4FFWC

Crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
210
structure length
207
Chain Sequence
QIVLSQSPAILSASPGEKVTMTCRASSSVNNMHWYQQKPSSSPKPWLHGTSNLASGVPVRFSGSGSGTSFSLTISRVEAEDAATYFCQQWSNHPPTFGGGTKLEIDRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system, inhibitor
molecule keywords Dipeptidyl peptidase 4
publication title An Inhibitory Antibody Against DPP IV Improves Glucose Tolerance in vivo - Validation of Large Molecule Approach for DPP IV Inhibition
rcsb
source organism Rattus norvegicus
total genus 29
structure length 207
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwC01
3I75A 4PJCE 1W0VA 1TJGL 1BLNB 5KSAB 3QEQD 5E9DE 4Q0XH 3SDXE 3UYPA 3LCYA 5C6PB 2DOCA 3X11B 2YD3A 5IFJA 3RA7H 3QUZC 1J8KA 4CN1A 5HI5D 1P4BH 4R90H 5F3BB 4OI9A 4X7CC 4IM8A 5F88B 5FECA 3ZT6A 4JGJA 4PGCA 1A7OL 1I9IH 1YZZA 3O6MH 3T65B 1A1OA 1JPST 4M9OA 1N0XL 3GSOB 4Y5VB 3S6CA 1A4JA 2V9RA 4NN7B 5J8OA 2P5WE 5C0FA 4Z8FH 4QEGA 3UDWC 4MA1C 5F71A 5EO9A 1T0MB 3HMWL 3MLYH 1BBDL 4XTRD 5C09A 4E5XB 3SKNA 3MC0A 1K8DB 4OF7A 3O6LH 2VDNH 3EZ8A 4OFYA 4KKAC 4RFOH 3RPIA 3O11A 2XKUA 1RFDH 3CPLA 4YXKH 3U7WH 2BRRH 4R7DA 5LGJB 1TJHH 4ERSL 1A6VH 1C5DA 4HBCL 5C8JB 4K23L 3QIUC 3QQ3A 4L5FL 4LDOB 4D9QD 4AEIH 2VZSA 3C87A 2DBLL 1HQRB 3BSZH 2C4FU 4KDWA 3FQWA 3T2NL 4ZAKD 1DVFA 5CHNB 3ARGA 3L95B 3IDGA 3W11D 5HHPA 3MV01 4G6FD 3ZTJG 1CD1B 4K8RL 3CMGA 5C0AD 1CLOH 5B8CC 3BXNA 5E4IA 4PTUB 1MFAL 3MV7E 2EE6A 5DMGD 3T0ED 4Z76A 5AD0B 3C5SA 4IIQA 1D5BA 4DTGH 1FLTX 1PG7H 3ALPA 1YEFH 3WS6C 2V7HB 5FYJE 2NW3B 3GGWB 4M4RA 2MFNA 4BH8A 2B0SL 5GGVY 4GAYA 4YHZL 4WWID 1T22A 1NBYB 4HFWB 3GMLA 1B2WH 4PJ5A 5FOBB 4QRUA 2CO7B 1KUMA 2LAAA 1IILE 1FFRA 5TQ2H 1LE5A 1ORQB 2V2WB 4HJ0D 4XPFH 3WFHA 3VXQB 3SDDC 1CFTB 1LK3H 3QUXB 3H6JA 3QI9A 3MGOB 4DKAA 3HFMH 2WV3A 3CSBA 4YUEL 4RGMB 3KPSA 4UOW0 2B4CL 2JCCB 3CVIH 2EKSB 4GRWH 5HHXL 1CTOA 1QLRB 2Q7YB 1MVFA 2PO6B 2EC9U 5I1CH 3R0NA 4F7TA 4FG6D 8CGTA 3D39A 4M7LH 2DLFH 4I0PD 4NHUA 1FL3A 3TM6A 3S35X 1DBML 4HPOL 3TWCL 4OLWL 3H0TB 2X1XR 2Z8WC 1H3WM 1PQZB 4XPBL 3AU1B 1VGEH 3LQZB 3MJ8A 4ZFZB 3UBXG 4OJFH 3T0DA 5KW9L 2C1PA 4PY8I 1MCOL 3STLB 5J1SC 5JW5A 5CFHA 2LQRA 3PGFL 3QQ9D 4NC2B 1J8HD 1PSKH 5HYJE 5JO5B 4I2XE 2NXZB 4BZ2H 5EIVA 2HKFH 3KYOB 4X6FA 4ZO8A 4OFIA 1MHEA 5E00A 3MNVB 3MFFA 4JFQA 4P2RA 1H8OA 1HIML 2F19L 1OAUH 1KC5L 1PZ5A 2GSGB 4LHUB 4KKLC 2DQDH 2WQRA 2QADB 3V5DB 4O58H 5DD5L 3QDGE 4CRPA 5J1AA 1DDHB 2P4AB 2C26A 2G5BB 3VFOB 1Q8MA 3NOIA 4FQIH 4RMSA 3O3BA 4PJCF 2NY1B 4O4YH 1K3IA 3I84A 5EU4B 3WEXB 3HE7B 4I0PC 2ZJSL 2X6MA 5J3HD 4M1GH 1D6EA 4JFXB 1A1NA 5IMKB 3H9SE 3BPCB 3GJFK 2VE6A 3LS5H 5SWZE 3TV3H 4X5WA 1CL7I 2YPLB 1A14L 3VXSB 1AO7D 2HRPH 5C0DB 4U0RC 2JK5B 3OKEB 5DQ9A 5L0QC 4YGAB 2IF7A 4LMQE 1MIML 2O5ZL 4IRSD 4H88L 1J0KA 2RCSL 2DQCL 3MRFB 3K2UL 2Y06L 3G04B 3QIWB 3MXWL 4Y4KB 3DURA 4NQDB 4NN5C 2DAVA 5HDBE 3S36H 5IFAL 2I60H 4XP9H 1N2RA 1MI5B 1RQ5A 4ZFFB 1I7ZB 1YY8B 3AS2A 1LO5A 4U6VH 3VFWA 2B1AH 4PRHA 3AY4C 1MAJA 3O3AA 3WO4C 3RWFA 2R23B 1U8KA 1P7HL 5IT2L 4A2LA 1NANI 3WFBH 5IJKC 5GRVK 2WQ8A 4JN2A 3G08B 1UGNA 5KTEL 4HIEB 1IGCL 5GHWH 3BIAX 4NO5A 3LDBB 3LH2H 4LKCB 2P8MA 3CUPA 2ITDB 1QFWM 2PCPA 1I9RL 2BNQE 2HP4A 2EH8L 3NIFE 3EYVB 2C3VB 3CFCL 3KNBA 5BXFB 3ZZ1A 1S7QA 3K2MC 5H37G 1IGIL 1JWMB 5I75B 5D93C 2P46B 4GO6B 4OUUB 1T1WA 1IAIH 3NGBB 3C9NA 2X89A 3QIUA 3LMJL 1WCQA 4NQCB 1HDMB 2B1HL 1KSRA 4IRSC 3D3VA 3G5XA 2ZOKB 3QA3B 3IJYB 4C56E 3RDTA 3MACH 2PW1B 4H20H 4JKPL 4MAUL 5BRZB 1JVKA 3QIBC 4XP5H 2A0LD 3KHOA 2GJJA 1UH3A 3LIZL 2ADIB 2AV7A 3LEXB 3U48A 4Q74A 1IEAB 3AMLA 5DRWA 4MMXC 4HIJB 4LGPB 2DYPA 2ZP0T 3NFNB 3LD8C 2EDRA 5I76A 1YEGL 3MRNA 3VA6A 1A9EB 1G7IB 4Z7VE 2EEBA 5C6WH 1F6AB 1OVZA 4NJAL 1RZFH 5J6GB 4JGMA 2EDTA 2A77L 1IM9B 3UTSA 3C09B 4K7FA 2XTJB 4UTBH 3CXDH 5FGSA 5I16B 1AQKL 1XF3A 1JHKL 2F15A 2F5AL 1EGJH 1SM3H 3C60B 5DMKA 5HVWA 3DI2B 4ZUWB 1D5ZB 3U6RA 3EYQD 5CJ8A 2P24A 4PV9B 3EFFB 2Q86B 2WBJC 5HPMB 2QHRH 3SDDA 3C8DA 1I1RA 1MJJA 5DJCA 4MJ5A 4TUOA 1KTLB 4QY8B 1Z0MA 1GZQA 3DMMD 4ZXBC 2VDPH 5FK9B 2ZG2A 4MCZA 4PJDA 4ZS6D 4P9HL 1EEYA 4YWGH 4NRZB 4RAHA 4LKXA 2Q3ZA 3U4BH 3KYNB 4X6DE 1DEEA 3FOMB 3GSNL 4CMMA 1CD8A 1MFBL 2BNRA 3VXNB 5KS9F 4EI5A 4YQXL 3DUUB 1I1CA 3JTSB 1UYWL 5E1HB 1FZJB 1V7ML 3D9AH 1MQKH 3HNVH 1H5BC 2G5RA 3MLZH 3PF2A 3TC9A 5I1KH 1X4XA 2E9WA 1CGVA 1CVSC 1JWUA 1CT8A 5DZOA 1U58B 5M94B 4DGYH 1CGXA 3BH9A 4O2FA 3TT1L 4MHHG 2ZZUT 2LAGB 3P9LA 2P45B 5KN5B 3IJSB 5FYLE 4LLUA 4HEME 3ME0A 4MQ7A 2ZUQC 4NZTH 1JF5A 4U6YA 3CVHH 3MCKB 3WIHL 1K9TA 1SEBA 4HC1L 2DIBA 1OQXA 2ZUXA 5HGDA 3SGEI 3BRGC 4LPCA 1KNOA 3R06B 3I6LD 5HGAA 4MNGA 3M1BA 3U9UB 25C8H 4U49A 3DGGA 4L3EA 3BP7A 4QHMA 3UTTB 4DKFH 3G5ZB 2R0KL 3KLAA 3CDCA 2XZQH 4XCFL 3S4SG 2AEPH 3WN5A 4Y16B 1XCQA 1D5XB 3QFJE 4XHQA 4J2XA 5I15H 1TQCC 3T4YA 4Z18A 1BGXH 2C7UA 3GSXB 4YIQB 5D7JD 4GUPB 3PWNA 4HKZB 4FFZH 3KYMB 5T3XD 1A02N 4F57H 2NY4B 4NWTH 1DR9A 1JZ2A 4JFEB 3VXRA 3SKMB 4POZD 2XWBA 3IU4H 1OAKL 2C1OA 