2AJZA

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
216
Chain Sequence
b'DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 216
sequence length 216
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzA01
3OZ9L 1K8DB 3C5ZA 5FOJA 3VWKD 4L3AA 1N0XL 4CNIA 1MCDA 1MCHA 3ZTJH 1EEZA 5E8NB 4OZIB 4U6YB 1EMTH 5EZLB 1VA9A 4KKAC 3QPQC 4HCRA 4J1UB 1JPFA 4PB9L 2DJSA 3QXDB 4CKVX 1JGEA 1U93A 1OSPL 1KT2A 3X11B 4Z7VF 3B2UC 4LLMB 4L4TA 3CVHA 4FRWA 4PS4L 5FV2A 1DL7L 4NOFA 1CVRA 1YDPB 3BH9A 4X9BA 1LP9A 3LKRB 4R9HA 4YDKL 1Q9KA 2IALB 1PYWA 1HSBA 1B0GA 3FTGB 1A9EA 3LZFL 2BX5A 2NX5D 1OCWH 3TNNB 3IDXL 4PFEA 4UT6L 4OZGE 5C0JA 4XXDA 2Z91B 2FLRT 4BUHA 3AB0B 4PR5B 1KJ2L 5EH1A 2CD0A 1XR9A 1AO7D 3RWJB 1OGAA 5EZIH 1CD1B 5F9AC 1KG0B 2R2CA 4UV7L 3QJFB 3TO4A 5C09D 3B5GA 4JFYA 5AEAA 4XNMB 1PX4A 5TF0A 2XKSA 4MAYB 2LU7A 5GSRA 3ROLB 3ULUF 5HGAA 3DMMA 3OXSA 3MRPA 3DYOA 5L8JB 3VA6A 3WE6A 4CW1A 4Z0BH 1P2CB 5FHBL 5CJBA 1KOAA 2Q6WB 4JKKA 1SY6L 4NFBA 1SJXA 1LK3H 1WF5A 5E00A 4XX1G 1TJGL 3WEXA 4KY1H 4C54A 4M8QB 5DJDA 5INDA 1WIPA 3UP1A 3TBYA 3UYRL 4MCZB 3MUGA 9CGTA 4Z7NF 5HSFA 2X10A 4LCWB 1T03L 2DWDB 3QIUB 3ARUA 4IDJH 1A6VH 4NKOB 3OHXA 4LHJB 3WFEL 4UQ3B 1JZ5A 3HAEB 4Q9RL 3KPPA 2Q3ZA 3MLUL 3S4SG 4UAOB 5E8DH 2VABB 1XT5A 4ODSH 3C60D 4YDVA 1OP3K 2Y06L 5DO2C 3Q1SL 1CG9B 4GAGH 2N4IA 3FFDB 2ICWI 3DROA 4MQXD 4P3DB 4FQXA 4M6AA 3S36L 4OD3L 5B39B 2PTVA 4D0DA 1JPTL 1RIHL 4OGZA 2BCKA 1U8OB 4G8FA 4Y1AD 1Y0LB 1JPSH 1WT5A 2FD6H 2GITB 5C0EA 2WINB 3PWNB 3O4OC 4LLQB 4WFGD 4U6VH 5KSUA 2I07B 4PJ9B 3KNBA 35C8H 4ZOCA 4ONHB 3ARSA 3PDOB 4MDJA 3P30H 4QXUL 5JXEC 3ORJA 3V52H 3V7MA 1CGWA 2F19L 5HTSA 1QRNA 1IGFL 4KV5F 4UZGA 3VXTA 2IFGA 4ONGH 2NY2C 4JZNB 3SE4A 4R97B 1I8KA 3AAZA 4K8RC 4ODTH 1LE9A 5DJ2A 3AGVA 4YUEH 2J8UB 2W9EH 5FK9B 1GJIA 4FXKA 1ORSA 5B38B 1FNHA 2VR9A 3DVGA 3WXVH 3F12A 5ISZB 4XVTL 2QV2A 4M7LH 4CGTA 3CCHB 2IAMB 3I9GH 2AXGA 3ARXA 2GAZB 1CQKA 1EA9C 1YEEH 5CZXC 4MNGB 2GQHA 2HH0H 1KIRA 4I0KA 5J12C 3IB4A 4OGXH 3U4AA 2Q8BL 5DVMA 5DRWB 5GSVB 2XTJC 3PDGA 4L3CB 1SBSH 4U33A 1JPST 1F4HA 5JZ7D 3IKCB 2Q76B 2DQUL 4YBQC 5E8PA 3LPWA 4PV9B 1C08B 4F7CB 3TCLA 5IHZA 3D0LA 2YUZA 2D7OA 3QHFL 4DK6A 1F3DJ 4FTVB 3V5DB 2BNRE 3O4LD 3KPMB 4NQEA 3TBSA 3BP6A 5TH2A 1AXTH 2RFXB 5TDNA 4Q97A 4YHML 1R5WB 4GRLC 1J11A 2AJYH 2DQCL 4JREC 2E9IA 1LK2B 4F8TA 4NKDA 5BZDA 1KEML 4KU1A 1FV1A 4OBSA 3RWGA 3WO3B 1KENL 2FEDD 1UJ3B 3FQWA 5T3XE 5I0DA 1U8KB 1V3JA 5GGSA 3IFPB 3RVVD 4L8DA 1ZHKA 5EORH 3LEVH 3L3IB 1HCVA 4PRDA 3P73A 4Z95L 3IU3B 4OIIL 1JZ6A 1Z0MA 2VWEC 3CVIH 5CP7A 4Z0XB 4JN1H 1NMBL 2UZXB 5D8JH 4IRSD 4M7LT 5EU6D 4NN5B 3TT1L 4PV8B 4U6XB 3LCYA 2COQA 4TSBL 1IL1B 4IRJB 2FCBA 4M48L 4FZEH 1QVOB 5IMMB 2Z8WC 1JNNL 4HF5L 1W72B 2W59A 5TDPB 3ARBB 5GRUH 3MLTA 4JFXA 1QFOA 3KDMA 3G9AB 3MRIB 1FG2A 1LEKB 3BKCL 5IBLD 5IROC 1UEMA 4Q6IC 3JV4B 5SWSD 1KSRA 4JM4L 2UZYB 5FOBA 3SDDB 4NQSA 3C09C 4P59H 1ZMYA 4JZOA 5DEGB 1FN4A 3BQUB 3Q0HA 4N68A 1R24B 4RWYL 5HDLA 4O4YH 3NIDF 4ZUTA 4L8CA 5I1EH 5HVFB 1GOHA 3B9AA 1RQ5A 4LARL 3LH2H 2CLZA 1I7TA 1UACL 1QHPA 1UXSB 2X4UA 2SEBB 3RNKB 4OV5A 2YD7A 4NPYB 3L3DA 5F96H 3MROA 2CR3A 2CKBB 1OP5K 2WNGA 2C7UB 4FQPA 5GGTH 4P2OB 2JELH 3T1FA 2ITDA 1BLNA 2AVGA 4NHCH 2ERJC 1IKNA 3BVNB 4U3CA 3MBEA 1TZIB 1CTOA 1NC4A 3NIGF 3NCJL 4K23H 3ULUC 4JQXA 4YE4H 4YZFF 1S9WB 1RJZA 1OGTA 2DQEL 1FP5A 4Y5XC 4MNQE 5CBAB 1S78C 4M6OH 3MRMA 4PG9A 1WLHA 1OTSD 4PGEA 5CJOH 1C5CL 4NO2B 1T1ZB 2Q3AA 4PTTB 3K4DA 4HZAA 2Y36H 2H32A 2GUOB 1U3JA 1ZGLM 4RX4D 5TFSH 25C8H 2BSTB 2B4CC 1KBGL 5BXFA 2VDQH 2YD8A 4PRID 4ZO9A 5FYKE 1RUQH 5CINL 3MCKA 2DQDL 1DUYA 3BEWA 5HGGS 5TE7H 4UBDD 4JG0L 5D6DA 3FQXB 4N8CH 3N1MC 4OZHB 4Z5RB 4OM0H 4MJIA 2VL5B 1YYMH 3C08H 3MXVH 1TNNA 3VE0B 2F53A 4JDVA 3OPZL 5IIEA 1JV5A 1BVLB 1WEJH 3QXAA 5IMOB 4PRNB 1QR4A 3V79C 4YHOL 3W39A 3HRZB 2YK1L 4JFOB 5C2BL 1VCAA 5KOVC 3HC3H 2DIJA 3VGAB 3ZDXE 4PP1D 4ZAKC 2VAAB 3C5JA 3RA7L 3MFFA 2EDBA 1G6RA 4UILL 2HLAA 3KJ6L 1DN0A 5TQ2H 4DTGL 4O5LH 1T1XA 5LAXB 4EBQL 3H7BA 3N1FC 4GRLA 1CFVL 5DD6A 2PKDA 4ZS6D 3S88H 1H8SA 5KANG 5EBGA 2A38A 4PJBE 1A8JH 1R3LA 1IQDB 4QRTA 3IDYB 4PJ8D 2VLJD 4Y4KD 3S98A 4NHUB 1A7RL 1DVFA 4NDMB 1NDGA 5EU4B 4P9HC 4NM8L 3MJ8B 1HSAB 1MVUB 5ANMB 3TA3B 1CGSL 1SHMA 3T0EE 3MNVB 1OGAD 3BKML 1ZT1B 3WDHA 3DXAD 3TZVC 4DKEH 5D5MF 1UM4H 4OD2B 4BQBA 2XWBB 3TO4D 5ENWA 4PRHA 1IQWH 2ZCLL 2ZJSH 4HUVB 4U1GB 3OJMB 5ADOH 4JKPH 5FDWB 3DMMD 3O2WL 5L2KE 4MCYA 2HP4A 2RGSA 2VLLA 5E03A 1VFAA 3VFRA 3L6FB 2HTLC 1M1SA 1I8MA 4MLIA 3PL6B 4W6XB 4Z7VA 1ETZB 5IV2A 4XZUA 3REVB 3CUPA 3FRPG 1X5LA 3STLB 5AD0A 5LGKA 3I6LE 4HAFA 5E6IC 4F33A 1Q1JH 4B7IA 1FO0B 4BJLA 2HT3C 1FL5A 2XKNB 5ABDE 1RIUL 3FAWA 1UM5H 4HUXB 2F5AH 1NBVH 4S1SL 2A6IB 1JMZA 5T5FL 1JYXA 2WUBL 3U30B 1S9VA 3U0WL 1ZLWK 5D7KE 1RUAH 4WFHD 2GSIA 3MA9H 3T3PE 3RDTD 5H37H 5D7JC 2ORBL 4G6KH 4PJXB 3VFTB 5DQ9A 4JANB 1VEOA 5DVOA 5KTEL 4HH9A 5EIQA 3KYMA 1PSKH 1GC1H 1LDPL 1U2HA 5E94A 5BRZA 3MXWL 4K55A 4PJFF 4NKMA 5GGUA 5IG7A 2Y07L 4BFBD 3N85L 2EC8A 4TQEL 1MCFA 2JIXA 4OI7A 1EEUA 1A3RH 2Y5TA 3HMXL 3BGMA 1FAIH 1JRHI 4Y5XA 5DJ6B 3BMWA 