2AJZA

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 45
structure length 216
sequence length 216
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajzA01
3O81A 1G7IB 3DVNA 1FZKA 3LEVL 4XAWH 3WHXB 5DK0B 1L7TH 1UEMA 3NGBC 4AEIL 2EZ0C 1U8HA 3HG1A 3RVXC 3HPJA 2OI9C 5B39B 1MHEA 3WS6A 3S8WA 3WEXB 4NHUA 3FO0L 3VXSE 5J6GB 4KZEH 2KQNA 3X3GL 2OTPA 5TE7H 4KROD 4BFIB 2R1XB 4M03A 3UYOD 3ZKMC 3W11D 2Z31A 3E2HC 1SQ2N 1WBYA 1AR2A 1HXMA 1JPSH 2BSED 2APBA 1D5ZB 1VEPA 1CFSB 1A6VH 1KCSH 2ZKHL 1HQ4B 1TVHA 2AI0H 4MNHA 2RB8A 5EU6E 4GLRH 1CIDA 1T83A 1BD2A 5JXEC 1R3HA 5FYJH 5HYJB 2XNAB 3WV0A 1QFPA 1Q94A 4I4WA 3KPMA 3LIZH 5F88B 5FAAA 1CBVH 1JYWA 1UB6A 5T1DL 4U1IA 4CU6A 1Y6NR 2PYFA 1QKZL 4FQJH 4BFBD 3RI5F 4X5WA 2NY6B 5DRNA 3P0YH 3WS3A 3UTSD 1IC4L 1S7QB 5J6HB 2HG5B 4G42A 2R2HB 4NZDA 3S4SA 2MPAH 4G6FB 2CUMA 5IJKA 1UWXH 1M6OB 1R3IH 2VSDA 2LE9A 2RCSL 4NRYB 5EU7C 1XH3B 5L2KD 2QSTA 3LDBB 1W8NA 5GGSB 3VFOA 2F54D 5D1ZD 2AJUH 4NBZB 2BSRB 4QY8B 1NDGA 2YD3A 3J7HA 4DVBA 2I24N 1J1OH 2BDNH 4Q9CA 1G1CA 3VD3A 1AJ7L 3IVKA 3C6SB 1Z9MA 3HN3A 3QUKA 5C3TA 4A6YH 1FC1A 1LO2H 3RWFB 4ZUUB 4FTVD 4DFHA 1MHPH 4GMTH 5EZOH 1TQCB 3JWDH 1JTPA 4JG0H 3X13B 5CGYD 4HSQA 5EULV 3O6FB 3GHBH 4JFHE 5GRWA 1NUFA 2AJYL 4ELMB 1D5BA 2BRRH 35C8H 3SDAB 2GEEA 5C7XL 2BNRA 5C07D 3RUGB 3TH2T 1YMMD 4XBEH 3L3IA 3DMMA 4WJ5A 4I18B 4LIQE 5IBLD 1B3JA 3TWCH 1YEFH 2PCPB 3ARTA 4KQ4L 4QHMA 3GSNH 1BZ7A 3MRQB 3SDDB 3G5ZB 4BUGA 3S98A 3KPRA 3KS0H 5I1GL 5CJBA 3DSNA 5JQ6H 4HK3J 3GNMH 4FXGA 4HF5L 4Y19A 5KVGH 2Z0BA 3GRWA 3QIWD 3L3JB 3BT2H 5DUML 4HG4J 2CIIB 1CT8A 2LU4A 3EDEA 3BVNB 3CXHK 5DQDH 4DGIH 4YHML 4RIRA 4OBSA 3CX2A 1RK1B 4P2CG 4Q6IA 4QT5B 4DGVL 2DICA 4JY4B 3IDMB 4MDJB 3O6KL 1MUJA 4JY5L 2V6HA 1KT2A 1F4XH 1ZHNB 4YWGL 2KZWA 3JWNC 3QIUC 2VDRH 4XMKL 4M1DH 1IEAA 1UACH 2ITCA 1MVUB 1S7XB 3BZ4A 1AI1H 1S9YA 1AGDB 3HNSL 3QG7H 4L3AA 1RZKH 3H42L 1BIHA 3A67H 4MAYB 4CU7A 3WNMA 4LKXB 5I8EA 3MGOB 2BVEA 2VLRB 3FCTA 2BNQB 3FT4B 5DWUL 4HJJH 4RQQA 4NNPL 4RGNC 4BKLB 4AG4L 4EIZC 4PB0H 3HAEB 4C83B 4CMMA 4WEUD 3X12B 1KF9B 1B4JL 4JGMA 1HINL 4HEPG 2XWJA 4GKSA 5CD5D 4H1LG 2OJEA 5EORL 3ARDC 4ZSOB 4P57B 3CFBB 4OUOA 1D6VL 1SJVA 3FO2B 5TDOB 3DV6A 1FORH 3IU4H 1U3HA 2BRQA 1I1AB 1RIHH 2UZIL 4R0LB 2I5YH 3T1WA 4NCDA 4NQCD 2MTPA 3UZQA 1S7RA 3LS5L 3BKJL 3FN9A 3S36L 5EZLB 3G5YB 4XBPA 4PJCB 1NBZA 3LKPA 4MQTB 3PL6B 2X4TB 5BO1H 3BKMH 3IYLW 5BOZG 4OUUB 4J7RA 1YUHA 2H3NB 1AGFB 3QEHA 1BOYA 3BAEH 3QT2A 4GXVL 1U6AL 3JV4B 1S7TA 1HCVA 1YN7A 4Y4HB 5IT2L 1G0YR 2XI9A 5HGBA 5IMOA 4LRIA 4G7YL 3L95A 5E5UB 3P2TA 3L5HA 1LP9A 4NQTA 4YBQD 1ZTXH 2IG2H 3TLRA 4FP8L 4NFBA 4P3DA 3PP4L 3BRFA 4R4ND 1RJLA 3ZT7A 1UXSA 2P42B 4JRXB 4LHJB 4UAOC 4ZUWA 5ICXB 4HUVA 2CLZA 1W8OA 1LDPL 2RR3A 3SO3B 3VFRA 3DTXB 3EOTL 5IBTH 4BFGA 4P5TD 1BQHA 5D5ME 5EOCJ 4PJFA 3RIFF 1OB1B 3RKDC 3C5JB 1WFTA 3O4OC 1Q38A 3WLWC 1KCVL 4N9OB 5L88H 1NCTA 4Z7NE 4G6AD 2E9WA 1OHQA 4LHUA 1UKTA 5HVWA 3V79C 1F6FB 1F8TL 4S1RL 3UTSA 5I1DA 2E7MA 2HKFH 1A7PH 4YHIA 1JYVA 4WW1A 1NGXB 1KXVC 4LDOB 2AABL 5EC1B 3QDMD 4NKMA 5C08E 4Y4FD 1IZJA 3MRMA 1U8QB 3TNNA 5JW4N 3U30C 5L2KA 4G43A 2F54A 5D1ZA 5FGBC 3MFGB 4NSKB 1K8DB 1MHHA 1MAML 2VDNH 4YHOH 1SMOA 4GSDL 3OKKB 3BD3A 3BMVA 4NGHL 2Y07L 3WN5B 2B0SH 3IJSB 4JRYB 3LEYH 3TYFA 4TPRH 4PR5A 1RZKC 1QBMH 4FTVA 3RA7H 2XTLA 4Z7OF 1VFBA 4K9EH 3ZKXC 1NC4D 1OF2B 3NBNA 5K9KA 4BSVA 1H8NA 2PXYC 3QEGL 5FM5M 1OGAB 1UH2A 4MNGA 4XHJC 3QPXL 5C07A 4M02A 2H9GA 1YMMA 2QEJA 4I8DA 2VISB 1NDMA 3BXNA 4JM2D 2XY1A 4BA8A 2Y06L 3CAFA 5GXBB 4PJ7F 4O2CB 1DZBA 4F7CA 1SEBA 3ZZ1A 1KCLA 5IUSA 4PRHD 1KXTB 1DQQA 1P4IL 1JWUA 3P77B 3SKJH 5JIPA 5CEXA 1NAKL 5IJVA 2X5PA 5D7JA 4LSVL 3V7AG 5C70A 4FQIH 4NO5B 2E7BA 5FYJU 5DF0A 4MHHI 3QIWA 4UV7H 3VA2C 1PLGL 4U1GB 3WLBB 4OZHF 4H1LA 1BX2A 4PJIA 5ESAA 4LSPH 5LWYL 2EDDA 3M8OH 3CXHJ 3ULUL 4D8PA 1WFOA 1WISA 4ESKA 5DJCA 2R0WL 1MCSA 5DRZB 5DVLA 4NP4H 1YPZE 3FT3A 4DN3H 3QI9C 3L3HA 5EDXA 3WNLA 4J6RL 3RHWK 5IBUB 2NY7H 4KQ3H 1GOGA 1Q1JL 4OFVA 3GK8L 1U36A 1HHGB 2BSTA 2CUHA 3NPSC 5E7BA 4XMLH 2P46B 1QQDA 3QJFB 1MCQA 5E2TL 3VXME 4HIHB 3L3GA 2A38A 5F70A 4BYHA 3MRIA 4RMVA 4XRCB 1B0GB 2Z92A 4WFGD 4X9HA 2ZUYA 1FG2B 3SE3A 2JF1A 1U0QA 3DXAD 3W39B 1S5HB 4P2RD 4ZTOL 4U1JB 4B7LA 3BQUC 3D5OF 1D5MA 5I1JL 4WI2A 5IB1B 3RWEB 4I5BB 5INCA 4G8FB 5DMKA 3WDIA 8CGTA 5JR1H 2QQQA 1UXWA 1VADB 5CJOL 1XCQA 1U8LB 4FRWA 3VD4A 5F7NC 5CMAA 4NQVA 1RUAL 3MOBH 4OB5L 5EBLB 4D3CH 4U1SA 1UADC 4EOWL 5IESL 2FECI 2AK1H 4LMQI 4D0BB 3RGVD 4NQCA 2YC1B 4KTEH 5A2JH 2P45B 3U4BH 1J8HB 1Q0XH 5CEYA 1WICA 3BWAB 4KUZH 2G9HA 3QUXC 3D3VB 4G6ML 2I60H 3H7LA 2JCCA 3MXVH 3KXFD 2O5XH 2YSSB 1AHWB 2A6DA 3O6LL 1ZT1A 3OKMA 1GC1H 1F13A 2FWOB 4K9EC 4Z6AT 1RAMA 2IAND 5I76A 4IRZH 5HY9B 1NCBH 5E8DH 5IGXL 1YECH 3P40A 1UM6H 3WNPA 3QIBB 1SJHB 1C7TA 3DX7A 4PJBA 5CHNB 4PJHB 4J3WA 1NKOA 3TC9A 1E28A 3P9WB 4R6UA 2B1HL 4P59L 1PG7X 1PQZA 2XRAH 4Y5VC 2VZSA 2SEBA 4NQDE 5EC2A 4R7DB 2H2PD 1YEKH 1DBJL 5IFHH 3PIQA 1EO8H 4LBEA 5DD0H 4XVTL 3FFDB 1RZFL 4P5TA 5C92A 1YA5A 3HR5A 3IXTB 1XF2A 4MX7A 1T7WA 1UVQB 4X4MA 3AAZA 4RMSA 1U8IB 