3DKHA

L559a mutant of melanocarpus albomyces laccase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
558
structure length
558
Chain Sequence
PTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase-1
publication title Essential role of the C-terminus in Melanocarpus albomyces laccase for enzyme production, catalytic properties and structure
pubmed doi rcsb
source organism Melanocarpus albomyces
total genus 170
structure length 558
sequence length 558
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA03
1ZPUA 3HB3B 4M4RB 3IN2A 2IDFA 2VSMB 3NSFA 1OE3A 2XV2A 2R7EA 1BAWA 4DP8X 1PNDA 5B1BB 5PCYA 4DP9X 2VSKB 5ANHA 5LDUA 3NJJA 9PCYA 3GXUB 2VW6A 2H5UA 4G7RB 4E9RA 5I6LA 1ETJA 1V55B 4HHWA 2QDVA 3NJFA 1OOWA 3JT2A 3WKQA 2OV0A 2HX7A 3FS9A 1A4AA 1KDJA 1YLBB 1NWOA 2BP8B 4KO9A 3ERXA 2VMJA 2YXVA 3NP3A 3NSCA 2XX0A 2FQEA 2FT6A 1ZIBA 3ZBMA 4G7QB 4E9VA 3FT0A 2XXGA 1E30A 3FPXA 4DPBX 3IE9A 2YAFA 4E9QA 4WTQA 2GC4C 3UGEA 3X1GA 1OCCB 2QPDB 3NJKA 4M3HA 2WSDA 5I6NA 2PPCA 3FU7B 2BWIA 3PXLA 3TASA 4HCFA 1V10A 2YAMA 3H56A 1KCWA 4GP5B 5I6MA 3DIVA 4A2GA 1PLAA 1QHQA 2IWKA 4YSRA 3WG7B 2VM4A 1PAZA 3X1BA 1JZIA 2FT8A 1MDAA 1AAJA 2XVBA 4A2DA 4A2FA 1GS7A 1J5DA 3H4FA 1HAWA 3U25A 1M9WA 4HAKA 4UF7C 3T9WA 1M56B 2IH8A 4YVNA 4HHGA 3T71A 4YSPA 2MTAA 4KO5A 2AANA 2BP8A 4QKTA 1L9TA 3OM3B 2B08A 4MFHA 1ZDSA 4KOCA 2QDWA 4DP6X 1BQKA 1OCOB 2ZOOA 1AZUA 2I7OA 2BP0B 5D4IA 1CURA 3UADA 2XYBA 1ZDQA 5B1AB 2WO2B 1ILUA 1R1CA 4X4KA 1AZCA 1PY0A 3D12B 4AI7A 4BWUA 5I26A 3FU7A 1ZIAA 3UACA 4P5SA 3SQRA 3WKPA 1X9RA 3S3BB 1URIA 1PCSA 3SBPA 4JHVA 1NIEA 4G72B 1EZLA 1JOIA 4YSCA 5IY5B 5AZUA 5I28A 2BWDA 2PCYA 2HZHA 2ZONA 1XMEB 1PLBA 4AZUA 5TK4A 1JZFA 3RYMA 2GHZA 4YVUA 1OE1A 3T6WA 1AS7A 4N4YB 4AKPA 2J5WA 3FSVA 1IUZA 3QJUB 1E5YA 3KW8A 3QJTB 2EIJB 3X1EA 2PPEA 1GR7A 5AFAA 7PCYA 4KOBA 2EINB 2H47C 2PCFA 3NJLA 3PCYA 4BXVA 3S8GB 4KO7A 1EHKB 1TU2A 2HLEB 3ASNB 1JXDA 1QLEB 1AIZA 1HAUA 2Q5BA 2CBPA 3H4HA 1OE2A 2QPEB 1BYOA 1X9UA 1HFUA 3NYKA 4GP8B 3UAAA 3AG4B 4N8UA 1XB8A 3PPSA 3OD3A 3S8FB 2IDSA 4GXFA 2FNWA 1WAEA 1L9PA 2Y69B 3FSAA 1W6WA 3EH3B 1MG2C 1JVLA 4KNUA 1FA4A 1AZNA 2YQBA 4GP4B 4JKNA 1SNRA 1J9SA 2W8CA 2I85A 3OMNB 1IBYA 4NERA 3C75A 2WO3B 2FT7A 3PLYA 1RKRA 1WS8A 1XB3A 3ZX1A 1CYWA 2VM3A 6PAZA 2W88A 1TKWA 1E65A 1WS7A 3X1FA 1W8EA 1NIBA 1BXAA 2XUWA 3NJMA 5FC9A 3T6ZA 5D4HA 3WNIA 3AG1B 2GIMA 2BO0A 1FWXA 3FQYA 4DPAX 3CVBA 2YAPA 5B1JC 5I6PA 4PCYA 2HXAA 2AFNA 5B1JA 1B3IA 1PMYA 7PAZA 5I5MA 4DPCX 2HX9A 5B7EA 3UAEA 1NIFA 5B1KA 4W9ZA 2YAOA 4KNSA 4UANA 2PLTA 3MBWB 2PP8A 1QNIA 4YL4A 3GYRA 3V9EA 1JERA 2Y1AA 4W1TA 1NINA 2ZXWB 3CVCA 4CSPA 1ET8A 4FAAB 2BHFA 4FA7B 2DYSB 3BVDB 3TBCA 3ASOB 4YSOA 4JHUA 2EILB 4Q8BA 4YSEA 4YSQA 1IC0A 2EIKB 1ADWA 1DZ0A 2RACA 2XV3A 4HCIA 2FJSA 2JKWA 5I5JA 4EF3A 2DV6A 2AZAA 2P80D 1PZBA 2NRDA 1CYXA 1MG3C 4AX3A 3ABMB 2Q9OA 2OCCB 1NZRA 4DP4X 3PAVA 1AS6A 2CALA 1J9QA 1W6LA 1GY1A 4KO6A 5D4JA 4YSAA 1ILSA 3FYIB 1JXGA 1JZEA 1XB6A 2DWSA 5B7MA 3PAUA 4BWTA 1F56A 1PZCA 3OMAB 4BWWA 5EHFA 4A67A 3N2JA 3AG3B 2VW7A 1KV7A 3IN0A 1NDTA 3OMIB 3CVDA 2GBAA 1J5CA 2JXMA 2UXVA 2TSAA 4DP0X 3IBOA 3FQ1A 1SFHA 1AG6A 3NJGA 4E9XA 2UXFA 1L9OA 3ZDWA 1AR1B 2DWTA 2IDTA 4YSUA 2X88A 4PAZA 2PP7A 2IH9A 3NJIA 2N0MA 2VW4A 4BDVB 1GS8A 2J57A 1A4CA 1BXUA 5TK2A 2YAQA 2XLLA 4L0PB 5AKRA 2GC7C 4KNTA 4DP7X 1ID2A 2B3IA 1JXFA 5F7AA 1JZGA 3G5WA 3QJSB 4WKXA 4AKOA 3KW7A 1BXVA 2IDQA 4YSSA 5I6OA 2BP0A 3GDCA 1AS8A 1VLXA 3EHBB 5A7EA 4YSDA 5B7FA 3NP4A 4BXSV 3NJHA 1AQ8A 1AANA 4TXVB 3WIAA 2HX8A 1SDDB 3N55A 3AG2B 2UX7A 1J9RA 4GYBA 3EF4A 1KYAA 1OF0A 2BW5A 3T6XA 3HEIB 1SF5A 2CJ3A 3NT0A 3FYEB 1A3ZA 1OCZB 1A65A 1FFTB 1OCRB 2YXWA 1A4BA 1PNCA 1KDIA 4HALA 6PCYA 1UATA 5B3SB 4BDVA 1OV8A 4ENZA 1GS6X 2OJ1A 1DYZA 3MX0B 2GI0A 1E5ZA 3FSWA 4RH4A 2I7SA 2CUAA 1TEGA 2JFCA 3CG8A 2FWLB 2XX1A 1GSKA 2HRHA 2UX6A 1SFDA 1N68A 2YAEA 1NTDA 4A68A 4DP2X 2J55A 1PF3A 2FTAA 2GB2A 3FPYA 3OQRA 3ZIYA 1NIAA 2DY2A 1E67A 1SDDA 3EH4B 1ASPA 2XV0A 3S3DB 1CC3A 3AW5A 1T5KA 2EIMB 4HIPA 4E9TA 2XU9A 2VN3A 3FU9A 4UAHA 1GYCA 3X2QB 2J56A 3CDZB 4A2HA 1BQ5A 4BK5C 2IDUA 1BEXA 4Q89A 1AZBA 4E9SA 5F7BA 2CAKA 2TSBA 1MZZA 1NPJA 3TA4D 4G70B 2P80A 3FQ2A 1BQRA 1AOZA 3UABA 1JVOA 1SHWA 3SBRA 1SHXA 3PAZA 3QQXA 2FQFA 1RZQA 1RCYA 3FSZA 2YAHA 4K9JA 2PPAA 2H3XC 3IEAA 4F7KA 1NWPA 1N70A 3JTBA 3SBQA 4E9YA 2PPDA 1ASQA 1A8ZA 4HZ1A 5I6KA 3ABLB 2DYRB 2LLNA 4P5RA 3T6VA 4F2EA 2AZUA 1IBZA 1ASOA 1NICA 1GY2A 1WA2X 3WNJA 4GY4A 3TBBA 4DP5X 2BZ7A 3NJNA 4AKQA 3DTUB 4G71B 3FU8A 3V9CA 3QJRB 1SJMA 1WA1X 1JZHA 2E86A 2BZCA 2PPFA 2ZWNA 1RZPA 4G7SB 3ABGA 4HCGA 4NB7A 1ET7A 3BQVA 3L45A 1NIDA 2IAAC 3CDZA 4F2FA 2BW4A 2A3TA 4CSZA 1L9SA 2MRYA 2XXFA 1GW0A 2QT6A 1I53A 1L9QA 1NPNA 2FQDA 4A2EA 2XWZA 3X1NA 1AZRA 1M57B 2R7EB 3EH5B 3NSDA 3WI9A 3CZUB 2AVFA 1ZV2A 2CCWA 1IKOP 2UXGA 4YSTA 1KBWA 2GSMB 5I5IA 5PAZA 3TU6A 1SF3A 2YARA 3QJQB 2IWFA 1AACA 1ET5A 4NAJA 1BYPA 1TEFA 1KBVA 1KCBA 3NSYA 2IWEA 3AZUA 1MZYA 2FQGA 1PLCA 2UXTA 4QLWA 3ABKB 1CUOA 2PP9A 4E9WA 3DKHA 1KGYE 1WA0X 4A66A 1L9RA 2HRGA 3S3CB 1J9TA 1PZAA 3AY2A 1JZJA 2X87A 3QPKA 3QJVB 1AG0A 8PAZA 4ZK8A 4DP1X 5E9NA 1V54B