4G6MH 3HLAA 3T2NH 1WFNA 1BF2A 3OKDA 5F7EL 2X4QA 4Y19A 2EZ0C 1XEDA 4GFTB 3UTTA 3JWDC 2VJXA 4TVPH 1KCLA 3UTOA 4G9DA 4OLYH 7FABL 1Z5LA 4XBGA 1DEEB 2HG5A 5AZEH 3GJFB 1FJ1A 5JLZA 4AL8L 4OZGF 5KN5A 4Z7WA 3LS5H 3ARDC 4PY7A 1A6TB 4NN7B 1CFSA 4QOKA 3T09A 3KYNA 4LCUB 3LQZA 3VDBA 3QDME 1GGIL 1OAQL 1JGUH 2Y7QB 4QRQA 3KXFD 5FYKL 1JNJA 5GISH 3ZE0E 1AGBB 3OGCB 5B21A 3BT2H 2YSSB 1JTOA 1GGCL 4N8VA 5D1QA 1RFDH 1QA9B 2DJUA 1SEQL 1YN7A 3JV6B 5IESH 4G7VL 1QSFA 1OPGL 3T8XA 4HDIB 3WHE1 3QPQD 4HIEA 3QXVA 4LVOB 2X09A 4J8RB 1FGNH 3LHPH 4X0KA 3UTZA 4ZAKA 3VWJC 2ZWLT 3KWWA 3T0BA 2KUTA 1WFTA 2R4SL 1K2DB 4PJEF 4O2CA 4NC1E 4JR9L 3T0AA 5JOPE 1NLBH 4Q9QL 3B2UD 3TBWB 3VGDA 2FZ3B 2W9DH 4A6YL 1ZSDB 3HR5A 3DUSB 1H3PH 3QO1A 2GT9B 4LSQH 3IDUA 4IOSD 1NGXB 1B4JL 5D2LB 3UPCA 3VI3F 4EOWH 3EDJA 4YQXL 2I9TB 4KZDH 2O5ZH 4NQED 4KKBC 4L9DA 1ZGLP 1WIUA 2FH8A 3JVGC 4PJGF 5I6XC 4R8WL 5F9WC 5SWZB 5EN2A 5KVFL 2C5DC 1JFQH 2NXYB 2AJSH 4JFFD 4NQDA 5CZVL 5J13B 4LVNC 1JI2A 3PWVB 4MA8L 1WCBB 4JHAH 1X4YA 3ZDZF 1MFAH 1DBML 4R2GC 4WHTA 5BS0E 4JPVL 1D6VL 1EIBA 3HKFA 4XNQA 5DA4A 2YR3A 1KNOA 4G9FE 2QSQA 1I4FB 3QPXH 4CVZB 3MV7A 1NCWL 2OL3H 5ESVA 4ENEC 4G3YL 1J7VR 2FJGB 2FO4B 2N56A 3O3UN 5EOQH 1OWRM 3BKJH 3SE9H 1V7MH 2PF6A 1BD2E 1I7ZB 1CICC 2YC1B 1ZLUK 1KACB 3X3FL 4GOSA 1EO8L 1I75A 4NNYA 2AJVL 2CDFB 2F54B 3B6SA 1DQLH 4KTDH 1J0IA 4BH7A 2F8VA 3QEUA 2QTEA 5KJRL 5EO1B 4X6DF 4YDLB 1U91B 1DE4A 1P7HL 4L29B 1FDLH 4YO0A 3HPLA 4M5ZL 5DMIH 5E99H 3WYRA 5MERA 4NUGH 3SY0B 1BGXH 1CFTA 4UTAL 1G7JA 1F58L 4OLUH 2YPVL 3G5ZB 2CGRH 2XACC 4KRPD 2ESVB 3QEQB 4MX7B 2Q87A 2DI9A 1K4CB 5HHQA 3T0WA 4MMZC 2ZSWB 4LLWB 4YXLH 1EPFA 5DO2D 5IFAH 5IFJA 4JFQB 2X5PA 4NOBA 4PJ7B 2EYRB 1RUMH 4MLSA 2XV6B 2DDQH 2APXA 4GUPB 4I9WD 3MLSL 3G04A 3R06B 1OSZB 3KYAA 5F7UA 2R4RH 3ARRA 1KIQA 1S7XB 5IBUB 1AI1H 3D39D 4QF1A 4MJ6B 3LKPA 3HNTL 3CLEL 4M1GH 1ED3A 4BK5A 4I5BA 1EJOH 1FL6A 4U31A 1NC4D 4LHUA 4ODUA 4ZXBA 5I1IH 5GGRA 1ONQA 5JXED 2P5EE 3QDJA 2FIRT 4K3HA 4Z8FH 5EOCH 4TSCL 2RCSL 2BRQA 3RAJL 5FAAA 1EHNA 4LQFH 2E6JA 2H45A 4WUUA 1M7IA 1WAAF 2AI0L 2NY2D 3J7HA 1XGUB 2ZUQB 5BOPA 4ZQKA 4CBPA 2B1HH 3DO3A 5IW3A 1CDBA 1MEXL 4K8RD 3AM8A 4EQ2A 3RRQA 3C5SA 5T33H 5HY9A 2NZIA 4LLYA 4NQCA 4LLDB 5KOMC 1AFVH 3Q6GL 1E28A 3MODL 5FGCE 5D7LD 4LPVA 4I2XE 12E8L 2EDKA 3AS0A 3S37H 3HG1E 1T20A 2R1WB 2QSVA 1WVZA 1FFPB 1TPXB 1OP9A 3GSOB 1BFSA 4ODVL 3O9WC 3OTTA 4NQDE 3VFOB 5CZXD 5C08A 1QNZL 4GAYB 4X7TA 3BZEB 4R7DB 2D0GA 2AEQH 1PLGH 4JO2L 4ODXB 5EC2B 1MJ8H 1IGTA 3RIAK 2XTJD 4APQB 1ZE3C 3CDGA 5D70H 5EUOB 5DDHA 1KIPB 1EFXA 4XB8A 4Q9BA 1NAMA 2ZCKL 4JFDE 3MV7E 1A3LH 1JF1A 1MRDH 5DI8B 4YBQD 3BYYA 1YPZB 5CD3B 4X6CF 3LKSA 4UU9A 3QRFM 4EJ1C 4KUZL 2VXSL 5IJVA 4JM2F 5KW9H 3OKMB 2XY1A 3S3SA 5FUZL 4P99A 3BPOC 1SVCP 1K8DA 2EDRA 1I3UA 2V17H 1HINL 1YMMA 4OCYL 3S4SB 5KVMC 2I27N 3ISWA 3JVGA 4GRLD 5CD5C 1HI6A 1CS6A 2BNQA 3VXRA 4S1DC 3LN5B 2WIMA 3HC4H 5C0AE 4KTYA 2HYMA 1KJ2A 5DFTA 2XQBL 4MXWH 3BPLC 3V5HA 4ISVA 4JJ5A 3X13A 3EO1A 3CSYB 4J1UA 3B83A 4H88H 3SO3B 1N3NB 2H26A 1DVFD 1OHQA 2XI9A 1MCSA 1VADA 1QACA 1QEWA 5HHOE 2PW1A 3O3EA 5HI4C 4K94L 3PWLB 4LLMA 4DVRH 2X40A 4MS8D 2LQRA 5IB3B 5I1AA 3RHWK 3UC0H 1J05A 3QUYC 1SY6A 4Q0XH 4JRYE 4LCCA 4XMPL 3LKRA 3H3KA 4UOW1 1KELH 3KYKH 1WICA 4DK3A 4QRRB 4LCIL 1BBJB 4PGDB 3FCTA 2YBRA 1RZKH 1MCPH 3UBXG 1JGLL 3MV11 1UVQA 2GKIA 3NAAL 3DHMA 1KB5A 4WHCA 1HHKB 1S7RA 4JRXA 4PUBH 4EQ3A 2VXTL 4E41E 3MV8E 4Y5VC 3SKOA 1IGCH 5JA9A 2PW2A 3QHZL 3UMTA 2PN5A 3H6JA 3RKDC 4OFVA 3CMGA 3EYVB 3U6RA 1IM9A 1CD1A 3FRUB 4J3OC 3KPOB 4YK4C 5HGDB 4UUJA 3DVNB 3EO0B 1GAFH 1KCRH 4AQOA 3QJFA 4F7EB 1N2RB 3QUKB 2X4TA 2E8ZA 4ZFZA 4EI5B 5C86A 1F4WH 1G9EA 3INUH 4AJ0A 3QCUL 1LEIA 4CU8A 4ZDHA 1A6UH 3AXLB 3ESUF 4YHKL 4PLKD 2FECI 2E9WA 3MJ7A 4NO0D 3RBGA 1RUPL 1IGIH 2D4DA 1T5WA 2D7MA 3BKYH 1NC2B 1TLKA 3PHSA 5BQ7B 3EFDH 5D5MA 5A2IH 5J6GA 1NBZB 5C0CE 4NO5A 2KKQA 1R3IH 1N5YL 4L8BB 5ALCL 3PWPB 3D2UA 3ULUD 1QTYT 4Q74A 3N9GH 1SYVA 5CGMA 2H1PH 3FB8B 2WBKA 2C1PA 1S78D 4LCWA 2DWDA 3QIUA 1VFUA 3IAPA 4Y19D 1R3JB 4AEFA 5JHLH 5FECB 2JLLA 4UQ3A 3GHBH 1RUKH 2I5YH 2QHRH 4PJBF 2Y6SC 1CFBA 4G7YH 1KEGH 1AGEB 5C0RL 1JTTA 3GBML 5IB1B 5KVDH 1H3GA 4X5XB 1Q9WA 3QUMH 4POUB 1RULH 1BZ9B 3RVWC 5JIPA 2WUCL 4QOKD 1CGTA 3LKNB 1MI5A 4P3DA 2OJZL 3CNKA 3GSXA 4GSDL 2CKNA 1XMWA 5B39A 2R8SL 2YMXL 2ARJA 1Z9OA 4MD5B 2PCPA 2VLKA 1HH6B 1U6AH 2EKSB 1U8OA 2J8OA 4X80H 5LCVH 1G9NL 2XQYK 1KCVH 3F5WA 3FQUB 2YHGA 4LLQA 1YNTA 2Y1VA 3BD3A 2B2XL 3VFGL 4OQ1A 4YEEA 4ODWB 4ERSH 5T5NG 4OZIE 1FLTX 2FX9L 4P5KB 3TC9A 1R0AL 1J0HA 2HFGL 1MJ7L 1ZS8B 3GEWB 3PGDA 5DLML 5F89B 4PJFA 2MMXA 3ZKNC 2UUDK 4N5UA 4CVUA 2OJEA 3SE8H 1N59A 2HKHL 2BMKB 2BY3A 3OKLA 4ZAKD 4WRLA 1NGPL 2R9HC 2DD8H 3QI9C 4X9IA 5C6TH 4WHYH 1G7QB 2GJ6A 3EDDA 2WW8A 3VXSD 4HHAA 1VACB 1A1OA 1QBML 5D72L 1HQ4B 3GNML 3QFJD 1I9RL 2ATKA 4MQ7B 3MA7B 3PGCA 4X4ZA 4GQ9L 1XAUA 3O8XB 3MUZ1 2XTLA 1BOGB 3MCLH 3MLWH 4OIAA 5JO5A 3C9NA 3T3PF 2OP4H 3EOBA 2VKWA 1JRHH 3E2HB 3U46B 1CVSC 2H2SD 5IUSA 5HYJB 2V5MA 3CCHA 4FQ2H 1MSPA 3TIEA 2FEEL 3BIKA 3LKQA 1NCCH 3VXQB 4WV1B 1KTDB 