1ZA 4NO3B 1AR1D 3R8QA 2W0LA 4LHQB 3D69B 4OCXL 5C08B 2AP2A 4JFPB 1P7KA 1NGPH 4BUGA 2UY6A 1BIIB 1TTUA 2DOCA 5CHNA 5D2NB 4P23D 1VERA 3FQUB 1W8NA 1TNNA 4F7TA 3P9WB 2WBJB 3EOAA 4I2XA 4QXTA 1IZKA 4ZOBA 1D6EB 4PFEA 3FRPG 5DWUH 4NWTH 2ED7A 4EBQL 1CD8A 2WWMC 1R6VA 5ITBH 1WZ1L 2FYYB 2PTTA 4R2GB 3IVKB 1EEZA 4YHPA 5L2JA 3GSVA 2J88H 1P1ZB 4FFZH 1MCEA 4Q7DA 5T1DH 1J18A 4RDQG 5JPNA 3DI3B 2P5WD 5BZWA 4O58L 2Q86B 3EUUA 1AGFB 4WI6A 3EYSH 3MXVL 4EQ3A 4YDVA 1FFQA 4ZS6C 5I1KL 5FDWB 1KB5L 4PGCB 3CFBA 5T3ZE 5AD0A 1I7ZB 4ODWB 4LF3A 1EERB 2GJJA 4NQCB 5KN5A 4Y2DB 5BZDB 4E9LA 5A16B 1CR9L 3RZWA 3RAJH 2ARJQ 2M8XA 3AUVA 1RIVL 5JIKA 3MO1B 5A2JH 3QG7H 4ELMF 3O3AA 5TDNA 5EPMA 1NGQL 1A6TA 4DQOL 1R3KA 4ZO9A 4QOKB 1UKQA 1DVFD 5T5FL 5E70A 4IDLA 3WNKA 1ONQB 4MXVF 1Q9LB 2UWEF 3LN5B 4XP1L 3MUZ1 1IAIL 1AD9B 3B9KD 4F2MA 5JIIA 5MI0B 4FQQA 3O0RL 1R5WA 4WU7A 4LLMB 3T3PE 5KW9L 1RHHB 4GKOA 5EFIB 5BJTA 4R7NA 1LMKA 4CW1B 2FJFA 2WM0A 2KKQA 4X4YA 3UPRA 3VH8B 1T1XB 5AZ2L 3K74B 4TQEL 5A40E 1UACL 1MQKL 2P7TA 4TTDD 1XH3B 5C0FB 4PUBL 1S7UB 3DGGB 4UI2A 3NFNA 2GTZB 3OHXB 4XP5H 4L4TE 5KS9F 2D0HA 2F53E 4JCMA 4ZAKB 3EBAA 4IOIB 4LFHG 3LRHA 3BP4B 4GBXC 5C7XL 2NX5D 1QA9B 5GRVL 3T65B 1A6PA 4OLXL 5EZOH 3KYMB 3WEXB 3TJEL 1FCCA 2UVEA 5H35A 4PRHE 3VXSE 4ZUVA 3QDMA 1S5IH 2AXFA 4PV8A 4K3DH 1KB5A 1PQZB 1HDMA 1Z2KA 3ZDZF 1VGEH 4PG9B 2OM5A 2YD3A 4XC1L 1U42A 3ARDB 1EVUA 5F96L 4A6YB 4XMLH 2DI8A 1G1YA 3C8HA 1S9KC 1TZIA 2H9GB 1QHPA 1OVZA 4AYFA 1FGNL 5BRZE 3BZFA 4PJ8C 4U1JA 3Q6GL 1OAXL 1WBYA 2IPKB 1CXKA 2Y23A 4EN3D 1NANH 4S1RL 5FGCB 2XTLA 5I1EL 2HLFC 3MGTA 3QWOA 1BQHA 3NH7H 3UJTH 3UTTA 3M17B 3UTQA 1JUFB 3TH4T 4GRLD 4BJLA 1G6VK 2ERJB 2NZ9D 3L3IA 1U95B 4DCQB 4NJAH 2YMXH 2P8MB 1YN6A 2ZOLB 3BPLB 1X5GA 3F6LA 1FO0A 3QUZD 1J88A 4Z7UF 