3MJ8A

Crystal structure of hl4e10 fab, a hamster ab stimulatory for gammadelta t cells
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
SYTLTQPPLVSVALGQKATITCSGDKLSDVYVHWYQQKAGQAPVLVIYEDNRRPSGIPDHFSGSNSGNMATLTISKAQAGDEADYYCQSWDGTNSAWVFGSGTKVTVLGQPNAAPSVTLFPPSSEELKTNQATLVCMINGFYPADVAVTWEADGTPITQGVKTTQPSKSDSKYMATSYLTMTADAWKSRNTFICKVTHGGNTVEKSLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIMULATORY HAMSTER ANTIBODY HL4E10 FAB LIGHT CHAIN
publication title cDNA sequence and Fab crystal structure of HL4E10, a hamster IgG lambda light chain antibody stimulatory for gammadelta T cells.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 209
sequence length 209
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8A01
5DJYA 4DKAA 5HHPA 1CTNA 4J4PD 3I84A 1I1AA 2WK2A 3EO0A 3MRRB 2ICWI 4ZTPH 5F89B 3OGOE 2ZP0T 3ZE2F 4YFLF 1EEYB 3NN8B 4ZO6A 5DS8A 3QAZC 4PJXA 5J3HD 1GVIA 1ZS8B 4MNQA 1TXKA 1KCSH 2GW5A 3KS0H 1NC2A 1U8HA 1AI1L 1S7XB 5J9PA 4OUUB 1ORSA 4PJHE 5F9WB 3U30C 3FONB 1H3WM 4I77H 1QFWH 3PIQB 2DB8A 2EZ0C 4CKVX 4G6KL 2DJUA 5D1XB 4ETYA 2F54B 5EN2B 3MV8B 3Q1SH 3L3HB 4H0HB 3E1F1 4NGHH 4JFPA 1CL7I 1LDPH 3QHFH 4QOKB 1MCWM 4LCCC 5C0DB 1MPAL 4U1LB 1FAIH 3BYTA 1JGDA 5DEZA 4HG4K 3DXAE 1U36A 4UBDC 5FM5O 5D1XA 3DVNB 3KVQA 1T2XA 3GKZA 3MV8A 3QHTC 3Q0HA 1X5LA 5HSFA 1DL7H 3VXMB 3HE7A 1J05B 2YSSB 3SY0B 5JHDD 4HJ0C 3EZ8A 1FNFA 2EDEA 2OR7A 4FFVC 1BF8A 4ODTH 1JV5B 2CSPA 4JB9H 4OUOA 3QQNA 3LH2H 3IYLW 2JJTC 4J6RH 4HZLA 2VXUL 4KROB 3S37L 1FL3B 2KDGA 3SY0A 5LQBL 6FABL 3DMMC 5EZIL 2ZPKL 1P4LB 2GJZA 1T22A 4EVNA 2YD8A 2OI9B 4PJCE 5I1DB 4PJ5A 2ICCA 4Z7NF 1DBBH 2RIKA 4WUKH 3ZKQD 1FZMA 2YWZA 5F9AC 1X44A 5ICXA 1NSNL 2DQFB 5HI5C 3SKUD 5IBUB 3B5HA 1J12A 4UDTB 2HT2C 2XPGB 1X5JA 2BHZA 4BKLA 3TT1L 3JV0A 5I1DA 4K8RL 4Y4KC 4YH6A 1T0PB 2EC8A 1U8IA 3WLWC 1CN4A 3OAZH 3HZMB 4R8WL 1JVKA 1YJDL 3OV6A 1HI6A 3T4AA 4XPFH 2H9GA 1I8IB 2VZTA 1S7VA 4D9LL 1MUJA 2F19L 4JFXA 4ESKA 3GO1H 5BVJA 3DUUB 1Z9OA 1EJOH 2P5EA 2YRPA 5AAMA 3JSSA 3C09B 1C5DA 1BPVA 3RZCB 1D5MB 3QG7L 2HT3D 2ZOKA 1CQKA 5AZEH 3ZTJG 4UV4L 2YUXA 4PRIA 1N7MH 4KUZL 3KPSD 5C0CD 1QACA 5DD6B 2FNBA 3WUWB 1DQTA 2F8VA 5I66B 3ARED 2I9TB 4NM8H 5T1KD 4I77L 4K3GA 5CIPB 3EO9L 3C8KB 5INDA 2UWEB 5D2LB 1JZ8A 5L88H 1HQ4B 4HZAA 4NGHL 4ZS6C 2XKSA 1HXYB 3U2SA 3BWUC 2VLRA 4HLZH 2GSIA 3BH9B 4MWFB 4LF3A 2GITB 5HVHC 4QHMB 5CIPA 1UWGH 3UTTD 4HC1A 4IMLB 5SWQB 1EXUB 5IB3A 2J8HA 3RX7A 3L3JB 4CMMA 3L3DA 3S5LB 3SEPA 4TUOB 4OD1H 4QCIA 1HXYA 4TSBL 5DJ2A 1BQSA 3U36A 3DX8A 2X6MA 4HV8B 2R2BB 3M17B 5IWLC 1MHPL 1OSPH 1CT8A 4IMLA 3ULUH 1EXUA 4ZUVB 5D1QB 4HKXB 4DZBB 2AAVA 3LH2L 3QP3A 1XGQA 2APXA 1NEZB 2R2CA 1DJSA 1NGXB 4JAMB 5F3BB 1RSFA 4XWOD 3M17A 1UB5A 3ZE0E 2ZUQC 5GGRB 3WS6C 2CD0A 4PRNA 4QRUA 1DEEA 2XOTA 1IAIM 2HTLD 2OYPA 4B7LA 4MQXC 1I1AD 1HHGA 4B41A 4Z78B 3FRPG 3MZGB 1DLFH 1KJ2A 1A2YA 4WENB 5GGRA 3MNZA 4KMLB 1NEUA 3JXAA 3WBDA 1EHXA 3RUGE 1CGUA 1AHWB 5D4QA 43C9B 2DIJA 2NYYD 4MNQD 4R4BB 3WMSA 4UDUB 2NNAA 3EJZC 2AJVH 1W8OA 3QXVA 4RIRA 4GKOA 4I5BA 1I85C 4P46A 1AHWA 4IM8A 3CMGA 3ZKXC 4KMQA 3MOBH 3LKSA 2XTJC 5KVDH 1QYGL 2ZCLL 1AIFA 1ZT7B 4R2GD 1OSZB 1U3HB 2NXYB 2DQIH 1CFVL 4KJPD 4OV5A 1S9XB 2X4OA 4I48A 5LCVL 2HFGH 5D1XD 3MV8D 1WWCA 5FYLL 2FIKA 3HE7D 4HIIA 4M7ZC 2W0FA 3DYPA 3IDUA 4QOKD 2IMMA 5BMFH 5C07B 4N0UB 5GPRA 4Y5XB 1S9XA 3VFUA 4JQIH 2EDLA 3T0WA 3OKNA 4JG1H 2GCYB 3G5XB 1S9VA 1WAAE 3WXWL 3IKCA 3L95A 2HT4C 5CSGA 4N0UA 4NWUL 2A9ML 3STLA 2NMSA 3QEQB 4F37F 5J12C 2KQNA 2PN5A 5DJAA 4PJ5D 1MNUH 2GCYA 3AY4A 1GOFA 2R69L 1MWAA 3BYYA 5D7LA 3P2TA 4X7DC 3IF1A 1ES0B 1A6VL 3KPSE 5C0CE 3WLBB 4N0FB 1B4RA 2BCKB 2V5MA 2X4PB 5IVOA 5EIVA 4F9LC 2B4CH 3Q48A 4LRIC 5ADPH 4FFWC 3RRQA 5GZND 2ADGB 1B0RB 1YEKL 5I19L 4FQLL 3PP4L 5JLZB 3V5DA 1CICA 1QQDA 1JPSH 3VGFA 3WL9B 1FYTB 1MY7A 2XI9A 3HC4H 3UTTE 4O9HL 1FNHA 3KPQB 4E42B 3VXUB 4LAJH 1T6VN 5I1GL 3MBXL 2YD6A 4BH8A 1BIIB 1MJUH 2FIRT 5IGXH 4PRID 1SVCP 3WL9A 3ZL4L 4I0CC 4G8GB 1KN2H 3N1FC 4MLSA 2HKHH 5CP7B 3RZCD 3GM8A 3VXUA 3U46A 4C54A 5IHLB 1KENH 2EXWC 5FK9B 4JEGB 3SQBA 3CFJB 1AC0A 4DJMA 1QEWA 3LVEA 4G7YL 3BE1H 3AU1A 1G7IA 4YFLI 1LP9E 1MHCB 2BSED 1X5ZA 1EAPA 2H26A 1NAMB 4RDQF 2OL3H 5CP7A 4OCWH 1M05B 4GW4A 3C8HA 4NZUH 3O3UN 2W1NA 1KPUB 4PRPB 3LKQB 1RIHL 4KC3B 3WN5C 1RIUL 4MDIB 3ARBB 1MCPH 4U6XB 1HK6A 3LKNA 3SKNB 4OI8A 3OG6B 4ODWB 4WV1A 4GXUN 3W5NA 2YD3A 5BXFB 1KPUA 3G9VA 1R5WB 7CGTA 1HEZA 4Y5YB 1E4XL 4X9GA 3L5JA 3P40A 1ZLVK 4YBLB 3MLSH 5TQ0H 3KLHC 2YRZA 3S98A 2NY4B 1B2WL 4NDMA 4LKXB 1FVEA 1JK8B 2VXVL 3GIVA 4XNZB 3S34H 4AIXA 5D1QD 1MFNA 3BISA 5EOQL 2H6PB 4EI5B 4JFYB 1MHHA 2FHBA 4PJIF 1G7MA 2XWTB 1RZ8B 32C2B 3MV8E 4WIQA 3IJYA 3CH1B 4WTZA 4QOKE 3OKLA 4JFYA 3MYJA 2H3NB 3LDBC 2I9LA 1A7PL 3OXRB 3D18B 4JPVH 3SE4A 4P23A 4XPGL 4P46D 1OB1A 5I17B 1DUZA 1LO3L 3KPRA 1HILB 5E4IA 4PB9H 4TRPH 5J06A 1JPSL 1XGRA 4LCWB 5T1LA 2R4SL 3QO0A 2C1OA 2FJFB 4QO1A 1V7MH 3WCYA 1AGDB 4WI5A 4PJ5E 5IVZB 5F88A 1PYWB 4K3JL 3GSXA 4JRXB 2V2XB 4OM0H 3UTSA 4HMCA 1DQDL 1I7TB 1MCSA 4L8SC 5IVXA 2FJHB 1MCEA 3C08H 4KV5E 4HPOH 1UVQA 4RFNB 4RFOH 5GRWA 3C2AH 4V2BA 5B8CB 2VZ1A 1PEZA 1HHKA 2YBRA 1YYMH 