3MJ8A

Crystal structure of hl4e10 fab, a hamster ab stimulatory for gammadelta t cells
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
b'SYTLTQPPLVSVALGQKATITCSGDKLSDVYVHWYQQKAGQAPVLVIYEDNRRPSGIPDHFSGSNSGNMATLTISKAQAGDEADYYCQSWDGTNSAWVFGSGTKVTVLGQPNAAPSVTLFPPSSEELKTNQATLVCMINGFYPADVAVTWEADGTPITQGVKTTQPSKSDSKYMATSYLTMTADAWKSRNTFICKVTHGGNTVEKSLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIMULATORY HAMSTER ANTIBODY HL4E10 FAB LIGHT CHAIN
molecule tags Immune system
publication title cDNA sequence and Fab crystal structure of HL4E10, a hamster IgG lambda light chain antibody stimulatory for gammadelta T cells.
pubmed doi rcsb
total genus 38
structure length 209
sequence length 209
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8A01
4LSUL 5GRUH 1N4XL 4RCAA 3ABZA 3QQ4B 3EYQD 1BFOA 3QXWA 3SCMC 1WAAF 1G7LB 3OKLA 3NFPA 1HSBA 2X89A 4MXWH 2GCYB 3KPSB 1IC7H 5EZOH 4XPGH 3TYFB 2DYPD 4HC1A 1T04A 5EU6B 4JM4H 1VFUA 1F4HA 3VFOB 3DVFA 4FQIH 3B9KA 5E7BA 4DGIL 2NY7L 3IRPX 2F54E 1EBAA 1BGXL 4NRYA 3O45B 4L1HA 2V5SA 5IOPA 2C4FU 4EI5A 4HMEA 3PDGA 1U8NB 3H9HA 4PJIE 4GMTL 5SX5K 1NBVH 2EZ0D 4JREC 2PXYA 5LCVL 1RZIB 3V6FB 2Z31A 3EO1A 3PWNA 4ONFL 5DVMA 3OHXA 4L29B 4KK9C 3QIUC 5D7KE 3GSQA 5FGRA 3UBXB 4KVNL 4J3XA 4WUKL 4J2XA 3HUJE 5CZXC 3RHWK 1MLCA 1U8NA 3H9HB 4HC1L 4YGAB 2CUIA 3IFPA 5HJ3A 1C12A 3SO3C 5JHDA 1K4DA 3LZFL 3O6FC 1BLNB 4R4BA 1NDGB 1RZIA 2ZUQB 4M7LL 5IJKC 4WHDA 4XAWH 3ULSA 2BXZA 4I18A 1ERNA 4ZFZA 1JZ2A 3PWPD 3K81A 1AXTL 1FL3B 1L7IL 1MIML 3U2SA 4UIKH 3TPKA 2JLLA 1DSFH 5F7KC 1O0VA 4FZ8H 5E99H 1T0PB 3V4UL 1YMMB 2XA8H 3EJYD 5F88B 1D9KD 1T1ZA 2Y07H 1RUAL 5DUBB 1IQWL 4JFHE 1LNUB 2ZJSL 1K3ZA 3U9UA 4B5EA 5B3JF 1IKNA 1FE8L 1AXSA 3C8KA 5IGXL 1PLGH 3DMMA 3WJLC 4F7EA 5E24E 3PDDA 4OLYH 1DEEA 3P0VH 4P9ML 1TLKA 2E5EA 2VKXA 3GSVB 4ZPVA 3ULVL 1OPGH 1AE6L 5EUOE 3SKOA 1RUQL 2VERN 5I8OH 4RZCB 1YN7A 1KNOA 2IC2A 4FFZH 5J57B 4BZ2H 5HYEA 1F90L 1UVQA 3ARGC 4UB0L 1MHEB 1WT5C 2WIMA 3MRFA 2AK4B 2R0LH 4UOW0 3TNMA 1RUPH 4FQIL 3HG1E 5DMJB 2FEEL 2GUOA 3DXAA 3H42H 3AY4C 5DA4A 3KNBB 4M8QA 1U3HD 3G6AB 3IFNL 2P8LB 3GSNA 1EHAA 2CUMA 3MLRL 3AU1B 1MI5D 2AK1H 1VKXB 3LKRA 4DJMA 4MMXC 1Z2KA 3DETD 4U0QB 3MRKA 1I1FA 1KIRA 1MVUB 5EOCH 1CGVA 3OR6A 4B50A 1K4CB 1Y18A 3KLHD 2YK1L 4OF5A 4PJXA 1I9EA 4JM2F 3MUGA 4LLDA 2FJHA 3FRPG 1EO8H 4XVUD 3L5XL 4MD0A 3QCTH 4AT6B 4I13B 3U7AA 4I2XE 5C0FA 3QUYC 4KY1L 3JTTB 1NC4B 3GSQB 1N4XH 3RTQB 3VA2C 1G7PA 2D4DA 3CFDA 1TZHA 1C5BL 3WN5C 3NN8A 1SJHA 5IBLC 4UOW1 5L2KB 2BFVL 4FQQA 1NGQL 2DJUA 1FVCB 4M7KL 1WICA 5IMOB 4LCIL 1JGEB 2DQHH 1BAFL 4GKOA 4YIQB 4IDJL 4WHTA 3SDDB 3T2PA 3BWUC 2NQCA 5DR5L 3MREA 5FOBB 1R3HA 4EDWL 1NFIA 5FV1L 1XH3A 2XPGA 1AXTH 4R7NB 1PLGL 3TCLB 4HT1L 2R8SL 3QSKB 3VXPB 1FNSL 2CGRH 5I66B 2RFXB 1YQ2A 1KEGL 4NSKB 3TO4B 3OBAA 1J8HB 1HILA 4NQSA 5I0ZA 2YUXA 4IOFC 5FKPB 2BY3A 4X6DB 1NSNH 5DA0B 4NBXB 4UINH 1K6QL 3MRNB 1FL5A 5H2BB 1Q9LB 3QI9C 2XTJE 1PX4A 1G9NC 4LCWA 3JVGC 5B38A 2VITA 5CBAB 3TA3B 4M5ZL 1RZJC 5JZ7D 3EIFA 1FNEB 4CGTA 5CJBA 3TZVC 1CGTA 1MY7A 5EU7E 1QKZH 2R1YA 3N1GC 5C9KA 3QQNA 2Q7YA 2YEZB 2F54B 4IMKA 2EDTA 4IMLB 4W4OA 2AEPL 3RVUC 5DHVB 5E8EA 3HNTH 1Z3GH 5ITFB 4NRXA 3QFJE 1PY4A 1ZT7B 2IANE 4HWBA 3O4LA 1VENA 2UZYB 3ET9F 5CEZD 1QFPA 1C08A 2ADJA 3S5LG 3EOTL 5D7JA 3ARPA 3MRPA 3QDJA 3B9DA 5DO2D 4MAYC 1NGYA 1BBJA 3ORJA 5IQ9A 5F1NA 1WTGT 2HJFA 4Y1AD 4XZUA 4TUJA 4P46C 4XMKL 3N1FC 4PRBA 3LY6A 3ILPA 1R5WA 4RQQB 4F37F 3KPMB 4KUZH 4KK6D 1HHJA 3SDCA 2IADB 1KCUL 3D25A 3UZEA 3RNQB 1T1WB 4X9HA 2BVTA 1LQSR 2DLTA 3X13A 4XNMA 2YSSA 5EWIL 4HWNA 3U30B 4Q9QL 4DN3L 5E56A 1CLOH 3GKZA 2CRZA 4OCXH 1KCSL 4QOKA 5E1AB 1XZ0A 4R2GD 1HWGB 1JN6B 3DO7A 4YQXH 5HHXH 1NFKA 1SEBA 1NAMH 4PLKD 5AG9A 1EHNA 3AMKA 1T4KB 2BNQA 1JHKH 1RUMH 5FO9A 1EK3A 5DSCB 3QWOA 5HYFA 5T1MB 5I76B 2VR4A 3PQYE 1P69B 2BOCB 3V8CA 4I0CC 5C0DA 1V7NH 3P73A 4RMTA 5T1KB 2AEWA 4L4TD 5FM5M 4NN6B 3FRPA 2NY4C 3FB5A 3WO4C 4FQCL 1ACYL 5GS2D 1CICC 3D0LB 4LHUB 3DX6B 2IFGA 1REIA 2N1KA 2XRAH 1MF2H 4BK4A 5L7XH 3MLSH 5BV7L 4IOSD 4M02A 3SKNB 3ZKND 1UJ3B 1UZ6F 4YC2C 3NCYS 3N85L 1HINL 3EZ8A 3FN0L 3QUMA 2VRAA 4BM7A 2QADD 1O5DT 5DD3L 5CJXA 1N8ZA 4KZDH 2W0KA 1NMAH 4LU5H 2HJLB 3S5LA 1JWSA 2ZCKH 5GS0D 1SBSH 4JDZA 4S1QH 1ETZA 2W9DL 4PRPB 2Z8WC 4IIQA 3V6OE 4NT6B 4YHKH 4H1LA 1T0NA 4U1HB 5CSZB 4HDIB 3UXFA 2CK0L 3VXMA 3FFCA 1N2RB 3MJ7B 4ZFFB 4G6FD 1EX0A 3MV8E 5LG1A 3ZTNH 1WEJL 3VXSE 2F5BH 3SDYH 3KYNA 4LSUH 3MYJB 3RUGF 4PLOB 5LGKA 1NUDA 4KI5F 4ZUUB 2NXYD 2ADGB 3BP6B 5D6CA 5GZOD 4PJ5D 2C7UA 1D5BB 3H3BC 4PJFB 1Q72H 4G9FD 3WXWH 5I9QC 4KI5E 1VACA 1KFAL 4NQTA 4F8TA 2XWTA 4XPGL 3D9AH 1YNLL 4M3JA 4LSVL 2DDQH 5IFAL 2ICES 5K9JL 2OL3L 4U31A 3I2CL 1CFSA 1FP5A 4ODXA 3FB8B 2LU4A 2G2RA 5CJOL 3MUZ1 2XQYK 1AFVH 4YZFE 3VMPA 4ZNEE 4BH7B 1JPFA 2IH3A 4PFEA 3SKMA 3QQ3A 4NNXA 1ONQB 3HKFA 3TLRA 4O2CA 1ZHLA 4HXBH 5KTEH 1JNLH 2EIEA 3VGDA 3KPQB 1AD9B 2DQUH 4OFYA 4NBYB 2G60L 4CJ1A 1CDHA 3EGSA 4FZ8L 1VESA 3RRQA 4L4TE 1S8DB 3C6LB 2Y6SC 1YYLL 4PRNB 1OHQA 3RAJH 2EEBA 4K3DL 1C08B 4OLXL 2L4OA 5JOPD 5MHSD 4YR6B 2NR6C 4L4VD 4XNXH 5ENWB 5DMIH 3K2MC 4HBCL 2IH1B 5TFSL 1I8IB 3IJYA 