4X83A 3SOBL 2PKDA 1VEMA 3JUZA 1PSKH 1K8DA 2UZIH 1T22B 2H2PC 2VE6A 4PJBE 5TGBA 1XGQB 3MJ6A 3EJZD 2ZG2A 1SY6H 4ZOCA 1IGIH 2Y06L 5IQ9B 3ULVC 3MOAH 3P11L 2GITB 3OR7B 1I9EA 1GZPB 5DMGD 4APQC 1RZIB 3VFOA 5K9KA 2OSLA 3BEWB 3FT4A 2ADIA 1T2XA 3HC0A 4OKVB 1LO5A 2VISB 3MV01 2ITCA 1OD7A 5ITFA 1YECL 4OZHE 1JBJA 3KYNB 1JRHI 3OAZK 3C8KB 4WCYL 5ESQB 1Q0XH 1EHNA 5BXFB 5D7IE 1I9IL 1XR9A 1AY1L 2AAVA 4PGZA 3OXSA 3KXFB 5FYLL 1B6UA 1AHWB 4H0IA 3L7EA 2UUDK 4P9HH 3LB6C 4H1LG 3S3JA 3C6SB 1MQ8A 1MFNA 5CLWA 4HF5L 3ZE1F 2CJUH 1ZE3C 3DMMB 4PRPA 1JMZA 5IB3B 2VXVL 2JCCF 1IKNC 1U8JB 3QXTA 5HYSA 5EBLB 2IFGA 3NCJL 4QRRB 1T1WA 4DN4L 3O3EB 2XQYG 5DJCA 4M5ZH 1XT5A 2KDGA 4I4WB 2ZKHL 2MHAB 4K7FB 2BSRA 2VXTH 3NFSL 1HEZA 2P43B 4BSWA 3PQYA 1J0YA 3KR3H 4PRBB 1GOGA 3LQMA 5CKGA 1I8LA 1OM3H 4LSRL 3F58L 4JFEA 1YJDH 1G9NC 1CDHA 2B5IB 5CZVL 3MUHL 4NP4H 3ES6A 4WW1A 4J23A 1UWEL 3GK8L 4U1IB 4S1QH 1Q9OA 4M62L 3UZQA 2B0SH 2P46B 2DQUH 5FYJH 3CLEH 4PRNA 3FONB 4N0YH 2F54E 1WLHA 2LFGA 3VXMB 5C2BH 3DYOA 4K7PX 1FG2A 4XPFH 4LCWE 2DJ4A 1D6VL 1KFAL 1OF2A 4CJ1A 1TJHL 5JW5A 3BHBB 4N9OB 1U8PA 1IKFL 2EXWC 4R0LB 1P4IL 3IXAB 3PWNB 1Y6MR 4MXWH 1ZANL 2W60B 3QISA 3MV7A 1DBML 1KIQB 4NQSB 3BZEB 5LWYH 3OTTA 1UZ8B 2ZNWA 3HC3H 5F1NA 3O6FC 2AABH 4LVNB 1A7PH 1BFOA 2BCKA 4ZFZA 3QBTB 3ZHDA 2PYFA 2R23A 3OX8B 5DRXA 3DXAE 3V4VL 1XF5A 4PY7B 1ZLWK 4F58H 4PB9H 3A0OA 1C7TA 1RK0A 2ORBH 3T4YB 1S7SA 1Z3GL 2E6JA 5GJTH 4U4BA 5LCVL 4M6AA 3S37X 1QSZA 4X6DA 5T3ZD 3TBSA 4ZSOB 4PRIB 3ARBD 5J9PA 1YPZA 1V7ML 2DQTH 4PJXE 5BV7B 2ID5A 4LQ1A 5FUCE 4GAFB 1MCQA 4ZNCD 3JZ7A 4K71B 2DWDB 5FK9A 1WIUA 1RK1B 4NN5B 3QUYB 3LN9A 4X6CB 3HR5B 2NXYB 4UOJA 4G42A 1A9BA 2R0WH 4MLIA 2YKLH 1N5YL 1SBBA 4Y4HB 2NMSA 5IVXF 5EBWB 3FL7A 4IM8A 4YXHH 3SGJC 4JM2A 4Q9RH 3RWGA 