3MJ8A

Crystal structure of hl4e10 fab, a hamster ab stimulatory for gammadelta t cells
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
SYTLTQPPLVSVALGQKATITCSGDKLSDVYVHWYQQKAGQAPVLVIYEDNRRPSGIPDHFSGSNSGNMATLTISKAQAGDEADYYCQSWDGTNSAWVFGSGTKVTVLGQPNAAPSVTLFPPSSEELKTNQATLVCMINGFYPADVAVTWEADGTPITQGVKTTQPSKSDSKYMATSYLTMTADAWKSRNTFICKVTHGGNTVEKSLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIMULATORY HAMSTER ANTIBODY HL4E10 FAB LIGHT CHAIN
publication title cDNA sequence and Fab crystal structure of HL4E10, a hamster IgG lambda light chain antibody stimulatory for gammadelta T cells.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 209
sequence length 209
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8A01
1G9NC 3NTCH 3K7UA 1AO7B 1NGQL 5HYSA 4PJEE 1QLEH 2GJ6B 4JN2A 2CJUH 5GZOC 3IDYC 1B4JL 1BEYL 1B9ZA 2K1MA 4OGYH 2BXYA 5F6HI 1QFWM 4XBPB 2D4FA 4IMKC 3KPSA 3RZCD 4PJ8D 4QHMB 4P23D 5I1EL 2CO7B 4NHUB 2N1KA 1X44A 2WLYA 3Q1SH 3C5JB 3PDOB 1CICB 4JFYB 3FJTA 1QNZL 2LE9A 5LBSL 3BEWB 3MLZH 3KHQA 1UXSA 2QKIB 4JO1L 4OUUB 4NWUH 5CWSB 4FP8H 3P0VL 4L8SB 2FIRT 4K23L 1B2WL 2C4FT 1FE8H 4NO5A 1H9VA 3NIFE 3KR3H 3VXPA 4BYHA 5C0BA 4YBQD 5D2NE 3L95B 3OR6B 3RPIA 3MNWB 3MUGA 2QADB 2NR6D 2CKBA 4QNPF 5DEGA 2NY5H 2ICEB 3DPBA 1W72H 4XPHL 4MVBC 3TBTB 3PJSB 3L5XL 4ZSOB 1RZFL 1IAIH 5FCUH 4KK5C 1NLBH 3BPCA 5DQ9B 3HZMB 5GGTA 5HVFB 1A6PA 4M48H 1L0YA 4QHKI 3L3GB 3MV8A 4V1DD 1MH5B 3MGAA 3RWCA 1QSFE 5KSVB 4RGNE 1J8HD 5I74C 1DSFH 2XTJE 4BK4A 5DK0B 5E1HB 4OZ4B 4WW2C 1I1YA 2MMXA 5TJWK 2ITCB 3I6LD 1ZLWH 4LHJB 4M6ML 4GW5A 3V4UL 4PJ9D 1DVFD 4JRXA 4U0RC 3E0GA 3K1DA 5DDHA 3QIWB 5MI0B 3QUZC 4YDLB 1T0MB 1PKOA 3UXFA 1SVCP 1OCWL 3S37H 1A14L 4U05A 1UB5A 3ZDYF 1JWMA 2B5IB 4LSPL 5FIEA 5I71B 5FHAL 4LLYA 5K9JL 3TYGL 5E9DD 1WZMA 2GSIB 3PL6B 1MWAH 4G8FA 3H7LA 4HH9A 5JW4N 5EU7E 1VENA 1S9YB 4ZPVA 1BVLB 5FM5M 2GAZA 3GMMA 2GJZB 2W60B 4G9DB 4YHYB 2CKBH 3QWOB 4XCFH 3G5YA 5FYJH 3NABL 1BVKB 2LTQC 3G9VA 3ARBC 3F7PC 3E2HB 4ZO7A 3F7YA 4ZS6D 3OGCB 4MHHG 5GGTH 4PJAE 4PLJD 2AEQH 3KYKL 4KJQD 5CIPB 3U48A 1OGAA 3DROA 3U9UB 4TVPL 4OB5L 3RL2B 3H2WA 1I8IA 4HWEL 1NCNA 5D7JA 5KZCD 4PRPD 3SE8H 1X5JA 4PJDE 2FZ3B 3LZFH 5SWQB 1Q72H 4N8CH 3P4LA 3IKCA 5E6ID 1C5BL 2NZ9C 5GIRA 2IQ9H 2AJYL 5IKCA 2BY1A 4G42B 1LDPL 3LKSB 5J11B 3A6CL 4N0CC 2ZUQC 2GSGB 43CAA 3ZKSD 3TNNA 1QSFB 3GSOB 4HK0A 4RGNB 2R0ZL 2X4UB 4XWOC 3I6GA 2AJZB 3L3KA 1BZ7A 1S5IH 5DMJB 2YPVH 4NKIH 1CD8A 1LQSR 5IHBA 4ZDHB 2JJUA 1YN6A 5EA0H 1H3UA 4LHUG 5F6IC 3KLHD 5CJOH 1FL6B 4W68A 2H3NA 4LLDA 1A47A 3MTRA 3NZHL 2ESVB 4XBGA 5CJQH 5GJTL 5I19L 2I07B 2WMPA 4YXHH 1ZT1B 1IGYB 1R5VA 1E4XI 3GI9H 3DVFA 4HS8L 4WEUD 1BGXL 1UM4L 5EBWA 1BX2A 2P45B 3QCVL 1NAML 3MOBH 1I9IH 4IRZH 3V6ZA 2XZAL 1K3IA 5A2IH 3MRGB 4OKDA 1S7RB 1UJ3C 2F53E 5EU5B 1PGRB 3Q0HA 5JORA 2CUIA 1T2XA 2WUBH 4Y4FD 3QEQE 4C83B 5L7XH 4KROD 4P57B 5I1GL 4UT9H 1J11A 1ZLVH 2FATL 3KYAA 3QXDA 4OLZL 4XI5D 3UAJC 1QRNE 5DD5H 4KTDL 4BKLB 3NFPA 4PRDA 3SY0B 3WYRA 5EG6C 5HI4C 3VXQB 4DGVL 1FNEA 4UINL 4PRHA 3MXWH 5DWUL 4H25A 3GMLB 4P9ML 4PJDB 3IAGC 3FTGA 3RA7H 4XHJD 3VFSA 3DIFA 5D93B 3WN5A 3F7RA 3CPLB 1DEDA 4L3EB 1IFHL 1X4YA 2PXYB 4MA7L 2X89A 3H9HA 2C9AA 4UILH 2YPLA 4XVUC 2BMKA 3OG4B 2NXYD 4F9PC 2E7LA 5IBTH 2HVJB 3DNKA 1I8KA 2FX7L 4A2LA 3STLB 2Y9RT 3S4SG 4NC1C 1KUMA 4Y4HA 3E8UL 2IBZY 4PJIA 5EC2A 4QRQB 1B88A 4QXTB 2VLKD 3IJSB 3WLWD 1JUFB 4Y16C 1TXKA 1FFOB 4RBPK 5AWNL 2XG4A 1MCSA 1QBAA 4F8QA 1EMTH 1G7MB 2DYPB 2ICWA 1WWAX 2MWCA 4YNYA 3NCYP 5T3ZE 2C1PB 3RGVA 5DRXA 3HAEA 3NCCB 3FB8B 5HHMB 3G6JA 5TDPB 1T1WB 3VMNA 2IQAB 4QT5A 2FLRT 3D0LB 5F71A 5ID0B 3T3ME 4CVUA 3ULSA 4ZUUA 3WUWB 5HI5C 1AR1D 1IJ9A 2WZPD 1XCQB 4JFQB 2F53B 1KT2A 4J1UB 4PJ5D 3UJIL 2IH3A 3SJVE 4U31A 3MA7B 3FZUC 5EZLA 3NCEB 4F9LC 3WFBH 1R3LB 3EOTL 4G8GA 4KUCF 3IT8D 1QRNB 1U3HD 5K9OA 2VISB 1XR8B 3L7FA 2H6PA 3QEUB 1YNLH 3PGFL 3PGDB 5D96B 4DKDC 1CL7L 2JCCE 4NM8L 4QHUB 5GGSY 5IJVA 2BDNL 4JZOB 1TQCC 1XCTB 4EUPH 3JV0A 1F4WL 1EJOL 1AY1H 4P4KA 4NUJB 5IQ9A 4YFLF 4UNUA 1TTGA 2DKMA 1O7SA 5FM5O 4NM4L 4ZUVB 1KSRA 3CVHH 3TEUA 5HGGS 2XA3A 1S9WA 3SGJA 4R7DB 4L8DB 1U95B 3CZJA 2R69H 4B41A 3KPQA 3HAEH 1JPTH 1HSAB 2NQCA 1F8TH 5JMOC 2EXWC 1W72B 5JOEA 1VACA 32C2B 3VGBA 1ORSA 3ARPA 4DFHA 3QXWA 4MJ2A 2VSCA 3G5VB 3WS6A 1INEH 5GGVY 1UKSA 3ZTNL 1WISA 2CDGA 3O9WB 1R3JB 4YXKH 4U0QB 2BC4A 3F7VB 2R15A 1QO3B 4OCWL 1YJDL 1BJ1H 2YS4A 3VRIA 3HC4L 2VXQH 3QG7L 4HUUB 3WFCL 1MLBA 4RAHA 3X11A 4HWBH 5E95B 3FQTA 5ID1A 3AXLA 3LEYL 3ARDA 4JFFB 3RUGF 4WO4C 3BW9B 5F9OH 3CFDA 1U8MB 3T1FA 3QCUH 2EDTA 3SJVB 1NCDL 2BP3A 1RJYA 1HSBA 3UYOD 1UH2A 1JMZA 5HHVL 4UOJA 1MCWM 2ICWJ 1FZOA 2O5XH 1FO0L 2LQRA 3G5XA 4L4JA 1U8NA 4GKZA 1S8DB 1TQBC 4BELD 2ATPA 2ZSVA 5F93C 2I27N 2JCCB 4L4VE 5BJTB 1GGCH 4C56D 4F2MB 4G9FA 2GITA 3WFDL 5BOZG 2CRZA 5J8OA 2XRAL 2WP3T 4TTGA 4GRLD 1IILE 5ESVB 1TDQA 5DUBB 4QCIA 3OQ3B 1AQDA 3LCYA 4G80B 2V5RA 1BJ1J 3WS3B 3N06B 3FB6A 2G5RA 1OP3H 3VXRE 5F3HB 2OBGA 3QPQC 3QA3A 1EFXB 4CUCA 3CVIL 1S9XB 3BMWA 2WSKA 3I2CL 2R2BB 3D3VA 2C3HA 3DV6A 4QRRE 1HHKB 5DO2C 5BVJA 5SWSB 4Y19E 3BD4A 4JY5H 3GNMH 1E4WH 3GMQB 3ZDZF 2VN7A 3CMGA 