2QR0B 3BDXA 3OAZH 4WCYH 4YAQB 2M8XA 4P5KB 1J0IA 5ERWA 4OF7A 5IHZB 4UIKL 3G08A 4JFZH 1PG7X 3T3PF 1CBVL 4WVRA 1QA9A 1ND0B 3FZUC 1Z0MA 3IF1B 3V0VA 3OB8A 4YDLC 5BJTB 4G8IB 1J10A 1NCBL 2FO1A 1MF2L 2BDNH 2R1WB 3WKNA 1DUZB 1EZVX 3QUYD 3KG5A 2QQKL 5FO7A 3O2WH 4XXCA 3PGCA 1MAJA 4RAUA 2ATPB 6FABH 4XNZB 5C0BB 1MIEL 1X5YA 1UM5L 5ALBL 1UFUA 3WKML 4P59L 1JPSL 4LOUD 4KH2A 5EIIA 1J87A 3C60A 3E8UH 2FGWL 1ODAA 3BH8A 3QO0A 2VZUA 1A4JA 1R3KA 5D1XB 3SY0B 4O00A 5DK0A 1M7IA 5KZCD 5FA4B 3NIDE 1JTTA 2P8MA 3QZWG 3RIFK 1QSFE 5EC1A 1A6TB 2EDXA 1NGPH 3I6LE 1FH5H 3MJ9L 5F9DC 3STZB 2PO6D 3ZL4L 4I3SH 1I1YB 4IRSC 3LV3B 1DANU 2A6DB 2EIZB 2MQ0A 2HAZA 3D39B 1CQYA 3RDTD 3UYRH 5I76A 5E8PB 4QTIH 1AE6H 1V3JA 3KPRB 3T4YA 4UDUA 4TULH 3DOSA 4FFZL 3DROA 5F44A 1TITA 2NY5L 1QRND 4U0RB 4AQOA 4BSWB 4HIHA 4QOKB 1OTUC 5D72L 3C8DA 4NQCD 3KLSA 3OX8B 5EORH 1LVEA 1RZ8B 5F7UA 5I1CH 2FATL 3SY0A 4JRXB 4NHUA 2GT9B 4PBVC 5KN5A 2YZ1A 2OJZH 4OCRL 2Z93B 2R15A 5E9DA 4XVTH 5F1IA 3STBA 3V5HA 1D5IH 3ULUF 2CXKA 3SGJC 2XYCA 4TRPH 3QNZA 1KLGB 2W38A 1AR1C 2PW2B 4NFDA 2R4RL 3VXUA 1QO3B 1E4WH 1ZEAL 3RBGA 5DFTA 4EQ3A 1EBPA 4N0FA 1NGYB 4HBCH 5JIIA 4W6WB 4Y8AA 3OMZA 1CT8B 4NUJB 2Y4SA 3WDIA 1YY8B 1UA6L 2EYRA 3OZ9L 4Y4HD 4MMZC 2BSED 1HHKB 2CIKB 2D7OA 5D5MF 4ORGB 3MUGB 1PJ9A 2PO6A 3NIFF 1J12A 5C08B 4F7PB 5B8CB 5M7QA 1MPAL 5IVXF 3U4AA 1FNFA 1CLCA 5J4MA 5GS0H 2BFVH 2X70A 4GG8B 4P49A 1J1PL 2VITB 2HH0H 4XVJL 1NBZA 3UZVB 2WMPA 4K3DH 4LCWB 3DX9B 5F97E 2R56H 3QUXD 1N3NB 1CDJA 4LPVA 5KN5B 1ORSB 1YYML 4HLJA 1VFBB 1R5VA 1Q38A 1O7SA 3FQUB 4CKVX 3IB4A 4JY4A 4PRHB 5IW1B 5C2BH 4ZUSB 3LSOB 3HLAB 1LNUA 2ICWB 5ICYA 5FDWA 5CZXD 4HAGA 4X80L 5ESVA 3S36L 4H25A 4A6YH 3V5DB 5CSGA 4UAOC 4R7NA 4G8GB 4TSBL 4ZPVB 1ZHLB 4P4KC 4TUOA 1PBYA 5ICXA 5DZOA 2Q6WA 1R3LB 3LKQB 3GMLA 4LCUA 1KCVH 4F58L 1LDSA 1ADQA 2WV3A 3EUUA 5TE4H 2RCSH 2V2WA 1CWVA 5HGDA 4MGXA 1RULH 2Z31D 3TFKD 5H94A 5GZNC 3MLPA 4LOUC 1I7RB 1QSZA 1SJXA 1QTYT 4KPHL 3MNWB 3I6KB 4RFOH 5CMAA 2ITCB 2XXMB 5F3HA 3WNKA 1WFTA 1JYWA 1T7WA 3P0GB 3BZEA 4JAMB 2E7HA 4Q6IB 1CXEA 3L5WB 5FB8B 4P3CH 4PGZA 4LLQB 1H3GA 4IRZH 4HPYL 1CS6A 4Y2DD 3KXFA 3OAUH 1S7RA 5HYSG 2GYSA 1N2RA 3HUJA 5KVMC 3ZE1E 4NRYB 4I3SL 4D0CA 4IHOA 3BN3B 1MNUL 1A6VH 2AK4D 4M7JH 3GSOA 1BECA 3VXRB 1HK6A 5GGVY 2J8UF 3IYLW 4HZAA 3AU1A 1H5BA 15C8H 3T2OA 2DYPB 2R4RH 2Z31B 3O0RH 2HH0L 4XVJH 3KDMB 3CVHB 3KPNA 2RGSA 1JHKL 5T33H 2ITCA 4HJGB 3OWEA 1CGWA 2JB6B 3ZKMC 3T0EB 4YEEA 3AGVA 4LASH 4JHBA 1WBZB 4JKMA 3QDGE 5I1CL 5L2JB 4YWGH 1X44A 5HHVL 4CN1A 4JFDD 2IH1A 1U8JA 4FG6D 1L9MA 2OK0L 2YN5A 3NCBB 1V05A 2ESVE 1TDQA 5KVEL 5TE6H 4U6VH 2VLJA 1RUKL 5I1EH 1CDCA 1YN7B 3MRJB 2PXYD 1KJ3L 4RZCA 2XZQH 1YEJH 4FFYL 4S11A 4DGYH 2EC8A 2ZKHH 5FDWB 2ZUSA 3TA3C 1P1ZA 2FBOJ 1SEQH 4MCYB 1LEIA 3QZWA 2Y6SD 4YNYB 4PJCE 1WIPA 3CX5J 3G5YB 4PJ9D 1NGZB 5GRJH 5SWQA 1ORSA 4PJIF 5JR1H 1Q72L 3P40A 2X7LB 2BMKA 1QLEL 3NACH 3ARDD 3PIQB 3QUZD 2XQYG 4LGPB 2XT1B 3S7GA 2XWTB 4L8CB 4F80A 1CE1H 2VDLL 4Y4FB 4Z9KB 5ILTL 5JHDB 5DQJB 4OTXL 3H7BB 5T1DH 1NGWB 4AQ1B 4YE4H 2CLZB 2AK1L 3JTSB 3TBTB 1TVHA 1S3KL 4S2SA 2FX9L 3PGDB 2ADGA 4JFFA 4X0KB 1WCBA 3UDWA 1NMCC 3BGFC 3KHOA 3EKCA 4OFIA 2EIBA 4X83A 1PVHA 3CLEH 4W68A 1I9RL 5D8JH 5INCB 4MA1C 3MRDA 1KB5B 3A6BL 3S5LB 1CVRA 3VCLB 1MRDL 1UH2A 2V17H 3DRTB 4LPCA 4IIQC 2LE9A 3AMLA 3RWCA 4MA7H 5J9PB 1QQDA 4WCYL 1EVUA 4JGJA 3SKNA 4MNGA 5IJVA 2P8PA 5KAQG 4UDTB 3MGAA 4PJ7E 3LB6D 1KUMA 4MJ5B 3LQZA 1DQLH 4OCSL 5CBAA 1YYLH 2ORBL 4OSUH 2P7TB 3N1QC 3I50H 2UY6A 3I3BA 1D9KC 2K9UA 4YHYB 3PWLA 3TVMA 3A0OA 4XNYL 2F58H 4XCYB 3DYOA 3DV4B 4LPYA 5EDXA 3WUWG 5BZWA 2QL1A 1WQVT 4JPVH 5D1ZC 5MENB 2GAZB 2VXTL 4GO6B 2VH5H 2BK8A 3SE3C 5HHMD 4NC0B 1N6QH 5CKAA 1XCTA 5I9QB 2NYYD 4NKMB 5T1KA 5CFHA 3MMEA 4HWEH 1CD1B 5FM5O 2NX5D 4WI2A 2KL6A 4U33A 3FQWA 3QXVA 3DX8B 5A2JH 1CL7H 4KC3B 3QHZH 4J7RA 2DMBA 5ACMA 2CR6A 1S9XA 3HNSL 3SPVA 25C8L 1SJEB 3KAAA 4LASL 1A9BB 1E6OL 3SDDA 1CGUA 2YA0A 3RGVA 1MWAB 3L3GA 2YC1A 3T09A 5F8RC 5BS0D 3DVGB 4OQTA 4ELMF 3IDJA 1I7ZB 3QXUA 3IFOB 3UPAA 3V0WL 1KCUH 2P49B 4KV5F 5DJZB 4BYHA 3FOMB 5I2IA 3O4LE 3BEVA 5IVZB 4DFIA 2VDQL 2XZZA 5HVHC 1CLYL 4PRAB 2AJ3A 4DN3H 2O26U 2H9GA 5E95B 3H6JA 4CMMA 1DFBL 4NUGL 1J0KA 1A3RH 3EOAA 3QBTB 4K8RL 4KMQA 1X7QB 3TNNB 1MFDL 5D7SL 2J88L 1UM5H 3GFUA 3WKMH 3WUWA 2UVFA 4HUXB 5DD1L 2ZSWB 3QIBB 2R4SH 3FT3A 5MEOA 3KLDA 2EC9T 3HPJA 4N9GB 4QRPD 4XCFL 5CEXB 4XPHH 3OJDA 3SQOH 2P45B 1W0WA 3X14B 2AABH 2IQAB 1F3DJ 3WFBL 2GJ6E 5JW4R 4XMKH 4BQ8A 3L3GB 2PTUA 1U0QA 1YJDH 4J3OC 2DQGH 1FJ1B 1D5XA 4TNVF 2J5LC 2NXZC 2HN7A 3D87B 2VDPL 5J0BA 2CDEA 3OZ9H 2VABB 3QHTC 4Y4HA 1G7QB 5FF6B 5EOTB 3KS0J 5CZVH 1RZJH 2EDWA 2X4RA 2DQJH 5E6ID 2J4WH 1TQBC 4APQA 2UWEA 3TA3D 4XPAH 4MCYA 4XTRD 3P77A 3G6JA 3TC9A 5MEPB 1CXLA 5EZJA 1AGDB 3BJLA 4JKKA 5AZ2H 4P9MH 4HIXL 2DL9A 4GUPA 3PHOB 1EVTC 5L88L 1IC4H 4GOSA 2EH8L 3HPLB 5KANI 1V7NL 2NY6C 2XNAB 4GRMA 5ISZE 4X6BB 4Y2DC 4HKBA 5IVXA 1ZK9A 5BQ7B 4K23H 2VQ1B 3K8KA 1MH5A 3HR5B 3VDCA 1FC2D 3PUCA 1ADQH 1CG9B 4NKIL 1ETZB 3VXRA 5EU4A 3WIIL 4NZTH 4OLWL 1IGML 1U2HA 4CJ0A 3CVHA 3SJVA 4HPOH 1UKQA 1UWXH 1V5JA 1X4ZA 5HPMB 2UZIH 2E9JA 4DK6A 2VXQL 5E2VL 1WT5A 