3DKHA

L559a mutant of melanocarpus albomyces laccase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
558
structure length
558
Chain Sequence
PTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Essential role of the C-terminus in Melanocarpus albomyces laccase for enzyme production, catalytic properties and structure
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
molecule keywords Laccase-1
total genus 170
structure length 558
sequence length 558
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA03
1KDIA 1PMYA 3NSCA 1J9QA 1A4BA 1E65A 1BYOA 1JVOA 1SJMA 2XV3A 5PAZA 3OMNB 3TBCA 1ETJA 3QJQB 2QDVA 1SHWA 1JZIA 3QJVB 3QJTB 4E9YA 2XUWA 5I5JA 2GC4C 7PCYA 3ASNB 1AG0A 1NIEA 2I7SA 3NJFA 4HALA 3UABA 1PAZA 6PCYA 3EH5B 5I6NA 3ERXA 1ZDQA 1F56A 1ADWA 1PCSA 3IN0A 5B1JC 2FT6A 1NINA 2JFCA 3AG2B 1W8EA 2BP0B 2FQFA 1AQ8A 3NJNA 6PAZA 3TU6A 2HX8A 1CUOA 3T6XA 3OD3A 3X1NA 1ZV2A 1B3IA 2UXTA 3JTBA 3PCYA 5I6KA 3S3DB 2EIJB 2I7OA 5I6LA 2FQGA 1OCRB 1PNDA 2I85A 3FPYA 3PAZA 4E9WA 4DP9X 2A3TA 4JHVA 2W88A 3CVBA 3UGEA 1WA2X 2UX6A 4JKNA 1WA1X 1J9TA 2XVBA 3PLYA 2XYBA 3FYIB 1RKRA 1WS7A 2EIMB 2H47C 3WKQA 1SF3A 3S8GB 4NB7A 1NIDA 1PY0A 4PCYA 1ET8A 2JKWA 3MX0B 1AG6A 3S3BB 2VM4A 4HHWA 4AKQA 1QNIA 4BDVB 1WA0X 1J9RA 3NJHA 1E30A 2PCFA 4E9SA 3V9EA 4KNUA 2XV0A 2IWEA 4KO7A 3OM3B 4YSTA 2PP9A 2XXFA 2HX9A 4HIPA 1MG2C 4A2GA 2FNWA 1CC3A 2W8CA 1PNCA 4YSOA 2BWIA 3H4FA 5AFAA 4BWUA 3KW8A 3PXLA 4QKTA 1MG3C 1WS8A 4YVUA 3X2QB 4AKPA 2EILB 1GYCA 2OV0A 1FFTB 4DP0X 1OOWA 3ASOB 4YSUA 2YAHA 4G70B 1X9RA 2RACA 3WI9A 5A7EA 2BP0A 2CUAA 4A2FA 2ZONA 2CBPA 1NICA 4A66A 4KNTA 5B7MA 4P5SA 1L9OA 2VMJA 2HXAA 1ET7A 2IWFA 1ILSA 4DPBX 3DTUB 1SNRA 1YLBB 2PPEA 3CVCA 3FSZA 4GP4B 3H4HA 3ZDWA 1NWOA 2OJ1A 2VW4A 2MRYA 2BZ7A 3X1FA 4N8UA 4YSPA 4N4YB 3JT2A 2GSMB 1FWXA 1V55B 3TBBA 1L9TA 4KO6A 4YL4A 2XV2A 5TK4A 2FQDA 3ABLB 1KBWA 4KO9A 1KGYE 1XB8A 2XX1A 1ZDSA 2HX7A 1AAJA 2UX7A 4DP5X 2BO0A 1QHQA 4DPAX 1IBZA 4YVNA 2X88A 3CDZB 1A4AA 2P80A 1W6WA 4KO5A 2PP8A 2FT7A 3QPKA 4MFHA 5PCYA 4EF3A 4KOBA 1GR7A 2GC7C 2IDTA 1V54B 5FC9A 1ET5A 4YSRA 2AZUA 1KDJA 2PLTA 1IKOP 1A8ZA 4ZK8A 1OE3A 2AZAA 4KOCA 2DYRB 3IN2A 2DYSB 2R7EA 3IBOA 3AZUA 1IUZA 3NJKA 3FU9A 3NSDA 1KYAA 1PLAA 1J5CA 2YARA 3FSAA 3GDCA 3WNIA 2BP8A 2XU9A 3QQXA 1OCZB 1ASQA 4E9QA 4E9RA 1N70A 1NWPA 1MZZA 3T6WA 2Q5BA 2CJ3A 2GIMA 4HHGA 3NSYA 2H5UA 5TK2A 1OE2A 4BDVA 4YSEA 5B3SB 3CG8A 2HZHA 4G7QB 2TSAA 1DYZA 2YAPA 1BQKA 2VSKB 2BW4A 2NRDA 5B1JA 3PPSA 4M4RB 1NDTA 1PF3A 2WO2B 2AFNA 4HCFA 3V9CA 1A3ZA 4BWTA 2XXGA 2P80D 2IDQA 1TU2A 1AS7A 1BEXA 3AG4B 4KNSA 2FTAA 2YAQA 1ZIAA 2YAOA 3BQVA 1E5ZA 3CVDA 2IH9A 1W6LA 5D4JA 3U25A 2FQEA 3EHBB 3X1GA 2PPAA 2GBAA 4TXVB 2GB2A 4G71B 1GY1A 4M3HA 2TSBA 3DKHA 2Y1AA 1JZGA 1UATA 2B3IA 3FU7B 2J57A 1XMEB 2XX0A 4E9XA 3FU8A 3BVDB 1L9SA 1IC0A 1L9RA 3NJGA 2Y69B 1JXGA 1TKWA 4K9JA 2WO3B 2YAEA 3QJRB 3FQ2A 3ZX1A 2PPCA 1TEFA 3WIAA 3NP4A 3EF4A 2AVFA 1OCOB 2QPEB 3OQRA 1M9WA 2QT6A 3WNJA 5B7EA 3ZBMA 4F7KA 2H3XC 2MTAA 1AOZA 5I28A 3IEAA 2BW5A 5AKRA 1NTDA 1E5YA 2R7EB 1ASPA 2FWLB 2DY2A 3CZUB 2CALA 2YQBA 3QJSB 4NERA 3WG7B 4A2DA 4BWWA 1KBVA 4G7RB 3KW7A 4A68A 1IBYA 1PZAA 3EH3B 3MBWB 4UF7C 2VM3A 3NSFA 2QDWA 1XB6A 1JERA 1OV8A 1BXUA 3ABGA 3IE9A 3NJLA 2DV6A 3CDZA 3SBQA 2HRGA 3NJJA 3FS9A 3FQYA 1PZCA 4BK5C 4BXVA 1AZBA 1A4CA 1JXFA 2QPDB 2BHFA 1JZJA 3AG3B 3FPXA 4X4KA 2HRHA 4F2EA 3TA4D 3FSWA 3PAVA 3PAUA 4AX3A 2VN3A 2VW6A 3UADA 2BWDA 4CSZA 1JVLA 4DP6X 3T6VA 1BQRA 2CCWA 3L45A 5I6PA 4DP7X 1N68A 4AI7A 3HEIB 1ASOA 1JZHA 5B1BB 3T6ZA 1BAWA 2VW7A 5ANHA 2HLEB 3N55A 1M57B 4CSPA 1GS7A 3QJUB 1QLEB 3X1BA 1CYXA 1OE1A 3FSVA 1VLXA 4GY4A 3UACA 3N2JA 1KCBA 1MZYA 5I5MA 1AZNA 4HAKA 3OMIB 5F7BA 2EINB 1BXVA 2PCYA 3GXUB 3WKPA 4A2HA 1GS6X 2PPDA 3GYRA 2PPFA 2IDFA 1XB3A 1OF0A 3NYKA 1JZFA 4DP1X 2UXVA 4GP5B 1GS8A 1ZIBA 2GI0A 2JXMA 1NIBA 3FYEB 3SBPA 2FJSA 4GXFA 2IWKA 2N0MA 5F7AA 4F2FA 1J5DA 2AANA 1PLBA 2DWSA 5LDUA 3D12B 3C75A 1BXAA 2J5WA 4BXSV 1RZQA 4A2EA 1JZEA 1AS8A 1SDDB 4L0PB 4YSCA 2IH8A 3UAAA 4GP8B 4PAZA 5AZUA 1SDDA 3G5WA 3FQ1A 1L9PA 4YSSA 1R1CA 5D4IA 1MDAA 2WSDA 4W1TA 1AACA 1M56B 1KCWA 4GYBA 1OCCB 4E9VA 1I53A 1L9QA 3AG1B 1ILUA 1SF5A 1CURA 1BQ5A 1URIA 2YAMA 1NPJA 2BZCA 4DP2X 4ENZA 3AY2A 2FT8A 1JXDA 2E86A 5I26A 5I6MA 1GSKA 4FA7B 4AKOA 5D4HA 4DP8X 3UAEA 2IDUA 1NIFA 3X1EA 2LLNA 1AZRA 1V10A 3NJMA 3SQRA 2DWTA 5I6OA 1TEGA 4P5RA 2EIKB 1KV7A 3FU7A 1SFHA 3OMAB 1J9SA 1NPNA 3HB3B 1FA4A 1CYWA 3T9WA 1SFDA 3TASA 1GY2A 3S8FB 4UANA 4DPCX 1HAUA 4DP4X 2IDSA 2YXWA 4G7SB 4HZ1A 5I5IA 1GW0A 4NAJA 1AANA 2X87A 4Q89A 3ABMB 4YSDA 2GHZA 1RCYA 5E9NA 1AZCA 4W9ZA 3ZIYA 4HCIA 2ZXWB 4WKXA 1E67A 1PZBA 2IAAC 2XWZA 4QLWA 2UXGA 1HFUA 8PAZA 4YSQA 5B1KA 2J56A 1EZLA 3ABKB 2OCCB 1A65A 4YSAA 4WTQA 4AZUA 3AW5A 3NT0A 3FT0A 4Q8BA 9PCYA 2Q9OA 3NP3A 1X9UA 4RH4A 4FAAB 4E9TA 1RZPA 2UXFA 2ZWNA 1T5KA 2BP8B 2J55A 1AZUA 1AR1B 1NZRA 1BYPA 4JHUA 1DZ0A 3RYMA 3SBRA 5B7FA 3EH4B 2YAFA 3T71A 1HAWA 2B08A 3H56A 1NIAA 2VSMB 4G72B 2PP7A 1AIZA 5EHFA 4UAHA 1JOIA 5B1AB 4A67A 1EHKB 1WAEA 2XLLA 1AS6A 5IY5B 7PAZA 2ZOOA 1ID2A 1SHXA 2CAKA 3DIVA 1PLCA 1ZPUA 2YXVA 3NJIA 3S3CB 4HCGA