4XMKL 4U1LB 3EFDL 4K7PY 3M17B 1EGJA 4HK3N 1PDKA 5MEPB 2BOCB 3TYFA 5ETUB 2XY2A 2IAMB 4PY7A 5KVEL 4IEFB 2DD8L 3S37H 3DXAD 3GI9H 1WGOA 5A16B 1RIUH 1TFHA 4LLWA 2FX8L 1XGUB 3DX6A 4QRRB 1S9VA 3GBNL 3T77B 3T3MF 1FNEB 4ENEC 3ES6B 3TBWB 1JL8A 4MA3B 1KJ2H 2WNGA 4GRLC 5D7IE 1QRNB 1ZHBB 3ECBA 4NOFA 1FGNH 1CICB 1JFQL 1J11A 5BS0A 5ITBL 1WZLA 4OTXL 2Z31C 4YEEA 5AG8A 1T7VA 1EAPA 1I9JH 1TPXC 3UCRA 1G7MA 4KQ4L 5E8OA 1MJ8H 3ZHLA 4KKCC 3AROA 3RL1B 4ORGB 5D7JC 1CL7L 2Y07H 5HHMB 3LKRB 3AY4A 5DVLA 3NIFF 4G9FD 4HUMB 4MAYC 5MEOB 4JG1H 4FMFA 4POZC 1QLFB 3CVHA 2VH5H 4WU5A 2IBGA 2Q87A 5IJKA 2BX5A 2AJ3B 5F21B 5I8CB 4GKNB 3SPVA 1CD9B 1WZ1H 3SQOL 5E2UL 1UA6H 2HWZH 2BNUB 4JKMA 1BQUA 1XGYH 1U3HA 3FFCE 5DYOA 1T1YA 4WV1C 7FABH 5EU7C 1KJMB 2BVOB 1N3NA 1X6LA 1BOGB 3O45A 4KTDH 5CJBA 4P49A 4O02H 2RB8A 2OMBA 3H3BC 4M1DL 3HNTL 4PRDB 4HS6B 2BJMH 4KRNA 4ONHB 5ENWB 3S5LG 4PJCB 3CDFA 1VACA 4LQ1A 4MNQD 1AKJB 1RMFL 1XR9B 2FIKA 2VXQH 5D1QB 5C6TH 3HNSL 5L7XH 3ARZA 1EPFA 1OTSC 3M45A 5E9DB 4APQD 3QIBA 3SDXB 4PS4L 2XKNA 4JRWA 4LFHD 3I6GA 3MRPA 3OF6D 4KVNL 4FQHA 4MQSB 2OTWB 3BP6A 3ZL4L 2FGWL 4UT9L 3OAYH 4ODVH 1VCAA 1EVTC 1DBKL 5ALBL 3U7YH 1JPTL 2YUVA 1NCUA 3FRUB 4KDTC 4QF1A 1GGCH 4U1MA 1KJ2A 4BFGA 5SWQA 3U79A 1ES0A 3BT2L 4JZNA 3TNMA 3HCVB 4PJGE 1BZ7B 4HK0B 1E28A 1DZBA 3BKML 2F53E 3ZTNL 4N1CA 3D18A 1AGDA 4HWBL 3ZE1E 2A38A 3K3QA 2P5WB 3KS0H 2OTUA 4KI5C 5CUSH 2VISB 2WBJA 1P1ZA 5HHVH 4PD4K 5IMLB 2J8UE 1X4ZA 1OGAD 3F65A 4KRMB 5L6YL 3I02B 3TVMC 2R0ZL 4LIQE 1ZGLB 3TIEA 2W9DH 3EYOB 3MCLL 5CEYA 4ZXBA 5KG9B 4ZPVA 1ZT4B 4L3CB 5DT1L 1F8TL 3GSWA 5IMMB 2E27H 3MFGB 5AYUH 3QG6B 2Z91A 3A0OA 2DJ4A 2WP3T 4NGHH 2XIDA 1KJVB 3AC0A 3KXFA 3U1SL 1U8HB 5GS1B 4FMKA 1T2QH 3Q6GH 3I9GL 3C6LC 1WBZB 3JV4B 4RISL 5FA4A 4PJHA 1H5BA 2DMCA 4OZFG 4U3CA 1BBJB 2EE2A 3HS0B 4PJFE 3GO1H 4BFIA 4YXLH 5JXAH 4XC3H 3MV7B 4M7JL 5HYQA 3QEGH 3VGEA 2LTQC 5D2NC 1S7XB 5JZ7D 4Z78A 3FKUS 4G7VL 4I4WA 4AK1A 3DGCR 3KPOA 3W2DL 4R0LC 1NFIB 4YDVB 5I19L 2FATL 3HI6H 5ILTL 4JGUA 1I8MB 4X7EC 4FFVD 3VFMB 2AJYH 2GJ6E 3P4OA 4XVSH 5C08B 1ZLUH 1LK2A 1ZLVH 4EI6A 1MY5A 2YPVH 3MUY1 3OKNB 5ACLA 3RGVC 2K7PA 4QHLB 4KPHH 4D0DA 2NLJA 3A67L 4WNQA 3MR9B 1UQSA 2R56H 2FX9L 1ZS8B 1Q9KB 5F7NC 3C6SB 4JY5H 4P2QA 1GH7A 4HT1L 3BISA 2IFFL 4RBPH 3UO1H 1NAMH 1PZUB 2KPNA 4YPJA 1HXYB 2FYYA 5BO1L 3DNKA 3IKKA 4JPWH 5DA0B 4QLRA 5FKPB 3O4LA 5GRVL 3ZMRA 1OWRM 3L3DB 4HIIB 4BZYA 2AJZB 2J3SA 1U8NB 4LVNC 5DRZA 1J88A 5D9SB 3PWPD 3IFNH 4BZ1L 1PX4A 3SOBH 5MEND 4PRNA 3QWOB 2UWEA 5BZWA 4LPTA 1AC6A 2EDFA 1LDPH 4NN6B 1D9KB 4GRLA 4KH2A 1I1AA 1WIUA 3TESA 4WO4D 5IQ9B 2IMMA 3X12B 2G60L 1J5OH 1OB1B 5KS9B 2Z31A 5CINH 1UXWB 1AHWC 4GOSA 2P5ED 4AMKL 1FBIL 1L7IH 5HYJB 4YFDB 2IAND 2N7AA 3BP5A 4I2XB 3V4PL 4P9MH 5DJYB 1KCUH 1JPFA 4MDIA 3U0TB 1Q0YL 1Q0XH 2V17L 4MAYA 4Y4FC 4HD9A 5KSUB 4JQVA 1MFDH 2P8PB 5B39A 1CDBA 4IRJD 3LKQB 3BPNB 5D72H 3RTQC 3T2PA 3WNOA 5EU3A 3DX9A 1NC4D 3GIZH 3QDGB 4MJIE 3IDNB 5JW3H 4WV1A 3CD4A 4K3EH 4XCEB 3IXAA 4JZOA 1RZ8A 4LHQB 3KJ6L 3U0WL 1JYVA 3MRCA 1ONQB 1S7SA 2VDQL 1XH3B 4J6RL 1NAMA 1YNKL 4QCIA 1UWEL 1KCRH 5F1IB 4L1DA 3H9SB 2VLLA 3QDJB 5IVNA 2VLKB 3E2HC 3UROR 3WS3B 3S4SB 1NSNL 3ZKMD 2DKSA 3JV0A 1MFEL 2AGJL 5ESVB 4R7NA 2JKXA 2VZVA 4JPVH 4GMTL 3IS1X 2W9EL 4I3SH 3PL6B 5E8DL 3LKOB 2EYSB 4WGVB 5C0BE 4U2ZA 1CE6B 4N0FB 1FZOA 1Z9OA 1JZ4A 1LNUB 4KDTA 3PABB 2X1PA 5DWUH 1BFOB 2A9ML 4M9PA 4JVWA 5KSVB 1HHHB 3CFJA 3VI4E 4IRJC 3SJVE 5E2WL 3KS0J 4LF3B 4DK3A 4CU8A 1MUJB 4H8WL 3BP4B 3BPLC 3KPPB 4MCYA 4M62H 4O51B 3Q1SH 1INEH 5GGSA 2VR5A 4U0QB 3GFUA 3TBYA 5IUSA 5FAAA 4RDQF 2Z8RA 3OAZK 1HSBB 4XCNA 1MF2H 4JY4B 3T8XB 2BNQB 1A6AA 2OLDA 4TOYL 3T0BA 3DO3A 2VLRE 1K4DA 2QQQA 2EO1A 4NRXA 5KZCB 3VGAC 1QFWH 5E6IB 4M61A 3WXVH 1Z5LB 5T1DL 3CCHB 1DL7L 4E41E 1I3GL 3MBED 3ROLB 1UB6B 3LS4L 4YDKL 3SE8H 4KK5D 5HHNA 1A22B 5CZVL 1IGMH 3C6LA 4PGZA 2Z8SA 3LSOA 3GSUA 2DQUL 1B4JL 5T1LB 4RIRB 4FA8A 4L29A 4XBEL 4Z7UF 4XHJC 4KDVA 4KFZC 1KIRA 5HHOD 2HKHL 4JZJB 2L4OA 4GSDL 4MX7B 4CMHC 1CDJA 4NKMB 5CSGA 2ADFH 3VDBA 1JHTB 2I07B 2R15A 5D2NA 3VXMD 5JR1L 1W2KT 4R0LA 1TNMA 2BSRA 4PBVC 1PLGH 3RPKA 4F7EB 2X4NB 4JPIA 4Z7VB 4MXVE 4XC1H 4GMSL 1M6OB 4HULB 7CGTA 1SYVA 2ED9A 2X4PA 4F58L 2MQCA 1BVLB 5ID0A 5DJXA 5F97E 1GGIL 4AT6A 2O61B 3ZHDA 3S5LB 4YAQB 1EEZA 1JHLH 1WCBB 5D71H 5FXCH 4NCC2 4P4RB 4L4VD 4C83B 3WCYA 1NCWL 5F9AC 3IF1B 1QUNA 4A6YB 1NJ9A 1RIVL 3NFPA 1QPPA 2FJFA 4P46B 4S1QL 3CSYB 2YZ1A 2APBA 5I1JH 5TJWK 3OTTA 1MWAH 2ZWLT 4MJ6A 3QCTH 1B88A 4ODHL 1HYSD 4X6DB 1ZSDA 2ZOLA 1YN7B 1P5VA 3D69A 3FCTA 2AJSH 4AENB 2JJSC 5D7KE 4HUWA 4U1JA 3UJTH 3R8BB 3VWJD 2BHUA 3LPFA 2R69H 5AWNL 4QTHB 4AG4L 4OZHE 4ELKB 2JELH 4G6ML 5DUML 4TVPL 1AHWA 2PR4L 3UTPE 2JB6A 1KIPA 3NIDE 1LDSA 5B38G 4HZAA 1XGQA 1EV2E 1A7QL 5DK3A 5KVGH 3CAFA 1SQ2N 3L7EB 4KZEH 5C07D 3BQUC 5J89A 3DARA 4OIIL 3RVVD 3SGDH 5T3ZD 1DANU 1NMAH 3EYSL 4XRCA 3FT3B 1BQLL 2GY5A 4HIXH 4TTDD 3BIKA 4ZS7H 3TP4A 2YSSB 3BE1H 3RTQA 5CZKA 4BKLA 1H3TA 2MPAL 3B2VL 