1S7QB 1J8HD 1ZANH 3ILPB 1H0DB 3MX0A 4HC1L 4QHUA 4AYFA 5DRWA 2JKXA 4TSAH 2OQJB 3TZVD 4OUOA 2E9JA 4FP8H 1FVCB 3DURA 5I2IA 3IKCA 3BJLA 3RZCB 3EW3B 4HPOH 2VZ3A 3QUYA 3DSFH 1WGOA 5CFHA 2BFVH 3BUYB 3ZE2E 4F7CA 2QBWA 1WSST 2HTLD 3LPFA 4PJEA 5EA0H 3G6DL 5HHNA 1CL7H 1HDMA 1B90A 3OG4B 5F7DA 4JHBA 2HVJA 1JGVL 4OZ4B 1U8MB 3ALPA 5JMOC 4G80B 5E6ID 1PG7X 3DV6A 3E6FA 4LGRB 4ZD3L 2CQVA 1K6QL 4HBQA 2V7HA 2HT3D 1VGKA 3VD4A 1F6LL 2B1AH 2DMBA 2IAND 5I75C 4NCC1 3VXPA 1ODAA 3QJHA 1CDUA 4HLZH 4UQ2B 4JM2C 4YLQT 1MCEA 1M05A 4LLAA 3IFPA 1TZGL 5DJZB 3KR3H 4HCRH 3NCMA 3WBDA 1CGYA 4XVJL 3MR9B 2GTWA 3BXNB 3L3IA 4LSRH 1AKJB 5K59F 4PJGA 3W2DL 5D7JD 1MIML 4LSUL 3DLQR 2VZOA 3TJHC 4Z0XA 4AT6B 4WUKL 5I19H 4PV8A 5I1LA 5CHNB 4CMHC 3CVHH 4H20L 3JSSA 3HHRB 1RU9L 2JCCB 3H3PL 3KHOA 5IB2B 3ARWA 2EIDA 1QVOA 3K7UA 4IHOA 5ADPH 8FABB 4GW4B 5HI5C 3CX5K 5E2TL 3H9SD 3MRIA 5EU3A 4DW2L 2AV7B 2XN9A 2DB8A 5HD8C 1HHIA 3TN0C 3O11B 3KJ4B 3WIHA 3RTQB 4YC2B 3HI5H 3NFNA 1QLEL 2FYYB 4ELMB 1DLFL 3WUWG 3MV9B 4LHUD 1KYOK 3GIVB 2EZ0D 2VZUA 3IFOA 4ZXBD 5C9KA 4F2MB 5M95B 2CIIA 2FWOB 5DEZA 3QDJD 2A6KA 5HPMB 2OK0H 1GHFL 4HS3B 5ICYB 3HMWL 4X6DA 3ARDD 1UA6H 4WUUD 3LMJL 3P77A 2LABA 4OSUH 4HMDA 3QIWC 1DBAH 3RNKA 4HFUL 2AK4B 4WWID 4FQCL 3V4VH 4YBHA 5FCUL 3C6LB 2XOTA 5I73C 1RD6A 2J8UE 2BDNH 3EKCA 4P2OA 3E8UL 3B4NA 1ULVA 4RGNB 4NQCD 43CAA 1CD9B 3W0WB 1P4IL 1Q9LB 5ISZE 2P5WA 3NA4A 4UV4L 5JQ6H 2WP3O 4RNRB 5AAMA 5KAQF 4NBZB 1VGEH 2IPTL 2W1NA 2W0KA 4D9LH 4XVUC 1FC1A 1K4DA 4MNGE 3VWJD 2DQJL 5GS1C 3CFCL 1XGQA 4NO3A 4RAVB 4HKXA 1W0VB 5DURD 5ERWA 4NWUL 1CBVH 2FJHA 3CPLB 4PTTA 3SKMA 3BI9X 1QO3A 4ZUWB 2BSED 1PKOA 1EFXD 5F1SA 1U8QB 4LRIA 4AZ8A 1TENA 2VLRA 2VUYA 2X70A 3OGOE 4KI1A 3QCVH 3RFZC 5D96C 3TYFB 1CGXA 5B8CA 2VDNL 3L3GA 3BAEL 2AJXH 1FFNA 4FTVE 4Z76A 1DZBA 3PWUB 1CU4H 4JPIA 4DOHB 3FQTA 3C87A 2EO1A 2QJDA 2X42A 4KKBD 1B6DA 2VL5A 2G60L 2WWMD 1YMMD 2PETA 4OTXH 4U1HA 1UT9A 3W82A 2VN7A 1WAAA 4P49A 1RURL 2AKRA 3EYUL 4F9PC 1BVLA 1CLYL 1WZLA 2E9BA 2K1MA 3V6ZA 5HXMA 5JW5B 5IJKC 3HZVB 3OB0H 4XCNB 1EGJL 2GFBA 1G0DA 5K9JL 2E5EA 4NWTL 1U41A 5EFIA 4JO4H 3T0EC 5DJYA 2HKFL 2VXUH 4R2GD 1XF4A 4WHDA 4GRMB 4YWGL 1CT8B 4JG1L 4QRSA 2WQRA 3BDBA 1F6FB 3EYFA 4ENED 4P2CG 1N64L 3VXOB 4W4NA 3N1QC 1I8IB 3E0GA 1CICD 1D9KB 5H35A 3VFUA 2X44D 3ZSTA 1KPRA 1N6QL 3HE7B 2OZ4A 4JPWH 4MA3A 5HHVH 4XBPA 1CR9H 3I2CL 3TCXA 1OOAA 3OAYK 4DKDC 2R69H 1D5XB 4X6CA 4Y16C 5E7BA 4JRXD 2VO5A 3SDYL 5LQBH 3D85B 3GI9H 4M7ZB 5ANMA 2AJZA 3O2VL 1IM9D 4BZ2L 4OT1H 1E27A 4LSVH 1XF2B 3R8BB 5C0DB 3NFSH 1KJMA 1MCBA 1SYSA 2EXWC 3LDBB 5T1MB 3GI8H 4HPYH 3VG0H 3VD7A 3QXTA 3QXWA 4ORZC 2E7CA 3O45A 4KVCL 5JR1H 3GB7B 3K0WA 1F90L 3CX5J 4KHTL 3ULSA 1ETZA 1ZOXA 2YS4A 4YHYB 3HMXA 4TTDC 4BSVA 3GHEL 4WTWA 3L1OL 1EV2E 3U9UA 4EKXA 1OT2A 4I48B 2G75B 1C16A 3NZHL 3WD5L 4HBCL 1Y6NR 2HWZH 1GPOH 2IQ9L 4JKWA 2IPUG 3SGDH 1KN2L 4JY4B 4PJAF 1MHPH 4IIQC 4KFZC 4XCCH 5JXAH 2X4NB 2A6IA 2HT4D 5F1KC 3GKWH 4HSQA 3L7FB 1GCFA 1WV7T 3KPQB 1FVEA 3M17A 3P40A 3GSNA 3SDXB 3PV7A 3QIWA 4KMTH 5GS3A 4RFNC 3RJDA 4KJQC 5AUMB 5DTFB 1ZA6B 4KZEL 1LO5B 2EH8H 4QY8A 1FC2D 4OCMC 1UB5B 3CK0H 3QHTC 2AEPH 6FABL 1MI5D 4LPCA 1ZEAL 4POZC 3L9RA 3PABA 3Q3GA 4XP6L 4OZHE 1JI1A 1MCOL 2CUIA 3ROOB 1OAZL 4D3CL 5BOZG 1F2QA 4PJIB 4NJ9L 1G7LA 1CFNB 5GGRY 3ARPA 5MI0C 3WS3B 1C1EL 4PJ5B 4LKCB 4TOYL 3O9WD 5DRXA 2BY1A 4RA0C 3JUZA 4QCIB 1G7MB 1BFVL 3SDAA 3GSRA 4ZSOE 1QSVA 5F97E 3FOLB 3KPSE 2N7BA 4RMWA 1NLDL 1H5BB 4HIXL 4C83A 2YWYA 4QXWA 1R3HB 4W4OC 3QEHA 4KTEL 1KLGB 2JB6A 4WWKC 3UEZA 2VLMD 2Y7QA 2JK5B 4FQIH 4LLVA 1MRCH 4XGZB 1G7PB 2ILLA 5DJXB 4KQ4L 5CD5D 5IMKB 1NFDF 3ARTA 4S1DD 3DV4A 1AHWC 4ONFL 4PREA 3SEPA 3JV6A 4XPTL 1OQXA 2IQAA 4QRPA 3VA2C 1ZT7B 2NW3A 3C8HA 1V3KA 3IDIB 1VEPA 3HPJB 5CBEA 1D5BA 1OAYL 3VRLE 5IEHB 1A7PL 1H8OA 4FXGA 3SE3A 3NTCL 4ZFFA 5ANME 5CEZL 1P7QB 1EO7A 1BBDL 2XG5A 5HI4D 4K94C 1Y6MR 2J12B 4O02H 3BN9C 1JWUB 1XFPA 3D9AH 4QT5B 4AEEA 1C12B 3CSBA 1C5DA 3ES6A 3DUSA 3OAUH 2H32H 3QUYD 4K8RH 5ICZB 3MV01 4ZFOL 2D3VA 3D25B 4X6FA 2QKIB 5C07B 4QHKI 2I9TA 5HHMB 2LVCA 2VAJA 1X5ZA 2DRUA 3F58H 3GJEB 1I1YB 5E70A 4AMKH 5C9JB 4R4FH 3LKOB 3OKOA 1IC4H 1NL0H 3GKZA 2IMMA 2ZG3A 1DQJB 4P2RB 4NNPH 1AGFB 3QWOA 1NCBH 3ZHLA 4RRPG 5IW1A 3DRQA 3RKDD 3RWDB 4UINL 2PXYB 4G6JH 4E0RA 5FA4B 3BW9A 3IDNA 3IFNH 1CE6B 3MGTB 1HNGA 1M71A 4X5WB 1IGML 2CRZA 2XNAB 4PJXE 5I1JH 3QAZC 3VH8B 4OZFG 1OAXL 1B0WA 1ZLSL 1OF2A 2FJGA 1G6RH 3GIZH 3U36A 1A9BA 5CJ5A 2A73B 4Z7OF 3DOSA 2YC1A 3WFBH 1WBZA 1F8TH 1AR2A 3GSUA 5L7XL 1HHHA 1KCSH 5EO9A 4FQJH 4HJGA 3MYJB 3OKEB 2AV1A 4WU5B 1TNMA 1A6ZB 3NFPA 4YHZH 4WW2B 4RDQG 1QBLH 5EBMA 1YN6A 1U91A 1NCDH 1GGYA 3ZKXC 4OI8A 3L3KB 2P4AB 5ALBL 5DUMH 5FYJE 4MHHI 1A4JA 5F71A 4P57B 3BHBA 4JFHE 3WNOA 4LNVA 2Y6SD 3QDAA 5D7IF 4GG6F 4NRYB 1ACYH 4MX7A 5IVOA 1K4CA 1LMKA 4BM7A 1T1WB 1KPVA 3P9MA 3RVWD 2EYRA 2ICWB 1MIEL 5I15L 4XPBH 5IKCB 4PJCB 4Q9CA 1G9NC 3BEVB 4GKSA 4UIKH 3WNLA 2J6EA 2WMPA 1DDHA 4HV8B 3O6FB 3QNZA 4GH7B 2PYEB 2FX7L 4N5EC 1YEGL 2P5WD 5HYSG 2VDPH 5B3NA 5DRZB 2IGFL 4JQVA 1UENA 5TE4L 4S0SD 5T3ZE 2Q8AL 3UPRA 