2HVJA 1FFPA 1ORQA 3VG0H 4YFEA 1L9NA 1UM4H 2V7NB 3UJJL 1G7PB 4RGND 2HLFC 3EYOB 3G6DL 4JANB 5F7YC 1YY9C 1FORH 1KPRB 4GQPH 1QFWM 3RVTD 4HJJH 4ODTH 1TNMA 1JNHA 2I07A 4QRUB 2GY7B 1KCVL 4F58H 1RZ7L 4Q6IA 2NY3C 4NC1C 1KN2H 2R2HB 4KAQH 1FYTE 1HKFA 4XBGB 2P5WB 4U6HB 4NCC1 4PD4K 2D7TL 1WZMA 4XAKD 3QFJA 5E9DD 4G7YH 3ZDZE 4M1GH 3HI6H 3ROOA 1HSBB 3T0AA 5BV7B 4OCNC 5EFIA 3NFSH 3OPZH 5DQ9B 2V2XA 4Z7WA 3STLA 5D7LE 3DVNA 4PREA 3W39B 4QTHA 2R2CA 4M5YL 1CBVH 5GJSH 3UTSB 4RWYH 1F6LL 5C0IB 1RIUL 3MODH 4ZS7H 4R26H 4BZ1L 4U6YB 4UBDD 1GC1C 3FO9B 1N3NA 3VFMB 4E5XB 3BHBB 5IFHH 3DUHA 1U8QA 1K3IA 3UTTD 1UWGL 3ARBD 3P30L 3VW3H 1GGIH 2DMKA 4GW5A 4X99A 3MX0A 5AZ2L 1ADQL 2AJYH 3HTLX 4P59H 2DYPA 1U91A 3Q6FA 2DQDL 3CK0L 4BQ6A 2OL3A 2A73A 1MI5A 4PGBB 5HHVH 1RSFA 3HAEB 4ZO9A 1A7QH 2DWEA 4PJGB 1LK2A 1CT8A 4OLZL 3VE0A 5CZVL 4NRXB 1WBZA 3B9AA 3C9NB 4HUVA 3VRIB 4V1DB 3U2SB 3DUUA 1IAII 2AV1A 4NJ9L 2MTPA 2XZCL 2C1OB 5SWSE 5J13C 1CLZH 3IXTA 3JVGA 4NO0B 1KJVA 1UXSB 3X3GL 5GS1B 5D70L 3LKOA 1RV6X 1C12B 3F58H 1SY6H 1CF8H 2D3VA 4G6AC 4UT9L 4RGOL 4QRSA 1NCDL 3TYGH 4BUGA 1FHGA 4H5SA 4N68A 4NPYA 2NXZB 2A38A 3B43A 4HH9A 1IE5A 5KANG 5FDYA 1FAIH 3KPPA 3HUJB 1IC5H 5BRZB 3D85B 4FNLL 5IQ7H 2K3TA 1YY9D 2BNRB 1UB6A 4M1GL 5F6IC 6CGTA 3WLBB 2IBZY 1T22B 2VXVL 4XPFH 4TN9A 4V1DA 3MRBB 2D7PA 4TSAH 1LK2B 2M1KA 2DBJA 4GRLA 3LRGA 4HKBB 1Q9WA 3U4BH 3ALPA 2WINB 3C5ZA 1GGBH 3KR3H 5DK2A 3T1FB 1R3LA 4OJFL 5MEPA 2KQNA 2B39A 4X7TA 5EO1B 2PO6C 1DQTA 4HWUA 3U0TA 2A74A 2FJFA 3ULUH 5IHUH 2VZ3A 4Q9RL 3ARDA 2BX5A 1W2KT 1LK3L 2JJTC 4P9HL 1FORL 3QO1A 5FUCC 1Z5LB 2E7LA 3FO9A 3RX7A 3RZCC 5L8JB 3V79C 4HF5L 5DK0B 4P4KB 4D0BA 4ONGH 3QUYB 2X4NB 5T1LA 3DPBA 1KBGH 4H26B 4KZEL 4Q7DA 1P2CB 1JZ3A 4RFNC 4X5WA 3BD4A 1IAOB 1KG0B 2HLAA 1RUPL 3V6BR 2G9HB 1BP3B 3P4OB 5SWZE 4U3CA 4LNRB 3WUWB 1UXWB 1K4CA 1K5NB 3HAEA 3ZDYE 5HYSA 1LO2H 1H3UA 4QHKI 4CDHA 4FQHB 3BGMB 3HZMA 3HE7C 3EJZC 2Y07L 4JO2L 3GIVB 1PZUB 5IKCA 3S3JA 2XACC 2OQJA 4L3ED 5E08L 4L9LC 2XZCH 4H26A 4YAQA 2Y23A 1IKNC 2IJ0C 4UBDC 3V5HB 2GSGB 5GGSA 3HUJF 3KPRD 3GSRB 2D7MA 4HUKB 4U6YA 3OXSB 1A1MA 1DQDL 1KLGA 12E8H 3SJVE 5GISH 1UC6A 3MBEA 1YMME 3B9EA 3I84A 4JY6B 2UUDH 3K1DA 3J8F7 4U4BA 3FOLA 3ZYZA 4QTHB 2DDQL 3GMNB 3U7WH 3THML 1T21A 4X6CB 7FABL 5DD1H 1U8PB 1HEZA 4PR5B 5F9JA 3P11H 1U93A 4D3CL 1A7PH 2BERA 3LHPL 1P9MA 5I1IH 1PX3A 2NLJA 4HIJA 4AG4L 1QP1A 3FO0H 2BOBA 3QO0B 1OTTD 4NGHL 5C07E 1DN0B 3GO1L 4N8PA 3RVTC 4ZNEA 1NH6A 5FA4A 1IGTB 2EDRA 4TUKL 3EFFA 4POUB 1H3XA 1FAIL 4PG9A 3STZA 5JW3H 1KJ2L 1IEAA 1DDHB 1X5HA 3CUPA 4ORZC 4KPHH 3DVIA 4KK8D 2V5MA 1XGQB 1X5FA 5L8KB 3V0WH 3QIUB 1WZLA 2ARWA 4PGDB 5D5MB 5DVOA 4NPYB 2H1PL 4QXUL 2R29H 1YC8A 2DQTH 3O3AA 1G7QA 2OTWB 4KUCF 4HT1H 4TNWK 5L2KE 4HDIA 1TFHA 2FB4H 1EXUB 5C7XH 1H3WM 2I24N 1IEBA 4NNYA 2Y9RT 4LLUB 5TDOB 1FPTL 1NCTA 2O61A 2IBZX 1QNZL 4FFYH 2J8UA 4DGYL 3KHQA 4QXTA 4ZOCA 1J11A 4MWFA 4P48A 1CFQA 1A6ZA 5F93C 1TENA 3FL7A 3DRQB 1UADC 3CXDH 4LNVA 2P24B 4YHZH 1I9JH 2ZSWA 2X4TB 3U83A 3W82A 4O58H 43C9A 3IVKA 4CVUA 3MLXH 1EIBA 4YZFF 1Q9OA 2R23A 4F7MB 5C0DB 3RWJA 3D39E 4ETQB 4NO3B 3ULUC 5DZLA 4OQTH 4ZO6A 1YJDC 1DJSA 1CGSH 4MDIA 3ES6A 5EUKA 1BGXH 4K23L 1MFCL 1PEZA 2VDNL 4LRNL 1BVZA 1MRFH 5HDOA 4JQXC 3G5VA 1EGJL 1BHGA 4TNVK 2MNUA 2MKWA 4BELD 5KSUA 4WWID 5J11B 4O5LL 3SKUD 1BVKB 1WZKA 2OX5A 2EH8H 3WHXA 3BMVA 3R06B 3ES6B 5EUKB 1I7TB 5L6YL 5JMOC 4YO0B 1JNJA 2BNRE 1I9RH 3QQ3B 3E3QC 4NNXB 4G9DB 4F8QA 2YD1A 2JK5A 2BVOB 3Q0HA 1S9YB 4MQ7A 4F9PC 2W65B 3EW3B 4KTEL 4XC1H 5LBSL 3IFLL 2ZUXA 4XMPH 3ROLA 4CN4A 4I2XA 4ENEC 2C26A 2R29L 4MLIA 4GKZA 2JJSC 1NEUA 5DVLA 5TF0A 4Y8DC 4AENA 4GG6E 2EE6A 5GJSL 5DJ2B 2ESVB 1PYWB 1YDPA 4X4MA 4G80B 1GJIA 1M05B 4PJXF 1XR8A 4IRJC 1ZT1B 2YPKA 2L0DA 5E2TL 4MX7B 3MYJA 3O3AB 4PJ9B 4QGTA 2GJJA 2CIIB 4TTDC 3IDIB 3LDBB 1R3JB 4NQED 4PJHB 3RWGA 1L4IA 1EXUA 2JIXA 3AFLA 3BP4A 5HPMA 3VFUA 3X11B 2AJZA 4KRLB 1LE5A 3GBNL 4YHMH 2PN5A 1IEAB 5DD3H 3MV9D 4K7PH 1DQMH 3FO0L 1MIMH 2GJZB 2MCPL 2HT4D 3MLYH 3Q5OA 5E00B 4N0UA 1X5LA 3GJFB 3LDBC 3MFFA 3MJGX 1Q94B 5KSBF 3KXFB 3C60C 2IAND 2R56L 3HNSH 5MI0B 4AENB 2CRYA 3K4AA 1P6FA 1RJYB 3PABB 3N85H 1ZLVK 3PGDA 1AXIB 4NSKA 4HQQL 4Z7VB 1JGDA 4OKVA 4OLYL 3FQNB 3O6LL 1UQSA 4RMQA 1CZ8L 5KG9A 1CF8L 1FCGA 1ZLVH 4GKNB 4QRPB 5C7XL 4KRPD 5ICXB 1MRCL 4L8SC 5K9OB 4OQTL 5B21A 3NVQA 1AQKL 4LF3A 1RUAH 3CFEA 1EA9C 4JM2B 1QSFD 5ESVB 1BQLH 1J1OL 3NH7H 1JN6A 3O2VL 4NJ9H 4YHOL 3BKJH 2CUHA 1C5DA 4NDMA 5DLML 1FYTB 3WMSA 2FEEI 4PJCF 4QRRA 5BZDB 1CIUA 5GS3A 4ALAH 1LO4H 3S88L 5EUOA 5FIEA 3CK0H 3JWDL 1YEGH 1YN6A 2JTDA 2G60H 4P23D 2WP3O 4I9WE 1KEMH 3KJ4C 3FMGH 1NGQH 1J0ZA 1QSVA 2X4SA 5GS2H 3WFBH 3EDEA 1H8SA 5GS1C 5I8EA 5A2KH 2LVCA 4M93C 1MFEH 5IT2L 4M8VA 3HG1A 1M71A 3WNOA 1N7ML 5E5RB 1C16A 2F5BL 3SDYL 3O3BB 4KK9D 4C83A 3LQAH 2C3XA 2FH8A 1KIQB 4MAYD 3OR6B 4KY1H 5I15L 3CZFA 4JGMA 4ZS6C 3ZSSA 5FGCE 2WWKO 4WI3A 2JCCF 2E6JA 4X6FA 4MWFB 3KWWA 1EFXA 2AXGA 5F3BA 4N0FB 3O9WD 4OZFG 3ULVE 2UYLB 4JZNA 1F6FB 1ZE3C 2OP4L 2KDGA 5D2LA 4LSVH 2Z8SA 1N64L 3NCMA 5C9JB 2GJ6A 4W6XB 2D0GA 5GGUA 4HJGA 3AAZB 1L6XA 3C09C 4LAJH 1VKXA 5FYKL 3L7FA 2ZOKB 1S9KC 1LP9B 3T0BA 1IGYA 2QKIB 