3DKHA

L559a mutant of melanocarpus albomyces laccase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
558
structure length
558
Chain Sequence
PTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title Essential role of the C-terminus in Melanocarpus albomyces laccase for enzyme production, catalytic properties and structure
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 170
structure length 558
sequence length 558
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3dkhA03
2H5UA 3JTBA 1CYWA 4KO9A 2EIKB 4E9XA 1AZCA 2YAEA 2YAPA 3RYMA 6PAZA 4K9JA 1TEFA 1BEXA 2RACA 1AAJA 3IE9A 1GS8A 4MFHA 1IBYA 2CCWA 4PCYA 2IDFA 3X1BA 1NICA 2N0MA 2JKWA 7PAZA 1FA4A 2HZHA 1L9PA 5I26A 1HFUA 2BP0A 2VW7A 2YAOA 4RH4A 2FQEA 2E86A 4ZK8A 1I53A 2TSBA 2WO3B 3X2QB 5I6LA 2GC4C 2PP7A 3NJJA 1F56A 2DV6A 3TBBA 3V9EA 7PCYA 1JVLA 2BZCA 3FU7B 4YSPA 5ANHA 3PXLA 1JZIA 4YVNA 1A4AA 2DY2A 2J56A 4G71B 4WKXA 1JZHA 2B3IA 5D4HA 3U25A 3WG7B 3CDZB 1IBZA 2HLEB 3OQRA 3EH5B 2TSAA 1PNDA 1AS8A 1V10A 4E9VA 2YAFA 1JXDA 1XB3A 3C75A 1J9TA 4DP6X 4FAAB 4QLWA 1NPJA 1OV8A 4CSPA 1T5KA 3X1EA 3JT2A 3ERXA 1V54B 2GIMA 2OJ1A 3KW8A 2VW6A 3T6ZA 4YSDA 4M4RB 1L9TA 2CUAA 4EF3A 2LLNA 4HCGA 4HZ1A 3GDCA 3SBPA 5IY5B 1L9SA 3IBOA 5TK2A 4Q8BA 3FS9A 1ZIBA 2VMJA 3FQYA 2Y69B 4L0PB 1TEGA 4YSCA 5I5MA 5A7EA 2WSDA 1DZ0A 2AZAA 4A68A 2DYSB 3BQVA 1JZFA 4A67A 2OV0A 1BXVA 2GBAA 1AS6A 4HIPA 2QPDB 1SHWA 3BVDB 2BZ7A 4GP4B 2HX7A 1KGYE 1QNIA 3OM3B 3SBQA 1PLBA 2JFCA 4E9TA 3X1FA 5LDUA 1HAWA 1SJMA 2IDTA 2PLTA 1IUZA 1SFHA 4X4KA 1ID2A 1AS7A 3PAUA 1WA1X 1BYPA 3QPKA 3AG1B 4ENZA 1BQ5A 3EH4B 5I6KA 2XV3A 3NP4A 5AKRA 2R7EA 1JOIA 4W1TA 2J57A 1VLXA 2XXFA 2FQDA 2XV0A 3AW5A 4E9SA 2EIJB 2YXWA 3FYEB 1YLBB 1PLCA 3NJLA 2UX6A 2IDQA 2DWSA 3ABMB 3CVCA 1JZGA 1RZQA 3UABA 2UXVA 1ZPUA 3FU9A 3NJMA 2GHZA 2QPEB 4BXSV 1JXGA 2FT8A 2XU9A 1BQRA 1PNCA 1JXFA 1IKOP 4KNUA 2VSKB 1KCBA 4HALA 2FT6A 4FA7B 3PAZA 5B1JC 3N55A 3S3CB 3ZDWA 3G5WA 3NSCA 1V55B 1AG6A 4WTQA 8PAZA 1JZEA 4A2FA 1AR1B 3AZUA 2ZONA 2Q9OA 4UF7C 5B7FA 2PCFA 3NSYA 3TA4D 1GY1A 5B1BB 3T6XA 2IH8A 3X1GA 1ZDSA 2PPEA 3NJFA 4A2HA 1NIBA 1IC0A 1M56B 1BQKA 1ZV2A 1SF3A 2BW5A 1TKWA 2EINB 2MRYA 3FQ1A 2QDVA 1EHKB 1SF5A 3EHBB 2BWIA 5FC9A 5I28A 4KNSA 3AG3B 1W8EA 4GP8B 1BXAA 5I6NA 3QJUB 1PCSA 4KO7A 4F2FA 1NWPA 1GYCA 4DPBX 3NP3A 3IN0A 2HX9A 1DYZA 2IDUA 2J55A 3NT0A 4DPAX 4A2EA 4KO5A 1URIA 2H3XC 4HCFA 2HRHA 4HHGA 2BP8B 1QHQA 1FFTB 1SDDA 4DP2X 1XMEB 3NJNA 4YSSA 1X9RA 5I5IA 1L9RA 1A3ZA 3KW7A 4KO6A 2JXMA 2BHFA 4KOBA 2BWDA 3WKQA 4BWUA 4AKQA 1M9WA 4YSRA 2FT7A 3FQ2A 3DKHA 4G7QB 4E9WA 4NB7A 1OCZB 1BYOA 1JZJA 1OE3A 4NAJA 4YVUA 5I6PA 3DTUB 1BAWA 1A8ZA 1PMYA 3CVBA 3FPXA 3GXUB 4YSEA 1WA2X 3FU8A 2IH9A 3NSDA 1PY0A 1PZAA 3IN2A 1WA0X 3NJHA 3OMAB 4F7KA 3T71A 2XLLA 3DIVA 1KV7A 3OD3A 1RZPA 4N4YB 3FSZA 2HXAA 2VSMB 3ZIYA 1AZRA 1EZLA 3NJKA 5AFAA 1NIAA 2YXVA 2UXTA 1WS8A 2BP0B 2YAQA 1GSKA 3H56A 4BDVA 1FWXA 3HB3B 3S3BB 4BWWA 1GS6X 3PLYA 1L9QA 2PPCA 2ZXWB 4JKNA 1PZCA 2BO0A 1SHXA 2IWFA 3QJVB 1L9OA 2VM4A 2GI0A 2IDSA 1OCCB 2CALA 1AACA 5D4JA 4P5RA 1E5YA 1CC3A 1NIDA 2UX7A 1UATA 3SQRA 5B1AB 4DP9X 9PCYA 1N68A 3CZUB 1AQ8A 2CBPA 2FQGA 2AZUA 2XYBA 1AANA 1KBVA 2P80D 5E9NA 3WKPA 1N70A 2XWZA 5I5JA 4F2EA 3NYKA 1E67A 3D12B 4G7SB 1MZZA 1XB8A 3ABKB 1ASQA 1AIZA 6PCYA 4AKOA 1PAZA 3FT0A 4KNTA 4NERA 1AZNA 3GYRA 3TBCA 1QLEB 4E9QA 3AG4B 3QJRB 1ILUA 3FSWA 3S8GB 4E9YA 2PCYA 2X87A 1RKRA 2YAMA 4Q89A 2IWKA 2B08A 3PCYA 3FU7A 3ZX1A 3V9CA 1PF3A 1AZUA 4G70B 3HEIB 2EILB 2A3TA 3H4HA 1W6WA 3NJIA 3CDZA 1MZYA 4BK5C 2R7EB 1B3IA 5B3SB 3WI9A 3ASOB 3WNJA 4G72B 2IAAC 1ET5A 1NIEA 2PP9A 3S3DB 1RCYA 3ABGA 4AI7A 1ADWA 2X88A 4GY4A 4YSAA 2HX8A 2CJ3A 2PPFA 2QT6A 2UXFA 3UACA 2FQFA 1E5ZA 2QDWA 5D4IA 4QKTA 3ZBMA 1PLAA 3ASNB 2GSMB 1W6LA 1GW0A 1ASOA 1CYXA 3UADA 5B7EA 5PCYA 4BWTA 2XV2A 1NINA 2PPAA 4GP5B 1KCWA 3IEAA 4N8UA 4AX3A 4DP1X 1OE2A 1OCRB 3AG2B 2W8CA 5B7MA 3PPSA 1CURA 1MDAA 1XB6A 3MX0B 2VM3A 2Q5BA 4YL4A 1NIFA 2AFNA 2XXGA 2YARA 5PAZA 1MG2C 1NWOA 1AZBA 2XX0A 3T9WA 1NZRA 3CG8A 2FNWA 1A65A 1JVOA 2GC7C 1HAUA 3T6VA 1J5CA 4YSTA 3TU6A 1GS7A 5TK4A 4BXVA 2XVBA 1A4BA 1OE1A 4GXFA 4GYBA 1NDTA 4AZUA 3QJSB 1AG0A 4DP7X 3FYIB 4DP8X 3FPYA 4HCIA 4A2GA 4DPCX 2Y1AA 1SNRA 4W9ZA 1GY2A 1KBWA 1E30A 3CVDA 1GR7A 3NJGA 5I6OA 2IWEA 3AY2A 1JERA 4DP5X 2H47C 2FTAA 2ZWNA 3EF4A 4UANA 4A66A 5F7BA 3OMNB 2J5WA 1NTDA 3EH3B 3UGEA 1OF0A 1OCOB 1E65A 1OOWA 3WNIA 1SDDB 3FSVA 1SFDA 2FWLB 1ET7A 2AVFA 2P80A 4TXVB 3QJQB 5B1JA 3WIAA 2FJSA 5F7AA 2EIMB 2YAHA 3ABLB 1X9UA 4JHUA 3N2JA 4M3HA 4YSOA 3QQXA 2XUWA 2I7SA 2AANA 4DP0X 1ASPA 4KOCA 1PZBA 4A2DA 3SBRA 2HRGA 2ZOOA 2UXGA 2YQBA 1J9RA 1J9SA 2GB2A 4G7RB 5AZUA 4HAKA 1KYAA 2OCCB 2WO2B 1BXUA 2PPDA 2PP8A 4JHVA 1M57B 1J5DA 3X1NA 3TASA 1ZDQA 1J9QA 2XX1A 1CUOA 3T6WA 2VN3A 4PAZA 1KDJA 4YSQA 2MTAA 2I85A 2W88A 4BDVB 5B1KA 1NPNA 4HHWA 4E9RA 3FSAA 1ETJA 3S8FB 5I6MA 1MG3C 1ET8A 1TU2A 2BP8A 4UAHA 1AOZA 2DYRB 1A4CA 4YSUA 4DP4X 2I7OA 2DWTA 4P5SA 3UAEA 3OMIB 3QJTB 3L45A 1WAEA 2VW4A 1R1CA 2CAKA 3PAVA 3MBWB 1ZIAA 3NSFA 4CSZA 2BW4A 3H4FA 5EHFA 3UAAA 1KDIA 1WS7A 2NRDA 1ILSA 4AKPA