5GRUH 1UZ6F 5E7FA 1T1ZA 5EC2A 1A7RH 2HT2C 4JDVB 2IPKA 4YHOL 2IH1B 2AI0L 5D6CB 4HHAB 2IALB 4TSBH 1ODAA 1WAAA 5FUCE 2PXYC 4N5ED 2VABB 3DV4B 2P8LB 4IDJL 4FABH 2Z92A 1CXLA 4PRIA 5F6IC 1G9ML 4CNIA 2AXHA 4G8FA 1T0NB 1INDL 4GQ9L 3RBGA 4F7CA 1QBML 1JIBA 1F11B 3DO7B 1VPOH 4NQSB 4HGKC 1YEHH 1BFVL 1MWAA 1DUYB 4TVSa 2QKIB 4H1LH 2O5YL 1VFUA 3QG7H 3ZKNC 4C58B 4PGJA 1YEDB 1W72L 4PG2C 1A0QH 1WVZA 4WI5A 2VDMH 4XPTL 1FYTB 4MXQD 5J12C 5K9JH 5JXED 1IZJA 4JREB 3F7VA 4QXTB 1N7ML 4RSVA 5GGUB 1T7WA 1RZGB 3TNNA 3HPLB 1UVQA 2DM7A 2NR6D 2VAAA 2KKQA 4ZDHA 2OI9C 1GC1C 1WFUA 1XT5A 2AEIT 2ITCA 4FQXB 3ULVE 2NYYC 4UU9A 1IGFL 4LLVB 5DQDL 1R3KA 4LSRH 4XH2B 5J11B 2ID5A 4YGVB 4U1NB 4EDWL 4D8PB 3QXDA 3FFCB 4XT1C 4P5TD 1JYNA 4JFDE 4QXUH 2PYEE 4HJGB 5GZOD 1RUAH 3D3VD 4LU5L 1QHPA 4RWYL 4EOWH 1AY1H 3J8F7 4KK8D 3QXWA 1VHPA 3NPZB 1L7TH 5DMIL 4ZOCA 1KELL 4GRWE 3CH1A 5KSAC 3SO5A 4Z95L 1PYWB 1U92A 3OKLA 1NBQA 1TJIH 2O5XL 2OL3L 1R5VB 1NEZG 1U91A 1SJXA 2H6PB 2HJKB 4TNVF 4NUJB 2VOTA 4HCRL 1U95A 2JB5H 4HX1A 4PJ7A 2JIXD 1OAQL 1X5YA 5IB3B 2C3GA 1A5FH 5ERWA 1Q38A 5HXMA 1OPGH 1CDHA 2VQ1B 4XNUL 1H3XA 3LKPB 4UV7L 2N1KA 2NNAA 4Y5VC 4LBEA 1BM3H 1QEWB 4V1DE 4XWOC 4D9LH 4H1LA 3MJ6A 5D7LE 4NN7C 3B5TA 3K7UA 4X4MA 3RRQA 3PGCA 1RVFH 4CAGA 1T66D 1CIDA 3C5ZA 4LAQH 2VNCA 4OF0A 1ETZB 4GH7B 4GAGH 1MEXH 2QQKH 3HAEB 3RVXD 2F53B 5JIHA 1T83C 2R9HC 5C2BH 1E4XI 2R8SH 1Q9WB 1WTLA 1FLRH 1BP3B 4QRQA 4F7PA 4G3YL 5C7XL 1JNHA 3AXLB 2ESVD 4O00A 1CK0L 2VR4A 3ZKSD 4X7FC 1FDLL 2J8UB 4JB9L 2HLFC 3MV11 3QEQE 4PRPD 4M6NL 3S34H 3FB6B 1N26A 2CDGB 3S8WA 4YFEA 4UV4L 4DQOH 4HKBA 1N64H 4X7SH 2YD5A 3QXAB 5JHDA 5I9QB 1HHKA 1RUKH 4OQTH 4HKJA 2FD6L 3CGTA 1B9ZA 4RAVB 1PY9A 1OT2A 4PIRF 2EEDA 3MZTA 2IFGA 3L1OL 3FB5A 2JJSA 3BVNA 3GMMB 1BX2B 1AXTL 1I1YA 3BZFA 4R3SB 1NCAL 3G6DH 1NGQH 1FNGA 3VCLB 4KJPD 4N0YH 4JFYB 2EDNA 3OJVC 4PJAE 1UZ8B 1T66C 1GC1H 3DSFH 4L3ED 5C0ND 4GG8B 1G6RH 4KRPD 3L7FB 4XZUB 1PKQA 3S35L 3QRFM 1CZ8L 4XNZB 4HV8B 3IXTB 4U1GB 4EXPX 4JRYB 4QNPE 3BQUA 3AVEA 2GJ6B 2R1YB 4PRAA 3FQUA 3GKWL 1QQDA 2NXZD 3OPZL 5D70H 3VD5A 5J9PA 3OKMA 2HTLD 1MVUB 1CQYA 1ZT1A 3QUXC 5FYKU 2KBGA 2J2ZA 2BRQA 3Q6FA 3A6CL 1F4AA 3CFDA 2F74A 3TCLB 3QWQB 5LQBL 4NZJA 5C0AE 4RGMC 1EMTH 1NCBL 5F72S 5TGBB 4D9RD 4XP4H 4I1NB 1TMCB 3VRLE 3PGDB 2F8VA 2R29L 2PXYA 4XXCC 2PO6C 3P4LA 3T0EE 1XF1A 5CCKH 2GITA 2YUXA 1JNLL 2VIRB 3E8UH 3HE7D 4R8WH 5GZND 5IVXA 1O5DT 5C2UB 3KPTA 4FTVD 3QEHB 4KJPC 4J3SA 5EZOL 3NA4A 4FHBD 4HLZG 5DD3L 3RUGA 4BQ8A 4Y5YB 4ZSOE 4BSVB 3E6FA 5CD3B 3P4MA 4ETYA 2XXMB 5JIPA 4PB0L 4EUPB 4OQTA 1I8KA 1WUNT 5BMFL 4KVCL 3QUKA 2VN7A 1T2JA 2NY0B 2DLTA 3ESVF 3RIAK 3MLTB 2X70A 2JJVA 2NXZC 3G9VA 1L6XA 2DQJH 4FNLL 3VFRA 3QNYB 4XNYL 3IDXL 3MOAL 1OF2B 3L5WB 3CX5J 3LN4B 3LKNA 4NQXB 1IQDA 2BHYA 2W60B 3BKCL 3G5VA 4RNRB 1U8PA 3QHZH 1F3JA 1G6RA 5EUOF 4I9WD 1IGYB 2QADC 3NA9L 4PJEF 3TN0D 1U8OB 1EO8L 4LARL 3TBSA 4BQ9A 4GRMB 1C8PA 4XPGH 2DQGL 2NY1C 3BDYH 5D5MF 4MJIB 4Q9QL 3HE7C 4I48B 4JLRA 4X98B 5IBLD 3VI3F 4ZMAT 5DJDA 3T1FA 4BQ6A 5TE7L 2GAZB 2AABH 3MV8A 2B39A 1C7TA 5IOPB 2BSTB 3D85B 3CU7A 4NKOB 4NPYB 1DUZA 2F54A 4JFFD 5B38B 1LILA 5D4QA 3FMGH 3QULA 5CLTA 3RZCB 3S96B 1XMWA 5C0EB 2XA3A 5T5NF 1BLNA 5KSAA 3MZGB 1AJ7H 3MRIB 2FHBA 2LVEA 3B83A 3P4NA 1J8HE 2BSED 4AEHL 4J1UA 3X11A 4WW2F 1F97A 4PP2B 4XCYA 3QJHB 4PLOB 2PTUA 3QIWC 2CLRB 4Y4KC 3VG0H 4OCRL 4NWUH 4TPRH 1PEWA 5F88A 1WWBX 4R26H 1T20B 2IBBA 3FAXA 5GSVB 2ICWB 4LCCB 4I13B 3UYRL 3MRHB 1QBLL 3T65A 1NCDH 3VH8G 2ZSWB 3GSOA 2R1WA 1CN4A 4FFWD 1FCGA 1FFQA 1D5IL 1F3RB 2BFVL 3V52L 4GG6F 3GM8A 2ZCLH 1KENL 2DL2A 2X4TB 3CX2A 5MP6H 5CJOH 2QQNH 2W0FB 1T83A 4XVJH 2CO6B 2P7TB 3LDBC 1A9BB 5IBLC 3C60D 3QNZB 3ARTA 2XYCA 3CDGA 1MIEH 4DUWA 3QDHA 3FO2B 4QOKD 2FO4A 4NYLA 4LVHB 5I75C 1AO7E 3ARDB 4LQFH 2BVYA 5D1ZB 3CU1A 3V9FA 1CFVL 1KPVB 3H2WA 3IDIB 4Z7WE 4C55A 4ZD3H 2BZDA 2HVKB 4Y1AB 3NGBC 4RX4D 1HOCB 2VLRB 2RFXB 2DI9A 4KMQA 5CEZD 1U3ZA 3O2WL 4JDTH 3UEZA 5SWSA 1FVDB 4LSUL 3WKMH 5K9QI 1E4XL 5CHNA 4E41B 4PUBH 1ZEAL 4R2GD 1CD1A 2DMBA 3QYCA 4FZ8L 5DO2D 2P48B 4PTUA 2CDFB 3QHFL 1GGBL 3REVB 1S78D 4WJ5B 5BVJB 2VDRH 1ZTXL 4HF5H 4QNPF 4GXUN 4OM0H 1NCTA 1LO2H 2E7CA 1U2CA 3DUHA 1AQDB 4RCAA 2NY7L 2V7HA 4EVNA 5KVFL 4NT6B 3TCXA 4X99B 2NW3A 3C09C 2XTJC 3GSNB 5B3JF 1FG9C 4KXZH 1NBYA 1QNZH 1MCCA 2ZG1A 3C60C 1X6NA 5FOBA 2X4RB 1F4XL 3H3PH 1TETH 3RBSA 4JO2L 3V7AE 1OAYL 3ET9F 1M05B 1HKLH 5TFSH 3W39B 3RWEB 1CFTA 4Y16D 5L9DH 1KF9B 1UWXH 3IFOA 3QUXA 5E4EB 5DHVB 3N50A 3OX8B 3G6JA 1NEZB 3NZHH 1KN2H 3UXFA 4UBDC 3GZKA 2EC9T 3JVGA 5EORL 3PJSB 4XWGL 3V0WH 2NY4D 3JV6B 4JFED 5HI3D 2JCCA 5ISZB 1ZHNB 3KXFE 1A4KB 2EKSA 4TUKL 1EK3A 5CGYD 2L7UA 1VDGA 2PO6A 4M1CC 2NY5L 3MV9B 4ELMF 1VEPA 2YEZA 5FGBC 3TO2A 4XGZB 3NCMA 2E6QA 5F7HA 2EECA 3O9WA 1PQZA 2DICA 3AU1A 2GKIA 5C3TA 1CFNB 5K59F 3ZE2F 3DVNB 3GKZA 3HI5H 4PR5B 5IR1B 5C0CB 4CKVX 15C8L 2XA8L 1IAMA 1K8IA 5EDXA 1KYOJ 3WDIA 1UACH 1FP5A 1CLZH 2CQVA 4LDEB 5JO5A 3UZQA 1E4WL 4KRLB 1JI2A 3NH7H 5B4MC 