5MERA 3DX7B 2AV7A 4ZYKA 2NZ9D 5HYQB 4QXGH 3VXRD 3NFNB 1J8HD 1TVDA 1I85C 3BPOB 1IKFL 1TZIB 1RI8A 2CDGA 1G7JA 2XKNA 4XBPB 3P9LA 4E42B 1UXWA 3DX8A 2R2BA 2EDQA 1G0DA 2PF6A 1QZ1A 2Y36L 2XTJC 4PS4H 1K85A 4JO1L 7CGTA 1H8NA 3MRJA 3GEWB 4L3AA 4MD4B 3VFTB 5IIEB 3TCLA 4NKIH 3RY6A 4YDKL 3IAQA 4HK0B 4WW1A 3W2DH 4O51A 3CFJB 3I02B 3B2UD 4C56B 2X1PA 1LP9F 1MHHA 5F88A 5C07D 3BKJL 3GSNL 1UCTA 2GHWB 2NY1B 2BNUA 2CKNA 1H8OA 1MJJB 1QFUH 5E99L 1X5GA 3T3MF 4L3EB 5ISZA 3O6LH 3UTTB 1PG7L 4JVWA 1JPSH 4G7VH 4DKFH 1JRHH 3OSKA 4FTVB 4S1DD 2YRZA 2APFA 3MLUL 1AGBB 3GSUB 2A6JA 4N8CL 2AJUH 5EC2A 4EN3A 1WBYA 1YEEH 4OD1L 4PJCA 4MNGB 1JYNA 3CCHB 2XIDA 1FVCA 5EIIB 2H6PB 3NOIA 3N06B 4D9QE 2MQ3A 5HGAB 3GHEH 1JZ6A 1I3RA 4H25B 3O3EB 4NP4L 2ZNXA 4YIQA 3CNKA 2XTJD 4XHJC 2FATH 1WF5A 4PJDE 4X6CF 5BOZG 5FYKD 1G9EA 2CLRA 3UJTL 4XVTL 5CIPH 4ELKB 3VD9A 3LPWA 4MA8L 1JWUA 1RZKC 2YD2A 1VFBA 5FA3A 5LKNA 4JN1H 2A9NH 1F6AB 4I0PC 4C58B 5DRZA 2YUWA 3PWNB 5CUSH 5IT2H 1EJOH 1ZMYA 2NY5H 5EO0A 3TWCL 2IFFL 3NABL 1GGYA 1JWMB 4PGBA 3EYFA 2ZUUA 1FO0H 3QH3B 3MJ9H 2X70B 4GG8A 5D2LB 2IPTL 3VRIA 1N0XL 1WC7B 4LNRA 3O9WC 4ZPTA 4K7FB 4JFYA 3U1SH 1TJIH 3G6AA 5DURB 4N1CA 5FUOH 3WIHL 4DN4L 2Z8RA 1F4AA 3GMLB 4PJHF 3GJFK 2YBRA 4QCIB 3ARRA 4JM4L 5F6HJ 1KJ2H 3E6FB 4FQ1L 3FFCD 3CGTA 1TCRB 3QG6B 3PNWB 3O6KL 5GQBA 3ULUE 5T5NG 5I15H 1P7QA 4YX2L 2AXFA 4G9DA 4E5XA 3HAEH 5D93B 4LIQE 2VXTH 5BVJB 5HVFB 5F9OH 2A9MH 5F21B 3VJ6B 4K3GA 3SGJA 4XNQA 5M95B 4AEHL 1ZANH 4O2CB 2XI9A 4WI5A 5TF1H 2D9QB 2GSIA 4AH2A 4U1SA 1CLZL 4F7EB 3RY6C 4U1KB 4PV8A 4QF1A 4ZTPL 3QUZA 4MJID 4G3YH 1M7DA 4DQOH 3D6GA 43CAA 2YKLH 5B38G 3MZGB 3VW3L 1FE8H 5D7KD 3KPRA 3T4YB 1RK1B 1WVZA 3X14A 1NLBL 1L7IH 5DYOA 2UWEE 5TPWH 3LRSB 5JIPA 1A6UH 4AIOA 5TDNA 5LWYL 1NMAL 2EYSA 2WBKA 3TBSA 3RVWD 1UB5A 4GFTB 3T0EC 1QRNE 4C83B 3GUTA 3MLXL 1OD7A 4IRSB 4KHTL 1NKRA 4JEGB 5I30H 3OV6A 1PSKH 3PV7A 4P99A 5EBMB 5ANME 4QRSB 4Z8FH 2P5WA 3MLSL 4LARL 4U6HA 5BV7H 3ZDZF 5GHWL 3UJIH 5EOQL 3U9PL 4NN7C 4LFHD 2Z93A 2FCBA 5E9DB 3CX2A 5CD3B 1CDUA 5TDOA 4FQLL 1G1YA 4JKLA 5DT1H 4KKCC 1ZHKA 3IETB 1UJ3A 4JG0L 3DUSA 5EOCL 4BQCA 3REVA 1CK0H 1I4FA 3LN9A 1X3DA 2KZWA 3AM8C 3W11C 1HSAA 3AREC 5K9JH 5IB5A 4PJ8A 3GDBA 2J3SA 4G43B 4KK5D 4HF5H 4Q9BA 2XWBA 1H3TA 5IVXB 5DJCB 3O6KH 5DD6B 3K0WA 3ARFC 4Z0XA 3MBED 4XH2A 1MCFA 4OIBA 4XCEA 5DJDA 4TSAL 5C6TH 3I02A 1KFAH 1PZ5B 4WO4B 4DOHB 2IPKB 4YDVB 4YK4B 3QA3B 2OR9H 1I8IA 3IJYB 1AQDA 4XHJD 3ZT5A 5L6YH 1QACA 3OGOE 1XIWA 5IM7B 2BVEA 4Y4HB 3RA7H 5FF6A 4UIMB 5E1AA 3DO7B 4MVBD 3GHBH 4RGMC 3O2WL 3TM6A 2WNGA 1U6AL 4LVHB 1OSZB 3NIGF 3WJJA 4G9FA 1R24B 5JORA 2X4RB 3DURA 3MRIA 3O6ML 3RDTA 3CC5B 2V2XB 1AGDA 3T0EE 1VFMA 1JFQH 1MCWW 3ROOB 4YHNB 2AJZB 3D5OF 1KTLB 2JELL 3ARUA 5I8KH 1S9VB 1G7JB 2YSSB 2C4FT 5T3ZE 4QT5B 3MUJA 4O4YH 3LIZL 2FIKA 5F3BB 5DD0L 3TGXA 2QQKH 1BQLL 1J1OH 3NH7L 3RGHA 3SQBA 4XP9H 3HPJB 4PUBL 4M62L 5CWSB 1JVKA 2GQHA 4I3RH 2BHYA 4HZLB 4P5TB 4FXKA 1FL6B 4D8PA 2NY1D 4R96B 4NKOB 5ALBH 5CD5C 4OM0H 4QRTB 3RKDD 3KYNB 1X4XA 4N0CC 1ZWIB 2R0WL 2E3VA 4CN6A 2E27L 4LQFL 5JPMA 3WYRA 2HFEA 5KAQF 4NZUL 1OTUD 2LU3A 4EXPX 2Y5EA 2ICWI 4U7SA 4ZOAA 5JW5A 3I9GH 1S9VA 1FGNH 4PGJA 4RX4A 4ISVA 2PYED 3CVIH 5I1LB 2IAMB 3MRRB 1TIUA 3FQWB 1KT2B 3QUMB 3O4OC 1UM6L 1N26A 2Z4QA 3WFEL 5JXEA 4OZFH 2VZTA 3BQUB 3PV6B 3QPXL 1LDPH 3B9VA 3ZTNL 4J3VA 5IEHB 4RSVA 4Z7UA 4ZSOB 5I66A 2R23B 4PJAE 3CLFH 4F7MA 1NGPL 2V17L 4XWGH 1T20B 4A2LA 4NKMA 1U3ZA 4F57H 1UH3A 5FGBC 4YFDB 3KXFE 3HMWL 4Z7WE 2FDBP 5C6TL 4UIMA 1XEDA 2P8MB 3WFCL 4OD3H 4EVNB 4RDQG 2OP4H 3GO1H 3FMGL 1VB9A 3MR9A 2EKJA 3FCTB 2IAMA 3MRRA 5EH1A 3WDHA 3RA7L 3ARED 1CR9H 2GAZA 1ZHKB 1YPZF 4FQ2H 5L2KA 1IEBB 2I27N 4F15C 1RHHA 3UAJD 3LQZB 4MJ5A 1S7VB 3GIZH 5HGHB 4EI6B 5D2LF 4Q2ZB 3TH2T 4ZO7A 3OJDB 2Z0BA 4ODWB 3H3KA 5FO7B 2VR9A 3QG7L 2IQ9H 4K9EL 4GXUM 4PTUB 1NGWA 1GGCL 2GK0A 2QTEA 3QAZC 3LQAC 1FL6A 1RY7B 5JQ6H 4HZLA 4KKNA 2CLZA 3JTSA 3K2UH 4P5TA 1ND0A 2EYSB 4TSBH 3TBSB 2ESVA 3NA9L 1DEDA 4F7TA 4O5LH 5JQHC 5IMLB 1KB9K 4Z77B 1SY6L 4QWWD 1EERB 4HWZB 3VFGH 4YHLH 5F1NB 1I75A 4OIIH 4Z7QF 1G0YR 4WFFD 1FBIL 3TBVA 4JPVL 3HI1B 3OKEB 4G6KL 4LRIC 5HDQL 1A3LH 1OARH 1XF4A 4QT5A 5F6HI 5INCA 5D1ZA 1M7DB 1FQ9C 2FH6A 4M8QB 2EDNA 5HVHB 3BAEL 5T1MA 5I8KL 1NL0H 4PJ5E 4DKFL 3QT2A 1CD9B 3RGVB 1LEGB 4LSSL 1FZMA 1IARB 5EOCJ 1B3JA 1CFBA 3CSYA 3QEUA 5DD0H 3B6SB 4Y19B 5BVPL 5CJ8A 1BQHA 1MAML 2F74A 4U1SB 2IPUK 5DEZA 1RIHL 4L9DA 2IMNA 5GXBB 4JDTL 4MB4A 4PRIA 2PYFB 3PXHA 5C6PB 4PY7B 4V1DE 1OAUH 3HMWH 1A1MB 4Y19E 5HY9B 4PYHA 4ZAKB 5IBLD 5GGSB 1Q9LA 5GIRA 3BIAX 3WXVL 3V0AC 5IUSA 3RVXC 5IV2B 4G5ZL 4LQ1A 4WW2B 3G5YA 4ERSL 2NY2B 1YMMA 1E6JL 1S7UB 3WIHA 4NKQB 4D2NA 1JF6A 4BQBA 5EO1A 4CVXB 4FQ2L 2X1XR 3LEVL 1AD0A 5DUBA 4PP1C 3S97C 4HPYH 1A3RL 4K8RH 3D3VA 4KTEH 4XC1L 2E7MA 2IPTH 3MUHL 3UYRL 4DZ8B 3EYFB 2VZOA 3LH2H 3CVIL 5LVEA 1FVDB 4KJWC 4G8GE 4JG1L 4D0DA 5C3LD 4JFXB 5FUOL 1XH3B 2Z91A 2YD5A 1C7TA 2DBLH 4ZFOL 3SN6N 1OF2A 1DR9A 2A9NL 3LCYA 4JDZB 2O5XL 3S35X 2VISB 4MNHB 4FQ1H 3MLWL 2BDNL 2C3VA 3PP3H 3QUML 2B2XH 4JVPA 5J1AB 3MNZA 4MD5B 3SDDC 4DZBB 4LKCA 1QO3A 1Q9KB 5SWZA 2ARJA 5L8LB 1MRCH 2BY0A 3NPSB 1MIEH 2DWDB 