5KZCB 5DJYB 1MCPH 3MLSH 4UINH 1W72H 1BFSA 4I3SL 3RAJL 1A4JA 4JGJA 1CK0H 3FQXB 1ZA3A 1RIVH 2NY5L 3C2AL 5D1QC 4MNQB 3DUSB 3QDMA 4Y4FA 3ZO0A 4WW2A 2LVCA 3QO1A 5GZND 4P5KB 1C5DB 4TVPE 4UILH 43C9B 1A3RH 1NAML 3QUML 4OSUL 3QRGH 4RWYH 4X6CB 3WD5L 1OD9A 4QRUB 4G8EB 4CVWA 1AH1A 1J0ZA 5AWNH 3AREB 4UIMB 3CFCH 1PG7W 3LV3A 1N2RB 3FJTA 1WJ3A 2DD8H 4HIIA 5GRXG 6FABL 4ODSL 4OD1L 4KKAD 2VZTA 2VR4A 1FGVL 5IHUL 3MZTA 2I25N 2HJKA 2Q8BH 4TSBL 1NC4A 1KNOA 1AGEA 3NA9H 1GGCH 3EO9H 3SCMC 2RGSA 1RFDH 3VDBA 3MOAL 2EXWC 2H1PL 3KPSD 3QQ3B 4XGZB 4F57H 4PJGE 5IHZB 4NYLA 1G7LA 5F1SA 4D9RD 3O3DA 2QQKL 1I7RB 2KZ1B 5JW5A 1XGUB 3ZTJH 4PRHA 5CJXC 4G3YH 4C4KO 4YDVB 5CUSL 4GRLC 3MZGB 2NY4B 5HI3C 4YQXH 4XNYL 2KL6A 3ES6A 1KACB 4GLRI 3MREA 4WV1C 1NCCL 4IOSD 5D70H 5JXAH 4LAQH 1PKOA 3BDXA 4JPWH 3VD7A 3QWOB 2CKBA 4W6WB 4YGAB 1EAPA 3VXPA 5E5MA 1WZMA 3JTSB 3MRPA 1GC1C 1F90L 3L5XL 4KDTC 5DO2D 5IVOA 1NGWA 3NCYP 3NA4A 2C4XA 4X7TA 5D71H 4GAGH 5HHVL 2VZ3A 5TF0A 1LK2A 2X4SB 1AY1H 3IT8D 4PRPD 1YDPB 1BFVL 2QV2A 1T4KA 5JNYA 4R97C 4Q2ZB 3IXAA 3VDAA 2IAMD 1R0AH 4FQHB 1JPTH 3IFPA 1FZJA 1U58B 4PJ8D 4EI5C 2QKIA 2XWBB 3QXDA 4P46C 3C9NA 2FGZA 2LU7A 2HFFA 4DZBA 4ZUSB 3DXAA 3TVMD 4OZIE 4P2RA 4LVHB 3T4AB 3IB4A 4HD9A 2BOBA 4FQ2H 2W59A 3VH8A 5D1XC 3MO1A 5I6XC 3FFCE 4OGYL 4P5MA 4WY7L 4BM7A 1KYOK 3KLDA 2X10A 4HIJA 3FQNB 4ZOEA 4G9FB 1S7WB 5D7LB 5F7DA 4LPTA 3WFCL 1TZHB 5DJDB 3IFLL 5JZ7D 3OXSA 2DLTA 5GISL 4AEFA 3MODH 3MJ6A 1RULL 4HUWA 4XZUB 4P4RB 2O26U 3UJIH 1ADQL 3V6BR 4U0RC 2JJTC 4M00A 4NO0B 3T1FA 4KTDH 3G04A 1A9EB 1FZMA 1K2DA 3MQIA 1LE5A 1S9WB 1U8OB 2C1PA 4KHTH 4L4VB 3X11A 3MNVB 1GGBL 3QNXA 4X99B 5ADPH 3KXFA 1DUZB 4I1NB 1MFDH 2M2DA 3UTTB 1DLHB 1GPOL 5D96B 5I1AA 1BVKA 5EB9A 4PB9H 4KMLB 4HZLA 4CN6A 2IANA 4GKNB 4N0YL 4XNUL 4R96B 1KUMA 4CL7A 1I1YA 3NACH 4RGNE 4IS6A 4XCNB 3TJEL 3VFUB 1WCBB 1KN2H 3MXWL 3SKOA 4HULB 4P0DA 2YPLE 3CVIH 4L1HA 5K9OB 4MA3B 3REVB 3EW3B 3GMRB 3IFNL 1K3IA 5ESQB 2Z8WC 1KCRH 4OGXL 2NZ9C 2BXYA 2DYPD 5HGAA 4F2MB 2I27N 4CW1A 4Y5YB 2EDXA 5ITBL 5KSBB 5TDNA 2HTKC 4Y4KD 4M1CC 5FGCE 1FFPB 5L6YL 4AL8L 4F58H 3U79A 3N06B 5GGTA 3U36A 5KSAD 4LPVA 3MA7A 4QF1A 1R24B 1H3PH 5HTSA 5JO5B 5I16A 2XN9A 1IBGH 4X9IA 4NFDA 5F89B 1QSFB 4P48A 1EJ6A 2BFVL 2NY6C 4TQEH 4Z7QF 3AY4C 2PW2A 2LAGB 2IGFH 4POYA 2D03L 2ADIA 4ZTPL 4M1GH 2O61A 4K7PH 2OSLA 3NIGE 5CLTA 3CDYA 4WUUD 1OW0A 3C08H 4PGBB 4HKJA 1OP3H 3SN6N 3K4ZA 2L7UA 2AEPH 3I6GB 3R06B 1P6AB 3D39D 4FFYH 3OKOA 1VGKB 3LDBC 5IHLB 5JUEH 4XP1H 3INUH 5C0CD 2V9QA 4UBDC 3EFFB 4N5EC 3SDXE 4JN1H 5CINL 1JIBA 4YDIL 2Y4SA 4OIIL 4IBLT 5GRYA 1A4KB 32C2A 5IK3B 1YEGH 3B9EA 1Q9WB 2HRPH 3MCKB 4NM8L 3LKSB 4OTXH 2W0FB 2C3WA 4ZODA 3RWGB 2AW2A 3ZT6A 1IC7L 2EDWA 1UYWH 5J1AA 3TIEB 4OCLC 1QP1A 3O6FC 1LO4H 4DKEL 4N1CA 2VE6B 1ZLUH 1R3LA 3KPSA 3MNWA 1QRKA 3R1GH 4JO1L 3SDAC 2CLRB 1Z2KA 5MEQB 4EI6B 3Q1SH 3QFJD 3PV7A 2JK5A 4U1KA 3DETC 1RURL 3O0RH 1F97A 1CF8L 1MEXH 1PVHA 4I18C 2V2TB 4N9GB 3CC5A 5KW9H 4JCLA 3UXFA 1NEZA 1D5IH 1GJIA 5FF6B 2ZSVB 1TVBB 3SDDC 3V5DA 3FKUS 2APFA 4LPUA 3AB0C 3UPRA 3B2VL 2ZUQC 5E5RB 1BIIB 1SYSB 4LKCA 5C0RH 1HWGB 4KTYA 4FXKB 5IFAH 3IFOB 1ZLSH 3OKLA 5FYLE 4JPIB 1EMTL 1WFUA 3FONB 1NAMB 3QUMB 5GSVA 3T2NL 1UWEH 2XYCA 2DOCA 1YYMH 5FO9A 2EYRA 4JM4L 4GG6E 4PRPA 2EICA 3GRWL 4LCUB 4JN2A 3JSSA 2EZ0D 4HKBA 3HZVA 4YPJA 4MAUH 3RVXD 2IAMA 3E6FB 3OJDA 4OM0L 4LEOB 4NBXB 1C8PA 3DGGB 1N0XL 1CN4A 3IDUA 3KYOA 4PJDF 5TQ0H 4JANA 4PJ8A 3OR6A 3GB7A 5EOQL 4LCWD 3TVMA 4CNIA 2XPGB 1WAAE 1JPST 1FIEA 1UH3A 1KXQE 5EWIL 4MAYC 3BP7A 2BY2A 4DUVA 1YEDB 3PABA 1SY6H 3IDIB 3X3GH 5D7IB 3S35H 5JXED 4PFEA 4K8RH 5DUPL 6CGTA 5I0ZA 4APQB 2Q3ZA 1KYOJ 1JFQH 1J88A 5B38B 2EH7H 1OTSC 2R1WB 2NYYC 2OQJA 1OAXH 1YYLH 2XACC 4MD0A 5DJXA 4EJ1C 4ORZC 3SDXF 4NUGL 4YIQB 4HK0B 4NQXB 2VLKB 1QO3A 5T3ZE 2VAAA 3CFEA 3HLAB 1QLEH 5EO9B 4L4JA 1F2XK 2WUBL 4QOKB 3LAFA 2Z35A 4ONGH 5DFVC 5I17B 5I8KH 3U2SA 4U6TA 3BKCL 3V5KA 4F7PA 1MCOH 3GDBA 4XVSH 1AD0A 2H6PB 4ZFGL 1JRHL 4KRPD 4WCYH 4LQFL 5E1AA 2FATH 1HN1A 3IDGB 3MCG1 2Q86A 2RCSH 3EHBC 4K23H 4NPYA 3AGVA 4OKVB 4U4BA 1T1WB 5GSRA 3UYRL 4PREB 1IC5H 1WIPA 1QR1B 4K2UL 1VPOL 3RVWC 3HZKA 1G6RH 4U6VH 2PUQT 1G9EA 1IM3B 2GTWA 3OAZH 5T3XD 2VH5L 2I9TA 4WWID 1FAIL 3EO0A 1DBBL 2G5BA 1U92B 4N0UA 4OZGF 5CSZB 3S37L 1KJMA 5KSAA 3QAZC 4UB0L 4JFFB 4KK6D 4JJHA 5C0NC 1LNUB 4UQ2B 1U8KB 2AXFB 3SO3C 4H8WH 4GG6F 5EN2A 1DVFB 3QXAA 3REWB 1JYNA 4OFDA 2EYSB 3I3EA 4Z7UE 3GIVA 4IJ3B 4KH2A 5JOFA 1JZ8A 5MEND 1CL7I 4Q0XH 5HDBF 1W0WB 1KPUB 2J2ZA 1MPAH 5CSGA 1UM4L 2F53D 1K6QH 4WUUA 5I1GH 1WAAF 3ORJA 3DURB 2EECA 4JEGB 1PZ5B 4YFDB 3BP5A 2VIRB 1B6DA 1IT9L 1Q9KB 1JV5B 4HS6B 2QR0B 1JHKH 3GJFK 5C0AD 5C0CA 3ULVH 1QYGL 3BIBX 4Z7VA 5T33H 3VU2A 3LN4A 4RMQA 4Q9RL 1TXKA 4HWBH 3WN5C 1U8PB 1IGFL 1NANH 1RUQL 5IMKB 2BX5A 1RJYB 2EDYA 4Z0BH 2GIYA 3PNWB 1GGUA 3IDXH 1FZKB 1DSFH 1X7QA 2ICWJ 3KPPA 1EFXD 4LARL 1FYTD 2PR4L 1U8HB 3HG1B 4K8RC 4ZUVA 2FGWH 4NZRH 4F15B 3S9DB 1BQSA 1KN4L 3IS1X 3O41A 1F3JA 2YXMA 1ORSA 5H2BB 5SX4I 4LLAA 3QFJA 3QO0A 4ORGA 5GRZA 2NQCA 2UWEA 1I9IL 2BVYA 2VDOH 2NX5B 4XPGH 1N8ZA 