2A74A 3FN3A 5D9SA 1A7QH 2UZIL 3ZKND 5HYFA 2HJKB 1DSFH 5DHYA 3DX9A 5DHVB 4MA7L 2R9HD 5GIRB 3DVIA 3IJSA 3TVMC 5DSCA 2VZTA 3ECBB 1LNUA 3P0YL 4WWKA 1JWMB 1CDJA 4KROC 4U1NA 1Q38A 3VXUB 2G2RB 2IFFH 3MRCB 4OCRL 4DGVL 4U0RB 2VLRD 2OL3B 4PD4K 4U6HB 4XWGL 3FONA 3T2PA 4NJAH 5D2LE 1ZA3A 2BNRD 3MOAH 2H9GA 3FO2A 1AE6H 4PP2B 1T0NB 1AHWA 1PZ5A 1ROWA 1CXLA 5AWNH 2YXMA 5FIEA 4M7JH 3TO2B 3CD4A 4FFYH 5CIPA 5E0QA 2FBJL 5SWZE 3U7YH 1QR1B 4R3SA 1HH9A 3K1KC 3PHQA 4I77L 2XXCB 3BZEA 4R7DA 4HT1H 4KJYB 4APQA 3HUJF 3THML 4M3JA 3ARFA 1TDQA 1YA5A 3U4BH 1IVLA 5I1GH 4NQTA 4IRZH 5CUSL 1SEBB 5E2WH 2F74B 5IVXB 1YPZA 3AS3A 2NMSA 1LO3H 1QLRB 1FLRL 1FORL 2R0KL 4XP1L 3QNYB 1KTRL 2VZSA 5BO1H 5K9KB 1XIWA 1C5BL 1TCRA 3P4NA 1HIML 1T1YA 2F54E 4R4BA 3QUXC 1ZGLA 4BH8B 4GT7A 4YBLB 4XI5C 2NY1B 1YJDL 1FO0L 1U8IA 5J6HB 3PE9A 2MCG1 4JM2D 5I8CA 2APBA 4YDIH 1GIGL 3PP4H 1TMCB 2Y72A 2VDOH 4Y2DB 3Q5OA 1A7NL 4DZ8A 4KQ3L 1AO7B 2ESVE 3QEQE 3TJHD 4GG6A 1X44A 3RGVC 4OUUA 3V5KB 5AAWA 2FHFA 1VKXA 1RZ7L 2C3VB 2FX8H 5C09B 1RZJL 1WWCA 4CN1A 1SJHB 4PJ7E 4JO3L 3ZT6A 4NT6B 4QRRA 5ICXA 1I7UB 1UQSB 4X99B 5MHSD 2R2HB 5CEXA 1RAMA 3LRSB 4XWOC 5HI5D 5J1AA 1J5OL 1GVIA 4TULL 1UYWH 4XVSL 1AY1L 4LMQE 5IEKB 1ZLVH 3TN0D 1BEYH 3GMNB 4PRBA 5F9JB 5C92A 3RUGF 4HG4K 3LN4A 4IOFC 5K9QI 4FFWC 2A1WH 5C0IB 4MNQD 2NW2B 3FRUA 5FYJL 5L6YH 3TJEL 1XGTA 5JNYB 5DMYA 3FFCA 4DEPC 1ORQB 2R56H 1FE8H 2K9UA 3TGXA 2BSSB 1CLOH 4EI5A 2VQ1A 5H2BA 3V6FB 2NY3C 5BMFL 2W65B 1FZMB 4AH2B 1MFEL 4LAQH 1XF5B 5GS0L 1AR1C 3HI1A 1AQKL 2V9RA 3QIWD 1FNLA 2OMNA 1BIIA 2OR9L 4AG4L 4UMGA 3C60B 4KI5F 4OV6F 5FGBC 2CXKA 1R3KB 4LEOB 1S7WB 1RZIB 3HI6L 2XFXB 1T2QH 3SGJA 4L8BA 4HS8L 3P4OA 4L9LC 15C8L 3PWPA 5ESAA 1MFDL 2E7LA 5HDBF 5JPNB 5T3ZL 4XVUD 1CFQB 3C8KA 2QQNL 4I8DA 3HTLX 4NSKB 2PUQT 3QISA 3ULVE 4QHLB 4XXCA 4XX1E 3WFZA 43C9B 3VFWB 4UOJA 4GMTL 3TVMA 3FB6B 1YNLH 2HN7A 1TTGA 4XNXH 5EUOE 2IPKB 5FF6B 4D94A 1MFCL 4X5XA 4O2FB 4HWEL 4YHNA 5D93B 4H0IA 4PD4J 1E0OB 1YPZE 4MA1B 4BQCA 2J88H 5JIIA 3PQYB 4PJAA 4UT9H 1G7IB 1IGYB 5I8OL 2Q20A 4P9ML 4MD5A 4X4YA 4WTZG 3OKNB 1R5VB 1MF2H 3IYLW 4L3EB 4CADB 5TF1H 4ZODA 4DQOH 1WFUA 1RHHB 3F65A 4ODWA 3AU1B 4JFEA 4HXAL 4E5XA 5I30H 1JUFA 1Q94A 4QRPD 1S8DA 4AK1A 3VXNA 5EBLA 1NCAH 4M93B 1ZHBB 5HJ3B 5I74B 4Y2OA 3B9EA 3RWCB 3MSPA 3T0ED 3JWDH 4X98B 3V6OE 3GMMA 4NZUH 4PY8I 4CMMA 3K1DA 4MNHA 2AQ1A 4MAYC 1BVKA 3WUWB 4LSSH 4UIMA 3SJVA 3TWCL 1QFWL 3QG7L 4K7PH 2BHUA 5E8EB 3KYOB 4HULB 4MQ7A 5JPMB 1Z9SA 4B5EA 1UWXK 1IZKA 1DUZA 2AEIT 4RMSA 4DGYL 1XGYL 2XY2A 3QUXA 4XC3L 1N0XH 2Z92A 3U46A 4B0MM 5J0BA 3N0PB 1NBYA 3UXFA 3I6LD 5C0FA 5KZCD 1S5HB 2R0WL 3NA9H 4Y16D 5HHXH 3VXQA 1R5IA 2Z31B 1D5ZA 4JKMA 2PO6A 4IOIB 3RVUC 3A6OA 1T3FA 2DLFL 4PB9H 4XPGH 3D6GA 4N8PA 5HGBB 2VTFA 5JHDA 1EVUA 4GRWF 1NFDA 4XMKL 1I9JL 3RGVA 3UZQA 2B0SH 4MQTB 1A6PA 3X3GH 2EXWD 3RZCA 4LEXH 1YECL 1WZKA 2NXZD 2R0ZH 3QBTB 5F1NA 5F44A 2UWEB 1DL7H 1O5DT 4Y5YB 4P5TC 3QUMB 3S37X 5L2JB 3FL7A 4HKZB 4HUMB 3MBXH 4YDKH 4TTDD 3VFVB 5GS2H 2O61A 1ES0A 3HNVH 4KGLA 4OZ4A 3T3ME 4D9RE 1IAIL 3LZFH 4HG4J 4PJ9C 2F58L 2ARWA 4OAWA 2D31A 3IDXH 2CSPA 3PWPE 2MKWA 3S5LB 4OM1L 4H1LH 1MPAL 4KUCD 1JE6A 2X2YA 2QADC 2VXVH 1JPGB 4P5MB 3T77A 1KJ2H 3GMPA 2AJ3B 5A2FA 5GPRA 3B2VL 2YPLA 1L7TH 3PF2A 3ZDYF 5KSVA 3IU4L 3MRDA 3BXNA 2P42B 4TNWF 3C8DA 3U83A 5L88L 4M1DL 1A4KB 3L3HA 4UI2A 4GJTB 4RIRA 5KSBB 1FQ9C 2FLBT 2YN3A 4R97C 4KJQD 2H6PB 1Z6JT 3L5JA 1T80A 4G5ZL 1S7SB 5DEFB 3VRLF 4OF8A 5MENB 5MEOB 1LO2H 5GGVH 3OXRA 4POZD 2OTWA 1SY6H 1XZ0B 1S5IH 2FATH 4U1SB 4GKZA 1BZ7B 2OI9B 4XNZC 3G6JB 4DAGL 3UYRH 2IAMC 1KB5H 2FYYA 1KLFA 4H8WL 3W11C 1AD9A 2Y25A 3D69A 3GIVA 3QRGL 3IDJB 2MPAH 1T03H 2FWOA 4RAUB 2X1QA 4S1QH 3DJ9A 3RVTC 1U3HA 3WFEH 3MRBB 3EOYG 3SHSA 4Q9RH 3MRNB 3OL2A 4UTBH 4YGVB 4BFGA 4L4VA 5IFHL 4XP9H 3MLZH 3I6KB 1HKLH 1J86A 3L95B 1S7TA 4BUGA 3ZKQD 5J9PB 4WWKD 3Q1SH 4NGHH 2ADIB 2AGJL 4HWBA 1WFOA 1GZQA 2AEWA 4NBXB 3S36H 4OD3H 2DQGH 2X4RB 1RIHH 4PRIB 5D7IA 5DD1L 2DAVA 1D3CA 3FB5B 4NCDA 1B88A 2Z35B 4X7FC 3R0MA 3GRWA 5HYJE 4U1LA 2DWEA 3O2DA 2X89A 3C5ZB 1XCTB 4CNIB 1UJ3C 4JDTH 5A16A 1EEZB 3PJSA 6CGTA 1B2WL 1BFOA 2W0FA 5DMJB 1WCQA 1RIVL 5DZNA 3CPLA 3PNWB 4Z77A 2EIZB 1KFAL 3M1BA 1JPFB 4G9FD 2XZAL 4RA3A 1JMXA 3BP5A 5DD0H 1CGUA 1U93B 1N4XH 4NN5C 1F42A 4MXVF 5CWSA 5CEYA 2E8YA 3SOBL 1JNLH 3UTPE 2C3GA 1BD2D 3IFLH 1I1CA 3CVHB 3BGAA 1T22A 2X1WL 4ZYKA 5DGQA 3S9DB 3Q5YA 5LJYH 1U92A 2DBJA 2OR7A 4XRCA 3ARBC 3SBWA 1GRWA 5F7YC 3T0XA 3OKKA 4M9PA 1U8HB 3WKML 3P3YA 3BH9B 4LHUG 4ZPVA 1LP9B 5D2NC 3UJIL 1Q9KB 1PYWB 1HSBB 1B0GB 3BESR 1V05A 1A9EB 5F1OB 2VLJB 4Y4KB 4UB0H 2EKJA 3BQUC 5C0JB 1KC5L 2IBBA 2Q8BH 2AXFA 1OM3L 1NMAL 2CXGA 1CDCA 3WIIL 4GRMA 4TN9A 4NZRL 1XR9B 1OGAB 2MCPH 3AMKA 3DXAB 4P5TA 1MCJA 4CRPA 1MFBL 3TO4B 4C55A 4GAFB 2JCCE 5EIIA 2X4PA 4WTXA 3S34L 5GSRB 5DXWA 5E1HB 5BV7L 2C1OA 3HUJA 4XP5L 4JHWL 5HGAB 3DMMB 2X4SA 3OXSB 4YHMH 1CK0L 3MRPB 4CW1B 1D5XA 1KEMH 3TBTA 1VFMA 3MYZA 1I1FA 2V9TA 4L8SA 4ELME 5E00B 4QEGA 3WEXB 3MV9E 4U49A 1EMTL 5DJDB 3QUZC 3TBYB 4XPAL 4LF3B 3MUGB 4I0PC 4Z95H 1YEHL 3LV3A 4OIIH 3DETC 