3MRNA 1JNNL 1MOEA 2X44D 5CEYB 1J9CT 4WFFE 5JOFA 5HGDB 5IBUG 4QLRA 4RNRB 4U6TA 1OQXA 5HTSA 5FOJA 2WIIB 3V6ZA 2DLGA 3BUTA 4OLXH 1GRWA 2GCYA 1J8HA 4LHUD 4G3YL 3VFGL 4D0DB 3ESUF 2YKLL 1RZKL 4L4VB 3RWEB 4N0YL 1E27B 5HVGB 3L3IA 5FGBA 3QUZB 3VFOA 1F4XL 1T03H 1BFVH 3MLVH 2N7BA 3FFDA 1TMCB 1Q0YL 4O51B 5LWYH 1X6LA 1AIFB 1DQJA 3NFPB 4I0KA 1S78C 3FQUA 1AY1H 3KPSE 1MFNA 2NY3B 1FLRL 1MLBA 3RPIA 4QRRE 1I7RA 3BE1H 3QFJD 5IMOA 3BPOC 1L0YA 2J8OA 1MHEA 2X4QB 4Z78B 5JXAL 2QEJA 4Z0BH 2APTA 2VLKE 3HC3L 4Q0XL 1HZHL 3JWOC 1FRGL 3HG1D 1EFQA 4PJ8D 1TCRA 3QG6A 1KTDB 3WFDH 1H0DB 3QCUH 4N5UA 2D0HA 3LKQA 2IADA 1IGYB 2QKIA 3F12B 5GGVH 1F3JB 5DS8A 1NAMA 4NQDA 1KJVB 1UXSA 1DEEB 4RISL 1D5XB 5IFHL 4C56D 3MC0A 4ONHA 3MJ8A 4OGAC 3EO9L 3VWKB 3WO3B 4QRRD 2NTFA 2DQTL 5ESAB 1I8MB 3ZLQC 4J1UB 2FNBA 3QXDB 2CDFA 3AAZA 4Y88A 2JE8A 3MRHB 4RWYL 1BJ8A 4OZIE 1X5ZA 1I8KA 5EORL 3CD4A 3UO1L 5DJXB 2VDRH 2W60B 5EO0B 3S35L 1P9MC 4M93B 1X5IA 2YOCA 3L3OA 4OM1H 5EBGA 2X5PA 3Q5TA 1JHTA 5MEQB 4HWZA 4QHKJ 3KJ4B 4ZFZB 1MCSA 5KOMC 3F7YA 1YY8A 1DLFH 4D0CB 1NAMB 4NQDB 4ERSH 1SM3L 4ZTOH 2VTFA 3HCVB 1BPVA 4KI5C 2XTJB 1B9ZA 2R0ZL 4MQXD 1SVZA 4X4ME 4G6AD 1JWUB 4DUWA 3G6JE 2EH7L 3JWOH 4CL7A 5J6HA 2HVJB 4X5WB 2Z8VC 1RHFA 3DV6A 1G9MH 3ULVF 1QHOA 5F71A 3QXAB 1RK0A 3HFMH 1CXFA 1VPOH 1WBYB 2DAVA 1C16B 1CDGA 1F90H 2M26A 1JF5A 3D2UD 1OW0C 4GBXD 1FZKA 5DHYB 1EEQA 4OM0L 3UCRA 3S36H 3DHMA 4LDLB 3S96A 1OGTB 3UTTA 1YN6B 4XP5H 1A02N 3TO4A 4F15B 2WBJA 3VI4E 2EO1A 1E4WL 1ZEAH 4OGXL 5EU7C 2A6DA 2XRAL 3D39A 3P9MA 3WO4B 4KQ3H 4XBGA 1I3GL 3LKSB 4LVEA 5JXAH 2KH2B 4YWGL 2VUOA 1T0MB 1BOGB 4Y0GA 4BFIB 3CZJA 4NZJA 5HHME 1I1CA 4ELMA 1G9MC 3VXNA 4FN0A 5C08E 4O2EA 2H32B 1JGUL 4OKVB 5TE6L 5D6CB 2KQMA 3BP6A 3FONA 1AO7B 3B3IA 3RHWF 1AI1H 4P46A 2NTSP 1RK0B 2VLRB 1NMBL 2X40A 4PRHD 1F8TL 1BBDH 3HRPA 1KT2A 1A4JB 5I1JL 1DFBH 3TV3L 2HFGH 1FFRA 3MNVA 4OF3A 2VISA 4MNHA 1IM3B 4E41A 3BPLB 1FIGH 4G6MH 3H9YA 4P23A 1VCAA 4QYOB 5A3ID 1LE5B 2XZAL 5B8CA 4HKXB 3BEWA 2IPUG 4YC2B 5D5ME 3HS0B 1M05A 3BZ4B 1YNLH 4R7DB 3BW9A 1QA9B 2BJMH 3O4LD 2J6EA 5DJ2A 5EU6A 1JI1A 4QY8B 4Z7OF 4PJ9A 4LP5A 3W0WB 4EDXB 4G8IA 1S8DA 2YPKB 4K71C 2F5AL 1CGYA 4GAGH 2Z35B 1M71B 3SDDD 2JIXB 1SQ2N 4OJFH 4GW5B 1VADA 4NQVA 3QCUL 4X99B 5IB1A 4PJ7B 2JJSA 5EZJB 2COQA 2YD4A 1TJIL 3H7BA 4K2UH 3OR7B 4FABH 2VDOH 3FJTA 3QEGH 2AKRA 4TYUA 4N0UE 4JRXD 2V5YA 5J11C 5DRWB 1AD9A 3UTSE 1MCPL 2F54D 3ARGB 1MEXL 1EHXA 2FBJL 3UTOA 4S0TD 1BJMA 1Q0XL 4NZRH 4QNPF 1MLBB 2FD6L 3QI9B 3RPIB 5D9SB 3MRCB 5DDHA 1AQKH 5AG8A 4E41D 1G7HA 4JFZL 3OAZK 5DMGC 5DFVD 5GRJL 4JZJB 5TDPB 2VIRA 4ODUB 4ODVL 5D7IF 5D6DA 1IVLA 3KPQA 5KVEH 3B5GA 1HXYA 2CJUL 3K2UL 1RU9L 5BW7C 1XGYH 5LGJB 4J8RA 3B5TA 3ILQC 2E9IA 4YDVA 1OP5H 1Z9OA 3L1OH 1J05B 3O8XD 2UZXB 1EHLL 4P2OA 5EBLA 2PNDA 4TUJB 4F7TB 4NO5A 3NZ8A 3VFNA 5DRNB 1OP5K 3PWLB 5E2JA 4WI7A 3T65B 1DN2A 5LGHL 1II4E 1FO0B 4LBEB 1A1OB 2OK0H 3ARBA 4EN3D 4LPWA 2VB5A 5J12B 2GJZA 2NZ9C 3CSGA 3D69A 4KHTH 5HYIA 1A47A 3AS3A 3LKNB 1EEZB 3U30C 2HJLA 2Q86A 5E5MB 4EBQL 5KW9L 3VFWB 2QSTA 5BCAA 3P0YL 2EDKA 1CLOL 3V9FA 5DEGB 4OTXH 2QLVB 4QWWC 4F37K 4OCYH 1GPOH 2DQFB 3MODL 4XCCH 4ZFFA 1RVFH 3JV4A 5AEAA 3RDTC 1S3KH 3VDAA 2JCCA 5JIKA 1TETH 3HI5H 4O9HL 3HE6D 1U8LB 1ZLWK 3FB6B 2HTLC 3L3JA 1E4XI 1AR2A 1LEKA 5D2LE 1DVFD 5L9DH 4JFFB 4X0KA 2HLFD 4IRSA 2F53B 2X42A 3VFNB 4LCYB 1RZ7H 4XBEH 4B41A 1MFDH 5D7SH 4JKPH 2HJKB 4RMUA 1IL1B 1UEMA 3TV3H 3U0WH 1KN2L 4RBPK 3RPKA 3P4MA 4HFUL 2DICA 4KJWD 4N1HB 5I18L 3P2TA 2NY2D 2YPLE 1A9EA 4K71B 1DLHA 4LDEB 1IQDB 4JPIB 3QYCA 1BVKA 4RAVB 3QI9A 3JUZA 4G5ZH 4XPBH 5I1LA 5D7LA 5D7LD 1A2YB 4CADB 4LVOC 3LMJH 3ZZ1A 4G6FB 3MGOB 2Z4QB 4JPKL 3LEVH 3QHZL 3FB8A 5FYLL 5F7WC 2E9WA 4MDIB 5TDPA 1RUQH 2WBJB 4P0DA 1J18A 3HMXH 3JV6A 2AXFB 4R0LA 1N5YH 2NYYC 4WHYG 5JW5B 3X13B 1FFOA 2N4IA 3UTTE 1NGXA 3NN8B 1OGAB 2PETA 4KFZC 4RFEA 5C0GB 3MLZL 4R96A 3DI2B 1FIEA 4NO3A 3NPZB 1F97A 1FG2A 4EBQH 3F7YB 5KW9H 5FK9A 4OZHF 3U46B 5A2LH 1EHLH 3L5IA 5KSBA 1RZKH 2AKRB 1CICA 4FG6C 5D7IE 3RWFA 3VXMB 3NBNA 1PD6A 5ADPL 4EN3C 2VOTA 3OKOB 4LSPL 5B22A 2H9GB 1KELL 1HDMB 3BKYL 4AMKH 3KYMA 3OKDB 4GLRH 5DJ8A 1NCNA 1NBVL 2F8VA 1F6AA 1RU9H 2C4XA 1HH6B 1RURH 4PGDA 4HG4K 3WIHH 2DQGL 2NTFB 5ANMA 1AC6A 3MOBL 2LFGA 1Q8MA 3BT2H 1KBGL 1R24A 4LCIH 3ZDYF 4Z7UE 3SDAD 5DMGD 1K2DB 5D7IB 2IANA 4KVCH 1FNEA 3UAJC 2X4NA 3LB6C 5I71B 3ZHKA 2RAMA 3SQOL 5EZIL 1INDH 3D0VA 2H32A 2OS7A 4HX1B 5E94A 3MMEB 2MPAH 3CSBA 5TH2A 1BX2A 2DQIH 2VDKL 4KK5C 2OBGA 4P46B 3MXVL 1HEZB 1GGBL 5FOBA 4C54A 2DD8H 1HSAB 1QPPA 1I3VA 1MFAL 3M17A 5JDJA 1G9NH 4LRIA 5EBWB 5HHNB 4P2QA 5HYJA 1T5WA 4KK8C 2QADC 5EPMA 5GGSY 2XFXA 4JO4H 3O2DL 5F7NC 1C7SA 1UENA 1IT9L 4H5SB 3T0XA 2J8UE 3C8HA 1OCWL 5L9DL 4G8FA 1A6AA 2FJHB 3Q5YA 4QOKE 1NDGA 1A6UL 1LO4L 4PY8I 1B0RA 1P4IH 4M1DH 5C2UB 4LGRB 5J6GB 5I1DA 4U1IA 4NN7B 2NY0D 3OXSA 3NFNA 4XAWL 4MD5A 2WAHA 4B0MM 1UB5B 1JGUH 3MV8B 3OG6B 4HFWB 2ARJQ 1J7VR 5EU6D 4V2CB 1NMBH 5IVOA 5C0AD 4HIXH 4W6YB 4OGZA 4ALAL 5E8EB 1LWRA 5KZCB 4ONHB 5GRVK 1QVOA 3A67H 5C0JB 2HFTA 1K5NA 1BM3L 2WWMC 5ESAA 4PJAB 2WUBH 3UC0H 4HUMB 1AKJB 5SX4I 4A6YB 3BSZH 3NGBB 4LLYA 5DK3A 4QXGL 3VMOA 4DTGL 