5CIPA 1J86A 4OLYL 3EIFA 4Q7DA 1ZS8A 4P2QE 1HXMB 1J0IA 4QRRD 5D93C 3T0EE 3QCUH 4TNWF 1NH6A 3UAJD 3RDTB 2MHAA 4MNHB 5IW1A 4WTZG 5J9PA 2F15A 1BD2B 3MUGA 1U2CA 1ZA6B 1RZIB 2Z91A 1SEQH 1Q94B 2MKWA 3CH8A 4RFNB 3NN8B 1FE8H 1CE6A 5C8JA 1JNLL 4U1GC 5D72L 3V8CA 1GYAA 4U1IB 2PYFB 4L8BB 3OG4B 4X5WB 4FZEL 1CDUA 1E6OL 4V1DE 1EHLH 5EZJA 4XCCL 4G42B 3BJLA 5FCUL 4HAFA 5HYSA 2J3SA 3S4SB 3S36H 2VO5A 3P9MB 4BQBA 3V0AC 3I9GL 1VACA 3MRRA 3OF6D 2ARWA 4XPBH 1HEZA 4WFHE 4LCWA 4FZ8L 4G6KL 4JR9H 4FFWC 3L3KB 4HFUL 2EE2A 3PQYD 1MIEL 5FGSA 3V0WH 4FQQB 1NDGB 4DVBB 1MLCA 5ERWB 1CFNB 3UTPD 3HUJA 5FA4B 3O2DH 5SWZE 5JLZA 1PZUB 2Q3AA 1HDMB 4YDJB 1W0VA 3RVTC 5CJQL 5CLWA 5CGMA 5DMGD 5IT2H 3ZE2E 4G9DA 1HKFA 2GTZA 5I9QC 4LAJH 1NLDH 4PJAA 2UV3A 3VXTA 3QJHA 4E41D 1IKNA 1WIUA 3GBNL 3LQMA 3PP4H 2K7PA 3TN0B 1FNEB 5JQHC 4O5LH 5DSCA 4ODXA 3IS0X 2UZXB 3BISA 4MGXA 3L3IB 1RMFL 3CU1A 3DMMB 5F7FA 4WJ5B 3O9WC 2DQDH 5FK9A 3U0WH 5C0BA 3TA3D 3V6OA 2XKNB 1A21A 1DN0A 1IGIH 3WO4B 1FIGL 2OBGA 3KYMA 2HP4A 5E6IB 1IGCL 3PP3H 2ZSWA 1GIGL 4CAGA 5ISZD 3PDDA 4UV4L 1LO0L 4QHMB 1BZ7B 3P73B 3ULVC 5C0FB 4MD5A 3MMEA 3KPRB 1ES0A 3HE7D 1Q72L 2OJZH 5DUBB 4Y19B 4RSVA 4Z8FH 1QOKA 2B2XH 4NZJA 2IADB 4PLJC 1C1EL 3BKYL 1CT8B 2Q87A 1WC7A 3WHE1 1UM5H 4RIRB 3VXRE 2NY2D 3GSRB 2FYYA 3T65B 4Q6IB 2HFTA 2RBLA 5CZXC 3OKEA 4ODTH 5FA3B 1BEYL 3T08A 4L4TE 1KT2B 1NEUA 1RZGA 2Y07H 4UOW1 3HMWL 2R0KH 2DLEA 1KB5A 3QYCA 5HVFB 1YN6B 2QJDA 1BBJB 4TVSa 3VFVA 1IEAB 5BZDB 3BEWB 1OSZB 2DQEL 2ITCB 3SGKC 3N85H 1S9YB 4WI6A 7CGTA 3MJ8A 4XVUD 1T66C 5I8EB 3WYRA 3ARGC 3CK0H 2HT4D 4HKZA 5C9JB 2DBJA 1YEIH 4M8VA 4RQQB 4RRPA 3V4PH 2J8UF 4S1SL 5JW3H 4CMMB 3MUZ1 1CDGA 4NBYB 4CMHC 4DUXA 2G75A 3WIHH 3T09A 2XWJB 4GKSB 1E4XH 1K4CA 2XZAL 3L7EA 1KOAA 1LEIB 2W9EL 2X4PA 5BS0D 1U8MA 2YUVA 1G9ML 2F19L 2OTWA 2FLBT 1ACZA 1NUDA 1LK3L 3BUTA 1U3HB 5C0AA 1IGJB 4Y7MA 4AEHH 1IAIL 5BVJA 3AREC 2D0HA 1NBVL 2QQLL 5DMIH 2GJ6D 1N6VA 4MDIA 2R0WH 5E8PA 1LDSA 4XBPB 1FL3A 4X6DF 5BMFH 1NBZB 1EFXA 5GS1B 3CSGA 2YK1H 1FYTA 1QFUH 4HH8A 5HYJE 1YUHB 3S37X 3BESR 1NFDE 4P9ML 4QTIL 3TP4A 4E0RA 2NY3B 5KS9A 5H37H 1G9NH 2VDQH 3VE0B 1CIUA 3DVGA 1S7TB 4KROB 2GJJA 4DGYL 5GS2H 1NFIA 3N9GL 1JF1A 1IGML 5IMOB 2CLVA 5IM7B 3L95B 4QRRA 1LP9B 4HJGA 3RKPA 4EDXA 1IAIM 3ZDYF 4RISL 2NY4C 2IQ9H 2J88L 2VXUL 1A14L 4TTDC 3VFRB 3LPFA 4HQQL 4MA1C 3QDGD 3ILPA 4NZUH 3RWCA 3ARVA 4K94H 1V3JA 3TF7C 3QUXD 4KJPD 5I19H 2X4UB 3BWUC 5I8OH 4KU1A 5IQ7L 3UTSB 1KG0B 2DM3A 5I1DB 2OR9L 2ARJA 4YHIB 2WLZA 3PWPD 4WFFD 4WW1B 3QCTL 4ZXBB 3RTQD 2CKBL 2DQCH 3MRDB 2R69L 3RBGA 3HI6H 3EGSA 3MRMB 4ELME 1EEYA 1P9MA 3TNNB 3OF6A 5DQ9A 5L2KB 3OGCB 1WBZB 4G43B 1JTTA 1AQKL 2F54B 5D1ZB 3RUGE 2D7MA 3T0XA 4BZ1L 9CGTA 1XEDA 3MLPA 4P2OD 4YH6A 5I1EH 5F9WB 2CSPA 5C3LD 1CGWA 3VW3L 1RK0A 5T3ZH 3TYFB 1HCFX 5JDJA 3TGXA 1MAKA 1VFBB 5I66A 4JKKA 4WHDA 1ONQA 4BSVB 4E41A 4XXDB 4WEBH 1TJHL 3B4NA 5L2JA 4MNGB 1UEYA 5JPMB 2P5EE 5C07B 2OMNA 4X4YA 4MQ7A 2H9GB 2VUYA 1EFQA 2J4WH 1NDMB 3BXNB 1ZE3C 1FNSL 4PJ9D 3W9EA 3HCVA 3SKMB 4XVTH 3TA3A 3GUTB 4Y1AD 2CR3A 3EO1A 4ODVH 3RU8L 1SEBB 3ARFD 3W0WD 3FZUD 3L9RB 5ISZA 1U42A 1I75A 2OMBA 1DQQB 1EBPA 1IKFH 1I8LA 1JWUB 3O4LE 4QO1A 3UTQA 3WL9A 1FC2D 1IAMA 3HE7A 1R6VA 4OCRL 5CKGA 5CEXB 5ILTL 1K5NB 5IJVB 1K8IA 3OPZH 3LMJH 1RD6A 2E3VA 3SGDI 1QBAA 4OJFL 2ZUUA 1H3UA 3HA0A 5FYKL 5D96C 1AR1C 4H1LB 1F4AA 1RUMH 4PJIB 2UUDH 1NAMH 3H9ZA 3UBXA 5J12B 4ZG1A 3Q6FB 1OAZH 4D8PB 4OQTL 5JIHA 4D9LL 3K80A 5DJCB 4XBGB 1FRGL 5D2LA 5L8KB 1KULA 2Y72A 4PGDA 5CEZL 5ACMA 1YQVH 4UOJA 1F5WA 4ZAKD 3VGDA 1FGVH 2BSTB 3MLWL 2E7LA 4K3JL 4ZSOE 4Y5YC 1QQDB 3M45A 4FQLL 4JHAH 3L3GB 4X7CC 2F5AL 3MRIB 4QRSA 5DJZA 1Z6JT 2Z92B 1FO0H 4UIKL 2AEIT 4M7JL 2DJ4A 1N6QL 2E9IA 3QHFH 4TUJA 1DEDA 5HI3D 3VXSD 3S3PA 1D5MB 3O11B 5EU4A 4L8DA 4A2MA 4ELMF 4PJXA 3RNQA 2MOVA 4K94C 1D6EA 4PJCE 1WFNA 2IFFL 4Y16D 3RUGF 3DV4A 1XCQB 5TF1L 5CUSH 5CMAB 1J1XH 1MFEL 5BS0A 2DTML 4NQVB 2CMRL 5DA4A 3DHJA 1KCUH 3ARPA 5EU6D 3VWKC 1X3DA 2ZPKL 3LQZA 3ZTNH 1AFVH 2GJ6A 2DWDB 2VDPL 3I3BA 3NVQA 3P11H 3L5XH 5CEYB 4UUJA 3F62A 1ZKAA 3NPZB 2VN7A 3KLAA 5TJWK 2NY1D 3SQOH 5GIRA 2JJSA 4L9LB 3CDCA 2A6DB 1T20A 2CUIA 5JA8B 2F8OA 4JRXE 4QHLA 5HYQA 2VXVL 1EHXA 5I76B 4U7KA 2O5YL 1NCNA 3PDGA 4JG1L 4LVNB 2EYTA 4KJQC 2FX7L 2BMKA 4LLMB 5TE4H 4J1UA 5F6HJ 5I1CL 4OLZL 2VUOA 3WFDL 1E28B 4RFOL 4TTGA 3DBXB 1FL5A 3WMSA 5KSUA 1GGIL 4KRLB 1DL7L 2NTSP 3CFJA 1IQWH 5EC2B 4K3EL 2HFEA 4M93B 5I1HL 4NN6B 3S88L 2VABB 4LBEB 3BPOB 4JKMA 4P5TB 1H5BB 3RX7A 1WWWX 3QDGA 4JFHD 3S3JA 4DW2L 1XF2B 4F8TA 3TCLA 3WFCH 4CADA 5I8CB 3FTGA 4OFYD 3HZMB 4LCYB 3U7AA 4OD2B 4JRYE 3AAZB 3BEVA 5GISH 1KGCE 1BPVA 3IAQA 5D4QA 4M62H 1OAQH 4HS8L 1A4JB 2W91A 3T0WA 3PWPA 4TSCH 3RTQA 1F58L 5BQ7A 4AYFA 3OBAA 3QDMB 4HGKC 4OV6F 3SDYH 2EDBA 2E27H 5IB5A 4WW2B 2JJWA 3QO1B 2J6EH 2DQJH 3GBLA 3ISWA 4MA7H 1GPOH 4P2OA 3BDYH 3LV3B 3I50L 4HIIB 3UJJL 3V0VB 5F3HB 5A2FA 1R5IA 4GMSL 4UT9H 5MP6L 2MJWA 1G0XA 1WZ1H 4QRQA 5E70A 4JREB 2WQ8A 2HJKB 4YHPA 1NC4B 4JZOA 4UTAH 2DI7A 3RI5K 5GGVH 1KNOB 1G6VK 2YN5A 1AGEB 5BRZE 4OGXH 3CH1A 4APQC 4U1MB 