3TIEB 1YQVL 2ADJA 2BNQD 1A1OA 5I1IL 1MVUA 3GHBL 4U49A 3WJJC 2XQBL 4OBSA 3U7WL 2EXYC 4GFTB 3ROOA 4KVCH 5H35A 1JPFA 3GSXA 3B5GA 3VWKA 4BA8A 2J12B 3V5HA 1KPRA 1MFCL 2X5PA 4DN3H 1WT5A 2ZUWA 4XVSL 3O2VL 3SKNA 4E5XA 1UZ6F 3X17A 1F4AA 3JBG7 2NY3B 4HIHB 1WVZA 1YPZA 1DE4B 3DI3B 1U91A 4GBXD 3QIBC 4WFFE 3INUL 3D48R 4JDTH 4MMXC 3V2AR 3QRFM 1DQLH 1MPAH 1E28A 4NJAH 3U46A 3V0WL 4IOFC 1RHFA 2Q8AH 3P4NB 1N59B 3S3SA 3C60D 4JN1H 3X3FH 4MQ7A 2X1OA 4NWTL 4F8TA 4GS7C 1KGCD 4L9DA 3O11A 3CIQA 4WDIB 4XNZB 1DQDH 2UWEA 1GYAA 2DM7A 3OX8B 5HJ3B 1BZ9B 3LQMA 5E2TH 4CNIA 4F15B 2Y5EA 3B83A 3IDIA 3LV3A 3VXRB 1UCBL 2A9MH 4Y2DC 5JMRA 4GG8B 2OL3L 3CMOH 4EI5B 2J88H 1DJSA 2DQEL 2YUVA 3IVKB 4QRRB 5IEHA 3Q6FB 1M7IA 4ZNEA 2IANA 3ZE1E 2VR4A 2V7HA 5JR1H 2GCYA 4G8EA 5EZJB 4GSDL 2F54D 3HRPA 2X4RA 4XP5H 3TH3T 2VQ1A 3G6DH 4H0GA 3TFKC 1ZVSA 4HXAH 1T4KB 3L6FA 5J13C 3AS2A 4P9HL 5BV7L 5ISZE 5I73B 3PWUA 4M8QA 1RJCA 3DUUA 4PJ7E 4UQ2B 3FO9A 4NNPH 1ZLVK 4FNLL 5I30H 2QHRL 3F58L 3GDBA 4V1DE 3SDAA 1PLGH 4UUJB 3I50L 1YY9D 2YA1A 4DVRL 4MSWB 1MCWW 1J8HE 1FL5B 5F1IB 1U8LA 4ONHB 4ZFOL 3GIZL 3IU4L 5HDQL 5LKNA 4OF5A 1BP3B 3ULVL 1N5AA 5HHOD 3RIFK 4Y5XA 3T0EC 5KSAC 4NNXA 4GKSB 4Z7NF 4MXQD 4OJFH 1A7QL 5HPMB 3CC5B 3PIQA 4O9HL 1VEOA 5D1QD 1RV6X 1K8IA 3BT2L 3VJ6B 3H0TA 4U3CA 4POUB 4KKBC 2APWA 4KFZC 1WITA 1BBJB 2XKNA 3PWLB 2GTWB 3FB5B 4WV1C 1K2DA 4WI6A 4M7KH 5A3ID 3BP4A 1MCOH 1WGOA 5JNYA 5E9DE 3V0AC 4TVSa 3MLRL 5EORL 1F00I 1G9MC 1JYNA 1TETH 5FUCC 1DLFH 2D2OA 5AD0A 3NFSH 2LVEA 1BQHA 3L1OH 4PRID 3SGEI 3L3DA 4EUPB 4DEPC 3LS5L 3GSNA 1N6QH 1MREH 3SQOL 1PKQA 2VE6A 5IB3A 5GS0C 1NMBL 1KNOA 4KMTL 4BSJA 3LQAC 3HE6A 5IROA 1SJHA 3C87A 4NFDA 1VKXA 3CVHB 5D7LD 2YK1H 4OIIH 3X3GL 5E2UL 4DKEL 3MFFB 1YDPA 1W0VB 1OAYL 5ISZB 4N0UB 3V7AG 1O7VA 4NN7C 4PJ7B 1HH9B 1JNNH 3KPRE 2P8MA 3P4MB 4PGJA 1EERB 5D9SA 4M8VA 2P8LB 1PG7L 4ZAKC 2JJTA 4WI9A 2P47B 4DKAA 1KEGH 5F3BA 1FZMA 4XC3L 4X6CA 4Z7OE 3VFOA 4GOSA 4QXWA 5D1XC 1HZHH 4JFEB 4U7KA 3LS4H 4LQ1A 3QDAA 5LWYL 4RGOL 4XZUB 4NO0A 1KG0A 3FAXA 2HVKB 1HYSD 4UIKH 5FM4A 1FSKB 2VDOL 2H1PH 5F7EH 5FO8B 4HWZA 4JQXC 1QSEE 5AUMB 3GSNH 5I1LA 1NBZA 5CZXD 2EDEA 1JRHH 3X12B 4JPVH 2MKLC 3ZSSA 3VRJB 1FO0A 4PJBF 1LK3L 4JM2B 3LMJH 2ZCHL 1B0RB 5FDYA 4F80A 1ZHKA 4LLQA 5GGQL 1LP9F 3OKMA 3MV7D 4ENEC 5TPWL 1S7TA 3IDMA 3G04B 4R97C 4HKXB 1NC4B 4YUEH 5C0GB 3TPKA 2R23B 3H8NA 5KSBA 2C3GA 1CDYA 3VFUB 3FN0L 1D5BB 3J7HA 5I1HL 1S7WA 4HAGA 3RX7A 1Z6JT 5JPMA 5E6IB 2KKQA 4HWNA 5ESQA 3OXRA 3KPRB 4HHAA 2LABA 3BQUA 4YR6B 1FNLA 4OGAC 4KWUA 1EX0A 2CDEB 4GMSL 3VXOA 4ZFGH 2EEBA 4APQB 1RZJH 3FRUA 3IAPA 1KXTB 1ZGLA 1H5BA 1BAFH 2CUMA 3T2QA 2R4RH 1MCNA 5IESL 4XNUH 3O3BA 3GUTA 4LCCA 5J3HC 4YHLL 1OWWA 2G60H 2ORBH 2HT3D 2VLKE 2IMMA 3ULUF 4U3HA 1A4JA 4FFZH 4HCRL 1BMGA 4P3CH 3QSKB 5GS1C 3MLYL 2WV3A 3JUZA 4OUOA 5EU4A 1CGVA 2W65B 4Q74A 4CU6A 4Z77A 2IF7A 2AV1A 1A7BA 3ZKQD 1QSEB 2X42A 5JPNA 3FO1B 4TSCH 1MCDA 1VADB 1WCBA 1RVFL 1S7QB 3HI6H 3OPZH 1NSNL 1YYLL 5C09D 3WE6A 1UWEL 1IQDA 4JFDA 4ETYA 3EYOA 5IFHL 2D4DA 3GB7A 3AB0C 4W4OA 2YEZA 3RBSA 5IBLC 1PSKL 1AKJA 5C7XH 1OT2A 2ZNWA 1JGLL 5C6PB 1JNHA 2HA1A 4U6YB 3H3BC 5E8DL 4RMRA 1A1NB 4ZTOL 2EICA 1MRFL 1SYSA 3QQ4A 4QWWC 3RAJL 3W2DH 1AQKL 3VFNA 3EDDA 3CDCA 2J4WH 1NGYA 1UH4A 5T1KD 4TQEH 5GJSH 4KUCD 1A6VL 3RVXC 3DLQR 1A8JH 3ARTA 1YMHB 3D18B 5KJRH 5JIPA 4XBPA 2YMXL 3EDKA 5DA0B 4HZLB 2WBKA 5JOFA 4KZDH 4NNYB 5IVNA 2DLIA 4ZFFA 2ZP0T 5FO9A 3PDOA 3WL9A 3MO1A 5JW5B 1Q38A 3Q48A 4Y4KA 2DQCH 1RJLA 3U0WH 4TOYL 4KUZL 3D39E 3QIUD 4HPOL 2C1OA 4ODBD 3GKZA 4R9HA 5FKPB 3RDTC 3H9YA 3IB4A 1OAXL 1HH6A 4MLSA 2AV7A 1MHHB 1P4LB 4ZFOA 3K3QA 5C0IA 4KI5F 1WWWX 4J6RL 1TITA 1CF8L 3WO4C 2JK5A 5FV2A 5DD3H 4LSQL 1FORL 4L1DA 3WNOA 2Z9TA 3O2WL 2ICEA 3IXAA 1MAML 3V5KB 4WWKC 3SGDH 3WD5H 4FFWD 5GISL 3L3GA 2DBLL 3PWPA 5E70A 3DVNB 3DHMA 1XF1A 1LEIA 4YHIA 5T3ZL 3I9GH 2YZ1A 5BRZD 4R4BA 2W9DH 3VFPA 3VXUA 1L7IH 1MHCB 3AMLA 4C56E 2XN9A 2RIKA 4PJFF 4NHCL 3B5HA 3GJEB 4K7FA 1JYVA 3A6BH 3T65A 4H26A 3NIGE 1A22B 4PJEA 4FQJH 3O8XB 4HC1H 1NLDL 4KU1A 4EQ2A 5I1AA 4P2QE 4Z8FH 4PTTA 2CR6A 1GPOH 3D25A 2FO4A 5CCKL 5FA3A 4LVEA 4JO4H 5J1AA 3BP6B 4XXCA 4Z7VA 5E7FA 4YFLI 3L7EA 4ISVA 1S9YA 2Y36L 4FFVD 3NPSC 3QCTH 2W60A 1KCSL 1WQVT 3D39B 3QWRD 1BQUA 1FZJA 2H32A 3QH3A 4N8VA 1IGCH 3CFKB 1BREA 3QUXB 3GK8H 2GI7A 2B39A 1J87A 1NL0H 4HUXA 1J1PH 1RUAH 3MLXL 1C1EH 5D2NA 5I66A 2C7UA 5E08L 1CE6B 4L8CB 3JTSB 1Q0XL 1IGJA 2OSLA 4NRYA 1OTUD 4JZJC 4GLRH 4MNHA 4NUGL 4JRYD 1Q72L 1X5ZA 5SWQA 5F1KC 4Z7QF 4MQTB 5F44A 3D0VA 1I9RL 1VHPA 4OLWH 3LKRB 4G42A 1MCJA 3LKSA 1DFBH 1ED3B 2QQKL 5BQ7A 3QFJE 3WIFA 3IDJB 1T83A 2MTPA 4Q6IA 5K9KA 5DJAB 4JDZA 2NY1C 1FGNH 3ROLB 3DO7B 1I7ZB 2QSCH 3MJ6A 4QRTB 4RFOH 2DQGL 2RR3A 3OHXB 2R56H 5ICXB 4I48A 1FCGA 1QA9B 3CUPB 2A77L 1KGCE 1S5HA 1KELL 2VAJA 1YC7A 1IKNC 3DVGA 3RGHA 5EA0L 3ZSTA 2WLZA 1BM3H 1H0DB 4KGJA 5SX5H 1ACYH 4WHTA 2KZ1B 4BQBA 3PGCB 4LFHD 1F4XH 4HF5H 3IGAB 4P2QB 4U6XB 5I1JH 1LO3H 3QB7C 4NKMA 1SBSL 1LO4H 4AEIH 5ERWB 3EYFA 2BVUA 3KVQA 5E2WL 1YEHL 2HLFC 3DX8B 5J56B 2ZSWB 3MRBA 4X0KA 4X99B 4D8PB 3V5DB 5DFWH 2BNRD 4XVTL 1YMMD 4U1HB 2HTLC 2YA0A 4AMKL 2HT2D 2BJMH 1I7RB 