chains in the Genus database with same CATH superfamily
3K6NA 1HHIA 4F7TA 1N59A 1R3KA 1U3YA 5C0FB 2EDYA 4XAWH 1TLMA 3FB8B 1HH9B 1RUPL 3ZHKA 2R0LH 2R2HA 3CV5A 4YUEL 3RUGB 3T8XA 4IHBA 3MKKA 3F04A 4PMEA 4IBQA 2EUXA 2O93L 1YAZA 5DRNB 2O1AA 2WYZA 5JNYB 3KYOA 3SDCC 1FPTH 5J6SA 1WVZA 3FQXB 1QBBA 1HINH 3LQMA 5I24A 1Z32X 1IC5H 1OOWA 1TOXA 4WI6A 1VFBA 1HYSC 1MRDH 1CG9B 2HX7A 1ZVHA 4QJ3B 2WUBH 5EEXA 1J87A 2DL2A 4ERSH 5J9PA 2BP8B 5GSRA 2ZXQA 2EH7L 4NC1E 3AT0A 3E7JA 2FQEA 4HK3N 4X6CB 4BIKA 2VLMD 1XGRB 1DSWA 3QFJB 4XCNB 3QUXA 4C56B 4ZFOB 3W57A 3BUIA 1ZJAA 2J21A 4CVUA 3ARRA 2VXTH 5FUCE 3F64A 4DZBB 1JPFA 2OA9A 3VI3E 3U2IA 2NW2B 5F6IC 2R15A 1XAUA 3RDJA 1S8DA 3CSYA 4HZAA 4HCRL 5DEGA 4CVZA 4QRRD 1AHWA 3MQIA 3QORA 4UQ9A 2ITCB 3ZIMA 4YHML 4OZIB 4Q9BA 5F9JA 1JWMB 4OZ4B 4AXWB 4TSAH 3EJPA 3A0OA 2CZNA 2VL5A 3WNOA 2JI2A 2VDMB 1MREL 4MAUH 1FBIH 5D7EA 5CSGA 2BXZA 1DANU 3U30C 3BW9B 1HWHB 3VXNB 3WIFB 4MJIA 2XVBA 4LSRL 4A2FA 4Q6IC 3INUL 4FQXD 3TH3T 1VCBC 3GZKA 3GC3A 5F3HB 4AQ1C 3FT3B 3QJXA 3BGMA 4H5SA 3G5YB 5KBMA 5F2FA 1XSJA 5ACZA 1JZ5A 3BXNA 1KULA 3HMXH 5E1IA 5TPWH 4KK9C 3LB6D 1F42A 3W9EB 1BZQK 4HHAA 4WO4C 4DUXA 1H3UA 3IDJA 4LCUB 2NNFA 2FX8L 5JW4M 3WD5L 2QFPA 2IEPA 4RAVA 1IQWH 2WQRA 3MV9A 4RGNC 4Q2ZA 4APXA 3L5JA 4HQQL 3C60B 3AXLB 5LWYH 3HCVB 4KX8A 5JW5B 3LXUX 4YHZH 4ZI8A 3QHFH 1NCBL 4PVMA 4HXBH 3BN9D 4P9HL 3BKMH 5EEYA 3BDYL 4FQ1H 1J88A 3V0VA 1XCXA 3SY0B 1E6JH 3CDGB 3ZKMD 4X98B 5KS9E 3D25A 1LDSA 1OGPA 4GXVH 1QACA 4BRVA 2OP4H 3P2BA 3SE8H 1EHXA 1ZE3C 5FA3A 3SDDB 2VDOB 1PJ9A 4N2MA 4NQDD 5K9JH 1FL3B 5C6TH 3S37H 1INDH 1M42A 3X1EA 4FNLH 3ILPA 5FYKD 3IDYB 3PCYA 2X4QA 1F11B 2HTLD 5FHBL 2Y06H 3QQ3B 1FORL 3SCMA 3MROA 1HS6A 4MJ6A 3WMPA 3VWKD 4G6AC 3IU3A 3B2VL 2OZ4A 4FC3E 3JWNE 1QLEB 1FFOA 3OKLA 4A39A 3BKYL 1OE2A 1RHFA 2BIOA 1BQLL 3WEAA 3CSGA 1JSYA 1BOYA 2CRIA 2VMDA 1OVZA 5AYQA 3IJSA 3ML8A 4AYFA 3PL6C 3HN3A 3MBXL 2FX9H 2F5BH 2FZ3B 2VE6A 3DRQB 5C0CB 1A4KA 3FSAA 4EZMA 1OB1A 5T5NG 2YQBA 4UBDC 5HTSA 4FADA 4KK6D 3G5XB 5FO7B 3TIEB 1Y6NR 4Z7OF 1MCCA 4AGOA 4BKSC 3QAQA 4ACPA 1T7ZA 4F2MA 5E2UH 3VFWA 4NERA 5KVFL 1IAOA 5FGCE 2D7MA 1DBKL 5KVEL 3UYOD 2XWBA 3CFEB 3GHBL 4XNAA 5DK2B 5GJSL 2X1WL 3BZEB 4M9OA 2NT1A 1QLFB 4QGYA 1JPTH 2OSXA 4WUUD 4K5NA 2CU9A 2XUWA 3IDMA 3T6ZA 1JZDC 3N9GH 2G5RA 1HCVA 1JZ6A 1U3NA 2BNQE 2C4FU 1OXYA 3P4MB 5I9QB 3BDBA 1K2DA 5DR5H 4ISVB 1OT2A 4PJAA 4PGBA 4P49A 3QUZB 3I6KA 3PP4L 3J7HA 3LNDA 2Y2YA 2HXAA 1EQWA 1C7SA 4HAFA 4JN1L 5DWPA 5I5MA 3CX5J 1BZOA 5IEHA 3EAKA 5B7EA 2J8OA 2ZCKH 4Z7NB 1I8AA 1D7BA 4ZAKD 4WEEA 5CEZH 3KDMB 3AROA 4ZX4A 2I32A 2B1AL 2AJUL 3GYRA 3L7EA 3MFGB 2H2PD 3DX3A 1Z0NA 2RH0A 3LH2L 3PU7A 1S7UA 2X1QA 1ZHBB 1IEBA 4FA7B 1K3IA 4P06A 3GF8A 4JJHA 3W56A 5J89A 5JIDA 2UWEE 1NCUA 2VJXA 5JYMA 2ATAA 1RULL 2DOCA 3KPPB 2RACA 2XV3A 1DP0A 2E8ZA 4RMVA 4AM0B 4F7EB 4MGXA 1P7QA 3KJ6L 2K6YA 5IHUL 4KQ4L 2OCCB 2DMKA 1IBDA 3RKDC 1TQUA 4H13C 1TZIB 5D1XA 3UAJC 1VFMA 1MJJB 3DUSA 1RVFL 3HE6A 2WSPA 5F6HJ 3WTYA 2DWSA 4OM0L 3RUGE 1SYSB 2DLGA 3B2XA 4PRNA 4X4YB 4YZFE 5I19L 1S46A 5DT1H 1A3RH 3EGXA 1DCEA 1F58L 1KF9B 5KYYA 4A37A 4JRFA 35C8L 1AI1L 4NJ9H 5T3ZL 4Z7QE 1PL3A 1FZMB 3GMOB 4KKQA 1Q9LB 4OKVB 1ACYH 4NKDB 2A9BA 3LKQB 3Q1SL 3JYCA 4DP0X 3BGFB 4XRCB 3DX8A 3UDWA 3R18A 5D70H 5AVRB 2P43B 2OX5B 4ZS7H 1NGWB 2E7LA 1JI1A 1E6OL 2DWTA 2WY3B 3NQKA 1SJVA 4NJAL 5EUKB 4Q97A 4X6CE 2NXYC 2H32A 1YMME 2J72A 3QFJE 4JM2F 3FUNA 4C56E 5IQ7L 3PRZA 3PWLA 3TPUB 3VFGL 2VW4A 3MRDA 3TWCL 4APQD 2RQEA 2ZXAA 1MNNA 1G7PA 4FD0A 2H7WA 3ARGA 1BXUA 4KJYB 4QRSB 1MCQA 5IBUB 3ZK0A 1M3JA 3AWFA 2WIIA 1CFTA 1JTOA 2A4CA 1JZGA 2BNRE 1U42A 4P23B 3O45A 1V7NH 3T65B 1S9YA 4DK6A 3FQNB 2X12A 3LKPA 4P4KD 2XN9B 4OZIE 4AYMC 1A2YB 1YYML 1Q9OA 3BD3A 2IFGA 4MMZC 3ZKND 2KZWA 4FFVC 2M2DA 5IFJA 4LL4A 1AANA 1KTCA 3GMRB 4FCAA 4GFTB 1A21A 1LEKB 2RIKA 3QQ4A 1MJ8L 1TZGH 4PRAB 1M9SA 3PWPD 5CU9A 5HI3D 1VACB 3D9AL 3MNVA 4UILH 1T5WA 4KJWC 5DMJB 3MNDA 1U92B 4RISL 2I60L 2BSBA 2CIIA 3IJEB 1WAAE 3IPFA 3K6FA 4GT0A 4Y2OA 3RWFB 2O6CA 4Z5RB 2NT0A 2XPGB 3VFTA 1UATA 3R4DA 4M03A 1XZ0A 4B9PA 3S37X 4UMSA 2VABA 4ENZA 1JK9B 1BG1A 2IFFL 2J71A 4XTRC 3EDJA 3ATEA 2IJ0C 3OJDB 1XFPA 3NCCB 2VXSL 2DYPD 5CLZA 4U6XB 1RURH 1FHGA 2QKIA 5TH2A 1OP3H 3RU8L 5IW6A 2F5AH 2WXGA 1C5BL 3CMGA 3P4NA 1MELA 5EUOA 2MMXA 3RDTB 5K1NA 4DN3L 2D7PA 3C2AL 1X5IA 3MUHL 1XGPA 1ICTA 2Y7QB 4IRZH 4Q9QH 3OQRA 1SOXA 4HV8B 4CADA 1S9VB 1NDGA 3SJVA 4AQ8C 2O26U 1KEGL 1NIAA 5KSUB 3VD5A 1LE5A 2F74B 1TVBA 2X53A 1AXTL 3ZQ9A 1NBYA 2CDEB 3I6GA 3K74B 1G6RA 3ZE0F 5IMMA 1BZ9A 4UIMB 1OD9A 1THCA 4R4BA 2FEEL 2F19H 2ZYRA 4NM8H 5DLMH 1RJZA 1ZLEA 2OMXA 2ZPKH 1WZLA 3NCBB 3ZZLA 4XMVA 4ZDHA 3A4AA 3ZHNA 1S3KH 2KLSA 4X0KA 4G6JL 3RWHA 1ZA6B 3N44F 4LCYB 4KAQH 2X38A 2RD0A 3R8BB 4U3SA 3SD5A 2ZYIA 2ZUYA 4TUJA 3OJ2C 2DQCH 3PAZA 4OCSL 4U1GC 4ZFFA 3ILQD 2PPAA 4EN3A 1FLTX 1Q94A 3JTBA 1IE5A 3MREA 5CM1A 4LQ1A 4WCYL 1JCKA 3HC0B 2LLNA 3DX7A 4KK8C 1L0XA 3TT1H 4AG4H 5IR1B 4WTZG 4OQTA 2YGQA 2XA8H 4KKBD 4P2YA 3P9MB 1VZIA 1RUKL 4JVWA 3LZRA 1A6TA 1CFBA 4YFDB 4J4PC 4OT1L 1NGQL 2COVD 2XTJE 3OHXB 2R0WH 3HUJB 4OTXH 1CK0L 4U7SA 4WVRA 