4EXPX 1BM3L 4PD4J 4WW2B 5D9SA 3FO1B 3MA9H 4NRYB 3CFEB 5LKNA 4OIIL 2VIRB 4HAFA 4S1QH 1HSBB 4M61A 5INCA 4ZPVA 4ZUTB 4PRBB 3CVHA 1AO7A 4KKLC 4AENA 5FKPB 2DF3A 1A5FH 1AXSA 1LEGB 1Z9MA 2CR3A 1FN4B 4NZUL 1TZGH 4K8RC 5JTWA 2F9BT 4NRYA 4MGXA 1QVOA 2VIRA 1FZJB 1UJ3C 5C2UB 4YX2H 3M8OH 4ZUTA 5D7LD 5DLMH 5HDLA 1LEGA 3FQWA 3OKKB 1T7VA 3GJFH 4PRIE 5CGYC 2FR4A 1FN4A 2WIIA 5HYFA 4Z6AT 3BKYH 4NIKB 2WBJA 3NCJH 3T2NH 2PTUA 5KN5A 2E6PA 3HLAA 3PV6B 1KT2B 5HPMA 1IQDB 1ACYL 4E41A 3B8SA 4LFHD 5JQHC 2HRPL 3A6BL 3VFNA 5FCSH 3ARTA 4U1JA 1T66C 3TIEB 1CICD 4CN1A 4FQHB 2ZUVA 3PWLB 3VFTB 5D2NB 1F45A 4OZIA 4J3VA 3BD3A 1OTSD 5I1AA 1S5IL 1DP0A 1TIUA 3MBEA 2GHWB 3HKFA 1MVUB 2UWEE 5D2LE 4JFQB 4DOHB 1TFHA 1U8OB 5F96H 4R7NB 4KZDH 4N5ED 1KB9J 5EORH 2ADFH 2HRLA 3WHE1 4YHKL 3VXUD 2Z8RA 1XCQB 4JLRB 3RWGB 2GK0B 1KXVC 3N06B 5CINH 3PABA 4LBEB 4XXDA 5T3XD 1U8OA 2EH7L 1N0XH 2GTZA 4FZ8L 3RKDD 1NMBH 2IGFL 5FDWB 3KWWB 5DWUH 1F4WL 1T0MA 2AKRB 2BNQB 4K23H 1MFAL 2J8OA 4KKBC 4LBEA 3TLRA 4MZ2A 4H25B 4XH2A 5KW9H 1LK3H 5IFAH 4OT1H 1MQKH 4LVEA 3BZEA 4GQ9H 3NCYP 1FO0B 3C6SB 4ZUSB 4AIZB 3PHSA 2APVA 2WBWB 2NY2C 1SM3L 2A83B 2CIKB 1R3LB 3RL1B 2DAVA 1Y0LA 4WU7A 4LPXA 2R8SH 4PRPD 3FT4A 3IDJA 3C9NB 5HI3C 5BVPL 5ITFA 1IEAA 4R9HA 4ZUSA 4Q2ZB 3ARBD 4P2OC 4HC1L 4HFWB 4KWUA 2HFTA 2OTUB 4CJ1A 2ICWB 2RCSL 5EBWA 3TZVA 1RZJL 3O2DA 3RL1A 2ORBH 2QJDA 4W4OC 4XNYH 1TDQA 1MOEA 2AQ2A 3OJDB 1NC4B 3I02B 4WTWA 2OTUA 3NGBC 5T1DL 5E2TL 4OGYL 4QWWD 3M8OL 1MJ7H 5JW5B 4S1DD 4U6TA 4F58H 2J6EA 4X4XA 4YBQD 1JWUB 3OJDA 5TQ2L 4NRZB 3UBXG 4DQOL 1JPFB 4XCNA 5E8PB 3LQMA 4EI5D 2VC2L 1WF5A 4L9LC 4IS6A 1UB6B 4S2SB 4P5KB 1TCRB 3BP4A 4P23D 1FVDA 2LFGA 1KJ2L 2DQHH 3K4AA 3G6JB 3KPRD 3O9WA 5SWSB 3GI9H 1JF1B 1U95B 5CD5C 4KI5D 4HW6A 4BFIA 1JPTH 1TPXC 4N0UE 3LSOB 3ZKMD 4OCRL 4P5KA 4G9FA 2YPLA 4WWKB 4OCLC 5JDSB 1MCRA 1QNZL 1WZ1L 3K7UA 5D7LE 3UTSD 4ZAKC 4MX7A 3UDWA 4OD3L 3EHBD 4ZFOB 5IMOA 3LSOA 4AG4L 5FA4B 4F7TB 5I18H 3G5VA 2AS5M 3FAWA 1SJHA 4WI4A 1OD7A 4ZFGL 2AEWA 5KSAC 1KXTB 3JWOL 3E2HC 3DETD 5KZCB 1JNNH 3Q6FB 3WIIL 3NIFE 1IC4L 3VH8B 4YAQA 2APTA 3ROLA 3P73B 1JGUH 1DVFA 3KJ4B 4LDOB 5EZOH 5BS0B 1DLHA 1KLGB 4Q9RH 1EFQA 4APQC 1AO7D 4KDTC 3D9AL 4NHCH 5FXCH 4FZEH 2PXYC 4KKNA 2P5WA 3ULUC 3VH8A 3T04D 4NOBA 4F9PA 4Q9QH 2EEBA 4QXUH 4GQ9L 5I9QC 1H8NA 3G5YA 5AWNL 3GMLA 4U05A 5GGVH 3NACL 3MRPA 3N1PC 1BZ9B 2HFEB 2DIBA 5HYJB 3GSRA 4G8FB 3DO7A 1QBML 3QXTA 4Z9KB 3I85A 1RZFL 4WI3A 4YHNA 3IDMB 2WBJD 3VXUE 4Z7WB 4QRRB 1Z3GH 1VFMA 5T3XE 3KYOB 1MWAL 4UUJB 1BZ9A 4E41D 3PDDA 4HWBH 4XCEA 1QSVA 5DXWA 3SDXF 4U1IB 1IC1A 1GL4B 1KIRA 5DHYB 2VDKH 2Q8AH 5DUPH 3TA3C 2JCCA 2F5AH 3BFOA 1OAKL 4K94L 1Q1JL 4YXLH 1CD1B 1QFUL 4KK9C 2E9IA 4QRRA 1F13A 3KYOA 4JHAH 1DE4B 4GBXC 3D25A 3MBED 5HVWA 1IGJA 3QPXH 4RGOH 5GGTA 4ERSL 1LE5B 1KYOK 1EH9A 3V6ZB 4FQQA 1S9WA 1YNKH 4KHXL 4U6HB 4UOW1 1C08B 1FGNH 1A14H 1PZ5B 4PRPE 4N8VG 5HVGB 3DLQR 2L7JA 4M8QB 3GBLA 3OMZA 1H5BA 3ZDYE 1S3KH 5ELIA 2DKMA 4X6EB 2R39A 4OBSA 3V6ZA 3C5SB 4XMKH 3TWCL 4F33B 1UADC 4Z0BL 1PZ5A 1P4IH 4NZTH 1KEML 5ALCL 4KQ4H 1RK1B 5IEKB 3KHQA 4BZ2L 3VWJC 1I9JL 3VG9C 5GSVB 4JDZA 3WUZA 4DGVH 1LE9B 1QOKA 5BZDB 5AYUH 1FC1A 3B9KA 2BNQD 5E56A 5KSUA 3ZSSA 1P69B 4BK4A 2Y07H 4HGMA 3X3GL 4OI9A 3S35L 5IROA 1IC5H 2VDNL 3IFNH 1LE9A 2BNRB 3L5IA 4Z77A 2V9TA 4Z7UA 5EZOL 3TZVD 1OHQA 3KPRE 2OTWA 4YUEL 4BH7B 4KI5E 1NQBA 5D6DA 4Y1AA 5IQ7H 1CFSB 2EDTA 2HFFB 4M6NL 4I3GA 3WYRA 1FE8H 4TNVF 1BJ1H 4YEFA 4J23A 3UCRA 1A3LH 2B4CC 2A77H 3FQTA 5DQ9A 3QIUC 1FP5A 1VEOA 4M5YL 2Q1EA 2AJUL 3UTSE 3X3FL 1CFSA 3O0RL 4TVPD 5MENA 3SDCB 4NQSB 1JZ2A 4P48A 1FDLH 1JBJA 2FH8A 3OWEA 5EUKA 4GKZA 2EIZA 5B38G 1NGPH 5I15H 4NP4L 5EB9A 3R0MA 2W38A 1T03L 5KANI 4PJDB 5IR1B 1QPXA 3LKOA 4NUJB 1D7FA 1ZSDA 2ED8A 4TSAL 4HCRA 5AUMA 5E0QA 3K4DA 5I76B 5DT1H 1LO0H 3WNLA 3O9WD 1VGEL 5DUPL 4HF5H 2EYSB 2F5AL 2MCPH 1G9NL 2O93L 2X7LA 1XF5B 12E8H 3OB8A 4G9FD 1G6RH 1DQMH 2Q86A 2YPLD 1SBSH 1N2RA 3MR9B 3E6FA 4L4JA 1Q0XL 3EDJA 2B39A 4H1LB 4KJYB 1GGBL 1IEBB 1JL8A 1EFXA 5KS9F 4MXWL 1A14L 5IUSA 1YN7A 5FKAB 1QO3B 5GSRA 3O6FC 4E41E 5EU3A 4ODVH 4XI5C 5GISH 5IESH 4U6YB 2IH3B 1A1MA 5C92A 3Q3GA 4CDGC 1P4IL 5HYQA 4KQ4L 4NC0B 4DN3H 2X09A 2VXTL 4WNQB 1XCTB 5D93B 4PR5A 2P5WD 1T1WB 1YY8A 4OZIE 2CGRH 5FCUH 4GRWB 3QJHB 3IETB 4HKBA 3DRQA 3KYNB 3DUHA 4IIQB 2RAMA 4JREB 4DKEH 5GJTH 1SYVA 4HG4J 3CVHL 3S88L 2YD4A 5D2NE 1T1WA 5ENWA 5F93C 3KR3L 1IC5L 1FLTX 3KAAA 4M48L 3RPKA 1NLBL 4WHYH 4ODXB 2OQJB 5MHSD 1QFPA 2NLJB 4KK6D 4KQ3H 5BOPA 1WEJH 4JJHA 3OR6A 5IQ7L 5JQ6L 2YN3A 2X4NB 1VDGA 4R96B 2FEEL 2B1HL 1ZE3C 5FIEA 4I2XA 4L8DA 4ODXA 2ENSA 3H0TB 4QRRD 4KK5C 3WEXA 1S5HA 3LMJH 4HIEA 4QT5B 5JXED 5IB4A 4X99B 4R96A 3H9SA 3GMQA 2BNQE 4DTGH 1RU9H 1EHNA 2LV4A 5I15L 2P8MA 3EGSA 4YHLH 3NFSH 3BAEL 3NAAH 2XRAH 5ECJE 4NQCB 3VFSA 1EHLL 5DT1L 4Q7DA 3BUYA 1PEWA 4HF5L 1M6OA 4RZCA 1SEQL 3TO2A 1R3HA 1E4WL 4LRNH 4ZXBA 3FB8B 3QUKA 1D5XA 4X7TB 5ADOL 3MRKA 4QHLB 4BYHA 4YPJA 1S7QA 1KCLA 3QYCA 4GRMA 4L9DA 2Y5EA 5ABDE 1JHTA 4GLRH 3QUYC 4TVPE 5GHWH 2C9AA 1YY9C 3B9KD 3D0VB 4R4FL 4L5FH 1LO2H 1R24B 4LVHB 5E08L 2Y4SA 1D6VL 3RNKB 3OKEB 3E0GA 1I1RA 4RA0C 3ZYJA 4KHTL 5C0JB 5GRUH 