3GSNB 3GHEH 5JNYA 2V17L 1P53A 4HKXA 1OTTD 4KWUA 1Z5LB 1ITCA 4X0KA 3VA2C 3D85D 4KKLD 2XA3A 3FRUA 4NC1E 2EO1A 2HN7A 2OL3A 1F45A 4QXUL 4OF8A 2CKBA 2HLAA 1SEQH 1RZ7H 1IJ9A 5L7XL 2X4QA 4KTDL 2F53D 1EHLL 2MTPA 1FHGA 4JZOB 3MLXL 1JRHH 2MJWA 4J3WA 4HPYH 3QFJB 1WSST 1QSVA 1AI1L 1ZA3A 4HDIB 1OL0A 4YHYB 1CD1B 1F13A 2UVFA 4UQ2B 1NC4B 4JGUA 5DJ6A 4PRHD 3U0WL 4JDVA 5IGXH 3VXSD 5EZIL 2CLZA 5GRYA 1NLBL 1R24B 4U6XA 4I2XE 3B2VH 3WFCH 4X80H 5H2BB 5E2UL 2YD7A 5JA8B 4GSDH 4KTYA 5FKAB 43C9A 1JFQL 4DGVH 3FMGL 3SE3A 3MJ9H 4GMTH 3SQOH 2V5MA 2LQRA 4TRPH 4WU5A 1T2QH 3PNWA 2C4XA 1IBGL 2BJMH 3J7HA 3SCMA 1GSMA 1BFVL 3IJYB 4PJDF 4S11A 4WW2A 3E0GA 4HIIB 1HCVA 4PJ9C 1ZVHA 5HPOA 4ONGL 2ZG3A 5BRZD 5FEBA 2VR9A 3MQIA 5DHVA 2G9HA 4GKZB 5I74B 1E4WH 2DQFB 2WLYA 4KQ4H 4YGAB 3L3OB 1MHPL 2BNRB 4HWBL 4UB0H 5JQ6L 5IEHB 4DOHE 4RWYH 4ZFGH 2MPAL 3VGHA 4JKPH 1YEFL 4BH7A 3W11C 1XFPA 2NTSP 3MCG1 4R4BB 1A6ZA 3T4AA 3D87B 2BVOB 4JG1L 5ICXB 3Q2CA 4FFVC 3V5HB 3FOLB 3R0NA 2GSGB 4RSVA 2KZ1B 4PRAA 3TVMA 3ZLQC 3GMQA 2ATKB 3EHBC 3ZDYF 1MCOL 4R26H 1CFVL 2DL9A 3VGDA 1OTUC 2FRGP 4QY8B 5HGAA 3LS5H 1G7PA 3P0YL 3R06B 4DN3L 2AJYL 1BF8A 1JNHA 1IAKB 2UV3A 1TCMA 3EW3B 4PJIB 5IMOA 3LKQA 3LKSB 3QQ9C 4XWGL 1BMGA 3QNZA 3QXUA 1IGML 4KJWD 1CGWA 4NT6A 2COQA 1EAPA 4OZFH 4JFDB 4U1HB 3BMWA 2DMKA 3JWOH 3WLWD 3V2AR 1W72A 3PWPA 4G8FB 5A1AA 3BP5B 4XHJD 1JGDB 5DUPH 2ZPKL 5EWIH 5E8EA 3IRPX 1A4JA 3W0WE 3MMEA 3FB6A 3ZTJG 2ESVA 5KZCB 1H15B 4C4KO 3QDGB 1JVKA 5L8KB 2Z93B 5C09A 3T0VA 2EC8A 1I7UA 1NAML 3HKFA 2XIDA 3B5GA 3CFEB 5HDQH 2GHWB 4MNQE 4RFNB 2IALA 4NRYA 4LCUB 3T77A 3S6CA 1WVZA 3CCHB 5LGJB 5E6IC 1KCVL 3MV9A 2WNGA 3X11B 5CIPH 3VWKB 3C60D 3ZKND 1ZEAL 2GAZA 1KXTB 2DMCA 2OI9C 1KJ3H 2JKXA 3HE7B 3VGEA 4AENB 3HS0A 4P46A 1T03H 2FEDC 2UUDH 3HZMB 