1FVCA 2B1HL 2LU3A 2P8PA 4UB0H 3LN4B 1QR1A 1MFBH 4UT9L 4ODXB 1SMOA 5E94B 4WUUE 2HWZL 4LCUA 1JF1B 3CGTA 4HIEB 5LQBH 4PJAA 3P77B 4U1KA 2BRQA 3RKDD 3GKWH 3JVGC 1VPOL 3I3BA 4WI4A 1J0KA 3MXWL 4YC2C 1KB5A 4FXKA 4M3JA 3VFGH 2Y07L 5BZDB 1A7OL 4PJXB 4TUOA 1JCKA 3BIBX 4YDJB 4HCRA 1F2XK 4QNPE 1WK0A 3RY6C 1W8OA 1GOFA 2N4IA 1EO8H 4Y5VC 5F1SA 5JDSB 4WY7L 5INCB 1RUPL 1AIFB 3QFJB 2YXFA 2VITA 5IK3A 1KN4L 5GSRB 1T03H 2OTPA 2Z0BA 1I1AD 2M8XA 4JJ5B 1TPXB 4MXWL 1FFNB 4LARH 3STLA 4O58L 3AY4A 3BDYH 3QNYB 3RTQC 5MENE 1JUFA 3UTQB 1FFOA 5JZ7D 4ONFL 2B4CC 3SDDD 3MRDB 1EGJL 3ES6B 1CDJA 5J9PB 2XNAA 5ITBH 1UCTA 3DXAA 4CVZB 4F7PB 3FB8A 4NQEE 2R2HA 4WNQB 4ODUB 4BH7B 5HVHB 3X14A 5BVPL 5ID0A 1K4DA 1Z5LA 5EOQL 1YEDB 3VD5A 5BZWA 1FP5A 2R0WL 1XCQA 1G6VK 1E6OL 1KB5H 4HQQL 1EEUA 5D7LE 3QEQA 1BLNB 5JXEA 5E4IA 3W0WA 1IGFH 3QDJD 4WUUB 5IHLB 4XMKL 5KVDL 1QRNA 2VDQL 2VISA 2DDQL 1JN6A 2P49B 3BPLB 1CZ8H 3BKCL 4G6KL 2EEAA 3QNXB 1D9KC 3LAFA 3MV9D 4QOKE 5JHLH 3FFCD 4JHZA 4JZOA 5DD1H 3RY4A 1BBDH 1AY1L 1DN0A 3QDMA 5J4MA 2GFBA 1OAZH 3HUJF 4WTWA 4NUJA 2EO9A 1ZT7A 5IBUG 2RBLA 3QI9D 4PFEA 4QRSB 2X4QB 4PG9A 2VDLL 1U8KA 2UZYB 4PGEA 5F21B 4R7DA 2E7HA 4L8DA 5KW9L 4NSKA 4QHLB 4LOUC 4Q6YA 1HWHB 4X5LA 1FNFA 2X4TB 3TC9A 2FBOJ 5DJZB 4N9OB 1Q9WA 2PO6B 5T1MA 5M7QA 5MENB 2MCPL 1INEL 3G5VA 2EZ0C 4OFIA 1I8LA 4LSTL 5D7IF 1B90A 1H3TA 1EH9A 2GTZB 5B4MD 1HQRB 4DK6A 2HJKA 3N85L 2VQUA 4HLZG 4DGYL 2FYYA 5CJBA 4NQEB 4HIIB 4P3WA 2Y7QB 3MV7E 4FQXC 2VR9A 2WWKO 2OI9B 1CR9H 3OKOB 4MAYB 5EO0A 1V7NH 4MNQA 1QPXA 3QCUL 3C6LC 5IHZB 1P7HL 4M61A 2AI0H 1IMHC 3GJFA 1RAMA 1DBML 3SKJL 1RHHB 4E0RB 3U1SH 2B2XH 4IIQC 2Q7YB 5IVXF 5T1LB 5EU6A 5DTFA 3EO9L 5IW1B 1RY7B 4QOKB 1M6OB 5B3NA 5BJTA 5L2JB 3LQZB 4F2MA 5KS9A 1Q1JL 4KHTH 2OQJB 2Q86B 5HHPB 4HUWB 1ZSDA 4NIKB 4LVNB 2CK0L 5HY9A 1MEXH 2FHBA 1MRDH 2NX5D 2R2EB 2EE6A 4OKVA 5ESVA 5DUBA 4BJLA 4I2XE 3O0RL 5C0FB 1MFAL 3WS3A 2R1YA 5B39B 3RVUD 3DX7A 3MNZA 4OFDA 1LHZA 1S9XA 4YQXH 2VL4A 2PYEA 1KJ2A 1T5WA 2VAAA 3PNWB 5CILH 3OL2A 4FA8A 3TN0D 1HHKA 4H1LA 1S9KC 3UJTL 2XG5A 4RMUA 1LILA 1MCHA 1N6VA 3LKNA 3MV11 5D4QA 3BN9C 5IM7B 5H2BB 4UTBH 1AFVH 4ONGL 4LAQH 1IM9D 4G7VL 5J6HB 1WIOA 5C09E 2BSRB 3ULUD 4N5UA 3GJFH 4BSVA 4AZ8A 1ZLUH 4FG6D 1V7ML 1J0YA 1CG9B 2EDBA 3MRQA 4MJ4A 3N1PC 4MX7A 4M1GH 5FKAB 3KPLB 5FECB 4HULB 3BP7B 3VGEA 1GL4B 4AENB 2NY6C 5AZ2H 1U8HB 4LPWA 2AJUH 2B1AH 1S7VA 1AGBA 1EEZB 1ZA3B 4H88L 3V6FA 5CD3B 4OZFB 1OVZA 2Y06H 3MODL 3KPNA 4G6AC 4L4VA 4EN3D 3CFCL 1N59A 3FQUB 1KENH 4P46B 3EJYC 5L8LB 1KJ2H 2A0LC 3MUZ1 2PTTB 3OAZH 3OX8A 1BD2E 4H1LH 4RMTA 1LO2L 5EO9B 1T20B 1A7NL 1DLHB 2NLJB 3GIVB 4JJHA 3S5LA 5EZIL 1HYRC 1A6UH 2H9GA 5DUPL 1Q8MA 1WFUA 4M62H 4OGXL 2CIIB 4N5ED 3V8CA 3BDBA 2X9YA 3S88L 1G1CA 1DBBH 2V17H 4Y19A 3MLTB 3CFBB 1OTSC 1NMAH 4F7MA 3LH2L 4NQUA 1P4IH 1HK6A 1F11B 1U9KA 2ADIA 5BW7C 5E8PA 4PREB 3MBED 1CLOH 2PYFA 3QJFA 3CXHJ 4YBLB 3LKOB 4YEEA 4LQFL 2AK1H 4KI5D 3TO2A 1ZHLB 4NT6B 4J4PA 2IPKA 4UUJA 3GRWL 1NCWL 5F7YC 3CH8A 1EGJA 1KPVA 5TE6L 3RUGE 1EHNA 2B8OT 4WEMB 4YK4C 2DL2A 3BP5B 5DD0H 4HX1B 5D7JC 2YD3A 3BIAX 4OAWA 4I13B 1HE7A 2ZOLB 3DETC 3MCG1 4Z6AT 4ZYKA 2KZWA 3SDXB 3BSZL 4RFNB 3UZEA 1MCKA 3WFZA 4KK9C 4G8IA 3N1GC 1YYML 4M7LL 3FT4B 2HH0H 4Y1AD 1BIHA 4JKMA 1F3DJ 4AH2A 4PJCF 5AG8A 3UTTD 5DT1L 2GTWA 4PJ8A 4ZPTB 3EYQD 4P23A 5KN5B 3BVNA 1TLKA 1AHWB 1BD2B 3LEXA 4I18A 2A1WL 5IMOB 4ZODA 5EN2A 2CLZB 2ICCA 4LMQI 1TETL 1YUHB 1WIPA 3UBXI 1GAFH 4LEOA 1WBYA 1YNTA 3V6BR 4F3FB 4EI6B 2APXA 4YHKH 4H8WL 3L3OA 1YEGH 3EDEA 3CXDH 1MCIA 2P24A 2R1XB 4XC1L 3WEXB 4IEFB 1OF2B 3T8XA 4LNRB 4WFHD 2EC8A 5DQDH 3QZWG 4P5TD 1RIVH 3NPZB 5IMLB 1HKLH 4Z9KB 2Y5TA 3ZDZE 1RK1A 2WANA 4FFYH 4URTB 4YWGH 1CFNA 3MRPA 4JRYE 4IRSB 5D5MF 4ALAH 5LGHH 3TWCL 2DMCA 1G7IA 1SM3H 4PJ7A 1HH9A 1Q9OA 4QY8B 5FXCH 1UACH 2P48B 4V1DA 5FUOL 3V79C 1RJZB 4WFGE 3T4YA 4K7PH 1J8HA 2VDRH 1KCUL 5D70H 4LSDA 1JPSL 1ZLSL 3RUGB 3T77B 3QDHA 4KRPD 5TFSH 5I2IA 1UZ6E 2FSEB 1F90H 4KZEL 1NUFA 3I85A 5TH2A 1OM3H 4F7TA 3QHZL 1RZGB 4PJ9A 2WAHA 1DVFA 5EU3A 3KPMA 3WN5C 3BDXA 4ODTH 4LLWA 4PV9B 4X8JA 2AJ3B 1FJ1B 5FDWB 1XF4A 2EYTB 2NW2B 2NY0D 4MDJB 2E7LC 5B8CB 4QHKJ 2BVOA 1OSPH 3WLBA 4EIZC 5E9DA 1NDGB 1YMME 3S35X 5JO5A 3MJ9H 2A83B 1CN4A 5F9JA 2D31B 2D7MA 4Y4HC 4KY1L 4R8WL 2RAMA 5C9KA 1OPGL 3FQWA 1NDMA 5T3XD 3VGAC 1G6RL 3V52H 1BQLL 5EPMB 4MA3B 3TO4D 4MJIE 1MCCA 2PW2A 3G04A 3ZL4H 3RGVC 5EBMB 1JFQL 3F62A 1JHKH 1F42A 2R23A 2QJDA 2A6DB 1WZ1H 4PRPA 3OSKA 2VKXA 3CNKA 1DBAH 4GRWF 4M93B 4PPTA 4G7YL 5E6IA 4I0PD 3FO0L 4LSRH 4L4TD 4KTEL 4YR6A 1H3PL 2EIZA 3N0PB 1U93A 3O6KL 4ZFGL 1XZ0A 4UU9A 5MEQA 3OXSB 4NZUL 4AT6A 4IM8A 5C71A 3RQ3A 3DMMD 2EEDA 2V7NB 3EHBC 4LHUB 5HYJE 3BO8B 5H94A 4WUKL 2G60L 1LO0L 3FQNA 3QAZC 4PR5A 3PWVB 3QDGD 4P4KC 3TV3L 1P7KA 2X1XR 4Y0GA 3WJLA 2D03H 2CIKA 4P3CL 4JY4A 1EUTA 2VDML 5GRZA 2RJMA 5DYOB 4FABL 5IW6A 5KVGL 1I7TA 3MMEB 4JO2L 4OCYL 4ODSL 4U1NA 3RL1B 3SGJC 4LIQE 4LK4A 3SDCD 2F19H 3FQRB 1VADA 4ZOAA 3UTSE 2EDJA 1EZVX 1RIUL 4FZEH 3PHQA 3STBA 3V4PH 3DX9A 4K3JH 3X13A 3WS6C 4Y4FA 3KYNA 5C0CB 3TVMD 5ANME 3RX8A 3B9VA 3GJFK 5I0DA 1ZLUK 4XCNB 1EK3A 3MRCB 5HI3C 2AJXL 2H45A 4MJIB 4XPGH 3IAQA 1IM3B 