1NBYA 1HIMH 2EXYD 3EOBA 2Z92B 5GGRA 3F7VA 2YPLB 5DTFA 1QEWB 1BIIB 3DVNB 5JUEH 5I0DA 1A4KB 4M9PA 1RJLB 4A6YA 4DVBA 5DQ9A 3DIFB 5JW4N 4IOIB 5ETUA 3Q2CA 4IDJH 3UYOD 4BZYA 4JR9L 2D7TH 5I8CA 5DR5H 2WINA 1S5HB 2FX9H 1U8JB 4M9OA 3BYTA 5EB9A 1KXTB 3SCMA 3CLEL 3QUZC 4HJJL 1EV2E 5D8JL 5BS0B 5GGQL 2ZPKH 2VMFA 4JM2D 4MZ2A 3KGRA 1OM3L 3U9UB 4PTTB 2DD8L 3EYOA 3MRMA 5DZNA 1G9NL 4G9FE 1GZPB 1JV5A 4HGWA 4JG1H 4N8CH 4AM0A 2ARJB 3DNKA 3W0WD 2OR8A 1SJHB 2XZAH 2ZJSH 2Y06L 4K3JL 3M8OL 2P42B 1CFTA 1ZKAA 1GZQA 5T3XE 1URLA 3B9KB 4M5ZH 2FR4B 3RGVD 3VRJA 4M7LT 3IDGB 4NFBA 1KPRA 1A5FL 2F53E 1AGEB 4L4TA 2AV1B 3ULSB 5CS7A 1KLUA 1N6UA 1JRHI 3V7AE 5CILL 2XA8L 3MCLH 5GS1A 2WSKA 5FYJU 2C3GA 3DTXB 4JN1L 1NC2D 4S1DC 3VWKD 2J2ZA 1G7LA 1UJ3C 3B8SA 3CPLA 3JSSA 4P2RB 4PBXA 3VFSB 1MI5B 1FNGA 1Q9KA 1Y6KR 5J1SC 4U1NB 4FZEL 4OV5B 2EDFA 3VD5A 2EXWD 4WNQB 3WFDL 1V7MH 1NUFA 3EFDL 5EBWA 4X6BA 4D9QD 3OTTA 1KGCE 1KXVC 2J12B 1OPGL 2CO7B 2KUTA 4QF1B 3SE4C 1YEIL 1NCWH 2MHAA 4EI5B 3BPCB 5DJ6B 3QXTA 1B0GA 2VZVA 2Y25A 4NQDD 1MCWM 1NAKH 5K33A 1FN4A 3MRLB 2AJUL 1Q0YH 5HHPA 4DZ8A 2F8OA 3LN5B 1BAFH 5BVJA 4CAGA 1QEWA 4XP1L 5E2UH 4AIZB 2VABA 2A6IA 3G5XA 1QFWH 4OD2A 2DOCA 3QNYB 1XR9A 5DWUL 2CJUH 4R4NC 4PJGF 4P9HH 4P2RD 5E70A 4PJ5A 4WEBL 3IKKA 5K9KB 1ZSDA 1C5BH 4ZSOA 5HYQA 3EO0A 3U1SL 4GW4B 5D2NC 2YHGA 3D18A 5DVNA 5IEHA 5DC9B 4F9PA 2GKIA 4EEEA 1JPFB 1ED3B 4HS3A 1OM3H 3SKMB 4BH7A 5EU5A 3U0WL 1HH6A 2J88H 4YDLB 2VAAA 1QSFA 4Y16B 2AI0H 1VGKA 2DQHL 2FJGB 4OZHE 4K7FA 4CU6A 5IMMA 3LHPH 1EFXB 4XCFH 3IFLH 1T7XA 4X98A 3ZSTA 5DRXB 4ZS6D 4RQQA 2HMID 4MCZB 2JJWA 4OF6A 1EAPB 5C9JA 2E6PA 2G5RA 3QULA 2ZPKL 5HHOB 5JPMB 3HG1B 2QR0A 2XA3A 4GBXA 5EIQA 5D1QC 1AHWA 4QY8A 5T3XD 3S35H 3QDGB 1ZLUH 5IB3A 1MFBL 2CLRB 3SDXA 4L29A 3D3VE 1B0RB 5BMFH 3L7EB 3TIDA 4DVRL 3DVGA 2X6MA 3QUXC 5ICZA 3TBWA 1S5IH 2H3NB 3TT1H 4LLUA 4L3EE 4OGAD 1BZ9B 1TJGL 5E9DE 4AEIL 1LGVA 2YEZA 4G6KH 2Q7YB 2NY3D 5GSRA 1B6DA 1FNSH 1WFNA 2OJEB 4FOMA 4PY8J 1BREA 2KZ1B 3JBG7 5EU4B 4F2MB 3SDAC 2YR3A 3L95B 4JFQA 2OR7A 4O2FA 3D3VD 3FZUD 3THMH 2D4FA 5E8PA 1JGLL 1MAMH 1FGVH 2YXFA 3P0VL 4O2EB 1G7IB 1X5AA 4KDVA 3O11A 5K9OA 3QB7C 5TPWL 3L9RA 1A7BA 3GMPB 3HN3A 3CFJA 4OZGE 4JFDA 5EN2B 4LSRL 1I3GH 4FTVE 4GS7C 3UYPA 2AW2A 3VG9B 5B39A 5ITBL 1CD1A 4PJDA 1J8HE 4C4KT 3KYOB 3TH3T 2B1AL 3FQTA 1QLFA 3MA9L 2K7QA 2CDEB 2FEDC 1UWEH 1IAIH 1S7XA 1MCIA 5E00A 4NWTL 5FYKH 4PB9L 4IIQB 2VLKB 1MRDH 4WW2F 1CQKA 4WI8A 1CYGA 5JHLL 3EDFA 4JE4B 4MNQE 4QHNB 1WWAX 4PJEB 4LVOB 2C3HA 3NCCB 1UJTA 3RWGB 4TTDD 3E1F1 3D69B 1J88A 3PWUA 3TZVA 4X8JB 5JIHA 4M61B 5C0BA 5HHXL 1QBMH 4HEME 1H9VA 5EU6E 2OSLA 3TNNA 2FBJH 4HJ0D 4YDKH 1MCQA 3QJHB 3QUMH 3W9DA 1HHIB 4LHUA 3D0LA 4L9LB 2HJFB 2ZZUT 4HUXA 2VLRD 1W0VB 5EWIH 1MQ8A 2NNAA 1KPUB 3PXJA 2VQUA 4RX4D 4LEXL 3KVQA 2W65A 4XVUC 4L8CA 5CCKH 4G8EB 4YR6A 1ITBB 4GAYB 2BOCA 3HC4H 1U8KB 4HMCA 4GKZB 5E2WL 1OOAA 1ZV5A 3PJSA 2CQVA 2BCKA 4Y4FA 2O5YL 4WWKC 2Z9TA 2Z31C 2WK2A 3GNMH 4YNYA 3UTZB 3GMRB 1KN4H 5IHLB 2Y5TB 2R2EA 4HS3B 5DMYA 4JZOA 5JMRA 1UCBL 2X7LA 1OD9A 3LN4B 3FN0H 5SWSB 4NN5B 3IFNH 3UBXI 3R0NA 2FJGA 1GSMA 4JM2A 4JPIA 1SYVB 1INQB 4PV8B 1OLLA 1PG7W 1T1WA 3QNYA 4NQXB 4TQEH 2JIXD 5D7LB 3GSVA 2XY2A 3MROA 4MA8H 1IFHH 1UQSB 5K9KA 5L7XL 1Q9OB 3D48R 3NIGE 1MJ8L 2H45A 1UWEL 4UI2A 5B39B 3UC0L 5D96B 4Y4KD 3HNVH 2P5WE 4Y4KA 5DC0A 2BY2A 5IB2A 4GRWE 5DJYB 1AKJD 2BSSB 1KJMB 2B7DT 2EKSB 3VWKC 4Q58C 4BUHA 1P4IL 4M1DL 3C2SA 4GBXC 4NRZB 4U1MA 2PTVA 1INEH 4EDXA 1QFWI 3ZKMD 1HKLH 2WANA 4HHAA 3ECBA 4PIRF 3RUGB 3I3EA 5C0JA 2UY7A 5CEZH 4RMSA 2AERT 3DTXA 3QIBD 1JZ7A 2P8PB 3D2UA 4OIAA 4LKXA 1AFVL 4WW2C 5DJ0B 2ZSVB 1VERA 3WL9A 4OZFA 4PYGA 4MXWL 4DKEL 4YBLB 5FKAA 2Y72A 3ZKXC 1WWCA 1EMTH 4AEHH 3CFCL 1CFNA 4FQXB 5IFAH 2I9LA 4LCCB 3TO4C 3T04D 1QBLL 1DN0A 5INDB 3FB7B 4YBQC 4S2SB 4F57L 1MREH 4LVNC 1FYHB 5CINL 1W8OA 2IALA 1JL8A 1GZPA 1JV5B 3CCHA 1YUHB 4FFWD 1B6UA 5IB4A 4QEGA 3SCMB 3P4LA 4J8RB 4E9LA 3JWDC 1QRKA 2VWEE 2P8LA 2BNUB 1K8DA 2X9YA 3LPFA 2A1WL 1PSKL 4POZD 1XZ0B 4UZGA 5H94B 2XZQL 4PJFE 5BRZD 1FFNA 3MBEC 4DVBB 4NQEB 5IP4A 2HMIC 4X7SH 1T21B 4AL8L 3ULUD 5ESQB 1OLZA 2RR3A 4LLYB 4HUWB 2ADFH 2V7HA 4AK1A 2J6EH 3PWPE 3BGAA 4N9OB 3SDAB 4A6YL 5IG7B 3UTSA 4NQEE 4Z5RA 4Y5VC 3C8KB 2CDGB 5ACZB 1EAJA 4ZOBA 3ZT6A 3EJZD 3U4EA 1HCFX 1IQWH 2GEEA 4LHJB 4R0LC 4U1LA 4ZPTB 3F7VB 3L3DB 1GIGH 2W60A 5C08A 5E5UB 3MRPB 3P4NA 5C0AE 3KXFD 5IGXH 4RIRA 5KS9B 3V7MA 2OQJB 3VA6A 3S4SB 2NW2A 4JFDE 4WTWA 32C2B 3MOBH 1YMMD 1ZGLM 2VO5A 3L3HB 3F7QA 4MAUL 3VWKA 3TESA 3DX9A 4LHUG 3U6RA 1NL0L 1QYGH 2RQ8A 4L4VE 4UV4H 5CP3H 4G6JL 3X12A 3MLUH 4ODBD 1BWWA 2CDFB 4S1RH 4ZOEA 4RIRB 3MNVB 4EUPG 3FO2B 1V3MA 4RFNB 4M5YH 3KWWB 3QEHA 3A6BH 5FA3B 2EEDA 2HLAB 2E8ZA 1T3FA 2E7LC 1QLRA 1RMFL 1HN1A 3BPLC 4KRMB 4R26L 3MGTA 4BZ1H 4IMKC 3RIAK 2XFXB 3PWVA 1EO7A 5C0GA 1U95A 3KYAA 1A22B 3O3EA 3F62A 5JO5A 1KB5L 2DKUA 1GGIL 3FTGB 3WNLA 4KJPD 4UT6L 3SE4A 4ZXBB 2XY1A 4OLVH 4UQ3A 5HI5C 4ZMAT 1QSEE 3DROB 4N8VA 4C4KO 5EZIH 1JMXA 5B39G 5CINH 3T08A 4ZUVA 4HV8B 4AL8H 2WUCH 4KHXH 4KKAC 4HIHB 1I3UA 4Y16D 4YPJA 5D7JC 3V4PL 1MWAL 1T20A 4TSCH 1MCCA 4JN2A 4FRWA 3QQ4A 3IDYC 2OR9L 1WCQA 2XPGB 