2F54D 1YNLH 2CDEB 2VDPH 5IVZA 3VI4F 5FAAA 2W38A 4LCWD 2CDFA 3GEWB 4DKFH 4J4PD 4NOFA 1B90A 1AO7E 4EUPA 1CVRA 2IF7A 5FA4A 4F9PC 1Q9KB 1MFEL 5JHLH 2FCBA 3MX0A 4N0UB 4U1SA 5TDPA 4OQTL 1JGVL 3U4AA 1CG9B 1RZJH 4D8PA 2LVEA 4AEIL 2CLVA 1O7VA 3QEHB 1ACYL 2XWJB 1X6NA 6CGTA 2D7OA 3SGKC 4Z77B 4P4KC 2EEAA 4K8RH 1A3RH 3DXAD 3HAEH 3Q5YA 1L6ZA 3KPPB 1XMWA 3HG1B 3VXRB 5KSBE 2W92A 4YDLC 4XXDB 5GS0C 3BFOA 1LO4H 1SVZA 4ORZC 4QTIL 4KHTH 3TO2A 3T09A 3GBML 4I18A 4YK4B 5I1DA 1NCCH 4KZDH 3V7MA 2I07A 2G5BA 1NFDE 4JJHA 1OD9A 5F7LB 1G6RA 5CZXC 3O45A 4HS6A 1NMBL 4PGDB 3L6FA 4HAGA 4LLDA 4HUVB 3TYFB 5DLMH 4ERSL 3KJ6L 1S9XA 1PZUB 2VLJA 2ADFH 2EC9T 1T04B 1X7QB 1INQA 1P84K 4H88L 5ECJE 4ZFFB 4Q9QL 2AJ3B 3GO1L 4X7TB 3ME0A 1CXHA 2X89D 3E8UH 1D5BB 1R3HA 4LLWB 3V9FA 3HI6H 3HUJE 4QHMA 3AREB 4NHUB 4MA1C 3PGFH 4P2YA 1Q94A 3CSPA 5ESVA 5DMIH 1DANT 2OP4L 3ROOA 4QHUA 4NNPL 4EDXB 1ZT4B 3MLUL 4IRSD 5GHWH 1YC7A 1LNUB 4OIIL 1ZLWH 4UTAL 1OGTB 1DFBH 5E8OB 3F7YA 1N6UA 4TPRH 4H25A 5GS2H 3CFKA 2Q1EA 1JPTH 2HFGH 1VFOA 3IFPB 3EYOA 3NA4A 4OCRL 3VFMB 3GFUA 3IB4A 2AW2A 4UBDC 4XP4H 5I2IB 5E7FA 4JANB 5F9WC 1C8PA 1A8JH 1CXLA 4ODVH 4NPYA 5D1QC 3SDCD 3BPOB 2B1AL 1KJVA 2XN9A 4JFQA 3FFCA 1VFAB 3K4DA 4YDIL 3JSSA 5F7NC 3CMOL 3I3BA 3ECBB 2HRLA 3QQ3B 4JY6A 1AGBB 4F57H 5CJ5A 3S88L 1FAIH 5DQDH 1KPUA 3BPNB 4JFYB 5CINH 4LLUB 1SM3L 1TVHA 2CLRA 2IFFL 4Z7UA 4CU6A 4HPOH 4K3EL 2XQBH 4KROB 3L3DB 4PJ8A 4F33B 2R8SL 4R7DB 4HK3N 2YPLA 3UEZA 3IAGC 4XAKE 3D3VB 4HULB 1WF5A 1HILA 4KMTL 3FQTB 5JR1H 3GKWL 4J1UB 3O4OC 1Q1JL 5TF1L 5FM4A 5JW4N 1MWAB 5KVMC 2BC4B 3HMWH 5IOPA 1XIWC 3QO1B 4GS7B 1WFTA 2Q6WA 1HKFA 1U6AH 1A7QL 3DUUB 4MJIA 3B9DA 2VABA 3QIUC 1R3IL 5I9QC 4Q6IC 3SO3C 3GBLA 2DKUA 2H41A 2QADD 4XI5D 3UX9B 2FZ3B 1YPZE 3FN9A 1RUMH 1OAUL 