4GG8B 5LVEA 2JJTC 4FNLL 3DI3B 1NMBH 4HQQH 3RDTB 5IK3B 4Z7UF 4XTRC 2AK4E 3KPPB 1OTUC 4TSBH 3V6BR 2Z8VC 4M48H 1IC7H 3T0DA 3T0VA 1X6NA 4H1LG 4RGNE 4YDVB 3W0WE 3SQOL 3WIFA 1MCCA 4I48A 3HG1D 4FQXB 4N5ED 2QQLL 5DRNA 4Y4HA 3F6IA 2BCKB 4G8FB 4M7KH 5C0EB 3BGFC 3ZSSA 1OCWL 2IADA 4JM4H 5KSUB 2XPGA 1KJ3H 1N6VA 3ZE1F 1MELA 4QHNA 3KPQA 3U2SA 4X8JA 3TVMD 5EZIL 4MDJB 4YFLF 2NTSP 3UTSA 4JFDD 4KROD 4JEGB 4FABH 4G8IA 3ILQC 3P4LA 1MLCA 4LIQH 3ESVF 3VXTB 1FNAA 3VMOA 1NGYA 4DOHE 4JLRA 4XNYH 1I8KB 2FB4L 4P4RB 2DKSA 1UKSA 3AAZB 3KXFB 2YPKA 4YAQB 1LE9B 2MWCA 3NCBB 2GI7A 3IDYC 4FXKB 1ORSB 4S1RL 5LKNA 2ZOLA 4KY1L 4HUWA 3DVGB 3SCMA 4U2ZA 1IZJA 2DQEH 3WIHH 2CJUL 1DN2A 1YYLL 1MCIA 3TA3C 4XNUH 5HHOD 2LFGA 2AXGB 5E5MA 5C0NC 4IDJL 1A6VL 4HK3J 1KIRB 3GDBA 4U1GC 4NM4H 4ZFOA 4FFZL 3VXMA 4N0YL 4JRYD 4ODSL 3NABH 1OWWA 5CAYB 4JG0H 4GAGL 1VHPA 1PKQA 4JFZL 2YEZA 3CC5B 5E8PB 5IMKA 1NJ9A 1H3WM 3QUXD 3TCLB 5IHZB 5D2NA 1JPSL 2FD6L 4XI5D 1YJDC 4E41D 3C6SA 3MV8D 4NQEB 3TBSB 1V7NL 3BP6B 5TH2B 1KLUA 4U6VL 1U36A 5TDNB 3MLRL 3T65A 4YHOH 35C8L 5T1KA 2B8OT 5E7FA 3E1F1 4U05A 5C3LD 4NKDB 1P7QA 5BZDB 2Q86A 3U30C 1FV1B 3V52L 4WI2A 3RA7H 3RWGB 3D48R 3FQWB 2CR6A 3RGVD 3DX8B 2RBLA 3KJ6H 2V2XB 1ZHKB 1RZJC 3KPLB 4FMFA 4M5YL 4ONGL 4PRDB 5ICZA 4X4XA 3P73B 3BPCA 4YNYA 1W8OA 5CP7B 4ODTL 1CFVH 3BDYL 2C4XA 4EI6A 3B9KA 5EUOF 4XWOD 3CJJA 2VDMH 4P4KC 5C0CD 2W9EL 5E5RB 5JQHC 1QUNA 4MJ4A 3WXVL 4IOFD 3QA3A 1A7RH 5K93A 4PGBA 3MLTB 4JFXB 5FYLL 3RWDA 3KDMB 1V3MA 2APFA 3I9GL 1S3KH 1FG2B 4NM8H 2UVFA 4I0PA 2YPLD 3VDCA 5A43C 2HH0L 2JJTA 5FOBB 4OGXL 1B0RA 2NY3D 4NIKB 1ZXQA 3SDXE 4JZOB 3TYGL 1FN4B 1AR1D 3FHAA 1SBSL 2ZCLH 4NN7C 2H2PC 4KRPB 1BJ1H 2YWZA 5DZOA 4LQ1A 4ZUTB 1ZTXL 4M62L 5IVZA 4L8CB 2KZ1B 3CXDH 5DGRA 5MEQB 2V5RA 5AG9A 1I7TB 2XZQL 2DQHL 4WFFD 2DMKA 3NZ8A 4WU5A 2MKLC 2X4UB 2EYSA 5IBTH 4PJIE 4OV5B 2O5XH 1AXTL 3QIBC 3L3DB 2OZ4H 3MROB 1Z9LA 5FUOL 4PJ5E 3O4OB 3T1FB 1RIUH 2ITDB 1RZFH 1H9VA 4V1DA 2BOCA 3MBEB 4AEIH 4FXLA 1NC4B 4EVNA 3FMGH 3K46A 1H3VA 2V7NA 1TJIH 1F6AA 1RJZB 1OGTB 4NZTH 4OF5A 3GJFK 2D7QA 2ORBH 5HDQL 3PP3H 2IC2A 3LEVL 3U7WL 3V4PL 4L4VD 4PGEB 1OT1A 5F3HA 1EZVX 5DZLA 4D0CA 4P2QA 4M8VA 2XZZA 3HE6A 2QQKH 2HFEA 2NY2B 4JN1L 1C7SA 4DWHA 5D8JL 2V2WA 3MXWH 2H32B 4RFEA 5F7FA 1BIHA 4HV8A 5DD3L 1LD9A 5GZOC 2Y07H 4TQEH 3NIFE 4FZEL 3MCKB 3BDXA 3HMXH 4PY8J 3AS1A 1DUYB 3BEWB 4DZBA 5GRUL 3DRTB 5HDOA 5AG8A 5FA3A 2NXYC 4MJIB 4AENA 3H8NA 5F7EH 3BJ91 3UBXA 3WDJA 2F53B 4JDVB 2EEDA 2YZ8A 1JV5B 3IJHA 5DHVA 3QXAB 2ZNWA 3T3MF 3IXTA 5IIEB 4FFVC 4JO1H 4P59L 3CFJA 4XCEA 3W39B 3ECBA 4ZPTA 5SWQA 1JWMA 4O4YL 3RIFF 3VXUA 3D1MC 4H0HB 2XWTA 2G2RA 5J56B 5I1EL 4ZNCD 3C5JB 2XQYG 4JY6A 2EE2A 1GGIH 1WC7A 3GSNH 5ECJE 4WO4A 3EYOA 3EHBC 1G6RB 2HLAB 1DN0B 5C07E 4AM0A 4GW5A 5HHME 2DI8A 3B5TA 1L7IL 1TXKA 1GGCH 1T1XB 5GGTL 3VWKA 1DQTA 1SEQH 2OXGA 3H7BB 4GRLB 4P2RE 5DD6B 3QH3A 4YDLC 4NHCL 2BHZA 1OPGH 4JREB 3RVUD 2IF7A 5FM5O 5EULV 3RI5K 3WCYA 3ET9F 1R3LB 4K23L 4YE4L 2A6DB 4QRTB 3JZ7A 2CH8A 2R1YA 2ZUYA 3JTSA 1DVFB 2PTTA 1FGVH 4M6OL 4TVPE 1SEBA 5CJOL 4FQ1H 2VDRL 1Y18A 2EYTB 1FNEA 1TJHL 3P11H 3CFEA 4P5TD 25C8L 2M1KA 3L7EB 1B4JH 5ENWB 4PRHB 1RZGA 4N1HB 1RUQL 2I60H 4J6RH 1ADQA 4MCYB 4PJ9D 2L0DA 2VLLB 1VFAB 3VFRB 1OTTD 4OM0L 1I8MB 1M7DB 5KVGL 3PHOA 4Z7VB 1YYML 3MXVL 1DP0A 2FGZA 2NX5A 4X4MA 4XZUB 1JK8B 2QADD 5F6HJ 5IV2B 5FHAH 3MACH 4BKLB 5AD0B 4J2XA 1IAOB 4F33B 2DKUA 4CU6A 5FFLA 4LSDA 1FL5B 1FYTA 3KLHC 4JPVH 3HC3L 2ZUQC 3KPNB 1NCWH 1T0PB 1MCQA 4ODHL 1S9VB 2GSIB 1SJHA 4YJZL 4LAJH 2VE6A 2BOBB 1XH3A 5DQ9B 3MGAA 4PJCE 4O5LL 4X99A 4HH9B 2HA1A 3ZYJA 3PGFH 3HS0A 3KYMB 3QIBA 4NO0B 2AJVH 2LV4A 3ARGC 3WFCH 5E94B 5BRZB 2PYEE 5GGUB 4KWUA 1G7HA 3G5VA 1SJEA 4OCWH 2XZCH 4O9HL 5IG7B 1NUDA 4H8WC 2IAMD 3WXWH 2ERJB 2JIXB 5C0IA 2NW2A 4WI5A 2YOCA 3CX2A 3BGMB 3RVTD 2M2DA 4ZS7H 4Y5XB 1F58H 2YPVH 3C2AH 3OKDB 1BQUA 1U8JA 2BSSA 2X4QB 2XWJA 4Y19B 3V6FA 4X9FA 4KRLB 4AH2A 5I71B 4M3KB 3UTTB 5KANI 4DKEL 4JCMA 1UM4L 1E4WL 3UTSD 3VXUE 4G9DB 2ID5A 1Z5LB 2E7BA 1IEBB 1GZPA 1SBBA 2HG5B 4XBGB 3GMRB 1FJ1B 4PJDF 4FTVD 5JLZB 2ZJSL 4RMTA 5E9DA 5KN5B 4Z7WB 1IBGL 3JV5A 3BH8B 4KK8C 4QOKB 2XFXA 3LQZB 5E8OA 3RY6C 3VRJA 4RDQF 1YEJH 4QRQB 1H3UA 3BE1L 3CLEH 4Y1AA 4OLWH 1T7ZA 4Z7UA 1Q1JL 4TUJA 5D1QB 2VC2L 4N1CA 3SO3C 4EDWL 1YN7B 3W81A 5CEZD 2W38A 4JZJA 3V6OC 1QSFB 3T8XB 5KS9F 2RCSH 5CJ8A 3L3OA 4HIEB 1A6WH 2P24A 4X0KB 3UTZB 3O0RH 2AI0H 1RUAL 4ZAKB 5IVXE 3KWWB 2X1XR 4E9LA 1MEXH 4O2CB 5BJTA 4R6UA 1RVFH 1EHLH 3MJ9L 3GSWA 1ND0A 3MRJB 3P0VH 2BC4A 3GGWA 3R1GL 1JGDA 3IXAA 4KJPC 1PSKL 1GC1L 3Q6GH 4YX2H 3ARBD 3LS4H 3QO1B 2EDTA 4I3SH 1CGVA 2J6EH 3IETA 3HZYA 5I17A 5IM7A 1A3RL 4D2NA 2DQIH 1IEHA 1IGJA 4OQTA 4ODVH 4P46A 3IGAA 4KHXH 5T1KD 4R26H 4G6ML 1RJYA 4JO2H 5EN2B 2BHYA 3SDCC 1AO7E 2EIEA 4OLYL 3L5WA 3GMQA 3TZVB 4G8GA 5C09E 1LO4L 1J1OH 3X14A 4KUZH 1INDH 5E8EA 4WHTB 3X17A 4XNQB 1KNOB 5BV7C 3UO1L 4FN0A 1JGUL 5ESVB 1QG3A 4ZNEE 1HINH 2KBGA 4O58L 4OCYH 4NYLA 5GISL 3O3AA 4QXTA 1NANI 3B9KD 3O4LA 4NBYB 3T2QA 4RFOH 3BRFA 1RY7B 3RNQA 4NNYB 5CIPH 5IESL 1G84A 3B6SB 4BH7B 3QEUB 