chains in the Genus database with same CATH superfamily
2D9QB 5HHME 3B5GA 5JPNA 4MLSA 2C3GA 1YDPA 3BAEH 3O41B 4AH2B 3TBWA 1OWRM 3ZU8A 5AVVB 3EYVA 3LS5L 1BCIA 5E8EA 3GSXB 3M46A 3UTTD 3DYOA 2JCCB 4JRFA 3MV8E 3U7WH 3PRZA 1VHPA 3ESMA 1ZLWH 4AL8H 3LH2H 1ZJAA 3H0TA 2R0LL 3ULVD 4CSSA 3GNML 1U92B 3HE7A 4P5TA 2X2UA 4X8CA 1RZGA 1RU9H 2EEFA 1AIFA 5D7HA 4N8VA 1C5CH 3IGLA 3BH4A 4AYFB 2HFTA 1YN6A 3ZE2E 3KBHE 3S3DB 2EIJB 4GKOA 1RP9A 1PX8A 3GLZA 3PABB 3S37H 1MCKA 2W07B 3U4KA 2J88L 5KJRL 2X4UA 4HUNB 4AW4A 3BAXA 4HS8H 3ZL4L 5JA9A 2CO3A 4YIQB 2OZ4L 4CDHA 1EZSA 3OHXB 2VABB 2ZCZA 2EH8H 5A2JH 5HGBA 4WHCA 1I82A 2DN7A 1KUMA 3VSUA 5FM5O 5FO7A 2R0KH 5IW6B 1U3NA 2G60H 4KDTA 1NEZG 3L1EA 1U58A 5ERWB 4I0KA 5E5UB 4PMFA 5EO9A 4TNWK 4XRCB 1DR9A 4AUYA 4PJAF 4HUKB 4JFTA 2CCLA 1F1DA 1WLHA 2DMHA 2B1OA 1I3GH 2FGWH 2VR5A 3LKOA 5TGBA 3TJEL 4DZ8B 5IFHH 3Q3GA 5AVXB 4C56D 2X0WA 2WXIA 2WBWB 3VDAA 3WE6A 2VDNL 4DEPB 4RFEB 3P2BA 4OCYH 3L6FA 4G6JL 4FQXB 5BW7C 1S5IH 1SJEB 1UWXK 5E95B 3QS3A 5IBUG 3P1VA 3N9GL 1XO8A 3FQUB 4E41D 1YEJH 1XF4B 1N64L 4ZRGA 1U8JB 4NNXA 4WK4B 4Y1AD 5AFAA 4LMQI 3IPEA 4L8SA 2LABA 5LB1A 3WAKA 5KYYA 2P5WD 1FZKB 2XFGB 3ZK0A 4G1EB 1AI1L 4MQ7B 1MI5A 5DYFA 3OF6D 3G6AB 5D1XE 1CO1A 4DQAA 3HTLX 4HLZG 1QVOB 1T5XA 2QSVA 4G3YL 4YPGB 4UT9L 4W70A 3N42B 4LMQE 1OD7A 5DS8B 3VX1A 1XZWA 4A66A 4MD0A 4U6YA 1FFPB 4P5SA 2VDQL 2KKQA 1EQWA 1WAAE 3O2WL 3SQBA 3KDMB 2BS71 1IBGH 4EUPA 3NPSB 1QSVA 1RV6X 3CVCA 3FSZA 3G5ZA 3PG2A 2C34A 3QUGA 5EUKB 4A6YL 5EEZA 3OZ9L 2NY0D 3IDJA 3B3IA 4RA3A 4Y19B 3ETTA 5LGJA 1YPZB 5I71B 2ICWB 5INCA 4YOKA 5IB5B 1OVZA 5A2KH 4GRWB 4JFFD 3U46A 5I1HL 4GI8A 1QG3A 3SKMA 2FCBA 3HRZA 3B2UC 2ZOTA 4G7VL 1DFBH 4KJWC 1X5GA 5DZVA 4Z8FL 3GLAA 1Q38A 3QXDA 4X0KB 4GQPH 1BVNP 3BVTA 5F88B 4PBXA 1W6WA 4PJXB 1G7PB 2WN2A 3A47A 3QT2A 4R97B 4DZBB 5IROD 1DVFB 3F6LA 1JF6A 2VOTA 3GJFH 2WCPA 4B3VA 3U6RB 4CVXB 3MRNB 2XA8L 1SLXA 4ADJA 3AXHA 5IMLA 4BE6A 2J2ZB 1DQMH 1KGIA 1AGDB 4XXCA 5EO0A 2IFGA 3HG1D 5EEWA 1LO2H 4TQIA 2VQ1B 2CM6A 2XI9A 5DU7A 3ZUCA 1B9ZA 2A1WH 1CICA 2RHEA 2R4RH 4G9DA 3NFSH 4YE4L 4MQ7A 3L3JA 1TIUA 35C8H 3JVGC 3V0WH 1T7VA 3MJ8A 2EEAA 1AHWB 1W72H 3DDFA 1TZOA 2VUOA 2WP3O 2EE2A 2NXYD 1M1SA 1QSEA 3N85H 3PJNA 1GTFA 3F7QA 4GRLC 4ODHH 4X6DE 3ZKXB 2FB4H 1AD9B 2FEDC 2H5UA 4JLRB 4MJ2A 1HXYB 5FGRA 4UB0L 2Z0BA 5FO7B 5C09D 1NCJA 2E76C 2FX9L 1LWRA 1ZTXL 3W57A 2XPGB 5JPNC 2BW4A 2O6PA 3T0EC 4NM8L 4FHKA 5B39G 5BQDA 2H6OA 4KUZL 2WO2B 2A7BA 2AFNA 3SQOH 2YOAA 3WIHL 2H26B 3FT3B 5K9OA 4HUVA 4N68A 5B8CB 3FFDA 3IM1A 4JCWA 1HN1A 2CHWA 4HUCA 3RB7A 4W9EC 4NPYB 3MJ6A 1IC1A 1E4WH 3BSZH 1YEEL 2W92A 4HQQH 4MD4B 3RTQD 4U7KA 3U0PA 4RGNC 3CVDA 4Y5XB 3TA3A 4M00A 1CS6A 3ZT5A 1JWSB 5CFAA 1TT6A 2PPAA 4ZMNA 4J3UA 5EZPA 4G71B 4RWHA 3TZVA 2Y7QA 2Y1AA 2OJEB 3ROLB 5JPMB 1HINH 5C0JA 1IGTA 1RHHA 2DI7A 3QHFL 3ZMRA 4P2QB 1ZE3C 5K1JA 3VXOB 2AP2A 2LU3A 3TCLB 1AGFA 1T22A 5J12C 3CN2A 3G6AA 4XVTH 2WO3B 3TYGL 2GK0B 5GS2D 5JQ6H 4H25A 2WCGA 5C8JA 2ZX9A 3QAQA 4NYLB 2B2XH 3RNQB 2QQNH 4BRJA 1X7SA 1F8TH 3EF4A 3C5XA 1OCOB 3NCYS 5C0IB 3SPIA 3FQUA 2C4FT 3HRPA 2IH3A 1KY6A 4QWWC 3CFUA 4F7KA 3L3OB 4RGND 3TBVA 5MEPB 2MTAA 3KPLA 5TF1L 1XWVA 1QEXA 4DAGH 2QVMA 3MLTA 3D08A 1DJHA 1E4XH 4NC2B 3PHAA 2CCVA 4HCRL 3SPGA 2C26A 1PZAA 4XCCH 3KPSA 2XNAB 1U3HA 3GC3A 2GJZB 4YDJA 1JERA 1K4DB 5BVJA 1OV8A 1DLFH 2RMNA 4HKBB 1F11A 3SIKA 4BQ8A 3KPPB 3U30C 4M02A 4PLKC 3D0VB 3T2NL 2ZYHA 2IV8A 5CD5C 5F88A 1DDHA 3ZLQC 5BO1H 4W9CC 4MD5B 1C1EL 1V7MH 5IT2L 3S35L 1U8PA 4LOUD 3QJHB 3DX8A 2FB4L 3UYRH 4AGQA 2CNYA 4ZUSA 1KXHA 3K6SB 2NY3D 3SBWA 4M03A 2VN3A 3VI4B 1T89A 5IB5A 1QYGH 4HMEA 2BHYA 4GSXA 4DO4A 3ESPA 4NO3A 4WV1B 3SDCC 5CWSB 3VXME 1N59A 2VLLA 4P2RA 5EG6C 5BS0D 3SDXE 1UA3A 3O4OC 3NG5A 2XCMC 2WB1A 3UGXA 3O6FD 4NKOA 43CAB 4Y4KB 3O2DL 4I4WA 2G9HB 4PTUB 2J1KA 1P4LB 5JW4M 5C07A 2F2HA 1MQKL 1OAZL 1JHLH 1ZK5A 1GC1H 2B3RA 2YEQA 3DBXA 4FULA 1MIEL 2VAAB 4BGDA 1MFMA 3RG1C 3WV0A 5GGSB 1KB5L 5HYSG 1BXVA 4PRBA 1HINL 4JPVH 1UT9A 1ZGLB 2QSTA 3CZFA 4MDJA 3SDCD 4PU2A 4JKMA 4PCKA 5FOBA 4J8RA 1LTXA 1OB0A 1R3KB 4FKKA 1IE5A 3ESVF 5DJZA 3I75B 1OAKL 3SGJA 3AB0C 3ZDZB 3DIDA 1QAWA 1G9NC 1NAKH 4HUXA 1OP9A 2XHNA 3V4PA 3W11C 3PWPE 1BF8A 4Z7IA 4JRYA 5BOZG 3O81A 4IRSA 1WAAA 4NUMA 2OYLA 4BV1A 1SDDB 2DBLL 1FCGA 4Z3HA 4EDWL 5T1DH 2NNXA 3ZGHA 2YK1L 1OKEA 1IC7L 1R5VB 3IK2A 4OCMC 5LCVA 5GZOC 3S36H 1WHPA 1AR1C 4S10A 4O02L 5E00A 2QHRH 1BIIA 2BC4B 3PV6B 5ID0A 3FUDA 3NIGB 5DMIH 4DERA 3CMOH 1SVZA 4HC1L 4UMGA 2P45B 3UZQA 4TUKL 1U8OB 3TH4T 3FHAA 3K81A 3NACH 2F7OA 4I18B 3HZYB 4RLDA 5I82A 4WWKA 1Q4NX 3TLRA 3F2LA 1MWAH 1ORSB 2WNWA 2QEJA 2KZKA 4X7TA 1JGUH 4AVJA 4IYKA 3ECUA 1QLEH 4I9WE 3CU7A 4HXAL 4GW5B 3QNYB 3QDGE 3N42F 1RIVH 4LFHG 1AMXA 3W9DB 4FYQA 3HZVA 5C07E 4RAUB 3BZFB 3HE7B 2CE6A 5C8JB 2XA8H 1WBXA 2YXFA 4EQ3A 1JHTA 4U3CA 4R2GC 4CN4A 4OD1L 1P5VB 5AVUB 4PRNA 3H7BA 3EO0A 3I50H 2L7QA 2WXHA 3SE8H 5T3XE 2WTOA 4X80L 1ZD6A 3I6GB 1HFUA 3E7JA 8PAZA 1UWGH 1U3JA 2AEOA 4ZPTB 2IOMA 1QASA 2V2XB 3SDAC 4LVHB 4WWKC 3VNZA 3RI5K 1T5WA 1INQA 3GMRA 4NENB 1VB9A 3ZHNA 1HTYA 1R24A 4JPVL 3UJJL 1A6AB 4PSRA 4N2EA 4QAMB 