chains in the Genus database with same CATH superfamily
1IBGL 1CFTB 1UA6H 3AUVA 5DD5H 5F7UA 4N1CA 4MWFB 5JYMA 4LSPL 1UD8A 2VNCA 4DZBA 4OV6F 4FHBD 4PJAB 4L1SA 3R8BB 1C5BH 3CFMA 2KDYA 4MCZA 4JO4H 1IBYA 2CCWA 3Q8BA 2OL3L 4OF8A 5FYLH 1T0NA 1E8XA 1W72A 3UTZB 1SXZA 4I0KA 4AOFA 1NICA 2N0MA 4A7VA 4RRPM 1TUPA 1JHTB 2NX5A 3NPSC 4L8DA 3PDOB 2G60L 2BRQA 3IKKA 3WXWH 4H26B 6CGTA 1ADQL 1C5DA 4PRPA 4Q6KA 3RVVC 1PZ3A 4AG4H 4B9CA 1YNKH 3D18B 3TBVB 1XO8A 4AQ8C 2XVGA 4X0KB 4KKNA 2WC7A 2CO6B 4X98A 1GVIA 1BLNB 3E38A 3IRPX 3CDZB 5I76B 2EKSA 3DA0A 1MJJA 4YHIA 5JW5A 2AJYH 3K91A 2NT1A 2OS7A 4N2KA 1LWJA 5AW7B 1XIWA 5FOBA 3QDMA 3ZE2B 2XPZA 4E9VA 1MIEH 1WICA 5IB3A 1U42A 5F9JB 4Z7WF 2XKUA 1JN6A 3JWDH 1NPJA 1OV8A 4G1MB 1XGQB 3CLFL 4R96B 1AXIB 1F3DH 4XN9A 2VW6A 2OSXA 5ALCH 3CXHK 3WIFA 1XTMA 4WSJA 2OR9H 4XNUL 5JOFA 3GO1H 4C83A 2N1TE 4HCGA 2XJKA 1KY6A 1U30A 2AXJA 1UFUA 3OZ9H 3KLDA 1DLFL 4NHCH 4PJBE 1I8LA 1KEML 2RJMA 2XWJA 3MLTB 1U4EA 3MCLH 4X5WB 4DIXA 1BF2A 4Z7VA 1UQSA 4NRXA 3ZRFC 4JVUA 5DEZA 5I1AA 2J1XA 2BZDA 1MCIA 4A67A 3FW6A 2D2CC 5KG9A 5DJ6B 3GFUA 3WE6B 4KVNH 3PS6A 2VDRH 1ZLEA 2WXGA 4KXDA 4D0CB 4TOYH 2ALWA 3L7EB 3D4CA 3ZOAA 4XOAA 2PTVA 1NCHA 1SJMA 4FNPA 3LJ3A 2HKHH 5C86A 1M2VA 5SX4H 1O75A 5CGMA 1NAKL 3X3FH 1GGIH 1T80A 4ZODA 5EZIH 2WNGA 3AG1B 1BQ5A 3QAQA 4JANA 1XTLA 4JKWA 1S4IA 5SWSA 1PZUB 5BRPA 1WWWX 2WKLA 4C56E 3NCYS 1XIWC 3SHSA 5FECA 4J3VA 4Y5XB 4YE4L 3T4YA 1ZA3B 4WK2B 3W57A 1H3XA 3ZGHA 2OR8A 1ML0A 1MRDH 2YXWA 5AOZA 3RZCB 1J0YA 4DGYH 5F71A 3WFDH 1GHFL 4M8QB 3D3VE 5DK2B 3PG2A 3IT8D 2YEZA 2VTFA 2VOTA 3GZOA 4WI7A 5KS9B 2R1YB 1EEQA 3M1OA 4HFWA 4M62H 3VD7A 1N19A 2YMOA 1MW2A 2DQHL 4TUJA 3MLVL 2YSSB 2J20A 3HI1B 1FO0A 1GC1C 4LSUL 1G6RH 4OF7A 5F88B 3RVWC 4RAVA 1GYUA 5FGCB 4I1PA 3R06A 1CZ8L 1HCVA 4HC1L 4B97A 4R97C 3V10A 4HUMB 4EN3C 3IWUA 3O6KL 4GI9A 3CC5A 5JQ6H 1AG6A 5FA3A 3K81A 3SYQA 1JHKL 4FQIH 8PAZA 1RPKA 1GZQA 4ZO7A 3AB0C 4X8JB 1ODUA 5ADPL 1F90L 4MJIE 4AWJC 1TVBB 2XTJB 1KPRA 4L4TA 3CUPA 2EINB 4RZCB 3V5DA 1IO4C 4XAWL 1SVCP 3U83A 1MW0A 1M4KA 1T7YA 4F27A 4BKTC 3LS5L 1JNHB 4E68A 5TQ2L 4AXWB 2GY7B 3MV9A 3T0EB 4BRVA 5I1LB 2WIIB 4JZOA 4GUCA 1F1GA 3CFEB 1OZUA 1PCSA 2XZCH 4YHOH 3W11D 4L37B 2DBJA 5INDA 4JO1H 3MCKB 4DGIH 2N7SA 5KTEL 4WY7H 4LOVA 5C70A 3O2VL 4ZD3L 1DVYA 1DYZA 2Y36H 2XXCB 3FOLA 5KYUA 1TU2B 4JEGB 1DSWA 3SY0A 1U58A 3MLZH 3OHXC 3FKUS 3V4VA 1NBZB 4NENA 2YFOA 4NDMA 4X7SL 2KLTA 4XHQA 4DKDC 1DBKL 3WIIH 4FZEL 5FYKD 1FVEB 4NO0B 4AJWA 5CINL 4OW6A 4YGAB 3ZUCA 5D2LA 3MJ8B 4PJ8D 3LV3B 4I13B 3PRZA 4XTRD 3KMDA 1MJUH 3TA3A 3DX4A 2WWMC 1EEZA 1I1YB 1UENA 1UXWB 4IU2B 1YPZF 5T3XE 2IF7A 4K7FB 1JZJA 4LCCC 1KYOJ 2O61A 4H0LC 4XH2A 2NZ9C 1V7ML 1A7PL 3OX8A 3N9GL 3N6YA 3MKGA 3RWJB 5IWLC 1GGBH 1F86A 2GJZB 4X6CE 3MTXA 1QBLL 2DZEA 2NYZA 5HGGS 3EFFA 3FB7B 2GUOA 1N10A 4FQXA 4P2RA 4X50A 4XXWA 3APMA 3FSZA 5DLML 4JN1L 2V3EA 4WW2B 2ESVB 1P4IL 4P3WA 1GKOA 1WS8A 2F8OA 1ZHKA 2YMXL 1U3HB 1WAAA 2H2PD 5DMIL 4TS6A 1FWXA 4M1CC 1IQWH 2WUCL 1A6WL 5IMOA 3BYYA 3PLYA 3DIFA 3RIAF 2WXPA 1SHXA 2YLHA 1G9ML 1L9OA 1K5WA 3O8XB 4RWYL 2C7UB 3DGCR 2Q7NA 4JO2L 3U0WH 2FSEA 3CFTA 1PZ5A 3MRIB 1IGTB 1T4WA 2CO1A 3GI9L 1NIDA 4WZ9A 5CJXC 1FL6A 2UX7A 2XHNA 4MNHA 5IBTL 4ABWA 3PWPA 1NLBL 5JDSA 3TYFA 3PJNA 35C8L 3T3MF 2GW5A 3HS8A 4YDNA 2V0AA 1I9IH 1JGDA 1IEAB 2JI3A 4X6FB 5EZPA 4YXHL 3TA3C 4DK5A 4TQHA 1GJIA 4IBLT 1P5UA 5E9NA 2C1PA 2NCEA 2V3DA 1E4WL 1YY8B 4GKNB 3QJFA 2Y22A 4KI1A 4JBSA 4GO8A 1SOXA 5EBWB 4FMFA 1ORQA 4LNRA 1TIUA 4NUJB 5FGRA 5I23A 1P4LB 1XB8A 1ZK5A 1ETA1 5E94A 3RLSA 3K8MA 4N87A 3UCRA 3VE0B 5T33L 3ZE1F 2VITA 3P4NA 4QOKA 3VRIA 3QJOA 5IHWA 4GW1A 1ED3A 5DTFA 4KDTC 1XXFC 4GSQA 3WMPA 4QWWC 4RETB 5IB5A 5IFJA 4HWZB 3EFDH 5EU3B 2OPCA 4ZZFA 5KJRL 5JQHC 4Y1TA 4NP4L 2H26A 4F58L 4XVSH 3TT1H 3O3DB 4MNGA 1FGNL 5BXFB 4MAUL 3V9CA 1PF3A 2WM0A 4G70B 2Z7ZA 3QUKA 3KYKH 3ALXA 4NQEB 4I85A 3ZTCC 2ZG3A 1B3IA 5C0AE 4M5ZL 3FCBA 1ETZA 2CLRB 1EA9C 1ZTMA 4R7NA 1J18A 4BD4A 2EC9U 2A2QT 1UZ6F 2X1XR 4AI7A 2DQGH 3FU6A 4HGKC 4NQCE 1VFUA 1DBMH 3QCTL 1QI4A 3UBXI 3V0VA 1E5ZA 3QNXA 3H2PA 4ZYKB 1L0QA 2VLRA 3PDDA 3N1MC 5ALBL 5C09E 5C0EA 1KTLA 2BHUA 3D85A 3M17B 1FJ1B 4P4RA 1FL3A 4OSUH 3VRJB 2G5RA 4N8VB 5DA4A 2Z0BA 2C3HA 2OL3B 4UTAA 4GQZA 4KROB 4G80A 3DX2A 3L81A 3ZKNC 4XVUD 4MASA 1RIHH 3B4NA 2F5AL 2QADC 3LHPH 5F0LB 4F37F 3BWUC 4XN8A 1JZ3A 4R26H 5A3ID 1VPOL 1I9RH 1WO2A 3AU1B 5FM5O 1CURA 5CBAA 3N04A 4LDEB 4AYFB 3AADB 1MAMH 2A0LC 5EPMB 1I9JL 1PJWA 5AOIA 4GG6E 4YUEL 3SKMB 4GO6B 1UG9A 5GJSL 3GB7B 5L7XL 1J8KA 2GHWB 3BT2L 4JFQB 2CDGB 4G7VH 1E6JH 1KGIA 1ZVSA 2XN9E 3K6SB 3IJ7A 5ECGA 1OE1A 2ZNXA 3WMQA 4PRPD 4HWBA 3SPVB 3P1VA 5ACZA 2WGXA 3ZE0E 1XD0A 4QRFA 4PQXA 4QXGH 4FQHA 5HGAB 3PJSA 1GR7A 1YYMH 3GK8L 4X6DB 2JKJA 3IGAB 4BQBA 1JERA 4PGDB 4M7KH 3EOBA 1N3NB 3OMNB 2AMUA 3H9SD 2ZUSA 1EBPA 2J72A 3EH3B 1OCOB 5IVOA 2W9LA 3NEOA 4LP4A 5MENB 1ACYH 3LS4L 2NY4C 3MLWH 3WXVL 2ZUYA 2Q7YA 3RDTD 1WRFA 3BIBX 3IFLL 3KPOA 3EO1B 1DJIA 2VZ3A 3FN0H 1KJVB 4LHUB 4QRBA 5DSCA 2SEBA 4MNQD 3HAEA 4ZQKA 3DX9B 3N2JA 1DVQA 2JCWA 3ILPA 3KPSE 2F8IA 4NKQB 5BQDA 4JRXD 4OQTA 4ZMAT 2R0WL 3FU5A 2BSEA 4PTTB 5CMAA 4HOZA 