2LTQB 3V5KA 4R3SB 3UAJC 4Y1AD 1ZT1B 1I3GH 3MRNB 2JB5L 1RUAL 4G9FE 1I7RB 3G6DL 1VACB 5FCUL 1CFQB 1EGJA 1BZ7A 4M7JL 5HGDA 3LOWA 2J12B 5IBLD 4QGYA 5SWSE 3H3KA 1G9EA 3HRZA 5K33A 3O2DL 5GJTL 4UAOC 5CZVH 5MEND 3MSPA 1I7RA 2PNDA 3VXRB 4M9PA 3BQUC 1AE6H 4KTDH 1T1ZA 1P7HL 3TGXA 1MCIA 2R2HB 2YD1A 5HHXL 2CUIA 4KQ3L 3TH2T 2A9NH 2J6EL 4JN1H 4TVPL 1NFDF 5GGTH 5MEOA 4FXLA 1WQVT 4WUUA 1GZPA 1P7QA 1F97A 4KAQH 1HH9B 2VMFA 5J11B 2GIYA 4JM4L 3LN5A 5DD0L 4PRHA 2D03L 1AP2A 1U0QA 1AD9B 4R6UA 5BS0E 4UMGA 4L4TB 5CEYB 4IOFD 3TNMA 4DTGL 5GS2H 4IOIA 3GBMH 4EDXA 4QRSA 3GSVB 3PWNA 4UNUA 1S7RA 1EFXD 3NFSL 5HHOB 3DGGB 3UTQA 3MNVB 1E27B 1U3JA 3V6OC 4GOSA 5MHSE 1JPGA 4EQ2A 1I9EA 1N5YH 3VI3E 3GSVA 4OGAD 4OZFA 1JRHL 4DFIA 4OCXH 3TPUB 2AXFB 1OAZH 3BP5B 3G08B 4P4KB 4P2RB 2CXGA 3QHZL 1NCCH 4FS0A 4PJGF 1W0YT 3F6LA 1E27A 3EYFA 5E8EA 4NYLA 2DQTH 4Z7WE 4QRRE 4JKKA 2IG2H 3P77A 3VD7A 1GHFH 5KVFH 4JGJA 1AR1C 4P2RA 2PTTA 3HR6A 3IJHB 2PW2B 3FQXA 1JNHA 4ZMAT 3B5GA 4L5FL 2E7LC 4P2CG 4K94C 1NCTA 3A6CL 2PKDA 3T4YB 2CLVA 1RIVH 3OKMB 5ACZA 4HUUB 2H41A 1QA9B 4OV6F 1GZQB 1QR4A 1UJTA 5IBTL 1B88A 3AS0A 3MV01 3RJQB 4P3CH 5E70A 2IQ9L 3FQNA 3HAEB 3PGDB 2I26N 5SX4I 1RMFL 2EDDA 3OKOA 2DQGL 1FFPA 4O2FB 4HUUA 1T0NB 1FNAA 1QSFB 5BV7L 4X83A 4UI2A 2YD7A 3ROOA 2JJSC 4Q97A 3O6KH 2FL5A 3NPSB 3C60A 2FX8L 4JO4L 5CZVL 3H9SD 3PGDA 5DYOB 4EOWL 3H8NA 2Z4QB 1CFNA 1UACH 2O5YH 1AE6L 1T0NA 2W65B 4I0PB 2AJZB 4KTDL 1QSFA 5DC0A 3MRJB 2W0KA 3RWIB 4K3DH 2O61B 3KS0J 3NA4A 1QLRB 4YC2C 1NGZA 4JN1L 3FOMA 5GGTL 1C5CL 4I0PA 4XP5L 3RGHA 4XP1L 5F21B 4Y1AE 1GPOH 4H5SA 3MRJA 4KAQL 4HJGA 4ZXBD 2BNRE 2O61A 5HGBA 1QLRA 4WEMB 1U8MA 2CRIA 2F74A 2G60H 5IFJA 1NBZB 1F90L 3VXTA 4M93C 4H88L 3VFMB 4YQXL 5MENE 3KPOB 2I07B 3QIBA 4I3SH 5CGMA 1XIWB 3BZ4A 4KRPB 3UJJL 4RNRA 3HI6H 4F7PB 4HKJB 1EEUA 1N5YL 5FYJD 5E6ZA 1HKLL 2BNUA 1ZHBB 3KPOA 4OCXL 3ZYIA 2I07A 2Z92B 3BVNA 3MCG1 4M7LH 1R3JA 1NCCL 5GRJH 4EUPH 1XIWA 3CSBA 3KDMB 5DJ6B 3REWB 4F7PA 4BFBD 2DQTL 3ALXA 4PJFB 1LNUA 4U0RB 2Q6WB 4PJDE 2IG2L 1W72A 5GGUB 1A7BA 1GHFL 1Q9LB 1PAMA 3NABH 2Z92A 2YPKA 1WT5A 3SE9H 3SOBL 2X4SA 4MJ4A 2UZYB 1MCBA 4ZFZA 5DJ6A 4JO2H 5HYSA 1QTYT 2OJEA 1YDPA 4PJAF 1LEIA 2A0LC 2P1YA 4Y16B 3OR7A 5C0NC 3TBVA 1WZMA 4ONOA 2BSRB 1NGQH 3TCLB 4F57L 3KLAA 1UH2A 2P46B 4U1HB 4AL8H 5CZXD 2DN7A 2EECA 3CFCL 3NCYS 2Y1VA 4P3CL 4U33A 4PV9B 2EH8L 1N64L 3PP3H 2IFFL 4YK4C 2XNAB 4WUUD 4HK3J 1P7QD 3L3KB 4FA8A 3WIHA 3MLVH 3PGFH 2AEQH 2R56H 4WU5B 3O6KL 2D2OA 4PRHD 3TYFB 4HCRL 2DQEL 1HOCB 4GXVL 2AJSL 3LN4A 3VXNA 2XG5A 2EKJA 2QSCL 3L3KA 5I73C 1UACL 3LKRA 4ZD3L 3IDXL 5D1ZC 4JRWA 4MD0B 2Y36H 4UQ3B 4F15C 4K3HA 5D6CA 2Z9TA 4WU5A 5AZ2L 3RAJH 1FJ1A 4ODBD 4GRWE 5TDOB 3UEZA 4NNPH 5C7XH 4L4TD 4U1NB 2VXSH 5DUMH 2Q76B 4GG8B 4XRCB 4MMXC 3RPIA 1I1FB 4PIRF 3ULSB 1DN0A 4HUMB 2BDNH 3MJ8B 4I2XE 4XNXH 2AW2A 4H0IA 2WWKT 5ERWB 4I3RL 3MQIA 1TVBA 3MRGB 3D39B 4XRCA 1M7DA 4P2RD 3H9SE 1I9IL 4LSRH 5IB5B 3BXNB 4PY7A 3BGFC 3MJ8A 1KULA 3LQZB 4JY4B 1J1PH 4GS7C 4P5TC 5DHVB 4NPYA 5ERWA 1A8JH 5FM5M 15C8L 4X6CB 4Z5RB 2R0WH 4PJ8C 2EKSA 1UM5H 5GS1C 5IB5A 2Q8BL 4IRSA 2VDLL 3MRHB 5D5MB 1Q9KB 4M7LL 3ZE2E 2QHLA 5GRJL 2FO4B 4C56B 2NXZB 4OF0A 5DD1H 3DTXA 1AQKH 4NQCE 4X0KB 4G42A 2FZ3A 2NY3C 3G6AB 1CBVH 2B1AH 3A67L 5J8OA 3MRHA 2BHYA 3MX0A 4ODSL 3ARDA 1IMHC 1KF9B 4NJAH 3C60D 4C56A 4JHWL 3MMEA 1RULH 5EBGA 3IKKA 4X0KA 3WS3A 3P4NB 5ALBH 3L3OB 3U0TA 3X11B 1JZ6A 4Y4HC 4EDWH 1QSFD 5AAWA 3SJVB 4S0SD 2F58L 1GAFL 3TH4T 3ARVA 3RGVA 3QXDA 1I9RL 5FYJE 4HFUH 4WHTB 5AG8A 1U6AH 4NM4L 1MIML 4G6FB 1H9VA 4MCYB 5DR5L 1HINL 4PJIA 5GZOC 1NAKH 4I0PD 1PKQA 2OJZL 1KSRA 5IW3A 4B7IA 4XAWL 3BP6A 5F6IC 4LPVA 1OL0A 2R56L 3HZYB 1S7TB 1K8DA 1WIOA 1WCQA 1F2XK 2A6JB 4LU5H 4MCYA 3KYAA 2R4RH 1C16B 5I8OH 1IGML 4EN3B 1A6TA 2E9BA 4KZEL 1X5AA 3ZHDA 3FO0L 4HBQA 4P2QA 4WO4C 5JUEH 3H9HB 3QIBD 1OAXH 3RAJL 1D9KA 1RJZA 1Z5LA 5H35B 2VAAB 1ZANL 2CDEA 5M7QA 1G7HA 1BD2B 5F7YC 5IBUG 2ZSVB 3RVTC 3QRGL 3D85B 5DUML 4Z7NE 3DV6B 4FQ2H 4G6AD 3SO3B 2NY6D 1YA5A 1WVZA 4GKSA 5JXAH 1XIWD 3CFIC 4XBGA 2CKBH 4KKAD 4N0CC 5TE7H 3O6ML 4PRHE 5FYJL 2COQA 1WLHA 5DFWH 4S1SL 1TZHB 1DFBL 1LEKB 1C12A 7FABH 2R0KH 3TJHC 2ATKB 1EMTH 2OCFD 3B2UC 4MSWA 1JF5A 3VRJB 1EGJL 5E8OA 4I4WB 4L4TE 2V5SA 2NW2A 1BQLH 1HHJB 5C08B 1ZLSH 3SGKA 3QEUB 4M9OA 4NO3A 1ZLWH 5DGQA 3VWKC 3ESVF 3OHXA 3BWAB 2H2PC 3IFLL 3Q6GH 2FHFA 3VRJA 5GRXG 5L0QC 2EDXA 1X3DA 3SDAB 1V3KA 2AVGA 3BEVA 2DIAA 3QEUA 5EC1A 4Z76A 4YHOL 5C0EA 4XPHH 4XNQA 4GUPA 4OB5H 4P2RE 4LGSB 3IDIA 2E8ZA 4YDIH 3BWAA 4PJ9A 1A6WH 4XPAH 5IW1B 3V7AG 5ALBL 3CCHA 3RTQA 4NWTH 3DRTB 2QSVA 4WHDA 4XWGH 3T0EA 4NQDA 3CZFB 1EVTC 1YMHB 1WCBA 3MRQB 4I18B 4PGJA 5GS0L 1YZZA 5I30H 2MPAH 3GDBA 3MRDB 4YFDB 1DVFC 1V5JA 3DHJA 3TBSB 3MC0A 1YEIH 4YHIA 5I1JH 5BZWB 3UXFA 3TBTB 2K7QA 3NZ8A 4NN5B 9CGTA 5D70H 4P3DB 4HX1A 4KJQD 3PWVA 3CZFA 4YO0B 2AEIT 4G80B 2VYRE 4WGVB 3ZYZA 4P57B 1T1XA 4LU5L 1UM6L 5CMAB 3EOBA 3MXVL 1GIGH 4DW2L 1NMCC 4RISH 3STZB 5I8OL 1AGEB 3SKOB 1CYGA 4NO2B 5ESVB 5JOFB 1ZLUH 5F7EL 3F7YA 1U92B 3DI2B 3ZMRA 1QSFE 4OZGA 2ATPA 3TN0B 3J7HA 4BSVB 2HH0H 5H2BA 3QDMB 2KL6A 5DK0B 1OM3H 3VRIB 3UBXI 1MI5A 4IRSD 5GXBB 3IAPA 4MQ7A 