1U95B 3WS6C 4DWHA 3CDGA 4MXVE 2YZ8A 3QI9D 1KJ3H 5F7HA 2BRRL 3P4MB 4LGSB 4ZUSA 1MJJA 3BYYA 2EIZA 4JFED 4U1JB 4Y89A 5E8DH 3BO8B 2CKBL 1JZ5A 1FZKB 3K8MA 4KWUA 4YBLC 5C1MB 3MACH 3QDMB 4I8DA 5JOFB 4GMSL 3BRGC 4RGOH 5T1LD 2H41A 3UTQA 3RWDB 4NP4H 3VD7A 4PP2B 1D6EA 4P5MB 5BO1L 5C0FB 4XXCC 4RISH 1XAUA 1NPUA 1XCQB 4FQCH 4L4JA 5IK3B 3CFDB 1JTOA 3H0TA 5IMKA 2AXGB 4EXKA 1CXIA 1JE6A 1ZHNA 1FVDA 2IF7A 4X6FB 2E27H 4LQFH 1K6QH 4BH8A 4W81A 2BVQA 2FYYA 4MX7A 1HHHA 4U6XB 5IK3A 1GPOL 3MJ8B 4DFHA 3ILQD 2YS4A 3IDUA 4LSRH 4KROD 3DECA 3FQXA 1ZA3A 2I60L 4I48B 3D3VB 4FA8A 3RWDA 4M48H 4WUUB 5E0QA 3EYVA 3LKPA 3RWFB 1NCAH 1T83A 3V6OA 2GW5A 3U46A 1PYWA 3SE3A 2YMXL 3MRQA 1JMZA 4J6RL 3IDMA 5IROA 5ECJE 2RIKA 2EH7H 4PRNA 3MROB 4IRZL 3MRFB 4YEFA 5J8OA 2D03L 3PP4L 3VFMA 4MA7L 4JRYD 3K4ZA 5K59E 3Q6GL 3U0TB 3WS3A 5FYJD 2W0LA 2W91A 3BP7A 1FZMB 1OP3K 1DE4A 2AJSL 2CKBB 1S9XB 4PJAF 5IVNA 1JJUA 5KSUB 3VI3F 2IQ9L 4OD3L 2F74B 2NY0C 3P9WB 4PGCA 2AVGA 4K8RD 2X1QA 2V7HB 5J7CC 5DGRA 5E2WH 3WHXB 3L3IB 3OL2A 4GRWF 5D9SA 1N59B 2R2HA 1OP3H 1XCTB 1DQJB 2FRGP 3QA3A 3BIKA 3PHQA 4TVPL 5CJOH 2DLEA 5E8DL 2FO4A 3EHBC 1KIPB 2VDRL 3V6ZB 4GMSH 4OF0A 4PD4J 5D7JD 4EJ1C 3D0VB 3LS5H 3E2HB 3PGFH 4L8SA 4S1SL 4OZIB 2FHCA 1ZT4A 1KPVB 1CU4H 2DIBA 3W11D 2OXGA 2A77L 3HC4L 1F11A 4D9LH 4EOWH 5HHOE 3WL9B 1QBML 1M7XA 2XG4A 3FQNA 5LAXA 4APQD 3B4NA 3UROR 4PJFA 3UZQA 3BH8B 4FP8L 5GGTA 5IJVB 2DF3A 3EZJB 4HPOL 3PL6A 4C59B 1MCNA 1HWHB 3FB6A 1MPAH 1PKQB 1CFQB 1CG9A 4WHYH 5TQ0L 4YXKH 4OQ1A 4Y5XC 5DJ8B 4QHNA 2ZP0T 1VFOA 4P2RE 4YK4C 1UH4A 2IWGA 1QFWL 4UV7H 4R9HA 2EKSA 2HVKB 5I30L 3O8XC 3NACL 5EBLB 4KDWA 4X6DE 4P5KA 3MO1B 3KPSA 1W72B 3QISA 4PUBH 4ZAKD 2ITDB 5EOQH 3FN9A 3MR9B 2W9LA 5DLMH 1VDGA 1R3JA 1SEQL 3FQRB 1WWBX 2VIRB 2HFGL 5DFWH 5KSVA 1LO3L 4H88H 1SMOA 1EH9A 2FZ3B 2GK2A 3BAEH 4XB7A 2YWZA 1Q1JH 3OF6A 4JRYE 1A3QA 3S6CA 4HIJB 4GUPB 2MJWA 1UZ6E 4P2OB 2ZCLH 5GGTH 4LSSH 4K07A 5F9AC 1MCPH 3FN3A 4ZUWA 4JDVA 4Y2DA 3EYUH 3MLWH 4M6NL 3SE9L 1HE7A 1YC7A 1DE4B 2CKBA 2UWEB 4XNQB 5B4MD 1KJ2A 2BNQB 1NDMA 2AJXH 1E0OB 2B2XL 2IGFL 4PJBE 4Y5XA 3HNVL 3MXVH 1F42A 3MLTA 4GJTB 3G5ZA 4MQXC 1DL7L 5KVFH 4QHLB 4OV6F 3S96B 1W0WB 4X4YB 1C1EL 3UBXG 4Y19A 1WIOA 1DQQB 3D9AL 4DVRH 4J4PD 1BZ9A 1CU4L 2VDQH 1SYVA 3VU2A 4YHIB 1VADB 2A77H 4D9LL 1UT9A 3CFCH 3HI1A 1U8OA 4NKDA 1PFCA 3RVXD 3T77A 1NJ9B 1X7QA 4TPRL 5HHMB 4NZRL 2Q8BL 3CFBA 3FFCB 3MJ7A 5AAWA 3RL2B 4FQXD 4XX1G 2D31A 4HS8H 1FYTD 1WJ3A 5CIPA 4PV9A 2BVQB 4Z77A 1IAIM 1X9QA 2FX7H 2AABL 4NHCH 5T3XH 1PKOA 5F89B 4LKXB 3QIWC 4U6XA 1XIWC 4HBQA 4GRLD 3WIIH 4OF8A 1G0XA 5E6IA 1HQRB 1DBML 1XCQA 3MCG1 3QUXA 1IAOA 1KG0A 3ARSA 3TT3H 4XPTH 1YNKL 4JFEB 5ITBH 3HS0A 1MREL 1WIUA 5DD5H 1MVFA 3P4OA 1EEZA 2OTPA 4R4FH 4H88L 5DI8B 5GS0L 2ID5A 3SPVB 4ELME 4F3FA 3VXSD 1QYGL 2ATKB 1RUKH 5I1EL 2FLRT 2BHZA 2BSTA 1H0DA 2C1PA 3IGAA 5DJDB 1RJZA 1D9KA 4FTVA 1HYRC 4MAYA 3TVMC 4ELMB 5HVWA 2APBA 5JUEL 4PRID 2XQBH 1F58L 3VFPA 2ICCA 2G75B 1G7IA 2HRPL 4JFEE 1TCMA 4G6JH 4PB0L 4BK5A 1N5AA 4WI9A 4NM4H 1OT2A 3PWJB 4MSWB 5DK2B 4XPHL 5JA9A 3BZFA 3ZYJA 2Q3AA 3CPLB 2DLHA 4ZAKC 4U1GB 1CIDA 2BCKB 2XOTA 5FYLH 3SDCB 2HT3D 3L7EA 3QCVH 3TIDB 5C0BE 1HXMA 4MDJA 2H8PB 2X41A 1ZWIA 3SJVD 3ILPB 2WIIA 3BDYH 4XB8A 1H5BC 2F19H 4KK6C 3AC0A 4IS6B 1R5VB 2GITB 3M1BA 2ADIB 2CLVB 4TULL 2EDJA 2X09A 1F2XK 3RNQA 2PYEB 4MA3A 5CD3A 2UWEF 1CFTB 3PWVB 3MBEB 2CSPA 2B1HH 5EO9A 1XIWD 1I7UA 4UUJA 5TDNB 1FZOA 1MVUA 4ESKA 4LDOB 1I1FB 4XZUB 3E6HA 2GJ6B 5IB1B 5HXMA 1C5CL 3GIVA 1JHTB 1BZQK 1IZKA 5C07A 4QRTA 2UYLA 1WCBB 4JZNB 4XVSL 2ZUYA 3HC0A 5IESH 2EDYA 4ODSL 5FHBH 1ITCA 5E4EB 4NQCE 1BJ1J 4G7YL 3OB0H 4BJLA 4R7DA 3S37H 4B7LA 1LO0H 3P4NB 3NFSL 2K1MA 4NUJA 2FSEA 1EO5A 1ZVSA 1WITA 2Y1VA 4OLUL 3MRGB 3OGCA 3UJJH 3CC5A 1EAPA 1UKSA 3TA3A 3QFDB 2QHRL 1GC1L 1KIRB 3OB0K 2AEQL 3RWHA 4FFVC 5GRUL 2VZSA 3QNXA 3I3DA 3EYSL 1TQBB 4GH7B 1T1YB 3BX7C 1MHPL 3A6CL 1GYAA 1LE9B 1NCWL 3MV01 3WN5B 1XIWB 3ZTJH 1U3YA 1TVBA 4Y5YB 1KACB 1ZGLA 4JDTH 2WBJC 1JZ8A 2GJ6D 3R0MA 4JDVB 4Y2DB 5IEKB 5I75C 3WHE0 3U7WL 3UTQB 4X6EB 2NW3A 7FABH 4JJ5A 4NFCA 3GKWH 1SHMA 3MLZH 4HUWA 3VXPA 1CGXA 2ZOLB 2HYMA 4OCWL 1ZLSH 1A6WL 2IPKA 1UGNA 2JF1A 5D1QB 4LARH 3WFHA 2ZKHL 4FQJH 3QFJB 4J6RH 4F2MA 1ZLWH 4J3SA 2Q8AL 3RKDC 3U36B 2DLIA 1ES0B 4HIIB 1WZ1H 3WEXB 5I6XB 1A6TA 2XWBB 4HV8A 3ISWA 5GSRB 3LD8B 1HI6A 1FLRH 1DVFB 4JRYB 3FFDB 2CH8A 4DGVL 3RWIA 4OZIF 4FMKA 3VRJB 3UBXA 3V8OA 4YXHL 4X4XA 4NJAH 4OCSH 3D85A 1QR1B 1ACZA 3UPCA 1R5IB 5DRZB 1ULVA 4KROB 3TN0C 3DHJA 3IFPB 5HJ3B 4ONGL 2AJYL 2JB5H 3WLBA 2VDKH 3F7PC 1FNGB 4KJQC 5DUPL 4YXLH 4AT6A 2BNRA 1MCDA 4JANA 4PS4L 4OI7A 3HAEG 5FB8A 4OUOA 2X4PA 3CH1B 3RTQA 3S37L 3PGFL 4KVCL 1FZJB 2UVEA 4KMTL 1S7QB 3LRSA 3TYFA 1OY3B 2BJML 4EOWL 3O41A 4GG6A 1E6JH 3K46A 4HMDA 3VXQA 2DWEB 5FEBA 4P2QB 3HR6A 3QUKB 1A64A 4DCQB 1U3HB 3BFOA 2F5AH 1EPFA 2GUOB 2DI9A 3DXAB 5SWZD 4C56A 4EZMA 4WEUD 5D96C 1YEDB 5IV2A 4CMHC 2FO4B 4WU7B 4Y4KB 4ZD3H 4HIEA 3RQ3A 1Y0LA 4YBHA 2AJSH 3ARFD 2DJ4A 3SGKA 5I1HH 1KJMA 2VDOL 2Y7QB 4UINL 2BSSA 5IQ7L 2DM4A 2EDBA 3DYMA 2PYFA 2XNAA 3ULVC 1J1PH 2DLFH 4V2BA 3GBLA 4LSQL 1B4JL 3VXOA 3NCJL 1EGJA 4Z76A 4IOIA 4KDTC 4YO0A 