4RDQF 2OMWB 1F11B 3RWGB 1IVLA 3R7QA 1A02N 3GJFB 1CT8A 4N90D 5INCB 2D03H 1LE9B 3P9MA 3VXQA 4P4KC 1VFAA 2PP8A 1LO0L 1RJCA 3FF8A 3WO4C 2OCJA 5IVZA 1MNNA 3AWEA 1JAEA 5G55A 2ADJB 3C6SB 2J25A 3HG1B 1KN2L 1ZDQA 1J9QA 5H94B 4RWHA 3BLBA 2OYMA 5F89A 1T0MB 4ES9A 1MCFA 3HRZB 4PJCA 3E3QC 5I17B 3FQTA 1AGEA 4ZS6D 1DFXA 4OAWA 2BOLA 2VDOL 2C1OB 4JO3L 3REVA 1LQSR 3LRKA 1F41A 3K2UL 3IDIA 4KTEH 3WYRA 4KV5F 1OSZB 3VWKD 1BX2B 5HI3D 3BESR 2CHWA 2ZX6A 1SEBA 4R8WH 1F1AA 4PJ6A 1WZ1L 3VI4B 3QJTB 3QUZC 1UKSA 5CCKL 3CIQA 1F5WA 2WNWA 1KY7A 3T8VA 1E28A 2GJ6E 2LV4A 3ILQD 4Q6YA 1VFMA 1T1WA 3FTZA 1OGAB 1TLMA 1VEOA 3HLKA 1AZZC 4IGBA 3TZVB 25C8H 5F7YC 1VGKA 1MELA 1JF1B 4O00A 2DLFL 1V27A 1BQHA 2H5UA 1OWRM 3K2KA 4ZFFA 4HIEB 4C57C 1CL7H 1R5VA 1ZE3C 3DV4A 2D7TH 4HXAL 1EAPB 4NIKB 1DANU 4QHPA 2FHFA 5AB2A 3OLIA 2AJZA 5I1JH 5F6IC 4UDTA 1CXFA 3NIFE 4OZ4A 3NFPA 3LMJH 2EEXA 4JK0D 1FA4A 1AGBB 5B8CC 2IC2A 1HDMA 1HFUA 1XSIA 1BVLA 5I26A 3ZR5A 2EE2A 4R4ND 3GMOB 1L0XA 2C9SA 2VRKA 1QFHA 3V9EA 2WQSA 5I18L 7PCYA 4PYGA 1HCFX 3PXLA 5GSRB 3TT3L 1C16A 4S11A 4WKXA 1JZHA 4DHLA 5HVWA 1R3HA 2V2WB 5EUOE 3QUMA 2X2UA 3B83A 3QUYA 3V4LA 1QBML 3R1GL 3PWNB 3X13A 1LHZA 1LO2H 2G30A 4H7VA 3BZEA 3C75A 4FABL 1LD9B 1Z9OA 4GB9A 2X3AA 4NRYB 4HWNA 2OJ1A 3VMOA 4NXKA 3A22A 4IGBC 4UYQA 1YEWA 2V5RA 4R3SB 4UB0L 1FV1B 3OXRB 5F1IA 5HDBF 3KGRA 1R75A 1NAMH 1OXYA 3LEYH 3IGLA 1EH9A 1AZVA 4PEEA 1N2RA 5DJ0B 3BQUC 5GXBB 5DD5L 5ICUA 5TK2A 4Q8BA 3FS9A 1XF2B 3BCFA 3H53A 2EIZA 1TEGA 1M7XA 3MYZA 2MH4A 2FJFA 4QAWA 2NXZC 5ETUA 4ODUA 2WCGA 1AC0A 1C5BL 2YD6A 1L7IL 2MKWA 1JPSH 3G6AA 2CQVA 3NRFA 1TJIL 2WLLA 4XBGA 4CC4C 1PX8A 1KFGA 1XGRB 2W65A 3OM3B 3SBQA 2RCSH 4PJ5E 2E7LA 5BJTB 3WXWL 1HAWA 4MQ7B 1U0QA 1Q0XH 5D5ME 1ANUA 3DXAD 4AG4L 1YNKL 1FIGH 2QVFB 2D31A 1X5HA 4ELKA 5JORA 4PJBA 4AVKA 1AJ7L 2C4XA 3CWGA 3E8UL 1KGCE 4TSCL 1X5MA 1FP5A 2KPNA 5E1QA 4FQLL 3SKNB 3MRLB 3V9FA 1ZE3H 3QUYC 3CFKA 3CPLA 1MY5A 1Y6NR 2IOOA 4OIBA 1MFUA 3VG0H 1MIEL 2FQDA 3AJ7A 2Y3AA 3LIUA 3HPLB 3MR9A 2EIJB 3JWDL 5HI4D 3DVNA 3E2HB 1HQRB 3SPGA 4N0CC 5TDOB 2X89A 1EDHA 4FYSA 5ALCL 4XVTH 5IJKC 1KIRB 1BOGA 1RZ8A 5E8OA 4AUYA 2OR9L 1R4XA 2A74B 2QPEB 4NHCL 1WIOA 2XU9A 2R0KH 4CVWA 3AITA 5EH1A 3IS1X 4C47A 4FNRA 4MJ5A 4PJFE 4YR6B 2AK4B 4LAJH 1ZANL 2YBGA 1NGXB 5C0GB 2W5PA 3WLWD 2D4DA 2BLFA 5DQ9A 3E6FA 2A9DA 2Q8BH 4A39A 4C56A 4XMPH 3BP5A 1EXGA 4LARL 5EC2B 1MCJA 4AVJA 4PRHE 3I6KB 3U6RA 4WFHD 5ISZB 2ZKHH 4KVNL 1AKJA 1IGJB 1M6OA 2VDRL 3PP3K 4TOYL 4X4ME 1J0KA 2E7LC 3QNFA 4UF7C 4DW2H 2NNFA 3D3VA 1GY1A 3BRFA 2IH8A 1UD2A 1ZHNB 4IRJA 3RUGB 1VESA 4IIQC 2BOCB 1TKWA 1G9NC 4JM4L 1RZKC 1TNNA 5GRVL 5EZIL 3BMVA 2X7LB 4M8UA 1UB5B 1GSMA 1EFXD 3QSKB 4M61A 1JPFB 1J05B 1U8LB 5CJ8A 5IFHL 1J8HD 2VH5L 4AQAA 3JTSB 1QO3B 4Z3GA 2VN7A 3BIKB 5I6NA 5DEGA 2LU7A 1HOEA 1MRDL 2VMCA 2EIDA 2F74B 5E4EB 4H1LH 3BUYB 1HILA 2HTLC 2QR0B 1RUMH 3U4AA 3D9AH 3WLBA 4DGYL 3T0BA 4LL1A 5F96H 1N12A 2ED6A 2LQRA 4MJIA 2G9HB 4PJDB 4HCFA 2DWYA 4BKLA 4PJGB 4JM0A 4LQFH 1EEYB 5CLXA 3ATEA 1XMEB 2YGVA 5TDNA 1FLTX 1S5IH 3QUXC 4NN6C 4H0IA 2Y23A 4RX4A 1HH9B 1F6AB 3T1FB 3UC2A 1G6RL 5IOPB 3D85D 4PV9A 2Q76B 1JWSB 2BPBA 3DKHA 4WU7B 4AZ8B 1RK1A 4DQOH 3BGAA 4RZKA 5JQ6L 3ZU8A 3MRHB 2LLGA 1J1OH 1QLFB 2H1PH 5DZ9A 4OJEH 4GIPD 4XAKE 5H8DA 1PTZA 1P7BA 2XRAH 3KBHE 4IRJC 2AEQH 3CSYB 4L5FE 3SJVD 2KQMA 5AVRB 1A64A 1ES0A 3D7PA 5E2JA 4J2XA 3INOA 3BHBA 5E7BA 3ARGD 1A3RL 3OMAB 4XB7A 3FO9A 3KLSA 1DTUA 1N6VA 4HBQA 3B8YA 2CHNA 5FEBA 2A6DB 4F9PA 3ULSB 1KV7A 1URLA 3UOAB 4QHNB 2Q10A 3GLEA 2XZCL 3IDGA 4XBEH 3L2LA 3CSPA 5I19H 2IANB 4JO1L 1JYNA 3I2CH 4DGIL 3BW9A 5H35B 3JZ7A 2FBRA 4IKLA 2R0LH 3L3IB 3VH8B 2GG1A 3F12A 1S7XB 4EI6B 1KOAA 3RL2A 1BD2B 4I8DA 1JV5B 3QO1B 3MLZL 2DWDB 4UIMA 1B6DA 3KGUA 4X6CA 1P4BH 1OCCB 2C3VB 2L8AA 2OMNA 3O6FC 3DUHA 5ELIA 5IEKA 3WIIL 5DUBA 3MRKA 4DVRH 4P5RA 2A38A 3N40F 2WB7A 4DN4H 1DZBA 3FNKA 4MKTA 3QPQD 4WFED 1BXXA 3EFOB 3FFCE 2Q6WB 5HDOA 4JMNA 4YZFE 1MJUL 1R5WA 4IBSA 4YIQB 5BRZB 4FI6A 2JKNA 2J8UE 2IALA 3AFLA 5FA4B 5EO9A 4CMHB 3EO9L 5AWNH 4LPCA 4FLQA 5DD6B 4DETA 1MW3A 4OBRA 5B21A 2LHAA 5MHSE 3GHEL 3D12B 4Z7UE 1AYOA 3B7YA 4BV1A 1GGBL 4U1JA 3ABKB 4PCSA 5IVXB 4WTZG 5DC9B 4TF4A 1IFGA 2JJSA 1D5MB 1WWAX 3MUZ1 3DV6B 5KAQF 4U1HB 2XWDA 4KNTA 1IJNA 3GSUA 2VDOB 3CFDA 1R3JA 3DROB 2PABA 1NOFA 1KXTB 3V6OE 3D33A 5KWYC 1A6PA 1ZTXL 2PCYA 1RKRA 1IBDA 1G7QB 3KBFA 4Q89A 1A6TB 5ESVA 4JQXA 1MJ8H 1UKQA 2A6JA 3N0AA 4HS6B 4KKLD 2BNUA 3LPGA 5CEXB 4CW1A 4OCLC 5F3FA 3TCXA 2ATPB 1ZSHA 3U0WL 5C6TL 4OGXH 1EUUA 4V2BA 5BO0D 1AGFA 2HX8A 1U8OB 1I9IL 1U95A 3K0WA 4LCWE 4WKZB 3NQKA 1P5VB 2JLLA 4PGBA 3K4ZA 4Y4KA 2ZPKH 4UNTA 5ID0A 3UC0L 1ASOA 1DQIA 5L4FA 4ZUSA 2XV2A 3H55A 4H2AA 3DURB 3I02A 4LPUA 1MJ7L 1MAJA 4HPYL 5C0AA 1Y0LA 3RWIB 2HRPH 3NCJL 2JJSC 4LOUC 3W5MA 1LL1A 1IGML 4X9FA 2ZOKB 2B1AH 3ECVA 3PPSA 3JYBA 3BZ4B 4LHUG 4NQCA 3SKJH 2VGLM 4YL4A 3EFDL 4MA8L 4YNYA 1BZDA 3JWNH 4Q9QH 1U4FA 5C09A 4KZDH 3SE3A 4MXWH 3OAZH 4G8EA 4U6XB 1CE1H 1NOLA 4PJ9B 1GIGL 2HFFB 4UWQB 3KYKL 4HZAA 3LNDA 2EE9A 5ENWA 5IBLC 3D87B 1E8YA 2FH8A 1FF5A 2EDDA 3FPYA 1QPPA 5MEOA 3BP7A 3QHFL 3FXIC 4AT6B 2DQGL 