1ZHBA 3FMGH 3U1SH 2R4SH 5ITBH 2IQAA 1UGNA 2X1PA 4JM2B 1G7LB 2FEDC 3BW9A 3IJYB 1QSEE 2H45A 3NFSH 1XGYH 3O3DB 4PJ9A 3BSZL 43CAA 3JBG7 2V9TA 1NLBL 4JQIL 4Y1AA 1BWWA 5JW5B 3ARFA 3W0WA 3VFGL 3A6CH 4PRHB 3BZEA 4NO2B 3A6BL 5T1KD 1VKXA 1YEJH 1XGPA 3EYFB 4JFXA 4XH2A 2VZVA 3QHZH 4X9FA 3ES6B 5F1IB 1AP2A 4S0SD 4R2GD 3MREB 2NW3B 5DC9B 1A6TA 2Z4QA 1TIUA 1GZPB 2CKBB 1FNFA 3ZTJG 1MCDA 3VXPB 4DK3A 1EO5A 5E5MB 1T2QH 3MRPB 2IPUG 2YKLL 4OLVL 2VSCA 3UTOA 3NIDF 4QGYA 2DKMA 5LXGH 3VRLF 3VMNA 1MIML 3GKWH 2ZNXA 3GMNA 4ZAKA 4Y5XA 1T4KB 3DIFA 4YDIH 3IXAB 4GRWE 1I85A 1X5GA 4BQ8A 3QEUA 4GAJL 2VQUA 5HGDA 3IFPB 4NDMB 1DBAH 2O5ZL 2Q76A 5LAXB 2QKIB 4GAYA 3QXDB 3C9NB 4MB5A 1Z3GL 4P3CL 2HFFB 4DZBB 4DKEH 2HWZL 2D2OA 3DXAB 4P2RB 2C4FU 3U6RA 1FFRA 3OJMB 4C55A 1J8HE 5ETUB 3VXSA 1R3KA 1X6NA 3VH8B 2UZYB 1U8NA 2P4AB 1DVFC 5F8RC 3SJVE 1RURH 4WDIA 1LE9A 2F5BL 2FRGP 3U83A 3D18B 3MO1B 4Q9QH 2AQ1A 4P5MB 5KTEH 4Y16A 3QQNA 3B3IB 4IJ3C 1BJ1J 4NNYA 4HIJB 4XAKE 2IPKA 1V5JA 1UZ8B 2CQVA 4JRWA 5GS0L 5F7DB 4HCRL 1P1ZB 1RHHA 3K8MA 3OXSB 3TJHC 3B2VH 3I84A 2QHLA 5EU6A 5JA9A 4Q97A 1KTDA 4HKXA 4ZS7L 1ZHKA 3C60D 3TBVA 3MV9B 3RGVB 2BERA 1MRCL 2PW1A 1EMTH 1CFVL 1K2DB 3KPTA 1LE5B 1JJUA 1IC1A 3PWNA 1LO3L 3DWTA 4KZDL 1X5XA 3X11B 2HVJA 3QNXB 4O9HL 1EGJA 4YK4C 3KXFB 3V9FA 4KVCH 4I77L 4KUCF 4WI7A 4FQXD 4CBPA 1O5DT 3QFDA 4FQ1H 4HZLB 4HXAL 2IANB 5TQ2H 4OM0H 1QLFB 4DN4L 1QA9A 5JOPE 2BK8A 5C08D 4PRAA 1I1YB 3MUJA 2LVEA 3WS6C 4ONOA 1PFCA 4ODHH 4O4YL 5HPMA 4IS6B 3NCFB 4H0HB 4S1DC 4OZ4A 2CGRL 3QZWA 1ZGLP 1OTSD 4L1DA 4YXKH 1WSST 3H3BC 2NYYD 3UPCA 4MNQE 5HGAB 2Z31C 4X80H 4CW1B 5TDNB 4FFVC 3RL2B 1LO5B 4XI5C 4BZ2L 4X6CE 2X9YA 5KG9B 4RGOL 4JJ5A 1T83C 1UWGH 3U36B 4MSWA 1MFAH 3MCLH 4XNXL 3P4NB 5ALCL 3VFMB 4HWEL 4I2XE 3MA7B 4OFYA 4QF1B 4KAQL 3CIQA 3HE6B 4XHQA 3V6ZB 3WKNA 1ACYH 4FQCH 5I16B 5E9DE 5J1SC 5C2UB 3PGFL 5BXFB 3EJZC 2DQTL 2MMXA 4OCYL 5FUCC 2WAHA 2AP2A 5I18H 1SM3H 1E4XI 3PWUA 4KDWA 4XCEA 3KHOA 3LKNB 3WXWL 1HHHA 2OSLB 5I74C 3EHBD 3KLHD 4GW4A 4WTXA 4KPHL 1E4WH 1AGCA 5IJKC 2BVTA 1NFKA 3ULVF 3OB0K 3OKOB 5DI8A 4ZFGH 1DLFH 1BVZA 4EQ2A 1FLRH 4OCWL 5GGRY 3BP6A 2GJZB 5E99L 1RU9L 4PJ7B 4PGJA 4OF3A 4X0KA 1RZJH 3RIFK 2DMBA 4HT1H 3BPNC 4AJ0A 32C2B 1VPOH 3VFTB 4OZFA 1MH5A 3E6HA 3PGCA 1MCIA 4MJ4A 4QEGA 2A83B 3U48A 1OY3B 3H9HB 3MLUH 2APWA 5CFHA 2NZIA 3D9AL 1ORQB 3HMXA 2OZ4A 3KPSB 3BMWA 1C5BH 4G8GB 4PJHF 4J3TA 2AKRA 1I9RH 5J4MA 3CZFA 3VXMD 2JK5B 4U1KB 2CD0A 2YMXH 3DMMC 4OT1L 3VGAB 5T1KA 3CC5B 3ZKSD 1CFTB 3SE8L 2DWEB 1ZLVH 4NKOB 3WO4C 3RX8A 2FBJH 3GBML 1XF5B 3I75A 5K59E 3U4EA 3V5DB 4LLYB 3E3QE 4LGRB 4S0TD 1F00I 4Y8AA 1FGNL 2GI7A 1UM4H 2GSIA 5AD0A 5C0IA 1KTLB 3QR2A 5T5NF 2OTUB 1F3DH 4WI5A 4PJ5E 4LEXL 1LILA 5KJRH 4I0PD 5GSVB 1RUKL 1MOEA 3QH3B 5LGHL 4RNRA 4EN3D 1HHIA 4X6BA 4Q6IC 4PRPB 4JO3H 4JKWA 4JN2B 4HKBB 3HZVB 4X6CF 3FRPG 5HD8D 4K8RD 4ODWA 3LPGA 3OX8B 3OJDB 2LTQB 2P7TA 3CVHA 4G9FE 2Q20A 5J1TC 4LCCB 3KYOB 5D7LE 4JANB 4PJ8B 3OR6B 4RA3A 5DLML 2FR4B 5IW6B 2X89D 2JB6A 3TNMA 4M48L 1T3FA 5T3XL 3TVMB 1XFPA 1KB5L 3NCEB 1YNKL 5DT1L 4YHZL 1U41A 3BP7B 5CP3H 2R8SH 1KN4H 2AJSL 2WWMC 1DUYA 1QRNB 5GRJH 1XR9A 4IEFB 3I3DA 5L9DH 1M7IA 4L4VE 3ULUE 4LOUD 1OOAA 4YHNA 4PGCA 1CDBA 1ETZB 5E08L 4LSQL 4R3SA 1AQDB 2OQJB 1Z0MA 5IMLB 3F58H 3MUY1 1CGUA 3PWVA 3DRTA 4WRLA 4LLQB 3C8HA 1AD9A 1QO3B 2IH1A 1CI5A 4NQDD 3CFEB 1INQA 4YZFE 4YX2L 3C60A 1U3HC 1INDH 3JV6A 4ZFZB 1YJDH 4XP4L 1A47A 3OHXA 3WUWA 1JNLH 4XP6H 4OLXH 5D5MA 5D72H 2FHFA 4XAWL 3AU1A 5J3HC 1L7TL 2J8HA 5FUZH 2MQCA 1TQBB 2R1YA 1T5XA 2VXSH 4FQXA 3ZDXF 4KZEL 1RZJC 4QRTB 3LKRA 2CIKB 3GMOA 5FCUH 5CS7A 3FQWA 5TE7L 3ROLB 4IOIA 1NL0H 3K3QA 3HI1A 5C08A 4YJZL 5HHME 1ZANH 2Q86B 4NPYB 4TVPD 3UP1A 1JPSL 1GSMA 3BO8A 2VRAA 5LGKA 1T03H 1A6VL 3DX6A 1KCSL 2ED8A 4LSDA 5K59F 2AI0L 3HZKB 1FSKB 2NXYD 1QSFE 1TJGH 3H7BB 4XPAH 2DYPB 3W11C 1QNZL 4FG6D 25C8H 4LRIC 5KN5A 2I9TB 5FECB 1K4DA 2ADFH 4OGAD 2G5BB 3SDCD 1ZXQA 4Y4KB 4PY7B 1N59B 3LIZL 2EDJA 4GH7B 4C59B 1CBVL 4BH7A 3GSXA 4FABH 4FQJL 5MI0B 3V5HB 3TT1H 5IBUG 3GBNH 4N8CH 5MEOA 3MJ9H 1ZK9A 1YNTA 2GSGA 2A6JB 2VWEC 4IRJB 2MPAL 4HWUA 5BJTA 2WIMA 1A22B 1R3IL 1AXIB 3S3SA 5I15H 5DJ6A 5SX5K 5JHDE 3NIFF 1J1OL 3HRZA 1G1YA 2MWCA 5J11B 1N5YH 3D39B 4A6YL 1GL4B 2JE8A 1MHPL 5D1ZC 5EZOL 2D7TH 1FFOA 3JWDL 4JG0L 1C1EH 1MFBH 5C0CB 3B9KD 4Z7VB 1Q9OA 3GMPA 4JFYA 3GHBL 4YDKL 3V4VL 4H5SB 2AJ3B 1VHPA 5F9WC 1MY7A 3K1KC 4KJWD 2EDQA 4MCZA 2HKHH 4WGWB 2BRRL 35C8L 2VQ1A 5CSBA 4F33A 2FJGB 2FL5A 1HOCA 5DMJB 1YPZA 3PJSA 4XBEL 1JF5A 2ZCLH 5CGYC 1X7QB 4PJEA 5ID0A 3KPPB 1UCBH 2ZUXA 4L3CA 4YZFF 4XC3H 1T6WA 1AIFB 4AEEA 1GAFH 3TWCL 1YEFL 2GY5A 4PD4K 4HV8A 3O41B 1F3JB 3GSNL 2H8PA 5ICZA 3QO0B 3VXMA 5H35A 4S2SB 5JQ6L 3UDWA 4G80A 5KSBF 5I30H 4KHXH 4PV8A 5IBLC 1ZS8B 5KVGL 4IDLA 4NKDB 1YJDC 2E6JA 4S1SH 3BT2L 5HXMA 2D31A 2UY7A 2MHAB 5IW1B 3G6DL 5DQDL 1OT1A 3ELAT 4DGIL 5J9PB 3MUGB 1AXSA 5C0GA 1DE4A 4A2LA 2Z91B 5D7JC 3HFMH 1FNAA 3QIWC 1F4XL 5C0EA 1I8KA 2ATKA 15C8H 4I0PA 2FJHA 5J12C 4EN3A 1V7MH 2VDRL 2NXZD 4M1DL 5D7IE 2CDEA 4RZCA 1UACL 3NGBB 3X3FH 5C2BH 1ERNA 4L5FH 