5DEFB 1Q72L 1FL5B 2ZCLL 1F3DH 4ZQTA 1QFOA 2AJSL 3PY9A 1H6UA 1GAFH 3VX0A 1CLCA 3ZYIA 3NSJA 3QI9A 1UUNA 1A7PL 4Y9GA 4ZXBA 3IDXH 5B7FA 1OD9A 3ZXAC 1JIBA 4LBEB 4TUUA 5KVGH 4LF3B 1UB5A 2VITB 5CBAB 1R9FA 3G08B 3MRJB 1G9NH 4LAQL 4HBQA 4ICWA 3JV4B 5EUOB 3R4RA 5F9OL 5GGUA 7PAZA 5B4MC 5TDPB 2HTKC 3DRQA 3ISYA 4PJHE 5H37A 3HNTH 4Y5XC 1RZ8A 4RGNB 3LIZH 1WWCA 1FRGH 4YDLC 5E5MA 3OMNB 1VEOA 4WDIA 3QJQB 3UDWC 1UM5H 1P4IL 4WUUE 3HVNA 4P5MA 4FG0A 3U30B 4TSCH 2YRPA 3IJHB 1GC1C 1DVZA 2JKNA 3O3BB 2JSFA 5BNXD 4UIKL 4K2UL 1PAZA 2IG2H 4KPHH 2YWYA 1N10A 3ARBA 5C0NC 2W0PA 3VFVA 5IUSA 2AK1L 1NMCC 3VVWA 3FC8A 3KD4A 2FWOB 5FF6A 4RX4A 2O5YL 4L4TA 3O45A 5E1GA 4RMSA 1CLYL 4RRPA 1MFVA 4QTHB 3ZTCC 1BFOA 4EQ2A 5KBLA 1YMHB 3BN9C 1N9PA 3GMRB 1JZ6A 1CG9A 3PWUA 2CKNA 3LQZA 4M48H 5MENB 4WW2F 2YA2A 3T0XA 3RHWK 2CLRA 2F54D 4DGVL 4PI2A 1AXSB 4R4BB 3RWGA 5DRXB 2DQDH 4M6ML 4NRZB 1YCSA 3QH3B 3TO4A 3L7EA 1OSPH 2QGEA 3S7GA 3UEQA 1UD3A 1FDLH 4OIAA 2H47C 4XC3H 3E9UA 2EC9T 1A7BA 5JOFA 3D69B 4WO4C 4DGIL 1HL4A 4S0TD 4PJ8A 1FAIL 3C60A 4R96A 5HGHB 2KZ1B 2XIIA 1XHHA 3WUWB 1Q9OB 1EEYA 2XWRA 4JB9L 5EC2A 5CEXB 3S2CA 1TKWB 4R97C 3UTPE 2YA1A 2ICEC 3DX3A 3QHTC 3OB0H 2EDWA 2P1YA 3T8VA 3CSYB 3HNVH 3V4UL 3M07A 1PY4A 3IT8D 3QXVA 4UT7L 4A2GA 4FFWD 2VDRL 2F5BH 5LQBL 4YHIA 3LD8C 3MLZL 1R5IB 4QY8A 3ECVA 5C6TH 3IMBA 2EDXA 3TZVC 4H1LB 5J06A 4PJIB 1N8ZA 2VDPH 1E43A 4WNQB 5E7FA 3VXTB 3Q2WA 5EBMA 1MI5B 3O9WA 1LYQA 2DQJH 4FFZL 4QKXB 4BELD 5KYYB 3GXIA 4XPHH 2E47A 4NZUH 2VLJB 2ZKMX 4GG6F 1N2RB 2IAMA 4GT7A 4UDUB 3WKML 5I19H 4O9HH 5SWQB 1B4RA 3BUTA 2DPKA 3HS0A 5C08E 3H1ZA 5DVNA 4S0SD 3V0HA 1KT2A 1OB1B 5FYLH 3SOBL 2HPTA 1QP1A 4AGOA 3I9GH 3SYCA 1ZVSA 2E59A 1CCZA 1QFWM 2ATPB 2P48B 2DMKA 4XPFH 5TQ2H 1KGCE 4HD9A 3RVXD 4UT6A 1S9WA 4UM8A 2VMEA 3BKML 2NYKA 3A21A 2R15A 1ZVYA 1SDYA 2LOEA 2XV2A 3FQXB 3K72A 3DXAB 4XI5C 4H1LH 4PJEA 1KBWA 1FJ1A 3QNXB 4XPTH 5EEYA 1MPAL 1UM6H 4RAHA 3T0WA 5I8EB 8CGTA 3D0LB 2DM2A 1TJGL 4W68A 1IBZA 4PMEA 4PRPD 3F7KA 3CH8A 3UROR 5HD8D 3RVUD 2GJ6D 1FC2D 5KSVB 1KC5L 3LIUA 5L9DH 2N7AA 4JFYB 4R8WH 1L5GA 3BQUA 2BDNH 3DVGB 2VDNB 3A6CH 5D4QA 1LD9A 4NT6B 1ZXKA 1KLFB 1MLBB 2VRQA 4OZGB 4UOZA 1VZIA 4XWOC 1RSFA 1DBKH 3BPCA 3LYRA 4ZW8A 4UQ3A 4EIBA 3ARFA 3MYJA 1GR7A 1ZLWK 1FDLL 1NCBL 1AE6L 4I48B 4I77H 1HXMA 1ZEAL 1ND0A 1WBZB 3CDGB 2AZAA 5I71C 2CR0A 4S1RH 3MRRA 2QLVB 3DHPA 3M1OA 4M5ZL 4I0PC 5D7LE 2PR9A 4AT6A 4PD4K 5FO2A 3HOGA 2FIRT 4G11A 5CZKA 3R8QA 4HETA 3D4GA 5E9AA 4HISA 4FXKB 1CIDA 3V0WL 1QRKA 2RD0A 5T5FA 4EN3C 3CCHB 4PREB 3E2HC 5KVEE 5F8RC 3VW3L 1WP6A 2ZSVA 3G6JA 3BZ5A 2OSLB 5K39A 4ZFOB 2MQCA 4BDVA 3BZEB 1O5DT 4XP1H 4OCXL 5B3SB 1ZV9A 2APTA 3BZDA 4N0CC 5DUPL 3ZDZF 2UYLB 3IRZA 3T77B 4HZAA 4XNYH 2WZPD 3ZE2B 3K6SA 2E9JA 3RUGF 5AAWA 4M4RB 1J5OH 4GXUM 4LLAA 1U91A 3OKEA 4ZDHB 4L3ED 4HCFA 2Y2TA 3AY4A 1YC8A 1GGIH 4UQBA 3ZZQA 1O7DE 3CPUA 3U2IA 5DJCA 3FT3A 5BS0B 1S9VB 5FFLA 2OR9H 1E0OB 4MDIA 5L4JA 4G7YH 2AQQA 1NCDL 1DZBA 5I17B 3FB7B 4MJIB 1SLVA 5DF0A 4M3HA 5MHSE 2X9ZA 3KLHC 3CSPA 5GRJH 3RGVA 1KTLA 2QV4A 3FU7B 3NTCH 4X9HA 5ISZE 2I24N 3WJLC 4Z6AT 5CO1A 4NNPH 4JFEA 3NMEA 5CHNB 5H37H 3KEHA 2OTPA 3P9WB 2DTSA 4RX4D 4I48A 1JXGA 4LCIL 4HZLA 3O8XB 2X9YA 3CFBB 5SWZA 4GKSB 1F4XH 1KEGH 3U2JA 3OXRB 4MA7L 1CFQA 3AWGA 3F85A 4MA8L 3U7YH 5L6YH 4XMPH 2OL3L 4XHJD 5EN3A 2B2XL 4Y2OB 3BRDA 4TPRL 4PP1D 3TBVB 1CLVA 3ALPA 3QR1A 1JWUA 3VH8B 5DJ6A 1CBVH 4NUPA 5EORL 2JKIS 2PYFA 4BUGA 1EBPA 4OQTL 2AJXL 2IGTA 3Q7JA 1NTDA 3ECBB 1BWWA 1YQ2A 2HLFC 1RZIB 1WF5A 3EGDA 3SJVB 3QJSB 1I1CA 1HEJC 1IAIM 4U1SB 5DRNB 3LZQA 2G9KA 3DVFA 4M5ZH 3EH3B 1NA8A 2GCYB 2IPKB 2VM3A 5H35A 2I07B 3Q44A 4ZTOL 2V8MA 5AVRB 2VDMB 5I8EA 3D0VA 1BXUA 3DX1A 3IMVA 3VYNA 3NJLA 4J8QA 4RBPK 4UINL 1T0NA 3EW3B 1DLFL 1OB1A 1UZ6F 4PS3A 4AYBA 3FONB 1CLYH 4JQXA 1YUHA 2GPZA 4ZUSB 2XIDA 3PNRB 3C8KB 3UZQB 1Q0XH 4OLWL 1CDBA 1XVSA 2LAAA 2AEIT 3ZRCC 1RUMH 3FSWA 2V6HA 3EYUL 3JT0A 5EOQL 3TBTA 2Z7ZA 3L3OC 3MBEA 4L23A 2R0ZL 3UYRL 2Q76A 4UUJA 1K2DA 3T6VA 2MEJB 4I13B 3EXJA 1FIGL 1NEPA 3VU1A 3F01A 3SE4C 5ITBH 1XD1A 2J71A 2X44D 1TCRA 4UDTA 2Q8AH 5HGDA 1KCSH 4R7NA 3ZKSD 1NGWB 4ZMZA 4MNQE 3WTWA 1H9DA 4B5EA 1S2EA 3LEXB 2BOCA 4OFIA 5T1KD 1UJTA 3GLDA 1USQA 4C83A 1IBBA 4Z7OE 1U8LA 2B5IC 4DGUA 5ADOL 2AS5M 4I3SH 3O2DH 3ZR5A 2J43A 1DVXA 2E9IA 5JPMC 3P3TA 3N2JA 4ZUWA 1KTBA 1TNMA 1U30A 3TNNA 3E9TA 2A6DB 3VXRB 2FZ3B 5KBMA 1I9RH 4H13C 1VESA 2PCYA 1ZGLA 1AZZC 2J73A 2MPVA 1SYSB 5IB3B 1EO7A 1GS6X 1PD0A 4PRBB 4K7PY 3NCFB 5EN2A 2WOYA 3N50A 5C0FA 1HJBC 3U9UA 3VRJA 5JOPE 2EDEA 1AD0A 1BWMA 2EC8A 1ZIBA 4JREC 4UV7L 4BQCA 5E1AA 1WDAA 2HUHA 1NAMB 2HVJB 1FV1B 3WMPA 5D7LB 4ZW5A 3KLAB 5BJTB 4CMMB 3FT4A 1QI3A 32C2A 4QNPF 4UNTA 4ZXBB 2QADD 4K3JH 3T4YA 1AQDA 4N25A 1AP2A 2BHUA 2IH8A 2P28B 3T3PF 1U3YA 5AZUA 3GI8H 3ZKXC 3FTGB 4BZ1A 4CKQA 3ZE1E 1U8HA 1RULH 1A22B 4MSWB 3UL4A 1EAJA 2NY4B 4B9IA 2V9QA 4RMBA 5JMOC 1OQXA 1DJIA 2ZG3A 3VWJC 2YEZB 1A1MB 1SVCP 1LK3H 5DA0B 5FCSH 2ERJB 5ID0B 3X17A 4LCWA 5I1AA 2YAMA 1GOFA 4N0YL 1IFHH 1K8DB 4L4JA 3UDWA 4G1MB 4BZ2A 2JQMA 1C16A 1MAKA 1GMIA 4Z7OB 1CFVL 4L3EB 4PN6A 5TF0A 1UQSB 3NJMA 3S34H 2BSRB 1YAZA 