2CZNA 5D7IB 5DO2D 4XMLH 5I16B 1PD1A 32C2B 5E6IA 4ADIA 4C55A 2FR4A 4GG6A 4POZC 5KBLA 4FX5A 5F3HB 5IK3A 3RX5A 3WNIA 4OSUL 1T6VN 1H8LA 1NCBL 1CN4A 2XN9A 3F83A 2OJZH 3G6JF 4UM9A 3RKDC 3GSRA 2P80A 4TXVB 2QV4A 4KUZH 1DVZA 3GPEA 1RIHL 4Y16D 3LHPL 3KYNB 3CFNA 2A4CA 5I30L 3ARUA 4JY4A 5LAXB 5CZXD 1I9RL 1U93B 1YUHB 3MUGA 2W0FA 2D3JA 4P5TB 2YEVB 4G5ZH 4X7TA 3BPCA 4KKRA 1MAML 4QRQA 3NEXA 3L3JA 4OCMC 2WZPA 4DUWA 1YEDA 1O6VA 3V6ZB 2O26U 4L8SC 1CXIA 5K9OA 5DU7A 3KWVA 3TIDB 4HH9A 2NZIA 5HHOB 4XN7A 2YRZA 4MVBC 5C07D 5CSZA 1IKNA 3TESA 5TDPA 3VXME 2EDFA 1EZVY 4G7VL 3KPRD 5CN1A 3NCYP 4DEPB 3ARFB 4OJYA 4BZ2A 4DF9A 3VFWB 2E59A 4OZFB 2JIXA 5EF2A 1JHLH 1O9ZA 3F58H 4I0PB 1E9PA 4NZJA 3RVXD 2NY1C 3QBTB 1C1EL 3T6WA 4UQ2B 3KPSA 4QGTA 4YSQA 5CD3B 1SYVB 1YYML 3DYOA 4HHWA 2EKJA 5E6IC 1S9VA 4OFVA 3N06B 3WEXB 2AEIT 3S8FB 3B9DA 5I6MA 3IJHA 3V4PA 1PG7X 4NNPL 1HSBB 1ET8A 2GY5A 3FB6B 3ZSTA 5M7QA 3EYOA 4P06A 1XF1A 3VA2C 3CK0H 2IV8A 3T0AA 4DP4X 1T22B 1ACYL 3MLWL 1J1PH 3NZ8A 5E56A 2WAQA 2VDRB 4HAFA 3I6GB 3SDCA 5GGSA 3BH9A 2EO7A 2RH0A 2OQJB 2WOBA 3CDGA 3OF6A 3F3HA 3FN0L 3L95A 4KY2A 4HISA 4PP2A 3A6BH 3UAJD 2CAKA 4CVXA 4PR5B 3U0TB 3JXAA 4GT7A 4HKZA 1FAIH 4KK6D 4L0ZA 5HYJB 3ARQA 3B9KD 5JNYA 4HDIB 2H1LM 2PNDA 1DR9A 1KDIA 4KMQA 4E42A 4GRWF 1J1XH 1URZA 4HCRH 4NKDB 5AAMA 1QFWI 3K2IA 3EJRA 2VRQA 2D03L 5HJBA 4PJXF 1HQ4B 3RGVD 3UYPB 2DEXX 2VZVA 3MUY1 1SDAB 4FD0A 4PH8A 3T77A 2WXMA 5ACLA 5DFWH 1BIIA 1I7UB 2VLJD 4QAMB 3RAJL 1JGIA 1XF5A 1YA5A 1JK8A 2GJ6A 4JO8A 3U36A 2GBTA 3NPSB 4CKVX 1D9KA 5F7DB 3TBTA 1CF8H 3QIUA 4XMKH 1XF4A 2ZUXA 3VXOA 3OB0K 2Q86B 3CSGA 1G94A 2BOBB 4NXSA 3VFNA 1FG2A 4FULA 4CC0A 3JSSA 5CJOH 5T1JA 4OFQA 5ICZB 4ZSOE 1G6RB 4KTEL 5IB2B 3B3IB 2JI1A 1A6UL 2WLYA 2QPFA 2B9BA 3KEHA 1DLHB 1RSYA 2VDLH 2ICEA 3P69A 2AHIA 1A7QH 4Z7OE 3F04A 3RA7L 3FU3A 2BY3A 4UQBA 3ATBA 5I5RA 3I3EA 4BFKA 3L4VA 4MA7L 3X1EA 4I77H 4L9DA 5FK9B 4XC3H 4F7PA 4TPRH 3ZDZF 3S5YA 5DR5H 2DAVA 4X5XA 5K9KA 2P8MB 4BGLA 1TJXA 2LLNA 1NC4A 4LIQE 1WBZB 2AJUH 3ZHLA 1JRHI 2V2XA 5FW6A 2NY7H 1J9CT 2P5EB 1CL7L 4AM0A 2D7TL 2Y69B 4FFYL 5EUOA 1IE5A 1A7BA 5EU5A 5FKAB 4X83A 4IIZA 5FO8B 3AQZA 4LBEA 1BXVA 3NRPA 1AS6A 5I1JL 3B2UD 2GPZA 3DHUA 4A55A 3POCA 4FC3E 2ITCB 4GFTB 5D7LE 4XR8C 2I5YL 1BW8A 1KJ2L 3LMJL 3K5RA 3DMMA 3ZUNC 3PGCB 4LF3A 4UV7H 5FX3A 3W37A 3OKKA 5LDUA 1S9YB 1I8IA 2XZAH 3BWSA 3CHQA 3I6SA 3P9WB 1X5IA 4HKJB 3AT8A 4CMMA 5HGHA 5T8IA 4U1SA 3TO2B 2O5XH 4XZUA 5E4OA 1E43A 3VYPA 3WDJA 3IFPB 5KYWA 1BYPA 4U1NB 1D5XB 4QNPE 3IJSA 4MB3A 5T3XD 5GGQH 2O93L 2FLMA 5ESAB 2ICEC 1ZVNA 1G7MB 2CUMA 2X4UA 2M8XA 4BZ2H 1LO2L 1HWWA 1UZ8B 3ARED 3UTQB 4PS3A 3HJEA 2ENPA 5JIDA 4Z7VF 3I50H 1E27A 5EUKA 1J7VR 4PJ5A 1SJXA 2UUDH 4D0DB 4YGVB 2MIZA 4IOSD 2YD1A 2BS71 4LVOC 2WBJD 5MEQA 5EZLB 3K6IA 5IR1B 4M29A 5D5MA 1KLUB 1ZPUA 4MJ6B 2ODIA 4OZGB 3L7FA 3C6LD 4H40A 3LEYL 4D3CH 2JI2A 1IKOP 3A6CH 3M7OA 4KNUA 4WWOA 4YBQD 3LRSB 1VJSA 5DMYA 2HFTA 3MRMA 4FRWA 1HU8A 3LIZH 4XNMB 4YHLH 3VRLE 1DQQA 4EN3B 5CLWA 5JOPE 3GSVA 4Z77B 1JPSL 3P0VH 3SCMA 3J27A 3D0LA 3I85A 4OM1H 2NQ3A 3G5YB 5AL0A 2LVEA 3GTNA 1M1SA 1WWCA 3AB0B 5IFAH 4ZT1A 2RCSL 3MJGX 3DHPA 1CTMA 2BSTB 5IKCA 4G1EA 5LQBL 4PJHB 3ULVE 3APNA 4PI2A 2C3WA 5EWIH 3QIWD 1FIGL 2IPUG 4YO0B 4M1DH 2IG2L 3HW7A 4GBXD 3ZL2A 1YEJL 1MI5B 4JQIH 2GK0B 4FQJL 4PJFA 1TF4A 1EHKB 1FVDA 2A4ZA 2FSDA 1KEGH 4HGWB 4JDZB 2WVSA 4CC1A 3EBGA 3HMXH 4KNSA 5LBGA 4OI8A 4WIQA 1HJCA 1IQDB 3ABZA 1GZHA 1JWUA 3HHSB 3QJHA 2XPGB 3KYAA 4PRHA 1PEWA 3VG0L 2PO6A 2YBRB 2DQ6A 4OZIE 4O4YH 4N22A 5GS0C 4O2CA 4OJAA 3H85A 4X4MA 3WFHA 3ZHFA 4UTBA 1BQSA 3WTUA 5AAWC 4DPAX 1RSFA 4XVTL 2JJUA 5CIPH 5ID1A 4F93B 1I1AA 3OHXB 2BP8B 4QMEA 3EUDA 4DGVH 2J1ZA 1RHFA 4NZDA 4OCWH 4Q6IB 2B77A 3DRQA 2EUVA 4XX1E 1M7IA 1A3ZA 1A6VL 1OANA 5JHLH 3IBEA 2ATAA 1XFPA 4XPHH 4RFEA 4HBCL 1GGTA 4AKQA 3WTVA 2JKIS 4HQQH 4YSRA 4JRWA 2Q8BL 3FQ2A 3ZKSD 3X14A 4B0MB 4XMPL 1XDTT 1OCZB 1AQDB 3EDKA 5F1KC 2ZKHL 2EDMA 4G2AA 1NC2D 5J12C 5C0AD 4G8IA 4BFIA 3QDGB 4WFFE 1CFVH 5DRZB 3GXUB 2OXGB 2CRMA 1ZV5A 1CLZH 3N0PB 3P3TA 4XMVA 1EHXA 4Y5VB 4XTRC 2N3JA 5T3ZD 2Z93B 5GRWA 3U1PA 5DYFA 5C09D 1X5ZA 4TQIA 1X7QA 1GZHC 4MDRA 2PO6C 1VDGA 1T5XA 3QJXA 4ENEC 5IMKB 5J6HB 3H56A 2DMHA 2CA4A 2X4SB 5AUMB 2FYVA 1RUML 3TEZA 3B9VA 3NACH 4UQCA 2ARJB 1AOHA 1PZCA 2QVIA 2AAAA 5F96L 1I1AC 3ULUE 4TLUA 5BVPL 3FT4B 5DURB 1XZWA 4LQFL 1O6SB 4MZ3A 4MJJA 1S5IL 5CWSB 5M95B 5E5RB 2BY2A 1D5ZA 1BFTA 4I3SH 2WYIA 2EC9T 3H7LA 2AZUA 4DQOL 1HIML 4NQDE 4PLJC 1XCQB 3M86A 4HJGA 4ODSH 1MCPH 2P80D 4JY6A 2OMYB 2B9AA 4LSSH 4A2LA 2H1PL 2RHEA 3CMGA 5AB1A 4LDLB 3HOGA 2X2IA 1GPOL 2XRAL 5J3HC 4D0BA 2VQTA 4PUBL 1AGDB 4FFZH 1WAAF 3L17A 1QSED 2EDYA 4BKSC 5KSBE 3A21A 3X3GH 1IEBA 4LVHC 4PWHA 3S5LB 4P23A 3IDYC 4FF9A 4PY7B 4HA1A 2ZAIA 3KWWA 3OR6A 4GAJH 2XBTA 1HXMA 4RVBA 5DHXB 5T1KB 3EO0B 3FFCA 4BH7B 2ADGB 3BGMB 1NDMA 3I74A 3GSNA 4RIRB 4YFEA 5I19L 2J8UA 1MFNA 3I2CL 2CIIA 5JZ7C 1ZWIB 2R0LL 1KC5H 3E8VA 3UEZA 2E6JA 3PCYA 1T3FB 4Z7UA 1AZUA 5DS2A 5HPMA 1D5RA 2PYFA 3BZDA 5L88H 5I15H 3GSXB 1P4BL 3CZNA 4KJQD 2BXZA 4RRPA 1MVUB 3S48A 4DVRL 5BPPA 2ARWA 4DN4L 1QEWA 4HJ0D 3ARBA 3NGBC 