1E4KA 4OAWB 3E8UL 1FVCB 2P45B 4ZYKB 4X6DF 5ID0A 2CKBL 2IF7A 1L9MA 3LV3A 1PLGH 2UYLB 5L2KA 4JRYB 2ICES 3QZWA 3ARDD 4OAWA 4HAGA 3RQ3A 4C56D 7FABL 1J0HA 1A7NL 3HUJA 1RY7B 1MRDL 2NTFB 2CRYA 2VLMD 3EW3B 4NCC2 4LLWB 5D7IF 1NUNB 3JVGC 3RGVD 2C3WA 3QUXB 1GC1H 1NGWA 2EEAA 2E6JA 4LHQB 5E8DH 2NY1C 1XGPB 1XF1A 3EYSH 2WLYA 2FJGB 4RWYH 4K7PY 3S9DB 4ZQKB 3L3IA 5CJXA 1IM9A 3O3DB 2RQ8A 2A6IA 3EKCA 1X4XA 4OB5L 3EFFB 1A1NA 5TE6H 3CDGA 1GH7A 4XC3L 4JPIB 5CWSB 4GRLB 1HE7A 4P2QD 3S3PA 4IJ3C 4D8PB 1KYOJ 4G8EA 1NGYB 1D9KD 3MV9B 3OZ9L 4JE4B 4JG0H 4LFHG 3BZFB 4JM2C 3V5HB 5I1JL 5GJSL 4GRLA 4OM1H 1I8MA 2C5DC 5B4MD 2EYRB 2ZWLT 4M6OH 1F11B 2DYPB 2UZIH 2QKIB 4CVZA 4HUVA 3RVWD 2GAZA 1GJIA 1S9KC 1QRNB 3V8CA 2P7TB 4RGND 3TBWB 2OK0H 2GQHA 4FXKB 3WJLA 5CJOL 4MAYC 2EYRA 2BP3A 1F11A 5DMYA 1MHEB 1QLEH 3C2SA 5I8EA 1DBKL 1JN6B 5EU5B 1QD0A 4NN7B 1A6ZA 1UM4H 4IDLA 3T1WA 2FX9L 1W72L 3X13A 5F1KC 5DJDA 5F9JB 2UUDH 1RUQH 2J8UF 3GB7B 3KXFB 5EU5A 3FO2B 4O02H 4KK8D 1CDUA 1A64A 5ESQB 1XR9B 5C0AB 4RWHA 2XQBL 4L3EA 1JTOA 3WNNA 3H7LA 1E6OL 3OKDA 3S8WA 1B0WA 2D0GA 5TGBA 1PSKH 1IM3A 4HBCH 3IU3B 4PJ9D 3SDXA 4Y5VA 4ONGL 1AR2A 4D2NA 3RTQD 1W0VB 1EAJA 4XBEH 3WIHL 3T0ED 4NQDD 3O8XA 1T1YB 2VDOL 4MHHG 3B3IA 1JFQH 1L0QA 2X5PA 3IDYC 4ZSOA 4X4YB 3BIKA 4GG6F 5FO7A 2G9HB 5KSBB 2GFBA 4KI1A 4RWYL 2VWEE 5HD8C 1IAOA 3HN3A 2VXQH 3PL6C 5DK2B 4BSJA 1U8QA 1T04B 3AS3A 5HI4D 5ITBL 1W2KT 2AJYH 4YGVA 4ZNEA 2PW1A 1CF8H 3MJ7B 4C56E 3MLZL 1OLZA 1T89C 5F8QC 4WTZG 4M43L 3MACH 4HS6A 1MRCL 5BCAA 4X80L 1T04A 2VLME 4FG6C 4OLUH 4BZ1H 5EO9A 3FQRA 1RQ5A 2Q7YA 2NY7H 3GIZH 3S36H 4DEPC 1JGEA 2ZSWA 3ULUF 3MJ7A 3H2WA 2ZOLB 4PUBH 1B4JL 3QQ4A 1MI5D 4YDKH 4PJIE 1HWHB 1ZLWK 1NMAL 1V3LA 4UV7L 2IAMB 3RY6A 3SJVE 5DO2C 3HC3H 5I16B 2G5BB 4YIQB 1GGIH 4GW1A 4RMSA 2Q87A 1HSAA 1X7QA 1DBMH 4S10A 1CWVA 4OLXL 4G7VL 3SBWC 4LNRB 4WTXA 5EZLB 3ARYA 3SCMA 3NIDF 4BSWB 2WINA 1KIQB 4PLKC 4NQVB 1H3UA 3ECBA 2D4DA 4NKMB 4QHNA 4RBPH 5CBEB 4P2QE 5T3XH 5E9DB 1KOAA 3DSFL 3A6OA 4R7DB 1J88A 4XT1C 4JRYD 3MRIB 5I2IB 1DEDA 2CK0L 3QIWA 3LRHA 4OFKA 4N1EA 4X9HA 4ELMB 1VGKB 3VFPB 1DQJB 3SQOH 4NUGH 3LS5H 5IP4A 3MRIA 1BD2E 4HMDA 4NFDA 2NR6D 2B20A 3T1FA 3EOTL 4R0LC 4RGNE 4ODUB 1NAMH 4XVJH 5LXGH 5HYEA 3QUMB 5JZ7D 5CGTA 4MD5B 3MRFB 4IRJC 3IS0X 1IRAY 1DBJL 3IXTB 4XCCL 3JTTA 5HHQB 4J8RB 3VFWA 5GGQL 4R4ND 2HKFH 5IM7B 1QHPA 3MV7A 1IGCH 3V6FB 5F3HB 4MD5A 3BRGC 4O4YH 3MUZ1 3T65B 4MB4A 4GRLD 2CIIA 5DRNA 5TF0A 1S9YA 5J13C 4JQXA 1YEFL 4QNPF 1EPFA 4S1RH 3U7WH 1CU4H 3UJTH 1IKNC 2VXQL 4J12A 5KS9A 3QPQC 5SX5H 2D7MA 3CVIH 3T65A 1MFDH 3ZKND 3ZO0A 3QEGH 3NMEA 4F37K 1F4YH 1FRGL 1RUPH 5DJ0B 2YEZA 1U93A 5K93A 4LIQE 1UQSA 2BVOA 5CEZL 5HDQL 2Z31C 1QRND 4BZ1L 4HDIB 3ARGC 4NQDE 4Q6IA 3LQAH 1DUYA 5IT2L 1W0WB 3MCLL 3NFNB 2APBA 1K9TA 3R06B 2EDHA 2JK5B 1U8KA 3KPPB 4LASL 2MKLC 4JZJB 1JZ7A 4PV8A 4PJXF 4Z0XB 1RPQA 1J11A 4L3ED 3VGBA 3B6SA 4PRAB 3MJ9H 1M71B 4PGDA 4D0DA 3L5WB 4ZOEA 3PWUA 3OQ3B 2V5TA 2FB4L 3U7AA 5JW3L 1S7WB 4RAHA 1KIUA 3FMGH 3QDAA 1IAIH 1IQWH 3MO1A 1JWSA 2H2SC 2XKUA 1R3KB 2DLTA 5EULV 3O8XD 1KTDB 2IALB 4YDLC 2FEDC 4HHAB 1AXTL 4DGIH 4TUJA 1MI5E 1CLYH 3GK8H 3O4OC 2ARJB 5E7FA 1XF4A 4O2EA 3U9PL 3CMOH 4R97C 4HULB 3P0YH 1G7PA 1T2JA 3C5ZA 4JDVB 1R3IH 4O51B 4FP8H 4RGMC 4D9RD 1AY1H 1A1OB 1ND0B 2MSPA 4JFDA 3TO4B 2ESVA 1FCCA 3L7EA 3M45A 5JR1H 4NQEA 5AG9A 3F58H 3HE6B 4OFYA 3WDIA 4JRYE 5DZOA 3H7BA 4ZTOH 3QNZB 4QTHB 3VXQB 1U8NB 1I7ZA 3KNBB 1IZJA 2X1PA 2MCG1 4ZS7H 3O45B 4G9DA 1Q94B 5I1IH 3ARUA 4MJ2A 1F42A 4JANB 3CSYB 3IDNA 5KVGL 5JOEA 3BKMH 4YXHL 2E9JA 5HJ3B 4LSTL 3GJEA 4HK0A 2XWBA 3BGMA 2X4RB 3LPWA 4JANA 2MWCA 3P0VH 5ESAA 2YHGA 2OZ4H 3QIWD 3FTGA 3G9AB 1FNLA 2QADC 4N0YL 3P30L 3T3MF 1ZT4A 2DTSA 3N85L 3VH8G 2V2TB 4XB7A 1NFDB 3SE3C 2HG5B 3RL2B 4AT6B 3KLDA 3NCFB 1F3DJ 3Q2CA 3FB5A 2HTKD 3JTSA 4LCUA 1JYXA 1IAIL 1A0QL 2X42A 3WV0A 1ED3A 3UJIH 3W2DL 5L6YH 4JPWL 3U30B 1QRNE 1FO0H 4KROC 3UTZB 1QSEB 1KJMB 1ZGLB 3MV7D 3PHQA 2WUBL 3RWDB 1NL0H 4Z8FL 2OI9C 3NA9L 3DROB 3EYUL 4ETQA 4YEEA 3OJVC 2R1WA 4PJEA 2I5YH 2MTPA 4XX1G 2WWKO 4ORGB 1ZGLA 2G2RA 1A02N 3P0YL 1IGYB 1DQQA 3HPJB 3U48A 4L3EE 4LMQE 4WJ5B 3ZZ1A 3DROA 1FNEA 5IF0B 2CDFB 5DUBB 5DSCB 1WT5C 1KUMA 4LCCA 3W11C 2XZQH 1OD9A 4YPGA 1OAUH 5C0AE 5J1TC 3U1SL 3SDXE 5MERB 1QBLL 5KVEL 2OSLB 5C8JA 3BEWA 3PWPA 1NANI 4PJGA 3IU4H 2I60H 2B2XH 2QR0A 1YPZB 2VABB 3C09C 4M4RA 4U1KB 3RWCB 3I6GA 1CL7H 4KUCF 1D5IH 3ZTNH 2W92A 4ISVB 3RU8H 2JJTA 1TNNA 4J2XA 4AQOA 4FXGA 2P47B 3DMMA 1AQDA 3MGAA 4X5XB 4NCC1 2VRAA 5JA9A 4U1KA 1HYSC 4D9RE 5D8JL 1GC1C 3PNWA 2E5EA 4ZNEE 5SWZB 1KTLA 2CO6B 1KCRH 1FFOB 3QDGA 4YHYC 4I0KA 2X89A 3LZFH 4PP2A 2XWJB 1WC7B 2X9XA 3EYVA 3QCVL 5E2WL 3U9UA 1Q9WA 4Y4KA 2DWDB 3IXAA 1TZIA 4HJJL 3VW3H 1C8PA 5JW4M 3TV3L 5FAAA 4E9LA 1KFAH 4YHPB 3ABZA 5TF1L 3B9EA 1UKTA 1KB5B 4DVBB 1YEDB 4UQ2A 5JIIA 1K5NB 2C7UA 3TVMB 3MRCB 3GMOB 5C6WH 3BPOB 5HYIA 3C5ZD 2GK2A 1KCUL 3MLWH 3CFDA 3KPLA 4DVBA 4O5LH 4ZDHA 4QXTB 1D6EA 3UBXB 3GMPA 4JFDD 3KPNB 1FH5L 2VISA 3GMOA 1KCVH 1E28A 2IPTH 4PS4L 4NQED 3ARPA 5E6IB 5LGJA 5CLWA 4OFYD 4QY8B 2DBLH 1P1ZA 4NC1C 1XZ0B 1K8IB 3VXPB 2MQ0A 4Z95H 3WKNA 2I5YL 4HIXL 3WE6A 2VL5B 1WUNT 