1HNFA 3WMQA 1U8LB 4PJAB 5ISZB 3FU7A 1H8SA 3EFFB 4LFHD 4U1LB 1NPNA 2LU5A 3S35X 3HZVB 3C2AL 5K5YA 1LO3L 4LEEA 4YC2B 3CPLB 4UT6H 3D30A 2HVBA 4EBQL 3P9MA 4DP4X 2N59A 4OJFH 2VDRB 4V1DE 4G7SB 3CFTA 3FUJA 5KTEH 2BXZA 1KCRL 2JV6A 3MRIA 4IGBD 4MBOA 1O6TA 4X9IA 4Q89A 4PJ5D 3V0JA 4AIOA 3VXPB 3X3GL 5JXED 3H42L 5KSBA 2WXJA 3BPLB 4F92B 4Y1AB 5TE6H 4N85A 1TTBA 1V3LA 2NSMA 1HWGB 1DEEA 1MCSA 3TO4C 2YMXL 1ZGLP 5HJBA 1KCLA 4YDKH 2GI7A 5ESVA 3QIWB 1T3FA 3ARGA 4L8CB 3QH3A 4YPJA 4AZUA 4JFDE 2EDMA 2J1WA 3DSFH 5KJ4A 5BV7L 1QABA 1AP2B 1IX2A 1T5WB 2IOIA 2UXFA 5BV7C 1XH3A 4MWFB 3HMXL 4DW2H 5IM7A 2J55A 3CFJB 1WISA 4AG4H 2DQ6A 4J3OD 4YBLB 3RYMA 4OI8A 1J8HA 4MXWH 4EO5A 3QFDB 4ONHB 2BY0A 4R6UA 4I85A 1F6AB 1CLOH 3MPCA 1JHKH 1M7DA 2X1OA 3S5LG 1RJYA 4IM8A 5FYKU 2O93L 2KI6A 3NIGE 3QORD 1P7QA 5D5MF 4X9GA 2ETWA 3CDYA 2CKBL 2ZOKB 3D50A 1SHXA 3FB6A 4UILH 4YXKL 5HYFA 3UIYA 2R59A 2WLJA 3RL2A 1CDJA 1MXGA 5ISZA 5E6UB 4IBZA 2MOVA 3E6HA 5GRVK 5I74C 3CHQA 3O9WB 2B4CC 1Y0LB 3ZHFA 2F19L 3QUXA 2YD7A 1HZLA 2Q87A 2GBVA 4F7EA 3ME0A 2XNAA 4N0YH 1JUFB 2AXGB 4AQEA 1SBSH 4E5XB 2ADGA 3OC5A 3JYCA 3VDCA 3KXFD 3DURA 2VN4A 2ORBH 5CUSH 4KK8C 1FIEA 1ZDQA 2XV6B 3FSOA 4M6AA 4G83A 2WZ0A 4ILDA 4GEIA 1NINA 4BQ6A 1ZVSB 1E6OH 3D39E 4UYPA 4YR6B 5DD0H 4GRMB 1CUOA 1KIUB 2YS4A 3MROB 4JE0A 4KMLB 4N2BA 5EBLB 3UTZA 1MF2H 1SMOA 2IO5A 5F3HA 1IGFL 1KCRH 2UY6A 5C08B 2O6DA 1V8HA 2MKWA 1BDYA 3JV5A 1E3XA 2H9GA 4Z7WE 3QQ4B 3DGCR 2LU4A 4LSRL 1S3KH 4NRZA 3DJZA 3DBSA 3TN0D 1P9MA 3RFRA 3WMSA 1GYVA 2EVHA 4E68A 4WF7A 4WIQA 2VL5B 5EEVA 5DRXA 1E9QB 1QFPA 1SUJA 4PWKA 1N6QL 1W72A 1P6WA 4JFQA 2O6FA 5AKTA 2ERJC 1QKZL 2KLSA 1JPFA 4DH2A 3PDDA 2GJ6A 4L5FE 4PJ7A 2F7PA 3RY5A 3MJ7B 1W72L 2X41A 4PM1A 4FMKA 3FDWA 1IGCH 1QUPA 1UM4H 2E9GA 3EFOB 4WSKA 5J4MA 2DM3A 3BDBA 2NY6B 3QUZB 3OKLB 5I1KH 1UJ3A 1UASA 1QBLH 4ABVA 2QGCA 4RFNB 5C3LD 1JVKA 4UTAL 3OX8B 1MJ8L 4ZODA 2J6EA 4UT7H 4AYDC 3M6DA 3FT9A 2KZBA 1R6VA 2H6PA 4GAAA 4LASH 2HG5B 3PXLA 5I0YA 2B1AH 4EN2A 3UC2A 2WZ5A 4Z7AA 3FTWA 2H4EA 1MJ7H 4TULH 5FGSA 1N5YL 2XWCA 3TPKA 3IGKA 2YN3A 5FHAL 2WQSA 3U0TA 3BSZL 5F44A 1D5BB 3FCBA 1DCEA 4AOFA 4WKZA 4M5YH 4C56A 4MQTB 1C7SA 4N9GB 3FQTB 5EPMB 3PV6A 1FLRL 3IRCA 4JRXA 3W0WA 1TO5A 1M6OB 2XWBB 2VMJA 3DARA 1TVHA 1X6NA 2QPSA 3ULUD 1OTTC 3QHFH 4FQ2L 4MGXA 1WE5A 2OJ1A 4TYUA 5B3JF 5HYIA 3CMGA 1U33A 1FGNH 4N4YB 3SDYH 1EX0A 5K33A 2I69A 1LGVA 2DQTH 1PQZA 1NLDH 5TK4A 4FLSA 1JMXA 2WIMA 3MV7A 5IW6A 2R0LH 4XO8A 4DP5X 3H7LA 1ID5I 2BO0A 2XC8A 1GPOL 1Z9SB 4M8UA 4NFBA 1XSOA 4NLAA 5ENWB 1S4IA 1L9MA 2Y06L 4BHUI 4PJBF 1WGOA 3PGDA 3LY6A 4JM2B 4RFNC 3SEPA 4RGNE 5EU4A 1S3KL 1A6WL 1WAAF 1AY1L 1ACCA 1X4YA 4FLRA 3JWOL 2GTZA 3QUYB 1A6ZB 4EI6B 5AVQB 4U6VH 1ZS8A 2GT9B 3WIHA 4KOBA 1THAA 2BFGA 3OKOB 1V54B 5HYJD 4N6RB 4PJFE 4AEHL 1ND0B 5FV1L 4YSRA 2XETA 1LP9F 2PW1B 2ZQKA 2EYRB 5C1MB 2OZ4H 3T6QC 2OI9C 3J2PA 2DQEL 1BX2A 1B6UA 2OMWB 2YOCA 3ECBA 3IBOA 1ZHBB 5FKPA 3FU9A 1UB6B 1TJIL 1J48A 3MR9A 3D85D 4DKTA 1F1GA 4ELMB 3GIVA 2AGJL 2X4OA 2HMIC 5I1KL 1OCZB 4GRLD 4CU6A 4CUCA 2H0PA 1NC2D 4FQJL 3T0VA 3TEUA 2R2BB 1DQJA 1NWPA 2R29A 1M7IB 3MLVL 2YC1B 3CFKA 3NSYA 4X4XA 2JK5B 4AM0Q 3QXDB 4X0KA 4G6JH 3G6DH 1D5IH 2VC2L 3CJJA 3ZRSA 1IM9A 4Y16A 3QHZH 4GNKB 2TSAA 3QUML 2F8OA 4QRQB 4YXHL 2W5PA 2VSKB 3O9WD 1MLCB 4LLVA 3D33A 3TXAA 5MP6H 3D51A 3QQNA 2UY7B 3SE4A 3KJ6H 1MFEL 2WYTA 5TE7H 1DQQA 4NIKB 1SGKA 3ESNA 1W0WB 1U91B 3OKEB 5AW1B 3VD3A 4KNSA 1MIEH 5CGYD 1G1KA 1WUNT 2NSXA 2D0HA 5IBLC 4Z7WF 4Y5YB 2C3VA 3HN3A 3DX9A 1OPOA 1S9KC 3NIDF 1KB5B 5CJOL 2C1PA 3PV7A 2AF2A 1TDQA 4TXVB 1CD1A 1OLZA 4JUSA 1YQVL 2VH5L 1EFQA 3GMNA 4TNEA 4RGOL 4XGZB 1XMEB 4P3CH 3ZMEA 1KENH 3GSNH 3CVHA 4GAGL 43C9A 5I18H 4UM9D 5F0MB 2W60B 4K9JA 4Y9FA 1OHQA 3OR6A 5KBKA 1SM3H 3TO4D 4OIIL 1TYRA 2ZP0T 1E2VA 2EDTA 4Y4HA 4I8DA 1OLLA 3FQRB 4PJ6A 4UILL 4F27A 1M9WA 4EN3B 4NO0A 2HKFL 2OMZA 4WUKL 2CKBB 2N7SA 1RZ7L 2OMYA 2WXLA 2MQ3A 3L9RA 1S78D 2YQ2A 4YHPB 1THCA 4FXKC 1XD0A 3GHEH 3AQYA 4IIQC 4K3EL 1HZKA 3RA7H 3FT4B 2QJDA 5DUMH 5EIVA 5JHLL 3WTTA 1F6LL 3VYOA 4Q52A 4A68A 5JOFB 1AC6A 3Q8AA 4JZJB 4NFCA 1FGVH 2R1YB 3QE5A 1MRDH 4N1HB 5E56A 5H35B 4LPCA 1YEKH 3NZ8B 4MZ3A 3FT2B 4P99A 3VO0A 3C8KA 3H9YA 3VMOA 3EJRA 3UX9B 5E4EB 3NGBC 4XCNB 4F7MB 5BZDA 3PFUA 1E5BA 1ZT1A 1HL5A 1FPTH 1SQ2N 1XGRA 2IVFC 3VFPB 3B8YA 5I74B 5I0VA 1JD7A 5DWPA 4KRPC 1VADA 4WZ9A 4UOW0 3QHZL 1J88A 1OL0A 3B7TA 1N8ZB 4GIOA 4XNZB 2AV7A 4X6CB 3ORJA 4AJVA 4FZEH 2NUTA 1NKRA 2FX9H 3GK8H 4G6FB 2G0KA 2QKIC 2JE8A 4R4ND 5T3XD 3EDJA 3FCTA 3GUTA 1BPVA 2QMKA 4LHUB 5CN2A 3MCYA 3OR6B 5EFIB 1G9MC 1KCUL 1A6ZA 5E99H 4ZXBD 3X1BA 5GRXG 4Z3FA 4PJEE 5CFHA 3NZSA 3UJJH 1IGCL 1UM4L 1SXSA 3V4VH 5KSBB 2ZUQB 4IRSD 1RSYA 1E4WL 4LHQB 5BV7B 5I5MA 4JPIB 4HKJA 5I8CA 3GT6A 1YQVH 3TIDB 4QO1A 1KJ3L 3L3OA 4A2HA 4XBGB 3LHPH 1QLRA 3QJHA 5GIRB 1A7PH 3STBA 1L0XA 4ZFOL 1G6VK 1O6SA 3D5OF 2M2DA 3LPOA 4LKCA 4PB0H 1FJ1B 3QNXA 4IU3A 2K78A 1CMOA 4EKJA 4XNXL 3MBWA 2XY1A 5DZJA 1BVZA 1UD2A 4QOKA 4F7CB 4P2OC 1YSOA 5BO0D 1N5YH 4FHJA 4NUJA 4NOFA 4N8VG 5GS1C 4OFKA 4Q58C 5B3JE 1RZ7H 5G4NA 4Y5XA 1KELL 3PWPA 4JZNB 4L9DA 1IAMA 2CNZA 4GT0A 5FYJE 4OFYD 3SHSA 