4P2RD 3JV6A 5EOCL 1D5IH 3MV9E 2O5YH 5IEKA 1ORQA 1PX3A 3FFCE 2WWMC 2UYLB 1L9MA 3ARDC 1UVQB 5DVKA 3GHEH 3AU1A 3MRRB 4RRPG 3CSBA 5IB1B 5GJSL 4F37K 1TVBB 4K07A 4BFBD 1M7DA 3ALPA 3S4SB 4R90L 3ARGD 4NDMA 5HGBA 1MFNA 3H9ZA 4FTVD 4KVNH 2P4AB 2VWEE 4AEFA 3I84A 2VXVH 5HYJB 5GGUA 5L2KD 1HXMA 1HHGB 1L9NA 3MV8D 1FL3A 2VLKA 3O4LE 5HGHB 5DJ8B 3QEHB 5IMKB 4G43B 3QUYD 1XIWB 1UM6L 3GRWA 4PUBL 4BM7A 1TZIB 1WFOA 4PS4L 4X4ZA 3IJYB 2ARJA 5C6TH 3BWAB 3TT1L 5L9DL 4CADA 2H26A 2W9EL 3W5NA 1GC1H 3UTSB 3BOVA 5D6CB 3D69B 1FGVL 2EH8H 4OCNC 4IJ3B 3SPVA 4PJ5A 1TNMA 2DKUA 4KTYA 1M7XA 4PJBE 4TPRH 1UEMA 4OF3A 4M1DL 5ANMB 4ZQKB 4DN4L 3IXTB 1LP9E 4J8RB 3WSQL 1U3HA 1CCZA 4S1RH 1MFDL 4HMCA 4LASH 4ACPA 3MV9B 4HUVA 5F8QC 2M1KA 3VWKC 1IQWL 4NFCA 1WT5C 5E5MA 3GSRA 5INDA 4NC2B 4DW2H 1M05B 2NX5E 1C7TA 4YIQA 4ZUWB 4YAQA 1J1XH 4JPWH 3OJ2C 2DB8A 1KV3A 4PY7A 1Z9OA 3QR2A 3EBAA 5IOPB 1KIPB 1T1YA 3N1FC 2X4OB 4WHCA 1SMAA 4Z7UF 2HFGH 2QQNH 3H9SD 4PYHA 1FV1A 2ZKHH 3B4NA 4JM4H 3NA4A 4D9QD 2X10A 5C0AD 3O4LB 3D39A 3FMGH 4JKPH 4MB3A 3KPPA 4RFEA 1CLZL 5LGJB 4K2UH 2GW5A 5KVMC 3VD3A 2EYSA 2VC2L 3HZYB 5JOPD 7FABL 2OTWA 2AABH 2O93L 3O81A 5EIIA 3M1BA 1ES0A 3L3HB 2O61A 2NY2B 3HLAB 3O6LH 4OIBA 1XR9B 4PJBB 4HJJH 1T80A 1AE6H 3K2UH 2VERN 1XGQB 2EDKA 1FNAA 4QRPE 1XF2B 5DFVD 5A2KH 3LKRA 4G6MH 1NBVH 1PZ5B 1ED3A 3CX2A 4LCWD 1CD0A 3RU8H 1BF2A 1UWXH 4YH6A 2AK4D 3QO0B 2I5YH 1IKFL 2QSCL 3DO7A 1KACB 5FEBA 1IC5L 4C56A 3C5ZB 3ILPA 3OHXA 3UTPD 1NGXB 1G9NH 4KKNA 1R24A 4XP1L 1QA9A 5HI5D 4YHML 3QPXL 2YD1A 4IRJB 5GS2H 1T2JA 4GRLA 1G6RA 2Z8SA 5FB8B 4HS6A 3B2UD 4U1IA 2GYSA 3BGFB 5DHVA 4LDEB 2IC2A 3GO1L 5E6ZA 4P2QA 2JIXD 4Y5XC 1J18A 2Y25A 4WGVB 1A4KA 3DX6B 5ERWA 4JG1L 1F3JB 1QLRA 2BFVH 3BD3A 4Y2OA 3VXNA 4YPJA 3ZE2F 4K8RD 2YPLD 5ELIA 3SBWA 5C0NC 1JBJA 1AH1A 3H7BA 1X4XA 2VH5L 1I7RA 1QFWL 1RIHH 3C09C 2ADGB 5C8JA 4S1DC 5JQ6H 2BNQA 3MA9L 1MAKA 3LN4A 4RDQF 1N6UA 5CINL 3TCLB 4P4RA 3PDGA 1RPQA 4X7TA 4I5BA 3TNMA 5I1DA 2C3VB 4A6YB 2X1QA 1G7JA 1FNGB 1A6ZA 1J0ZA 3HR5B 4U6VH 4X9HA 5FOBB 1KIQB 2JF1A 2WP3O 4R2GB 2R4SL 1N64H 1OAKH 4QRPB 4GBXA 4U1JB 4UV4H 1INDL 5JDSA 1ZKAA 1HDMB 3QFJA 4GXUN 2D0GA 2XWBA 5DJ0A 1S3KH 3VCLB 3GSWA 1G0YR 1QKZH 1HHHB 2E6QA 4EN3B 5I9QC 1RD6A 3UC0H 4PG2A 3C60A 1MCQA 3T0WA 5DRNA 1AXTL 4Y1AE 5K9QI 4MZ2A 3UTTE 4GKNA 1WIUA 4DKFH 2JJTC 3LY6A 3V6OE 3RIAF 3LN5A 3U9PL 2PR4L 3EYSL 1LK2A 4QF1B 1SEBB 2XXCB 5FO7B 3WIIL 1HILB 4F7PA 4HW6A 5CSZB 1U8IA 1X5LA 4M6NL 3OGOE 2F74B 2PUQT 3VFRB 5FHBL 2CUHA 2Z8VC 4WI3A 4C55A 2QSVA 1IC7L 3Q5TA 3SE9H 2DWEB 3NN8B 3V7AE 2W91A 2F54A 2BRRL 1P69B 1XGPA 1Z3GL 4D9LH 4ELME 4AL8H 3AREB 2D9CA 5M94B 2A6JA 1H3GA 1LEKB 2XV6B 5F88B 4LBEB 3RWJA 3EDFA 4UV7L 1KYOK 1I9JL 2Z35B 1NJ9B 5CLWA 2MKWA 4JHWH 1J5OH 1MQKH 2XWJB 4I0CC 5IMMB 2IG2H 4OFYD 5HYSG 3FQXB 5JUEH 4OD2A 4Z7QE 3ARFC 5HHOA 1PG7W 3DWTA 1TZGH 4YHPB 1FNSL 3HE7D 3MBXL 1NKOA 5D1QA 5D1ZB 2PNDA 1ADQL 4XAWH 4KKAC 4DOHE 4ZG1A 1CXKA 3V4VH 1GGBL 3ZHKA 2XZZA 4AIZB 4G6JH 5E8NB 3K4ZA 4H20H 1H5BC 2DM2A 4P2OD 3SCMC 4LKCB 1I8MA 2GTZA 4ZUTA 2OCFD 2IFFH 2UUDH 3CLEH 4LCCC 4IOIA 4HIXH 4S0TD 2VB5A 1D6VL 1JGUH 5CEZE 2OS7A 1EV2E 2Y23A 2DQUL 4NQSA 5T3XE 2E27H 4OCRH 4FQQB 2I60H 3VI3E 2IBGA 3MRNB 5IHUL 2NNAA 1N3NA 4FHBD 1JP5A 5D7LA 5IHZA 4GXVH 3NIFF 1G84A 4HEME 5CSBA 2Q3AA 4ELMB 4E0RA 2QQLL 2OZ4L 1TCMA 3O6ML 3LHPL 3WHE0 1IAIM 3IJHA 3RVWD 4W4OC 3K46A 1MJ8H 1M6OA 4Z0XA 4P2YA 4IS6A 3BIKB 1PYWB 4CMMA 1NEZA 4QEGA 4HUWA 4GAYB 5HHNB 4XCYB 3VFVA 1F02I 3JTTA 3VG0H 3ZKNC 3L3JB 5B39A 3BRGC 1NCBH 2HFEB 3MJ7A 4OCSL 5FFLA 4K94H 3QDGE 2EDWA 5DJXA 4JHAH 1RMFL 3TA3D 1A3RL 3FT2A 1ZHNB 2IALB 4DOHB 2BY0A 1QEWA 2VZUA 1ZTXH 1BFVL 5ESAA 1GGIH 2H2PD 2Z31B 3BZFB 4QTIL 5DS8B 3UJJL 4ELKB 3S9DB 1DQQA 2Z91B 3PHOB 2FX9H 3LSOB 4OZGE 4TSBL 2FB4L 5IFAH 4FXGB 4Q9QH 4RZCB 5BV7C 2N7AA 4N1EA 1CG9A 4Y4KC 3K8KA 2JKXA 3BYTA 4OM1L 3LB6C 1ROWA 3MV7A 3WIHH 3ZKMD 1QFUL 1N8ZB 1GIGH 3IDYB 5DQJB 3TLRA 4AENA 1UZ8A 1U8HA 3ILQD 4XGZB 4TNWK 3REWB 4OFVA 5JW4Q 3ULVC 1EEZA 2HKFL 2BCKB 4K3HA 4Z95L 4L9LC 4MMZC 1AXSB 3MYJA 5CD3A 3F5WA 4MA8L 5LAXB 5DZLA 3IFNL 4OZFA 5FUZL 4YLQT 5DRZA 3E6FB 5D7KD 2ZG2A 1XGYL 3HHRB 2OX5A 5GSVA 1IAKB 4X6FB 35C8L 3IDNB 6FABH 2WUCL 4HH8A 5GS0D 3W9DA 3NACL 3JWDH 1EVUA 2LAAA 3OKKA 3OV6A 1LNUA 1K8DA 2E7BA 3HUJE 4I2XA 5L2KE 1AC0A 4NP4L 5C3TA 3EYUH 4KHXH 2R8SL 3BXNA 3SDAD 4XPAH 4S1SL 1L0XA 1HN1A 1JIBA 1KLGA 4JKWA 3MACH 4CU7A 5E1AB 4OZIF 1FH5H 3R1GH 4YHOH 4JREC 5I8KH 3Q3GB 5DD6A 1DBBL 4J23A 4MYWB 1AGDA 3JV5A 4RMQA 3I6KB 2VLLA 2ZCLH 2IEPA 5I74B 3MRMA 4OZGB 2HFFB 2XA8H 4WW2B 4XXCC 1QBLL 3MCLL 4OLUL 5C09A 5TE4H 1KJ3H 1YEFH 2W0FA 3CLFH 5EBLB 1MI5D 5D7IE 3EO0B 4WTZA 1QSVA 4U0RB 1CGYA 2BSTB 2MCG1 3JWOC 4LEXH 3D9AH 4LLUA 1HXYB 4JPKH 4M5YH 3QUZB 4PD4K 1MF2L 3LPFA 5I15L 3JWNC 5ACZB 4RGMC 4JG0L 1MCPH 2YN3A 4U4BA 2OMNA 2GKIA 3MJ8A 5D2NC 1H3VA 2FHCA 5JIIA 4LIQL 2WBJD 2P1YA 3GMNA 5DD0L 2H2SC 3GBLA 2DMBA 4ETQB 4FQCH 3MLUL 4XPTL 1IEBA 3HE6D 5T1KA 4YDIL 4O2CA 2DLGA 5IVXE 3VW3H 1RULL 2LTQB 3R0NA 2A9NL 3ARBB 2YC1B 2X7LA 3KJ6L 1T83C 5GQBA 4Q6IC 4JFZH 3CDGA 1F6AB 4RGNC 1AHWA 3C2AL 2XTJC 1BD2A 3QT2A 2ATKA 3HUJB 1LE9A 15C8L 1CXIA 3HAEG 1NGPL 