5FM8A 2V2WB 1N0LA 3BIBX 4J12A 3FHAA 1MH5B 4DEPB 2Q3ZA 4NUGL 2O5ZL 1YN7A 3C9NB 1U3HB 1QO3A 4AY0A 3H9ZA 3VXNB 2JCCA 2P5EA 4JE4B 3EO9H 1BJ1J 1YDPA 1YEKH 3DX9A 4LEXL 3IF1B 2CMRH 4OF5A 3VCLA 3EOTH 3OXRB 2Z8WC 2WINB 4JB9H 3RX8A 1EIBA 2NY0B 4XVTH 4BQ8A 1RUQH 3INUL 4J8RA 2AJZB 2VKWA 3TC9A 1ITBB 5DJDA 2DQJH 3CVHB 4LVHC 1QFWM 4MZ2A 5LJYH 1P4BH 2FO4B 1L7IL 1PX3A 2IEPA 1QHOA 4PJCE 1IKNA 3R1GH 4DK6A 1BAFL 5GGUB 4P9MH 3OKKA 1MLCB 1QSEB 1YEGH 4HIXL 5F7WC 5SWZA 1J8HB 4IRJB 1CLYL 3I75B 2CIIB 3W0WD 3PWUA 5F88B 3ZTNL 2C3VA 1QFUH 1SQ2N 4U1GC 3O41B 2PR4H 3C6LD 4JDTH 3LDBB 2SEBB 5C0AB 3R4DA 4QTHA 4XGZA 2YUXA 3MA9H 3QFDB 4M7JL 4AIZB 4I3SH 2BVPA 5DJ8A 4HKBA 3MV8B 1XR8A 2EYRB 4OLYL 4JRWA 4O4YH 5I73B 1SJXA 5DEZA 5HYQB 1CK0H 4R90L 1KEGH 3MUGA 3WD5L 3VWJC 5CILH 5D7JB 4NRXA 1EBPA 2AXHA 5B21A 3TBTB 4XCFL 3DX6A 1H0DB 5CWSA 3TA3D 1AO7D 1R3JA 1EJ6A 5MENE 4PJ7F 3GJFB 3QRGL 3UTTD 3O6FA 3K1KC 1RIUL 3BZDA 3CH1A 3GHBH 5IK3A 3MRBB 4YZFF 4JJ5B 1UA6H 1S7QB 4M5YL 2NY1C 2FJHA 2XWTA 3T8XA 4F8QA 4ZD3H 1BVLA 3L5XL 2E9JA 4N0FB 3QCTH 3FO9B 4L4VA 3QUMB 3UBXB 5FOBB 2VDOH 3RVWC 4M1DH 1M7DA 3GSXA 4LPYA 4HIJB 3DRQB 5JORB 5TH2B 3VU2A 2ZUWA 5IVXA 1VA9A 5EU3B 3DUSA 2CR6A 1ZXQA 1FL5B 1K5NA 5I1LB 2Z35A 4XVSL 3B5HA 5CFHA 2EDTA 4XPTH 1QR1B 3OG6B 4TUKL 3T0EC 2QHRH 1FSKC 2APTA 5KSUA 5B4MC 2C1PA 2DN7A 4LU5L 1NDGB 2E6QA 4PJ5E 3B3IA 1UM4L 4NKMA 4RZCA 3WL9A 4DTGL 1NSNL 1I7TB 4NKOB 1HWHB 3S96A 4PP1D 1RVFH 2J5LC 2NPLX 3LIZH 3CLFH 3SGJA 5D1XB 1G7LA 1D7FA 3QHFL 2VDLL 2UZXB 4XAWL 2CR3A 4M43L 3OKYA 1FVCA 4R4FL 3PWPE 3IU4L 4QHLA 5ID0B 4ELKB 5D70L 2FD6H 2I24N 1FFOA 5CJBA 2GSIB 3MLVH 4KKNA 1S7WA 5F1IA 2DRUA 4MA8L 3GB7A 1N64L 2D7TH 4NFCA 3P4LA 3QJFA 3OF6A 3PV7A 1KIRA 2FL5A 1FJ1A 1YMHA 4OFDA 4NO5B 3RWEA 4YBHA 1TZGL 3PQYD 