5BRQA 3IWUA 1RURH 4KTEL 5D96B 3DX7B 3HE6D 1IM9B 3QUXD 4OTXH 5ICYA 3HA0A 4XOBA 1FRGL 4WJ5A 1BLNA 5JW3H 4XB3A 1HKLL 5CIPA 2GW5A 2P5EA 4HWBL 3RGBA 3BGMB 4MA1B 4E0RB 5SX4I 4FYSA 1BF5A 3IE4A 3H0TB 1ILUA 1NCTA 1UWFA 1VFBA 1YECH 2R1XA 4LRIC 4RZKA 4Z7OF 5IW1B 5ETUB 3QULA 3ZT6A 1HH9B 2VE6A 1H3GA 3H2WA 1NEZA 4O51A 1OM3L 1MW1A 4KH2A 3VRLE 5SWSE 5I6MA 5FA4B 1H3TA 4HPYH 3I3EA 5INDB 2AQRA 4JVUA 1AZRA 2H3NB 4J3TA 3BIBX 4QHLB 2WKOA 1OK8A 2WXMA 2NY4C 3LRSB 3M17A 1JWMA 3JWDL 3FOLA 5GRZA 3MLTB 3VXRD 5DHMC 3MNZA 5CSZA 5D1ZA 1SFDA 4PJDB 1E90A 5HDBE 3P4MB 5FFOA 3VAEA 2YSTA 5FV2A 3FB5B 3H54A 2FEEI 4PJXF 4Y4FB 5I1EH 4TNVF 2KERA 2O5ZH 1SXCA 3CLEH 4JRYD 4RBPH 5KANI 3MA9L 4H88H 1NCWL 1C8PA 2Y6SC 5BXFA 4XC3L 4KXCA 1AZCA 1MFAH 4W9ZA 1N67A 4X4ME 1BIIB 2BC4A 4P2RD 1E67A 5F6HJ 5BS0A 1DE4A 1DBMH 3V4VL 3CWGA 2B20A 2J56A 2FEJA 4CVWA 4LCWE 1JZDC 3OLGA 2X1QA 2F7QA 3VI4A 5HGBB 1E42A 2CR6A 2YMXH 3FB7A 4MJIA 1DANU 1EXGA 4KMTH 4IOIA 1YY8A 3NP3A 3QFJE 1RVFH 3KVQA 4EUPG 4G5ZL 5EO9B 3RY6A 4HOMA 4YDMA 3NEXA 5C2BH 5SV3A 2ZXCA 3MLPA 2I9TA 1BSIA 4P04A 4LSSH 4AV0A 3MCLH 4O2EA 1J1OH 2PR4L 5IVXF 1EAQA 5A2AA 3WJJC 3ZTJH 5I15H 1ORQB 2L3BA 3O8XC 2K0RA 1P4BH 4IIQA 4UU9A 2WQWA 5IF0A 4Y9BA 4U49A 4NZUL 2DTML 2PWHA 4UQ3B 3T2QA 4KKCD 1BD2A 1P1VA 3VXNA 5CMAB 4FX5A 3DO4A 2R9HD 5I19L 5AYUH 3EO0B 5GSVA 1PLCA 3ARYA 4Y19D 2HN7B 4QT5A 1WBZA 3BKYL 5CN3A 5GGTH 3FTYA 2G3NA 1WUZA 2HT4C 4D0DB 1PY9A 3SZKC 4BK5A 4G1EA 3PP3H 4PJXE 2XV3A 4CN6A 2D3NA 5KYXA 4RGOH 4W81A 2O5XH 3II1A 4JHAH 3RPKA 4LP5A 4OCLC 3BKMH 1PG7L 2NW3A 4TTDD 2I7SA 4YDVA 3LKQB 2MCPL 5FPIA 4HALA 4R84A 5HPMA 5EO1B 2EO1A 1SXNA 1QFUH 3BDYL 5IV2A 3TPUA 3QIUD 4Z0BH 3H2QA 1QD0A 2BP0B 1FE8L 4OLVL 1RZFH 2AJ3B 2E27H 4JDEB 3T8XB 1XF2A 3MRNA 1ZV2A 4GMSL 2WWNA 1CE1H 3KPRA 1A4JB 2E75C 4IU3B 1CGSL 1BM3L 4GO8A 5BRZE 3CDCA 5ACZB 1BD2E 3IMRA 2OSWA 1VF5C 5JHDA 3SYAA 1PFOA 1VIWA 2MOGA 3L1FA 4JHVA 3KYAA 2HJFB 3B56A 1OAUH 1MFAL 4P07A 2AW2A 1MCLA 1J9TA 2XVBA 3P30H 4ACTA 3PGDB 4EXPX 1RKRA 5D2LF 4D7PA 3NRPA 4PBDA 3GSNA 5DO2D 4XXDB 2MCAA 3I50L 1NSNL 5F7DB 1YEHL 1WICA 5DJDA 1X4XA 4P9HC 3IJHA 1S5HA 3H3PL 4AUJA 3F58L 3WFBL 2Y5QA 3DV6A 1U9KA 2ZYSA 4G5AA 3B9AA 4L29A 1FORH 1IARB 3AJ7A 1T4WA 2PCFA 4Q0XH 4YJZL 4PH8A 2AC0A 4OCYL 4E9SA 1J18A 3BI9X 4KRLB 3WTSA 5FKPB 1OXYA 2NZ1A 1P5UC 2YPLB 1BJMA 4G9DB 1JPTL 2OJZH 3AXIA 3NA9H 4PRNB 2H3NA 4W9GC 2BOBB 2VLKA 4WDIB 4ODVL 5DO8A 1XAUA 5JR1L 1PU0A 2K7PA 2YN5A 2W8CA 3APMA 4DFIA 4ES9A 5SX4H 1KSRA 5CJQL 2N56A 5LKNA 1GGIL 3QEHA 1H3VA 2AK4B 2FIKB 1CXKA 4POZD 5IROA 3L1OH 4RIRA 2OV0A 5MEOB 1FFTB 2EKSB 3NFPA 5A7EA 3TEZA 3IJSB 3LDBB 3P3SA 2BNQE 2WLLB 1T1XA 4WI8A 4FNPA 2O5XL 4MMXB 4V2BA 3SCMA 1IBGL 5IJVB 1V05A 2IWGA 5HGHA 2VDLH 5CEZH 1CFSA 4AGNA 3LQZB 4KBPA 1JGEA 4X6CF 5IQMA 3WE1A 2YFOA 3IJEA 3RWFA 5ICUA 4JVWA 4U1KA 4U33A 2P47B 4Z0BL 3MV7B 2WYHA 2EDQA 1CFTB 3VFTB 3SDDA 1F86A 3X11A 4FNLL 4EI5D 2XX1A 2V7NB 5DZ9A 4PJCB 4ALAH 2ITEA 4LLQA 4JHZA 2WNKA 1LXMA 3DOIA 1PKQB 3G7TA 4U6XB 1HQRA 2R1WB 5C09A 3NIFE 1MUJA 1HHGA 3H9SB 4XP5L 1VZHA 3NAAH 2Z4TA 3QZLA 2JI1A 2RBLA 4P5MB 5HHMB 1EGJH 4OZGE 2YKLH 3BP4A 1DQLL 4KWUA 3U4AA 4CBZA 2R69L 3D6GA 1YN6B 3PIQA 3FBQA 3FO2B 5DD5L 3BW9B 4JUTA 3V0DA 5CMAA 4EI6A 4JRXE 3GGWA 3LVTA 2Z92A 3VXRA 2W81C 4YHPA 1HCVA 3A4AA 5AOMA 3HC3H 2NNCA 1WJ3A 1FNLA 5HI4C 5SWSD 1I8LA 2BCMA 4ZOCA 3FU0A 4FTVD 1EWHA 4NRXB 5C92A 3JWDH 4NCDA 3U4BH 2GY7B 2EUVA 4JM2F 2VXUH 3REVB 4X98B 3TM6A 5JQHC 1TJIH 3OWEA 2OS7A 5AW3B 5HYSA 1C5BL 1QRND 1T4KB 1P6AB 1KIPA 2A2QT 1FUNA 3S6CA 3GSUA 2E56A 4NWTH 3OKMA 3VI3B 4NRYB 3DUSB 4W6WB 4JG1H 3ZDXE 1ZGLM 3CFNA 5FEBA 2V37A 4HT1L 4CMMA 4UZSA 1NCGA 1OK0A 5C09E 3CFIC 4X4XB 1BFTA 3ATEA 1L5GB 1KULA 4LT7A 3CUPB 1MLCA 4LLVB 1OZUA 1F45A 1KTCA 3VFRB 3F3HA 1FNFA 3MUY1 4U1KB 5DHDA 4R96B 2FD6L 1LEGA 4PTTA 3KPTA 5AW5B 4PJFA 2R0WL 4XTRD 3FQXA 1EEQA 1DBBL 3HN5A 2E9WA 3LX9A 3PJSA 5E4AA 1WFMA 2QR0B 4JO5A 4GI9A 4ZFGL 3MRMB 3DMMA 4L0ZA 1WCQA 4OZHE 3LKNA 3VJ6A 2VLRB 1F4WL 3EYFB 1MY5A 1V7NL 3F04A 4OI9A 4MNQB 3RQ3A 3B9KD 1AQMA 5SX5H 3RVTD 2ODIA 3OSKA 3N5AA 4LSTL 4KI5C 3F00A 3FB8B 3R06A 3QFJD 3D9AL 4B9KC 1QR4A 3G9AB 3K0WA 1MREH 4JN1H 3BAEL 1SDAB 2NZ9D 5KEZA 1SXZA 1Q0EA 2HCZX 1UATA 2D9CA 4FZ8L 4I1PA 4U7SA 3T08A 4P8QA 4NS0A 5F7UA 4XNQB 3VWKA 3BVDB 1IQWH 1QLFA 3S5LA 4X9YA 4XPFL 3MVSA 3QG6A 4PREA 2H32A 3B2VL 3GGWB 2W9DH 2IPUG 1E7VA 4RDBA 1NCIA 3QJOA 4C4KO 1JNHB 4XVJH 2DQFA 3QJRB 1TPXB 3EKCA 4Y4HB 1RUQH 1FBIL 3WXVL 4PG2A 4HG4K 1S7UB 3CXDL 4AM0A 1IL1A 3B6SB 1RZJC 3TF4A 4LOUC 3QK0A 1UM6L 2HVKA 1NUGA 5DJ2B 1XAKA 5CSBA 3WLWD 4OLUL 5HDBB 4PWGA 3RWCA 1GZQB 4QHPA 3IDNA 4FXGA 2F74B 3IEAA 4HIJB 4Y4FC 4JJ5A 5EU3A 3B37A 3SJVE 3V0GA 3K4DA 3QP3A 2ODHA 4X7TB 1BJ1H 3MRKB 4FABL 1JYNA 3EH1A 4WSJA 4TNFA 1RFDH 1UGNA 1V3KA 5DHVB 3WEOA 4E42A 2ZKHH 4P5TC 4CVXA 1GZHC 5J1AB 1CU4H 2P8LB 5JDSA 2BSEA 4ZMPA 1MVYA 4M93C 5D8JL 5LG1A 3MJ9H 1MEXH 5AENA 2JKSA 4RGMB 3RFZC 1LO3H 1OSZB 1JDAA 5LBVA 2EXYC 3MUGA 3GBML 5J56B 1FN4A 2DJ4A 1SY6L 4AX3A 1HSAA 3DIFB 4MMZA 1IGYB 2K9FB 4JQIL 2BWDA 2ZX8A 2AHIA 2Y6TE 4PJGF 3VB9A 3M17B 3DVNB 5E9DD 2OXGB 4O02B 3S3SA 3BKCH 5I1DA 5DJ6B 