2OM5A 5C0AE 1KC5H 1JZ5A 1GAFL 2QR0A 2W0LA 3QIUA 3STZA 3U4BL 3S35H 5TQ2L 1FG9C 4BQ9A 2ZUQB 3ISWA 1J1OL 4KJYA 4YPGA 4KDVA 1P6FA 3EO1B 2DTMH 4U1LB 5F96H 2OP4L 1GZPA 5KOVC 3WEXA 1KN2H 3SKMB 5JOPE 1A6AB 3QQ9C 4NFBA 3B6SA 5CZVH 5F1NA 4UAOC 1YEJL 4NC1E 4LGPB 1UB6B 5D7IB 1ADQA 1PQZB 2BHYA 1OQOA 1EPFA 1RUQH 4XRCB 3T3MF 5F6IB 3LRHA 4LVHC 3QFDA 4HLZH 1JTOA 4QXUH 4ZS7L 5ADPL 5DI8A 5DSCB 4I77H 1KTKE 1AP2B 5T33H 4IOSD 4G6FD 1B0GA 2NTFB 2YR3A 1LE5A 3GFUA 5BRZA 2NXZC 2B0SH 1UQSB 2KDGA 4MS8C 2J2ZA 1D5XA 3BPOC 4WW1B 1FHGA 4XPFH 3JV4B 2HLAA 3MROB 5E00A 4BSWB 4U6TA 1C5DA 3RRQA 3HRZB 1I1FB 1UJ3B 2R9HD 1PX4A 3OB0K 1NFDE 4F7EB 5IVXB 1MHPH 4R3SB 1HOCB 4LVOB 1CI5A 4S1QL 1N7MH 1JWUA 3TZVD 4JZNA 4MCZA 2ZPKL 3WNNA 4MDJA 5DR5H 4UTAH 5B8CA 1T0NA 1VGEH 4OD1L 5CP7B 2OZ4A 3OAUL 2IBZX 1WBXA 3OKNB 3OR7A 1NDGA 3BQUD 4NGHH 2A83A 2IJ0C 1CFVH 5BO1L 2AJVH 3NZ8B 1A9EB 1IAOB 4NRXA 3AY4C 4FQLL 1IGIL 5CGYC 3QWRA 1IGML 3BESR 4JGMA 4NKOB 4JLRB 2UUDK 1A9BB 4ZXBD 3LD8C 2DKSA 4JR9H 3V52L 3G5ZB 4YEFA 2NY4C 3L3IB 4X80L 3CH1A 1F97A 1CFTA 1Q9KA 5CJXA 3P11H 3MRIB 4MD4B 2BVPA 2A6DA 3MOAH 2KUTA 5FYKE 3S34H 1MLCA 1CTOA 4JRYA 4MLIA 3IF1B 1CGSH 2IAMD 5DJDB 4LPUA 4Y16B 1VFAA 3KHOA 3TBSB 3OTTA 4HK3N 1FFQA 5JXEC 1U6AH 4M5ZL 3I02A 4BFIA 4IHOA 3D2UB 2E3VA 12E8H 1T3FA 4TN9A 5D72H 2G9HB 4A6YL 4OV5A 3BO8A 5FAAA 1LMKA 5IG7B 3HA0A 4HKJB 1HHIA 3U7YL 3VD7A 1SYVB 1CFQA 4TSAL 1NFDB 1LWRA 4MQXC 5J0BA 3KS0H 2AKRA 4POZC 3VRLF 4RCAA 4XBEL 1BPVA 1DCLA 3T4AB 5C86A 2VLME 1G9MH 1T66D 4O02L 1AO7D 4PJCE 4MA1C 2BNRA 1YMMA 5FF6A 3SDYL 2F8VA 2GJ6D 1C08B 2J6EH 4M9OA 1TQCB 3WDIA 4HD9A 1MRCH 5DVOA 1DUYB 3RY5A 5JA9A 5ALCH 5CUSL 3FB7B 2D7PA 3MV01 4X7CC 4R96A 3MGOA 3MPCA 4MJIA 1CICD 4NO2A 2DQDH 1XF5B 2C3WA 5FYLE 1MFEH 2AXFB 5C9JA 2VDKH 1FBIL 1Y6NR 2Q8BH 1R5IB 3ZYIA 1MHEB 1Y18A 2UYLA 4OLXH 4DWHA 2DN7A 3FONA 2J8HA 5DMKB 2XZQH 5CKAA 3HC3L 1FN4B 2WM0A 5HVGB 5EIVA 1JHTB 5D5ME 4U1SA 1HIMH 2QADD 1CVRA 3LKPA 1PVHA 4RWYL 3HG1E 3RKPA 3S4SA 3UTOA 2OJZL 3GMPA 1I1AA 1JHLL 3REVA 3JUYA 3W39B 1NMCC 3W11D 1X7QB 2C4FU 3TT3L 3LN9A 1HHGA 4WO4B 4P2CG 4ZOCA 5HYQA 1Y0LA 1RZ7L 4IDJL 5DJ8A 1DP0A 4G43A 3SDDA 3T2NL 4WU5B 1P1ZA 4WHYG 5K93A 1UYWH 4FQIL 5GPRA 1FVDA 5C6TL 1Q0YL 4JFPB 3BWAA 4M7LT 2QTEA 2ILLA 1TQBB 1MJJB 4PJCB 2Q6WA 1UG9A 3HCVB 2YPKA 1A2YA 2ZUXA 3QIWD 4N9GA 1IC4H 4AM0B 2W92A 4NZRH 1E27A 4P0DA 4XMPL 3DSFH 4PGBA 3R06A 1T1XB 4LSVL 3VA6A 1DQTA 2VLRE 5A2LH 5DHYA 3F6IA 1OTTC 3B9KC 5MEOB 2IADB 3RHWF 3QDJA 4ZQKA 3MRFB 1KCVL 3PL6D 3FKUS 3IXTA 2OK0L 3HMWH 2R29L 4DZ8B 1K6QH 2XPGB 1UFUA 4S1RL 4LASL 1CU4H 4HT1L 1TIUA 3MV9A 5IBUB 3FFCA 2XY1A 4HBCL 3UO1L 1N2RA 3CK0L 1MJUH 5ALBL 5BS0E 1BJ8A 1C12B 1YNKL 2I9TB 1FG2A 4OI9A 4ZO6A 3TBVB 2Y6SD 2DQJL 5JIHA 1VFBA 3MSPA 2DQFB 2ZJSL 5SWZB 3ARZA 4GAJH 2ARJQ 3HG1B 2AJSH 1RZKL 3DTXB 1QSZA 4Y7MA 5ADOH 3T3PE 4NQDE 4BFGA 4FQ1H 3MRLA 2RFXB 3GBML 3NCJH 2ITDB 4PP1C 3VG9C 1F13A 3AAZB 1JPST 3GI8H 4CJ0A 5TQ0L 3RJDA 1BQHG 1QSFD 1FVEA 1RU9L 1CFBA 3PP3K 1KIRA 1DBJH 2KL6A 4XXDA 5TDOA 4NKDB 5FGSA 3QIBB 4BH8A 4KAQL 2XICA 4F33A 3HKFA 2BSSB 3HZYA 4V2BA 3SKOA 2YZ8A 2AABL 3HS0A 4JM2F 4YE4H 4L5FL 1T04A 1GZQB 2ESVD 3L3HA 4GS7B 3O6LL 5I8OH 4CMHC 2VLRB 3K81A 2VZ3A 4XAKD 1LP9A 2HT4C 4X6DB 3HPLB 4Y2DB 5FUCE 2BOCB 2IPTL 25C8H 4YFDB 4G3YL 4BK5A 5CEZL 1FCCA 1NGXA 4N0FA 5T3XL 1GOHA 3WFHB 4J4PC 4NQCE 5CP3A 5BS0B 1NAKH 5CJ5A 4IRJA 5DJCB 5FB8A 2NX5A 4RAUA 3BH8A 1RURH 2PW1A 3QO1A 1A5FL 1TJHH 2FJFB 5J13B 2FIKA 4M6AA 3FOLA 4NQDB 3KLSA 1CDIA 3L9RB 3DX6A 2DQTH 4OF6A 3Q5OA 1F3JA 4ZMAT 1TCRB 1RZ8B 4RX4D 2IMNA 2PXYD 4L3ED 2O5ZL 4X5WB 4UIMB 3OKEB 3TN0A 4MAUH 2XACC 1HI6A 4M6OH 1CK0L 1LEGB 4PJ8C 3RZCC 4ZD3H 4P23C 1A3LL 1A1MA 4X6BA 1IM9A 3O3DB 2LU4A 4I18C 2X1WL 2EE2A 1MI5E 4L29A 5KVEH 1CXHA 5KSAB 3T0EB 1ITCA 5L6YH 2A6IB 2J8UB 4JO3H 2VDNL 4NN5C 5SV4A 4A6YA 3VFTB 4NJ9H 4HFUH 5TE7L 4UT6H 5LCVH 1JZ6A 2DYPD 1AD9B 3S98A 3DUSB 1OAQL 5FOBA 3P9LA 4WV1B 5GRVL 4FZ8H 4KQ3L 5HHMD 3ZYJA 3ZTJH 4YBQC 1A6TB 5CP3H 2BOBB 4JVUA 3I75B 4PLNC 2FGZA 4LSSH 3MXVL 4DVBA 2NR6C 4XP4L 1MSPA 4J3TA 1HHHA 2F53D 4EN3A 3AC0A 3O45B 4I9WE 4DCQB 4OLEA 4Z76A 4JDVA 4PBVC 4DEPB 1YY8B 4UNTA 4NPYB 5GHWL 5IVZA 5FGRA 2V2WB 3RWDA 4NQCB 1QRND 3VWJC 3CZFB 4MJ5A 1TVHB 2CDFA 5EWIL 3RI5F 1FIGL 1KFAH 2F58L 2A6KA 4HKBB 5DEFB 1H15B 3O2DL 4OCLC 2PCPA 3HMXL 1YPZF 1KLUA 4NQTA 4OD3L 2J7LA 3UBXA 2YD7A 4PJ9C 2YSSA 4NYLB 1BVZA 1CD1B 1DVFC 5DA4A 5HPOA 3ULUH 4NN7B 2F74A 3FCTB 1NFKA 2HJLB 4JCMA 4ZAKB 4MNGA 4WCYL 1HINL 2APVA 4Z7UE 5E8EB 3FT3B 1AGFB 5I0ZA 5IFJA 1FFPB 4JB9L 3PQYE 4ZTPH 2E7MA 1MI5B 5D1XB 1FAIH 3NFNB 2UWEF 4O2FB 1BOGB 4MDIA 1AGEA 2AGJL 3V0VB 3MBEA 1P4BH 4GRMB 1XEDA 4XNXL 3P9MA 3MREB 1T21A 3O9WD 1T7XA 4WEBH 3DYMA 1GGYA 2FEDD 4ZS6C 5DVNA 4PLJC 4TULL 5FK9B 1WAAA 5IT2H 4KJQC 4PJHE 3BN9D 1BIIB 2Z4QB 4NBZB 4OZHF 3D5OF 1JGEB 3RWFB 4JFFD 3KYMA 3C08H 3HZKA 5CLTA 3DOSA 1DL7L 5E6IC 3WFEL 1JNLL 5MERB 3SJVD 3ZE0F 4X4XB 5IF0B 3LIZH 5D7SH 1FYTE 2F8XC 5GGVL 4Y1AA 5CAYB 4R97B 3BAEL 3UTTA 4PY8I 2CRMA 5DC0A 1XF3B 1ZMYA 4PJFA 5E8NA 3UPRB 4O2EA 3BUYB 5IB5B 4LKCA 3O3AB 4ERSL 5EO1B 3TBYA 2VXUH 3IDGB 4OCMC 4D0BA 2HKHL 3C9NB 2DIBA 5FYJD 3P9WB 2D7QA 4MJ6A 