4GOSA 2EXYC 2R1XA 4ZQTA 1PG7L 5ITBH 1FFRA 5B22A 4Y2DA 4PJIF 3STLA 4PJEF 5J1AB 3O3DA 3BPCA 2GW5A 3MGTB 4EZKA 1XR9B 3EJYD 4J3OD 5JLZA 4L8SA 4KDTC 3IDXH 1G43A 3GJFA 4P3CL 4QEGA 2WXJA 2AEPH 3OMZA 1UA6L 1EXUA 4EBQL 4Z7NE 4O00A 1IKOP 1UZ6F 1TO5A 2YLHA 5IMKB 5EF2A 3FRUB 2ZUQC 3G6JA 4NUGH 3AVEA 4JPSA 5LNGA 1Z3GL 1BW8A 4AIZB 5FB8B 1LP9F 2JK5B 3SDCB 2GAZB 4AMKL 2H6OA 2YMXH 4QTIL 3TGXA 3GRWH 4PJBE 1B3JA 4LKCB 4KY2A 1R0AH 5HGHA 2VDRB 5EEWA 1QI4A 2YD8A 4OY9A 4FQ2H 3FT4A 4E0RB 1CFNA 2CPUA 4ODUB 4HIQA 1C12A 2LU5A 3MRMA 1YO4A 2YQGA 3ZR5A 5FO8B 1DLFL 4LDOB 2BS71 5HGDB 1IQDA 4IDJH 4A7GF 3GUTA 3FTSA 1B4RA 3ESOA 3LEXB 1QVOB 3M6DA 3RA7H 4BH7A 1U95A 5F6IB 4NS0A 4KUZH 3FH8A 3FB6B 2XPZA 4EOWH 5I1KH 5C0DA 3CH8A 3NIFF 1O9WA 4HLZG 2X3BA 2E9IA 1KTDB 5B1BB 2JKXA 1QSEB 3ZTNH 4BGLA 3FF8A 4A7UA 4ODTL 4FMVA 2BS8A 3WS3B 4K3EL 2ZT9C 1DL7H 4OLEA 1FYTE 1NCCL 2GBTA 3U30B 1RMFH 1FLRH 1AR1D 2EQDA 2QDVA 3TV8A 3E6FB 5J1TC 6FABH 3JT2A 3HBQA 3WY1A 4I0PC 4AQ1B 1AE6L 4XNYH 4YDIH 4DEPC 4KO9A 4WGKA 3A5VA 2OMVB 2P45B 2XNAA 4YNYA 4ELMF 1PKQB 1D9KD 1EGJA 3JXAA 5D1ZA 1AD0B 4TOYL 5ANMA 3QRBA 4YXLH 1NKOA 1J8HE 4WO4B 3L5IA 3GK8L 1MIEH 4UT9A 3N41F 4AZ8B 3U7YH 4KQ3L 4LMQE 5I1HH 5FDWB 5HYSB 1MFEL 2E7CA 4IU3B 1PDKA 2DLFL 3DSNB 1DN0A 1L4IA 1EV2E 4RGNB 4LL9A 4YLBA 2PW1A 5I1EL 5IW1A 3G5ZA 4OZGB 2IV8A 3SE3A 3OKOA 3PHSA 4UQAA 2EEFA 5EB9A 2H9GB 5ENWA 2ZNWA 3B8YA 4F5CE 2HFGL 2R0LL 4GUQA 1DBAH 5C9KA 3O3BA 4D8PB 4A2MA 2WVVB 5IM7B 4YSRA 2ARJA 5FCUH 4WTZA 1R3HB 3X1BA 1UKTA 4IMLB 3W81A 1WP6A 1AGFB 1FPTL 1KGUA 1J5DA 5FKAB 5FYJE 1HINL 4JRYD 1IC5L 2NOYA 4N20A 1JDCA 3BLBA 4G1MB 2WUBL 1MCLA 2P8PA 2BSTA 1YG9A 3ZO0A 1U93B 3L5XH 5I71C 1CU4H 1EDYA 2P44B 5D1XD 4TNEA 5DS1A 2ZOOA 5IMOB 2ZSWB 4FLQA 1NKGA 3HE6D 2VXTL 4GW1A 4LPXA 1NC2D 1IGFH 4GS7C 4ZTPH 1Y6KR 4NO0B 3FU7A 3PL6B 1COBA 2UZIH 2FGZA 1GGUA 5ISZB 4M5SA 3OLGA 3VDAA 2B4CC 3BIKB 5D5ME 4RMSA 3QXVA 4LVNC 4TSAL 4XBPA 2PCYA 3T0EE 4QHMB 2X7LB 3MLVH 4IKIA 2YBGA 1VF5C 2X70A 4MAUL 1FBIL 1LK3H 3TP4A 1JWSB 1HQRA 5IK3B 3AS1A 1RUQH 1OP3K 1FZJB 5DSCA 1QR1A 4JMNA 1QUNB 2MHAA 2DIBA 2ZCLH 2PCFA 4KJQC 4N9GA 2WXIA 4NQSB 1UEYA 5TPWL 2GJ6A 2PUQT 4L4TD 4FERA 4LKXB 3IXAA 3LMJH 3VD3A 3QXTA 1B0IA 3ZUNC 5EBWB 5IB4B 4D2NA 4Y9FA 3ASWA 4ZPTA 3KPOB 3DXAE 2VWEC 1KIPB 3HI6H 1T22A 4FLRA 1S5HB 1Z5HA 1IQWL 5ICXA 1XB8A 3U6XS 4AV0A 4RETB 1CL7H 4GAYA 4IM8A 2R2EB 4MXWH 1A9BB 5F9AC 3EYFA 1IKFL 5LWYL 5EU5A 4WHYG 4YHZL 4FG6D 4N8VA 3QHFL 2WIMA 3RVVD 1A1MB 3KDPB 4JGNA 2IBBA 4HXBL 3BKML 3VGFA 4FQ1L 3NCXA 1OAKH 5C0IA 1E6JL 3M1OA 1YMHB 1NEUA 3CC5A 2NXZC 4OFVA 4M7LT 4GXVL 4OVVA 2CGYA 1QA9A 2OP4L 3HUJE 4JFFB 2YXFA 2X10A 3SE8L 4GRWB 4HJSA 4WWPA 1S5IH 4XXCC 4YPGB 3WOVA 5K9JL 4PJFE 1N10A 4ZJ9A 3WNIA 5C6TL 1INDL 4FNLL 2XWRA 4NKOA 3BKJH 5JQIB 2FECI 4WGWB 5DHVA 1I7UB 2Y06L 1IRAY 1KZYA 5KSAC 4IJ3C 4IMKC 5I6PA 4W9EC 3CMOH 4X5RA 3FBQA 4ZPVA 4UUJA 3ILEA 2OSYA 3BAKA 2IH3A 4CSSA 1KTBA 1NIFA 1ZT1B 2D2CC 4JY6A 4ZTEA 4B60A 4ESKA 1I8IA 3LH8A 1PQZB 1GGYA 5C3IA 2FX9L 2F5BL 1WSST 1TQSA 4LLWA 2HUHA 1IEAB 2DWYA 1KC5H 1M53A 3FU0A 1IT9H 4KI5C 5EU3A 5CD5D 1NINA 3S5ZA 2UZYA 4I1NB 1BVLA 1W9XA 4IYKA 3VXPA 4L9LC 4NOFA 4UOQA 3ZQWA 4PN6A 1HHHA 1BLNA 1EO5A 2AJXH 2NXYB 1ADWA 4HD5A 3GXDA 3OV6A 2V0AA 1AFVH 3GRBA 3UMTA 4WIQA 1JPTL 4KMLB 3FHQA 2AABH 3N9GL 2X41A 2OTWA 4B50A 1N9PA 2IV9A 3E9UA 3ZE1F 1YNTF 5DR5L 1JPEA 2AW2A 4HUUA 1P5VB 5IMLA 1ES0A 3HNVH 1JZEA 4FYQA 4PJGA 5FFOA 4J6IA 4BWTA 2R51A 3WL9A 3QCVH 1T66D 4MMZB 4MSWA 1MHHB 2IPUG 1FV1A 3U0WL 3UTSA 5ADPH 2ZCKL 4YE0A 3TV3H 1GA2A 1HZKA 2RR3A 4GO9A 1J12A 1GYWA 5DK0A 5CEZL 5HYJE 3T4YA 4BK4A 4ZNEE 1YY9C 3P3TA 3V4PA 4HUKB 4MRCA 1M05B 1WBXB 4ZSOA 3HG1B 3IBOA 3FUFA 3NJGA 4RAUB 2MOQA 1I8MB 2YHGA 3BZ4A 3OL2A 4ONGH 1UACH 1PKQE 1B2YA 1TJIH 1ZHNB 2X88A 2Y3AA 2H26B 4IEFA 4KNQA 1OK8A 3ZL2A 3CHXA 2WYIA 4MDRA 2E47A 2NLJA 2J57A 3C5ZA 2VLKA 2NY0B 2WQAA 4DGUA 1A6VH 3VRIA 3QWRD 4Z3HA 2VXQH 4PJXA 4RGNE 1KB5H 1BLIA 3G5WA 1RZ8A 4WTXA 2VSCA 5F44A 2E6QA 5DJ6B 3FUKA 5I17B 4YHKH 1ZK5A 1Q72H 2DLEA 4TTDD 4L1DA 4A7TA 4ZUTB 5EU4A 1FO0A 3ZYZA 2Y25A 3RTQC 3UZQA 1OSZA 4XNXH 3ARWA 4NZ8A 3F00A 3NJHA 1ERNA 3J27A 4Q9CA 3GSQB 4TXVB 3RILA 5HGBA 3QIWA 4MLSA 1A3RL 2R1WB 5DT1L 5I2IB 5IFHH 1N64H 1UZGA 1RK1B 4NJ9L 3KBHE 4WI7A 3HPLB 2YD0A 4JZOB 2VJ0A 1ACYL 2MPAH 3K5SA 1CGYA 3ARBC 3IKCB 2A0LD 1FFTB 3IFNH 5D70L 4G11A 4Z7UA 4ZS7L 3TFKC 5LN4A 4YS4A 4XX1E 5CINH 3HZKA 3N04A 1CFQA 1O6VA 2PCPA 1YEGH 3MA7B 3LNEA 2PWGA 2RFXB 3L9BA 4HKJA 2V2XB 1I3GH 3EOBA 1YYLH 2EYTA 4NRYA 4FP8H 4JFHE 5LBSA 3TNMB 3MRGA 1NMBH 4U1GB 3WN6A 1V7NL 2X6AA 2F7IA 2GQHA 3RVTC 2X4NA 1TJMA 2FSEA 3MRPB 1PYWB 2OL3H 1RV6X 3FPYA 2DEYX 3SDDD 4FHBD 2DM3A 2C1PA 4JG0H 3TYFB 5KYNA 1GJWA 2A9MH 4MJ5B 3UG4A 1R5VA 4XAKD 4PWKA 1E4WL 3H8NA 4JKMA 4MYWB 4KKLC 1TZGL 3GM8A 4QRPA 5I1CH 4M56A 5E94B 3AGVA 4YGVB 4F24A 4AVIA 3W38A 2OMWB 4GEIA 3MLYH 3ZU8A 5CIPB 1X7QB 2VN3A 5H8DA 4QF1B 4UILL 5FKPA 1AKJB 4R3SB 1URZA 2R1YA 3JVGC 4A2HA 3WJLA 4M6OH 3B3IB 2ALWA 1YCSA 5CCHE 1MIMH 1MZZA 2GUYA 5D9SA 3VXOB 1E8WA 1IM3A 1GMIA 2V9TA 3GEFA 4XHJC 2XVKA 4ONFH 3A6CH 5C92A 2FO1A 4ABVA 3PIQB 4NHCH 4LLUA 3U0TA 5C0CD 