3TESA 2DWEB 5E9DE 3UPRB 4U3XA 1XF2B 2IPKB 1O7VA 2VE6B 4V2CB 1UWEL 1SJXA 1ACZA 2XG4A 1HZHH 4KTYA 5BO1L 2XFXB 3MV11 5F1NA 2GSGA 1E4XI 4XGZB 4Q74A 3BHBB 3H42H 3PHOA 1ZEAH 1IARB 2VZSA 1A7QH 3U6RB 3MV7E 3E3QC 1F3JA 2PYFB 5FF6A 1TVHA 1LVEA 2B2XL 5I8CA 3T0AA 2ZUQB 5IWLA 3BHBA 1U3HC 4PREB 4CBPA 2NXYC 5KSVB 4TSCL 1YNTB 2KZWA 5IHZA 3CK0L 4Q0XH 1B9ZA 3OF6A 4PJAA 5KS9E 4QRQB 1WBZB 4KJWC 3WS6A 4UTAL 4HWZA 5BOZG 1YNTA 4AEIH 3DO3A 4Y5XC 1WFTA 3QQ3B 1H8SA 1UYWH 5DRXB 4A6YB 3QWOA 2D7TH 4OLEA 2QQNH 4LCYA 4M02A 4XMPL 1WBZA 1YYLH 2Z91B 1MCJA 4YE4H 4XVSH 5D7JC 1G9MH 3CU1A 1QBBA 2Z93A 3LEYH 1DDHB 4CL7A 4HWEL 5TDNA 3VW3L 3B9DA 2XTJB 2F53A 4PBWD 3TFKC 1I85A 1QSED 1TETH 4DZ8B 2EZ0D 2E7CA 1R0AL 2GY7B 4DAGL 2V5RA 1ZVSA 5F6HJ 1N6QL 5EU6B 4ELKB 4P5MB 4XZUB 1QKZL 1OGTA 4NZRH 2W60A 1R5VA 4ONFL 1NCUA 1N4XH 3BKCL 1JHLL 1ZA6B 1ZHNA 4O58L 2IPTL 2FLRT 4N8VB 3WKMH 4PBVC 4UBDD 4PBXA 5CSZB 4KTEH 1A3QA 4YHZH 5GIRA 4AH2A 3B8YA 2MQCA 5HGHB 1INQB 3CXDH 3DV4B 4XP9H 2XQYK 3MROA 3EO1A 3MUGB 4ZO8A 5BJTB 3AS1A 1F4AA 1KJVB 4HJ0D 2K1MA 1WWBX 1L7TH 5F8RC 4FFVD 1OAQH 5J12B 4RMRA 5CSZA 2ITCB 4XC1H 3SHSA 2B0SH 3GMNA 3RKDC 4YR6A 3BKJH 2PUQT 3W39B 4D9QE 1HZHL 3DMMD 5C86A 5A3IC 1UG9A 1YEGH 2HJFA 3WFEL 3ELAT 4QTIL 3PUCA 3QWQB 4JKPL 1RVFL 5HI5D 4H1LH 4NQEE 1D5BA 2X89D 4CUCA 5EC2A 4Q58C 1UXSA 5J6GA 3THML 5ANMA 5A2JH 2HT2D 5DVMA 3DX9B 5EA0H 1A3RH 1OAYL 4ZUUA 3TBYB 3HNSH 2VKWA 4Y4KD 3I75A 5CSBA 2FSEA 3EJYC 4OLVL 1HWGB 4P9HL 2F8OA 4PJ7F 3F12A 4LRIA 3WLWD 3ARBC 5IVXF 4HUWB 4P4RB 4OD2A 1CFTB 5J6HB 1ADQA 4HIJB 4BELD 2GEEA 5H37H 4K71B 1NDMA 3FB6A 1U8LB 4Y5YC 2AXGB 1UENA 4FABH 3D2UB 4N8CL 4P4RA 3VGGA 3WDHA 4HIJA 4GRWH 2IWGA 1JMXA 2NY4C 1IBGH 4ZO9A 4X8JB 3GSWB 3CUPB 2R23A 3MXWH 2EC9T 5IIEB 4HLJA 3W9EB 2XZCL 4R26L 1FIGL 4KMTL 1E4KC 1WTGT 4RMWA 4JHBA 4M6MH 3HA0A 1TJHH 3PWJB 4P2YA 1J1XH 4PP1C 4QRPB 5TDPB 4XCFL 3LQAC 5EOCL 2DMBA 5C0GB 1SMOA 4ZS6D 2IBZY 2W9EH 2YC1B 3V7MA 5J1AB 1WITA 3PWJA 5E5MA 2VZVA 3FL7A 1NFDE 3G5ZA 3WN5A 4ALAL 5DD3L 3VA6A 2VDQL 5GGVY 3MOQA 5I74B 3QXAA 3V4VH 1MLCA 5EBLB 3CXDL 4ENEC 3GSNA 5IV2B 1BFVH 4OZFG 5E94A 4E5XA 5DJCA 2JIXA 3RDTB 5IKCA 2ZJSL 3QFJA 4Y19B 1LK2B 1QSEE 2O5ZL 4JPKH 4HKZB 3OF6D 3P9LA 1XR8A 3F65A 4RFNC 4MA7L 1JGLH 4Y2DA 3T0XA 2XZAL 1X5IA 5B8CC 3HCVA 1OP5H 2DD8L 1OOAA 2OXGA 4WW2C 5DI8B 4CGTA 1X4YA 2BHUA 3V2AR 4WW1A 3O11A 4MQXD 1TTGA 2DQCH 1I1CA 4EI6B 1G0XA 2A74A 4G6MH 4BJLA 4HT1H 1IGFL 4ONHB 3G04B 4PJGE 3MCKA 5T3ZL 4WY7H 3UO1L 3RX5A 3GI8L 3EJZD 2F53D 4FN0A 3QULB 1CGWA 5CKAA 4JJ5B 1T4KA 3WXVH 3R4DA 3U7YH 4O2CB 5C9JA 3HB3C 2DLFH 1F3RB 5E95B 4TN9A 5IEHB 1HDMB 5I75B 1HHIA 4L8SB 1NUDA 2QHRH 1H3GA 1KG0B 2XTJD 1G7LA 3R8BB 1KN4L 4OGXL 4JJ5A 1JUFA 2Y6SC 1M1SA 3EZJB 1F58L 4PJHB 4OLZH 1JIBA 25C8H 1N26A 35C8L 3CC5A 3AM8C 1J8HA 4TUKL 3F7RA 2KUTA 4RMVA 1ZHLB 5M94B 2AERT 1LO4L 5D2NC 3WFHB 1U8PB 2HVJA 2NY0C 1N3NB 3L5XL 3CLFH 5AD0A 2FGWL 2LABA 3RY5A 1NDGA 4M6ML 3UMTA 2E9WA 2H32B 1J1XL 1CZ8L 4MCZB 5DRWA 5LAXB 2C1PA 1UJ3B 5DEFA 1KLUA 5EOTB 4X6DB 2HT4D 3BN9C 4Y4FB 1RUKH 4C58B 3QI9B 3VFRA 3BT2L 2HLFC 2PYEB 4CW1A 4ZODA 2DQJL 3KYMA 3O4LA 5LVEA 1U58A 1UJ3A 3P4OA 4J1UB 4AJ0A 2BVPA 1UZ8B 3JV4B 1FBIL 1EO5A 5C0IA 2CXKA 2HWZH 1S8DB 4Z7VF 2XT1B 2KQMA 5IQ9A 5JPMA 1I4FA 2IADB 5D7IB 5C0BA 2V2WA 3UC0H 2AI0L 4J1UA 1NJ9B 2JB6A 2VDML 4FFWD 4HPYH 5CILH 4YHMH 3I6LD 1FORH 5BRZB 1FZKB 2OX5A 5FYJU 2YOCA 1G6VK 3CLEL 1RZ7H 5D7IA 3VCLB 1A6AB 5HHMD 1BOGB 1F6LL 1G7JA 1NCNA 1REIA 3VXSB 5HYSG 5IJVA 5A2LH 1FZKA 1K6QL 1RZIB 3MTRA 1TMCB 3MLRL 3ARFB 2YA1A 3KPMA 1BOGA 3AAZA 5I8KH 4K7PX 5F1IA 1BVKB 4DGYH 2R29L 4Q6YA 5DZLA 1L6ZA 3R1GH 1YQ2A 4U6VH 3E6HB 1FNGB 2EXWD 5I1CL 3O2VH 1U41A 2DLFL 1YUHA 2EDQA 1NBYB 5C2BH 4PJAE 3DVGB 1U8JA 5I0ZA 3SDDB 3HAEH 4XCYA 1K4DB 4D0BA 5TH2B 2CRMA 1FFRA 5IB2B 3UZQA 3SCMC 3U83A 1NPUA 1FNSL 3CX5K 4H20L 2MMXA 4JZNB 1CG9A 3QNYB 3P11L 1SMAA 2JCCF 1VESA 1Y18A 4FRWA 5DRZB 1KPVB 1HIML 3CLFL 1XGUB 4L8BB 4WWKC 5A16A 2JIXD 2HJLB 2H45A 4P2OA 4XNUL 1KEGH 1WFUA 5ETUB 2J8UB 3NGBB 5T5FH 1ZTXH 3KLHD 4MHHI 1BVLA 5DTFA 5TPWH 4F7CB 3HS0B 2UVEA 3GUTB 4Z7OF 1OARH 3INUL 4W4OA 3FB7A 4JY6A 1NFIA 1KPVA 4JFZH 3LAFA 1F8TH 4POYA 2EO1A 2XTJE 3VGHA 1P4BL 2G75B 4MDJA 1CGSH 5F7MC 4Y19D 5A2FA 4F7CA 3KJ4C 1ETZA 4MZ3A 5FHAL 3IFPA 3S3JA 1R6VA 1ADQH 4LKCB 4M62L 4PRDB 4F7MA 1VADA 1YEJH 4EEEA 4WFHD 3V4PL 4PFEA 4MD4A 1YN6B 4P3WA 3EAKA 5JDJA 5LGHL 4L9LA 5F7DA 4HS3A 1N8ZA 3L5HA 3GMRB 4LLUB 4CJ0A 4LKCA 3T3PF 1MCCA 3EBAA 4WVRA 5CS7A 3I6KA 2FYYB 4JKWA 3MFFB 3GSOB 3BESR 1RZ7L 4XNMB 2EDRA 1D3CA 2FBOJ 4NKOA 3ES6A 1KTRL 4GAJL 4L8CA 1QR1A 5JHDB 1I8LC 4JM2F 3GFUA 5CUSH 4UTBH 5FOJA 4Z7UF 5A2IH 5KSAB 3T77B 3E2HB 5JXEC 5CCKH 4GG6A 2WUCH 4GAYB 1EA9C 4ZAKA 1ONQA 3BOVA 1BAFL 1N0LA 1J8HD 1WZKA 4Q6IC 1TJIL 4J3XA 5FV1L 3SKMA 3K8LA 5ANME 3MLUH 1CGXA 4QKXB 1SEBA 3ZKSD 3R1GL 1Q72L 1L4IA 1KNOA 2Y7QB 2PXYB 3BPCB 2X4TA 3KLSA 5DQJB 3OGCA 4RFEA 1T80A 3I6LE 2CPCA 3HI1A 4PYHA 1UA6H 2P8PA 4RAVB 1U91B 4APQA 5KAQG 4KKLD 4KDTA 5FA3B 2Y7QA 4FNLH 5HHME 2PXYA 3RWJB 4HSQA 2X40A 2VR5A 1AKJB 4K8RD 3O4LD 2JELL 4OZ4B 2FD6L 4X7SL 2VN4A 1S78C 1VPOL 4LSQL 1YNLH 1I1YA 4XVTL 4UIMB 4AM0B 4QYOB 5CGYD 4Y4FD 