5HGBA 1FIGL 2IANB 2OS7A 3QUZD 3RPIA 3JWOL 2EEBA 1T5XB 1WWAX 1DE4B 2DM4A 4I0PD 1AGDA 4U7KA 3DETD 1A02N 4YO0B 4K7FA 3HPLB 4RBPH 5JIKA 2EDFA 5MERB 1NLBL 5D7JB 4XTRD 1G7JB 4Y5YA 1OTUD 5L2JA 4IRSA 1WK0A 4XMPH 3VFNB 5EU6A 5HHQB 1H3PL 4LCIH 5KSAA 3QQ3A 4ODBD 5IFJB 1JGLH 2L7UA 4EOWL 4CJ1A 5E56A 5IHBA 1AP2A 4KZDL 3BWUC 3O81A 2BZDA 1A6AA 5DMGC 3MLPA 1NEUA 3G04B 3K4AA 3H9SB 1T66C 1UWEH 4P5MA 4EN3A 1KIQB 2JTDA 4QF1B 3TESA 5L9DH 5FV1L 1XGPA 3KPSD 1ED3B 1JFQL 5SWSA 4I5BB 3CSGA 4GMSL 2A77L 3LD8C 1WZ1H 4LHUB 4ODUB 4ZXBB 2A9NH 4JGJA 4QTHA 5GGRB 1ONQB 3JBG7 4JHAL 1K5NA 2NYYC 3QDJB 5SX5H 3PQYE 5IQ9B 3ILQD 1J1PL 2XICA 3QPXL 3WN5C 4Z78A 4P2QD 1UH3A 3HE6D 4WUUB 1M7IB 1RUPH 3UTQA 1K85A 3NPSB 4JPKH 5EOQL 2NY4C 4L3EE 3BKJL 3SE9L 2NR6C 2ADJB 2UY6A 3KGRA 5HVHB 1UEYA 2JJUA 3C5SB 1NGZA 5HY9B 1N5YH 4LLYB 5E1AA 1L6ZA 4NQCB 5EZOH 3KPTA 5D71H 5EC1B 1CTNA 1DQLL 4KTDL 1E28B 4LASH 4K3JH 1EFQA 4PG2C 4WV1C 3TA3D 1T20B 3QZWA 1U8NA 5DWUL 1MAMH 1MRFH 3WS6C 5DMIL 5E99L 5C0ND 2J2ZA 2YUXA 2YRLA 4D8PA 5C08B 5C0RH 4JGMA 3GBMH 4X7TB 2K3TA 4OLUL 1X5KA 1PY4A 1IGTB 2DYPD 3CDGB 1NEZA 5CJXC 5DDHB 4YXLL 1EFXB 2OJZH 1IMHC 4R90L 2R8SH 4WO4D 5IFAL 1JF1B 3K74B 5ITFA 1Q9OA 1G9NH 1RUML 2Z35A 3LKSB 1I8LC 2XG4A 4HGWA 4UU9B 5EO0B 4Z7QE 2B2XH 3VFGH 5IWLC 4ZTOL 1UCBH 3D0VA 1I1AC 2HFGH 1MJ7H 1YMMB 4TUOA 4X7SH 1JHLL 1XCTA 2PYFA 1HI6B 4WU7A 4OKDA 2BNQB 5LGHL 3U82B 3VXRB 1EJOL 5F9WB 4H1LB 4O51A 2HKHH 3BO8A 5I1IL 1KJ2B 3V5HB 2NY5H 3BP4A 3PNWA 4ISVB 1RK1A 4JJ5B 2EIZA 3X13B 3EO1B 3F6LA 2H26B 4Z8FL 3AREC 1T04A 2IH1A 5EOCL 1VADB 3BISA 4R2GB 1QEWB 3WNPA 2PW1B 2UWEE 3O3EB 1KIUA 1OLZA 5D72H 4PGJA 1LVEA 3EOTL 2EDDA 4LHQB 4YIQA 5I1AB 4P4KD 1J05B 1U8HA 3UYPA 3G6AA 1RPQA 4N1EA 1AFVL 4LCCB 3LN9A 2JJWA 3FCTB 5EZJA 2YBRB 3U4EA 2HFFB 3S37L 1QYGH 1GXEA 1LEGB 3S3PA 1UVQB 5FYJD 3GK8L 2VSCA 1MLBA 2VLJA 3OF6A 4PJ8A 4Y4KA 1KB5B 5F9OH 3CDCA 1EO5A 1PQZA 1S7RB 4JRXB 5CGTA 3SKOB 2PW2B 4F3FA 1RSFA 2AEQL 3U6RB 1IM9B 1FYTD 1MJ8L 5KSBE 3DXAA 4UUJB 5GJTH 2B20A 1M6OA 2H2PD 1QQDA 4QNPF 3RVXC 2Z8SA 2PTUA 2X41A 2X4TB 3FHQA 5MENE 2DTML 1MRDL 4X7CC 1CF8L 3C6LC 4ZFZB 3S96A 4F37K 4P3CL 3MRFB 5KW9L 3G6DH 3I84A 4RGNC 1LEIB 4ZDHB 1U8LB 3PV6A 2OLDA 2WM0A 5TQ0H 5GRWA 3QIBD 3MJ7B 3G6JE 4PRPA 1T5WB 3NACH 1K6QH 5C8JB 1VFBA 5D5MB 5T3ZD 5J6GB 4RCAA 1TVBA 4FA8A 4NO5B 2V2TA 1KCUL 2X1OA 3EZ8A 4KH2A 3D2UB 1E4KA 1MAJA 4H88L 2K7QA 4LF3A 1T4KA 4JY5H 1HKFA 1SYVB 5KAQG 4K7PX 1MIMH 2C1PB 4GG8A 2R2EA 4S2SB 1IM3A 2DM2A 3D3VA 3RDTA 2PR4H 5IK3A 3WN5A 4HAGA 4DVRL 2VQTA 4OKVB 3QWRA 2ZNXA 1WQVT 3H3PH 2ZOKA 4M4RA 1ERNA 1Q9WB 2ZUSA 5E9DD 4PRIE 4Q0XL 4U1IA 2VSDA 1KELL 3KYKL 1JP5A 3MRGA 2BVUA 1MI5B 3GSXB 4DW2H 1RZKL 1JL8A 2ARJB 1MCPL 2PCPB 2VLKB 5J06A 4X6EA 2EDHA 2NXYD 1QLEH 3F5WB 1MHCA 3NH7H 1YNTB 3WNNA 1IAKA 1NGQL 1IGCL 3MJ6A 2GK0A 4OB5H 3CU1A 1JBJA 4FFVD 3UCRA 3PGDB 4PJFB 1GAFL 2MTPA 2Z8RA 4RRPA 2OJEB 1N59B 3L3JB 4U1JA 3VFSA 3UBXI 3O6LL 3OKLB 3LMJH 4R0LC 4WDIA 1F4WL 4HFUH 3INUL 4FQCH 3EHBD 4K3EH 1D9KC 2OSLB 4L4TE 3HRPA 2GJ6B 4NQVA 1I8LA 4HHAB 4MZ3A 4P4RA 1A1OB 3KXFA 4YAQA 4OZFA 5IWLA 1P4IH 2F54D 4YHPA 3GMLA 3RY5A 4XH2A 4MZ2A 2ATKB 1I1AA 4UV4H 1LP9E 3EFDL 4GBXC 3PGCB 4PPTA 4HUUA 5JO5B 3K4ZA 3C9NB 4JCLA 1R3IL 2IPTH 3FQRB 2BJMH 3EOBB 4NKQB 4MAUH 4PJDA 4OZGB 2VLJE 2DQJH 3HZKA 4P46D 3TNMA 5K9OA 4PJHF 3UJTH 2H1PL 3VDAA 3TIEB 3BIKB 3LKQB 1TIUA 1WITA 3AREA 3QFDA 2ESVD 5JHLL 1BWMA 3RWHB 2CDEA 5GRJH 5M94B 1OGAE 1RUKL 2I5YL 3ARYA 3O41A 4QYOA 4C58B 3DXAE 4QHUB 3EJZD 1KEGL 2H3NA 3OR7B 4G8GD 1QZ1A 3DURB 1J9CT 5I2IB 5HHPA 3RPKA 1LHZA 3QUYB 2D7TL 4HWBH 4ETYA 3CC5A 2JE8A 1MCKA 1EAPA 4DKFL 4RGOL 5DD5H 5LCVL 1U6AL 4X80L 4C4KT 1L4IA 1HN1A 5GGQL 1KCVL 1RURH 2P43B 4PJEB 3EYUH 5HHNB 4N9GA 1HDMB 2VKXA 5F88A 2ADFH 3GRWH 4ZTPL 5DVKA 4ERSL 3O2DH 1EAJA 5F7DB 2GK2A 2HVJB 3R8QA 2W0PA 3FB7A 4OLZL 5EBWA 4NWTH 3DV6B 3E6FB 3G5XA 4JFFA 1YEFL 2YXFA 2V7HB 3CFDA 1VGKB 4Y7MA 5HYSA 4QKXB 4I3RL 3SE8L 3VXPB 3QJHB 4YK4B 1P9MC 3DX8A 4YWGH 1M05B 4AEHL 2ICES 4Z18A 3S36X 2QSCH 2V2XA 3WJJC 2GTWB 3KPLA 2WV3A 1ITBB 4PJGB 4M6ML 4CAGA 3BIBX 1S9YA 5I0ZA 5I1LB 2HRLA 2ZUVA 4NNXA 4CN4A 3QWQB 5KSAD 2DLHA 5J8OA 3ARGD 4L1HA 5JOFA 3SKUD 2OP4L 1KB9K 1JRHL 4IHOB 1C7TA 1HYSC 2B7DT 5FO7A 3F7VA 4FQ2L 2VUOA 5EU3B 4EN3D 2XN9B 1HHIB 4D0BA 3ALWA 4BZ2H 1H5BC 3NFNB 3NPZB 1ZANL 4W68A 5B22A 3IFOB 4JRWA 3D5OF 2CIIB 4NC2B 2A6KB 4FP8L 4JN2A 5EU7E 4CVXA 1QRNE 4HPOL 5MEQA 1NANH 2V9QA 3OBAA 4X6DB 4BQ8A 3IJYA 2NY7H 4XPFH 1T2XA 3IDMA 2YKLH 4KK8D 3P77B 3KXFE 3GHEH 3L1OH 2WWKT 1QBBA 3QCTL 5EA0L 1J1XH 3MQIA 5ESQA 3CH8A 1TFHA 3D39A 4HBCH 4KK9C 43CAB 2IQ9H 1HZHL 4MD4A 4FOMA 3O3DA 2P5WB 1TITA 2MJWA 4WEMB 5EG6C 4LPTA 5JW4Q 5JXEA 3KPRD 1DJSA 1ZVSB 1UZ6E 3SGKC 3U7AA 1HOCA 1K4DB 3KR3L 4HCRL 4HWUA 3U1SH 1HEZA 4R0LA 1XGQB 4NO3B 3TIDB 4HKXB 1MWAA 5ERWB 2FJHB 3I85A 4N0CC 4KZEH 3JWNC 3SKMB 3DNKA 1QO3B 5B4MD 2DICA 5I19L 2WANA 2CUMA 3CVHL 4KJPD 1GC1C 1ZEAH 5LBSL 2VLRB 3VRIA 4MGXA 3GSQA 2X70B 1OAZH 2VIRB 5CGYD 3H42L 4ZUVA 1A0QL 1NUGA 5B8CB 3L3GB 4NJ9H 5ADPL 1FFNB 3V8CA 4QO1A 4JPIB 4Z76B 3DRTA 3FQTB 3MRLB 5D7LA 