5LN8A 4HH9B 3FCTB 5DZPA 1QFHA 1HSAA 1RIUH 5JPNA 2NY5L 3FTUA 1UXSA 1X9QA 4M61A 4ENED 5KSVB 1RURL 2ZUQB 2XG4B 3SBQA 3GXFA 3VXRE 1ZA3A 1LL1A 3HS9A 4XMLH 4XC3H 4M93C 3EO1A 4RRPM 3JQOB 3VQLA 3GMPA 3D18B 5D7LA 4IRZL 4RNRA 3AITA 3CFDA 4Q9QL 1WA2X 4PV8B 4JRXA 3ZHFA 4FE9A 2YSSA 5E2JA 5FOBB 4M7ZC 1JV2B 4G71B 4P5MB 5K93A 3TZVC 1KYDA 2WV3A 4IJTA 5H2BA 5ESVA 4AQEB 1A7OH 5K33A 3SPJA 4EDWH 1BEYL 4GRWE 5ELIA 4W9JC 3PPEA 1MLCA 3MR9B 5JTWA 3QUZD 2F19L 4NM8L 4QO1B 1BOGB 5DLML 3MRHA 5ABDE 1VAHA 5A7BA 2ZPKL 4PGDA 3CBRA 3NZ8A 1ZWIA 2EEDA 4BZ2A 3DX9A 3OR6A 3GMQA 1OZTG 3L1GA 5F1IB 4DKFH 4KKRA 4O2CB 1N4XL 4BE5A 1S3KL 4P99A 1WV7T 4ZW7A 4EEEA 2F7QA 1HJCA 3RTLA 2JNZA 1BVZA 2CCLA 2Y5TB 3N50A 5B8CA 5BUGA 4FTDA 3TO4C 4FFYL 1BBJB 1TUPA 4PLKD 1RPKA 3RBGA 4FNUA 3MTXA 1SEBB 3P54A 1TDQA 3FO2A 2R83A 1BD2A 5H94A 3LN4A 1O9ZA 3SPHA 2Z8SA 1A6ZB 2Z34A 3PHOA 1OSEA 2CKBB 3AY4C 2DWEB 2A83B 3MNWB 3FUMA 3TT1L 3U0PB 1BYPA 4AG4L 1G7QA 4HBCH 2XA8L 4G43A 1KBVA 4MX7A 4PRDB 4I0PB 5E0QA 4DEPB 1CUOA 1P2CB 2FL5A 3HZYA 5DYFA 1JZ3A 4PP2B 5C07B 2R0WL 5DD6A 3MJ6A 3PS6A 2B15A 1UC6A 4PJ5A 5FO2A 1C08B 4N2GA 3X11A 5ITBL 4PSRA 2QMJA 4LLVA 3QUKA 1WHPA 1WAPA 5IJBC 2AJ3A 1IAII 4JFSA 4NQEB 1HI6B 4IDLA 2QKSA 3T0XA 4PM1A 3HBGA 3MV8E 4BBWA 1B2WH 3CD4A 4L5FH 3IDXL 3REVA 3MTRA 1SXZA 1SLWA 2AEPL 3QUYA 3TESA 3PDOB 2EYSB 1M7DA 3CZNA 3VXSA 4UQDA 2IBZY 4MCNA 5F7DB 2IALB 4NUGL 2HG5B 4A6YB 2E9GA 3N0AA 5T1DL 3MLZH 1UCTA 3KPLB 4LARH 4PWFA 4HXAH 2YMXL 2XSKA 4BSJA 5SX5H 1T0NA 3CNKA 5BJTB 1R0AL 1EWHA 1UOLA 4Y1TA 1OGSA 3SEPA 2WLMA 4W9CC 1OT4A 2BSRB 4FZEH 1K72A 3NCFB 3T1FB 3VMPA 4ACTA 2A6KA 1MVUA 2JSFA 4FQ2L 3GO1H 4BZYA 4DGVH 2CE6A 4M1GH 4HEMA 4P23D 1JNNH 2ICWA 1UD4A 1X5YA 3CJJA 4X6DF 3WDJA 4WJ5B 2XN9D 4IBZA 5DGQA 3UGEA 5C1MB 4K0OA 3K2MC 4KQ0A 4IDJL 1J5IA 3SE6A 5EO1A 3ARFB 2JH2A 4UT7H 4GS7B 4Z7VA 3LKRA 1VKXB 2EIZA 2FATH 3RA7L 3NG5A 4TNWF 3UCRA 5KW9L 4K15A 4KUZL 4U1IA 5KSBB 1KCWA 3E8UH 1M7IB 4GP5B 3D06A 4K7FA 2HH0H 5AEAA 5I1KL 4N85A 3VU2A 1W0WA 1T1WB 1UGNA 4J3TA 4LVNB 5L4JA 2R0KL 3ZTNL 1WBYA 1K4CA 2YUWA 3G9VA 4K94C 5LAPA 2BVQA 2NR6A 1AAJA 1DL7L 5LAXA 4FJYA 4R0LC 2EVFA 3H4FA 1RMFL 2C8NA 3BFOA 1FLRL 5C7XH 3DJZA 6FABL 2P1YA 3A67H 3LNHA 3SPVB 4YSPA 2AANA 3L8QA 4XNYL 4YDIL 3VGAC 3S48A 4MFHA 2EVIA 4PPTA 3K6OA 3ZR6A 5B38B 5GGUA 1UM4H 3EJTA 4YXLL 2HLAA 3DYPA 3L3OA 3RDTD 1F6AB 1MFDH 1NFAA 1MIEL 3DSFH 4X5PA 3U7YL 5INCB 3I9PA 5I1HL 5EA0L 4XE5B 3MGAA 1DLHA 5E6RB 4AMWA 2H1PH 2DLTA 3IVKA 3VD4A 1OZUA 1WTGT 2AK1H 3FQTA 2BC4B 3LD8C 5E2VH 5E1QA 1FGVH 3GS7A 4X6FA 4OGYH 1LHZA 4NUMA 1PCSA 2BHUA 1EZLA 3MLWH 4LHQB 4R8WH 4U6YA 1Z9SA 4YSCA 1E2ZA 4R4FH 1DBAL 3EGDA 4A04A 4RMQA 3C6SB 3T8MA 2EZ0C 4PVNA 3HHSB 5FCUL 5HSFA 4YGAB 3RNKB 43CAB 2NXZB 3D4YA 4I18C 5BRZA 5DZNA 4NCC2 1IUZA 4JZNA 2DLHA 3KW8A 4YDLC 5FGBA 1V3LA 3DPBA 1CDBA 3L81A 4I48A 5KZCB 5AFAA 7PCYA 1KNOA 4TQEL 4JFQB 2VLKD 3EFOB 4JFEB 3VXQB 1UT1A 4GO8A 5FA4B 3SE4C 1V8HA 4NAQA 4TNWK 5C8JB 4TVSa 1T03H 3QDMA 4KTDH 2Q5BA 4IJ3B 5KSAB 1V3MA 1R3LA 2BY0A 2YD2A 5KVGH 3EG9B 4HS3B 2X4TB 3NK4A 5DMKB 1GXEA 4QXWA 4JJOA 5IVZB 1OANA 4BH8A 3QZLA 4ZTPL 1UZ6E 3O3EB 4OJYA 4AEIH 2FNWA 1C16A 1WAEA 2V7NA 1BJMA 2UZIL 3DOSB 3KYNA 4I3RH 2AXWA 1JTPA 1A1NA 1QQDB 1QRNA 2A6JB 3LNFA 3QPQC 4LPUA 4FMKA 2DQGL 2NZ9C 2YQ2A 3Q3GA 4ONHA 2NSMA 3VJ6B 1EJ8A 3G3LA 2M8XA 3LZPA 3QR1A 3FQ4A 3LS4H 3MLVL 2FT7A 4P2QA 4A55A 2C9RA 4GINA 1XB3A 3LEYH 3ZX1A 1LK3L 5L9DH 1VZHA 4L9LB 3PWJA 1Z7JA 1RUQL 1HXKA 2M83A 1OAQH 2E5EA 4EI5A 5FC9A 3KPQA 4UQ2A 2O61B 2GSIA 1SY6A 1WG3A 3QZWG 2ZCLL 4MAYC 5EWIH 4DT2A 4NO2A 4X7TA 1PIGA 4WWOA 5DS8B 5DRWA 4MNGE 1U8LB 2BDNH 1ORQA 3LMJL 2AQTA 4GG6F 2ZX5A 4AENB 1D7FA 4P48A 2EXWC 5FFLA 2W65B 5AWNH 2X4UA 3QUHA 1T0PB 3HI6L 1TPXC 4LOEA 5IOKA 3L3GB 4D3CH 4L0ZA 1CL7L 1HC1A 4MXWL 5ID1B 3MLPA 4XP5L 2CGRH 5C08D 3UTZA 3EIFA 4RDQG 4G8GA 4Y4KB 4FTVA 3FU3A 4ZMNA 1OAKL 3ASOB 5CBEA 3AAZB 3TCXA 2J25A 4DVBB 2QSQA 3ME0B 2CA3A 4ELME 5CZVH 5FO9B 4YAQA 4GUCA 1S5IL 1XEDA 5HYFA 4IRJB 1D5BB 5LG6A 5B3NA 4BEIA 3I02A 3U7AA 5HHQB 3BKJL 4M3JA 5DRXA 5D93C 5FGSA 1QSED 1JK8A 3P11L 4TNVF 3HG0A 1CVRA 1PCXA 3CMOL 5D7SH 3T2QA 3ZL4H 1Z9PA 4MQXC 1TQTA 5KYXB 3VVVA 3ZGHA 5E6IC 5IV2B 3RTQB 2E27H 1DQIA 4WW1A 4UOJA 3IMWA 2G9KA 4U1KB 4ZG1A 1B4JH 2NNAA 3GZOA 4OI8A 1FE8H 2OMBA 4QKXB 4G3YH 1DBBH 1OM3H 1KC5L 2XG5B 1IT9L 3OKMB 4KK9D 4NN6C 2KBGA 1CQKA 2JKJA 4I2XB 2HMIC 3DX1A 2H32H 4LLMB 4WO4D 1JNHA 1JNJA 3ARBB 3BVNB 4JM4H 3KPNB 1N5AA 1ETA1 2KZBA 4XNQB 3BRGC 1OK0A 1JPSH 4N0FA 5AQ0A 2M26A 2AJXL 3T0AA 3DURA 4WO0A 5EZOH 3V6OE 4LDCA 1OF2B 1AFVL 4KDVA 1A4CA 2WCGA 4L0PB 2A2QT 5DVLA 5SX5K 4JX0A 4K5MA 4B9GA 1OSPH 3TC9A 3QJSB 2ADJA 4FDWA 4K55A 5I6OA 4MJJA 1IAKB 5IEKA 1T2JA 2G5BA 2WTRB 4HFUH 3HNVL 2V5MA 5TF1L 2VIRB 4UM9B 1M71A 1J1PH 1D6VH 3S96A 1EFXA 4JAMA 1AQ8A 3KWXA 3O9WC 3TV3L 5HVFB 4BV1A 3EYVA 5EU6E 2WD0A 4GSXA 2Q2EB 2WNWA 1J9RA 3RNQA 1AGCA 1XBDA 5BVPH 4KVPA 5H37A 1IL1A 4BE6A 1FIEA 2N01B 3O2WH 1A3QA 4UTAA 1DJYA 3DDFA 4FLOA 4H1LB 1OCZB 4PJ5D 1A65A 2BFGA 1KPVB 1OCRB 3P02A 2HWZH 2V2WB 3BSHA 1G5AA 3BH9B 2XWJB 3KXFB 5HHOE 4HALA 4ONGL 1UACL 2ZOWA 3QZWA 4BQ8A 1TJIL 4GG8A 