1B0GB 4JPIB 2FH6A 1O5PA 2FGWH 2J5LB 4H8WH 1JK9A 3V6BR 3V6OA 4FN0A 2R2HB 3DUUA 3VNYA 5AWNL 3EDFA 3SDCD 3VFSB 3CZFA 2Z7WA 2CA3A 4JFDB 3PQYD 1KIUA 5AW3B 4XC1H 3ZY7A 1T21A 3CZLA 2NMSA 4P23C 3IPFA 4DKFH 4DN3H 2AC0A 2IOMA 1BPLB 5GGVL 4AYID 4J3OC 4LCWA 3Q6FB 1NGWB 3DX7B 2F7IA 2PCFB 4ZMOA 1VENA 3P02A 4WUKH 1MG2C 2CK2A 2X4NB 3BH8B 1MJ8L 1N59A 1NZRA 4LFHG 3WO3B 5GZOD 1HZKA 5CBEA 2VB5A 2YFNA 4HV8A 4Y19E 4OD2A 1D9KD 1T0PB 4P0DA 3VO0A 2WUBH 3ESUF 3LZLA 3QIUD 3NN8B 1J12A 1SLWA 1G43A 1P7QD 4YQXH 1UOVA 4G6JL 2B59B 3QC5X 4JHWL 1ZT7A 4OZFG 5IHLB 3VD0A 3FRPB 1HH6A 2UZXB 2IAMD 3ARBC 3IF1B 4XMWA 3OAYH 4FEMA 4ZW6A 1E30A 4TQPA 2DQTH 1WC7B 4MCNA 3MXWH 3V6OC 4A38A 2PXYB 3NK3A 4O5LL 1KWGA 1V7NH 1E40A 3S88L 4OLEA 4L8CA 1ZLWK 2NY4B 4CA4A 1YZZA 3TC9A 1OT1A 5EOCH 1H3PH 3JYCA 4IK6A 4JCMA 3FTXA 3WL9B 1A4JB 3TEUA 1KJ2B 3OHMB 1XGUA 4YEFA 4PLNC 2HRPL 1JGUL 2I25N 5EN2A 3GS7A 2NY0C 4JHUA 3PWJB 4L1DA 5MEPA 1AYRA 4XN4A 4KRNA 4Z7NB 4FJ6A 3NIGF 4P2QA 1S5HB 3SKJL 1DHKA 5E8EA 2YGQA 1IAIM 5CEZE 1H0DA 4E5XB 1FH5H 4M7LT 5HY9A 2NXYC 2XNAB 5DS8B 2UXGA 4MXWL 3V0WL 3MLUH 4JL2A 2OCCB 4GSUA 3KDPB 4P4KB 5A40E 1U8KA 4JM2D 3WO4B 1SPDA 5HHNA 5I9QB 3DMMD 3I75B 1J5DA 2DQCH 2DQFB 4G8FB 3RPBA 4TRPH 1W0YT 4U7KA 4NQQA 1BOYA 4X8CA 5F7EH 1CD0A 4L4VE 4DKTA 3DO4A 2GVYA 5H37H 2EDEA 4UM8A 2XQBH 1EFQA 1OD9A 4QRUB 3DI3B 4XP4H 1TLKA 1YEKH 1NAMB 3F7YB 2MTAA 3GHPA 3TV8A 4AE0A 1RULL 3L1GA 4XMZA 5D1QD 1ZLVH 1YC8A 5IZ7A 3MRPA 4J3OH 3MLXL 4NZRH 5B3JF 1U2YA 5AYQA 5D1XD 3QA3A 4N9GA 3FULA 2JTDA 1AOZA 1J86A 1AY1L 3VXMA 4BZ1H 1ZMYA 1EUTA 5IF0B 4OVUA 2H2SD 3ME0B 4P5SA 4B9KC 4JX0A 4WENB 1K6QH 2VZOA 4ZXBA 4AV0A 3VWJD 5KVFH 1J5HA 2DEYX 4BGDA 3CDFA 3EJUA 4EUPH 1A14H 4WWKA 3INUH 4FDWA 1S7SA 3BWAB 1KGCD 3IDNB 4MLSA 3TVMB 1MFVA 3BH4A 4G5ZL 5HI3C 2NRDA 4AYEC 1SXSA 2YO3A 4IKKA 5LB1A 1BJ1H 1BP3B 3BP6A 3IGFA 1I8KB 4XHJD 3RYMA 3P3RA 1KCSH 4U6HB 1S7UB 2RFXB 4PJCF 1BYNA 3P4OA 4HOWA 4X5QA 1AAJA 3Q01A 5BO1H 5JXEA 3ARSA 5F6IB 2X6CA 3FH7A 4PRNA 1LWHA 1JPTL 3QAZC 4K23H 4I2XE 3VXTA 4EVNB 4PGEA 3HBZA 4PCYA 3TM6A 1SMAA 5B39A 5E23A 5B8CB 1UXSA 4RH4A 2E86A 2TSBA 2WO3B 4MAYD 4JZJA 4EZMA 1TNMA 4U7SA 2G5BB 4WRLA 3BD3A 3KLKA 2RAMA 1AD0A 3WG7B 5BZDB 2HH0H 1G6VK 5CXPA 3OPZH 5FO7A 1J1PL 3UZEA 2V4LA 4LLDB 3HRPA 1YPZB 4XCFH 5LG6A 4ZXBC 3AT0A 2QQKH 2EUWA 2OSLB 2Z34A 4M6NH 4FAAB 4U0RB 4G9FD 5DC0A 4QF1B 3VI3E 2IGTA 3A6BL 3E6HA 1ZLSL 4ODBD 4KK8C 5JPNC 4V2CB 3RDJA 4K73A 2C4FT 4NKOB 4TM9A 4HIQA 3FOMB 2F9BT 4R5VA 4M4RB 3SYPA 3LN5A 5JW4N 2IPKB 2CUAA 3U46B 3UTTB 1J1XL 4HCRL 4CN1A 3KYMB 3HE6B 2R2BB 4K2UH 4ZSOA 4PV8B 1EJOL 3O4LE 3KCPB 1L0PA 1NBVH 1HHGB 2F15A 1HWHB 3FQYA 2IMNA 4F8NA 5A2FA 4E0RB 3VDCA 2GBUA 1LK2B 2ZXQA 3BVNB 1MN4A 2QGBA 3MYJA 3O9WA 4H1LB 3VQ2C 1DQJA 4J23A 2HX7A 2EEDA 1KLFA 2CLVA 4TNGA 1JYWA 3P77A 3W3BA 4OUOA 1PLBA 3T2LA 1DCLA 3X1FA 2GEQA 2VIRB 3T2QA 4QHUA 3F7QA 4X4KA 4JZJC 4ADJA 4LLWA 1HHHA 3D25A 3GSQB 1KSRA 3PAUA 5CJOL 5L0QC 4BH8A 4KZEH 1MHCB 1UGKA 3CC1A 2QPSA 2R7EA 3M07A 1A7QL 1UJ3A 4TTDC 4W1TA 3UZEC 4P07A 4F7CA 1NFDF 4DPRA 5DVLA 4GINA 1TSHA 5K1JA 3X11A 3TO4B 5EDSA 2UWEE 1G7JB 2IDQA 3UGUA 2DWSA 2DW5A 4XC3L 5AVTB 4G42A 4HMEA 4DVBB 3CSTA 1LWRA 2XA8H 3S3SA 3P2BA 1QNZL 2YC1B 5F9WC 2JB5L 4Y1AE 1MCWW 2AJUL 5DK0B 4ZTPH 1OPGH 1E9OB 4M03A 1BQRA 4ZOCA 5IIEA 5IMLA 2FWUA 2NY7L 1AO7B 3NZUA 4P5KA 1SYSB 2DYPA 3W9DA 1B4JL 3APFA 4FA7B 4PBDA 2V5TA 5F70A 1BM7A 4PJBF 3O9WC 5AZ2H 3S36X 2HFEB 3HZVA 2J43A 5BV7H 4CADA 2WXIA 3VXSB 4QRRB 4WTQA 4ZTEA 1Y1DA 3QPXL 2EDLA 2Q9OA 2B14A 4UV7L 5KN5B 1Q9OB 4OKVB 3PV6A 4PLKC 4IRSB 2COQA 3HN8A 4IIQB 5GQBA 2IH3A 4FXGA 1BQKA 3GHBH 3MJWA 3MRJA 3UJTH 3SDAA 1GKEA 4LKXB 1I7ZB 1IL1B 3IDJB 4WUUE 5GGQL 4QYOA 1UADC 1VACB 5FC9A 2DQEH 4K94L 1I4FA 3WKMH 4KK5D 1HEJC 3I50L 1KGUA 5AVZB 2DI8A 3O4OC 4WI8A 1H8OA 3ZHDA 4F5CE 5I71B 3MV8B 4G11A 4BUHA 2GSIA 4KUCD 1KELH 5J7CC 3A4AA 2H3XC 4ZG1A 1X7SA 2YRLA 4Y2DD 4KZCA 3QUXB 5DQJA 2WXHA 4NPYB 4D3CL 3MACH 4XMUA 2BMKB 3CFCL 3MLYH 4OCXL 2C26A 5DI8B 3LIZL 4MDIB 1M1XA 1JPGA 1EZSA 2DQIH 3SZKC 4K8RC 1TQCC 3TH4T 3CVHA 4OM1L 4OZIA 3CH8A 3GPSA 1R6VA 5CD5C 3C6EA 5IFAL 1L9NA 1KACB 5FV2A 5DQDH 3TCLB 2KUTA 1QBAA 2D7MA 3A67H 2EH7H 3RI5K 4GAFB 4R0LB 5BS0B 3ZTJH 4WNQA 2HLFC 3BKMH 3FU8A 5EWIL 2IJ0C 4N6RA 4YDJA 5EN3A 1ZJBA 4ZMWA 1I1RA 1PW3A 3NSDA 3SDAC 1GYWA 1VFBB 2VR5A 4B9YA 5E4AA 4JQIL 4JG0H 3W9EB 3IN2A 1AP2B 1H9VA 3L4CA 3TPUB 4RMBA 1E5CA 1RZJL 3FHEA 2HCZX 5E08L 1UHVA 1UWEH 3HMXL 3S5LG 4AEHH 5J13C 5J89A 1SHSA 3UG5A 3VAEA 3ZIYA 4L0YA 3DVGA 4G7YL 4JGUA 4RESB 1L7TH 3NG5A 2AABH 1TVHA 4NX0A 4FQQB 3MJ9A 4U33A 1UYWH 4OT1L 1NBQA 2PPCA 1HNYA 3ARGC 4MB4A 5JIKA 5E4IA 4GKSA 4AGNA 3ARDB 5IQ9B 1NLDH 1R3LA 5CJQL 4DGVL 4PRDB 1T2QH 4OCWL 4OB5L 2J6EH 4AMXA 3O6FB 1P7KB 3QJZA 2GTWB 4LIQH 1K8DB 4UZUA 2NUPB 4PJAE 3TIEA 43CAA 5JHLL 1M05B 3SE9H 2FWOB 3N1PC 2NW3A 2QGEA 5IHZA 3IMTA 4NQXA 5DEJA 3S35H 1S78D 1U3ZA 2HWZL 4C8XA 3HHMA 3CHOA 5DHVH 1BJMA 3AQDA 3JZYA 3UMTA 1WT5A 4XBPA 4EI5B 1IGIH 2AXGA 4AIZB 1KG0B 5I6XC 3NFNA 4WI0B 3LB6D 5LGJB 2BSRB 2ZZUT 3WCYA 2IDCA 1CLZL 4GXVH 4ZJ9A 2ZWLT 3RWEA 2XVLA 2P8LB 3ES6B 5CUSL 2CU9A 1AFVH 3WOVA 4IQHA 