4I9WE 2OI9B 5HYSB 1AI1L 2BSSA 2V5RA 3QG7L 4Y8DC 3CFDA 2R15A 5K9JH 4HJJL 1VACB 2NPLX 2HJLB 4KY1H 1CVRA 3IJHA 4LCWB 4KJYA 2VLKE 5T5NG 4PB0L 2X89A 2X9WA 3LD8C 1EHAA 3HUJB 3BN3B 3T0VA 2DLGA 4QTIH 4YGVA 1T0NA 1D7FA 4QOKE 5JLZB 2FHCA 3SE3C 2EE9A 1A7NH 1N4XH 3VXUD 2X2YA 3ZE1E 1FORL 4L3EB 4QGTA 1RJZB 5HDLA 5HHQB 4PJAB 5CD5C 4WHCA 3VXTB 2E6QA 4X6FB 4K3DH 1FBIH 1A9BA 2W92A 2I5YL 4RISH 5EU5A 5DSCB 5IR1A 1P7QB 1CGYA 2D0GA 5SWQB 4NQDA 1RUPH 2VXUH 3WE6A 5FK9B 4BK4A 1U3YA 2YWYA 1DN0B 5C71A 3SE9H 2BCKA 3KYMB 1KEGH 4M6MH 5BO1L 1JWMA 3BKML 7FABL 3B5GA 4YC2C 4D9QD 5JTWA 2R2BB 1DQLH 3BAEL 4QXGH 3TV3H 4ISVA 3MACH 4AIZA 2W38A 2XXMB 4AM0A 2D4FA 1UT9A 2C4FT 4KRPB 2R69H 5FO8A 4HPYL 4U6XA 4BUHA 5GGRB 4JFFE 1WC7B 2GFBA 3AVEA 2ZJSH 1ZTXL 3B83A 3VJ6A 2FYYB 4XP9H 1MCCA 3OKEB 3F12A 3NZ8A 2XTJE 3HNTH 1D5XA 1FNHA 4L29A 1I1RA 3TPUA 3WFBH 1RZGB 1OWWA 4OI9A 1FVEA 1KB5B 1CQKA 4HMCA 3QCVH 1IM9D 1XF4A 3SDCA 5IBTL 4YBQC 4X5XA 2X1QA 4NRZA 3VFVB 4YE4H 5L88L 1MVFA 1I7UA 2VC2H 4R4NC 5KSVA 1QZ1A 4M6OH 3FL7A 1TZIA 4M93C 4NM4H 4K07A 4NN6C 4WWKD 1JL8A 1TETL 2H32B 3MJ8B 3BPOC 1JPFA 5D7IF 1NGZB 4HKZB 3H9SE 4P5TC 3NTCH 4FS0A 5M95B 4XNZC 4PJGA 4ETQB 3VFSB 3WIIH 4G6AC 4PGZA 3FQTA 2G75B 5MENB 2DKSA 4XNQA 4M4PA 3C6LA 3L5IA 1K4CB 4WU7A 1AE6H 2VDNL 4YHOL 2F53B 1I4FA 2C3VA 3L7EB 2Y23A 4Y4FC 2L7JA 4NT6A 5E03A 1U8MB 4WW2C 2B0SL 2OTWB 3LEYL 4TPRL 1QBML 4MJID 5IHBA 5C0AB 2ESVE 3RA7L 4OJFH 3B9KA 5BVJB 2JLLA 3MRJB 5DS8A 4G6JH 2NX5E 4KK9D 1KIRB 5CGTA 1FHGA 1JGDB 5EPMA 5FYLD 4MS8D 1P4LA 3DSFH 5E8PB 5E4EB 3AS1A 1FL3B 4JREC 1AKJD 1EFXB 5D7SL 1NJ9B 1BD2E 1TCRA 1FYTB 5DD6B 5EO1A 2F8XC 1DQDH 3T2PA 3OMZA 4PD4J 1JZ4A 4B41A 4E0RB 1MCWW 5I2IA 2EDRA 1PJ9A 3T0DA 2FSEA 1T0PB 3RWDA 3SKJL 4EKXA 5A43C 5AZEL 2FO1A 1NFIB 1JF1B 4PP2B 4KI5E 3ARDB 2G60H 4LNRB 2CLVB 4M7JH 4OZIA 3P4OA 5MHSD 2CPCA 4FQIL 4UV7L 3K2UH 3X14B 2P5WE 3AS3A 3T4YA 4EDXB 4LSPL 3M8OL 5H37G 5GGTH 3FB7A 5J06A 4AQ1B 4NP4L 5TF1H 3F7VB 3HTLX 4ZDHB 3ILPB 3RWCB 4NUJB 5D6CB 2CMRH 3VXQA 4JFEE 2NY7L 4KQ3L 3UZEA 3EZJB 3O2DA 4NRXA 4X6EA 1EDQA 2KQMA 3NH7H 5AG8A 2ITDA 5T3ZD 5D8JH 4I0KA 2VMFA 3O3AB 4XMLL 4HUUA 2NCMA 2A0LC 1MJUL 5GQBA 2ARJB 3V2AR 1UKSA 1XGRA 3R8QA 3W81A 5SWSB 2WLYA 5JMOC 2Q8AH 2ATPA 3EGSB 4HGMA 1XGQA 1JI1A 3VG9B 5CWSA 1VERA 3PQYB 3CD4A 2X44D 3OTTA 1IILE 1JRHI 8FABA 4KGJA 4NC1E 2V5TA 2N56A 2PTVA 3MLYH 1YC8A 4CVXA 5JR1L 3TBYA 1A6AA 4WO4A 4HLJA 4R8WL 1M1SA 3VXUA 2NLJB 1V3LA 5E24E 4UAOB 1OT2A 3MOBL 2YPLA 1ONQB 4NJ9H 4D3CL 4E41B 2P47B 1BAFL 4N1HB 4RFOH 1GVIA 4Y89A 3WBDA 5EUKA 2AK1L 3FQUA 1GGIH 4X4YB 4MQ7B 3SQBA 2N1KA 3VI4E 4KTEL 3KYAA 1UWXK 3U4BL 1Q0XL 5JHLL 3RWJA 4ZFFA 3S88H 4KUZL 3W9EB 3D0VA 3T2OA 4LVOC 3C5SA 2I60L 3N0PB 1SVCP 3CPLA 2P44B 4R90H 2O5XL 5ISZB 1I8IB 1P7HL 1GC1L 1S3KH 3RWIA 3KPNA 1Y18A 3UTQB 3WL9B 1G7JB 2NTFA 4IRZL 1NCBL 4HS8H 2EC9U 5E8DL 1TPXB 1H8OA 2VITA 2EDFA 4PYHA 1YECL 1UM6L 2P8LB 2VN4A 4EVNB 4GJTB 2CO7B 4M5ZH 3UBXB 4P4KD 1S9VA 3W5NA 2NY2B 1WT5A 3ZKXB 1EGJL 1TLKA 5D2LB 3LB6D 2PXYB 3UJJH 1FFNB 1YEKL 3S5LA 3SDXA 5IFHL 2HN7A 1IM9A 1EO8L 2AJZB 3AS0A 5DD0L 2D7QA 4NC0B 3SOBL 4ONHA 3Q6GH 3MYZA 3B6SA 3M1BA 1JF6A 1LGVA 3P4MB 4CUCA 4AH2A 3L3DA 5FHBH 1MCPL 3MLSL 3CFIC 4UINL 1W72L 4WWKA 5DJZB 4IIQA 5F97E 1CK0L 4JKLA 3VGHA 3ZE0E 1RIVL 3PHSA 4KKCD 1DBMH 4LLVA 2Y36H 2YA1A 1MJJA 4TUJB 2FZ3A 3X17A 4UILL 5BW7A 2D3VA 3BZFA 5EU4B 4L8DB 1NBYA 3QRGL 4RWYL 2BJMH 4PJXB 3RNQB 3VFGH 5ID1A 5KVEL 5HBBA 5KVDH 1D6EB 2FIKA 1KC5H 2CRYA 3DV4B 5AWNL 1JP5A 2D9CA 3CFCL 3GSVA 2R9HD 3FHAA 3HB3D 2DD8L 2FX8H 5GZNC 3T0ED 5GGQH 4MJIA 3C5ZD 1OW0C 3NCCB 4AY0A 3QI9B 2Q8BL 2FB4H 1HK6A 4J3XA 3LQZB 1NUNB 1M7DA 1MJ7L 1V05A 2GJ6B 5GRUH 3NA9L 5DJ2A 1GGCL 3EO9L 4O02H 5L0QC 4KKAC 4UUJB 3IF1A 1RFDL 3MV7E 3QEQB 3KLAB 1IVLA 2MQ0A 3ZSSA 3QXWA 4F57L 4QNPF 3G6JB 5GIRB 1AKJA 1MIMH 4V1DD 1T20B 2EIZB 1WZLA 2N7BA 1CFQA 4QHLB 3U46A 4GAJH 5HYQB 4N8VG 2EYTB 5GRVL 4G3YL 1U93B 1WCQA 2AXHA 3PDOA 3BQUB 5F9AC 4PP1D 3LSOB 3RVVD 3TM6A 3VRJA 4WFHD 4P3CH 1C16B 4YQXL 2BMKB 5EG6C 1OP9A 1WBXB 2OK0L 1YEEH 2CRIA 3PWJA 5D70L 4LAQL 4XNMA 5JXAL 3VGAC 2OZ4L 4JPWL 3HNVH 5SWZD 1FL5B 4O58H 5KSUB 3EOBB 3MRCA 3QQ4B 4XCYB 3IKKA 3CFJB 2F5BH 1ZV5A 1PBYA 1NMAL 1U91A 3UCRA 3UYPA 2AERT 2F54E 3Q2CA 4MB3A 3GI9H 3QDGB 4MXVF 3MRHA 1AY1L 2WANA 3TCLB 4CADB 4JFPA 4WFEE 1WZKA 3QUXB 3UJTH 5E95B 3BEVB 3SHSA 5HHOE 3NZHL 1R0AL 5DO2C 2CO6B 4BFEA 5TH2B 1JPTL 3C2SA 5ESVA 3PWPB 3LH2H 4PG2A 2WBKA 2IAMC 1HSAA 2GITA 5C07E 3ZDZF 1VEMA 2LTQC 4TNWK 4DUWA 4M6AA 4FQ2L 4P2OB 4PJ8C 1TZGH 1CDJA 3ARBD 5IMMB 1JZ2A 4H88L 1HYSD 3TVMC 2OP4H 1R5IB 5ENWB 2Z31D 4XPTH 3CVHL 1X6LA 4QRQB 5BV7H 4M7ZB 4O4YH 3VXRD 5EBMA 4YHPB 4JZOB 5JDSB 3OAUL 1BHGA 4L8SA 4MCYA 2FO4A 3CH1B 1I3RA 3MODL 4GUPA 3HS0B 4WIQA 1ZHBB 3ZT5A 5AYQA 3SY0A 3UJIL 2RHEA 3L5WA 2IJ0C 1BWMA 1DEEB 1T2JA 4KTDL 1HQRA 4K7PY 5EBGA 5FKAA 5JZ7C 4KHTL 5CIPH 2X9XA 1MCJA 1LP9F 5M7QA 5D1QB 5ADPL 4XNXH 1RI8A 3W0WB 4HWEH 4OM1H 2Q7YA 4PB9L 4HHAB 5F7EH 4UT7L 2A74B 1J0YA 3MBXL 1QD0A 5L7XH 4JFXB 3PHQA 5C0DA 5HHNA 4Z7UA 1JK8A 3NACL 2ZCHH 2PF6A 4PJFF 1TJIH 4OV5A 