4K8RH 4TNVK 4NO0D 4BDVA 3PL6D 4NZFA 4TUKH 5HJ3B 1P7BA 3GIZL 5ISZD 4PRIB 3MX0B 1W72A 3PWVA 2I7SA 1YEKH 3C5XA 1AXIB 1A6VL 4XXDB 5J6GB 2VXQL 4UBDD 2FWLB 2G2RA 3QDGB 1KB5L 1KLUA 2A7BA 3VXSD 5D2LA 4ZUUA 3QCTH 4NN7C 3PV6A 1U8IA 3LJ3A 1Q72L 3MGOA 1H9VA 4M93B 3B34A 4N1HB 3F84A 3ZLQC 1MCEA 1AH1A 3D0LB 1CLYH 3ZIYA 3FF7A 3N85H 1U41A 4MNHB 4XNXL 5I8CB 2XY2A 1O7DC 4AVJA 3BQUA 4M7ZB 2R29H 5GS1A 4LSSH 1SN5A 5IFHL 1N64L 1HHJA 1CC3A 3TZVB 2EAEA 3ATAA 1A6UH 2Z4QB 1B0GB 4X8GA 2IMNA 3FTGA 5FM5M 2MPAL 5BXFB 1YDPB 43C9A 5F7YC 1T7XA 4JFEE 1DUYA 4KZCA 3IFNL 3RG1C 2UY7A 3L3JA 1IIIA 4ODXA 4XT1C 2Q7NA 5CINL 4ANKA 3TA4D 3V0DA 4L18A 1ZGLP 1YEGL 1K8IA 3MV01 2ID5A 5FXCH 4WWID 3TO4B 1T3FB 1I3GL 3O6FC 1AIFA 3US9A 1YYLL 1FSKC 4FP8L 3D51A 4UQEA 1NMBL 5DD3H 1A8ZA 3LRLA 4LHUA 5GRVK 3BSZH 1KGJA 1EHLH 3VFSA 3VWJC 2Y2WA 4F2EA 4YX2H 3P77B 2NY3C 4JFFD 2OL3L 1S9XA 2VN4A 2LVEA 5JO5B 1LILA 4JG0L 2I07B 2J8UA 2EDWA 4X6BA 2AK4E 2A9ML 3QGVA 5LCVH 2K6ZA 4OZFB 1N0LA 4TVPD 3WNPA 2DIAA 1DVFA 4FQLH 2KZKA 1UXLA 3QJRB 2WWKO 1NAMA 1DVQA 1EA9C 1VDGA 5EOQH 3SPCA 2BZCA 4AL8C 5I1CL 2H6PA 3RKDD 5DQJA 1ADQH 3UAJD 3MLYL 2WLZA 1G9MH 2F2HA 3L5HA 3RWJB 1C5DB 2A3TA 4JPIB 2QEJA 4M6OL 4CSZA 5DCCA 5LG1A 4GLRH 5EZLB 3CCHA 2C7UB 2R7EB 4ONFL 3A6CL 3WJMA 2AVFA 1ZV2A 5E2WH 4RZCB 2GBUA 4NHCL 3WLWC 4QYAA 3JWNG 1RIUL 4GEJA 2ZUUA 3A6BH 5FF6B 3UPCA 2CNYA 5E9DB 2F54B 3DGGB 1SLVA 2I26N 4XC3L 4I13B 4Y16A 1EANA 3MUUA 4GQQA 1ZGLA 1XSKA 2NXYD 2AEWA 3RP1A 4OUUA 4HU8A 4ZUVA 2D3LA 3BZFA 4AC4A 4GT7A 4HKBA 2Q3AA 1ZLWK 4E9WA 2XFXB 2YKKA 3EYQC 5E8NB 5AYTA 4AM0Q 1A7OL 4EDWL 1M2VA 4YN3A 3S3CB 1J9TA 1T0MA 3DJ9A 3R1GH 5T5NF 4ES9A 5GGSA 1U8HA 4KFMA 1FNHA 4FQQB 3ZRCC 5JHDA 4W6WB 3QEHB 2DQIH 4FFVD 4KC3B 3IDGB 2R2BA 2DJUA 5IUCA 2GY5A 1KT2A 1RZKH 2DJSA 2IWGA 3P4OA 3WE6B 1SQMA 3VI3A 1PNDA 3NUKA 5PCYA 3HG1D 4M1CC 1BPLB 4G59C 2Y5QA 2VQ4A 3P73A 1RZIA 3RKPA 5IVXB 4KJWD 5GZNA 2ATPB 2E0PA 4HHWA 2XVGA 4I87A 1OLZA 3QQNA 4LGPB 4R0LB 4XGZA 2EXSA 4I2XE 3MRFA 3STZB 4MMYB 5GHWH 1YEDB 2EC9T 2D0FA 4HMCA 1ZSDA 4HBCL 3ETBF 1O75A 2Z4TA 1OTSC 3VGAB 2OMUA 2FT6A 3GD1C 4XTRD 3X3GH 4E9VA 2EDTA 6CGTA 5ERWB 3LRSB 1G7JA 4U1LB 3OB0K 5KN5B 1GC1L 4DPBX 2QL1A 2JKNA 3LZFH 1MHEA 1XF5A 4LOUC 2X0WA 2MQ0A 1QI5A 3C8DA 4P3DB 4BJLA 5IT2H 4M1DH 2QPDB 4AT6B 1TMCB 1PD0A 4ORZC 4MMXA 2BWIA 3LPGA 2L7UA 4N24A 4ETQB 5DUPH 4PRHE 4CA4A 3LD8B 4W81A 3TA3A 5F0LB 3SKNB 2GITB 4UZGA 4LCWB 3SGJC 5DDHA 2CK2A 2HVKA 1B2WL 1T6BX 2W60B 3HR5B 4L5FL 5I76B 2ENYA 3E1F1 1PLAA 4WQOA 4AK1A 4UNIA 2IWKA 3UO1H 4PHZA 2Z35B 2ETWA 2VM4A 4FTVD 2WZAA 3N3EA 4LBEA 5F8RC 1OTTC 1YZZA 2Z64C 1OGTA 5LGKA 1VEOA 1YC7A 3MLZL 1GYVA 1EEZA 4I18B 4LARL 4HXAL 4AE0A 4F7PA 4YDLB 4LASH 1HH6B 3MRRB 4FQHB 4GRMB 2IF7A 4HHGA 4EI0A 4FNRA 2DTSA 4B95C 1Z9MA 4FZEL 1CGWA 1I7RA 4NUPA 1DE4B 1H3TA 3GO1L 4HDIB 2I7OA 4M1GL 3WTSA 1T7WA 8CGTA 1JNNL 1JYVA 2ATKB 2W80C 4U6VH 3US0A 5AG9A 4PJ7B 2ZKHH 5L8JB 2WXFA 4KK8D 4B97A 4BA0A 3QDGE 4JANB 4M8QB 4UT7L 4M5YL 1JRHI 2FJFB 3WKPA 4BA8A 2FATL 4N2KA 3OKYA 3TNNB 3E8UL 5CN1A 3T2OA 4J4PD 3KMDA 2HH0L 2Q7YA 3BRDA 1XMEB 1INQA 1G1CA 2YIHA 5TK4A 2H1XA 4G9FB 3MRNB 2EXYD 2VZTA 3EDKA 2OAAA 1I7TB 3CUPB 3QCUH 3QJUB 3ESUF 4NZUH 2Q76A 3CN2A 3F7RA 2JKSA 4MD4A 4ANXA 5C7XL 2P8LA 3MAWA 4UV4H 2BHZA 3A67L 5AAWA 4OV5A 3HRZA 4NKQB 5F70A 3NCEB 3PJNA 4MAYB 1PZ5B 5INDA 4XB7A 1WWBX 2ITDA 3QNXA 3RWIB 3MJ7B 4IBUA 1UM4L 4HLZH 5EIVA 1XGZA 2BSSA 1S78C 2QPEB 3RZCC 2BNQA 1MFDL 1HFUA 3DSFL 5FYLE 2W92A 3WE1A 2HUEA 2Y36H 4OF8A 5F7EH 3QYNA 4WEBH 2X9WA 2H1PL 5AW8B 3OAZH 3MRJA 2ADFH 1S7TA 1TPXB 2IDSA 2WP3T 3QK0A 5DHYA 3DNKA 2AK1L 5E2VL 4OCNC 1Y7VA 4RX4A 1FGVL 4CU6A 3GIVB 4OGYL 1ONQB 1S7VA 5AW9B 1SNRA 4U1SB 4WRLA 1J9SA 3EJUA 3MKGA 3MLWL 3CDCA 4G8FB 4R8WL 1R5WA 3BP5A 5J3HC 3DJRA 1EBPA 3B7RL 1J7VR 3GMMA 2GFBA 5ES4B 4ZUSA 1PGRB 1C5CH 1CYWA 4MVBC 5I1IH 2YRZA 4AJWA 3KYKH 1KXVA 1DZBA 2ZXBA 2Z7WA 3HNSL 3LRGA 3GSWA 1I1AC 1WBZB 2HT2C 4YO0B 2CLRA 5EO9A 2WLNA 1IGIH 1XH2A 5GRVL 3KG5A 5D93B 4DCQA 3ARDC 3P9WB 2R4RL 1I85A 4Z7WB 2R56H 2WLHA 2X2UA 3QWNA 4KTDL 1E4HA 4HEPG 4PJCA 5KVGL 1TFPA 4NPYA 3BVWA 2QGDA 1RUMH 5E6IB 4ZYKA 3VXTB 4XOAA 1JF6A 3DI2B 2GYSA 4JNXA 5TDOA 2J12B 3SQBB 2B8OT 4QRTA 5I73C 5CCGE 1IV8A 1QBLH 2F54E 3BQUD 3LNGA 4I3RL 4LDLB 3QUMA 2Q8AH 3WUWA 3ZDZB 3OLDA 3CVCA 1N18A 4NN6B 1BP3B 2BHFA 2NTFA 3E3QC 5C07D 4ALAH 2FBJH 2YZ8A 3CLWA 4QTHB 3LS4L 4KVCH 4ZUWA 3LEYL 3ZTJH 4E41E 5L9DL 1IC0A 1CBVH 2XZZA 2YN5A 3CZJA 2FJSA 4LSVH 1OAQL 3FUJA 4NQED 3IJ8A 5CHNA 3P1VA 5B39A 5JR1H 4Y19B 2QBWA 1T1XB 4KV5F 2IQ9H 3HN5A 1R46A 3HPJA 2BOCA 1NZRA 3NQIA 5EWIL 1I4FA 3UTQB 1AS6A 1YMMA 5I1DB 1RY7B 2ICWI 3C6LA 3JUZA 4XPGH 3CXHK 5K39A 2VR5A 2ZE0A 4RIRB 4JZJA 2V17H 1F6LL 4LHUD 3FRPG 2BVTA 2V3FA 1F56A 5I8EA 4HS6A 2YPLA 4Z3TA 3QC6X 1B88A 5HYQA 5AWNL 2BNRA 1L7IH 2I5YH 3WTTA 3O9WB 4XXWA 5IVXE 2E7MA 1I7ZA 1H8LA 1ZHLA 2OXGA 3OMIB 1J5CA 3R06B 4ABWA 1H0DB 3L3DA 1U8NB 1QSFB 3SOBH 1D5MA 5C0JB 2XJKA 4O2FB 1XR8B 3K71B 2IOOA 2JTYA 1C1EH 4ZRGA 2D73A 2QGCA 3O2DH 2AJYH 1RQ5A 2N0MA 2WK2A 4H20H 1GS8A 3IYLW 2QJDA 5CZVL 2WLLA 3AQZA 4X8JA 1XEUA 5AKRA 4LSUH 3W9EA 3MUGB 4K3JH 1VRSA 2IANB 