2ADJB 3KYOA 1KIQB 4MSWA 1LEKB 3MNVA 1IKNA 1KJ3H 2BY2A 1CR9H 2A6JA 3AFLA 4Y16C 3HE6A 3T0VA 4QWWD 1Q9LB 4Q0XL 2HYMA 4QHNB 1LE9B 4QRTA 4NKQB 4NNXA 1KV3A 4LSSH 3MGAA 4GW4A 5HHMD 1IC4H 3RA7L 5IB2B 2NY4C 3V5DA 2VZ1A 1UENA 2EIDA 1P4BL 5KJRH 1PJ9A 1B4RA 1JGVH 1DDHA 2EDBA 2G5BA 3VFOA 1NKRA 5JIKA 3H9HB 3OXSB 1CFQB 2IAMC 4JCLA 5IROA 3RP1A 3PWVB 4NO3A 3UPRB 5EU4A 1MFNA 3KAAA 3P11L 5K9KA 4HSQA 1DLHB 4DN4H 4TTGA 1Q9OA 4JFXA 3TO4B 1IAII 3MRQB 5JLZB 2BERA 2PW2B 2YPKB 5CJQH 5FYKH 1WBYB 3BPCA 4NBZB 4PREA 1SJEA 4U6XB 5HHQB 4N1HB 1N59B 2YPLA 3VXSA 1P84J 3MLYL 3QDMD 4YHPB 2JK5A 3I6LE 3OKEA 3OSKA 1R3IH 8FABB 2VXVH 4N9GA 4LSQH 3ZDZE 3O6LL 3R1GL 2VDNL 1CICC 3WFCH 4RFOL 3G04A 3QIWA 4Y4KA 5IF0A 2QJDA 4NQDA 4YXKL 2XKSA 2BRRL 2WW8A 5D1QD 3SDCD 2YBRB 1YDPB 5DJZB 1TJHL 4WUUD 1A6VL 3HPJB 4QWWC 5T3XE 3EJZD 3QCUH 3QSKB 4YNYB 4AEIL 4ZFFA 4I18B 4R4FH 1ACYH 3FO1A 1YY8A 1A6WH 1V3KA 3MODH 1IBGL 2CPCA 2GQHA 2R23A 1KXVC 4U1IB 1CLOL 3T0WA 5TDNA 3N06B 3G08A 1BD2D 2W9LA 3DXAE 4HIEA 5ABDE 1XFPA 1ED3B 3KYKH 4LKCA 2ITDA 5TF1H 4ZFGH 4OD2B 4UT6L 5EU7E 2X7LA 3EYVA 4DTGL 5BXFA 1JWMA 2XT1B 1PG7L 1V8HA 3QXVA 2VXSH 1V5JA 5D96B 4OUUA 3DRTA 1M7IB 5L2JB 3GMOB 1TTGA 1BMGA 4I77L 3WL9A 5EUOB 1NKOA 4NQCA 5ICYB 1WLHA 3NTCH 1HDMA 1IT9L 5A43C 2BMKA 2ZOKA 1MRFH 1ZGLP 2RR3A 3OKOB 3V7AG 4WEMB 4DZ8B 3RX8A 4PJ8B 5DDHB 2ATPB 1HKFA 1NGYB 4POUB 1DQDL 5D1QC 5I1HH 4Q9RH 4OM1H 5BRZA 1LK3L 2XRAH 4M7KL 4JO3H 2ADIA 1YECH 2X4OA 3HFML 5D2LA 2OQJB 4S1RH 2PUQT 3ULUD 1IEAA 4G9FE 4HIJA 1XR8B 3NFNA 1CFSB 5AZ2H 3NABH 1GSMA 1A9EA 1G7IA 2H2PC 2F58H 1K6QH 1A6TB 1F6AA 1EZVX 3ZTJH 1MHPH 4YHMH 3OAYK 5T1MB 2ZUTA 1S8DB 5IESL 5J6GA 1IM9A 5JPMA 4WW2B 1FFNB 2D4DA 3ZYIA 4HMCA 4EN3B 2DLFL 3RHWK 4V1DB 1FNAA 5D7LB 5AZEL 4DEPB 4ZUWA 2R2HB 1D5ZA 1C08A 4XCCH 1A7BA 4PV9A 2Q86A 3EFFA 2CKBL 5C08D 4OJFL 2F8XC 5I8KH 4X8JA 1HZHH 3CLFL 1R3HB 1QSFD 1KTLA 4QY8A 3TYGL 5JA8B 4YDIH 3NFSH 5FK9A 2X5PA 3BRDA 1MCLA 4YFLF 4MGXA 4MNQE 4NRZA 4BZ2L 2HKFL 3MA9H 5LCVH 5EOTB 3FOMA 2FSEB 3VH8B 3MLRH 3VXNA 4FQLH 2BVTA 3VGBA 1ND0B 5GS1C 1FN4B 3QZWG 3BN3B 5ACZB 5CEXB 2IH3B 1EEUA 1OAUL 5FGBA 1IGTB 1FZJA 4UILL 1OTUD 1QSZA 1JGDB 4OAWB 2OCFD 2D7TH 2DQDL 4O58L 3VXUA 4FQIL 2OBGA 1F4HA 2EIZB 1KTDB 2VAJA 3ARSA 2AK4A 4M1GL 3R06A 4PJAB 3WNPA 5GISH 3EW3B 4DVRH 1OGAE 3UX9B 3LS5L 3UTTA 1W0WB 3G5ZA 2RQ8A 4GT7A 4PJIA 3VMOA 1I8LC 3MJ7B 1KEMH 2HRPL 1D5XA 1ZKAA 2JTDA 1ZA6B 5EBWA 5MEQB 3GSXA 3FO9B 4GUPA 4KAQL 3RL2B 4HKZA 3D2UD 1MCEA 3B3IB 3KYMA 4HWNA 1ZLUK 3ZDXF 3FB7B 1VGKB 1YPZF 5E8EA 3SKMA 3MYJB 3S36L 4X6CF 1J0YA 2I60L 3MPCA 5DVNA 4CVZB 1G1CA 4NNPH 4LEXL 4U1LA 4UQ3B 4XP9L 3M17A 1JPSH 4QTIH 4ZAKB 3UZVB 5MEPA 5ETUA 5EA0H 2IAMA 5CBAB 4G6FB 1OLLA 2OZ4H 4J3WA 4RBPK 5C0AB 1Z9LA 3SKOB 4N0RA 5A16A 2JJTA 1ZHLB 1J9CT 4U6VL 3ZE0E 2B1AL 4NJ9H 4QRRA 5I30H 3T0EB 5E8PB 5DI8B 3JWNC 3T77A 3WFBL 5DJAB 1FNEA 1S7VB 1MAKA 3TBWA 5D1XA 5JOPD 4DKEL 4MA3A 1EVUA 4X6EB 4NN6C 1RZ7H 2GW5A 4ONGH 1D9KC 1QRNA 2FBJH 3LQMA 1ZHBA 3GMNB 3LQAC 2VLKD 4W6XB 4ZSOB 4AEEA 1S5HB 4JG0L 4ELMB 5KSBE 4WU7B 4OZGA 4KJQD 1IAIL 3OXRB 3FQRB 3IB4A 4DUVA 3HUJE 2R4RH 3GUTB 2P49B 2HT4C 4ORGA 4Z9KB 3RL1A 5TDPB 5ESQB 2MCG1 3LKRA 1R5WB 2HRLA 2RJMA 5MEOA 3MACL 4P2OD 2ICES 4H20L 4XP5L 4KKNA 4GKNA 4ODXA 3C08L 4PTTB 4AIOA 2DWEA 3BPNC 1JMXA 3SE4C 3VU2A 1I3RB 3PWPE 2BNUA 1WSST 3UBXA 5MENE 4XMLH 2E7MA 3WUZA 3IDMB 2H32B 1CVRA 3GRWH 2YC1B 1DQJB 4U1KB 5EZLB 3F6IA 1KJMA 1Q72L 1U41A 2BVOA 4C54A 1Y6KR 1RZFL 4PJXA 4Q6YA 2YHGA 2NZ9C 5KAQG 5DC0A 4UTBL 3CXDL 1CD0A 3ZT7A 3O8XD 1UCBL 1EGJL 3BD5A 1SM3L 3CC5B 3ISWA 2BOBB 5FIEA 4JM2A 4Z7QE 2KH2B 4PRDA 4HS6A 2EXWC 4JJHA 4K7PH 4BSWA 1MCJA 4PJCA 2P5EE 4G9DB 5H37H 2QHRL 1AKJA 5IVZB 1DQMH 2OZ4A 5E9DA 4UUJB 4P23B 1J8HB 2Z4QB 3SDXA 3PWLB 4OQ1A 2IANE 2OTWA 4NN5B 3PL6C 2VDPL 5FYJH 1CGWA 1RUMH 5EU6B 4K94L 4CDGC 1NFDF 4U7SA 1WFNA 4YWGL 1XCTB 3FRUA 3HKFA 5AAWA 4LFHG 4KK6D 5MI0B 5IG7B 1BQHB 1LWRA 4HK0A 4NRYB 1CI5A 2IQ9H 3WD5H 4XVUD 3MLWH 3D9AL 3I6KA 3VFPB 4NQED 1MQKL 3HNVL 1RURL 2A6IB 2P5WA 5F7FA 4DGYL 5F7EH 1FNSH 1LMKA 4PGEB 1YJDC 2RAMA 3WDJA 5JPNB 1FZKB 5IMLA 3FTGB 3X3GL 1PVHA 3I02A 4NZTL 5AEAA 2XACC 5J13B 3EYOA 2HJFA 3CVHL 5KG9A 1TNNA 2Y5EA 4JJ5B 3O3EB 2DDQL 2D7OA 3N1QC 4L3CA 2QSTA 1AO7B 3MUJA 1LVEA 25C8L 4U1HA 1CDYA 3CFKB 3QG6A 1EJOH 4MVBD 4Q7DA 5E6IC 4BK5A 1OAZH 35C8L 1KJVA 1U8HA 5GS1A 1KG0B 4WIQA 3GRWA 1WBZA 4N0CD 4G6JH 1BF8A 3JV4A 1I4FB 5CZXC 4DK6A 4FFZL 4F3FA 2PYFB 2VDKH 2MQ0A 4P3DB 2N4IA 5DSCA 4F57L 1BBJA 5HBBA 3HS0A 3SGKC 2DQTH 2UV3A 3D25B 3IU4L 1OCWL 4YXHH 4XB7A 3V0VA 4AY0A 1AD9A 3MV7A 1EXUB 3U82B 2YD7A 5HI4C 4MMZC 3ULSA 1OTTD 3F62A 4KHXH 1S7XA 1SHMA 5LJYH 4LRIA 5T33L 3TFKD 3S37L 4XVUC 1C1EH 3ZO0A 2YK1L 1NFIA 2H26B 3GI9L 1RIUL 4YDVA 1FE8H 5I1DB 5CMAB 3UPCA 1I8MA 3VFMA 4KJWD 3MRBB 1P7QD 1G7HB 1GIGL 1IM3B 4QRSB 1I8LA 4JFZH 2ZCKH 4QHLA 3A6BL 5I1IH 1KJ2L 3NIGE 1NPUA 4RQQA 1ZS8A 1S7WB 2FJHA 4NNYA 1FGNL 1SJHB 4X4XA 3OV6A 4L4JA 2VSDA 1HXYA 1BEYH 2EDQA 2ZSVA 5IB1B 