4NQEE 4KPHL 2D9QB 4TOYH 2H41A 3RWEA 4U1HB 5DQJA 5E2JA 2PXYC 4JVUA 1BFVH 3HI5L 1YEKH 2AKRB 2AJUH 3HCVB 3V6ZB 5GJSL 2R1XA 2FHBA 4HIXH 3SDCD 4KAQH 4C56A 4F58L 4J3XA 2GFBB 1ZK9A 5FXCH 2OK0L 3A67L 5EFIB 4YXHL 4KTEH 1VERA 2VN4A 5DJYB 4OGYL 1MHHA 4M43L 1XF4B 5C7XH 1A14L 4B7LA 4QRSB 2MNUA 4Q2ZA 3MPCA 3EYFB 2G5RA 4N0UA 3TFKD 3V4VL 4D9RD 2AAVA 1UH4A 3DYPA 4WW2C 5H35B 4XPTH 3VFUB 4V2CB 1KPRB 4RGMC 3TPUA 1IAII 4MA3B 3TV3H 4MJ5A 1MAKA 3PDDA 4XBPB 2EDWA 3A6BH 1A7PH 2A6DA 1Q0XH 1VGEL 3OF6D 5DT1H 4X6CB 5CEZH 4D9LL 1BBDH 5EOTA 1FZOA 2I24N 3JWOC 5J1SC 1D5MA 4JM2B 2UYLA 5FGRA 5EIVA 5T3XL 5F6IC 4MVBC 1CBVL 2EYTA 2AJZB 4ZOBA 5SV3A 1E27B 2BSRA 5FO9A 5FKAA 1KJMB 5KVEH 3L7EA 1SYSB 4ONOA 1HHJA 1FZKA 3EJYC 3QCVL 3RL2A 1J0ZA 2AJXL 1CU4L 1FBIH 4KKCC 1KB9J 3F62A 3O45B 4I9WE 2XA8L 1H8NA 1YZZA 1M7DA 5DMGD 4DN4H 3ULSB 3RIAF 2R2BA 2NY0C 1JK8A 1T66D 1UC6A 2WQ8A 3KLDA 4PRPD 4BSVB 2YUWA 4WTZA 3U9UB 4BKLA 4NRZA 4PBXA 1F11A 1IAOA 3F7RA 5LXGH 4UINH 2D0HA 5IROA 1QPXA 2VITB 4JFPB 4Q6IA 4HJJL 1C16B 5DMKA 3MZGB 1UKTA 3V2AR 4F7TA 4K71C 4Z7QF 4YXKH 3SKNA 1F4XL 1KGCE 1P1ZA 1IGMH 4JO4L 2W92A 5B3JE 5LWYH 3KPNA 1F4YH 2NYYD 2J3SA 3UX9B 4HW6A 5A3IC 1FVEB 3D3VD 1F02I 2BOBA 3M17B 2DF3A 3QWRD 4F15C 1YY8A 3BUTA 3GSNB 4Y4FC 4TRPL 2NY4D 5L7XH 3QIWB 3ZT7A 5CSGA 3B8SA 2NR6D 4YDJB 4NO0A 5I73B 4QY8B 3WO4B 5HYJD 4OFYD 1AJ7H 1DFBH 4R96A 4P2YA 1AXIB 1BP3B 4IMLA 3L9RB 3PABB 3Q3GB 5HHVL 1CR9L 4WJ5A 4MJIE 2G5BA 1X5FA 5ALBH 1G7LB 2C3HA 2ICEA 4PLOB 2F53E 3V0VB 4GS7C 3SGKA 3RHWF 5TDOA 3O6ML 3FO0L 1JWSA 2BVEA 5DRXB 5GS1B 4UT7H 2DOCA 1FH5L 1JHKH 2IEPA 4X9GA 3SDAB 3GSRB 4PBWD 3MOQA 3MJ9A 3ZO0A 1IEBA 1S7UA 3GMRA 3UTPD 4HX1A 4HPYL 4C83B 4G6FD 1MIEH 3VG0L 3MUHL 1NGWA 2XIDA 5I15H 3QEHB 2ZSVA 1MCWW 3BH8A 3NMEA 5D96B 2JB6B 1N0LA 1TVHA 5JR1L 1X5AA 4HIJA 4GRWH 3KAAA 4LLVB 4M03A 5KSBF 3Q6FA 1IJ9A 3TBVB 2NY1C 1I1AD 3EOAA 2IGFH 4PJBB 2VH5H 2Q8AH 3DV4B 1CL7I 1L6XA 1K8IB 4PREB 2HWZL 5GQBA 5JW3H 4H25A 1GPOL 5CSBA 2IQAB 4QRPB 4KKAD 1MHPL 4Y2DC 3BIAX 4XCCL 3IS1X 5JXAL 5JORB 2NW3B 4KVNL 4MA7H 4DN3L 5CBEB 1D5BB 3QG6A 4EDXA 3ARED 4FXGB 4LPXA 3T0EB 2YN5A 4ZFFB 3P0YH 3WNKA 5B38G 2GTZA 1QSEA 4OCRH 4Y8AA 1OY3B 4GQPH 3MRJA 3VXSA 5ITBH 1KTLA 3NGBB 3TM6A 2C9AA 1C5DB 4PRHE 1XCQA 3ES6B 2EH8L 4LVEA 3QFJA 3CK0L 1PGRB 2DQTH 1FNFA 5KG9B 5F7MC 1E4XI 2FSEA 4X6FB 2PNDA 2FBJH 3OB8A 4IS6A 4Z7VE 5FYLD 5KZCB 2EE3A 3OKOB 4I77H 2HLFC 1VPOH 5JOEA 2VDKL 3VGHA 4F9LC 3IRPX 3W5MA 1KN4H 3QWOB 1J8HA 3V4UH 2CMRH 3EDFA 3MRKA 3DRQB 5IW1B 4KC3B 5DHVH 2N1KA 5CUSH 2CK0H 4BFIA 4LCYA 3TZVA 4E0RB 3BW9B 4J12A 3CLFL 3IDNB 3RWFB 3RVXD 2FECL 5JDSA 1M71B 2NXZB 3C6LD 1LGVA 4PJHA 2P47B 1JYVA 4FQIL 1INEH 1OF2B 1MRCL 2HJLA 1HIMH 1I3RA 4MDIA 3LVEA 3U36B 1A9BB 4KDVA 5BRZE 5D1ZC 1WBZB 1GGBL 3GSUB 3K2UL 1HHHB 1TZHB 4MB4A 1YJDH 5EO9B 1UB6A 4HJGB 5E6IA 1T7WA 2AV1B 4J4PC 1A5FH 1PX3A 4OCSH 4I3GA 1Q72H 3NFPB 1GIGH 3H3BC 4RQQA 4ACPA 3ZT5A 5BW7C 2IANA 5EBMB 1YN6B 2NCMA 4IIQB 1T5XA 4KQ3H 2FHCA 1EK3A 4Y19E 2CRMA 1A4JB 3BHBB 2ICWJ 3UTTE 1IRAY 5D7JA 3D9AL 1DANU 1FCCA 3NN8B 1RZJH 3DBXA 4XBEL 2F9BT 4Y4FA 4FQHA 3VFNA 1KPUB 3OAUL 1J10A 4YGAB 2P49B 4Z7WE 1KPVB 3WFDH 3P9MB 4QOKE 4Z7NE 3GFUA 1G0YR 1RZKC 4XVSH 4AMKL 1ADQH 5TPWH 4GKSB 1IC4L 3H9SA 1NL0L 1DDHB 2O93L 5C0GA 5IOPA 3CAFA 5IMLA 3QNZB 4M93C 4NNPL 2WLYA 5I74C 3TJEH 3GUTB 4FQLH 4GW1A 4TPRL 1QSFE 4POYA 2J7LA 3UPRB 2A74B 5D9SB 1S9XA 3IFNL 4NUJB 1N5AA 3P9LA 5DHYB 3DX9B 2VERN 3HB3C 5IQ9A 3REWA 4XAKE 1UADC 3IJSB 4Z9KB 4AG4H 5DSCB 3ARDA 1D9KD 1G6RL 1LNUB 4WWKB 5CSZA 3IAGC 3H9ZA 4U1NB 3PUCA 2ADJA 4RZCA 1BFTA 1O7SA 3WFBL 1F8TL 4MQSB 3FONB 1KCSL 3A6CH 1UWGH 4GBXD 1ZA3B 3I6GA 4FQJL 1HWHB 5EC1A 1MFDH 2H9GB 2VDLH 3FO2B 4UDTA 1T6VN 2Z31C 4KV5E 2CRIA 4YHZL 1AHWB 1PZ5B 1XF3A 3E6HB 1QBLL 4LBEA 5CIPB 4GMTH 5DUML 4R3SB 1HH9B 3VWJA 1YMHA 3PHQB 4ETQB 1MFCH 2AXHA 4C56D 3MNZA 4HWEH 1FNSH 2ZPKH 2GSGA 1DBJH 1ACYL 4P48A 4HKJA 3ARFB 2A83A 4L5FH 1FAKT 4P9MH 5I1KH 5DC4B 5EO0A 1U0QA 1X7QB 4XPBL 1EERB 5ETUA 4UIKL 1UG9A 2VQUA 2N7AA 4G8EA 1XIWB 4I18C 2WLZA 4HXAH 1TCRB 3P4NB 1T1YB 3QULA 4R4BB 1OARH 4PRAA 4H1LA 4P23C 1AXSA 5IBLC 2BVOB 1ZGLB 4ZUSB 2IANE 1J0JA 5EOCJ 1IFHL 1U8IB 1UKQA 1DSFL 5I8CB 4EIZC 2E3VA 5L8KB 3SGDI 5C0BD 1J8KA 4NFCA 4DCQA 4OI9A 1UXWA 1ZWIA 4DZ8B 3IS0X 3ZKSD 3QG7H 4M6NL 1YEDA 3MGOB 4HIIA 1T89C 4XCFH 1F13A 4DGYH 4GG6B 4OUUB 2GHWB 1VKXB 1C8PA 4LNRA 1CICA 1U95A 2DKMA 5D1ZA 3MRRA 3U0PB 5CILH 1BQHA 4NN6B 2OI9C 1HYRC 1AE6L 5ICXB 4PJ5D 5AWNL 1ACZA 4WI8A 2HFFA 1HYSD 3H9SE 1LEGA 5CEXB 5DR5L 4M7JL 4FFYL 5J1AB 4OD1H 3CFKA 3BRGC 4NP4H 3GM0A 4OQTH 4BSJA 4PRBB 1WWBX 3LN4B 3NCEB 4O00A 1A22B 3UJJH 4XMKH 4TYUA 2EDXA 3AY4C 3QDJE 1XGTB 3U4BL 3FFCB 1VSCA 2FIKA 4IRZL 1D7FA 4KRNA 5F72S 5E2WL 1H3XA 3JXAA 5INCA 2VQ1B 2BNUA 1I9IL 5H2BB 4WUUE 2OTUA 5A2KH 3MRFA 5J7CC 1EUTA 3HI1B 1DBBH 1U8LA 5BO1L 4QXGH 1BIIB 2JJSC 1IAIH 4WEBH 1YUHA 2R0LL 5SX4H 4NQCE 3ZDXF 4JHZA 2BXYA 3C5ZC 2IH3A 1FZJB 3KS0H 3NIDE 4KK9D 5C8JA 5T1DH 2DQFA 5BVPL 2ZUWA 1A1NA 3B2VH 3P4OB 5ESAB 3EGSA 1EVTC 5KBNC 4H5SA 3PP4L 3C8KB 5C08E 3RX8A 4S2SA 3OAZH 2OMBA 3BZDA 5HYQA 