1FZOA 4P5KB 4WHYH 4AH2B 4WFHE 3VNZA 2ZIDA 4OLZH 2WKOA 3WENA 1NEZB 1FFQA 2VDLB 4LCWE 4RSVA 4F80A 1AS8A 4NN7B 5DD0H 4DKAA 4FKHA 3CX5K 3ZL4L 5D7SL 2QVFB 3NP4A 4BXSV 5EMYA 3HCVA 4QCIA 2E27L 3F3HA 4QHPA 3CVIH 3JV5A 4PMFA 1Q9WB 1EPFA 5DD5H 4CC4C 1B4JL 2UX7A 1UOVA 1ZVSB 2W0FA 1QPPA 3L54A 4LEBA 1C8QA 1FE8L 2N7BA 4G3YL 4KJQD 2I9LB 1SF5A 1DBBL 2VC2H 1OM3L 3T6XA 2F1EA 4F7MB 4DPRA 4JDEA 4BKLA 5JDSA 3KPRE 2G3MA 2ZKYA 3M1BB 2KUTA 4KY1H 2LAAA 1A4BA 4JM4L 1KDIA 1O6TA 2LFGA 3D4GA 4ICWA 3EO0A 5MEOB 1JPSL 5JHDD 5JPMC 3T6QC 3EFFA 5LBSH 4KROC 5EZOL 2E46A 4HCRA 4AQAB 1DYZA 4PBXA 4HG4J 3FSWA 1MW1A 2VR7A 1OAUH 2AQ3A 2BNUB 4GIAA 2CIKB 4D0CA 4XNZC 4HEPA 3GS0A 3VSTA 1DQMH 5I8OH 3O6FB 1VB9A 1PZDA 1FSKB 4OLXL 1OSPL 4XH2B 5IBUG 1YPZB 3ALWA 1R9FA 4KRNA 2WLIB 2WZPD 4HFUL 2NXZD 3VWJB 1P7KA 4JPQA 5C86A 1J1PL 2J2ZA 1ZXQA 1D6VL 2NY3B 4IOIA 2IQAB 2MPVA 5HDWA 1L6PA 4G9FE 2ODHA 5TE6H 1DQQB 2WXRA 1SDDA 4Z23A 5KZCD 2WAQA 4RZKA 4NKMB 1PG7W 3IMSA 1HZLA 3ZKXC 1NUDA 5BVPL 3G6DH 2FH6A 3QULB 1B0RA 1UZ8B 3O2WL 5EZJA 5HHVH 1IFRA 1OP5H 2F1AA 1Q9KA 5KSAD 4MTMA 5BS0E 1BQ5A 2VMFA 3BJLA 2V9RA 3CU1A 4JFOA 4N6RB 3RWEA 2HWZL 2Y23A 3D0VB 1T6VN 2Q86A 4X7SH 4YDKH 4GH7B 1HNYA 4K8RL 4HSAC 4TUKL 4YIQA 3RL1B 5DFTA 3Q5TA 1ML0A 1RZQA 3FRPA 1NOLA 4U31A 5DMIH 1MJUH 1YEKL 4KI5D 3X13B 4HWEH 4L9DA 3VX0A 1NWPA 5LGJA 3OAWA 1VIWA 1W8NA 4A2LA 3HKZA 2PO6C 4HZ1A 4NO3B 4CW1B 2DYRB 4L3EB 3QCTL 4YLQT 4IIQC 2FO4B 3BH8B 1GY2A 1SJHA 3ULVE 1CLYL 3DDGA 2FLBT 3QNZA 3TBBA 1K4DA 3N85L 5G5DA 4MNQB 3FNKA 2KLTA 2OR7A 4OCLC 1X5XA 3LZQA 4WFGD 2YLKA 4CDGC 2PXYC 3ZSTA 2R29L 2UZXB 2Y6SC 3OAZK 4LSSL 4PJBA 7FABH 4XMKH 3BWSA 2NUPB 1A6UL 4BZ2H 5ESAA 3FOLA 3L45A 3U46A 3QBTB 2A74C 2BW4A 2YOAA 1WICA 4JW3A 3HI1B 2ZNXA 4LEEA 3MDJA 5EEZA 1GKEA 2QLYA 3OZKA 1OOAA 1I1FB 1NPNA 4Z7WE 2FQDA 2GK2A 1S6NA 2Y3NA 1FIGH 3NIGE 4QI3A 4X5XA 1AZRA 3B5TA 3QIBA 3EH5B 3SKOB 3MJWA 4WDIA 1E28B 1YY9D 2OK0H 1S7QA 3BP4A 1KG0B 3DV4B 1HXMB 1UB6B 3VFNB 2TRYA 5DA0B 3PWUB 5C97A 4MQSB 5DD3L 4P46B 3N5AA 3W39B 3ZDZE 4X4YA 3BSZL 4TLUA 4QXGH 3GSRB 5TE4H 3LIUA 4YX2L 4IRSC 2WVSA 2CRYA 3B9KC 5IQLA 2FQGA 4PTUB 4CU7A 1I8KB 1P4LA 4HUXB 1FYTA 4HLEA 4WWKC 2C3VB 5LCVL 2FIKA 4YC2C 4OGZA 4FQLL 4LB8A 3D1MC 4ZOCA 3VGBA 1W0YT 3ULUH 3PQYB 4NQUA 3FHEA 4HKZB 5EOQL 4GBXC 3BISA 5HVGB 1TYRA 2GABA 1ADQL 2EC9U 4FA6A 4AEFA 1G9ML 4AC2A 1J8HA 1TFHA 4H44C 4PB0H 3QNYB 1OE3A 1BAWA 3NPSC 2CBQA 1WK0A 3GSXB 5E2WL 3GMNA 3I50H 4F33B 5TQ0H 3LPWA 3X17A 1AXSB 3VFUA 4PW9A 1KCUH 4FZ8H 4I1PA 4KJPC 1A2YA 2B14A 3A6BL 1UEMA 3ARBD 4KKPA 4F5CA 1GOFA 3TONA 1F3DH 1T83C 3L3HA 3TFKD 5E5UB 3OQ3B 1AGDB 2DQ6A 1QSFE 1P53A 3G5VA 2DB8A 3N42B 4H0LC 2N56A 3MNZB 1QEWB 4WK2B 4EMZA 3L7FA 3DX2A 3DV6B 4LFHD 1VACA 2EDEA 1N8OE 2AJZB 2COQA 4KRPC 5IQ9A 4WI2A 1WC7A 3INOA 3V4UH 3R1GL 2YPKA 1LMIA 4XCEA 1U6AH 3ETSA 3QO1A 4NGHH 3RVTD 4UM9D 5C6PB 2WOYA 3FUEA 4ZZFA 1XCWA 5D2NE 3DARA 4UCFA 2DQIL 3OXSB 3H56A 1GJUA 4NQQA 4WI4A 3WXVH 1EO8H 2VL4A 5E51A 1RZKL 5D1QC 2B59A 1U8QA 4N26A 4H25B 4KKLD 2MIZA 1QASA 1XGUB 2GTWB 4MCZA 1RZGA 4Y5YC 4GAFB 5K9KB 2RB8A 3GINA 4X4XB 4XO5A 1K5WA 5D5MA 1A1OB 3NJVA 3PJSA 1N2RA 1FDLH 4HV8A 3T0EA 3P4LA 3KXFD 5CSBA 2YC1A 1M56B 4K5OA 4YVNA 1U8JB 5GHWL 3FQWB 1ZMYA 4PRID 4XHJD 5F9OH 1YRKA 3DHMA 4NRXB 2D7QA 2EH8H 2OQJB 3UCQA 4FQIH 3IGAB 1SN0A 3X3GL 1BQKA 5DJZB 3WHE0 1DVTA 2BP0B 2BM3A 2JB5H 2XYBA 4OAWB 2GBVA 5FYKH 2WN3A 4HUCA 4X4KA 3RZCB 3LZFL 1L6ZA 3DROA 2PYFB 3CFUA 3HAEG 4MDJB 3TBYB 4M1DL 5IT2L 4NI6A 3ECBA 5HYSG 3BZDA 1TIUA 2XKNA 4LCYA 3SQRA 5HJDA 2P5EB 5DUPL 3DXAA 4FFZH 2HKHH 4RFEA 1HHGB 4XNMA 3TZVD 5IB2A 2ICEB 1JFHA 1YUKB 2KT6A 3DX6A 3UO1L 2ZX8A 3VD9A 1ZLVK 3L4VA 3DC0A 1EEQA 1QZNA 2AXJA 3QJHB 3H9YA 2G9HB 1KENH 4ZBJA 2EIJB 5CBAA 3SBWC 5DD1H 2DICA 4AJVA 5CEXB 1E3ZA 3RWCB 1U4EA 4NT6A 4LASL 1IZJA 1NJ9A 1HNFA 4HJTA 3EYSH 1I1AB 3DWTA 2DRUA 1XGTA 1CT8B 2HLEB 3BIBX 5FYLD 3EGSB 3TO4D 4E68A 3ARDB 1ZPLA 2Q20A 1E4KC 4GSDH 4N86A 3BJ91 4PJFA 4C4BA 3MLXH 4M7LH 1UWYA 4BFIB 4XX1G 3WLBB 1LEIA 4ZMZA 1G4RA 3MGTA 4U6VL 1MUJA 3L48A 1FVDB 3ZN6A 1MWAH 2ZKHL 4Z18A 5GPRA 3ZMNA 1OP5K 5F71A 2VDQH 4K2UH 4IOFD 1G1OA 2SODB 3QG7H 4L3EE 3LHPH 4WKZA 3MACH 4B0MM 2CLZB 1L0PA 4NNXB 4Y1AA 1UD5A 2H3NA 4XCFH 4W4OA 4XO3A 3ULUF 1LTXA 5E70A 1O9VA 4MNQE 2IPUK 4R7DB 2N3JA 3PWNA 4L37A 4FXKA 3HZMA 5GXBB 1UTDA 2QVMA 3IJHA 1SMOA 1SY6H 4LDEB 2Z8WC 2X4PB 5CWSB 4YEFA 3H9HB 5B4MC 2ZOLA 3P9LB 2R2CA 3FTZA 4WJG3 1Z6JT 3QCUL 5IESH 5L2JA 4NZUL 1AMXA 2ZUSA 4FKKA 4O51A 4UV4L 3FOMB 3W0WA 3TO2A 2G75B 2WCPA 3PUCA 2XOTA 4NCC1 5T1MB 4Z3EA 5J5EA 2PNDA 1KJ2B 1FJ1B 2PYEE 1QLRA 4PG9B 2AFNA 5KJRH 1G7LA 1XCTB 3Q9QA 4O02H 5E9DD 3SGEI 1U3HC 2F54D 3DRTA 5T1KB 3SB3A 2Q6WA 2Y36L 4PJIB 5F7EL 4PJEB 3UTPE 3VI4F 4WEBL 4HULB 2ADFL 2Y9RT 4HUNB 4MQ7A 4JJ5A 3V9EA 4NRZB 1HXYB 4UOZA 5LB1A 4X7SL 4JFTA 5GIRA 4Z7IA 5JIMA 1NBZA 5IBTH 2D03H 5E8PA 5HYJA 2RCSH 5DTFB 1JPGB 5E8OB 3RIAF 4ZNEA 4XCCH 1SVCP 4FQXC 1KELH 4Z7VF 2YGNA 4U33A 1KXQE 1UQSA 5HGGS 3AU1A 4YSQA 1C5CL 2VLJB 5I1IL 3EJSA 2XZAH 2EDOA 3PQYE 4NNYB 1I75A 2BIQA 1BX2A 1X5GA 1S2EA 2UUDH 4MKTA 4OSUH 1SPDA 4WU7B 5GZOC 2YWZA 1S3RA 3T3PB 3LH9A 4DP4X 