4FFZL 4X6BB 5HY9A 1AKJA 2FEEI 2AK1H 3TA3B 1NCWL 4GH7B 5C0BD 1SHMA 3RIAF 4TNWK 3MLYL 1JHKH 4PTTB 4UIMA 3TC9A 4AM0A 3B2VL 3V0WH 1U2CA 5CD3A 2V9QA 2BC4B 4DKFH 2YA0A 1MJ8L 5DQDH 3CFKA 5HVFB 2BJMH 1G9MC 4K7PH 2NY5H 1OVZA 4UIKL 3UZEA 3TA3A 1T66D 4XP6H 3KPSB 2VH5L 4HIHB 5H94B 2JJVA 2MHAB 2ZKHL 1JNJA 2BC4A 4PGCB 4GBXA 4K55A 3MRMA 5DEGA 4AEHH 2O26U 3AREB 4R90H 1P6FA 1K3ZA 1CFBA 1ADQL 4E0RA 3BI9X 3PJSB 3FO9B 3V4UL 5C0FA 1MFEH 3BJLA 1T20B 2MHAA 4AEFA 3UPCA 5DHVH 3OXSB 1P6AB 3VXSD 3MGTB 3HI5H 3VWJB 3VG9B 5L8LB 5CHNA 1HNGA 4JVWA 3T2OA 3UTTB 1H15B 3BMVA 3PJSA 1KBGL 3QR2A 1FL5B 2P24A 3SDCC 1T20A 2R9HC 4YDVA 5K9JL 1IEHA 2J5LB 1Q9OA 4N9GB 3IJSA 2YPVL 3FOLB 4OTXH 1BQHA 4V1DA 4KKBD 4Y19E 1FGVH 1XF3A 2DL9A 4K7FA 4MA8L 3X12B 4OQTH 5HGAA 4N9GA 2NY2D 2GT9A 4WFHE 4UT9H 2QQKH 4AYFA 1CXLA 1A9EA 4FQIH 5GQBA 5DJYB 3VMNA 5C3LD 1MAMH 1MCOL 3K8MA 5HI3D 4IEFB 4NNYA 4D3CL 2F8XC 1CCZA 1V8HA 1FLRL 1UXWB 4GXUM 1I1AB 4P2OD 3EO0B 1CE6A 2H1PL 5F97E 1ZHKA 4TOYH 5IFHH 5KJRL 5I1KH 3GSNL 4NSKA 4TQEH 5DS8B 4PJXB 3TNNA 1AD0A 1EBPA 4MNQB 5LBSH 4CN4A 4LVNB 3FFDA 3DPBA 1UXWA 1IGIL 3VD9A 1NC2B 3QIUA 3REVA 1U8HB 3MODL 3NTCH 2VLJA 3V6BR 1G1YA 8FABB 1EUTA 5J9PB 1ORSB 3D87B 4IDJH 1CQYA 1OP3H 1DBAL 2A1WL 1MEXH 4L1DA 4X6FB 1J8HE 3RWEA 4UNVA 5DVOA 4Y7MA 5C6TL 4DFHA 5D93C 1I3VA 1T21A 2HLAA 1IAMA 2D0FA 3H3PH 3LPFA 8FABA 4FQ1H 4R2GB 4JFPB 1E4JA 4LEOA 4DKFL 1BFOA 2J4WH 3C5JA 4X6FA 4IIQC 4JREC 1JGDB 3ZDZF 3K4ZA 4LLDB 5CD5D 1UC6A 4XP6L 5EU4A 3U0PA 5FYLD 5GRZA 2DLEA 3QZWG 2Z8SA 3HE7B 3GHEH 3O4LE 3V0VA 4AEHL 1J5OH 1RK0A 4LLDA 3O6FB 4X6DE 4ZAKD 1JRHI 5I1EH 2AJ3A 1MFEL 2OL3A 4HZLB 2ICEA 2PYEE 4PJBA 1VB9A 4UOW0 2GJZB 5KSAD 3T0DA 2QQLH 3D3VA 4Y89A 1T22B 4EVNB 1PQZA 4PTUA 4LSSH 4P59L 3VD5A 3O6FA 4PJ5B 2VDPL 4TPRH 1RV6X 3SGDI 2W9DL 3ARRA 3K8KA 1CVSC 2Q3AA 1FZMB 5ICXB 3MRBA 1Y6MR 1L7IH 3CDFA 3OBAA 2P44B 4OCYL 1F2QA 5D7IE 1IAKA 4N9OB 3RWHA 1V7NL 2PXYD 1OTTC 2E3VA 1ZXQA 3FAXA 4WFED 4BKLB 3ULUD 2AJXH 1U8IB 2X9WA 5BRZE 2CLZA 1LO5A 1WISA 5IHUH 1HI6B 3T4AB 5DMIH 2H9GB 5DDHB 3GNMH 1QRKA 1KACB 1AKJD 4WI9A 1S7VB 4P9ML 3VXSE 5JO5A 5FUCC 4BFGA 1AFVL 1MUJB 5J57B 3K2MC 4JFXB 2VOTA 3FZUC 5F9OL 5BVJB 2P5EB 4FQXA 3FFCA 4MJ5A 5EO1A 1C5DB 5DDHA 4N0RA 4TOYL 3ARQA 2ZOKB 3DBXA 3WD5H 2PO6A 5L7XL 2FH6A 4ODHL 2F5BH 3ZT5A 2M8XA 4CADA 3TA3D 4PRIB 1INDH 2EXYC 4LVHC 4KY1H 5FOBA 1TITA 3BRDA 1RFDH 4KK9D 1RAMA 1DR9A 3GGWA 4ZTPL 1PJ9A 4GBXD 4IDJL 4KVCH 1J0JA 4OBRA 1ORQA 1KCSL 4U4BA 5INDB 4KPHH 4KVNH 4W70A 4X5WA 4DCQA 4F2MA 3U2SB 2VLRB 2GSIB 4YNYA 3PGCA 4LF3B 4U31A 1QFWL 5F7FA 3M07A 2XQYG 5IB3B 4M1DH 3IT8D 3QUYB 4M3JA 4CMMB 3L3DB 3Q1SL 1WIPA 1MCHA 1LDPL 4QCIB 3QHFL 5DJ2B 3U36B 3T08A 3DX8B 3VWJD 3N1GC 4X4ME 3ZT7A 2J8UE 1FAIL 4V1DD 1D5ZA 4MA3A 2UY7A 3DVIA 2P42B 4BZYA 1GCFA 1CT8B 5FB8A 1A9BA 4YWGH 4IRZH 3QUYA 2CMRH 2EE6A 4LLVA 1EO8H 1DL7L 1KPRA 3MYZA 3HMWH 1XGQB 5DJ8A 3U0WH 2BOBB 3I2CH 2NX5A 5F7LB 4OGZA 5J11C 5F6HI 2RBLA 2CJUH 1UB5B 5CBAB 4ODTL 4RQQB 5E8NB 4LSSL 4PRNB 4QRUB 3OAYK 1DEEB 2C3VA 4JB9L 5DD5H 3U4EA 4J6RL 1HHGB 3ULVH 3GJFA 2BOBA 3EJJX 3QDJA 1KJ2B 4YGAB 1A2YB 5CBAA 5FYLE 3MNZB 4NQXA 4RQQA 5F1OB 4HUNB 5E8NA 1IT9H 4JR9H 4G6JH 2NNAB 1FAKT 1DBBL 4KFZC 4WUKL 2BRQA 4UT6H 3QIUD 5ILTH 2VLJD 3FCTA 4GG6E 1OY3B 4RIRB 4I5BB 5DMIL 1T2QH 2YXFA 1I3RA 4P46B 4P4KC 3OSKA 3NCBB 4GMTH 1V3JA 1Q0YH 4MS8C 5JHDE 3BQUA 5IMKA 3LKSB 3F7PC 1NC2D 3J8F7 1YMMA 3X14A 1AIFB 1AGFA 4MQSB 4XPFL 2WIMA 4OV5B 2F5BL 2X4OB 2QEJA 4I48B 1DQLH 3D69A 3GO1L 3O41A 1EJOL 2D3VA 1RJLA 4WFEE 2FIKB 4HIIB 3ULUE 2W0FB 2UY6A 3ZTJH 2AV7A 5AZEL 4F7EA 3VFUB 3LS4H 1N7ML 3OKNB 4UT7H 1MFCH 5GGSA 4KVNL 1NBVH 1S9VB 3IKCB 3L95B 4TVSa 2X9YA 3BP7A 2VLLA 1UGNA 3ZSTA 3D3VD 4NM8L 3STLB 3V6OA 3NIDE 3NPSC 5DJAB 3O6FD 5CLTA 3CGTA 2A6KA 4XI5D 4M1DL 2NZIA 1MWAB 5D7LB 5L88L 3DYMA 2L4OA 3IF1B 5FO9A 3QQ9C 2W07A 4UZGA 3WFDH 2A38A 5BW7C 1UWGL 4PG9A 2R2EA 5L9DH 1CXFA 3GSQA 3SDYH 4OD1L 1IZKA 1OP3K 3HMWL 5DJZA 4H0GA 4X98A 2YUWA 1A7RH 2E7LA 2LVCA 1TQCC 4XPBH 1OSPL 3P4MB 3QEHA 3V5DB 3ULUL 3LPGA 1CICB 4CAGA 1QQDB 5DD5L 1MCWW 3FFCD 4JDTH 4U7KA 3DVFA 3P4MA 4LPTA 4BH8B 1NCAH 5JMRA 43CAB 4G6JL 4KRPC 4UB0H 2P5ED 5DVLA 5I1HH 4DVRH 1FZOA 4L3CA 2JJSA 5IJKC 3EDKA 1DLFL 3U46B 2KKQA 4QNPE 4M7KH 1QEWB 4YC2B 43CAA 3AU1B 4LSDA 3RBGA 2R1YA 1G7IB 4L29A 5ISZA 2QV2A 5D96C 3F5WA 3LIZH 1A6PA 4U0RC 1FYHB 3QG6A 5TE4H 4XP4H 5KBNC 1OTUC 1EAPB 2H26B 2AJVL 5SX4H 2GTWA 3ALPA 4CU6A 5CJ5A 4GW4B 4NN6B 3VFGH 3R8QA 4AMKH 3B4NA 1CK0H 3MOBL 1VHPA 5IW6B 2E6QA 4M93B 3BPLB 3LKNB 5KVDL 4Y16C 3MREA 4ZO7A 5C09A 3BSZH 4WV1B 2DQDH 2VLRD 2DQIL 2XKNA 1PX4A 1CD8A 5E2VH 1HEZB 2VLJE 3BH8A 3IAQA 1C1EH 5IW6A 2HFGL 3QUYD 4PJXE 3VXOB 3JWDH 1YY9D 3WJJC 2HAZA 4MNQE 3HNTH 2GI7A 5DA0B 4ZFFA 2NX5D 2R0ZH 3PQYA 2HVKA 5BMFL 4X4ZA 4NDMB 3HR5B 1FVEB 4JQIL 4M1GH 3OAZK 1UWXH 1VENA 2BERA 2WBKA 3GIVB 4JG1L 5JPNB 4K3EH 2EIDA 3VXOA 4WEBH 4LGPB 2ZZUT 4S11A 4Y2DC 1MHHB 4MJIB 3WO4B 1SJEA 3QDJD 1G7MB 3UAJD 1CR9H 3HR5A 2LE9A 2DDQH 4KGLA 5DMGC 3IJYB 1MNUL 4H26A 5JPNA 4MA1C 3OKLB 2EE2A 3MYJB 3QUMH 1CDYA 2I9LB 4KUCD 4HWBA 3IDGA 4MJIA 3VGDA 4P23B 2NY5C 4CVXA 1OB1B 1DUZB 3OX8A 3KPRB 5EWIH 4HGKC 8CGTA 