5CBEB 4NO0B 2DQHL 1MJ8L 4P46C 5E99L 1MCNA 5FKPA 1NAKL 2MSPA 4N0CC 5K9OA 3L3DA 1NL0H 4FXKB 4HIIA 2AJZA 2Y07L 2HN7A 4HWEH 4LLAA 5HHOE 3UJJH 4AZ8A 4QKXB 3STZA 4TNWK 1IAKA 1Z9MA 2H3NB 1OGTB 4JG1L 5E5MA 2XICA 5MHSD 1TZIB 3B8YA 4RMVA 3VXME 1Y6MR 1C16B 3QH3B 1UA6L 1D9KA 2HWZL 1V05A 3HUJF 5C0RH 5GS0D 1CG9B 5IQ9A 1XGYL 4XP1L 5GRJH 3RVTD 3X12A 43CAB 3BMVA 3WFDH 1OB1A 4G8EB 5BV7B 7FABL 3IGAB 1TZGH 4LDLB 1UXWA 3FOLB 5IHZB 4KTDL 4OI7A 5IWLC 1NDMA 5GRWA 5IW1B 5HYJA 3WUWG 4O02L 3BGMB 4I2XA 1EO5A 4L4VE 3RU8H 5DJYA 2BJML 3DV6B 2X4UB 3DMMB 1FYTD 3CXHJ 1OSPL 4PJ9A 5KSUA 2A6DB 5C6TL 2P8PA 3SDAB 3QZWB 3OGCB 5ADPH 1LGVA 2ZKHH 3LKQA 4DCQB 1QA9B 4ODVL 2EDXA 1G0XA 5E1AB 2FL5B 1PFCA 2X40A 1QR1B 2VDOH 3QDGA 3RY5A 3VRIB 3IDNA 2GUOB 1W72B 2M8XA 4IOIB 4ONFL 1N8ZB 5DK0B 4OCWH 4XCEA 4OLXL 3IDYC 1ONQA 3JWDL 1U93B 2E9BA 5H2BB 1WFOA 1QFWI 3PQYB 3HMXH 4GW1B 4IDLA 4Z7NE 4X6CB 5A40E 1RJLB 2XXCB 4ODTH 3H9SA 1N5AB 5HYSG 3QDJA 3JTTB 5SWZA 3WS3A 3SY0B 3BEWB 2W0PA 5CUSL 3S4SA 1KBGL 3W0WD 2AJVH 5HHVL 3WSQH 5ESVA 2IBZY 5SV4A 5JHLH 2HMID 1R3LA 3S97C 3P9WB 3F6LA 2W9DL 3CK0H 4JHWL 5C07E 3PL6A 3LKOA 5T3ZE 2EYTA 1G7LB 5FM5O 4U3XA 1W8OA 1DJSA 3BO8A 4N0FA 1F5WA 4ORZC 4RZCB 1G7JB 2E27L 3PABA 1CF8H 1JP5A 1BFOA 5F9DC 2GCYB 2AQ3A 3BX7C 4JREC 5KSVA 4NGHL 4C4KO 1HHHA 4NBXB 1T2QL 1QYGH 3PWJB 4LF3A 2Z35B 1MUJA 4A6YH 3HN3A 3DETD 2WWMC 4K9EL 3WHE0 4HUVB 3KPPA 4FQXC 2OL3B 4PLJD 3RY6A 3GO1L 3SCMD 4YXLL 5JXAL 1AD0B 1HH6B 3DXAB 4XC3L 2WUCH 5J11C 1CXFA 4WTWA 2XV6B 1A1MA 3MX0A 2EDJA 1ADQH 1TVBA 3T8XA 4JY4A 5L8KB 2BNQA 3CX5K 3WXWH 1J0HA 1HNFA 3E1F1 1BF2A 5HYEA 4MB4A 2PETA 4O9HH 1QBBA 4XVSL 5IIEB 5E6IA 5DUBB 1RZIB 1Z5LA 2HMIC 3CCHA 5E5RB 4KPHL 3FZUC 4F7MB 1UB6A 5J06A 1HHGB 4ZYKB 2R56L 4EKXA 4K3HA 4C56A 4E9LA 4JY5L 5T1LA 4RIRA 1ITCA 3UO1L 1NAML 3MRLB 5CIPB 1QFUH 3EYUH 4WHTB 4JZJA 2BY3A 3HMXA 1JGEA 5IBUB 5L88L 1R0AH 4MX7A 3TJEH 3MJ9H 3U36B 3KPNB 5JQHC 2BCKA 1JHTA 2I07A 4G9FB 3DBXB 2YOCA 3TBTB 4WHDA 1LD9B 1D7FA 3QFDB 4W6WB 1WC7A 1AXSB 1I7UA 1JWSA 4Z7VA 2XN9B 3IFNL 4I5BB 5GSRB 3SDYH 3BZ4B 1P4IH 1S7TB 1M1SA 3OHXB 4OZFH 1C7SA 4KHTL 1UT9A 1ZWIB 4XB8A 1NFDB 3EYFB 4K8RC 1BVLA 5DGRA 3RWHB 2HT3C 1LDPL 4WCYH 3SGDI 5A3ID 2XG5A 2JF1A 4P4KD 2VC2H 2X4SB 3ZSTA 5ACMA 4DUXA 5AAMA 1VESA 1F13A 1TENA 3P40A 4YAQA 3P77B 1WCBA 1KB9J 5FGRA 4R9HA 4HUNB 4P4RA 1I1FA 5H94B 2DF3A 4C83A 4A6YA 2H1PH 1K85A 2DRUA 3QNXB 4P46A 4A2MA 5LXGL 1FL6A 5IMOB 4OLZH 1L7IL 3BZEB 1WT5C 1U8LB 1F00I 4APQB 4YE4L 5E6YA 1NGWB 5I9QC 2X41A 4K2UL 1KCUL 4X6DA 1BFTA 1ADQA 1Q0XL 2J8HA 1YN7A 3GSVA 3O9WD 1MFDL 4LASH 4X8XA 2I25N 4AENA 1YN6B 3L5XH 5D72L 5E08H 3MREA 3OZ9H 3LHPH 3QR2A 4MQXD 3I3DA 3ARBD 3GIZL 4J4PC 3PWUB 2BSSB 4ELKA 5JW3L 1CLYH 4K3EL 1TJGH 2R1XB 2ERJB 3LN9A 4L8CB 2B4CC 1DANT 4NFBA 1MCRA 2ESVE 5IWLA 2AEQL 2CUHA 4XNZC 1MCFA 1WF5A 4U1GC 1KCRL 4XNQB 2I5YL 3MJ9A 3ULUL 4HUXB 1FSKB 4PRPE 1R24B 2V9QA 2GY7B 1A7OH 1EHLL 3FT3A 4JPVL 3QFJA 3MRKB 4CGTA 1KPRB 2BXYA 2UVFA 2IGFH 4LNRB 1E6JH 4I3SL 3EIFA 1MCBA 1NCCH 1EFXD 1JN6A 3FQNA 4OZFA 4XAKD 3Q5OA 4MWFB 4D3CH 1FG2B 5GIRB 1YC7A 1MH5B 1JGUL 5KANG 5IM7B 3CFEB 4FXLA 5DWUL 4AM0B 4JDVA 3T1WA 1MRCH 1NQBA 2IH1A 3K8KA 5D6CA 4GLRH 4HHAA 2IALA 4GAJL 2VABA 5LAXB 1AGFB 3L3GB 3T3PE 3I50L 2YZ8A 4Y2DB 1YY9C 2ZG3A 3U2SB 3LRSB 1NLDH 2MKLC 2WWKT 3BYTA 1T0NA 1X5AA 2BVUA 4M62L 4ERSH 3Q1SL 1F11A 2PNDA 4K23H 4NQSA 3MLXL 4GBXA 4Y5YC 3RZCD 1DUYA 4K7PX 2QKIA 2DBLH 2W92A 3GMPA 5D7IA 4YO0A 5ITFA 1MF2L 4TUJB 4FQ2H 2AAVA 3TA3D 4HG4J 4QXGH 1BJ1J 3T2NH 1TTUA 4FQQB 1DTUA 4M4PA 1YEDA 4K8RH 5KSBB 5F9OH 2NY0C 5INCB 3WLWC 1QFWL 5IBTH 1MFAH 3VGDA 3HUJB 4QXTA 5IEHB 5GGUA 3SE8L 1RZGA 1IGML 4LIQH 1UM6H 1KYOK 4D9RE 3TZVA 4FQXA 3F7PC 5IHBA 4LLVA 5CKAA 1P7KB 1WICA 4XH2A 2ADFL 4YGVA 3PWPB 4U1NA 5EUKA 3D5OF 4FTVE 5MENB 3FFCA 3TF7C 4WWKD 5FUZH 1UJ3A 1VA9A 2Q6WB 3B2UC 5F6HJ 3RIAF 1AIFA 4XC1L 1AI1H 3OKYA 2VB5A 3QEUB 4OSUL 4WO4B 4NQVB 3RZCC 2DTSA 2HFFA 2H2SC 4MZ2A 3WUWB 1MCQA 3BN9D 1KXTB 4RFEA 3CSPA 1OP3H 1PYWA 4YUEH 3V8OA 3LVEA 5FUOL 2EDLA 3VW3H 5ANME 1WZMA 3RAJL 3PIQB 3AREB 2P5EB 1R5VA 5D71L 4RA0C 5TE4H 3C2AH 2H6PA 2FGZA 2HJKA 1YYLL 4JQIL 2B8OT 2OXGA 4NUJA 4ODUB 3NCYS 4MJ2A 2LVCA 1MI5E 5HY9B 5IB3A 4ZQKB 4LCCC 2BVPB 5EC1B 4P2CG 5I1JL 3LKPA 4HPOH 1P84K 4OLWH 1MWAL 4I9WE 2YD4A 4M5YL 1A6ZB 1J1XH 3QCTL 5J4MA 1JZ7A 1QEWA 1RULL 2E9JA 5KW9H 1MY7A 3QWRA 4G8GB 4HZLB 3FB8B 3B9KA 1UH4A 1S9WA 4PJGA 2AJSL 1NC4B 4ZUSB 5SX4H 1ETZA 1IEBB 1SBSL 2F53A 1H3GA 4UB0H 1DE4B 2HVJB 1X5ZA 5HYSB 4DFHA 2R2BB 1E27B 2R2EB 2R69L 3ARFD 2IPUK 4JFFE 3P30L 3I75B 2HLAA 2JELL 2J8UA 1W0VB 4LVHC 5J7CC 5DRNA 3ARDC 5D1ZC 4J23A 2F19H 5IFHH 5DFVD 3BN9C 5IFJB 4NM8H 5EU5B 1WT5A 5KVGL 2GTZB 5CLWA 5DD5H 4KZEL 3QXAA 4JR9L 2YR3A 3RGHA 5ISZD 4RAVA 4YK4B 1I3VA 4HIXL 4ZS7L 4UT7H 1ZAGA 2ZJSH 3VG9B 3ZSSA 3N1GC 3LEVH 3DPBA 3MV9D 3BE1L 1BX2A 1F4WH 2X9WA 3DX8A 4KGLA 4M6OH 4R3SA 4PJFA 4JO1H 4XXDB 5T1KD 4PJDF 4YHIA 5GRUL 4JFYA 1KIUA 2C9AA 4BFBD 2Q8BH 3OG6B 5C09B 4TSBL 1HILA 