3MUZ1 3H42H 5I6PA 1I8MA 2YD0A 3MA7A 4YO0B 2X0UA 4Z0XA 4ELKA 3PWLB 3MOBH 2ENQA 5CZXC 4JLRA 1JZHA 1K72A 2VW7A 5D72H 5ALBL 4P5TD 1RUKL 2OW6A 2WM0A 4ZS7H 4WU5A 4XI5D 3O8XD 5GS1B 2G0LA 5E6IA 3JYBA 3O8XA 3NPSC 4J1UA 1CYXA 4TS6A 4GKSA 2XRAH 3RUGE 1EK3A 3NFNA 1OTUC 4FDWA 2Y36L 2CG9X 4AM0B 1PX4A 3UCRA 3LZFL 3BVWA 4PGEA 3UTSE 1XZ0B 1AZNA 4CADA 5BMFL 4MZRA 1G6RA 1RZKC 1LJMA 4MAYA 1CVSC 2J72A 3WS6C 3SDAB 1CYGA 4F8QA 3MRHB 3A3YB 3ZVVA 4OCNC 4FFVC 2P24A 2F5AH 3V4PL 3OLEA 1E6JL 2G2NA 4O4YL 1MWAB 3K4AA 4ZT1A 5GGUB 2QTEA 3JBG7 5DJCB 2X70B 5DHVA 4R2GB 3KGUA 1WC7B 1Z1WA 1WFJA 2DIJA 4YXKH 4BXSV 1RZQA 4Q9RL 1OAQH 5I24A 2YIHA 2IAND 4ODSL 1ZWIA 2ZUTA 3QIUC 1JJUA 3QWOA 1RZKL 2WJ5A 2CLVA 4LLYB 1U8IB 5DK2A 1CGTA 5FECA 1K8IB 1R1CA 4F7PA 4XNZC 4DKDC 4OTXL 1M56B 3GMMA 3P4NA 1MAJA 3CZGA 4Z76A 1JD9A 3BVNB 2X6BA 3AG1B 5E70A 1TQSA 4G6KH 1URIA 4M62H 2PW2B 5DVKA 1FL6B 1U95B 1MWAL 1UKSA 3MCKB 3OXRA 4OV5A 3MJ9L 3WN5B 1HESA 3II3A 4QHLA 4PR5B 3KWUA 4QDGA 5KYXB 3ZTJG 3SQRA 1XQ4A 1WFNA 4LGRB 5GS1A 4Y89A 2IALA 3ILEA 4OGXH 2VXQL 2ZWYA 1YEIH 4PJDA 4WV1C 4JZJC 3S5LB 4ZNEE 5A6LA 3M1BB 3KS0J 1PKOA 3S8FB 1ZY9A 3GJFB 5GHWH 2BIHA 4W4NA 2X4TB 2YXWA 4KQ3L 3BWSA 1B90A 1D5XA 1FIGH 1K3IA 5GGQL 1RUKH 3SE8L 4BQ9A 4JNXA 1U8HB 5DC0A 4N0UB 2YD5A 2BNUB 4HX1B 5LG6A 4N2CA 2X3AA 4K9EL 4MDRA 2ZUXA 1H8LA 4HCRA 3BMWA 3RZCC 4JFXB 4JO4L 4IRJC 5B1KA 4TUJB 1A65A 1TQBB 4IOIB 2APSA 2BNQD 2EC9U 3K7UA 4I3SL 4NKOB 4WTQA 4NKMA 5JHAA 4QGTA 9PCYA 1QRNE 1DBAL 1PG7X 2CXKA 2G2RA 2CPUA 5A1AA 5DZAA 5IK3B 3WS3B 5E94B 1HIML 5FO9B 4PLOB 3OLDA 4G2AA 1ZHLA 2KQNA 4O4YH 2BERA 1RPQA 2X6UA 3IYLW 4PRIB 4P4KC 5A16B 3UPRA 5C2BL 1OSEA 3RWDB 2QV2A 4C83B 3E1F1 1TZAA 3S3PA 4E9LA 2D03H 1T1ZB 4DUVA 2PCPB 3Q8CA 5BZWB 2J8UB 2A9NL 3TYGH 4OJYA 5GGSY 3NCCB 4ZUWB 1DBBH 2CKBA 3L1GA 4M5YL 4ZFGH 4N6RA 4WW1B 4EKXA 2UWEB 3L5XL 1F8TL 2OMTB 2TRHA 2WWOA 3GJEB 3WL9B 1QEWA 5LXVA 3K74B 2IALB 5IB3A 4WNQA 1E4JA 2VRAA 4WCYH 4MX7B 2BINA 1ZA6A 1M6UA 1MREL 3BKYH 1I75A 4RQQA 1U3HD 2DD8L 1YG9A 4WUUD 3VCLA 2QGBA 3ULUE 4R5VA 3KCPA 4U3HA 4DESA 3MC0A 1UYWH 3HS9A 2XUWA 3GEWB 3EOAA 3QDME 5FW7A 1AFVL 2WLMA 3FRUA 1UT2A 1CI5A 4BUHA 2ZXQA 2NXYB 1WZ1L 1N0XL 3MUUA 4KQ4H 1PG7H 4NQQA 2B9AA 3Q1SL 2VXQH 4NN5C 3O0RH 4LEXH 5AALA 2VKWA 4HKXA 1R75A 1SHSA 2YLHA 2Y25A 4AGLA 4MB5A 4V1DB 5LGHH 1NAML 2CK0H 1JMZA 4YHYC 3I9PA 3B9KC 5KSBF 3BWAA 1A6WH 4EIZC 3KPRD 5HDQH 1T80A 4PLNC 2VLLB 3FPYA 3KPRB 3TN0A 5C70A 3BCFA 4YDZA 4DCQB 1Y07A 1WCBA 2A3TA 3MRDA 3UGEA 2WO4A 3ELQA 3MV11 4D9RD 3TTYA 5ADPH 3RIFF 5E1QA 1WFOA 5F97E 3PGCB 1IGIH 2OM5A 4JM2C 2EABA 1FSKC 4BJLA 5KG9A 3NIFB 2NT0A 4B6ZA 2GSGB 4UTBH 1OGAA 3M8OL 1RIHH 4PJCE 2JJTA 2ZUVA 3EYVB 1G1CA 5I1GH 4GO6B 1DBAH 1XR9A 2DL9A 1XSKA 2SODB 3KDMA 4PYHA 2ALAA 4XP4H 3HC0B 4M6NL 4BDVB 1S7VA 1D7DA 1UACH 3V0FA 1FORL 1QFWH 1G5GA 2ZCHH 5J3HD 4KNUA 2XV0A 1F5WA 5AW7B 4DW2L 4BKLB 2RH0A 4YSTA 3MODL 4K94H 2HX9A 1O9VA 4JJHA 4FQHB 2H41A 4DOHE 3QIBC 3KWVA 1JPTH 2OJZL 3BEWA 3BUQA 2X4NA 1QSZA 3KVPA 4ERSL 4KXDA 1FF5A 5F9WC 1CLZL 3C5SB 3H4FA 5B38B 2C9PA 4MZIA 1HHIA 3QI9B 1D5MA 1IC4L 2PCXA 4MCYA 4YVUA 5I73B 1FVEA 4AKPA 1QTSA 2VSDA 2ZKYA 3ARRA 3DI3B 6FABH 4HF5H 3WI9A 4ODUB 1R5VA 5CBAA 3BYYA 3LPWA 5MERB 2KPNA 4PJHF 3UTSD 5KUMA 1S8DB 5E2UL 2Q3XA 1AO7E 4MJID 1PZUB 4U31A 5E2TL 2NYYD 5CJXA 2F19H 4XOEA 3VGAC 4A7SA 2YGPA 4DCQA 2YQGA 4Z7UE 3ATBA 3DGDA 3ZDWA 3U7WL 2GABA 3MCG1 2L7JA 4DHLA 1XGRB 3VYPA 4YSPA 3OKKA 4TL5A 4EOWL 3RWFB 2OCFD 5JZ7D 3EJPA 2WV3A 3H8NA 1TJGH 1QPXA 1KGYE 3CSBA 3QZNA 1R3HA 1H8OA 4LLMA 5L4FA 2WXNA 2CMRH 1WZKA 1RMFL 1OAYL 5D6DC 4PGBA 5TFSL 3DJ9A 4PG2C 3O0LA 1JNHA 2XJLA 1X4ZA 3HG3A 4K3EH 1HHHB 2EXYD 5E4EC 4XP5H 3DPDA 4YE0A 3APNA 3W5MA 3I84A 1K3ZA 1YMMD 2JQAA 4HH9B 1XXFC 1ZLDA 2NW2A 4PLJC 4Z7NE 4J3OC 4ACPA 1OAXH 4TUOB 1IKOP 4GUQA 2RQEA 3CAFA 2NLJB 4RISL 3ZE0B 1O6VA 4XC1L 1NOLA 4GAYA 2C3XA 3TT1L 2GSIB 1HOCB 2NNRA 1RK0B 2FGZA 2IH1B 2EE9A 5JLZA 1EA9C 5LDSA 1ZKAA 4L4VB 1F58H 3EJZC 4DNLA 4GKLA 3T2NH 4OKVB 5I23A 3ULAB 2XQBH 1OTUD 2EEBA 1QSED 3K1DA 4HHGA 1Z9SA 1D5ZB 4ZPVA 4NQVA 4HPOH 2W59A 3HUJF 4X50A 4YL9A 4YSEA 1I1FA 2GBTA 5DZNA 1VPOL 1AI1H 1BQKA 1FO0B 3T0DA 6FABL 2FHCA 5GS0C 4NQDB 4XE5B 3WEXB 2H8PB 3UBFA 5DUBA 2X89D 5LJYH 1NC4A 4WFHE 2WLNA 1D7BA 1R5IA 4QY8B 2XPZA 3ILQC 4RMRA 4D0DA 2EIBA 2DLEA 1ZIAA 3L81A 1SJHA 3GBNH 4MZ2A 3F64A 3T09A 2NCEA 3U9UB 3VRJB 3NEOA 2PO6A 2V5TA 4N2HA 4YBLC 2EXTA 5CNHA 5D4JA 2ENSA 1U8CB 8FABA 2DDQL 4APQA 4JS7A 3VGAB 3MNVA 3GM8A 1HNGA 4YMPA 1UEMA 1JWMB 1P4IH 2XQ0A 4XVUD 3ZHLA 5I1CL 5T3ZL 1OP5K 2OYKA 5CCGE 3KLHD 1Z9OA 3L3IB 2R27A 1NGYB 2Y69B 2A6IB 4K23H 1TNNA 5CP7B 1TITA 3BAJA 3F7VB 2PYED 2H32B 3LB6C 4X6BA 2NNFA 4XMPL 1NLDL 2W9DL 3TVMB 5I73C 2UVEA 3GB7B 3D1MC 3MN8A 1GOGA 2ZG2A 3ILQD 1V3JA 1P7KA 5B7EA 4N1EA 2OMVB 2Z8VC 4NJ9H 2CO6B 2V7HB 2Y7MA 3BT2H 4GKNB 2DYPA 4KK9D 3BUYB 5DA4A 3RVWD 5ABDE 4NPYA 2NY0C 5AB1A 3T4YB 1IVLA 4B95C 1PQZB 3ATDA 1ECYA 4E42B 2WMPB 3NESA 4S11A 5HYEA 1VSCA 2P8LA 5JDSB 3LXCA 5E8NA 3T65B 1OSPL 3VRIB 1T04B 2WZPA 1S8DA 1TQWA 3BOVA 3GMLB 5IB2A 5J9PB 3IE9A 4D0CA 4GSQA 4S1QH 2EO9A 1PZCA 2WK2A 3HLAB 1A4CA 3VACA 2NT1A 