1A6TB 2Z4QB 3UPAA 1KN2L 3GMQB 3BHBA 5DK2A 2N7AA 3ARUA 5E8NA 3WXWH 1JUFA 3CVIL 3IKCA 1FNGA 3TBSB 1CR9H 2AK4E 4P4KA 4OIBA 4PRNA 1KCRL 3OXRA 1KIPB 4WGVB 3DUHA 1A6ZA 1IAII 1NCUA 1V7NH 2HH0H 4M5YH 4OCWH 5F7LB 3S97C 5DEGA 1S9XB 2LFGA 3GMNB 1FSKC 3RFZC 4JQVA 3FO1A 4LSUH 3GO1H 4F58L 2YBRA 3KS0J 1R3JB 4ODUA 2F74A 3QEUB 3MA9H 5HGDB 2BNRD 1H3PL 4LSSH 3L3OA 1OAUH 3GIZH 4GAYB 1JGEB 4HUKB 1IBGL 1QHPA 5JPNA 1IGTB 3S4SG 5KSAC 4JPVH 4KGLA 4TQEL 5HYJD 3U6RB 5HVHC 1BBDH 2IGFL 1KIQB 3TESA 4GRLB 1RY7B 4M1GL 4U2ZA 4K7PL 1U8NB 4YR6A 1BVLA 3G5XB 4WDIB 3C08L 3KPQA 2AEPL 4Z78A 4Y16B 1PAMA 4CN1A 4FFYL 5D9SA 5JUEL 4XP1L 2IPKB 3GBMH 1WTLA 4JFQB 4X6DB 4NQSA 2Y5EA 2DL9A 3T0EA 4O2EA 4JN1L 4PTUA 4GKZA 5CJ8A 3C5ZA 4Z95H 5J11C 4G6FD 3ALPA 2F9BT 1YEGL 4HKXB 5GZOD 3TBVB 2HRPL 4RWHA 4OTXL 4PRDB 2YHGA 3BGAA 4R97B 2PW1B 1F4YH 3PWNB 1LO4L 4C56D 5DZOA 1HHJB 2HVJB 2NY1B 4D94A 3R1GL 5DYOA 4V1DA 5BV7C 3Q1SL 4PJIF 1IL1A 4AT6B 2IBZX 3U0PA 3O0RL 3TYGL 1NPUA 1QA9B 3VCLB 4DAGH 5KW9L 5EIQA 5D1XB 2RFXA 1G0DA 3ZYZA 1D5IL 2V2XA 5HPMB 1OTUD 3L7FA 5DEFA 3CSYA 5LQBH 4OZ4B 3QUZD 3QZWB 4J3SA 1KB5H 2VZOA 4P2YA 1W72B 1J0HA 4KV5E 5SWZA 5C0RL 3IAPA 4UNUA 4F7TA 2A1WH 2DB8A 5IOPA 5IFAL 2LV4A 4LPCA 1JZ3A 1AGBA 3AM8A 1H3GA 2EE6A 3L5JA 1N5AA 1UJTA 3RY6A 2B20A 4UNTA 2BXZA 4JJ5B 5E08H 1UWEL 5FHAH 4LSQH 1YYML 2YEZA 5HJ3A 3NAAH 1X5KA 4PV9A 3V7AE 2P5ED 4GQ9H 4EDWH 1KIUA 2AV1A 2PN5A 4MAUL 4XPHL 1NGYA 5TDPB 4LFHG 1BECA 1HE7A 1HNGA 1TNNA 4XCEB 4ZFOL 5F1OB 1HHHB 4U1NB 3S34H 3O4LD 1EEZA 3U7WH 5D2NE 1SY6L 3EYUH 4WI9A 5IFJB 5DI8B 2DL2A 3S35L 3CSBA 3MLTB 5F6IC 4OFPA 4BSWA 2BVQA 3DECA 3ARBA 4K8RL 4Z0XA 4LHQB 1JFQL 5FGRA 2EH7L 5EFIA 2JCCF 4X0KB 3SKUD 4GFTB 1OAXL 2LQRA 3VXRA 4FNLH 1YYLL 1ITCA 3MR9A 3M07A 1EAJA 3Q5YA 4OZFB 4XCFL 3PGCB 4FN0A 4ZUTA 2IBGA 1QLEL 1QNZH 2VZUA 1IKNC 1NSNH 4HX1A 3MV8E 4ONGL 5I8KL 1S7SA 4PBXA 4I3RL 3CZFB 2QSCH 2J12B 2KDGA 2Q6WA 4LHUD 2VLJE 1MCOL 5T1KB 4M8QB 4XVSL 1I1AD 3V6OC 5EOTA 3F5WA 4UTBH 4WCYL 3LN5B 5EA0L 2FATL 2X4NA 5LGJB 5HI4D 3U4EB 3WFZA 2DQFB 4K23L 1JMZA 4RAUA 1TMCB 4R2GB 5T1MA 3GSUA 4U7SA 2QHRH 1DQJA 2G5RA 1IC5L 1UB5A 1ZEAH 3H0TB 2GSIB 1G6RL 4U6VL 3WHXA 4KRPC 3PL6D 1JYXA 4MJ6A 1X4ZA 3EDKA 4WTWA 5B39A 1A3LH 1JBJA 1CXFA 1DFBH 4KV5F 3WEXA 1CLZL 5J6GA 1HHIB 4WW2F 3OKNB 5F72S 4YDKH 3V4VH 1BQHG 5JW4Q 4BFIA 1S8DA 5GRVK 3OJ2C 1WITA 2MFNA 4ODWB 2IPUK 5KVMC 2P7TB 3CVHB 3DI3B 4H8WL 4LHUG 1A1OB 1WGOA 1D5ZA 3U9PH 5INDA 1HQ4A 1PKQE 4URTB 2MSPA 4RBPH 3TNMB 1J10A 4Z18A 1NMBH 4LU5H 1C7SA 1D9KD 4JRXD 4KK6C 5HYJA 1QFWH 3MV9E 1XMWA 4Q0XL 1NFDA 5HDQL 4LDEB 2EC9T 2RJMA 5FYKE 1MPAL 3TCXA 4EXKA 2ADGA 1DUYB 1XR9B 1K6QL 5F88A 1M7IB 4TNVF 3FOLA 3AB0B 4DZ8A 2ZUQB 2A9NH 2IMNA 4YHNB 3KXFE 4PGCB 4GG8B 4MVBD 5D7JD 2NY0C 1JHKL 4JM2F 5DGQA 2HG5A 5CEZE 3ULVL 4D0CA 4TUOB 4MZ2A 4NQEE 5DHYB 3PWVB 2IANE 5T33L 2R2HA 1XF3A 3G6DH 4HWBL 1AD9B 1HWHB 2IH1B 2WK2A 3NFPA 4NRYA 4PLKD 3C60B 1HZHL 4Z5RA 3JV6B 3NFNB 3OHXB 1UQSA 4PLNC 4Z0BL 4FA8A 2BSRA 3IDXL 1DSFL 5D5MB 3ZKND 3AU1B 4IHOB 4LGSB 2DBLH 4JHZA 4C56A 3C6SA 4ZNEE 1A64A 1JI2A 4JRYD 2FGWL 4NZRL 1MFNA 5TPWL 3RWFA 4FQXB 5E4EC 3LKRB 3W9DA 3FQWB 2E7HA 3X13A 4IOIB 2PKDA 2JB5L 2VDOL 4XPGL 2NMSA 2WUCL 3FQRA 4ELMA 5CCKL 1JGUH 3B5TA 4LLWA 5B4MD 4GW5B 1PYWA 1PX3A 2DLHA 3QCUL 3BFOA 3I6KA 1PY9A 3QUZA 4K7PX 1H3TA 4HIEB 2Y7QA 4PBWD 4IMLB 5KN5B 1SEQL 4MB4A 4Z7OE 3QG6A 4YHYC 1FE8L 3SGEH 3ROOA 3MRQA 3G5ZA 1VFAA 3UAJC 4M7LL 4BH7B 3MPCA 2ZUSA 4TUKH 5DHXB 3LPWA 2Z8SA 5BRZD 2EIEA 5MEOB 4U05A 1EHLL 2QTEA 2P5EA 2X1XR 2YOCA 1YNTB 2GSGB 4H0GA 3M17A 4ZD3H 4PJ7E 3CDGA 3O3BB 2CR6A 4R4BA 4IRSD 2AEQH 1I3VA 1QSED 1T0MB 2WP3O 3BOVA 5BJTB 4XPBL 5A1AA 4MJ5A 1VA9A 1OGTB 4JR9L 4MDJA 4M43H 1CVSC 7FABH 3V0WL 3JWDC 1WIOA 5DJ6B 1ZHNA 3HRZB 3O4LA 3O2DL 2AJVH 3ILQD 3MRKB 1ZWIA 3A0OA 3B8YA 1FQ9C 1P9MC 3CZJA 4G8GE 3WDJA 3V7MA 3VG9C 5JIIA 4OZHE 4HPYH 4F7EA 3GMPB 1AGDA 1KJ2H 1MI5B 1NLDL 4O2FB 3IDJA 3MGOA 3FT4A 3T77B 2IF7A 1Q0YH 5I1IH 5AAWA 3VGFA 2VQ1B 3RZWA 1SJXA 4O5LL 4F33B 5HYIA 4Z7WB 1ZSDA 5DMGC 3QAZB 3X12A 5FDYA 4PJEB 3VFPB 5ID0B 3GEWB 1DJSA 1MWAA 2DQDL 4L3CB 3U0WL 1H15A 1A6UH 1CLCA 1U95A 3FN0H 1IGIL 3KR3H 5DRXA 5J13B 5ADOL 4YNYB 1OP3K 4HV8B 1BMGA 4N90E 3QNZA 5ICZB 1LD9A 4P57A 2BHYA 3VXMB 3FO2A 1TETH 2V2WA 2E6PA 2OJZL 4G80B 1I1AA 3TA3C 5E6YA 4PV8B 2X4RA 3KPLA 5K33A 4Z8FL 4R0LA 2B2XL 3DYPA 1VSCA 1SJEB 4RAHA 1I8LC 1J8HD 2W0KA 3HE7C 1UM5L 1FL6A 5EO0A 4X4XB 3SJVD 1DE4B 4LASL 1TPXC 4PJCA 3HC4H 1JGVH 3K74B 3PL6A 4ODTL 2D7NA 2JELH 3QSKB 4XAKD 4ZFOB 2YD4A 1JHTB 1ZLUK 1NKRA 2H3NA 2R0KL 5C0EB 2X4QB 1I8KB 5CP3A 5IVXB 1JZ5A 2FJHB 5AUMA 2NY2C 1QRNE 3HI5H 3JV4A 4HZAA 1ZOXA 3QIBD 3U0TB 2ZOKB 4Y4HA 5KVFH 3N85L 2BSSB 2EXYD 3UX9B 2R39A 1BGXH 1HHKA 5DD5H 4AMKL 1L9NA 3CK0L 1SHMA 1YEIL 4X8JA 2F58H 5BVPH 4PLOB 5E4IA 3V4PL 3IJHB 2E7LC 5D7SH 5F9OH 5JW3L 1H9VA 3E1F1 1BQUA 1D9KA 4JRXA 2Y25A 3WIHL 5ICXA 3O2WH 3WUZA 4XVUC 1E4XL 1WWBX 5D93B 2HT4C 3ECBB 3RRQA 3EYVB 3G6AB 3QWRD 5JOPD 1OB1A 1OAKH 3MYJA 3EFDH 1EVUA 1CD1A 4YEFA 5ACLA 2HT3D 5AZEH 3IDNB 1E4JA 4PRIE 4JZJA 4AEHL 1YY8A 1NGXA 1GOHA 