4NFCA 1MIMH 3Q48A 4GG8A 3OKKA 5HDQL 3H8NA 4XZUA 1RUQH 2P44B 2H9GA 2RCSH 2VZOA 1ROWA 3IXTA 4QOKE 4JRYA 2VN4A 4EQ3A 1TCRB 1X5JA 5IFAH 2GJ6A 2R1YA 3ETBF 4KKBC 1V3JA 2X10A 4J3XA 4LPUA 4S2SA 5JNYA 5CEZE 4NDMB 2VITB 4RAUB 3QG7L 3IFLH 5E4EC 4XI5D 2PF6A 1O0VA 2KUTA 1EHNA 3MBEB 4MD5B 3BUYB 1J0JA 1A0QL 2VDML 1QZ1A 5FFLA 5K9JL 5KTEH 1UWXK 2AQ2A 1U36A 1X5IA 3WBDA 4NZRL 3HRZB 4IIQB 2EH8H 2VIRA 4S1SH 5HHOB 4WFED 1IGIH 4YZFF 2CLZB 3CZJA 2WSKA 1UB5A 3QEHA 5TPWH 1HHIA 4Y4HA 1KLGB 1C5CL 4LSRL 4GAYB 4Y5YA 3RNQB 5CD3A 3PP3H 1RZKC 3N9GL 5LWYL 3N1MC 2A2QT 1QPXA 1NBZA 2PTVA 4Y5XA 3HR5B 4ZFOB 1IJ9A 1LE5B 2CIKB 4QXUL 2A73B 1T89C 4MQTB 3WFHB 4JKPH 1P2CB 1JGLH 4EOWL 3MLTA 1Z6JT 1SMOA 3VFNB 1L7TL 2CLVB 1GJIA 2Q76A 4ZTOL 1OF2A 3MXVH 3L5WA 1A2YB 1CWVA 3LN4A 3BJLA 4N5UA 4YHYB 1TJIL 1YYMH 4JFEE 4RNRA 4GAFB 2UVEA 5FDYA 4PGDB 3D6GA 1N6QL 4KQ3L 1IGYA 2A77H 5CGTA 1CXKA 5IKCB 2JB5L 3ZYJA 2EH7H 1T5WB 5F1OB 4GRMA 1NGXB 2F5AH 1A5FL 1OPGL 3I2CH 4MJIA 4IHOB 4I48A 3EJYC 4X98A 1YQVL 4OZ4B 1BM3L 2GAZA 3TO4C 5DRXB 2BSTA 4AIZA 5IOPA 3D85A 3VXPB 3VWJB 3T09A 5B38A 4LAQL 4GAGL 1MEXL 2QQKL 4OLUH 5C0EA 3AS3A 1G9EA 3MRIA 3B43A 2ARJB 2R8SL 4JFPA 1FLRL 4X6FB 2BY0A 3EO9H 1IC7L 1MHEB 3ZLQC 3P73A 3GSNH 4PP2A 4U6HA 4JFQB 2IPTL 3TPUB 1ORSB 2CLRA 4P2RB 4PJ8D 4GKSB 5C07B 3S34L 1T20A 2ICWA 3DSNA 4LCCA 4MDJB 5J12B 1PZ5B 5C0BA 4D0CB 4DQOL 1F58H 3MRHA 5HHME 1AH1A 2ZSWA 3RY4A 1N64L 4I18C 3TT1H 4AL8H 5J1AB 4FP8L 5EH1A 4LSTL 1RUKL 5GS0L 4OQTL 1ZHKB 4KXZI 5FHBL 2QQLH 5FCUH 3MA7A 3SJVA 3WIHH 5GXBB 1J1OH 5LBSL 3N0PB 2W0FA 3EDFA 1D6EB 5I18H 3U30C 4EN3D 2P7TA 3DHMA 5BVPH 1AE6H 3FO0H 3QNZA 2NTFB 4X5WB 2R0KH 3FO2A 4XCFH 1NUDA 3V6OE 4LCWD 4G80A 1DLFL 5DS8B 4B41A 4TSCL 1LO3H 3ARDA 5H8DA 1GC1L 4CVXB 3QDME 4B53A 3IDIA 1KPVA 1XGTA 2ARJQ 3KPRD 2HVKA 4Y1AA 1JZ8A 1HOCA 2VLRA 2RFXA 1MCKA 1N4XL 4G8IB 3F58H 1BIHA 1RZKH 1FVDA 1OAKH 3S3PA 1XF2B 4PLKC 3VFSB 1V7NH 3HG1D 2EIEA 1K4CB 4E41A 4WUUE 4OV5A 5D70L 1N2RB 4PJ8C 1QHOA 2CKBB 4XX1E 4MS8D 3X13A 3QPXL 3TBVB 1LO5B 2CDFA 5FA3A 4HIHA 3KPMB 2Z8VC 4PRHB 3REVA 4WJ5A 4X6BA 3PXJA 4R96A 3RWFB 2Y7QB 1U0QA 2CRIA 2GI7A 1ZANH 3GBNH 4WDIB 2ORBL 3J7HA 1EMTL 4XP4L 2CMRL 1BD2E 4NO5B 3MLSH 1EAJA 5JDJA 1X44A 2PCPB 4NT6A 4X99A 3WLBB 4WW2C 2HTKC 3GSNA 4OCXL 4RWHA 4EN3C 3KNBB 3E8UL 5ITBH 1F42A 3I3BA 4PJHF 4DEPC 2CH8A 2X4RA 2FWOB 1NUGA 4RRPG 1BIIB 4BQBA 2QV2A 1T1WB 1GYAA 4JO4H 6FABL 4P5TB 5L2KD 4JAMB 5H35B 4LLQB 3PV7A 3KLHD 3W39A 3RWEA 4PP1C 5FO7A 2WINB 3D3VB 2WLZA 1GAFH 4IMKA 1JI1A 3O2DH 3OX8A 5EIQA 1NEZA 1CGSH 3RDTB 5IB4B 3WIHA 3KYAA 3HI1B 2YD2A 5EBMB 3L5HA 1IGJB 4BJLA 2DQJL 4RGOL 5E2UH 2AV7B 1B0WA 5HTSA 5DRWB 3ULUE 1XIWA 1GPOH 1T6WA 2ICWJ 1HQ4B 3RHWF 5HI5C 5I76B 2JIXB 3MRNB 4N90D 4XGZA 5F7KC 2ED7A 1N6VA 1YEIL 2XY1A 5DR5L 2UZIH 4NQTA 4UINL 4G6KH 2XQBL 3HA0A 3HR6A 3DVNA 4HJJH 3KWWA 5DMKB 4K3JH 4PR5A 3SE9H 5IR1A 4X7DC 4XPGL 2KQNA 4M1DH 3BDYL 3VFVB 4TULH 1K2DA 4OZHA 3OMZA 3KLSA 1E4JA 5C08E 3QO0B 3AS1A 2AABL 4PS4H 4XTRC 5SX5H 5GGRB 1QSFE 3VWKD 4CJ0A 2ADJA 3ULVH 1KIQA 3FMGL 4HLZH 2FGWH 2ESVB 1LEKA 2UWEF 2NY2B 3RWDB 5ICZB 2VRAA 1AJ7L 1JPTH 4I3RL 4QHNA 4LKXB 5E03A 1LE9A 1MNUL 4PRPB 1MCPH 5EWIH 3W82A 5IB2A 3BT2H 3O0RL 3HZMB 1T03L 3V4UL 5F89A 3ZTNH 3H9HA 4JHAL 4YX2H 4ZAKC 5GGQL 4HWBH 1R6VA 1KCVH 3WNMA 4OCSL 1JWUB 3PWVA 3W11C 3UPRA 1NCDL 3K46A 4HUKB 3X17A 2COQA 5AUMB 1J10A 2DM3A 1S3KH 1G7PB 3TO4A 3MRQA 2PW2A 3VFTB 2Y25A 4U4BA 2YPKA 3IYLW 5L6YH 2O26U 2R0ZH 1WBYA 3O2DA 5DMGC 4ZOBA 2ZCLL 3E3QE 3T0EC 4OGZA 1F2QA 2HG5A 4AH2B 3WNLA 1SEBB 5MP6L 4FFYH 5EOQH 1N59A 3T2QA 5CJOL 2QQNL 1CGYA 1FFPB 1F8TH 1NC2D 1UKTA 3K81A 1SY6H 1DSFL 3H9YA 4G5ZH 8FABA 3DGGB 2BY1A 4L3EB 5CJ5A 3BP7B 4QHMB 5KS9E 4KRPB 3OKDB 3WN5B 3OR6B 4LQFL 2HH0H 4AQ1B 2YBRA 1YDPA 5DJZA 4P23D 4RISH 3BGAA 2Y6SD 5LGHH 1FVEB 3VXTB 4HJ0C 4YNYA 3S88L 4I18A 5EU6D 2FO1A 4YPGB 3RWCB 4Z5RB 3TYFB 3HZKB 3DTXA 4IBLT 1I8IB 3WFEL 4PY7B 5E5UB 3WIIH 1VADB 4U1IA 4XX1G 1VFBB 3RX5A 4LLWB 1ED3A 3RNKB 3DX6B 3EAKA 4S0SD 1S9VB 2EDYA 1X5XA 2VDRL 1AFVL 4OD2A 3X14A 2K1MA 3BW9B 4OM0L 4FG6C 1LO2L 4UIKL 5JOPE 5FDWB 3VD4A 2FX9H 4JRXD 4FTVB 3RI5K 2LFGA 5L2JA 3ECBB 4ODWB 4F9LA 3GMOA 1FPTH 1NDGA 4JFDA 2PYEA 3QDJE 2VQUA 3MRMB 4TSAL 2VLKE 1QNZL 4HDIA 1AP2A 4HLJA 1RHHB 2EC8A 5BO1H 2DKUA 3H3PL 1TETL 3NN8B 3BPOB 5F1NB 3N85L 4KI5F 4HWBA 4MNHB 3UTQA 5JUEH 1V3MA 5DDHA 3D0LB 1NMBH 2ATPA 2B2XL 1HKLL 5TFSL 3QQ9C 4P23C 3QUZA 5L9DL 5ANMB 3BAEL 3NZHL 1KN2L 3T3ME 3NCFB 2OQJA 3PDGA 3CVHB 3DYPA 4WU5B 1G9NL 2R2CA 3LAFA 1MREL 1XR8A 3V0WL 3SPVB 1CFSA 3U9PL 1SY6A 4LCIH 1Y0LB 1A6TA 1IRAY 5F3HB 5MI0C 5FOJA 3NAAL 5T1MA 1U3HB 3CFBA 1H3PH 3TN0B 3MO1A 4V1DA 5D7LA 3MRRA 5JQ6H 3UDWA 3UBXI 3QPQD 1HI6A 2YN3A 1N3NB 4NZUH 4WTZG 1AR1D 3ALXA 1YUHA 4P0DA 1FBIH 5J3HC 4ZG1A 1A8JH 3HI5L 4OZIF 2R0WH 3OWEA 4PJBE 5J13C 3B5HA 3ULUF 4JFFB 5GRYA 2V17H 3TPKA 1RIHL 1T7XA 2FIKB 3UAJD 1CLZL 3QEQA 3NH7L 1WFTA 1G84A 1MLBA 1J86A 5DJ8A 1WITA 1KJ3L 5EOTA 3VH8A 2FSEA 4NO0D 4TVPD 2IG2H 