3KYNB 5D1XA 3X12A 4IRJA 4HIEA 4J8RB 5IROC 5HDQL 4OZ4B 2TAAA 3ZE1B 3AU0A 3Q9PA 4PR5A 2O1AA 4YHIB 3A4FA 1JZ5A 2DEYX 4AY0A 3V4UH 4PJAA 3S2AA 2D7MA 3GSQA 3AGVA 3N1FC 1OTTD 3QC5X 4QRAA 4X7FC 1HNYA 4HUWB 3LAFA 1ZPLA 3ZKNC 4UOQA 5MEPA 3GFUA 1TTRA 2J8UF 3GMQA 3K4ZA 4P4KD 3QUMH 4YO0A 1D7FA 3CVHB 2DEXX 2IAMB 4QYAA 2ADJA 4NI3A 1KLGB 2A74C 2XN1A 3N06B 5C0AD 5CF3A 1ZAGA 1D9KC 4RVBA 2NW3B 3L4VA 4GXVL 1I9RL 1KCBA 1OOAA 2E8ZA 4ZD3L 1JP5A 2Q3ZA 5AW0B 4JO3H 4HAKA 1I7ZA 1T03L 3X14B 4WAFA 1YNTA 2EADA 2NY2D 2A4CA 3IJEB 3EOYG 3IJ8A 3SE3A 3PXJA 2PTVA 4XCNA 4X5QA 2ATKB 2COVD 5B38G 1J1OL 2PR4H 4NQDA 2C3HA 3ABZA 1E3ZA 4ZMWA 5CP3A 2EDOA 1GS8A 1A3LH 4KXAA 1ADQA 2F8IA 1DBJH 4ADIA 2Z9TA 1N59B 4P2RB 3GSVB 3SPHA 3EADA 3UTTA 1MFUA 2J4WL 1MPAH 3RTQC 3FF7A 5ICXB 3WIIL 4ONGH 4U6HB 4GBXB 3W39A 2B14A 4JY5L 1EXUB 4KC3B 5D2NB 4JX0A 1JGDA 5GGRB 2HYMA 4JM4H 1CBJA 1WGVA 3I9AA 2B15A 4QXGH 3QEGL 3UIZA 1LDSA 3N1PC 3DVIA 4GYBA 4D9RE 5IFJA 3HMXA 4WU7B 5A3IC 4KK6C 2WD0A 1E3FA 3FQNB 2V8LA 3HNTL 1FFPA 5MI0B 2N7BA 4KY1L 3TIDA 3PE9A 1SYVA 4K8RC 2GEQA 4NBYB 3FQRA 4F7EB 1FL6A 1U95A 4NN5B 4JO1H 4F2MA 3LN4B 3HG5A 2E27L 4HIXL 4GOSA 4LHUA 4U1NA 3C2AH 4Z78B 3L3HA 3QAZB 1BGXH 3GO1L 3PHOA 4HYTB 4AENB 3AQZA 3NPZB 3BCDA 3VW3H 2OP4L 4J7RA 1RLBA 2IADB 2L7UA 1CE6A 4PVNA 4AQ1B 1OT4A 1LEGB 3NZHL 1NGQH 5J0BA 4GSRA 4HJEA 5J9PA 4LNRB 5F89B 2EH7H 1S9YB 3PJSB 4TRPL 3HFFA 1PZDA 4HCIA 4X5XB 1KCVH 4CAGA 4YHLL 3KYNA 5CJBA 5D1XB 4X6DA 1XGTA 4X99A 2PNDA 4GG8B 4OGYL 4YZFF 4YSAA 1H3WM 3O3DB 1T03H 3PF2A 2X3CA 3H9SE 2WBJD 3BISA 4MJIE 2N3JA 2W0FB 4XP9H 1T04A 1T0MB 3PREA 3IFNH 4PHXA 3IVKB 1AZUA 4Q4EA 2VJXA 4JY6B 4B9ZA 4I88A 4D9QD 5F3BB 3QG6B 4JPWH 4KK5D 3QCTL 2ZXBA 4CC1A 2FZ3A 3RP1A 2NTFB 4Y9CA 3KLQA 3T71A 4L37A 4M8QB 3SKNA 3Q05A 1N0LB 2MCMA 5EFIA 4A2MA 1NKGA 5HHQB 3MLZH 3RBSA 2ICES 4LCIH 3GXNA 1NFDB 3PIQB 2KZWA 5GSRA 4EDWH 4B9PA 2XLLA 2WXFA 5LBGA 2AJVH 5DC9B 3WXWH 5I8CB 1YZZA 2O5NA 3EO1A 4KHTL 4OF5A 4HQQL 1PZ5B 2Q86A 4IBTA 5IJKC 4MX7A 4Z7NF 3CHXA 1Z9NA 4KTEH 2W0LA 3L5XH 3US9A 3I2CL 3GMQB 3HJ0A 1VAHA 2EDBA 5DMIL 1Q9LB 5F7WC 4BSWA 1YJDL 4DTGH 2WVVB 4M9PA 2WBXA 2GTWA 1E9PA 4H8QA 1NIEA 5DXWA 4JKWA 4OJAA 4PJ8C 2OK0H 2YSSA 2VR3A 1NGZB 1IC5H 3BH9A 4GH7B 5I2IB 3ETSA 2CBOA 3W81A 1F56A 4E5XG 3SGEI 4AYID 1U8KA 1T22B 4I3RH 4O2EB 4CMHB 5CS7A 3BWAB 3IFOA 4LEXL 4G1MA 5IKCA 4JFSA 5J13B 2WXPA 1YN7A 1NMBL 4P57B 1UWXH 2CHNA 4ZMLA 3PAZA 1SN2A 3WFHB 5DT1H 3TFKD 1OGTA 4CNIA 4PGJA 1KIRB 2E7HA 2XZZA 1CD0A 4JRXD 1LDPL 2J20A 2R51A 4IKJA 3PL6C 3RJOA 1Z5YD 3DMMD 5IHZA 5DQDL 3LN9A 4IS6B 4NQDE 2FJGA 2X05A 3RFZB 1HYSD 3IU3B 2EH8L 1G7HA 3FQWA 1J0KA 1AXTH 2XT1B 4PJFF 3ULVC 3W0WE 5GS0D 4OGAC 1V3MA 2KDYA 5D70L 1CWVA 5GRVL 4S2SB 4YBQC 5IT2H 4A39A 2OW7A 2LE9A 4OZFG 3CFCH 1NFIA 5EO1A 4AKQA 1FZMB 2XPYA 3IFNL 4NZDA 4ANVA 2Q10A 1EDHA 5HHOA 4IRZL 1LO0H 1X5XA 3QQ9D 4RRPG 4QRPB 3OAYH 3Q6FB 4L4TE 2VL4A 1TETL 1X9LA 2ZCHL 2CIKA 4HU8A 4FTDA 4OLYL 1S7TA 4JY4B 4NKIH 4W4OC 3LV3A 2FNWA 3VFWB 2ZWZA 1GGYA 3L3HB 4PRHB 1XF3B 4XP1L 5DLLA 1QR1A 3S37X 5FHAH 2R0WH 2CA3A 4FTVA 2AKRB 3OQ3B 3JUZA 1JN6A 3CXFA 4ODUA 3AXLA 4QRRA 5C0AE 1U6AH 1U8KB 3L3DB 1X9RA 4Y16B 3V8CA 3C6LD 3VFOA 4U1GC 1MAML 1SLWA 2F9BT 1NICA 2VZVA 5J1AA 4H20L 4X4ZA 4APXB 1KXVA 5B7MA 1L9OA 1DQQB 4YNYB 4HFWB 4OLZH 3KL3A 4KK9C 4W93A 2BP3A 5FUZH 3RVWC 3V6FB 4AZ8A 5JHDB 1T66C 4ETQB 1SY6A 1DL7H 5E51A 5BOPA 2JKRM 3VQLA 1Q9KB 3KLKA 1TZHB 5HHOE 4GIAA 4LOFA 4OZFB 4TSBH 3JT2A 3EO9H 1L6ZA 1IFHL 1IAKA 3B2UD 3O3EB 3RY4A 4EIUA 3L9RB 4EOWH 3EO1B 3CXDH 4IGBA 3VXMB 3ZIMA 1KLUB 4GQ9L 4LSPH 4AITA 4DPAX 4HH8A 2A77L 2KBGA 4RFOL 3VM5A 4K07A 1RZFL 2DAVA 3FQ4A 1CR9H 4GAFB 3VXTA 3L9BA 4MS8C 2MNUA 1A4AA 3JWOH 1RMFH 1N0LA 3ULUF 1CGUA 1MELA 5IJBC 3OJMB 1CDHA 1I8IA 3RVVD 3NCMA 2EUWA 2G75A 4C59B 4Z7WB 3Q6GH 2BXYA 1R5WB 4KY1H 2R29H 2BZDA 4BZ1H 4ZK8A 3B9KB 1CU4L 1N6UA 2VDOB 2WQXA 3D25B 4KAQL 1MKFA 3ZKND 1SOQA 3OV6A 5GGVH 2R7EA 4L8BA 4OAWB 3D39B 1LO2L 1ONQA 2EYSB 4JB9H 3GRBA 4AE1A 1FZOB 1I8KA 3QXUA 4NO3B 2WXRA 4FQJH 2WMPA 4XNBA 4KKQA 3SYQA 1UOKA 3APCA 3GBMH 5IM7B 5IVXE 2R4RL 4JFQB 1VGKA 3SPJA 4TTGA 3DSFL 4LIQH 1MJJB 4MHHG 1WIOA 2FBJL 2CJ3A 1JG9A 5FYLD 5JXAL 3GZKA 4M9OA 5B39B 4ODHL 3EYUH 4YNYA 4DZ8A 1AJ7H 5CZVL 3NA9L 1OW0C 3MLYL 3QWOB 4WJKB 4XCEA 2EH7L 3MOAH 1I1YB 4PJCF 1NDTA 3KPSD 5EBWA 1S7XA 2CO7A 1VPOH 2Y7NA 1U6AL 3AS3A 4BH7A 5I1JL 1X6LA 1NQBA 3EDFA 1EEUA 2GJRA 3CBKB 4HJ1A 1QEWB 2CHZA 4LRNH 2EKJA 2XRAL 1HWHB 4ZTPH 5GGSA 3HR5B 3LXAA 1G1OA 3V6OA 3KYOB 4CL7A 3P73B 4HU2A 1TZGL 1A5FL 1EZVY 1KLUA 5CXPA 1JDCA 5L2JA 1E5ZA 2VDLB 2ZCLH 2AEPL 2E6PA 2JJUA 3MNVB 1MUJB 4JG0H 3UCQA 3LV3B 5LUMA 3X1GA 1M7XA 2XTJB 5HVFB 5F7LB 1P2CA 2AEQH 1SN5A 3V4PH 1JZGA 2DDQH 2ITDB 2XX0A 3GJFK 4WEBH 4NQUA 1BVLA 3UAFA 1LMKA 5ABAA 4HKJB 1FZMA 2X38A 3L3KB 4XPTL 4ZX6A 4M7ZC 3NJGA 3QGVA 1I1AC 1HE8A 4OIIH 5CUSL 3QIUA 2ENYA 2RALA 5AB9A 4NQTA 3DETD 3UZVB 1X5ZA 4M43H 2CDFA 2AVFA 2BVPA 3G08A 3MRJA 5FDWB 4HJIA 1NFDF 2ZYRA 3STLA 3C08L 4ZOBA 5DYOB 3ZBMA 5IW1A 1L7TL 1IO4C 4IOFD 5DUML 4ABQA 1IGFH 4F37F 5I28A 5JHLH 4FTVB 3PGCA 1E5YA 4PPTA 4KK5C 2G5RA 2FWLB 4OZGF 1Z0MA 3RPIA 5IFAL 1KXQE 