3B6SA 3FT0A 3ZE2E 4G6FD 5HYSB 1G7HA 3KPPA 1MCEA 2R69H 2ZX5A 4X6CF 3NFSH 3WUZA 2AQSA 1FZJB 4NQDA 4NO5A 4E9YA 3EGXB 1D7DA 3AABA 1HHIA 3BEVA 1FNLA 3MREB 5EU6B 5JHMA 5FF6B 2AERT 5CJ5A 1DVFB 4P2OB 2A3TA 1QSFB 5E00B 4EQ2A 2HVBA 5KSBA 2BERA 2PW1A 1JDAA 1TZHB 4EZJA 1PZ2A 4GLRI 3WNJA 1L3WA 4IOIA 3Q8CA 3OAWA 1N5AA 2DKSA 2UY6B 1MXGA 4IKNA 2GI7A 1OZTG 1IM9A 1MDTA 2HG5A 1JZDC 4KKQA 4YSAA 5JW4R 3DX6A 3EADA 1LP9B 3QK0A 4M4PA 1MCBA 2X1OA 3DOSB 4GW4A 4L9LA 4ZW5A 1WT5C 4ODSL 1MCPL 3HE7C 4XB3A 3ASNB 4JN2A 4Z3EA 2QKIA 3MLSL 3DPBB 4R2GD 4APQD 2FWSA 2WMPA 4WWKD 1E3FA 1ZVHA 3O2DH 2GAZA 1TTUA 2OZ4A 3ULUC 1IGYB 2XQYK 4AY0A 4CVUA 4JDEA 1MCWM 4FFZL 3CHPA 2G3NA 1I3RB 3SD2A 3VDAA 4RSVA 1BBJB 3BZ5A 3QXUA 4HUVA 3SBWA 3H1ZA 5J1AB 3HR5A 4AENA 4GAJL 4GG8B 2K45A 2YPKA 3K72A 4ZAKD 4Y4HA 3HC0A 5DVNA 1TPXC 3DSNA 3FCTB 1FNEA 2WINA 4MRCA 4XNXH 4Z8FL 2AFNA 1KB5H 5DVMA 1BZ9A 1BAGA 1IFRA 4NBXB 5KS9E 1KC5L 3FB5B 1CCZA 4YHPB 4I18C 4E5XG 4BELD 5FYKL 1IC7H 3NEEA 4XCYB 5I15L 3QJSB 2WQ8A 5LAPA 2ZG1A 4DESA 4G6AC 2NZ1A 3VXRB 5FGCE 4GRLB 1WGVA 2I9LB 5EORH 4P46A 3MOBL 1KWKA 4ODXA 2G2RA 3CVDA 4OU3A 5E9DE 1WK0A 3LKPA 1TQTA 2P43B 3I3BA 3C9NA 1QG3A 2FGWL 3L9EA 4H8WL 2IIJA 2GUYA 3BAIA 4MA3A 4OFDA 2DQUL 2XQYA 1FYTB 4WFGD 3C8DA 3H0TA 2XTJE 3ARWA 4TLSA 5I8EA 4ZFOA 2VXVH 4WHYH 1CQKA 1MF2L 1P84J 3SPJA 1RJYA 3FO0L 4XC1L 1FC2D 4GQRA 2BNQD 4JG5A 2P24B 2NYYD 3P0GB 1FFQA 3T0EE 4NKMA 3HKFA 3CGTA 1TETH 4DKFL 4M93B 4DN3L 3RB7A 3ABLB 3MGAA 3HI6H 4YSOA 5FUCE 4Y4HC 4V1DB 3ECWA 1BMGA 3BFWA 3IETB 2OTPA 4L8SB 1F4WH 5GGUA 4A2DA 4YDLB 2HT4D 3W39B 1D6EB 1MRCH 3C12A 4WUKL 3QRFM 4FADA 2BNRD 3ILDA 4ZPVA 1RHHB 2QSCL 1M53A 4XCEA 5HJGA 2JV6A 3DO7B 3LRLA 2QGDA 1H5BB 2WBWB 2CBOA 2WO2B 4OCRH 4FGMA 1FFOA 4JHVA 3ASWA 4AYMC 4GG6F 4OZHB 5CZXC 3VXPA 1E4HA 3ULUH 3X1NA 3DETD 4Q2ZB 1E8WA 5LDSA 3CHRA 5C0CB 3RNKB 4LLMB 2JJVA 2NY1B 2RBLA 2X6BA 4G5AA 3QH3B 1MRFH 1WYJA 3NH7L 2HN7B 2C9QA 3WJMA 2VN3A 3UFIA 1CGTA 2VZTA 3FCGA 4O2EB 4RMVA 4Y8DC 4DUVA 2DQTL 4HH8A 3ET9F 3MXWL 3RX7A 3ZE0F 5AD0A 4FNSA 4P3DA 3HG3A 5K33A 4EDWL 1SOKA 1V7NL 1C8PA 1VAHA 4NPJA 5D7LD 2V37A 3IFOA 2FEEI 1N7MH 5HI5D 1T03H 5D2NB 5F7KC 3RY4A 1IJ9A 1K4DA 2MNJB 5C0JB 2Y7SA 1F1DA 2ZAHA 3L5WB 4L4VA 5FGBA 1KTCA 2NY2B 1AHWA 4KQ3L 4PB9H 4RGNB 1THCA 2J4WH 2ESVE 3PREA 3PHQB 3VYOA 1JF6A 2VR8A 3EBHA 3H4FA 2RA1A 3UCQA 3UAAA 3PFUA 4A37A 4AKPA 2F0CA 1FH5L 3SKOA 2CR6A 2DJ4A 2XFXB 3SQBB 6PAZA 3MLUL 3QORD 4FG6D 3OV6A 2P44B 3HNTH 5C9KA 1X7TA 1WEJL 3EZ8A 3SE8L 2F8VA 4BE6A 3HVNA 1AXSA 1GS8A 1VGEH 2XOTA 3B9KC 4TRPL 4ZMLA 4LE8A 4TNFA 1M9SA 1H19A 2J1WA 4WHDA 1KXVC 5IROA 3X1BA 1NH6A 2PW2B 2XQBL 4OLZH 1I1CA 3QFDB 5BNXD 1J5OH 4XP4L 4TVPE 1MUJA 1YEIL 1UVQA 4ZK8A 4I89A 3RGVC 3US0A 4U1KB 2GC4C 5E51A 5FYJD 4OH2A 5A1AA 5JOPD 2RQ8A 1B90A 4NZRL 1JVLA 5ANHA 2UYLA 5HDLA 4BZ1L 1KGJA 1N67A 5FO9B 1DFBL 3FF7A 2VR9A 3I84A 3U9UB 1JNLH 2W9DH 3S98A 3Q8AA 5IEHA 4MS8C 1A7RH 5DXWA 5HHVL 1JZ4A 4GSRA 4I2XA 3AWFA 5KVFL 2CJSA 2DQDL 4DP6X 1AHWC 2JQAA 3ZKXC 1AMYA 1A14L 3INUL 2IOIA 2BCMA 2BVUA 4H8VA 5B4MC 3BPOB 4NN5C 1V54B 2GIMA 3HS0A 3RWDA 1HOCB 2VKXA 4JKPH 1KTDA 1M42A 3GRWH 3GBLA 3U6XS 4NM8H 5E0FA 4F8TA 1IGCH 3GBNH 4X6EB 4M5SA 5D7EA 5DJ8B 2ZKYA 3P4MA 1KCSL 2EEFA 1E9QB 4NQEE 4RSYA 1ZJAA 2JB6A 5I0XA 2VL5B 4NN7B 4ZI8A 5BO1L 3JWOC 3OL2A 1F3DJ 2OV0A 4H5SA 4XCNB 5LBSH 5IROC 4FFTA 4HKBA 2NQDA 2QMKA 4PHZA 3VI3A 3MI6A 2YGPA 4JFPB 3VXUD 1L3NA 5BVJB 4QTHB 5LLIC 1F13A 5CIPB 3AS3A 2W07B 2IDTA 3ZW3A 1DJZA 43C9A 3NIFF 1EXUB 4GI8A 4WV1C 5DCCA 3DRTB 4OLWH 4QR7A 3O4LA 2WVTA 4FTVD 3NTCL 2D3LA 2FYYB 2H8PB 3CH1B 4Y0GA 4JDVB 5CFHA 2OXHA 3LKQB 1S7WA 5F0MB 2APTA 3LPWA 1S9WA 2J57A 1UCBH 4WFFD 4XCFL 5G5DA 3SZ6A 2Q8AH 4CNIB 4F8QA 3CZKA 4QRSB 3SOBH 1OIOA 3NK4A 4M6NL 1DN0B 3FT9A 5EUOF 2A99A 5BMFL 2APWA 3H6AA 1NGZB 4L8BA 4NUGH 3HS0C 4P2AA 5IW6B 1RZQA 1XH3B 5DWUH 4DO5A 1ZEAL 3L3GB 4KKAD 5J6GB 5DJCA 3MZTA 3CX5J 3FCSA 2EQDA 4K2UL 4ZNCD 1CS6A 1AR1D 3S3JA 3IJEA 4U3SA 5I1DA 3O3EB 4J1UA 2Z31D 4Y9FA 3JT0A 2P7TA 3RPIA 3OXSA 1JMZA 3EKCA 3DO3A 2ALAA 3NSCA 3GMPA 1LO4H 3QQDB 2UWEA 2YQ3A 1KT2B 1JZEA 3QI9A 4X6DE 1UXMA 1CFQA 5GGRY 1W0WB 2IBBA 1A1OA 5ES4B 2BC4A 4WCYL 2HPTA 2R2EA 1R24B 2BVPA 5E1AA 4IRZA 1DE4A 1NCJA 4UQEA 1IC0A 1B3JA 5MENE 4NQUA 4Y1AA 1ACZA 4FEIA 5GS1A 3MO1B 2X2YA 3D5OF 4APXB 3MDJA 3TN0D 4KZEL 5D5MF 1NMBH 5D1ZD 2BS8A 4GUPA 3I9IA 2LW3A 5DT1L 2E9IA 1X3DA 4HIIA 3JWOH 3EG9B 1JFHA 5D6DA 1NWPA 2HT3C 2BVOB 3LQZA 5J0BA 5L6YH 3QIWC 1FO0L 4YDIH 4AIEA 1M7DB 4XWGH 2DJUA 2JQZA 4UT9A 2OMTB 2CKBH 4XNZB 1MFMA 1QAWA 1XHHA 2MCPL 2FNBA 4H8PA 1YMMB 4HHGA 3LKSA 1G87A 2X9XA 1XEUA 2MJWA 4DP2X 1CDUA 1L9RA 2K7PA 2JXMA 4WUUA 2WYZA 3U82B 1RJLA 3HG1E 3V0IA 5FCUH 5CEYB 5AZ2L 1QLRA 4NB7A 5E2VH 4RDQG 5BV7L 4XNBA 4FQPA 4F5CA 5J12B 4MD4B 3JWNG 4JJ5A 2FJGA 4MD5B 1FNGB 1K4CB 1SOQA 4F2ME 5L9DL 1U91B 4UQ3A 4RDBA 3GS4A 1A8ZA 1ITCA 4L29A 4PJ8B 1C08B 5EIIA 5GS1C 1SJHA 4OVVA 1GAFH 3NESA 3HB3D 1WA0X 2DICA 3LKNB 1ORSB 2Y5TB 3NJHA 1IC5H 1D7CA 3EYFB 3VI4E 1OTTC 5F9OL 2DQEL 5A2IH 3V4VL 2VSMB 3VD5A 2EXYD 1EZLA 2BSSA 5D6DC 1DQLH 1YVLA 4D94A 5HYSG 1NIAA 1M7UA 4MCYA 3U2SA 1OGAE 3A0OA 