5ETUB 3ZTJG 3PWPA 3KPSD 1IJ9A 2X1WL 2DQEH 5ABDE 3HE7D 3TO2A 3LPGA 1U8QB 1BZ7B 3VDBA 2FECL 3G6JB 3QQ9D 1DP0A 1BFVL 5F96H 1BD2B 2FEDD 3NCYP 3IDMB 5JPNA 1QFOA 4JR9H 2DTML 4TNWF 1VEOA 5IBTL 3ZMRA 1BIIA 3RBSA 1LE9A 4C57C 4U6VL 5J13B 1GOHA 5AZEL 1RMFH 1FNAA 2R0WH 1NUGA 2CMRL 3UX9B 4R3SB 2ZCLL 5GGTL 3DSFH 2OMNA 4L8BA 5GGUB 1KENH 2NX5B 1EJ6A 5IF0B 3VFSA 1EEYB 1ZHBA 5FO8A 1AKJA 3MRGA 3KDMA 5DQDH 1HHGB 1F4XH 1T03L 1AJ7H 1HQ4A 1FGNL 5CEZE 1BWMA 4UTBH 1FL3A 2BY1A 1HHKA 2CIKA 5FYJH 1YMHB 2IEPA 3IAGC 1FG2B 2P5WD 3BUYA 3CU1A 1YECH 2FWOB 1N6VA 3GKWL 5EA0L 3TBVB 3G04A 4UV7L 4NKOA 5EUOB 1AGFB 1WBXB 3X17A 3UTPD 5M94B 4U1IB 4P3DB 4YE4L 2L7JA 2PW1B 4RGNB 5EC2B 2OSLB 2A6JB 2FIKB 1HOCB 4E0RB 5F9WC 4WU5B 3BEVB 1A6AB 4DGIH 2Q8BH 4AEEA 4UU9B 3RTQC 4QRRB 2O5YH 4HKZB 2G5BA 4P5TD 3IU4L 3QWRD 3ULUL 5ALCH 3MACL 4NRZA 2OI9B 2PTTA 5E4EC 4PGEA 5DVKA 4DAGL 4JN2B 3EO9H 2H32H 4TPRH 1RIUH 2MCG1 3LEXB 2W0FB 2NW3B 3O2DA 3P3YA 4JFPB 1HH9A 4XBEL 3ARGD 3CFKA 4HD9A 5GISL 1OGAD 4MNQD 3ESVF 3B2VL 1JHLH 1T66C 1B90A 4S0SD 1LP9E 1VGEH 1XGUB 2JJVA 2HKFH 3DXAE 4KJYB 2YPLA 4LCYA 3TVMB 3NAAL 1OSPH 2VC2H 1NBYB 3EOBB 3UJIL 3G9AB 1EGJH 2ICWJ 5FV2A 4WV1A 5JO5B 1K8IB 1T6VN 3X3FL 4NIKB 1A7PL 4IRSD 4OGYL 4H0GA 4I0PD 3F5WA 3L7FB 4GAFB 1HDMA 5L88H 2G5BB 5CEXA 3S88H 3CX5K 3QEUB 1DBJH 3CSYB 3QUXB 3DBXB 1KEML 4RGMB 5D2NB 3ME0A 1F02I 3RFZC 4XAKE 4XX1E 4LAQL 3X11A 3ZHDA 1I1RA 4PJBF 4MLSA 4Q6IC 5IHBA 3BZDA 3NZHL 1I1AA 3F58L 4CMHB 3K80A 1M4KA 5CIPB 1FO0A 4LBEA 2PUQT 4FXLA 2WWMD 3AY4A 1CN4A 5I2IB 5KSBE 4OLEA 2PW2A 1CTNA 3QIUD 5T1KD 3DLQR 4ONFH 3W9DB 2BVOA 3H8NA 4EI5C 3CZFB 3WUZA 4YQXL 4CDGC 3W0WE 1OAXH 1J05A 4BSJA 4WUKH 5DQJA 1BIHA 3T8XB 4ETYA 1W0VA 1SYSB 5BS0E 4KRPC 4N8VG 3QDAA 2YD7A 3VH8B 4M4PA 4MJ6B 3MV9B 5JLZB 4H0HB 4DUXA 2H8PA 4KDTA 1P2CA 1I7ZA 3IJHA 1T7VA 2ERJC 4NC1E 5F7FA 4URTB 2QADB 4HLZG 2AS5M 1OSZA 3RAJL 1BFSA 5FHBL 2NR6D 1P1ZB 1FYTA 4XC3H 4Q97A 2WLZA 1OTTC 4ONOA 3EAKA 1W72H 4MHHG 1IL1A 4FABL 1WAAA 2HTKC 3MRIB 3WIFA 3HI6L 2LVEA 4WTZG 2BRQA 5A43C 4OLUH 2H1PH 3E2HC 3ZE0E 2NY5C 4DAGH 2MQCA 4X7TB 1KGCD 1YJDL 2AAVA 4S10A 1ZA6A 4Y1AB 2MPAL 3L3KB 2ATKA 3MZTA 4QRQA 1QLFB 4OGYH 5GZND 5CBEA 1GAFL 4K55A 4C56E 2NZIA 1S7TA 4KZDL 1WFOA 4MXQC 1D9KB 1U3JA 1P4LA 2WW8A 4WFGE 3QCVL 2IG2H 4XWOC 4Y19D 1AGCA 2F53A 3VGAC 3ZE0F 4LSTL 1T66D 2F19L 1RJYA 2HKFL 2ICEB 5H35A 4BZ2L 1S9WA 1CFVL 2HJKA 4M43L 4XH2B 4DW2L 2R0LL 4Z0XB 5FGSA 1U58B 1WV7T 3MFFB 5GGRY 4Y16C 3SE8L 1MUJB 3TJHD 5I1GL 3TZVD 2X4UB 4H1LB 5CSZA 2EXYC 4HKZA 5F89A 2X89D 1MAKA 3HRZA 2HVKA 1DUZA 4P2RA 4JO2H 5C0AA 4NBZB 1LMKA 2LAAA 4S1RL 1A6PA 2O5ZL 5FECB 2B1AH 2OTWA 3UTSD 3HZKA 1AGEA 4L4TB 3WFZA 5J9PA 1NEZA 3V5KA 3VGAB 1IC1A 5DYOB 5KVGL 4XCNA 4JB9H 3QJFA 4KTDH 3C6LD 2A0LC 1MRFL 3NGBC 12E8L 4U1MB 4BFEA 1Y18B 1J0JA 4ZFGH 3IXAB 1HYSC 4DEPB 3QDJD 4OZ4A 4IRJB 3H9ZA 1DTUA 4U1KA 4K7PX 4FQJL 4JRYA 4X98B 4K94C 4QHMA 3L5WA 1NJ9A 3O8XB 4KVNH 1DCLA 1U91B 3BIKB 2MSPA 1JUFB 4FS0A 3QULB 4UT7L 4JO3L 5I16B 5AYUL 2ENSA 4J23A 3CVHL 4AEFA 5I1KH 3ULVD 3DSNA 3OAYK 2IMMA 1W0YT 1KSRA 4NQXA 2Q1EA 5DDHB 4X6CA 4LMQE 5FM8A 1XGPA 1WLHA 4KKLD 1ZLSL 3SDCC 4M00A 3C87A 3OJ2C 4K7PL 4U1GC 4X6EA 3TIEA 2BP3A 3EYVB 3LKPB 4QHUB 1VFAB 4JO1H 5HDBE 1A5FH 5CAYB 1HHJB 1VEPA 5JW3L 1QSEA 3MCLL 2OYPA 4QO1A 4GRLC 3MCKA 2BVYA 3GZKA 1IBGL 4Y5VA 3HZMB 3VH8G 2FGZA 1X5XA 4ZUUA 1YZZA 2KKQA 1I8LC 3SDXE 1U8KA 1TNNA 4ETQA 4KQ4H 5DEFB 3M8OH 1J8KA 4G42B 1EZVY 2ZCKL 1FNLA 5IMKB 4GG6B 1OAZH 1W72A 5ITFA 1LP9A 2FECI 3ARDC 1MJ7H 4NNPL 4OV5A 3MV7E 2XN9B 4NQUA 4R8WL 4GS7B 3FFCE 5HHQA 3HA0A 3O4LB 5GZOC 2VDMH 4P46D 4JFYB 5MI0C 2WBWB 2RBLA 3I6LD 3VXSA 3H42L 1G6RH 3BKML 4F7PA 5BVPH 3IS1X 4OB5L 2B5IB 2VWEC 1RZGB 4NNYB 1FFPB 3PWUB 3C2AH 3P11L 5FAAA 3QNZB 4ZUTA 5I1AB 3WXWL 1T2JA 5HSFA 5I8OL 1CICD 1GGTA 3FONB 3QO1B 3S3PA 1QR1A 2B0SL 2BC4A 2IBGA 1A7QL 3H9SD 3WXVH 3OKKB 5T3ZH 1INEL 1BMGA 5FYLD 5IBTH 3GSNH 1KPVA 1FV1A 2RFXA 4MJIE 3HE7B 1XGRB 3LZFH 3DWTA 4ODHH 3MNWA 4UMGA 4M7LH 1V7ML 1BF8A 4G7VL 3R4DA 1F8TH 2JKXA 1AO7A 1OGTA 3B3IB 1HNFA 1KENL 3CDGB 3BZEB 3NA4A 4M7KH 1U92A 4U7MA 4LCUB 1S7WA 1A0QL 5IWLC 4P3CL 3LEYH 5BS0A 2E6QA 3QCTL 2LV4A 4DKAA 1JGVL 4JHWL 4BFIA 4BQ9A 4ZUVB 4E42A 4JFOB 3MXWL 5J1TC 1RJLA 3GHBL 1ZGLB 5JOPE 5MHSE 2BC4B 3K7UA 5K93A 3TT1L 1I85A 4XMLL 1OCWH 5CEYA 4IEFB 1TJGH 3FTGA 1LILA 4S1SH 3BDBA 1NC4A 1VA9A 3WHE1 5I17A 2D7QA 5HGBA 5CLTA 5E2TH 3GSRA 5EU3A 5F7DB 3L5XH 2FYYB 1MCEA 3MGTB 2PO6B 3L3HA 1J0YA 5D7JB 4ORGA 5KSAD 2ADJB 1T1XB 2DS4A 2HA1A 3HE6A 5IR1B 4KGLA 3O2DH 5ADOH 5MEOB 4TVPD 2Q3ZA 3X12B 2XN9A 4JGUA 4OB5H 2HFFB 4NQCA 9CGTA 1JNLL 3C9NA 4HUVB 1AHWC 3L6FB 1ZVSB 3AREA 3OKDA 3RJQB 4LVNB 5C2BL 3TJHC 4U1LB 3MQIA 2DL2A 1J1XL 4HKJA 4PPTA 4D94A 3MBXH 3L5JA 4JCLA 4NNPH 3RL1A 3HE6B 3MA7B 3UJTH 1KIQA 4XP4H 1E4XH 3GMMB 4O02H 4TOYH 3HC0B 1TZGH 4NHUB 3BE1L 3T3ME 2AQ1A 1MCOH 1F4YH 3IU4H 3TWCH 4IS6A 3G08B 4NZUH 1FSKC 4MXQD 3TNMB 4M4RA 4OT1L 1LHZA 3IDJB 1F3JA 3S4SG 4OCMC 4YPGA 1U8OB 4KJQD 4BSWA 2MFNA 5C0CD 4X6DA 3EOTH 1NGXB 3STLB 4U1JA 3BZFB 2QSVA 2H6PA 2XKSA 3OX8A 2A83A 3QRFM 4HJ0C 3WFEH 2NY6D 4EI5D 1BOGA 1F45A 3BISA 1TQCC 1A1NA 2GT9A 1L0QA 4KKLC 3SDCD