1NDMA 5L0QB 2DL2A 1QPPA 3TVMB 4N0CD 4OKVA 2HN7B 1P4BH 4KROB 2FX8L 5HHMD 1P6FA 4RMUA 4YHNB 3LEXA 1NUFA 5FO8A 4PJAB 4Y88A 1Z3GH 5FB8A 3DUUB 3FAXA 4LU5H 2D7PA 3EYSH 4X4YB 4P2RD 4U3XA 4DAGH 1WISA 1YMME 3MRHA 4H8WH 1GGTA 2FGWL 2BNQE 3VXRE 2PXYD 3K81A 3QRGH 5GRYA 3ZTNH 3CFBA 5ACZA 3O9WA 4JFEB 4E5XB 1FRGH 1JUFB 3FT4A 1BM3L 1Q94B 2P8LB 4ALAH 4BA8A 5L6YL 1S8DB 3VXNB 5EBLB 5IFHH 3L3JA 1W0YT 2R56L 3HNSL 2AERT 4WNQB 1QD0A 3CZJA 4XCYB 3I75A 3OX8A 1CLOL 3GMMB 1IT9L 3TO4C 4CMMB 1QSED 4LAQL 2OSLA 2YD3A 3CSPA 4MNHB 4DGIH 4QWWC 2KQMA 1BVKB 4HXBH 1NFIA 4UIMB 3SJVB 1K3ZA 1P5UA 3FN0L 2DTSA 2MFNA 4I18A 5C1MB 3HFML 4KDWA 1DUZB 1T2QL 2CIKB 2R23A 3FQRA 3QUXB 2EXYC 2Z92B 1B4RA 1OAKL 4OZGA 1NBYB 5C0FB 2EDQA 4JRXE 3EIFA 1WTGT 1RIVH 1R5IB 1D5ZB 2PO6B 3OJ2C 2OX5A 3W9DA 3BSZH 3DGCR 3RWHA 3ZHDA 1T3FB 2XZAH 2F5BL 4MVBD 5JHDB 2X4OA 4LP5A 1FCGA 3OR7A 1NFDB 4V2BA 3RGVB 1FFRA 2NLJA 2J88L 3EJYD 4UT9L 1MHEB 5F1NB 4KUCF 4HEME 3ARVA 1TETH 1CXEA 4GAJL 4KKCD 5DK0A 4LDEB 3WKMH 2PYED 1MF2L 2LE9A 4FQXC 5TGBB 2BERA 5TF1L 1UH2A 2WBJC 2AK1H 3L5HA 2NY0D 2O61B 1WT5C 5D5ME 1ES0B 3QEGH 1CZ8H 4Y5VA 1F3JA 4OAWB 2D31B 3RJQB 1QOKA 3VFMA 4D9QD 1OM3H 4ZFGH 5IHLB 3ZE0F 3T77B 3GMPB 1X5GA 4LCWE 3HZMA 3MO1A 2YPLB 5KSVB 4KXZI 3MRDB 5A3ID 2NY6B 5EU7C 5GHWH 2NY3B 3T4YA 5IB4A 2AW2A 4LSSL 3L3HB 4XPHL 3S34H 3I02B 4Y4FD 4RIRB 5BV7H 4LRNL 3SE4C 1E4XH 4K7PL 4XP5H 5J3HC 1CK0H 4KDTC 1EHXA 2XT1B 1BQSA 1MI5E 1NFKA 1FSKB 3OXRB 2VLKE 2OTWB 3CDYA 1QRKA 4GKZB 1WBXA 4L9LB 3NA9L 5HHXL 1HXMA 3OB0K 4WGWB 5I16A 2DLGA 4XPAH 2A0LC 1NMCB 1AD9B 4XPGL 4ZOAA 3IVKA 3D69B 1NCTA 4PJFE 3VG9B 1YEHH 4YHLH 4OFPA 3T4AA 4FNLH 2B0SL 2MOVA 3MREA 3X3GL 1U3HB 4LVHB 4LEXL 5MEPA 3U79A 1FHGA 2R0ZL 5IBUG 4GO6B 4L4VB 2VR4A 1NAML 4DVBA 2GJ6E 2DBLL 1S7TB 2VLME 3JV0A 5BVJB 3STBA 2DMCA 1X5HA 1X9QA 3SQOH 3B43A 1D5IL 3QDHA 3MBXL 1GZQB 4PYHA 2QQLH 4I4WA 2NY1D 3HNVL 5IT2L 3K8MA 3LEYH 5D7IB 4LP4A 1AC6A 1X3DA 4U1LB 2DWEB 1SJVA 2DM7A 3LY6A 4GXUM 3PIQB 2VXVL 4Y2DD 3I50L 1A3QA 2ZP0T 1ZVSA 3CZFA 5E4EB 1L7TL 1JZ8A 5A16B 4QGTA 3PJSB 1UJTA 3TIDA 5EPMA 3VJ6A 1BFOB 1J0KA 2W0FB 3QI9A 3ZHKA 5TE6H 1N7ML 2ZKHH 1CDGA 4Z77B 2IJ0C 1TQBB 3M1BB 1W2KT 1AQDA 3BP5B 2G9HA 3U0TA 3FOMB 2FB4H 5CWSB 1LO2L 2VIRA 3MLXH 5GGVL 5CEYB 2BNRA 4OLXH 3G5YA 1S5IL 2FATL 3MRLA 1DQDH 1JHTA 4S1RH 1MH5A 4PJEE 1T22B 4ZYKB 1U92B 4XRCB 1DCLA 3OKKB 2HLFD 2AABH 1BQLL 2MHAA 2CJUH 1YYLH 4ZPVB 4Z7WF 1KB5L 1A7OH 2CLVB 4OBRA 5IQ7H 3HCVA 5DJ0A 5HVGB 3MOBL 3X12A 3T1WA 2MPAL 4KGJA 3VI3E 4S1QL 5I66B 1O7VA 4UTBL 1NSNH 1BVZA 2AXFB 4KRPC 1KUMA 3MLZL 4XP9L 2WIIB 3GO1H 4FFZH 5HGHA 4KMQA 4FQQA 1HKLL 4PJGE 4WW1A 4N0YH 4LLUB 1RV6X 4LIQE 3QDGD 4J3WA 4NGHL 2AQ3A 2YD2A 1HK6A 4NKIL 4ORGA 4KK5C 3ELAT 3EBAA 4JFZH 4P5TB 1IC5H 2DQGL 2WBJA 5EWIH 5EIIB 5D1ZD 2X4PB 4OZFH 5J57B 2C1OB 3HUJB 3ZDZE 1V7NH 2X4SB 3MLRH 1F3DH 1UZ8A 5I18H 3QZWG 4J4PD 2X1PA 1SM3L 1IKNC 2XN9E 3MBEC 1X5IA 3TH3T 4RSVA 3TBTB 4JDTL 2QADB 1JN6A 4JM2A 1I1FB 4JQXC 4L8SB 2GY7B 1Y6KR 4RISL 1CXHA 1NEZG 4K3GA 3PQYD 4M5YH 4PB0L 5DD0L 4MXQC 1UM6H 3LV3B 5I1HH 1J18A 1N4XL 4X6DE 3BPNC 4KDTA 4L3ED 4JB9L 1JNLL 3BDYH 3IFLL 4WI6A 3F7YA 1MJUL 2VL4A 1F5WA 1U58B 2DLTA 4YFEA 4OJFL 4G42A 5D6DC 3RGHA 4OCXH 2GCYA 1CE1H 3WLBB 1E6OL 1HE7A 4XNZB 3TN0A 3WIFB 4RMQA 5FYLH 4BYHA 3GMOA 4WY7H 2P5WE 3VCLA 2VITA 4JFPA 5MP6L 5DRNB 4Y4HB 1KYOJ 1QFWM 4MNQA 1MJJA 2IADB 4UB0L 3IDGA 3MUY1 4U4BA 2XPGB 3HB3D 3TYGH 1ZVYA 4QHNB 3U2SB 5I1CL 4MWFA 3JTTB 2ZCHH 4X8JB 3W9EA 2MCPL 1F4AA 1ZTXH 2P7TA 4M62H 3UTSB 3RUGB 1JVKA 2XZQH 2FJFA 2DQHH 2VLRE 4YDJA 1JZ2A 3ZTJG 1EHAA 4G8IB 1OP3H 2QHLA 4LK4A 5HVWA 1MLCB 2JJVA 4TUKH 2X6MA 1NGYB 3O6KH 3WSQH 5DJCA 4JLRB 5FYJU 5FUOH 2Z31D 2YD9A 2YPKB 2QR0A 2WZPD 1WAAE 1MNUH 3V0VA 5DUPL 3QNXA 2ZOLB 2LAAA 4HUWB 3SCMB 1DVFC 5GS1A 4WI4A 3U9PH 5HDQH 5F7KC 3NCYS 3U7WH 3V4PH 3QQ9C 2B5IC 4NC1C 1IAIM 3MLYH 4A6YA 4PTUA 3LSOA 5E5MB 4MS8C 4HQQL 5F1IA 2ATPA 5DD3H 5AYUL 4ZFOB 4S10A 2A9ML 1IC7L 3VXMB 2ITCA 4HJ0C 5C70A 3TBVA 3I3BA 4K9EL 5DVNA 4PJBA 1PKQB 5I9QB 2YEZB 3L5XL 4A2MA 1NJ9B 4F9PA 1K8IA 3BMVA 4P23D 5IJKA 5D2NB 2J5LC 1QFUH 1H15A 4M7KL 4X6CE 4F7PA 3C6SB 1EEYA 1BX2B 5JORA 4HKBA 1KLUB 1XGRB 2VR5A 5I8EA 4YR6A 5IB5A 3T65B 1P6AB 1KJ3L 5T1KB 1LE5B 4LOUC 3T0EA 2P46B 5DS8A 2Q86B 1RMFL 5I76A 2R29H 5E08H 4ELKA 2DIAA 5IR1B 2W60A 1EEQA 5MEND 1X6LA 4WFEE 1MWAH 4M1CC 5D1XC 4FABL 4HLJA 1ZHLA 2AXJA 4LIQL 5L2KA 4Q6YA 4PLKC 5FKPA 4X5LA 3TT3H 4BQ6A 4OIBA 1L7IH 4X4XB 5KG9A 3BPCB 4YNYB 4XNYL 1FPTL 5MHSE 1PD6A 2XRAH 3AMLA 4EI6B 3B9KB 1W72L 1MQ8A 2R39A 4Y16A 2BXZA 4WIQA 4XB7A 1LWRA 3WIHL 3QA3B 4PGBB 4XNUL 1WBYA 3P4MA 3CU7A 4LSTH 3QUZB 5I71C 2BVQA 2VDRH 3ZL4H 1TJHH 4I0PB 3RWFA 5DFWH 4U1KA 4W6YB 2Q7YA 4YH6A 4FG6C 2Q1EA 1I7RA 4OZIF 1CI5A 1B0RB 4NM4L 4IEFB 3DX6B 3LPGA 2E27H 3NABL 2X05A 4Y89A 3GBNL 2D03H 5JW4R 3K8KA 5IW6A 5IVZB 1D6EB 1L9MA 2CKBL 4PGZA 3C5ZD 1TZHA 8CGTA 3AROA 4GRWB 5KVGH 4E42B 3EAKA 2J4WH 3NZ8B 2R15A 5D1QC 2EYSB 5I1DB 1T21A 3BGFB 4Y0GA 4IIQA 5IF0A 4BZ1H 2YD6A 1W0WA 4ZSOB 3KPSB 4U1MA 4V1DB 5CJQH 2BOCB 3NCFB 1E6JH 4EVNB 1QBAA 4XC1H 4ODHH 3NN8A