2YAQA 4BDVA 3JV6B 3G6JB 1UUNA 4Y2OA 1SLXA 2ORBH 3HR6A 2MQGA 3FQUB 3EOAB 4JFOA 4YAQA 5LXGH 1QRKA 1YDPA 4JKNA 5EULV 4YJZL 5JMOC 4MXVE 1N26A 4KITB 4P46D 1T66D 4Y5YA 1RPUA 4Z3FA 2HYMA 2UZIL 4ZFZA 3VFTB 1R3KA 4NM4H 2ZT9C 4WJ5B 3BAWA 3MLYL 4IK7A 1G4MA 2B16A 3SQRA 2X70B 4P5MB 3MRDA 1CO1A 5AVVB 5EMYA 5E95B 3CZUB 4L3CA 1W16A 2WBKA 5LCVA 2FQGA 1Z0NA 1KCUH 3TFBA 1VIWA 3O3AA 4Y19D 5EU4B 2AF2A 4NSKB 4HUWA 2KZBA 3WFCH 4Z5RB 3VB8A 4BJLA 4F15C 1BLIA 5DQDL 4ZO6A 3A67L 1CFTA 4F2EA 3ARYA 2EH7L 5L4MA 2Z7YA 2ITDB 4G8GB 3W5NA 1JV2B 4MWFA 2X44D 2ZKXA 3PHOB 4XNQA 3IDYB 4PJAA 4UAOB 3J7HA 3V6FB 1A5FH 2EDHA 1UWEL 1I1FB 4AEHL 4JFFD 2OTWB 3L6FA 2NTFB 2BJML 4A6YH 4DO6A 2DLGA 4PG9B 1JHTA 1L7TL 4KU1A 1GW6A 3PDOA 3WTSA 5ABAA 2AABL 5SX5K 1H9DA 3LOWA 3Q2VA 2FJHA 5T5FH 3D18A 3S37H 1A22B 1HXYB 2FZ3B 4JRYE 4X0KA 1WV7T 4RBPK 4G83A 1NLDL 2CO6A 3ISYA 2PCXA 4Y5YC 2R39A 4EE2A 1BLNA 2CGZA 2J6EL 3CDZA 5I76A 2EO1A 5CEZD 3Q0HA 1NJ9B 3ASOB 3KDMB 4N1HB 3SE9L 2Z3FA 1SY6A 5F9JA 2EIBA 3NGBB 4GRWB 3P9LB 4BE5A 4G1MA 1F2QA 1XGQA 3S35L 3EOTH 4R96A 4PWGA 5EEVA 1PX3A 4L3AA 3FUKA 1QSVA 1MSPA 4PJXB 1QTSA 1OP3H 4P04A 4HS8H 3VFOB 5JHAA 4FXTA 5JW3H 4YZFF 5T3ZH 1ERNA 2YRBA 3FAXA 2J8UF 4X5WA 5F7MC 2ICCA 1ZT4B 4PJ7B 4DO4A 2EADA 1KULA 2YD0A 1KBPA 2HJKB 1RL1A 5CZVH 2PN5A 4Z7UF 2AJXH 1Q9LA 3TTSA 3ECBA 4Z18A 5DJ6A 1T2XA 4HX1B 3WE6A 1MLBA 2R69L 4D0CA 2NLJB 3NFSL 3L7EA 4JFZH 1NIFA 2D2OA 4XWOD 3T6QC 1N8OE 2EXWD 2VCOA 5LVEA 2EDRA 3P30H 2FK9A 4EPSA 4CU6A 3II2A 3WN6A 5TGBB 2ADFL 2Y7LA 1NGPL 2AK4E 3NVQA 4OCNC 4KC3B 4XO5A 4IBUA 3BVUA 1IFHH 4MCZB 3WD5L 4HCIA 4Y5XA 1INEL 1T0NB 1ZA3A 2VUOA 3ZDZB 4U6YB 5G4MA 5GZOC 5ISZE 1F4XL 1NFIA 3BYTA 1BZEA 3HFFA 4M7ZB 2WTRB 1U92A 4M8QA 5DK2A 1C5DB 3ZDXB 4PRPB 3V0AC 3C60C 5KS9A 4PIBA 2R1YA 1JGEB 3HPJB 3L3DB 4M56A 1TZIB 3O2DL 3RG1C 2Y7NA 2CHXA 2A9MH 4XVOA 1A7NL 4X98B 4PGJA 1ONQB 4N25A 1MFDL 2YSSA 2HAZA 4KHXL 2V5MA 3QJQB 5B22A 3DJZA 2YD5A 1B2YA 1PZDA 5FOBB 3H9SB 4ISVB 1X9UA 2VDKL 2X4PA 5TF1H 5LGYA 1YQVH 5E9DA 2EVGA 3CZJA 1FIEA 4M48H 3QDJD 2ENSA 1MNUH 3BRGC 1WVZA 3RDTB 2YOAA 2YPLD 1KB5L 4X8JA 3WIFB 2HRGA 3V8CA 4PJDE 4IBVA 1CG9B 2ZCLH 4HAKA 1IM3D 4MNQB 5HYQB 4PJGE 1T1ZA 4LCIH 4CGTA 4RZCA 3OKOB 4JFED 4JRXB 4FNLH 4I7ZC 1YHPA 1IC7L 1MCKA 3L4WA 1JNHA 3TASA 4AXWA 5I1LA 3T0EA 2NDFA 2WIIA 1JD7A 2XX1A 3RFZB 4Y5XC 1TVDA 3CFEA 3GJEB 2WXJA 5EORL 3O4LD 4L37A 4PAZA 3S0PA 3MCKA 5TPWL 4KI5E 4BUGA 4JM2C 4NT6B 2JMRA 3RZCC 5DJXB 4E9RA 2G4EA 3GIZH 2PCPA 3MFGB 2G0LA 3MUHL 4OQTL 4F80A 1TU2A 7FABH 1SN0A 2HVJB 2VXVL 3BLKA 3MOAH 4JRFA 1NBZA 4M5YH 1F02I 1GMIA 4UT6L 3EXLA 1FVEA 5GZNA 4NO0A 4YDZA 3BUIA 2FO4B 2XKSA 4L3ED 3WHE0 4JR9H 1MQKL 3MJ8A 4J3TA 1TETL 3FZUD 3T4YB 2YXMA 4N28A 1G9EA 1NCIA 3HG0A 1I1YA 1UXWA 4IU2A 3VWKB 4NOFA 4K7FA 1F4WL 3GLZA 3OQ3B 4WNSA 5FYKU 4EDXB 2H2SC 4L05A 1BPVA 1MRCL 1C7SA 3LH8A 4TUOA 2YAPA 1BD2E 1U36A 3VWJC 2XTJC 2J1YA 1P1ZB 2XWRA 4HFWB 3QS2A 4OCRL 2EICA 1TZGH 2ICWJ 1XAUA 4S0HA 4PVLA 3MBXH 3FQXA 4XVJH 5C0IA 3FB7A 2OSYA 3MNWA 3RWFB 4RAVB 1PDKB 3WY2A 5GGTH 5I1EH 1GOGA 1MRFL 4HLZH 4Y1AD 1WCBA 1MCNA 4W9JC 4WW2A 2ESVA 2GK2A 3CC5B 4PRAA 5BRZE 2C3GA 2YGOA 2ZX9A 1U3HA 1J0HA 5AVUB 3VQLA 4X99A 2K8MA 3Q8FA 3ZYJA 1UH3A 1OD7A 2VJXA 3Q48A 4IBTA 2IVFC 1C5CH 1VZGA 4GXUN 2EECA 5F8QC 4L1TA 3S6CA 5A6MA 1H15B 1A4AA 3O8XA 1KTKE 4ANKA 2QHRH 2VQ1B 2XTLA 4M3KB 5IVXE 3F6JA 5CCJA 3MRIA 4KAQH 1IGTA 4X9GA 5BV7B 5GZNC 4WF7A 3IAGC 2YAFA 5EB9A 1J0ZA 2VN6A 4M9PA 5JPNB 3HG5A 1IEAA 4HOXA 4X6FA 3BN9D 2NCMA 3ERXA 2YPVH 3SEPA 4WUUD 3O11A 4FKKA 2IADA 2XY2A 5EBWA 3C2AH 3GDCA 4JPQA 5A16B 3QDAA 3SBPA 5C7XH 1IBHA 4NUJA 3V4VB 1P4LA 3HNTL 3TF7C 3GSOB 3VE0A 5KAQG 1AE6H 4AW7A 4FYRA 3O2WL 4R5TA 4HIPA 1NKGA 2OX5B 1YRKA 3SO3B 1RZFH 3U2JA 4OLZL 1QR1A 2BM3A 4WW2C 3DLQR 1ZVYA 4HWZA 2YKLH 1J5OL 1E4XI 2EP6A 3QG7H 5EU3A 1U3HC 3ZYOA 4BSVB 4Z76B 1QP1A 3KJ4C 3UG4A 3KL0A 3O3DA 3FCUB 1AS7A 2JKRM 4M6MH 5BXFA 3DTDA 1X5JA 3OX8B 1ZV9A 2OTUB 4NQEA 2ZJSH 3FJTA 3GRGA 3OGCA 2W9DL 1CFSB 5ICYB 3B43A 1S9KC 5I66B 1RUAH 3DXAB 5KYXB 5C3TA 5E6UB 3BC9A 3B5TA 2AQ1A 3ATFA 1Y18B 2UX6A 4H2CA 2HRLA 5FO2A 4FFVC 2R29H 4U31A 3ABMB 4ZYKA 5A7BA 2C9UA 1QZ1A 4JKPL 3QEUB 3GRWL 3GNMH 2BIMA 2WTPA 2Y72A 3FN3A 5IW1B 3BT0A 3M17A 3T3PF 3VRJA 4OLXL 4N8VA 3GBNL 3MV7E 2WXOA 3Q8EA 2AEPL 2G3XA 2XQ0A 1PNCA 4ONGH 4WTZA 4ZUUB 2ED8A 1U8JB 3F84A 1JXFA 1F2XK 3PGFH 5E2UH 3N91A 2FL5B 3UJJH 5CNHA 5ABDE 2L7JA 2K4AA 5AW2B 1ADQA 1JD9A 5LBSL 4W9EC 5J1SC 3TYFB 1NGYB 3AU1A 4LSVL 2DDQH 1IRAY 1EK3A 4LRNH 4AYFA 3OVUB 5D7IE 5EPMA 3EHBD 3O6ML 3NAAH 1UEMA 1YEGH 3QQ4A 2VERN 3SKMA 2C1PB 2EDOA 5KSAD 3GB7A 1QHPA 4UMGA 5AW9B 1NDGB 4R7DB 1KZQA 4M7LH 4JFQA 2BW5A 2CDGA 2EZ0D 3K6SA 1YN7B 5DEFA 4LNRB 4U4IA 5BZXA 3QXTA 2ZD0A 3RTLA 2R83A 2DF3A 2KLSA 3SPVA 3P4NB 5DHVB 1ECZA 5L2KD 5BOJA 3LSOB 2Q8AL 3SOBL 4KO7A 4MMXC 2G3ZA 1HKLH 1N4XH 4X6DA 3QO0A 5FM4A 1T83C 3IGAA 1EFXB 2BIIA 3IMSA 4PGDA 1ZLUK 3JV0A 1DO5A 1DJSA 1J8HB 1JDDA 1N3NA 2F1AA 2HUEA 1NFKA 4Z6AT 5DWUL 1WHOA 1URIA 2V5YA 5HHOE 3HN3A 3QWNA 1DDHB 5MENA 1G1YA 4KK5C 4YSSA 5K5YA 3D8MA 3N42B 4ZNEE 5IGXH 3V52L 3WJJC 2PWFA 3EO1A 4MHHG 3AWGA 4R7NB 3ARRA 1KJVA 