2CUMA 4N5ED 3L3DA 3FB8A 5C0CD 5FS5A 4TLTA 2HRPL 2LTQC 4K3GA 4NPKA 3CQPA 3NSFA 2JJSC 2N01B 5DS2A 2HJLB 2KUTA 1XF1A 4F5CE 5DD1H 5EU7C 3HHRB 5HD8C 1MCPL 2F8VA 3M88A 3O6KL 1LLAA 2DMGA 3HG2A 4PRID 2VQUA 4FA6A 2OMWA 2VXUL 2Z8RA 4OFDA 3VDBA 2JKLA 5L2KB 3O6MH 5FX3A 2FJHB 4OIFA 3R18A 2VW6A 2CR3A 1IL1B 2Z64C 3B6SA 3WIFA 3L3JB 4BEIA 4LSQH 1N5AB 4U1NB 3IETB 1QFWI 4X6FB 3DLQR 1PG7W 4LDOB 3SDDC 5C86A 3FUMA 5IW3A 4Y1TA 5IMMA 3RWIA 4LQFH 2XVLA 3MU3A 1WH0A 3WEAA 1M2OA 4KTDL 4OT1L 3S88L 4ES8A 1R33A 4R5XA 3X3GH 3DXAE 1JWSA 4HK0A 3L95B 5I16B 2APFA 2DQFB 5D1QC 3GKWH 2AQPA 3ML8A 4M7ZB 3UTQA 4FFYL 2JIXB 1OGPA 1SLUA 3HE6C 3ZTEA 4KJYA 1UA6L 3QSKB 2DH2A 4P2QA 3V0IA 1KJ3H 1V7NH 5K9OB 1ED3A 1ZTXE 4XAWL 3AQDA 4LVNB 4HUVB 1PPIA 4IBWA 3FONA 4HKXB 1A9BA 4H5SB 1VDGA 5AD0B 2EYSA 3MUGB 2VAJA 2GY5A 1JZFA 3AREB 3MREA 4RNRB 4XNXH 3TBTB 3OXSB 4QRRE 3RIFK 5DGRA 3FYEB 1DLHA 2ITCA 4LAJH 3TZVB 1MFBH 2Z7UA 1SEBB 2A9CA 3NRFA 2NZIA 3N43B 4XPHL 3QPXH 4YBQD 5E8PB 4EZJA 5IP4A 4ATTA 2HUEA 2OX5A 4MCZA 5HHNB 5C6WH 4N26A 3FAWA 2PTTA 5ID1B 3U82B 1OP5H 5L8KB 1CZ8H 4H20H 1GA2A 3DUUB 3IMSA 4JO2H 2D0GA 2ITDA 5C0RH 4OZIF 2WSDA 4W1TA 1AACA 2XKNB 3HS0B 3WDHA 3W1ZA 2BSTA 3ARBB 5M7QA 3C6EA 3HC0A 1CURA 5D7JC 5EWIL 1LMIA 3ZPDA 1ZHBA 1R3LA 2YBRB 2MNJB 3KJ4B 1A21A 2EDHA 3UYPA 1F1AA 3LH2L 3O45B 2R83A 3CMOL 1QBBA 3LN4A 2CDFB 3ARGC 2BVEA 4FQLL 4P9MH 4BSWB 1HHKB 3HG0A 1Q8MA 2Y1VA 3MMEA 4QRSB 2JWYA 1DJGA 2P7TA 2DQUL 1HL8A 1YEWA 1SFHA 2A77H 2X2HA 4FI7A 4HK3J 4RFOH 4QI3A 4ZQKB 1ZLUH 2Y72A 2NX5B 4HXAH 4MMYA 2H1XA 3S37L 1X5YA 2JJWA 5CEZD 4PJDE 3UTSB 3OKNB 3PJLA 5DQJA 1ETZB 2QGDA 3JV6A 3OMZA 4G8EB 1U8PB 3MBXL 4LQFL 3VGFA 1M7DB 1ZWIB 3WNLA 3L4UA 1JV2A 2R2EA 2NZ9C 3IFOB 3QQ9C 4LNRA 2NR6A 4PV9B 5DJDB 5HYQB 3JXAA 1GJUA 1HWWA 3P4OB 5DFAA 3RLSA 3BKCL 2IADA 2VLRD 1NC4B 4H8VA 3KCWA 4I1RA 3IF1B 4FFYH 2CLZB 1LP9E 3BSHA 3EYQC 2HJFA 1IM3A 1CXFA 1FVCA 4P46B 2K6YA 1EZLA 3OJDB 4KMTL 5AW8B 1JL8A 1S7SA 4OLXL 1KYUA 3ME0B 2F1AA 4N86A 3WN6A 2XSKA 2Q9OA 3I75A 4IU2B 3CGTA 1DSYA 4P23C 4IBLT 1AQHA 2DKMA 1LQBC 3DWTA 4MA1C 2CK2A 1N6VA 2CA4A 3BDXA 3ZKMD 43C9B 1L0QA 4MD0B 1LE9A 1Q0YH 3ATFA 1CGYA 1YPZF 3MLYH 1UFUA 5D7SL 2YAFA 5LN8A 2VSMB 3EZ8A 3J27A 3P3UA 4FQPA 1RZJL 3ARDD 5T1KB 5JQIB 5DMKA 5B1AB 1JGIA 2W95A 4LASL 2CU9A 3EJJX 4QCIA 1M2VB 3K5RA 1YEDA 2CBTA 1R3IL 1LO5A 5K9JL 3FL7A 1H15A 3FFCE 3WJMB 4X5RA 1CXLA 1G87A 3L2NA 1YEFL 1L0PA 1KDIA 2NY6D 1EUUA 1S9VA 2Q3AA 3BX7C 1A4BA 3I02B 5KS9A 4J4PA 1DHKA 5DRWA 5A40E 5GZND 1KG0B 3I2CH 3QEUB 2HT4D 4G8FA 4N2LA 3BQUC 5D5MA 2FJFB 3TP4A 4PJEB 5ES4B 3HAEA 1ADQL 4JR9L 1RUPL 1WYJA 2XN0A 2XFXB 4LESA 1NGZA 3BH9B 4OM0L 5CZXD 2DWEA 1J1XL 1YEKL 4F7MA 3O2DA 4MKTA 3KH4A 3UJIL 1A14H 1JGLL 4HG4J 3QFDA 4ONHA 5IKCB 4GFTB 4J3WA 1W8EA 3BIKB 3WS6A 1HCFX 3MLUH 4CA4A 1IM3B 3HKZA 1BM3H 3BEVA 3PCYA 3QUHA 5DSCA 2A6JA 1KMGA 4N3UA 3PDGA 3Q9QA 5JIIA 1EXHA 1T83C 4UIMA 1SUHA 3BP5B 5D1QA 5IMOA 4IDJH 5E94A 3CVBA 1WA2X 5DMJB 3IAPA 3C9NA 2J21A 3H2PA 2G30A 4M48L 4UTBA 1DQML 1Y18A 2EEDA 3FUNA 5D1ZB 3HHSB 2QL1A 3GUTB 5C0CE 2VM9A 1WS7A 5CR1A 2D3JA 2DL2A 2Q1EA 2K3HA 1I1AD 4AEIL 4DJMA 3DYMA 3GS7A 1TQVA 4GRWE 1KXTB 4AEHH 3AAZA 1IE4A 2MCG1 3H3PH 3W5NA 1A6PA 2N1KA 3B7RL 1GW6A 1TCMA 4K7FA 2DIEA 1IEAA 2J8HA 3BW9A 3FQWB 4LHUD 1W80A 3HI5L 2PWFA 4FQCH 1FZJA 3QBTB 4TN9A 2DIAA 1GH7A 2VCOA 4KDVA 3AREC 4TOYH 5KYNA 1R3LB 4GG6B 5F7YC 3II2A 4A7QA 4PJDF 1WG3A 2XZCH 4LBEA 4ZMOA 1XBRA 1JYVA 2ZPKH 5J7CC 5D7SH 1DQDH 4KO7A 5FXCH 4IRZA 4B9JA 4HIPA 1CDYA 5ITBL 1CJYA 4AIEA 5EUOA 5GRUL 2G2PA 1E2ZA 2FWUA 5F7FA 5CJQH 4IW4C 3KWTA 4FD0A 4JFXA 4J6RL 3KM2A 4Q2ZB 4AWJC 2MNWA 3PWPB 1NLBL 2OTUB 1P6FA 1LILA 4NQED 5IESH 3JV6B 2EILB 2XWTA 3A4DA 4HJSA 4G70B 4FLHA 4KKPA 2BSED 1W72B 3BIKA 2OMXB 3PDOB 5HHPB 1E8YA 1UURA 2UWEF 4U2YA 4JQVC 2LW3A 3HFMH 2ZKXA 4PJ9D 5JO5A 1VFBB 1ITBB 9CGTA 3N1MC 4NZ8A 2XTJC 4FQXC 1ET7A 4AIZB 4ZSOB 1P5UB 2PPEA 4LLDA 4XT1C 2XN9B 4NWUH 3V95A 1I1AA 3BO8B 2MRYA 2DS4A 4Z7UA 3K8LA 1IKFL 1CFQB 4TLKA 4N90E 4MKMA 4MJ6B 3UJIH 4OM1H 3R7RA 4FNLH 3GLEA 2KQMA 4FQHA 2IEPA 3MV7D 1F2XK 1B2YA 1A47A 2NY5C 2OMTA 3ABLB 3O4OB 4AL8L 5GS2H 5D1QD 3U2SB 3ULVE 4KZDL 4XMVA 4FXGB 4HS6A 1AD9A 1M1XB 5FOBB 3KLLA 1IU1A 1HHIB 3ZRFC 3GHBL 4PRPE 2CGRL 2YFNA 2W0KA 1JPGB 2V4LA 2FJFA 5DI8B 4XB7A 1I8IB 2OBGA 1S7VB 3BVUA 4MCMA 4QAWA 3TT3H 2EVFA 3PGFL 4KVNL 4U1JB 3KM1A 2NXZC 4BKLA 2GC7C 2IDTA 4KV5F 5A43C 3F84A 5F8QC 4IKKA 1G9HA 1T0NB 2IBZX 2DOCA 5F9JA 3SDDD 5F1IB 1F42A 1UKQA 3RI5F 12E8H 4K9EC 3DXAD 1D6EB 3MV8B 4KU1A 3JVGA 2DZEA 4LL9A 3AZUA 1HDMB 1CK0H 1M3IA 3NJKA 1YY8B 4B0MB 3MLWL 1ACZA 3WNPA 1O7DC 1Y1UA 3GDCA 2UZYA 4M1DL 4WI6A 3MGOA 2EYTA 3QWRD 4ZMVA 1MFCH 3IU4H 2Z7YA 1BEYH 5G2NA 2HJLA 1KYFA 2JJTC 4JQIA 4M6NH 5I0DA 2APVA 3GMOB 1KBGL 4X8XA 5HJGA 4QYOB 4LBAA 1OZTG 2DWEB 3QUYC 4ZUVB 4HMCA 5TK2A 5FO8B 1NCUA 4WW2A 4OF8A 4HKZB 1P5UA 5G4OA 3GUFA 1V27A 1A7QH 4J1UB 1NC2B 1DYZA 1QHOA 2DF3A 5I66A 3RTQB 3ARTA 2NRDA 4EN3A 4ZX4A 5J12B 4N8CH 4EI5A 3HG4A 4XNUH 5IJDC 3TGXA 3N44B 1A3ZA 3QFJA 5T3XH 3CZLA 4MYPA 4FLQA 4CDGC 3TBYB 4G80B 2Q7YA 3HC4L 2WBKA 3QXWA 2J5LB 4H1LA 4Y8DC 4ISVA 4NQSB 1SYVB 2QTVA