2DLGA 1KELH 5JHLH 3V52H 3L9RA 4H8WH 1T7ZA 3BQUD 3F7QA 1DN2A 1XGRB 3NFPA 2B4CL 5T1LB 5KAQF 5ADPL 3GBNH 3D3VE 3QO0B 2C1OB 1H3PH 5F88B 4TYUA 1WV7T 2X05A 2YS4A 3GSXB 3UTSB 1CGVA 5IVXB 1ZWIA 1UVQB 4U1GB 3NBNA 2YBRB 1HHKB 1RZGA 3HC4L 4X8XA 3EYQC 5DJXA 4PJ7A 2YWYA 5D9SB 3IFOA 1MJUL 2XN9A 5IGXL 2NXZC 2ZCKH 2CR6A 5B39A 4KXZI 2IEPA 5D1ZA 4M61B 5INCB 4XP4L 1KN2L 3P9MA 4ZPVB 3CVHB 3VJ6A 1AO7B 2WZPD 2HKHL 4AENB 4NKIH 1AXSB 4X5LA 5EBMA 4NO5A 1KENL 5FHBH 3BDYH 1SYSA 3BE1L 1QVOB 1NUGA 3RKPA 1U9KA 5I71B 4LCIH 2OL3L 4OCWL 4OF7A 3FQWB 2FR4B 2BXYA 2WIIB 3BGFB 5D71H 2BY0A 1BHGA 4MXVF 2P5EE 5GGRY 4F8TA 2WBJB 1AGBA 1VFBA 1MCPL 3T3ME 5KN5B 3HLAB 2EC9U 1AR1D 5HPMB 4LARH 1R5IA 4E41B 2AEPH 2ILLA 2VAJA 2R0ZL 3VFNB 5JNYA 4P5TA 4JKLA 1HQRA 1CLZH 2AV1A 1ZMYA 4U1JB 3IGAA 5IMMA 4PJ8A 2IBZX 4OZIB 3MLSL 5TQ0L 2NY3B 5GS1A 5I1AB 4WEBL 2D31A 4EN3C 3AMKA 1JGVH 3MBEB 4QF1B 2L7UA 3MOAH 5KG9B 1CR9L 2V7HA 4M1CC 3S34L 2VLRE 2ZUWA 3UX9B 4ZUWA 4QF1A 1JP5A 3SO3C 5KG9A 4D0CA 3PABB 4XXDB 2B5IB 4OZHA 2GTZB 4HUXB 4H8WL 1Y6NR 2FRGP 3V7AE 1SBBA 4ZPTA 1AH1A 4Y4HA 4HQQH 1T0MB 1IE5A 1G6RA 4LVOC 1A4JA 4M6AA 4JPVL 5E2JA 1TVDA 5F6IB 1IFHH 3MGOB 4ZNCD 3U82B 1B3JA 3QJFA 2DKUA 2VQ1B 2GY5A 4HUXA 4PB9L 4TRPL 4XH2B 5EG6C 3BZEB 3QDJE 3FRUA 4OZGF 1V7ML 3MGOA 5C09D 2CQVA 1JPST 1NKRA 1NUFA 1Y0LB 2VQ1A 3F8UB 4WU7B 5EOCJ 5J89A 4OM0L 5FO8B 4OQ1A 3FT4B 3IDJB 3O2WH 5ITFB 1IEAB 2ADIA 2R0LH 3C08L 5EO0A 4RFOL 4HPOL 5IVNA 4QGTA 5EBWB 1A6UH 3C2AL 1BBDH 3TZVB 3QWRA 2BSTA 4HH9A 5EU7E 1YYML 4WO4A 4JGUA 4NKIL 2BXZA 5CEXA 3SDAC 3MA9L 4I9WD 5FO8A 2N7BA 4S1QL 1P2CA 1DTUA 3W0WA 2VL4A 5HPOA 5DC4B 3AXLA 1A5FL 3HUJF 3LEVH 1TZGL 2PTVA 4X4XB 4I18C 1E6JH 3VFVA 1XGTA 4XCNB 5HDBF 4YX2L 4G43B 1TQBB 4IS6B 5DLML 2CDGA 3CX5J 2XY1A 4MJID 4EJ1C 3BP4B 4NN5C 1FVDB 1EK3A 4OLWH 4W68A 4HWNA 3O9WB 3BKYL 2CLRA 1CLZL 2A0LD 3VWKB 4BFIB 3IS1X 3NCJL 3T2NL 5C0ND 4G43A 1HH6A 4WW2F 3OPZH 1FPTH 2RHEA 4G9FB 4Z7VB 3V6OE 2VTFA 4FFYH 1JGVL 2YPLB 4RRPA 5IOPA 3RY4A 3VWKA 4MX7B 5FYKH 1AJ7H 5IMOB 5T1LD 3TN0C 3RNQA 2AK4B 3G5VB 4Z7VA 4OLYH 1SJHB 1K2DA 5JIHA 1BMGA 1MLBA 3VDBA 5DMJB 4YAQB 3ROLB 3U4BH 5F96L 2XN9D 1DVFB 4KZDL 1C5BH 5EORL 3MRLA 2ADFL 2AK4A 1DLHB 3MZTA 2OR9H 3O3EA 3QXWA 3TT3H 4K2UH 2P5WB 5CINL 1BX2A 1N0XL 5EPMA 1NMBL 3HG1A 3JV6A 3Q5OA 5DWUL 3G5YB 3MLXH 3GMLB 4L3AA 3P9WB 3MRPB 4K23L 1CE1H 1K4CA 5ICZB 3L1OH 1RJYA 3GSRB 4X9FA 4QLRA 1OLLA 3DO7B 4JN2A 1KJ3H 1LK3L 1U42A 4OT1L 5IFAL 5KW9L 2MKWA 1MQKL 4YHNB 4JO3H 5MI0B 3OJ2C 3QUXC 5BV7B 3ULVC 1JNLH 5ICZA 2EO9A 4XCEB 1SY6H 1KIRB 5HXMA 4P5TD 2R8SL 1URLA 3O6LH 3TJEH 2JCCB 1YEEH 3BO8B 4PJ8D 5T1MA 1T5XB 1PY9A 3QO1A 4MNGA 4JY5H 1FFQA 3WFBH 2ORBL 4XNYL 3O3AA 3D25B 2V7NA 5DVKA 1IGJB 4RMUA 1BGXH 1KB5H 1CXKA 4P99A 5C09E 3IAGC 3BO8A 1T5XA 2D9CA 4FQQB 5K9OA 4JZOB 1S9WB 2NY3D 4JVUA 1F4XH 1MJ7L 4YDJA 3M1BA 2C3HA 4F58L 4JO1H 4TTDC 3RI5F 1H5BB 1N6VA 5FYKU 2GYSA 4JZOA 2NY1B 4Y4HD 4POZC 1OGAB 1WTLA 4I9WE 4XHJC 3JVGA 4IHOA 4FHBD 1G7QA 5I6XC 3GSUA 3RX8A 2HP4A 4OFDA 1Z9SA 1KC5H 3HNVH 5IK3A 2DQHL 3PDOA 3GI9L 4JDZB 5GZOD 4NKDA 1JPTL 5C0RH 1I8KA 1IVLA 1NCDH 3QUZC 3SE8H 1OGAA 4HXAH 4NN7C 3B9KB 5KSUB 1MFBH 4OLYL 5MEPA 1T5WA 1LDSA 2IQAA 2ZUYA 1BBJA 4CNIA 2QBWA 4MJIE 4Z77B 4Z7UB 3SPVA 5I18L 4U3CA 4PB0H 1MREH 3GJFK 3GMMA 3QWRD 1A4KA 2OTWB 1WBXA 4WO4D 3DXAA 3ET9F 4Y1AB 3TT3L 5JW4N 4PYGA 4K2UL 1JNNL 2IJ0C 2HN7A 4G5ZH 4JM2A 1JGUL 3RVTD 3FQTB 5DQ9B 1LMKA 3JZ7A 1P7KA 4Q9RL 2DRUA 2R15A 4GAGH 1RHFA 3G6JF 4GMSH 4QHUA 5FGRA 4NHCL 3RVVC 4FZEL 1H3TA 5TFSH 4FQCH 5MENB 3GRWH 3HZVA 3CSPA 4LLMA 1S7SA 3DURA 5EUKB 4Q9QL 4GKZB 2EIZB 4N0CD 1CLOH 4QXUL 1ZA3A 4ZOAA 1WK0A 4PJ7E 4MAYA 2DLIA 5GGVL 2YN5A 3HZKA 3LKOB 4PJCA 1ZSDB 4OFIA 2XN9E 5IVXE 3FHQA 4A6YH 1UH4A 5AUMB 4RAUA 3TJHD 3VFOA 4AZ8A 3WFCH 3NZHH 3O6LL 3B2UD 4GW5A 4LSPH 4LHUA 3BPNB 1ZV5A 1FG2A 2XTLA 2X7LB 1Z3GL 2EIEA 4RX4A 1EV2E 3CPLA 4JY5L 1MIEH 3AB0C 5E1AA 3MUHL 4HWBL 1EBAA 2Q86B 2OS7A 4N90D 1YEHH 2EYTA 1N2RB 3E6FB 2VDKL 3UYRH 5A43C 2Q8AL 1BEYH 1XAUA 3VWKD 1AO7E 4YXLL 4LLYB 2R1XA 2H2PD 1T3FA 1EFXB 1N5AA 4JHAL 1F4XL 1MH5A 3QPXL 4HGWA 4K9EH 1YN7B 4RGOL 5GSRB 1Y6KR 2X2YA 4LLYA 5EU3B 3QCUH 4HXBH 1OPGH 2IAMC 2AK4D 2ZCHH 1YNKL 3WO3B 1A1MB 3Q3GB 1FGNL 3MLTA 4Q9BA 5HYQB 4LDLB 3RA7H 4U2ZA 3VGAB 4XVUC 1KC5L 4PR5B 1YY8B 1S3KL 1DVFD 2GUOB 4OSUH 2FWOA 3HG1D 1VFAA 3JWDC 4XMKL 3EOYG 3UPAA 5IHBA 4HKBB 5K9KA 3HC0A 3DRQB 4NZTL 1MFBL 3C6LC 1QBAA 2YR3A 5MP6H 1SYVB 4NZJA 1J9CT 3PL6A 5D72H 5ENWB 1N59A 2VN7A 3K2UH 4PG2C 1MQ8A 2GUOA 1OCWH 4DGVL 4DEPB 1B6UA 2GJ6A 5AYUL 4MVBD 1CI5A 2A73A 1T89A 4EUPA 2Y07L 3OR6B 3T09A 2ZG1A 4POUB 4QRTA 4ACPA 3IFNL 3QDHA 4MNHA 3MA7A 3F7VA 3JWNC 2C3GA 2UV3A 4I2XB 4L8DB 1INEH 3K0WA 4FQXC 3WEXB 3CFBA 2OMNA 1S5HB 4HIEB 2WQ8A 1MJJA 1FFNA 1PG7X 4GMSL 2D4FA 5IB4B 2PO6C 3QB7C 4NJ9H 2BMKA 3H9SB 3GMQB 4H8WC 4U1MA 1FE8L 1UZ6F 3GRWL 4XPTH 1A3LL 4BQ9A 2A77L 4M5ZH 2FX7H 2P8MB 3EGSB 1F4HA 4M03A 4NNXA 3SBWA 3UTOA 3VD3A 3VFSB 2X4QA 1FDLL 2IH1A 3BUYB 5C1MB 1JMZA 1RI8A 3NZHL 1NGPL 1M6OB 4EIGB 4RZCB 2FBJH 3TO2B 1R3HB 1PVHA 3RUGA 4ZXBB 1TJGH 3QUKB 1D5XB 1YQVH 3L6FA 4K07A 2FATH 3MRKB 1S7QB 4KDVA 4GRMB 4GSDH 1LO0L 1JHTB 5GS2D 