1DQJB 2OXGA 1G7HB 3KLHC 1T22B 3EOYG 2XFXA 3WJLC 3QHFH 4EIGB 3MRNA 2BVYA 3QZWB 4K7PY 3ZE2E 4NQXA 1EFXD 4OQTH 1VEPA 3RWHA 2G75A 4P5TA 5F7WC 1OY3B 3NAAL 3PQYB 1NGWA 2WIIB 1CGXA 1OSZA 4CVXA 2SEBB 3CFEA 4YX2L 4OCXL 4BZYA 4DGIH 1IAII 5SWSD 1NCCL 4WENB 3THMH 4KH2A 4WJ5A 4Y4FC 1OD7A 4KROC 4DUXA 1QYGL 5GS1B 1YQ2A 4XI5C 1W0YT 1DANU 4Z0BL 3UMTA 1GC1C 1R3KB 5HD8D 4HFWB 4PJHB 1PD6A 2NY7H 1QACA 1YECH 4KMLB 3P30H 4NQVA 4P59H 3RBGA 1UWGL 4XTRD 1R3HA 4XHJC 2PTVA 4NZDA 3AB0B 3U0TA 5IGXH 1OP9A 2NY3D 1KJVB 4PP2A 3WV0A 2A38A 1FYTB 1IC1A 5E56A 1MIML 2EYRB 1FRGL 2NXYC 3RWGB 3KDMA 5DLMH 4KJPD 3G6AA 1D5ZA 4N8VG 3Q6GH 3S36L 1HNFA 3PHOA 3H42L 5IFAL 1AO7E 3VFWB 2CD0A 1G7LA 5E0QA 2GJ6E 1AJ7H 3ETBF 1NUGA 2V2TB 3LDBC 4D9RE 1NC2B 1HHJA 4X6CF 1XH3A 3GSQB 3MLWH 3WLWC 2WINB 3VXSE 4RBPH 1M71A 5FGCB 5CMAA 3TO4A 1OB1B 4UQ3A 3VXRD 4NRZB 3U79A 2JJWA 4D0CA 5L88L 1A7RL 1B0WA 4EI5D 2RB8A 1JYXA 4BZ1H 2AP2A 4FQPA 4QRRD 5HGAA 1AR1C 2PTUA 2X4PB 2IAMB 3QP3A 3VXTA 1SVZA 4I0PA 4Q9BA 1CE1H 3GMOB 2GEEA 4L4TA 4R4FH 4PJXF 1L7TH 5IWLA 3RDTB 1F58H 2GT9B 1TZHA 1U3HC 5DMIL 3BZEA 3CD4A 4EVNA 4XB7A 1K5NB 1CFSA 4ZSOE 4BZ2H 1FFRA 3ECBA 1FLRL 4JPIA 3WO4B 5GRJL 1KPUB 3DMMA 3WKML 4XWGL 4N0YH 1E4KA 4Y88A 5ECJE 3BHBB 4EDWL 5FYKL 3QDGA 4XCEB 4WWKB 5JW4R 5E1AA 1IGTA 4Q9RL 2Q76B 1JZ3A 3Q3GA 3W81A 1IL1B 1U8JB 1KXQE 2I9LA 3SDCA 3BGMA 2HFFA 2NMSA 3P0YL 1QQDB 2XA8L 4U7MA 1KIUA 3MRJB 5C0RL 4HV8A 2HJFA 1JV5A 5D8JL 3QRGL 4FQHA 3TJEH 3VXSB 3TVMA 4M7JH 4R0LA 4JPKL 2V5MA 1VGKA 1YEKL 1IT9L 4E41E 4TYUA 4P2RA 1CDGA 2F15A 5L0QC 4LLVA 2FL5B 4AEEA 3HMXA 1EAPA 1OGTA 5KANG 3LEVL 4WIQA 3NPSB 2A74A 2FWOB 1FYHB 5GGRB 1SY6H 4QXGL 5AZEL 5I16A 4FQ2L 4D3CL 2X4SB 1R5WB 1ZA6A 3CX5J 4C59B 2OYPA 2DQHH 3ARBA 3ARGA 3IRPX 5B38A 1JGDB 5GRWA 1A0QL 4WVRA 4AG4H 5ISZD 5T5FH 1SEQL 4RISH 5AYUL 4FTVA 5JTWA 4AEHH 3FN3A 1YC8A 5FYLL 3SO5A 5A43C 5IIEB 2VQTA 5GGSA 5L2KA 5C08B 2HN7B 3KNBB 5C2BH 4JZJB 4LKXA 1X5XA 3GSUA 3C8KA 5DC4B 3QUYA 4GRLC 4KJWC 2RCSH 4YGVB 1QLFB 4HKZA 5TF1L 1I4FB 3BH9B 5KAQG 3HI1A 2DTML 4JFED 3MQIA 4LDLB 2NY1B 1T6VN 2CLVA 5IQ7L 2BZDA 1KBGH 3OJDA 4PYGA 4R4NC 1VA9A 1U92A 4LL9A 4PB9L 5F89B 1U36A 2OJEA 4HMDA 5J12C 3AROA 2ESVE 2K7PA 1PQZA 2FJGA 1WBZB 4R7NA 4I3SL 4Y5YA 2VDPH 2P5EE 3MUHL 4J3VA 2ZCKL 5KVFL 4XAKE 5KTEL 5AEAA 4OLVH 1DTUA 4I77L 5DSCA 1EHLH 1AP2A 4E41B 4JM2D 1F45A 1CQYA 1PJ9A 3BKYH 3KPOA 3ZMRA 1LO5B 1UQSA 4XNQA 3C6SB 1YEIL 4WW1A 3A67H 5IB4A 5MEPA 4IMLB 4LRNL 4HWUA 2O26U 4CN4A 3IFLH 3MROA 3QHTC 4LCIH 4QLRA 1ND0B 1H8OA 3HRZA 4QHNA 1NC4D 2RQ8A 5CBAB 5F7DB 1F3RB 4F7EA 5IVXA 5T1DH 4GBXC 2EDYA 1DEEA 4MCYA 1N7ML 1O0VA 2V2XB 5DJ2A 5CBEA 4PRAA 5LJYH 4L3EE 1ZHBA 5CP7A 3KPRD 3H9SA 5DUML 3C60C 4JAMB 4S2SA 4YC2B 1JWSB 1KEML 1T1ZB 2JB5L 4HUNB 4PB0H 5C0AA 2IBBA 1R3IH 2W1NA 4APQD 1L0QA 4JVPA 2F5BL 2R1WB 4UBDD 4NKOA 5BOPA 2DIAA 1A9BA 4Y5VB 3PXHA 4K3DH 3ARVA 4U1MB 1V8HA 5F8RC 3VU2A 4OZIE 2GK2A 4EOWL 1C5CL 1IBGH 2AXGB 4FXLA 4EBQL 4EDXA 3OKLB 4M43H 1FPTH 5DRWA 4JQIL 3TP4A 3MLSL 4MWFB 1BWMA 1Z0NA 4PRNB 2GJJA 4RNRB 2G2RB 2Q20A 1HEZA 1RZIA 2GK0A 1L6ZA 1U8QA 3RTQB 4TRPL 3RNKB 5HHME 5DJDA 1QSED 3O4OC 2P5EB 4P3DB 4O4YH 1MY7A 3C5SA 1CIUA 2NW3B 2WNGA 3PP4H 1N4XH 3S96B 4LCWA 3PWNB 2VABB 2CLRB 4OSUH 2P5WE 2FHFA 4XH2A 1JGVH 2AK4A 4N8PA 3N9GH 1MIEL 1RI8A 1DDHA 3DGGA 2Z92B 2NYYD 3UTZB 4HIJA 4Q2ZB 5TDNA 1ETZB 4HDIB 3HZVB 1YY9C 3G08A 4NBYB 1ONQA 1YN7A 1SYVA 5KG9A 1X5HA 4JFOA 1W0WB 4GMTH 3D85B 5BMFH 4H1LG 4XNMB 2JIXA 4KQ4L 4XP9L 4MXQC 5D1QC 1D9KB 1F5WA 4QYOB 1I3GH 3VA2C 3ARXA 4QTHA 1A6WH 1RFDL 5A3IC 4TUKL 3EFDH 1P7QB 5GS0L 3EIFA 1GHFH 3LQAL 1P2CA 4K94C 4I4WA 4YO0B 4OZIB 2DQDL 3QXAB 1PG7X 1MJ7H 4ODVL 2FBJH 1I7UA 2XQYK 2YRLA 4LU5H 3E1F1 5JW3H 1QHOA 3QUML 4B5EA 1UA6L 2OTUB 5F9WC 3M17B 1CGTA 2YKLL 2BXZA 2VLJB 5H8DA 1FZKA 3KPSE 3RP1A 5ACLA 4BQ8A 3HNTL 3L5WB 4DZBA 2IPUK 4PV8B 2P5WB 4UDTB 5C0DB 5D71H 4JFFE 3DBXA 2PETA 5JW4M 4HJ0C 3F65A 5KSUB 2P7TB 5ITFB 1J8KA 1AD0B 2V9RA 3QNZA 1JYWA 3CFJB 1S7SA 4FQXB 1N5YL 3SDXF 3GSVA 4ZFZB 2ERJC 4P5KB 1ZGLP 3QEGH 5ILTL 2AQ1A 3C6LB 3U0PA 4C54A 3U2SA 5C0BE 2HFTA 4XCCH 4XVJL 2MHAA 2VIRB 4X9FA 4LPCA 4F57L 2VXTH 2AS5M 1KB9J 3BKMH 4IIQB 3U36A 3SOBH 1RUKL 5FYJE 1EO5A 4PGCB 2CSPA 4PJCA 2CGRH 1HYSC 3FFDB 3O8XD 1G7QA 3CX5K 4RIRA 4DAGL 4K3EL 5GRUH 3JWDC 2VZTA 3BZ4A 3FO2B 3LRGA 4XPBL 5CZXC 1T1XA 3NH7H 4K9EL 3CCHA 1J05A 2IADA 2IGFH 3EOAA 3UYRL 5MP6H 4MD5A 5SWSE 4MXVE 3D39D 4JRXE 4R26H 3T09A 1ZVYA 3S3PA 5HYSB 1NGQH 4O5LL 3QUXD 2ADFL 4JN2B 4U6HB 1B4JH 1BEYH 2VL5A 3T0VA 1A02N 3KPSB 4OFYA 4EQ3A 5I18L 5I1EH 3OKDA 4CW1A 5D5MA 4GAJL 3QQNA 1ULVA 5C70A 5SV3A 3EZJB 3HE7A 5CEXB 1QNZH 5LBSH 3WMSA 1UXSB 3EDJA 1FDLL 4JO1H 4OTXL 3TYFB 4M1CD 1LD9A 3P0VH 4K23H 1F4YH 3AAZA 1B2WH 4LAJH 1EXUA 5H37H 5CD5D 4NO5B 2NY6B 1D6EB 3VXPB 2X41A 1MWAB 5C0BB 5I17A 2FNBA 3C2SA 4P2OA 1OGAE 3QIBA 2HRPL 5D2LA 1ZT4A 2DL9A 3PWJA 2CKBB 2EH7L 2CO6B 3P73A 5DEGB 4HUMB 1W2KT 2HT3C 2E9IA 3EJJX 3KPTA 3OBAA 4XPHH 3VRLE 1WEJL 1BECA 2DQIL 3L5XH 1RZFH 2BNUA 1AR2A 3M8OL 2HG5A 1GZQA 3DURA 4P2QD 1DANT 4UDUA 2FGWH 4L3AA 5DURB 5GZND 3RWCB 2DI7A 2VLRA 3BN3B 2FD6L 5T5NG 1I1YB 1TJGL 4KPHL 1WTGT 1OAUL 3FOMA 4UZGA 