2YK1H 4OZHB 1F0LA 4JHZA 4LRIA 1IGIL 1WF5A 3HAEA 3HS8A 1XF3A 5FS5A 3L2MA 3S34H 5ICZA 4R7XA 1EAPA 1BVKA 2OMYB 2R56L 5GSVA 4ZZKA 2E9JA 1PFOA 3DSNA 4HK0A 2XBDA 2Q0ZX 3T0VA 1IM9A 5F72S 3O3UN 1RUML 3BN9C 4WNQB 2MNJB 5DJAB 1UXWA 5HHMB 5CILH 1XXFC 1QBLL 4HJUA 2OYLA 2Q8AL 1F00I 1V7MH 2J3SA 3LZOA 2WANA 4ALAL 4NFBA 2FBJL 3ET9F 1ODUA 4UQCA 3K72A 5I0XA 4IHOB 4KGLA 5IHBA 2PP7A 3VXNA 4C83B 1CBVL 2P48B 2CO6B 5ALBH 5JPMB 5IB1A 4KROB 5HVWA 4LSVL 5JOFB 2YAQA 3QZMA 4HK3J 5JR1L 3T0DA 2IQ9L 2VITA 5GS2D 4XNZB 3CXDH 4WKXA 4NEHB 4PV9A 5D7IB 4YSSA 5IMOA 4XPGL 5I1LA 1TTFA 3T3MF 2BVUA 3JSSA 4P04A 2V17L 3EJZC 4XN1A 2EZ0D 5HJBA 2Y7MA 2XRAH 3AS2A 1HWGB 3U1QA 2YUZA 1WUZA 4JKKA 3RIAK 5FFGA 1L7IL 5HDRA 2I5YL 2ZYSA 3P2DA 5IGXH 4QHUB 3T0WA 1FGNH 3HEIB 1NUGA 3VXMB 4J3SA 4QHMA 3ZKXB 1E7UA 5FWQA 1R24A 5SX4I 3DIFA 1AVAA 3SOBL 2WNGA 3G08B 3ECUA 4UM8A 1C1EL 1W72H 4LPYA 2Q87A 6PCYA 2GEEA 4HWBL 3C12A 3IE4A 3O2DL 3WFHA 2Y1VA 3P30H 3KM2A 3TTSA 2AJYL 5LKNA 2BH0A 2PTTB 4H20L 5BOJA 5IIEB 3POHA 1JBJA 2W9DH 2GY7B 3U9UA 3K8KA 4K3JL 1G94A 5JZ7C 2NZ9D 3SODB 3BE1H 1BWWA 1NCDH 4HF5H 3TWYA 1NFIB 4G9FD 2PO6B 4TPRH 4OLZL 2FAUA 4ZAKC 4Y4HA 4PB9H 1AGEA 3B56A 2HN7A 5DD0L 1S5HA 5SWSB 2EDDA 4YBLC 4ZX6A 3B2PA 1NCWH 5E23A 1LD9A 2CWRA 5MEPB 5GRWA 3RE0A 3VXRA 4NQCB 4L2LA 4PWJA 3RJQB 3CVIL 5I8KH 2PXYB 5DJ2A 1FN4A 4PY7B 4LCVA 5CP7B 5I74C 3W1ZA 2VC2L 3NEEA 1EZSA 4RMBA 3C8HA 4OI7A 2F7PA 1GZHC 4LEOB 2EXWD 3MODH 3E38A 2Z31C 3D39A 5F7BA 3IM1A 3MFFA 4KY1L 4BK5A 3CBJB 3EUDA 2CHWA 2DBLH 2L3BA 4KRLB 3G9AB 1NUNB 1SHWA 1TCRA 3U2SA 5IP4A 2E56A 2FQFA 4YMPA 1OAUL 1RH8A 4GRLC 3MNMA 5F7NC 5T3ZD 2QHRH 2VLRB 1DQML 3ELAT 5H35B 5I8OL 1DFXA 4P2OC 1O7SA 3QXWA 1QRKA 4QXUH 5C3LD 5M7QA 4JFDE 4RESB 1A7BA 4Y5VC 1KTLB 4N3UA 1AC0A 4IRSB 3B9KB 2V8LA 1TYJA 3QZOA 2YRPA 1U8PB 5TE6L 5F3FA 3OZLA 4WWKB 3VFPB 3GTTA 5C9JB 4YC2B 3WJJC 2ZWNA 1CLZL 5ITFB 3G6DL 3TBTB 5CF3A 1BQHB 3QZPA 4L1SA 1G7MB 2MQ3A 4GBXB 5HHVL 4ELKB 2IAAC 1ZLDA 3TBSA 1DBMH 2SEBA 3O3AB 2AERT 4MQXD 2YO3A 4LNVA 5CFAA 1LO3H 4HD9A 1ZD6A 4RDBA 5E6ID 3UBXA 4A2EA 1BQSA 4YDKL 2DJ4A 2JJTC 1M57B 2DI7A 3IXTB 4JM2A 4ZMXA 2OMZB 5BO0D 2Z91B 4GSQA 2TAAA 4U1NB 2OPCA 5I5IA 2V4LA 3I3DA 3KGUA 5PAZA 5DMIL 4DH2A 1MJUL 4HWEL 1VHPA 3ZKNC 2HMID 1QPKA 3JUYA 3MV8A 4UNVA 3IB4A 3S36H 3MRBA 4Q56A 1F4XH 3VFVA 1WCQA 1MCHA 4N87A 1GZQB 2F53E 5I1AA 1KBPA 5MENA 3CFBA 5EOTA 5HI3C 3QWOA 1KGYE 4Y19D 1M05A 1CGVA 1ZGLM 1WD8A 2WQ8A 2F58H 5DZJA 2PN5A 4J1UA 7FABL 4XMKL 1HE7A 2BFVH 3L3KA 3PGDA 4KRPB 3TBVB 5BW7C 1HEJC 4KWUA 1TVHA 4JPVH 4C59B 1XCQA 1G7HB 1CD1B 2DM7A 32C2A 3T3PE 4HJEA 4OZHE 4PJHF 4HIIB 4B9KC 3HB3B 2AITA 4F1ZA 1XF4A 3GLAA 4N90E 5GS3A 3WIHH 4FLSA 1X5FA 3FUDA 3O9WD 4IU2B 3T4AA 1CO1A 1Y1UA 1FIGL 3WHE1 1MFAH 1ROWA 4DP8X 2X42A 4XBMA 1IFGA 2JI1A 4PUBH 4Y1AD 5D1QB 3VQ2C 2OK0L 1H5BA 3MLTA 1D3CA 2L8AA 1IGYA 3GXUB 9PCYA 4GAJH 1MFCH 4PJDF 4JO2H 5I17A 4HUWA 2UUDK 3DJTA 1FH2A 5HHME 3ZE1B 1QSFD 3GQFA 2QLVB 4Y5YB 2P24A 1J9CT 3GSNH 4BCXA 1L5GA 4JO8A 5F1OB 3F12A 5IOPB 1S7XA 4QXGL 5TE4L 3TEWA 5A3IC 3ZYOA 2R1WA 1NWOA 5I2IA 4UYQA 4PH8A 5TJWK 3W0WD 5BQDA 5D2LF 4NM4H 1RSYA 5B3JF 3FDWA 3QUXC 3D85A 3ROOA 1A22B 1BMWA 2JCCF 2Z92A 2CCVA 2AXFA 2F7OA 4N22A 2NYYC 3NZSA 3ULUL 2IAND 1SOQA 2HG0A 4I8DA 3X1GA 5F1KC 1CE6A 1Y1DA 3V7MA 1MI5B 5DRZA 2PPCA 1AHWC 3QORC 2QZ5A 4Y5XA 5BZWA 3TASA 2W5PA 5D7IE 1V10A 3STBA 4PB0L 2CD0A 3H1ZA 1NFKA 1RZJC 3O41B 5EC1A 3ARVA 3I50L 2MCAA 4BUHA 2JLPA 5TQ0L 4N0UA 2ZOKB 1KCUL 4FZ8L 5JOEA 4H26B 5C0AB 2DTMH 3GSOB 3E80A 2NY4C 3QXAA 3KH4A 4X4ME 2GJRA 5CD3A 3VXUA 2YUVA 4YHOH 2ADIB 2O4EA 3DYOA 3FH7A 1LEGB 3KPTA 4BHUA 5T1LB 2GJZB 4B9CA 4Y8AA 4CGUB 1GZPA 3O6FD 4AYGA 1TQBB 2DAVA 2VDKH 2W9EH 4QF1A 2DI8A 4EUPB 5B1AB 4S10A 3JWNH 3IDNB 3V4UL 3B3IA 5AKTA 5AD0B 1U6AL 2ICCA 4QOKB 2NNXA 4NGHL 1H3PH 4MB5A 4UTCA 4QRQA 4UZSA 5GGSY 3UH8A 1QBAA 3K6DA 3VXOA 5AG8A 5FUOH 2EUZA 2BVOA 2K3HA 2A77H 2NY7H 3WXVL 1YQ2A 1EO8L 4MXQC 5SWSE 3PGFH 1AGBB 2HFFB 4WSKA 2WXLA 3JV4B 3LZNA 2K8MA 5TDPA 2BLFA 4NQCE 5D71L 2AJVH 3FONB 1U8OA 1LP9A 5E95B 2UV3A 3DTXA 4O2EA 5DVNA 3EUUA 1FDLL 1T04A 2A6IB 1E9PB 1D2OA 1WCBB 4JL2A 3SCMC 1EHKB 4PVBA 4HJGB 3CVHH 5F9OL 4W9DC 15C8H 3WLWD 2FYYA 2EH8L 1U3ZA 4FQIL 4GMSH 4HW6A 1QSZA 2NTSP 3DVGA 3C9NA 5B38G 3B9AA 4GP8B 2JB5L 2J1KA 4L3ED 1NKRA 5FYKL 3SDXB 5JXEA 1U3HB 3ESMA 3D07A 4MNGA 2VLRE 4A7GA 1HX0A 2FNBA 4GKZB 5L0QC 1CFSB 3CPUA 2VDPH 4JKNA 4B53A 2ZSVB 2HKHL 4FFZL 2XWTB 2H6UA 2X40A 1TJXA 1NFDB 4NBZB 4KZEL 3EYQD 4DOHE 4FNSA 4OLYH 1FVEA 2XT1B 4FQXB 2VM3A 5AVQB 1TKWA 3R7QA 3S36X 4OGQC 5L4FA 2V7HB 4K3DH 3TN0A 5J12C 4HIJA 1KENL 1CTMA 1KLFB 3ES6B 1GAFH 5DD1L 3AACA 3RURA 5A2JH 3D3VD 3EKCA 5DUBB 1SBBA 1HKFA 3HE7A 3EYSL 3JZYA 5E1GA 2YD3A 3S5LG 1NC4B 3ETTA 3C5SA 3BAYA 3UTPD 4JDZB 4ELMA 5DJ8A 4TQPA 1FL6B 3WFBH 4GSDL 1KWGA 3FO1A 2GUOB 1R3JA 5CZXD 2J73A 1QSVA 3MLXL 3OF6A 4M7LL 4QXVA 1GCFA 1U8MA 3KPSE 3UTTB 2Z65C 5LDSA 4WZ9A 1ZT7B 3QUMH 1I1YB 2YAOA 4G80B 4KNSA 1MWAL 2VUOA 4UANA 3UG5A 3VGHA 4IRZA 2PP8A 2VDQL 4K2UL 4JFPA 1HEHC 4YL4A 5HPOA 3QG7L 2J1ZA 3LHPL 3MACL 3NFPB 2JXMB 3EOAA 3GSUB 2VZUA 3HRPA 2WMPA 4XCFL 5HJGA 2NX5A 1U91A 3KR3H 