1ND0A 12E8L 1FN4A 4P57B 5ACZA 1IFHH 6CGTA 5CEXA 2IH3A 2SEBB 4QF1B 4U1MB 5E8NB 1KJ2B 4EDXB 5B8CA 4LCUA 1JGDA 5SWQB 3KJ6H 3U0WH 3GMRA 2W38A 3TNMB 4ZO6A 5KJRL 1X5FA 3VFUA 1YNKH 5FYLD 4UDUB 5ADOL 1UWEH 5C0JB 3N1FC 4NQEE 2EIZA 3FFDB 5I1GL 1QKZL 3WS6A 1MFEH 5ID1B 1P1ZB 4PJAA 3QUMB 2XQYG 5CJQL 5E94B 2W9EH 3TIEB 1CLCA 1LEIA 4NO2B 5CJXC 1WJ3A 2GT9B 3MJ7A 4GQPH 4QOKB 4WEBH 4YDLB 2H32H 1JCKA 3GSWB 4M48H 2AW2A 3NCJL 4GKZB 5E2TH 1R3IL 2VXVL 5MEQA 2V5RA 4HH9B 2BVQB 3FO9A 3RL2A 3VGFA 2A9MH 2Z91B 3UAJC 3B3IA 3WFCL 1VGKA 1PBYA 3SDAD 4CVZA 2VLJD 1NLBL 3MLUH 4UQ3A 3RJQB 1U8IA 3W9DB 1FRGL 3C5JB 4ZAKA 3WNKA 3QQ4B 4R2GB 1ZXQA 3WJJC 4QHUA 5C0AA 1A6WL 3SKOA 3RWIB 2A0LC 4E0RA 4XNXL 1KB9K 4OBRA 2FX7H 3UTZA 3T4AB 3T0EA 5E8PA 4Z78B 3KGRA 3OL2A 5I1LB 5DJAA 2CD0A 2QHLA 3JSSA 2RGSA 1GCFA 5JW4N 3KYKL 2NTSP 2QSVA 3C8KB 3PQYD 1LO0L 3MBXH 2AKRA 3WKNA 5TF1L 3GMNA 4Y8DC 1LK2B 4ZFGL 4EI6B 1N5YH 5T1DH 4ZSOA 4KZDL 1S5HA 4WFHE 4D0DB 3LS4H 5BV7C 5TDOB 2D31B 1QG3A 1WAAF 3EYQC 2P43B 5C0IB 3FQRA 3PDOB 1QLEL 1A7NL 1Q1JH 3L3OA 2L7JA 3NTCL 4L4TD 1QFOA 43C9A 3GUTA 1IQWH 5TDPA 1QBAA 5ESQA 4TNWF 3RWJB 1ERNA 4GSDH 3TZVD 1M7XA 3DMMC 1U42A 5IW6B 3SDAC 5I1HL 4OM1L 1BREA 4ZS6C 4GKOA 5BJTA 2DLIA 1RSFA 2XRAL 1WBXB 3IAGC 4PTTA 3EGSB 4JO3L 5DRZB 1CQKA 4IRZL 1QSED 1I3RA 4LPWA 4CW1B 4OF6A 2AVGA 1S9XA 5MHSE 2HFGL 3IDMA 3LV3B 1LHZA 2H32A 1FZMB 5AZ2L 2NX5D 3NABL 4I0PA 2YC1A 1DQJA 2F58L 1K6QL 2RHEA 4U1KA 3L3JA 1YC8A 1I1AB 2CIIB 1LEGA 5DLMH 3O81A 4JEGB 4ZUTB 2Y5TB 3O41B 3CC5A 4YHKL 5TQ0L 1DFBH 2BOBA 3SEPA 1U2HA 1JZ3A 1RIVH 4M02A 4G9DA 4OLEA 4CUCA 4M5ZH 5I8KL 5IVZA 1HZHL 3AAZB 4UUJA 1J8HA 2Z4QA 2CR3A 4X9IA 2J1KA 1HWHB 1YMMD 1UKSA 3NFSL 3NPSB 2G2RB 1FYTE 4D0BB 5JOFB 2MMXA 2VL5A 1UCTA 1P6FA 2Z0BA 1XCTA 1UM4H 4FQ1H 3MA9L 4OGXH 5LCVL 2Z9TA 2ZPKH 4HWZA 1M7DB 3MLRL 4FQLL 3B9KD 5EU3B 3OGOE 3HLAA 2XZCL 5K33A 1BWMA 4HG4K 4PJBF 4MHHI 3VFPA 5BZDB 3IAQA 4ALAH 4M8QB 5DUMH 2D7TL 2XN9D 1ZV5A 5DEGA 1VFMA 2GJZB 2QTEA 4Y19D 5JPNA 1FZKA 4PJ7F 3GBMH 1BZ9B 4LOUD 4IMLB 5IQ7H 4Q2ZB 4OIIH 3STBA 4JJ5A 3O3EA 2NY6D 3W0WE 2V6HA 3EYSH 4R7NB 4PRBB 1AO7A 5F1SA 2E6PA 1WV7T 3QDMB 5GISL 2ENSA 4Z7WA 4DVRL 4QO1A 1XAUA 4IRSA 5HJ3A 4LMQI 1KEML 3IFPA 4OD3H 4HGWB 4L9LB 5BV7H 3CNKA 3JUYA 3V6ZB 3SDCB 1I4FA 3UTOA 2ZUSA 4HUUA 2MHAB 4WUUB 5I0ZA 2PYFA 5IEKB 4XMPL 4QRPD 4JDZA 5J6HA 2AERT 2EE9A 4UTAH 4IDJH 2APTA 3D25A 3FT2B 4NNPL 3MNWB 2Y72A 2ENYA 4DGIL 1F02I 1JPSL 4QTIL 4C57C 32C2B 4PYHA 2DQIH 5EA0L 4M6ML 4LEOB 4BQCA 1OAXL 2H26A 5I1DA 1BD2B 3DX7B 5CMAA 1IZKA 1FC1A 2Q8AL 3O6FD 1CXHA 5CP7B 4XCNB 1F6LL 1G7HA 1IM3A 4QRSA 5CJXA 1E4KC 2CXKA 1W72H 3WV0A 5E2VH 1RZ7L 3RQ3A 1S7WA 2FBJL 4MD0B 4M61B 1SJHA 1OSZA 4JFHD 2OR8A 3DRQB 4R4BB 4WTXA 1KEGL 4YBQD 5CBEA 1FAIL 1T4KB 4L29B 3FL7A 1F6FB 5I1EH 3WJJA 2W91A 4KROD 4APQC 1KIRB 2XG4A 2A83A 4OZIB 3DVIA 3T0AA 1OGTA 2CJUH 1T6VN 4OGYH 1A7PH 2ZNWA 1TZIA 3QUYD 1FIEA 3MRDB 2D03L 4QGYA 3ZKXB 4LL9A 3UPAA 1C16A 4JPIB 3LEYH 3QH3A 1MCHA 2HFEB 4Y2DD 1NCNA 1CG9A 3K8MA 3O3DA 5T3XH 3ZT5A 4IJ3B 2DWDA 2X4PB 43CAA 3GRWL 2IQAA 5ID0B 3IGAA 3QXTA 5DJXB 4Z95H 1L0QA 4Z7UE 1EDQA 2ERJC 3FOLA 5LVEA 4AT6B 4JRYE 5IHZA 2O5XH 2OL3H 4PGBA 1MLCB 5BQ7B 1DCLA 5IW1A 4PV8A 1D6VL 5IVXF 3BGMA 5EBGA 3EDJA 1QSFB 3C8HA 1ZVSB 1NJ9B 3DV6A 5EZIH 1VB9A 1FSKC 5I66B 3DMMA 2FJFB 1T04B 5ICXA 2A6DA 1KPUB 3QZWA 3RUGF 1DQML 4FZEL 3ARRA 3GHEL 1HH9B 1INQA 3LB6D 4DCQA 5FYJL 1RUML 2FL5A 5C0GA 1JNNH 3QT2A 5DFTA 3M8OH 1QR1A 4X5LA 5IHLB 4J8RB 2GUOA 2ZCHH 2OK0L 5BOZG 1N8ZA 5DK0A 5HGGS 1U93A 2UZYB 5CIPH 2EZ0D 2VR9A 3CDYA 3AB0C 3MRGB 4Y2DC 2IQ9L 1FDLH 1RJLA 5F6HI 4JB9H 2H41A 1HINH 3EKCA 3SE3C 1IVLA 3EOBA 3SY0A 4K3GA 2P1YA 5F7EL 5JZ7C 3CIQA 2QL1A 5HD8D 1HN1A 5GRXG 4FFVC 1HNGA 3PHQB 1IAOA 3KVQA 5I8EB 4WFFD 3ARED 2AXGA 4Q97A 2R4SH 5MERB 1G7JA 3L1OH 1JMZA 1WTGT 1EJOL 5D7JA 2X05A 1AXTH 4L8SB 2GCYA 1BPVA 3D2UB 1FVCB 5C92A 4AJ0A 4XAKE 4RGND 2X42A 1NCAH 4RMTA 4NBYB 4YHNB 4DJMA 5DVKA 3LB6C 3PWJA 1AGCB 1T1ZB 2CSPA 4G6JL 2IPKB 4JVPA 4Y88A 4HUVA 2I26N 2VDKL 5I0DA 2CGRH 1EBPA 1NGZA 2OL3A 5DTFB 3UMTA 2DQTL 4CU7A 4YXHL 1D3CA 1CZ8H 4G8GD 1AD0A 1HH6A 3DXAA 3VDAA 4MA8H 1O7VA 2EZ0C 4F7CB 3EHBD 5F8RC 5E56A 3QCVL 4LHJB 3WJLC 1C1EL 2FNBA 3SKUD 3RKDD 3OPZH 1FE8L 1F3DH 4X7TA 2WIMA 4YEFA 2VSCA 5IIEA 3HAEG 1S9YB 3O6KH 1UH2A 1MRDH 4WO4C 2D2OA 1UZ6E 3R4DA 3OBAA 4AEFA 1G7QB 1S7UB 1HHGA 4ZYKA 5LQBH 1XGRB 3HB3D 4OKVB 1F4YL 4YLQT 3AREC 2NY3B 2KL6A 3F7VB 3BZDA 5CIPA 3TNNB 4WHTA 1OP3K 1JNLH 4FXGA 4DN3H 2VAAB 1DN0B 4W68A 4ZDHB 3IDUA 3AS0A 5TH2B 4CDHA 4G9FA 1MHCA 4UU9B 3TBTA 2YXMA 4P2OB 1NL0L 1CGUA 1LD9A 4L8BB 4RDQG 5EZOH 3QFDA 3GNML 1RI8A 1AXSA 4WENB 5GSRA 2DIAA 4I5BA 4PB0H 3BZ4A 3V4VH 3RFZC 2FR4B 1RZJC 5C09D 1RY7B 5BMFH 2EDWA 1ZWIA 5HGHB 4LLDA 4RFNB 2FB4H 4ESKA 4OFYD 2X4SA 5C0RL 1JNJA 2V2XA 2YUWA 3TVMA 3P77A 5GRJL 4FNLH 4HWUA 3WFDL 2VUYA 3KG5A 3RIFK 4NSKB 1J0IA 4BH7A 5LG1A 3O8XB 4Y1AE 3QP3A 2J88L 5H94A 1TZGL 3OKLB 3MMEB 4PJBB 4O2CB 3DHJA 3BKCH 4LPVA 3QNXA 5GS2D 