1BOGB 5EC1A 1A9BB 1BQLH 5DMIL 3TO2A 3DI2B 4YUEH 3TBTB 4OQ1A 5CP7B 2A0LD 4ZPVA 1XCTA 1K8DA 1YNLL 5BMFL 3QNYB 1KCKA 5F96H 1G6RB 2YK1L 1QFUL 4XWOD 4KVNH 3IJSA 3OQ3B 1MCFA 4JRYA 5E9DD 4RMTA 1MJUH 3VFNA 4ISVB 1ZT7A 4AIZB 1G9NL 2VDQL 4AM0B 2JJSC 3VD5A 1T04A 1QACA 1OF2A 3S96A 5FO8B 2YZ1A 2WBJD 5D7KE 1M71A 4XVJH 3MJ9A 3T3PF 4BSJA 2QQNH 2C26A 4W6XB 4CVUA 3MGAA 5I9QB 2R29L 3F12B 3NZ8B 3TPUB 1D5XB 1U8JA 2NXYB 2IQ9L 4O2CA 2W07A 4X7DC 1FVEB 4FOMA 1GCFA 3LEXB 1XF4B 3SDCB 4R8WH 2V7HA 5JORA 1GHFH 2YUXA 4NZUL 3P77A 4NRZB 1ZT4A 4OF5A 3O9WB 1I7UB 3KJ4C 4K94L 4OCNC 5I19L 3D39E 5I8OL 1X5YA 1BAFH 1TZIB 5BRZA 3ARRA 2ID5A 4M9PA 4Z7VE 1OTTD 4ZO7A 5JHLH 2DQCL 5CKAA 4IRSA 3HI6L 1QSEA 2B1AH 4KJPC 3FQTB 1MY5A 4UMGA 4JFOB 3RVUD 2EDTA 5DRZA 2YPVL 4XNQB 3OAZK 3RTQC 3RNKA 2KKQA 1B0RA 1I4FB 5I1EL 1XGTA 5C86A 2XQYG 3VH8G 3S7GA 5T3ZL 1HHGA 4HC1H 4XT1C 4JVPA 2WIIA 4FXLA 1T21A 1KTRL 5A40E 3B9KB 4HIHA 4P2OC 2DQHH 2CDGA 4GOSA 1T22A 3JUZA 2WQRA 1CICD 4WEBL 1EGJH 4HGWA 2AGJH 4LF3B 5BCAA 5HSFA 1IEHA 1RVFH 5CZKA 2J5LB 4M7ZC 4PJ5D 4E42A 1F42A 2J4WL 2CXKA 4HDIA 5IB1A 3ARGB 2GK0B 4I5BA 1V3MA 4J3VA 5EO1B 3N1QC 3QPQD 4G8FA 3SOBH 3SKNA 4ODVL 5E8EB 3WFHA 1VADA 1U8LA 4G9FD 1IFHH 1IKFL 2H41A 4CMHB 1M4KA 3P0GB 2XN9D 5D7LD 3RWDB 4PJ9C 5EBLA 3D2UB 3S36X 2IH3B 3OPZL 3LMJL 3ARFC 4KI1A 3BH8A 3FZUC 2YC1A 1J8HA 1RUML 2YD6A 4R26H 4N0RA 3BWAA 3SJVA 1I1FB 5KVEH 1OAZL 4L4VD 3ULUD 4LLUA 4LCWE 5IV2A 1OP5H 3VD9A 3SGJA 2GY7B 1AHWA 5BZWB 1P2CA 1YQVL 5TFSL 4R7NB 2NR6D 2GHWB 2EH8H 5DHVH 4LMQE 1CTNA 2NXZB 4HFWA 2ITDB 4LIQH 3QULB 3EYOA 1MJ7H 3QIBA 4ELKA 3B9AA 4JHAL 3PV6B 3MROA 1XGRB 4L3EE 5A16A 4LSTH 2ATPB 4ZAKC 1FO0L 4Y5XC 3K1DA 1H3XA 3OAYH 1J1PH 1I85C 2VR9A 5IROA 1FN4B 4Z7VF 3QHFL 5CWSB 4PY8I 5C0JB 4I3GA 8FABB 3BH9A 5DVOA 3FFDA 3QWRA 4CVXB 2R23B 3TBYB 1A6AB 4OZFH 2I9LB 5HHMD 5HHXL 1J1XL 3VXUB 5EU7E 1C5CL 1U8IA 5DJYA 2OK0H 1KCUL 3NCYS 2ED9A 4MA1B 2OZ4H 3HMXH 1QSFD 3MRGA 4Y16C 3MRNA 4MNQA 5EUKB 3FQUB 4OLWH 4JQXA 2UWEF 2APTA 3ZTNL 5DMYA 1AFVL 5I71B 3P11L 4AENA 1NMAH 2VB5A 4HLZH 1DDHB 3DHMA 2XA3A 43C9A 4ZFFB 5C9KA 3D0VB 2XQBH 2VL5B 2VLLA 3C5SB 3MJ7B 3SQOL 1IAKA 3EDFA 2J7LA 3SBWA 4EUPA 3CPLB 4NHCL 4UIMA 4JB9H 4I2XA 3DLQR 5T3XE 3KPNB 3ABZA 4AIOA 3NZHH 2GK2A 4ZPTB 5E9DA 2JJVA 2NTFB 3CUPA 4Z7QE 3BD5A 3W2DH 1KLUA 2VITB 2NY1C 4HUMB 3STLA 5EIIA 1S7UA 2Y9RT 4HW6A 5GGVY 2WBJA 3ZYIA 1E6JL 5TE4L 2E9BA 1NEZG 5JHDD 4BH8B 1IRAY 2W1NA 5DJ0B 3MLZH 3BPCB 4N1EA 1Z9LA 1IQWL 4H88H 3S5LB 4K3GA 5MENE 1YMHA 5E94A 3PP3K 1I7RA 1XGUA 3CVHH 1A2YB 4ONHB 3LN9A 2F53E 4LSRH 1T5WB 4QYOA 1GGTA 3B6SB 5EZIH 4NKQB 2VR5A 4YDVA 1J87A 3OAUH 3HUJF 4U31A 2BVPB 1I9EA 4QWWD 1X4XA 4WWKB 4M62L 1OAQL 2ZNWA 4IIQB 5ICYA 2R2CA 3JUYA 4TSCL 1EZVY 1MQKL 1B0WA 1EXUB 1DTUA 3SDYL 4LLVB 2E27L 4HIXH 3WCYA 4PJAF 2J6EL 2DQJL 2C1OB 3BZFB 1NBYB 4MA7L 4MQSB 1F4HA 2FIKB 3I2CL 3BDYL 2EDNA 4UT7H 3GSVB 1KJ3H 3MBXH 1FH5H 1FYTE 3MLXH 3Q3GA 5FYJE 5GGUA 2EC8A 1OARH 4OBRA 3BZDA 4Q2ZA 4UT9L 4F7MB 4MJIB 1HILA 1WZ1L 4M7KH 1Z9SA 4M4RA 4R9HA 4X7EC 2W60B 4HWZA 4UTAL 1M7DB 2AXJA 5GGVL 3BGFC 1CICA 3ARXA 5KOVC 1V3KA 1ULVA 1UENA 4DTGL 3U1SL 3FMGL 2R4SL 3IF1B 4PJ5A 3WJLA 3JVGA 5FIEA 2HVKB 5HGHA 5IF0B 3NFSL 4ZYKA 1XGYL 5AZ2H 4I48A 3GM8A 3UBXI 2GQHA 3A6CL 4PJDE 4KKBD 4G9FA 1S7WA 5D7LA 1P4BH 1EEUA 5J89A 1JZ6A 1TZHA 1YEJL 2VXTH 2VLKD 3HC0B 3QHZL 2R4RL 4JFDE 3PWJB 4P4RA 2EDLA 4XNMB 3VGEA 4G8IA 4QXTB 4QOKD 1RZ8A 5SWSE 4BZYA 2FJFB 1C08B 3MRCB 3OJVC 1KLGA 4N5UA 3SGEI 1S9WA 1T2QL 3BP4A 4L4VA 3VWKB 1U91B 3MNVA 2B8OT 1CLYH 5EOCL 1DUZA 1OWRM 3PQYE 4R2GC 5IEKA 2X7LB 1A1MA 5LXGL 3MRHB 3UTPE 1PSKL 1W0YT 3GKWL 4U6HA 3AXLB 1U3JA 3GMMB 3VI3E 4R96A 4Z77A 3G08A 1DBAL 5ESVB 3U9UA 1QVOA 4J2XA 1WCBA 1WVZA 3AMLA 4PBVC 3WO3B 4PGEB 5CBEA 5K9OA 1QBLH 4MA3A 3REVA 4KRMB 1DBKL 5ESQA 2C7UA 3RZCD 1HSAB 1QBBA 2GITB 2ICWA 1I7ZA 4UT6H 5EH1A 2PTTA 3D0LB 4PS4H 2CJUH 3VFWB 4J8RA 4Q9QL 3IETA 3B2UD 3TYGH 1CXHA 4PG9A 2HTLD 2JTDA 5KTEL 3F65A 4JFFD 2CDFB 2GCYB 5ACZA 4UU9A 4QRPB 1RZ7H 4R4FL 4X98B 1HH6B 1R24A 3O2VL 5EBMB 5DVMA 4X4ZA 4LK4A 2MQ3A 4XB7A 2XTJD 4L8SB 4MCYB 1QSFA 2FO4B 5F89A 1I3RB 4JHWH 4XX1G 3WNOA 5KS9F 2HFGH 4WHTA 3L5WB 3O3EB 4LLDB 2X42A 1HQRB 4NKIH 4OZGE 2HLAB 4Q6YA 3CGTA 5FKAB 4PGBA 3QDJB 5D2LE 4KVCL 2LABA 1VGKA 3C60C 4TRPL 4Z76A 2BZDA 2Q7YB 4FQ1L 4YAQA 4XPHH 3H9SD 5EBWA 4MMZC 1I8MA 5TQ2L 2W0PA 3RL1B 1ZLWK 3PHQB 5C0DB 4M9OA 5HHNB 4Z7UB 1JK8B 5CBAB 3R4DA 1A4KA 5HDBE 4MQXC 4ODHL 4OV5B 4FQXC 2EIDA 1A7QH 3BHBB 5DK2B 2W0FA 5E8NB 1UKQA 1FNGB 5JHDA 1RV6X 4P4KB 1G7MB 4DFIA 4YXKL 1FO0B 4PRNB 1UCTA 3BJ91 2VE6A 1EUUA 3QXUA 4WI8A 4X80L 5F21B 5ITFA 3VRIA 1NC2B 3V4UH 1A6ZB 2CLRA 5MEQA 12E8H 4EI6A 2ESVD 1IAOB 1P53A 3O45A 2VDKH 3FO1B 2NX5D 1UWGL 2WZPD 1MFAL 2V2TA 2PYEB 3MCLL 5B21A 2F74B 4KRNA 3OB8A 4XCFH 1EH9A 3L3OB 1ACYL 4FQCL 1TVBA 3FRUB 3VI3F 4U6YA 3RDTD 2DMCA 5ANMA 5C09E 4BK5A 5HYSG 5JPNB 5C0BD 2YUWA 4NCC2 5I18L 1SM3L 2UUDK 1BP3B 4CJ0A 2VXQH 2HT2D 3CDFA 2A6KA 4FXKA 3IFOA 2GJ6E 3D25B 3ZMRA 4I3RH 4N8VB 1LEKA 3FONA 5LVEA 1BVLB 2AV7A 4S1QH 4RCAA 1QLRA 3QUMA 4Q9BA 3QEQE 1E4WL 