4J12A 4LHUA 4WEBH 1TQCB 2BVQB 4E9WA 1WCQA 4NGHL 3KPMB 5F21B 4N2AA 5ILTH 2Z8SA 1USQA 1FBIH 3V0VB 2OMWA 1KGWA 3AGWA 5IQ7H 1P4UA 3BDBA 3SQOL 4QO1B 1X5YA 4UZGA 3DTUB 3D85B 4P4RB 3FPXA 1FL3B 2BRRH 2A7BA 2CBTA 1NM9A 1WH0A 3PIQB 2R23B 2VQUA 1ETB1 5AOMA 5EF3A 1CVSC 1PZAA 3ULVF 4JJOA 1FNHA 1NMBL 2ADJA 3QG6B 4PD4J 3VFPB 3HG1A 3TGXA 5IHHA 5KZCB 1E8ZA 4HS3B 3SJVB 1E5UI 3BKCH 3QEQB 5GSVB 3JWOL 2E75C 2YXVA 4KK9D 5CBAB 5HYJE 5I8KH 1IGFH 1T0MA 5L6YL 1CMOA 4KJPD 4U3CA 3H3PH 3HRZA 4YDIL 1FZKA 5I17A 3EYVB 4HK3J 2K9FB 3ARGB 4PV1C 4ZOEA 3WNOA 1R46A 3D30A 4TQEH 2D9QB 2C1OA 2H3NB 3AAZB 4LKCB 4KNQA 1U21A 2APFA 1OSZA 4HC1A 4QJ4B 5EEXA 4QJ3B 1BX2A 2GI0A 2GJJA 3V8OA 2VDKB 4FLSA 4OD3H 5BOZG 3FTWA 3NIGB 3VI4A 2XN1A 3ZL1A 1XV8A 1MHEA 5ACZB 5FCUL 1LO3H 5JUEH 1KB5B 3GLAA 4PVMA 5E2VL 2XYBA 1ZHLB 4AK2A 2BCKB 1OGAA 3PJSB 4OCYH 3RU8H 3TZVA 4ZMXA 2WLHA 4Z3JA 2XG5B 2Y2WA 1SJEB 3B37A 3ZRSA 4Z3HA 5A2LH 4QY8B 4HIEA 4MX7A 1J8RA 5T3XL 4F24A 3FO2B 2KYIA 5E9DD 1EAPA 1S78C 1PVHA 4Z7QE 3HJ0A 2ZP0T 3KPNA 4F8OA 2OL3H 3ZMNA 3M6DA 1NFAA 5H37G 4H4NA 1IC5L 4Y9EA 3SGJA 2Z4QB 5LJYH 1K85A 2N7BA 3LB6C 1XR8B 2G60H 2P5WD 4JFHD 4KKCD 1AGBA 1U6AH 1DQLL 4CJ0A 1BVOA 12E8H 3FTVA 3GMOA 1XF3B 3HRZC 4N0FB 4ZFQA 3EBAA 2YAMA 2WWOA 2KBGA 4NS0A 1NMCC 5LXGL 1CT8B 2LU3A 5GSRA 3RI5F 4A7UA 2P5EE 2DB8A 2CUHA 2V2WA 4OR1A 3MRBB 4G8AC 3HG2A 5D7KE 3MKKA 2AQTA 3PWNA 2KS0A 1EHAA 1IC4L 3CLFH 1XZ0B 1LD9A 4HD9A 4S1SL 3SDDD 1TQVA 4NRYA 1OTSD 2ZUQB 1EPFA 3FQTB 3LVTA 1PLAA 4R3SA 1FV1A 3OXRA 4G43B 3I9GH 4OCSH 4OAWB 1DLFH 1KEMH 4JRYA 5DJ0A 2KL6A 3OMZA 3VQ1C 4GP5B 1KCWA 1XF2A 5CP3A 4N8UA 4CDHA 2Q3AA 5ADOL 2IEPA 5LN8A 1IAOA 3RB5A 1SEBB 3C8KB 3H42H 3NUKA 4TUKL 1VHPA 2FAUA 4YXLH 4YBHA 2WP3O 5KSBF 1MHHB 2W8CA 1TPXB 1XGRA 3CBJB 1XB6A 4A6YL 1RI8A 3ZSSA 1GCFA 5BJTA 3FUDA 4WK4B 1UWFA 4MQ7A 4EOWH 1NWOA 4FHJA 4Z1PA 4OZGE 3T9WA 5T5FL 4XODA 3GJFH 4QXTA 4YSTA 4HUXB 2PUQT 1JGLL 4WVRA 5DRWB 4AUJA 5A2CA 3QWOB 2JKLA 3MRLA 3V5KB 3GKWL 1JWMB 2EVFA 4YE4H 5I1HH 1ZTXE 3E1ZA 4PSPA 2ZCZA 4PRID 3PE9A 3CU1A 3O8XD 1B4LA 5A2JH 2VRAA 1HQRA 2XN0A 1IAIH 2H47C 4NQSB 4EJ1C 2BVTA 1KIRA 3QS3A 1GRWA 3VGGA 1SN5A 4PJHE 4HS8L 3UO1H 1NTDA 2A74A 1UJTA 1OF0A 1MLCB 1CFMA 2DQHH 5T3ZL 5K39B 3ZT7A 4ZFGH 1FGVH 2FWLB 3RVTC 3WEMA 4YR6A 2AK4A 5IQOA 4I87A 1DQVA 1NGXA 5E8NB 5C0GA 3WIAA 5CZVL 5D93B 1CF1A 3O6KH 5F7AA 2YAHA 4N0UB 2CO3A 4N2LA 5EC2A 4CKQA 3I6KA 1JHKH 3QQXA 4MAZA 4MXQD 2A5UA 1QYGH 5ISZA 3HFML 1EANA 4JFZL 3QXDB 1HWGB 1UXLA 1A6ZB 1F90H 1G9MC 3UBXB 3MJ7B 4Y16B 4L1BA 3P30L 1ZHNA 1J9SA 2NYYC 1I3UA 5IUCA 1OW0A 1NFDB 3HTLX 1G4RA 3MV11 1UB5A 4QLRA 2BHZA 2CDEB 3LS5H 1JPFA 1J05A 1U8LA 5TQ2H 2VLKD 5ITFB 5B38B 5BW7A 4GT0A 4IBQA 5ETUB 3JTSA 1QO3A 1EDQA 4ZDHB 3BIKA 1A47A 1UM5H 2K4WA 2NOYA 5C07B 1CDYA 4XBGB 3S96A 3MNVA 2VMDA 2W65B 1KDJA 3KPRB 4HIHB 2F74A 3E2HC 3TBYB 1X6NA 3BUYA 3VGHA 2NPLX 2QR0A 2X12A 2VT0A 3QCVH 3UTPE 4X9YA 4EKJA 2LAGB 3QDGE 3HZKB 4IEFB 2G9HA 4PJDA 3T8XB 1IAMA 4HSCX 4X7SH 5LNGA 1A4CA 4PJGA 4PJBB 2WLZA 1EEYA 1DBKH 4FZEH 4K5LA 2EYSB 1F8TL 3IFNL 4X5RA 2A9ML 3CTTA 3RTQD 3NJXA 4D8PB 3UAEA 5AVWB 1HH9A 2J88H 3IU3B 1NKRA 1F6AA 3T1FA 3UZVB 4AH2B 5IT2H 1XSOA 5IOPA 3H2QA 1JWSA 4JHBA 3EGSB 4WU7A 2F8XC 1YO4A 1ZY9A 3N43B 3AROA 2YA1A 5HHQB 3B2XA 2HJLB 1YQVL 2RALA 4HK0B 1ZXKA 3DIDA 1MNUL 3MRRB 5LUMA 1QLFA 4Q58C 3N9GH 4P3CH 3Q3GA 2YAEA 3CSYA 2YJLA 3QNYB 1JFQH 1QBLH 3TCTA 1G0DA 1Q0YL 3B9KB 4YWGH 3FK3A 4CBPA 2MQCA 5BW7C 3V4PL 1R3IL 2FEJA 5CP3H 2A6DA 5D2LE 1MPAH 3ULSA 5DLMH 4JN1H 2BX5A 1P4IH 2YLKA 4QHNA 5GIRB 1O9WA 3QWQB 2KQNA 3QORC 4HHAB 3RGVB 5E4EC 1M6OB 1R5IB 4W93A 5H35A 1CFNA 3L3IA 3UPCA 3TWCH 2WN2A 1F56A 4WSKA 3GIZL 3VH8A 1OAUH 3LPFA 4L48A 2W0LA 1S7XA 2FEDD 2Y2TA 4RFNC 2VLJB 1G9MH 2D3NA 4EI6A 1BD2A 5HVFB 1JV5A 4BINA 5E1IA 3QO1A 7FABL 2DEWX 2J56A 2DWDA 2WXLA 3L3KB 4G71B 1YNTF 3GZQA 5D4HA 3MOAL 4ATWA 2C3VA 1OARH 2HLEB 3LN9A 5IBTH 3OQRA 1V10A 35C8H 2MPAH 5I8OH 3ZKXB 1KN4H 3F01A 2DTMH 3G5VB 1TQWA 3CAFA 3EFOA 5SX4I 2Q6WA 1C8QA 4HMCA 4WW1B 3WN5B 4YIQA 5BRZA 4KI5C 1E4WH 5FA4A 2KZKA 4YSDA 3I6LD 5HYIA 4OGYH 1L9SA 3CXFA 2FATH 1INQB 3B3BA 1RUKH 3LDBB 4FFWD 5IVXA 2WSDA 3HIZA 3VFGH 3LXBA 3O0RH 3PP4L 3HZMB 1JZFA 2QEJA 3DYPA 3GLDA 3MBXL 2ID5A 4U1HA 2QPDB 3NZSA 2BZ7A 3FUEA 5I1EL 4CAGA 2HA1A 3DROA 4P9ML 4AEIL 5IHUL 4N9OB 1FZOB 1KXTA 1A6TA 4WI5A 5I1CH 4NOBA 4HS6A 2A9NH 4JFDE 4JDTH 3DWTA 4OGAC 1OHZA 2E56A 4H25B 1KBGL 3UPRA 5CEXA 5F7HA 3LZFL 4M5ZH 1CXLA 2WYHA 4HJ1A 2ATPA 3CSFA 1S7TB 2VC2H 4M02A 4YHNB 2FBOJ 3QXAB 5FB8B 3FO9B 3PV7A 1Q9WB 3VVWA 5I0WA 3BUBA 2WIMA 1NQBA 2WZ5A 1IT9H 3AW5A 4PMEA 2JVUA 1G7LB 4NC1E 5C0BE 1U8OA 1YLBB 2P5PA 2VXQH 4ZX6A 1P5VA 2ED7A 8CGTA 3AREB 4B9ZA 4Z7IA 3L16A 3C2AL 2NY6D 2JJTA 1KV3A 3DURA 3V7AE 3ZZSA 1Z66A 3KCWA 4GUQA 2ZCHH 1JF5A 1AE6L 1HZHH 2WBJB 3W0WD 4PP1D 1JNNH 1RUQL 1K8IB 5B1JC 2L7QA 4V11A 3FT1A 2ZOKA 3G6DH 3C6LB 4KKAC 4WO0A 1I9JH 2FHBA 1RZFL 3BZ4A 4WO4D 1R5WB 5HHPB 4M43L 3AY4C 3QG7L 1A6AB 5B7FA 1SXNA 5IQMA 5EO9B 3N85L 5DZPA 1BG1A 5B1BB 3N44B 1UOKA 4BFEA 3X1GA 1BREA 3K6NA 1RLWA 1NIBA 5D71L 3MNDA 4U6XA 3MV7A 3AM8C 1K2DB 3AXLB 4M6ML 4PJ9A 3TLRA 2F53D 1ND0B