1VGKB 2I9TA 4OGXL 1ED3A 4U3HA 1DEDA 4X6EB 3TXAA 4B9ZA 4D0DB 4I85A 3H54A 1O7VA 4NQDB 4LOUD 3NZUA 4KKZA 5KVMC 1IGJB 1UT2A 5J6HA 1WEJL 5A2LH 5F97E 1KEMH 4EF3A 1TTRA 2W0PA 2XQBH 4PG2A 2XQYG 5IESL 5IF0A 2NRDA 1E9QB 1CZ8H 3T1FA 3VWKB 5D1XC 2I69A 3GJEB 4YBHA 1J9QA 3HE6C 4FFYA 2VRKA 4GQ9H 3MBEA 3ULSB 3V6OA 5GS0H 2OS7A 3CQPA 5DQ9B 3WAJA 5KS9F 5KJRL 5EIIB 4J12A 1OTTD 1E9OA 1QFPA 3BUYA 4O02L 3LPPA 4FKEA 3ARFA 3KWVA 2HLFC 2Q7AA 4LNRB 3KLAB 4E42A 2X4OA 1PS3A 5LBGA 2NY1C 2VDMH 3M8OH 2YZ1A 2D7NA 3IN0A 4CC1A 2AV7B 3ALXA 2R39A 1I1RA 2CHXA 3UDWC 1VFAB 5EDSA 1HK6A 1U8KA 1SFHA 2OXHB 5GRZA 2E7LC 4E9XA 4ZW3A 5IBTL 1FH5H 5EU6A 2D03L 3WEXA 3AT9A 2RCSL 3TTYA 4XCCL 1KELL 2E3VA 3PABB 2AKRA 2E6PA 3AREA 4WUUB 1KTJA 4QPEA 1XF1A 3ARGC 5BOPA 1Q0XH 1F8TH 1SYVA 2XZAL 4L3CB 3SPVA 3IF1B 4WNSA 2NQ3A 3E6HA 1F3JA 1VZGA 1JXFA 5HHOA 5D7HA 4OSUL 3RB7A 1PD1A 2YK1L 3NFSH 2NUTA 1HL5A 3ZDXB 3IMTA 3L5WA 3ESPA 3S34L 2CJTA 5CCJA 4Z78A 1T4KA 1LYQA 1TQCC 4ZAKB 2Z0BA 2N4IA 4X7CC 3MV7A 5EN2A 3HHMA 4MKMA 4FG6C 4YBLB 3RVVC 4EXKA 1TO4A 3O11A 3PXJA 4NSKB 5MEND 5CILL 1HZHH 3CDFA 4BINA 5JHAA 4L4VE 4OJEH 4P59H 2XYCA 3IFPA 5L8KB 4Q9RH 1WHOA 3IFOA 4Z76B 2VDOH 3GLZA 1V7ML 5F89B 1E3XA 5F21B 5I74B 3WFDL 4HKXB 3HHSA 5E5MA 4V1DE 5HY9A 4U4IA 43CAA 3QZBA 4QJ5B 4UDUA 3RZCD 3REWB 3VH8B 2EE2A 5DHXB 2Z31B 4CN6A 4DESA 5E08H 3UPAA 4JHBA 3S5LA 1OV8A 3UROR 3F83A 3LKOA 1FL5A 4K8RC 2FECL 2OJ1A 5ALBL 1EH9A 3RRQA 4XPBH 2P5ED 1E8ZA 2MQCA 1QLEH 3F7VB 1IZKA 2QKIC 3CN0A 1HQ4B 4JFEA 4WW2A 1N6UA 2OMTA 3ABZA 3TURA 3O8XA 4QOKE 2H41A 5DJYB 4GRLB 4OJDH 1TLKA 3FK3A 3CXDL 2W38A 1BSIA 4L8BA 4P2OB 2ESVB 4C4UA 4HS3A 2DKSA 3RZWA 1ITBB 1MAKA 3O4OC 3UP1A 3QSKB 1QO3A 2UWEF 2XRAL 4AMXA 2Z93A 1E67A 3VFMB 4Y5VB 5MEQB 4MJHA 5CD5C 5F88A 2WUCH 2FR4A 2A6JA 4M8RA 3B43A 3T2NH 4ODWA 2VTFA 4BSWB 1I1AD 4F7CB 4GSUA 4PRPB 2HT2D 3AW5A 2FCBA 4FF9A 2PR9A 4UT6H 2IH1B 4E9TA 4U1JA 2P8MA 3QEUB 5SWZA 3ARDD 4PCSA 4UAHA 1GYCA 2AK4A 4XO8A 3L4TA 2VLME 2QQNH 2QADC 4YDVA 4E2OA 2JIXB 2XQYA 2D31B 2PW2A 4GUPA 3L6FA 3B7SA 3RUGF 3AT8A 1W72L 4YZFF 1THAA 2FLMA 4J8RB 1BQRA 4OF5A 3P30L 3UC2A 1AP2A 4GW4B 3E1ZA 5CEZD 3I3BA 4EN3C 5T3XD 3SDXE 3QDHA 3S35H 4OCWH 1Q0YH 1UASA 1FFPA 2W9DL 3LRMA 4Z7QF 3U36B 4PI0A 2ZX6A 2DD8H 4B9IA 3BE1L 4ORGB 5I6KA 1T66C 2YRLA 1NCDL 3COOA 4HF5L 1YNTA 3VI4E 4TPRL 3KLSA 3BPLC 4EO5A 1NCTA 1ASOA 4PB9L 1Q1JL 3MJ8A 5I30H 5J0BA 1NFDE 2BZ7A 4X6CF 5A2BA 1YEIH 1NCWL 5BV7C 4DFHA 3FU8A 5DMYA 2AHIA 4CU8A 5SWQA 1JZHA 2J6EH 1YN7B 2ZAGA 3DI3B 3K1KC 2YS4A 4Y4KA 5I8KL 4Y2DC 3EJRA 4PREB 4LCIH 2EVHA 2JJWA 5J56B 3CC1A 3M17B 3QQDA 4DVBA 2OJEA 4OZIF 1CCZA 2FO8A 4L8SC 1HHIB 1K6QH 1N59B 1R3KB 2MRYA 3MODL 4TF4A 5DJDA 3VYPA 4F7TB 3WSQH 2GI7A 2J1XA 3BT0A 2G3NA 4J2QA 2R2HB 2DBLL 4IRJA 3T8XB 3BHBA 2C34A 1NH6A 2DQDL 4UOW0 1NQBA 2Y2TA 4ABUA 4MDIA 4G1EA 5DFAA 4WV1A 2EJ1A 1A8JH 1SF3A 2JKRM 2QHRL 4G9DA 3V5HA 4K9EH 1BM3H 2IWFA 1QTSA 4WTWA 1VFBB 1ET5A 2EABA 2G0KA 2V8MA 4QXUL 4MJ2A 3ROLA 2VLJD 2EADA 1WAAF 3QXDA 4U1KA 4ZQKA 5J9PB 2HCZX 1Y6MR 5GSRB 3IPEA 3MRIA 1QATA 3PJLA 5CR1A 3U4EA 3NTCH 4NQDE 2IMMA 3PP4H 3QUXB 4TQIA 1SHSA 5IVNA 3OSVA 3IGUA 3ML9A 1G0YR 1JPFB 1IGTA 2BJMH 4GXUM 3PY9A 2X4RA 2YPVH 5E9NA 3CQFA 3CIAA 1S8DB 3CSYB 5DEGB 4CVZB 3QORB 2QELA 2XY1A 1LO3L 3ATDA 1II4E 3AS3A 5HHMD 1DFBH 3APNA 2VL5B 1KB3A 4PRHA 4XPHH 1CQYA 4H7VA 4MJIB 2R8SH 3ARZA 1RULH 2OULB 3WAKA 3BP6A 4I3SH 3DETC 3U4KA 1P9MA 3BGMB 3NN8A 4H5SB 3S36L 1F4XL 2L04A 2N1KA 3NEOA 4OD1H 1KDJA 3RQ3A 5ACZB 5FYJH 2NY4B 2Y07H 2Y5EA 3BXNB 4OU3A 5D1ZC 4KROD 5C70A 3K6IA 2CXKA 4HHAB 4YHYC 3HE7D 4WUUE 3IDJB 4KXZH 2ZOTA 2E7BA 4NQVA 3NDZE 1HN1A 2C1OA 2BFVL 4RAVB 3MV9B 2V2WA 4Q2ZB 2CDFA 3BH9A 4JPVL 4TV3A 4APXB 1NGXA 3FMGH 5TD4A 3SE3C 3T09A 3G04A 1W0VA 4M4RA 3ZDXE 2FEDC 4PTTA 2AXGA 1X4YA 5CLTA 3V4VA 4AIOA 3WIHL 2XN1A 5IQOA 4ENEC 1X7TA 2HFTA 3V0VB 4ETYA 1MFAL 4LAQH 4S0HA 3KL3A 2ED6A 5DO2C 3D25B 4PUBL 5GGQH 3VXMD 1FNSH 4NJAH 2NX5D 4GAJL 1MFCL 4JO2L 1ZSHA 4A2DA 4XN5A 5FA3B 3B5GA 5I66A 4WU5A 1R3IH 1K8DA 3GSNL 4UF7C 4I4WA 3ILPB 3V6FA 4LLDA 3BAEH 4QKTA 1NCGA 1ZCRA 4PWIA 5KYUA 3SCMB 3MROB 1AO7A 2VERN 4MJ6B 3U48A 2RBLA 3IU3B 4NM4L 3J8F7 2WBXA 1IO4C 3OKEA 1FFOB 2W07B 2C3WA 3OKLB 1HCYA 4Z7NF 3V2AR 4OLVH 3PV7A 4MWFB 3KYAA 4FXTA 5IJVA 2PO6D 3IJSB 3D12B 4AYFB 3MLSL 1PZ3A 4XBGA 2VE6B 5C0GA 1Z9OA 4G8EA 1A4KB 4MBOA 4PJBF 2GIXA 2NYKA 1OB1B 2C7FA 4JDTH 4PLKC 3VU1A 2ESVE 1NIEA 4NQCD 1PKOA 3SGDH 5L0QB 3AGWA 4MCYA 4OJFH 3BRFA 3D7PA 1BGXH 3S35X 1YNKH 1G9NH 3RGBA 2PXYD 2WM0A 1DTUA 1TQVA 4F2MB 4G7YH 1I3RA 2Y6SD 3VFWB 3MMEA 4E36A 4Z3GA 1IAOB 2QHLA 3DK2A 5EF1A 1SEQH 3RPBA 3UJTH 2XWBB 1WO2A 2IC2A 4YR6B 1HNGA 2WZ6A 1BIIA 4PP1C 1E27A 1YQVH 1HIMH 1BFOA 3IDMB 5J12B 4JKWA 1X44A 2VZVA 4KDWA 4KO7A 3L3IA 1K2DB 3RU8H 4YHOL 5EPMA 4D0BA 4L1LA 1TYEB 4PJAB 3LSOA 5FHAH 4PGBB 3I6LD 2D3NA 3I6KB 4NP4H 2BIIA 4F8NA 2CGZA 2CMRH 2VXQA 1KGXA 4HMEA 1TSRA 1X9UA 1QKZH 3GBNH 3WEMA 3T8VA 2W9EL 2VDKL 1ZLSH 1KEGH 5JXAH 4JR9H 3FU6A 2ZOUA 3UBXI 2CO7B 3A24A 3MV7D 1H3PL 4HJ0C 1J8RA 2DWXA 2FSDA 4Y4FA 4KNUA 3B9KD 3L7EB 4G8AC 5FUOL 4UV7H 2A77L 2NY7L 3X3FH 1VSCA 4F92B 4RMTA 1S7UB 1S7SA