3UYRL 4L4VA 2D7OA 4LQFH 2MCPL 4DN4H 2NY1D 2BSSA 4LEXH 1OGAD 1X6NA 12E8L 4N1HB 4YXKH 1G6RL 4R0LA 1HXMA 1DQML 2W59A 4URTB 5ID1A 1SBSL 4IRJA 1FSKB 2EE3A 1OPGL 3QFDA 2HMIC 3V5KB 2BOCA 2VLKA 3DXAD 3WIFA 5E6YA 1QLFB 3W9DA 3BRFA 1KXQE 3ARWA 1FV1A 4UOJA 4JM2D 3I3DA 1BZ7B 4ODVL 5GISL 5HGDB 5IESL 3FT2A 4OSUL 4OF6A 2H8PA 3RWFA 1A22B 3D0LA 4Y8DC 1AI1H 3HRZB 1QLFA 4DN3L 3QNXA 1IKNA 3IVKA 3EOAA 4Z7VE 4I1NB 3L3GA 1WAAA 2CGRL 4FQJH 3RZWA 2Y06H 2YPLE 4G6KH 5DK3A 1T1ZB 4MAYD 4NT6A 2XIDA 4DKEL 5ICYA 4CRPA 4OCNC 1MPAH 2AK4E 2YD5A 2Z31A 3BD5A 5MEOB 3OAUH 3AFLA 3ARGA 4WUUB 1GZPB 1P7QB 4LHUD 1FL6A 4HK3N 3LN5B 4PRHB 1WEJL 1AP2B 4RCAA 5DC9B 3TO4C 3LD8C 3N9GH 3TNMB 4IOIB 4EDXB 1X5HA 4QRSB 3PWNB 3HE6C 1JWMA 5DMKA 4RSVA 2P5WE 3ZE1F 1S7RB 4LMQI 3LMJL 2VXUH 3S37H 5LQBH 2NZ9C 4NC2B 6FABH 1WBYB 5EZIH 2ZPKH 4PJEF 3UTQB 1JPGB 5FGSA 1XH3B 1RU9L 1NKOA 4OZFB 5FGCB 3O4OB 3H9YA 4YHLL 4PGEA 3NAAL 2XRAL 4C4KT 3VMPA 2I25N 2APFA 1NSNH 1WBYA 1U3YA 3DX7B 5J4MA 3EYFB 5E8EB 4NYLB 5CAYB 1XH3A 4MNGE 5EIIA 3P77B 3TT1H 1PD6A 4OI7A 2PTTB 2DI8A 2H32H 4R8WH 1YJDH 4LRNL 2JCCE 4XX1E 1HHHA 3DX7A 3FQXB 5HD8D 1F6AA 1JNHB 3LB6C 1I7UB 3PL6D 2CKBB 5JORA 4M3KB 1UT9A 3DGCR 2CLVB 3T2QA 1PG7H 1RHHA 4D9LH 5ACZB 5E24E 5GHWL 2GJ6D 2F19H 2MFNA 4JFHD 5K59E 4Z7OE 1I7UA 1LO2L 4MYWB 2AABH 2X10A 3FQNB 2CKBA 3QG7H 4FG6D 2CUHA 2ID5A 3AVEA 3OKOB 4UV4H 1FFPB 4KUZH 5GRUL 2WSKA 3MRRA 3ROOB 4NBZB 5F89A 2FL5B 3C60B 1I3GL 1KV3A 5CJBA 1EEYA 1OGAE 3NN8A 4OF5A 4FQJL 5DO2D 1QZ1A 1ZS8A 3EO9H 1CFNB 2Y06L 5E4EB 4LOUC 4O00A 1FHGA 1S7XA 2B7DT 4OUUA 1FC2D 1ZGLP 3MJGX 2P8LB 3FONA 3T3PE 4PLKD 1NGZB 3ARXA 3FOMB 4HLZG 2QADB 3PIQA 1UEYA 3OAUL 4I13B 1T7WA 4H5SB 2F54A 5EN2A 5DA4A 4HJGB 3L3HA 4TNWF 2P8LA 5HGBB 4TSBH 2CKNA 4QOKA 4Z7UE 5C0DA 1U8MB 3ZYOA 2A9NL 1X5FA 4U1LA 1EERB 2F74B 5DFVC 5E03A 1MHPH 5IFJB 3N9GL 4L4VD 5TJWK 3VXTB 4OKVB 1GOGA 3DVNA 2NQCA 3SE3A 3VXMA 1J05A 2YSSA 4KKCC 3NVQA 3QIBB 2FLBT 3T0BA 3BZ4B 4RNRB 2AQ1A 4C55A 4IRJD 4OKVA 1ULVA 3GBML 1JV5A 2BNUB 3FJTA 2NY6B 3BVNB 1FL3A 1R3JB 1UCTA 2VLKD 1P4LA 2WWMC 2HA1A 3KGRA 1LNUB 2J7LA 4P0DA 1W72B 1T7YA 1OAZL 2YPKB 2X4SB 1U3ZA 1ZLVH 2DQFA 4ZFZB 2D9QB 4UDTA 5HYSB 2OJEB 1QPPA 1YDPB 1LEIB 2XPGA 3QPQD 3OR7B 4Y8AA 3TBVB 1PG7L 5KVFL 2C26A 4X7EC 5CP3H 3HZMA 1QYGH 2ZCLH 3KLAB 3DHMA 2W0PA 2AABL 3TVMC 1I8IA 2Z31D 1CFVH 1RIVL 4IMKA 3NH7H 3BPOC 3ARGD 5LCVH 3DUUA 5FYLH 1A7OH 3RZCA 4Z7QF 1D5MA 2X1OA 3LN4B 3VXNB 3K81A 3SKJH 1CDJA 1BQHG 5E6IC 4BQ6A 3LKRB 4YHYB 1IKFH 5GS0D 1NANH 5DD6A 5D6CB 3WUWA 3WXWH 1FJ1B 5I66A 4NWUH 2ZUUA 4J7RA 3TM6A 2GJ6E 2I9TA 2A9MH 4JFHE 4WI2A 2O5YL 3C8KA 2X1XR 3RVUC 1QHOA 2UWEA 5D2LA 2R69H 3RPIB 1HQ4A 2H2SD 4K3DL 1DN0B 2NW3B 1A6VH 3BH9A 4MWFA 4WDIB 2FEDD 3LY6A 2GITA 2WW8A 4HEPG 5GRYA 4QHMA 4U2YA 5SWQA 1TVBB 1PZUB 1GPOL 1M7DB 3L3JA 3U79A 3S5LA 4TUOA 4PY7B 2NW3A 4OIBA 4PGZA 4WDIA 4HV8A 1YEKH 4NQTA 2R2BA 5I19H 4NPYB 1G84A 4FQLH 2G60L 3PP4H 2B8OT 4ZUVA 2EKSB 5D1QA 4HKXA 3K1KC 4DZBA 5FM8A 4IRSB 1VEMA 3WSQH 4F80A 1NEZA 4I3SL 4O9HH 1NGXA 4JAMA 5F3BA 3HI6L 5I1GH 3MBXH 3DTXB 4G42B 2FZ3B 3RHWF 1F6FB 2QQQA 4XXCC 3ZL4H 1RJCA 3R0NA 3KYKH 4Z78A 3ARDB 4L4VE 5JIKA 3MMEB 43C9A 4LQ1A 4G7YH 3L7FB 4R4BA 2CRZA 3WS3B 3U0TB 3I9GH 4UDUA 2RJMA 3NABL 3SE9L 3RGVB 3QXDB 4JO2L 5E1HB 2ED7A 3ZDZE 4PJIB 3L7FA 1EO7A 3NH7L 1RIHH 1PKQB 1JZ4A 1NGQL 2VLKE 1RIUH 3BP6B 3ILQC 2F54D 4HD9A 1EIBA 1ZT7A 4K9EC 4AL8L 1A7OL 1K8DB 1OSZA 1U3HA 2QADD 2W0LA 3ZHLA 1X6LA 1E4XH 3SKJL 1ERNA 1A6TB 1CXIA 3DUSB 1IKFL 3MLVL 3PGFL 2AEQL 4P2QB 3VXMD 4PJFF 1D9KB 1RJZB 2VZOA 4HS8H 1Z5LB 4GAFB 5D7JB 5C07A 2CDEB 2FGZA 1B2WH 1G7HB 4Y5XA 3CSGA 2VR9A 3T2PA 3ZT6A 2VXVH 3TEUA 1Q38A 1FIEA 1X5YA 2Y36L 3DUSA 5EOQH 1UEMA 3DWTA 3G5XA 3N50A 3QRFM 3UTPD 4GKSB 4KROD 2NTSP 5HTSA 1YC7A 2XV6B 5D7JA 4BA8A 4JFOB 4NNPL 5C7XL 4XBGB 1JYVA 2VXSL 3QEQA 4RGNB 5FM4A 2MQ3A 3SN6N 1JI1A 1A7PH 1ES0A 1C12B 4WUUE 2BDNL 4JFOA 4XNXL 4NZDA 1MSPA 4XPGH 3WLBA 4N0FA 1LO3H 2BCKA 1O5DT 2ERJB 4MSWB 2X4PA 4BUGA 1IGTB 3HHRB 5E8OB 3RBSA 2R4SH 1L9NA 4LSRL 2NW2B 3W11D 2ADGA 3WSQL 3DIFB 1B0RA 1J1PL 4K3JH 4NO3B 5JLZA 2R0WL 3OHXB 4K71C 2DL2A 1DQDH 1IGTA 1UM5L 5EFIB 1FYTA 3KYKL 3BEVB 3RIAK 3DIFA 1O0VA 3KPQA 1LWRA 5EC1B 5FGCE 4E42A 1BM3H 4Z76B 4XNQB 5C0EB 4GUPB 3JUZA 3IDIB 5DD1L 4M7LT 3F6IA 1AQKL 1BIIA 4PJ9B 3FHAA 4OIIH 3I9GL 3D5OF 5EFIA 3CCHB 1NBQA 3RTQB 1CBVL 2B1AL 2N4IA 4G8GA 4NQUA 2D7QA 1IC7H 1OW0C 4NQDB 3T0EB 1CS6A 1WCBB 2EDFA 1HYSD 4NJAL 1CGTA 1RULL 1M7XA 5FK9A 3CFJA 1T83C 4YHIB 4EDWL 1MHCA 3NZ8B 3LN9A 4HX1B 3PWVB 1NAMA 2VQTA 1M05A 4X6CF 1T1XB 4HFUL 4HEME 1U6AL 1QFHA 4FMKA 3EOBB 1NAKL 3NOIA 1VA9A 4PRPA 3LKQA 5D5MF 4MDIA 3ARBA 4U6XA 3VMOA 3SKNA 2LU3A 5I74C 4ODWA 1ACYH 3F7YB 2IFGA 4XTRC 2HRPH 3A6BH 4BQ8A 4HS8L 5BXFA 2ARJQ 4OZGB 1R5WA 2ATPB 2R4RL 4Y5YA 2XA8H 1JTPA 3RDTC 5H2BB 1J8KA 1MI5B 1S5IH 5JUEL 1OAXL 4GT7A 4MQ7B 3P0GB 5ID0B 2F54E 4LKXA 2BY1A 3CIQA 1JK8A 3LV3B 5DFTA 4FQ2L 2H6PA 4EI5A 5B3NA 5L2KB 3DSNA 5JXAL 2VUYA 3QZWB 4YHKH 1CDHA 3PP3K 2XWTA 1G1CA 3AUVA 1RZ8A 32C2A 5TE7L 4LPCA 2EH7H 3VXME 5F7HA 4FZ8H 3HUJB 3JV5A 3CH1A 2IGFH 3EFDH 3S36X 2D7PA 1F4WH 2H3NA 3OXRA 2BVYA 3D18A 2R0KL 1MFAH 1EMTL 2ZG2A