4M6MH 4L3CA 2EO1A 3V4UH 4JFXA 4JRXB 5JLZA 3IFOA 1BOYA 1AGCA 4ODHL 5DDHB 2VRAA 2JELL 1CDCA 1BFTA 5EOTA 1OCWH 4M03A 5E8OA 1A14H 1UB5B 1JWMB 2WIMA 5E99L 2IH1A 4LSPH 2V9TA 1Q9LA 2ZOKA 5FHAH 5HHXL 2CKNA 2DWDA 3LOWA 5K9JH 3TYGH 5I1KH 4HH9B 4G8FB 1QBMH 4X98A 3IFPA 2FJFA 1T2QL 3RWIA 2GAZB 3GMMB 1X6NA 3TA3A 1EBPA 1KLFA 1K4CB 3DO3A 1JJUA 3G5YB 5C0EA 3OZ9L 3NABH 1DQML 3QFJD 3U4EA 5TF0A 2X70B 1RUMH 3F7YB 1JRHI 4U2ZA 2R0LL 5KS9F 4FS0A 1DUZA 5I76B 1UM5L 3IS1X 3KYKH 1OGAB 4YK4B 1NAMA 3O3DA 1I8IB 4OB5H 4TVPH 4HS3A 3NBNA 5D7JB 2E8ZA 4HWEH 3UPCA 4B53A 1KJMA 2FRGP 3RNQA 3P2TA 1U58A 3H3PL 3NMEA 3IKCB 1ZEAL 3MNVA 3QIUC 1C5BH 1QVOA 5GIRB 5BXFA 2VXSL 5IKCB 2AJYH 5C0JA 3DV4A 1LDPH 5EC1A 3A6CH 3DUSA 1BFSA 43CAB 4Z5RA 2EE9A 4B7LA 4N0RA 1EVTC 4TUJA 4HK0B 5CEYA 1Z0MA 2R0ZH 3B3IA 5I1CL 3ZYOA 4X6EA 3I6GB 3EOBA 1UXWA 4PJIE 3L3KB 4DK3A 3S37X 2E5EA 4C58B 1YN6B 3HPJB 3GMRA 4DJMA 4NPYA 4FFWC 2W0PA 4WUUD 2H3NB 4LLDB 2R0KL 3QG6A 4XBGB 2XWTA 3NZHH 3MGTA 5GJTH 5I19H 4N0UE 3G6JE 1S7XA 5F7HA 3HNSL 2QSTA 1EHAA 1R5VB 4LSUL 4HS8H 5EBWB 1BGXH 1UM4H 4I3RL 1BX2B 3V6ZB 5B21A 3QCVH 1NAMH 5DVLA 2XZAH 1G1YA 3QUMA 5HHQA 1A7PL 3PV7A 5JORB 5I1GH 3EFFA 4JFEE 3QXDB 4C57C 4OLZH 3BE1H 5DK3A 3HI5L 4KTDH 3NFPB 4X7SL 4PRDB 2ED7A 2AAVA 5EUKA 1OARL 2X40A 4DGVH 1FNEB 4OLYL 4UINH 4PRHB 1MI5A 1U8PA 4F58L 5DWUH 1WFNA 4FFVC 4H25B 4NZTL 3FTGB 3P4OB 3VFSB 3DIFB 2PO6D 4GAGL 5MEND 3WN5B 4KRLB 4WHYH 4UOW0 5C3LD 1IFHH 2XZCL 2DD8L 4MA7H 3H9HB 4HXBL 4TTDD 1KB9K 3WXWL 3E6HA 3SE4A 4NQED 5FK9A 5FA4A 1MOEA 1X5GA 5ENWA 5CJXC 2FX7H 1CXEA 2WBJA 4C4KT 2MPAL 3MR9A 4MAYD 5F9DC 1OTUC 5HYIA 4Y4HB 4PJIB 5EC2B 3E8UH 4KKCD 3ARSA 4NCDA 3TESA 3EYVA 3NCBB 5AWNH 4FN0A 4X4XA 3VGAB 5AG9A 2H41A 1IEAA 2ICWB 1EA9C 3NIDF 4YNYB 4L8BA 4HK3J 3RGVB 5DRXB 3HAEB 1YEEL 1XF3A 4Z7WA 3G6JB 3VFMA 5T1LD 2ENYA 2G5BA 4QOKD 2YBRA 2CMRL 3ULSB 4ZUUB 4XNYL 4MD0A 2C3XA 3O3EA 1E4JA 4J3WA 3HNVL 1KT2B 1ZS8A 1DQJA 2IH3B 3UJIH 1T22A 3WDJA 1X3DA 3EGSA 2ZUUA 5EZLB 4Z7UA 3PABA 4G8GB 3EOTH 3EUUA 4PJGF 1NBYB 3L7FB 2H6PB 4OQTL 5DMGD 3PGFH 3FRPA 1CL7H 4NM8H 5IJVB 5DF0A 2BDNH 2SEBA 4G9FE 3SGDI 2HT2C 3QAZB 1F4WH 4DQOL 4O00A 1EJOH 4P4KB 3PV6A 1IEHA 5IQ9B 3M45A 4ODWA 1Y6KR 3B2VL 4AY0A 4XP6L 4NM4H 3WXVL 5CHNA 5I8CA 2DI8A 1CXFA 5DJYA 1S9WB 4BUHA 1R3KA 5DJ6A 5ICYA 3RKDC 3B9DA 2J3SA 3VH8A 1MCEA 1U0QA 4RQQA 5DFTA 1ORSB 4UT7H 2UZXB 3NA9L 4YHZL 1EZVY 3VGFA 3ZTNH 2CDGB 3DRQA 4Q0XL 3TZVA 2B4CL 4DTGL 1S78D 4OCWH 1YJDH 3VRIB 3Q6GL 3HC4H 1I1AC 2OR8A 3QG7H 1PEZA 5T5NF 3K0WA 4OM0L 3WFCH 1MLBB 1ZE3C 1RK0B 3X11B 1VEMA 3FQTB 5ID1B 2YWZA 3AXLB 3OMZA 5FGBA 4GUPA 3ARDB 3LEYH 4P46D 2V2TA 2FX8H 1NC2A 1TFHA 3CFDB 1J10A 3T1FB 5A16A 2E9JA 1R6VA 4UI2A 1SJEA 5JZ7C 1YPZE 4ZXBA 1NCDH 3SDDC 1RJYB 1HSBB 4OT1L 5HHVH 2YUWA 4PGDA 3G5XB 3V8OA 1FO0H 2UZIL 1U8NB 3KXFE 3VDCA 1S9VA 5F70A 2ATPB 2HTKD 2YHGA 2ZSVB 4GLRI 1NGZA 3GBNL 4BZ1L 4JANA 5CJ8A 1S7UA 3HFML 5ICZA 2VZSA 4G9FB 2GITB 2ED9A 2X9WA 2IAMA 3VMOA 3WFDH 3P0GB 4Z78B 2XRAH 4RWHA 5EZOH 2UWEE 5E24E 4QCIB 1AQDB 3WNPA 2BVTA 4A2MA 2Q87A 3FB6B 4UOW1 4IBLT 5IW3A 1E6JL 3QA3B 5E4EC 2F9BT 4KKLD 3CVIH 3EAKA 4RAVA 3QJHA 3TPUB 3I2CH 3B9EA 3DV6B 5I8EA 1XGRB 3O41A 5BVJB 2A73A 4OZHE 2IANE 3BMVA 1KTRL 5LXGL 3QI9C 1QRKA 1YQVH 2ADJB 1A1OB 3TBWA 1MVUB 5I1IH 3ZE0E 4HPYL 3GHBH 5DZNA 2XQBH 4S11A 2D7TL 4YXLL 3PHSA 3U7WH 2OL3A 2QSQA 3NTCL 3ROOB 1AO7A 1QQDA 1QLEL 3UP1A 4MS8D 1B6DA 1JPFB 2CJUL 2GJ6A 3GSXB 3VWKB 2EDNA 1QFWI 4OGYL 3V5HB 1KPRB 4PGZA 1MFCH 3NCYS 4XVSH 3O2VH 3MJGX 4E5XB 4GAFB 4QHMA 1T7ZA 3VXSA 1YPZB 1DN2A 1PEWA 1BD2D 3Q1SL 4NHUA 1U91B 4WFED 3C5JA 5B4MC 1CICA 4JFYA 3INUH 3BEWA 3MLZL 5J1TC 4M00A 2QKIA 1E28B 3KXFB 4NWUL 1F6FB 4OUUA 5CWSA 4FP8L 3U46B 3V0WH 4L8SA 2FL5A 4RRPA 3NOIA 2UY6A 1FE8L 3EKCA 3ARYA 3KR3L 4NWTH 4CAGA 2X44D 1Z9MA 4DUWA 3O11B 3L95A 4WRLA 3OR6A 2UWEB 2DLEA 3MNWA 3E3QC 2YN5A 1QD0A 2NY5L 4LF3B 2YD9A 3IDIB 1W72L 2KPNA 3LV3B 1UCBH 3TBTA 3PJSA 4IRSD 5FCUL 1IAIL 4ZSOA 3C8DA 3MFGB 1NLBL 4EZMA 3VE0B 5DQ9A 3HZMA 2HN7A 2OL3H 4M48L 4JZJA 5IEHB 2DQEH 4J12A 1MH5A 1PKQE 4OZHB 5KSVA 2IANB 1WZKA 1DSFL 2V7HB 1KULA 5DK0A 4OZ4A 4YDVB 2X4RB 4GSDH 2ITCA 1T7VA 2VQ1B 1ZVSB 3RVUC 3L6FB 4P9HH 5BV7H 3PWUB 4M8QB 1CD9B 3FO9B 4ZUSB 3QIWA 1F4HA 4FNLH 1T0MA 2QHRH 3F58H 3K2MC 3QXTA 3S37L 3TN0C 3I50H 4RSVA 4DVRH 3T2OA 3RVVD 3ZT5A 1U8LB 4X6CE 1MWAL 2GSIA 3GIZH 3PL6A 3IU4H 4POYA 5HDQH 3ULUC 1BVLA 3ULVH 2YOCA 4FG6C 4Y5XB 2HAZA 2GJZA 4NNXB 4G9DA 4ELMF 3PIQB 4LRIA 1A7QH 2LU7A 2CKBL 4O9HH 1K8IB 4QRUB 1QPPA 4XCFL 1U3ZA 3BT2H 3H0TB 1LO5A 3QWOA 5FYJL 4NN6C 1BVKA 4IMLA 2DJ4A 5GGTL 2XKNB 3OGCA 3T0XA 3C09B 2AEQL 5CIPA 3BP4B 5CBAA 3U9UA 3RL2A 5J06A 1T6WA 5JNYB 3MLRH 3SE8L 1X5KA 3LZFL 4R6UA 5EORH 4PJXE 2FZ3A 4N8CL 4WGWB 5AD0B 2IQ9L 1G0DA 1BQHB 3JVGA 1A21A 3L3DB 4NOFA 2GSGA 3GSNB 1JWSA 3QISA 4PB0L 1PKQB 2VE6B 1QSFA 3GSOA 4WFGD 3SQOH 5IB3B 1KNOB 1NMBH 4KMTH 2LV4A 2X4UA 3RY6A 2WK2A 5KSBE 3QBTB 2AJZA 1MNUH 4LHUD 5E2UH 3X3GH 1S5IL 1YDPB 2ICES 2YPVL 3CU7A 4NKIL 1IBGL 5HDBF 1OAYH 4ZDHA 5CJOL 5I9QB 1FL6A 1NQBA 2P8MB 4N5EC 1X5FA 2VNCA 4MWFA 5D9SB 3JWOH 3DGCR 2H32H 1GJIA 4RNRA 2ESVA 1PG7H 5CJQL 3QQ3B 2I07A 4YXHL 3VI3F 