1YEHH 1L4IA 3G6JE 4KI5D 2OL3A 1DLFL 1FZOA 1FLRL 5EA0H 3GSOA 1REIA 3T3MF 4O2EB 4PTUB 3E6FA 4GKZB 2P5WD 3C5ZB 1FVCA 3KLHC 1SBSH 1RZJL 3DGGA 3MLRH 4HT1L 1DCLA 3LQAH 4L8CB 2E7CA 1FAKT 2Z8RA 5C6WH 4WNQA 1IJ9A 5I75C 3MLUL 2ZCKL 4JFED 1T6VN 1CLZH 1YEDA 4GBXD 1C5BL 3IDIA 3WFEL 1I9RL 1IL1B 1NMCC 4F3FB 3U0PB 3MFFA 4TVPH 2YMXL 5B38A 5D2LF 2NW2A 2UYLB 1ZGLA 4ZQKB 2X6MA 3PXHA 1XR8B 2FBJL 5J13C 3QA3B 4LRNL 4YIQA 3TN0D 2V2XB 2VLKA 5DZNA 5DEFB 5KANI 2FDBP 2NY0D 3WXVH 5HDQH 1ED3A 3IDYB 3UDWC 1X44A 4QOKA 5SWZB 3CLFH 1JZ7A 1JE6A 5E6ID 5I17A 3RIAF 1TTUA 1AGBB 1JGLH 1N5AB 3EZ8A 5KJRL 2W9DH 1C12B 1KENL 4N0FB 2DDQL 2FX9H 4JO3L 2QADD 4HH9B 4PV9B 5A2KH 3QWQB 3GJFA 4PJXF 1FJ1A 3IDGA 4YK4B 1NGYB 1G7HB 1HZHH 4I0PC 1JNHB 4EN3C 2FEEL 3DVNB 5B3JE 3STZA 1IM3A 1MNUH 3F6LA 4RRPG 3HPJB 5HD8C 3RZCA 1MHEB 4ENED 5TPWH 3SPVA 2R8SL 4NHUB 1E0OB 1U92A 5GRJL 1MFCH 1VCAA 5L9DL 2JB5H 4BSWB 2BVQB 3ARBB 2Y1VA 2WUCH 3GI8H 3W0WE 2Z31B 3LOWA 4JFFA 4F8QA 5CCKH 1WBYB 1LNUA 3G6JF 5EFIB 4ODBD 4UQ2A 4HUXA 2V17H 3F58L 5IWLA 3MR9B 3JWOH 1EJOH 1TVHB 1RIUH 1EEQA 4ZUTB 2YUZA 3QDAA 2XZZA 2VJXA 4M3JA 4LOUC 1R3HB 4MXWL 2HA1A 1A1NA 1INDL 5DD3H 4YEEA 1YJDL 4I4WB 3KPMB 5DD1H 4F37F 3B43A 4HX1B 4GW1A 4XP6L 4OLXL 5B8CA 3RBSA 1UB6B 4M7LH 5FUZL 2Q6WB 3BX7C 5DRNB 1Q9KA 3BD4A 3WS3B 2QR0A 2VXSL 4WI3A 5DURD 1CZ8H 2J8UE 3H9SA 5EOTB 1BREA 3F5WB 5I74B 1NL0L 1KLFA 4DOHB 1U8PA 1ZANL 4RAUB 5T1MB 3VFOB 5DDHA 2MCG1 3PGDA 1FDLL 1DQJB 4GAFB 1T03L 1RJYA 3BI9X 1UB5B 3PNWA 4MJ6B 5AYUH 3IVKB 1TJGL 4XPAL 4EEEA 3BPNB 3QUKB 2AJXH 4K71C 25C8L 3DOSA 4HJ0D 1AO7E 2ADFL 3RGHA 4CU8A 5I1KH 2NY3D 2P1YA 4H8WC 2ESVA 5H2BA 2IEPA 3MLVL 5A3ID 4FABL 2NX5A 4U0QB 2NXYC 1S8DB 3TT1L 1CDCA 4FG6C 4N8CL 1D5BB 4X6DE 3MJ9L 2BNRB 3SDCC 4OGAC 3MV7D 5INDB 3PG2A 3RDTA 2FD6H 1N7MH 1QFHA 2VKWA 2YXFA 5GJSH 3MBED 1ZA6A 1RZIA 5FOBA 1NFDB 4TULH 5EUOA 5ADOH 5D6DA 3NN8A 5B3JF 5I15L 2ADGB 3CMOH 3FOLB 4DZ8B 4L8BA 4CRPA 1KB9K 2VDML 1N5YL 4HS3A 4JO2H 4IMKA 4FXGB 4G5ZH 1JNNH 1HNFA 5DQJA 2P8PA 2D7TL 1MRFH 1YY9D 3C6LC 1MFBL 4D0CB 4ZXBD 3ZDYE 3PWLA 1XF3B 2P5WA 1K85A 1OL0A 5HI5D 3TZVD 3P9MA 2Y6SD 4LASH 2HKHL 1WUNT 3NFPB 4H20H 4GXUM 5FB8A 4Z5RB 3L3KA 1NCAL 4FMKA 1MUJB 1UQSB 3B9KC 3KJ6H 2ZCLL 1RQ5A 4FQQA 1GZQA 5ERWA 1CFNA 1UCBL 2DQUH 4JFEA 4WFED 5FA4A 4XC3L 4C56B 1GAFL 1HDMA 1ODAA 4GBXA 4KJWC 4YDJA 1A0QH 3BRGC 5HHOD 2XOTA 3RPKA 2J5LC 2XZCH 3BZ4B 5DJ8A 3DUUA 3W9DB 5E1HB 3JWOC 4LCIH 4W70A 5DR5H 3UC0H 4AMKH 3FCTB 1Q9LA 5IEHA 3FQRB 2EKSA 4KHXL 5I30L 3TH4T 4LLWB 1PYWB 3TN0A 1FNEA 3MRFA 2M1KA 3DARA 3MRLA 4NJAH 3QUZB 3I6KB 1FFQA 5SV3A 4QHUA 3VWJD 2Y7QB 4PRBA 2OJEB 1N64H 2XKNA 3DVIA 3UBXG 2VOTA 3BE1L 3HFML 1OVZA 1SMAA 5E6IA 4OLUH 3QG6B 3ROOB 3P73A 5C0FA 3DV6B 1VFAB 1KFAL 15C8L 5DZLA 5IB4A 1X5AA 1V7ML 3WKMH 4NN5C 5DUBA 3X3FL 5C2BL 2P5EB 4L5FL 2IADA 5J57B 1S7RB 3M17B 3CDGB 3JV0A 4R4BB 5K9JL 3GSRA 4ALAL 1YNLH 2NXZC 4EBQH 4KY1L 4MJ5B 3T65A 3LKPB 3J8F7 5FA3A 3QEHB 3O4LB 3E8UL 1OPGH 1ZWIB 1YN6A 2X1WL 1A7NL 1BBJA 4CDHA 1IE5A 3EAKA 5BZDA 1N4XL 1BJ8A 1YN7B 3BEWA 1OSZA 4I13B 1QSVA 5FYLH 5HGBB 4F7EB 5E0QA 3H3KA 2HJFA 5LBSH 2R0LH 3F7YA 3IDJB 4U3XA 2AK4D 3R0NA 5C9JA 4P3DB 4JFZH 4K3DL 2R29H 1AXTH 1FBIL 4WO4C 1L6ZA 2P24A 1ZSDB 1RJLB 1UXSB 1CGSH 4ZUWB 5DC0A 1RUPL 4HUVB 5E2WH 2CLZB 2X40A 1MWAB 1H15B 1U95B 1BQHB 1H3VA 1PG7L 3KYNA 4PJFB 5DRXB 3SE9L 1KEGL 1H0DA 4M6ML 3IU3A 3UTZA 5E2VL 1LEIA 3QNZB 3I6LE 1LD9B 5I71C 4LHUB 4NNXA 4HBCH 4YBLB 1DQLL 1YC7A 5C1MB 4S11A 1IGJA 2V2WB 4QXGL 3TV3L 3MACL 2X4RB 3KPLB 2DQGH 4M6NH 1LHZA 4NKMB 3OKDA 3GM0A 3NCJL 2WM0A 1EBAA 2ZJSL 3EYQD 1FL6B 2YPVH 3OR7A 5EO0B 1MHHB 4XP9L 4NOBA 4JVWA 4X83A 4QHKJ 1E4KA 3HNTL 5GS1A 2DQIH 3WFBL 4QLRA 2B5IB 2H2SD 2VNCA 4PR5B 3QCVL 4FTVB 3CFKA 5AUMB 1WT5C 1JN6A 3VE0A 4YE4L 3F7QA 5JIKA 3W5MA 2VC2L 5K9KB 2I07A 4BELD 4M6OL 1ZLVK 3VDCA 4X7SH 5J56B 4NM4L 3DROA 2UVFA 5IM7A 1HHKB 2MNUA 1O7VA 3MV7A 4OF6A 1YMMB 3NTCL 3HHRB 4X8JB 1EX0A 1HIML 3L1OH 4XPFL 3WIIL 5HPOA 1D9KB 1RSFA 4F7CB 1N26A 3MBEA 5CD3A 1N3NA 4WWKC 4IIQC 1AE6L 2VZ1A 4XXCA 2EIBA 3MYJB 3ET9F 1CD1B 4G7VH 3TO4D 4GS7C 4RMWA 3HC3H 1KB9J 3NCBB 3JZ7A 2X4UA 2XA8H 1A7RH 5BW7C 4ONFH 1XIWD 5D7JB 1INEH 1KG0A 4JZJB 3QIWB 5T5FH 1YY8B 4KXZH 4ZXBA 3RP1A 2EDKA 1BX2B 2WINA 4G6JL 3MRDA 3VGGA 5ESAB 2VLRE 2BNQE 3TZVA 1JHLH 3UO1H 3TO2B 1QTYT 5E8OA 2D4DA 3DSFL 3OGCA 1WBZA 3FT3B 4ZPVB 4O51A 2Y5TA 4YXLL 1XCTB 1KPRA 3L3HB 2CRMA 5IQ9A 3O8XD 4YFLI 5F9JA 5TFSH 1G9NC 4KK9C 3JV5A 4IDJH 4MS8C 3B9VA 4DK6A 3LHPH 2XIDA 1DQDL 5HHOA 1TVDA 3VFNB 5DVNA 1ZT7B 3LD8B 3OZ9H 3DO3A 1T04B 1SVZA 3S96B 3PHOA 3F7RA 1MCNA 4OF0A 1R5VA 4J3OC 2A9MH 4XXDA 2G60L 1M71B 5JPMA 5I0DA 3K2UL 4OCSL 1ZMYA 4J4PD 3O3UN 1U8JB 3VWJA 3SKMA 5INCB 5DMKB 5GGTL 3GUTA 1UXWB 5F9DC 1TENA 3L9RA 2HLFC 5HHXH 2V7HB 5JORB 3BRDA 1C5CH 1ZT4B 2ZOLA 4HWNA 1K5NA 2BHZA 4U1SB 5KANG 3NH7L 3NMEA 5D8JL 5BRZB 1MREH 2UY6A 4HK3N 4NQCB 4YC2B 4YHKH 1MI5E 3AS2A 1KJ2A 5IVZA 3MV8D 2Q8AL 4IRSB 1JPGA 2G9HB 1QSEB 3Q6FA 2JCCB 4NHCH 4XTRD 4XBGA 2VLJD 4Z7WE 5HYEA 3DGCR 1ZT1B 3OKMB 1PD6A 3RNKB 4PJEE 4PG2C 1B0RB 1T7YA 3GHEH 1X5L