4LSUH 2ICWI 4P57A 1H9VA 1IC4H 3HZKA 2HT2C 4WFEE 2CRYA 3RU8H 3HFMH 1S7XA 2OTUB 3UTSA 2PYEA 3BUTA 4WHCA 1KENH 1JNNH 2WUBL 3QEUA 1B0WA 1KJ2L 1TVBB 1I8IB 4YDKL 2B7DT 3H0TA 1A1NB 3ZHLA 1RU9L 3VFVB 4HLZH 3SDXB 4KZEH 4YXKL 3RRQA 3QG6B 1C12A 2JJTC 4M93B 5GRVK 3FQWB 1HQRB 3RNKB 4G6FB 4X5XA 3GRWA 3L5WA 3QCUL 2VSCA 4D0DB 3S4SA 3MV7D 5HHPB 4PJ9A 2AXJA 5C0ND 2NW2B 1LE9B 4FQJH 4M7ZC 4ELME 1U3YA 2OR9H 3IU3A 3LQAH 3VFGH 1A6AB 3OAYH 1D9KB 2YBRB 3G5ZA 1F4AA 4XAKD 1XGYH 1YQVL 1INDL 3WS3A 1N7MH 3MRJB 5DR5H 4WEBH 5AUMB 4NO0A 5EH1A 4CN4A 1FNAA 4MXVE 1D5XB 2UWEE 1MNUH 1AGEA 3QI9B 4OUUA 2GYSA 4MD0A 1IARB 4HT1L 4F9LC 3U46A 3MNWB 1WISA 2XTJE 3ARGC 4NKIL 3MRMB 1ND0B 2J8OA 3WUWA 4PREA 5IBUB 2O5XL 1SJHB 2DM4A 3NPZB 3H9HB 3KPMB 4K7PH 2FECL 5C70A 1DUYB 4YR6B 5I1CL 3BZ4B 3GUTB 2R9HC 2DQHH 3TIDB 4JY4A 4PJXB 1TQCC 2C3XA 5ACZA 1ULVA 2ZUQC 3E2HB 5J3HD 2JJSC 3IRZA 1MCWM 4PJFF 1EFXA 5HHME 3HMXL 4XC3L 3B8YA 5HDBF 1B4JH 3FZUC 5D7LA 4F7MA 4KFZC 5E2TL 5KS9E 5ADPH 4MXQD 1OP3K 4JFFB 4I0KA 5EU6B 1S78C 2W0FA 3N85H 1JGEB 5KSVA 3RX5A 3H7BB 1NEZA 1KJ2A 4LSVH 5HVHC 3MLPA 1KYOJ 5GS0L 2J8HA 4BYHA 5HVWA 3SJVE 4E5XB 2B20A 4NN6C 2Q20A 2QKIB 5HI4D 3UAJD 3S37H 1GHFL 1JPST 1QLFA 1S7VB 3NCYP 1ZLSL 4XBEL 2NY5L 3ZDZE 1L7TH 3HB3D 3G6AB 4P2RE 4LLYA 1OAQH 5B38A 3T2NH 4PGEB 2VQ1A 4BM7A 4P5KB 5D7SL 3RZCA 5INDA 5F7FA 3LS4H 5C0JA 2XZZA 5F3BB 5CP7A 5F9OH 1T1ZA 4L8DA 5DJZB 5JHDA 1KLUB 3AMKA 1XGRA 4HC1H 5D71L 3QIBB 5C9JA 3FFCE 1J0IA 5L0QC 1RZ8B 1GPOH 4LHUB 1BD2B 1HHGA 5E6IA 2Y36H 1NCAL 2XWBB 1TPXC 3S5LA 3EFDH 5IB1B 5DD6B 3QNXA 1A1OB 3EDKA 2ZNXA 3P73B 4L3CB 4NQEE 4YUEL 4P2CG 2VSDA 1LP9B 4KUCD 2OK0L 3CC5A 4Z7UE 1FN4B 4JGJA 4PR5A 5CBAB 5AEAA 4NO2A 4G8GA 5D5MB 1RZKC 3MRGB 1KTLA 3MROA 3P30L 3FO2A 4WUUE 3SCMD 3SQBA 2YPLE 5C07E