1ZT1A 1FZMB 2P5EA 1IGYA 3GI9L 4X6CB 3TGXA 4XC3H 4PLKD 2CLRA 1NEZG 4G5ZH 3VFOB 4IRZL 3MOBL 1I9IL 1P9MA 1JGVL 3B43A 3MBEC 3MRGA 1S7RA 5L8KB 5EU5A 5K33A 4MHHI 5GRYA 2WUBL 5L7XL 4NO0B 4C83A 5C0CD 4P57A 5DHXB 1KG0B 1NANI 1J86A 4KI5C 2VDOH 4MJID 4OF7A 4HDIA 5DD5L 3RJQB 1KCRH 4HWZB 4BKLA 1WC7B 3SY0A 3B8SA 2W38A 3VXQA 1NBZB 5I1LB 1XGUB 2OR9H 1FO0B 3GMLA 4PJDA 3RA7L 2X1PA 1LK3H 4U1GC 2ZCHH 3CPLA 4RX4A 1ZHKB 4L3EA 2PXYA 4LLQB 3OKMB 1ZK9A 4UILL 5C92A 1JZ2A 1S7TB 5TPWH 5IBTL 3EYQC 2HVJA 3DJ9A 5KSBB 3FN0H 4HGWB 3ARFB 5HYJD 5I1HH 3TCXA 4OZGF 1S7WB 3KJ4C 4OZIA 4QRQA 4WW2F 3ARUA 4QXTA 3IJSA 1A64A 3MZGB 2XTLA 3MCKB 2VZ1A 5EB9A 3CSPA 1EMTL 3OXRB 4HHAB 1G7MA 1GOGA 1XIWD 2DYPA 5E2JA 3M07A 2C1PA 2OTUA 2MSPA 3M17A 5TDPA 4GMSH 1T1WA 3FRUB 3O6FD 2IQAA 1ZGLB 1H5BB 3D0LA 4P5TC 3SCMB 5IESH 3O3BB 3UTSD 4UDTA 5D71L 2L4OA 3WUWA 3GUTB 4LCCB 4X4ME 4W81A 4YHLH 5GGRY 4HGMA 4JFQA 2ARWA 1Q94B 2F53A 4J1UA 3OKYA 3MA7A 4HCRH 2QLVB 4ZFZA 3WFBL 1HWGB 1R3LA 5EU4B 1MELA 4Z77B 1XR8A 1MAJA 2AV1B 5KBNC 1YNLL 3QEUA 3P40A 3PGDA 5JPNB 3IDXH 4KRPC 4QHUA 1WCBB 3MX0A 3SN6N 1RVFH 1VSCA 4WI7A 1NSNH 1YYLH 1XCTA 3BKML 5F72S 4IIQA 1IQDB 4JFDB 1UWEH 3EYOB 2LVCA 4GW4B 5IFHH 1II4E 4PGCA 3GB7B 3DYPA 4HGKC 1D7FA 2YEZB 4ZUVA 3HB3D 3CVHL 3FFDA 1PSKH 5ACMA 1AKJB 2YRZA 3JSSA 1CT8B 3PWPE 1JGLH 2NY0C 1JNHB 4JKLA 3FO2A 1U95A 2R69L 2I24N 5A2JH 5E8DH 1QZ1A 1SYSB 1JPTL 3QQ4B 4ZTOH 1MRFH 3VXUE 1HSAA 1F8TL 3RAJH 4CDGC 1W72A 3VFNB 32C2A 3H6JA 5GRXG 3O4LD 1NGYB 2VUYA 1R0AH 1PAMA 3WDHA 4Y8DC 3O9WA 1A6VH 4YXKL 1R3JA 3GGWB 4Q97A 3F7VA 4U6HA 3TO4C 1QO3A 2VXQL 2YMXH 4HUUA 3MYZA 2CXKA 2VMFA 5JOFB 4HWBL 1TTUA 4Z7VE 4JHBA 4ZFFB 3LKQB 5BV7B 5FO9B 3WL9B 3MO1B 4JFFA 5F9OL 3BW9A 5CEXA 2NY2D 1U8MA 4Y4KB 1RJLB 4TOYH 4I0PC 3SJVA 4KUZH 4HPOH 3T2PA 3TYFA 2C1OB 1F4YL 5IWLC 2P42B 3ZDXF 2O5XL 4HLJA 1D6EA 4GG6F 1HH6B 1OAXH 2AV7B 4ZFOB 5C0IB 1S8DA 1MWAA 3QUKB 2JCCA 4J6RH 1GGCL 4HJGB 3C5ZD 1CF8H 2JK5B 3DMMC 3KWWB 4L9LB 4LSQH 5HSFA 1E4KC 4Q9CA 1FORH 2D9QB 3VD9A 3RIAK 3O2WH 3DRTB 4IRJD 3IXAB 2I26N 1MAMH 2HP4A 1P5VA 4G80A 5GISH 3PWPB 2FGWL 2DBLH 5F3HA 1LEIB 4YHIB 3VWJD 1EFXA 5T3ZH 4PY8J 3SDCC 4R4BB 3VFPB 3VXUB 2EIEA 2R2BA 2XN9B 3NCMA 2X6MA 5SWSA 1J12A 4JY5L 4NHCH 3GNML 1E4WL 4K7FB 3GMQA 4LNVA 3TIEA 2DM4A 3B8YA 3T65B 3TVMC 4H26B 2LFGA 4PJEB 4YDKH 4R0LC 4S0SD 4JREB 3LRSB 1NLDH 3KYOB 5I1AB 4PTTB 4CDHA 3D25B 2FO4B 5FA3B 5CCKH 4KVCL 5J1AB 4Z7VB 1I3RB 5I1KL 1OW0A 1QBML 1ACZA 2NPLX 4MQSB 4DN3L 3L7EB 4ISVB 2Y36H 5BW7A 3AS1A 4FMKA 4HIHA 4R2GD 1C7SA 1KCSH 1FZJB 2H32B 5CSGA 1DE4A 1K4CA 3QH3B 4N8VB 4QRPD 2AEPH 4JDTL 1DQLL 1RUML 1NFDF 2X70A 3ARGC 4RGMB 1MPAL 3WO3B 4J3OC 4HUXB 4NJAL 3SDXE 1JNJA 5D2NB 3MLXH 5I76A 5I66B 2Q8AL 2C7UB 3P4NA 5E08H 4JN1L 3X3FL 1IGJB 2OSLB 1Q0XH 4NRYB 4MNHB 4NUGH 4LPXA 1DQDL 4WDIA 3VDBA 1W8NA 5E2TL 3BJLA 3QUYC 1BZ9A 5HJ3A 3D0VB 4WFEE 1NEUA 1I9RH 1Z9SA 2EIBA 2QQKH 5BQ7B 3WIFB 3VXRA 3K4AA 2A9ML 4Q6IB 5K9KB 4JDZB 3CSYB 3CU1A 3KLAB 4GG8A 3OG6B 2XTJB 3CMOL 4HSQA 3BKJH 1QFHA 2J88L 4EI5A 3NGBC 2DQGH 2J1KA 3IVKA 4QRRA 3Q6FA 4I48B 2UVFA 5GXBB 1FIEA 1F3DH 2A77H 1S5HB 3SO3C 1KELH 5JR1L 3DVGB 4Y5YC 3HPJA 5EZJA 4XP5L 3G6DL 4WHTB 4HXAL 1T4KA 3ARED 3H3KA 2BY3A 4ORGB 4KXZH 4NKMB 3DXAE 4K3GA 1SBSH 3EYFB 1VESA 5E2WH 4UQ2A 4NNPL 1YEHH 4LFHG 1AXIB 3MRBB 4X0KB 2GHWB 5I30L 4KK6D 4UAOB 4XVTH 1XAUA 1PLGL 4AMKH 4MSWA 1FL5A 1FVCB 5F1IA 4GQPH 3ESVF 4LVHB 4ONHA 2P8PB 2B1HH 1QR1B 3W0WE 4LVOC 4LCUB 2ZUSA 2HWZH 5F9AC 1JF5A 4OJFL 4GKSA 5HPMA 3BE1L 3CC5A 4PJAB 2ZNXA 2NXZB 4U1KB 5D1ZD 3VJ6A 3TH2T 3BPOB 1VPOH 3B5TA 1KB5B 4FXKB 3TJHD 1BBJA 1SJXA 3PWLA 3FB5A 2Y07H 1A7OH 3P4OA 4M7KL 3QDME 4TUOB 1MCOL 1MVFA 4LLAA 2RGSA 4WY7H 3K8MA 1RUPH 2VITB 5IK3B 1DLFL 1KN4H 3NFSL 3L1OL 4MXWH 4EUPA 3VDAA 4X5XB 4O58H 1N6QL 5HGDB 1MREL 2CH8A 3CVHA 2YK1L 3F6LA 4OIIL 3LD8B 5DFVC 4ONFH 2VZOA 3MFFA 1EGJH 2XNAB 3OF6D 5EIQA 2NY4B 1W0VA 1T5XB 3AUVA 4XT1C 3DXAB 5ISZA 4N0UA 1D3CA 1N0XH 1JNNL 2R2HB 4H0HB 2HMID 3P4MA 3X14B 3RVTD 2P8LA 5BVPH 1K4DB 1Z5LB 5EOQH 4I1NB 4J3XA 5EUOF 5BZWB 1KEGL 4MNQE 2R0WH 3B2UC 3ZKXC 1E6OH 4HQQH 3QEQB 3LVEA 3W0WB 1HZHL 3OAYK 1O5DT 4JFEA 4XMKH 5FYJU 1HQ4B 3LS4L 5KVDH 4OI8A 4HWBA 2VDQH 1NBYA 1JN6B 2DDQH 5EU6E 4XZUA 2QL1A 3BKCH 4UIKL 2HVKA 3HC0B 4G6KH 2H1PL 3AVEA 1LDSA 5KS9E 4K8RC 5F7EL 2Z31D 4NC0B 5FO8A 3ZHLA 2COQA 1DN0B 3QDMB 3GSNL 2GFBB 5AUMA 1ZT7B 1JRHL 4JPVL 3X12A 4PG9B 3VRJA 5LGKA 3RFZC 4Y89A 3LMJL 1U8KB 2VDLH 4JM2A 4PGEB 1B0RA 1JVKA 5IB2B 5JXAH 5CEZD 5C0CE 4MA1B 4LPVA 4X6DF 2PYEE 4NSKB 5KW9H 5GZOD 5GS2D 1KTLB 4UT7L 2EDQA 4HKXA 4M9PA 1Q9WB 4YUEL 1NC4A 5C0GA 5T1MB 2MCPH 3VFUA 1D5BA 4LSTH 4LCYB 2HJKB 1G7PB 4RA3A 5B22A 3N85H 2FYYB 4DGYH 3KPRA 1RK0A 3SQBA 3T3PF 4B7IA 5EO0B 2FX8L 2CDEA 4MNQB 4APQA 1RZJL 2DM3A 1BAFL 4M61B 2R4RL 3GJFB 4XNUL 1DBMH 2JB6B 4X7EC 3SKJH 2ZG1A 2XT1B 2BERA 2ORBL 1E4XH 4MVBD 1K3ZA 5EU6B 5DTFB 4FFZL 3EO9H 1NMCB 1I1RA 4KK5D 2J8UF 5KS9B 5F7NC 2AVGA 5I6XC 1Q1JH 2W65A 1QSEA 1ZSDB 4Z78A 3SEPA 5EZOL 4TSCL 5HY9B 3FO1A 2CK0H 3QXUA 1WUNT 2N56A 4KJWD 1RQ5A 4OKVB 5EFIB 3HI6L 1S7QA 3OPZL 3ZTJG 1ZLWK 3O0RH 1MFAH 4J3SA 2R1YB 2XY2A 3DX7B 3MNZB 3D6GA 5AYQA 2PYEB 4R4ND 3TPUA