3ZKMC 2FH8A 3GI8H 4G6AD 2WZPD 1OOAA 4MNQA 1DVFD 4GLRI 2IPUG 1U8LA 4N8CL 3ARGD 3IAPA 2YD6A 3RU8L 5DK2B 4HX1B 3OF6A 1NGWA 4LARH 4N8PA 5ERWB 3BIBX 2DQGH 4YK4C 1EERB 2NNAB 4NKIH 5ADPL 4DAGH 3CMOH 1MHHB 3VG9C 2EIBA 4OGAD 2ZKHL 1YN6A 3QJFA 5EZJB 5TE7H 3P9MB 4ETQB 4H1LB 3G6JF 4Q6IB 5DEFB 4F8QA 2VDOL 4JANB 3C5ZB 3BKJH 2Z93B 1ZOXA 5IGXL 3PWUA 3FQXB 2BSSA 4FQCH 4LVOB 4OCWL 3B5GA 2JCCF 2R1XA 4NQEB 3P0YH 3PE9A 4NC1E 4L8CA 4QRQB 1QO3B 4AEHH 3REWB 2YA1A 4PJ5D 4Y8AA 1KB5B 3HMXL 2NY5C 1H8NA 4XNQA 4ODTL 3RGVA 1ACZA 1OGAA 1DQQB 4X83A 4HUXA 4UAOB 1R24A 1OD7A 3QI9D 2AJVL 1E6OH 3UYRH 3WSQL 4EUPG 5JHLL 3MRKA 1KPRA 1U8MB 3MSPA 4D94A 2FLRT 1S5IH 3CK0L 1A21A 1I75A 3L3HB 1HHKB 4P99A 3KPSD 4MWFA 3FT4B 1JRHH 2CXGA 5ISZE 3MBEC 2EDKA 1FG2A 5GIRA 4KK5C 2W07A 3ZDYE 1SVZA 4IS6B 5IM7A 3CFEA 5EIIB 1CF8L 4AM0A 1EX0A 3BVNB 4UNTA 1JUFB 1I1YB 3CSGA 3MV9E 2NXYD 3D39D 1MAMH 2UZXB 2VKXA 2R0LH 1AGFA 1G0YR 3L3GA 4IIQC 1QYGL 4H25B 5I74B 1PEZA 4LVEA 3U0PB 3LRSA 4A6YL 3EDEA 3QRGL 2EEAA 2DIJA 3SE3A 1CFVH 3HZYB 1WZKA 1UM5H 5C0CE 1WK0A 2E7HA 4LRNH 5GS3A 1ADQL 4ISVB 4PRAB 4L8DB 4TUJA 1RZJH 3FQUB 1P7QB 3WXWL 3NZ8B 4FQQA 4KU1A 1ZEAH 5J9PB 4JM4H 5KSBA 4FS0A 3PP3K 5INCA 1ZT1B 1VENA 4ZUVB 4P2RD 3QHFH 1VSCA 1GGBH 3IU3B 3HUJA 4M00A 4Z7OF 3CFIC 5IEHA 3GHBL 1BVZA 1FH5H 1JV5B 3EOTH 4Y4FA 1ZTXH 5FYLL 4EEEA 4S1DD 4NM4L 5EBLB 1JPGA 4YHYC 1UEMA 5CWSA 5SX4I 1KN4L 4NP4H 4B5EA 5F7UA 4TRPH 1CGTA 1IC5H 1QFUL 2Q7NA 1P7KA 5INDA 3VD7A 1R0AL 4KUZH 5DHXB 2CDEB 3TJEL 1VKXB 5EOCL 3MJ9L 4WFEE 2EXYD 5I71B 1HYSC 3EJJX 3PWPA 5HVGB 1T21B 1RJZA 5MENA 5HDOA 3WJLA 3IDYB 2Y36L 2K9UA 3E6FB 2DLGA 2Q6WA 2YA2A 3B9AA 1JYXA 3SDYL 1I8KB 4WO4A 3VWJC 4NQVA 2AS5M 3CLEH 3QUKB 2GK2A 1EEQA 2XPGA 5IK3A 3WUWA 4WCYL 2DTMH 2F5BH 2OMNA 2VC2L 3QUZD 5J57B 1BVKB 3JXAA 3U4EB 2I9LB 3PIQA 2P5EA 4TUKH 1KCLA 1U8JB 2ADGB 5JMRA 3ZYOA 2IADB 4ODUA 4W6YB 2IANA 4X9BA 4W70A 1NFKA 4XVTL 2H1PL 5HY9A 1IQDB 3RVVC 4ZQKA 3A6OA 2VDLH 2BVPA 1ZK9A 4PRHD 2WUBH 4TTDC 4POYA 4ZOAA 4IRJA 2LU7A 3TBSB 2JJUA 3IJHB 2E7LC 4WUKH 3HC0B 1T7YA 4LASL 4HZLA 3FB8A 2XA8H 4KC3B 4ZUSA 5EULV 1NC4A 4XPHH 1IEBA 1DE4A 3L5XL 3T1FB 2HVJA 5HYSA 1U8QB 5E08L 4KKAD 4LLYB 5FB8B 2R2BA 5D2LF 3WE6B 3OZ9L 3K8LA 3LHPL 1E4WH 2R2EA 4J12A 2M2DA 3V6FA 3QULB 4N5EC 3SHSA 3P0VH 3GMQA 1CLYL 1TVDA 2X89D 3QIUD 5KOMC 3P4NB 5EUOE 3BRFA 3QXUA 4LCYA 4OCYL 2DMKA 4PJEE 5SV3A 4J1UB 3W0WB 5EU5A 3GJEB 1Z3GH 4XCYB 2GTZA 1RU9H 4Z0XA 2A1WL 3RDTD 5F7YC 3VDCA 5D5ME 1DQLH 3VI3E 1J05B 2A9NH 2CK0H 3NACL 1I85C 3P11H 2ICWI 2IGFL 1E6JL 2R1WB 4ODSL 2DYPD 4MXQC 2Q20A 3FN3A 5JXEC 1NCCL 4D3CL 4MA7H 3IVKB 3TT3H 4XXDA 1II4E 3K80A 1T1XB 2WIIA 1Z2KA 4OLYH 3UTSD 2OX5A 1MRCL 2NR6C 2XNAA 3LZFH 1T3FA 3FN9A 5F96H 2UY6A 2GIYA 1OP5H 3CDGB 3GSQA 3R1GH 4MD4B 3SCMB 2DM4A 3BYYA 2FO4B 4NYLB 4XNMB 3MOBH 1NLDL 1TCRA 2IC2A 4LCWE 4JPKL 4N0UE 3HZVA 1QOKA 3SDDD 1JZ6A 5I6XB 3KPRE 3ZDYF 2D7NA 4P5TC 2MNUA 1IE5A 5SWSB 2NY2D 4ZUUA 5GZOC 4NDMA 4GG6E 1RJYA 4FQ2L 2VITA 4RAUA 3HC3L 4QXGL 1P9MC 3HG1E 4GW5B 5DGQA 1IBGH 4KK8C 5M7QA 3MBEA 4MD5A 3RDTC 3BUYA 5F9OL 4Y89A 1IARB 2GTWB 2BNRD 5IBTL 4EI5D 4PLNC 4JKLA 1NBVH 2YRZA 4PJIF 3HRZA 4CJ1A 1MCIA 4N8VG 2YS4A 4UT6H 4HQQL 4LIQL 5HHOA 1UM6L 5JDSB 2CLZA 4IOFD 5T3ZH 3JWOL 4EVNB 4ZODA 1RK1B 1KLGA 3VXMA 1IL1B 4I77H 3RNQA 4KUCF 4LNVA 3DYOA 1IT9H 3GIVB 3HR5A 1X5LA 4ZFOA 1ZT7A 4W4OC 2CIKA 5FUZL 3RVXC 1D5MA 2A73A 5L2KE 1DQDH 3WNNA 1P2CA 2DQFB 4P4KB 4Z7UB 1AGEB 1AI1L 5C3LD 3IFOB 4M7KH 2MQ3A 3G6JB 2V5SA 4QT5B 3V6BR 2XTLA 3VFNA 2CLVA 2NY2C 2D4FA 2V7NB 1B0RB 2G9HA 1A2YA 3T2OA 4L4VA 4KKLD 3VXRD 3VW3L 4BYHA 2ATKA 2OSLA 1XF4B 2MTPA 1LO4L 5CP3H 4YHLH 5SX5K 4D9QE 4G43A 5B3JE 5TE4L 4HS3A 3C2AL 4PGDA 3BD4A 5IESH 4WY7H 4FRWA 4EI5C 5IKCA 1T5WA 2YEZB 3TO2B 5AZEH 1NGXA 4OZGF 1GOGA 4N90E 3SO3B 3O9WB 4B0MM 2KDGA 4IHOA 2CKBH 2WLYA 5TE6H 1J1XL 2AP2A 4OZ4A 2DLHA 4IOFC 1NGPH 2QSCH 2AXFB 5DRXA 3CLFH 3VXPA 2GSIB 3F7QA 3VWJA 3TYGH 3MLVL 1K8IB 3ARBB 5JOEA 1CBVL 4UB0L 5HVFB 2ARJA 5BS0D 3BOVA 1L6ZA 5FHAL 4KGJA 5C0NC 4Q9CA 4KRPC 4ELME 4MSWB 2A74B 1J87A 1FO0L 2W65B 2A6JB 1ZGLM 1QTYT 3WN5C 4OIAA 1S7RA 5IHUH 3HE6B 3TPUA 1ORSA 1MPAL 4GKSA 5C07A 3WMSA 4PG2A 4PJXF 1N0LA 4QRTB 5IFHL 4UILH 4ZOEA 4MDJA 4NNXB 4GW4B 4D0CA 1OHQA 3ZE2E 5K59E 4NM8L 2DN7A 5DJ6B 2HTLC 3DOSA 1KFAH 5CSZB 3I3EA 4JM2F 1KCSH 4OLVH 2E7LA 1EFXB 1ZHKA 1UKQA 5F1KC 1KLUB 3DVGB 4NO3B 4UT7L 5DMJB 2IBZX 5K9KB 3LEVL 5A2LH 1TZHA 3SDXF 1Q9OB 3BH8B 4OV6F 1U3HD 1TQBB 4LP5A 1T80A 1F4WL 1J0ZA 4M6OL 2VWEE 2X09A 3FONB 4JO1L 5T5NG 4PREB 1SJEB 2NTFA 4K94C 1QVOB 4FQJL 3GK8L 5DS8A 1WWCA 2Q8BL 4CVXA 4DVBA 2VZ3A 5GZNC 1W0YT 3G6AA 5CP3A 1UADC 4KAQH 4N9GB 1RUQL 4Z0BL 4LLMB 5M95B 4G8IA 2XWJB 3RWGA 5GJTL 5E24E 5IF0B 2PN5A 4P5KB 4E42B 1UXSB 4KTEL 1XF2A 4LEXH 3VFSA 3BPOC 3QIBD 1OM3L 1CFBA 5ALCH 3TA3B 1K4CA 3DROB 4DGVL 5C1MB 2NCMA 2RIKA 1I85A 1MCDA 2XZAH 2CKBA 4HK3J 5EU6E 3FO1B 3UJIH 3TBVA 4EBQH 2I27N 3IFLL 1SEQH 5JXEA 3KPMA 5F3BA 1CDGA 2Y7QA 3PV6B 4WDIA 3WHXB 5TDNB 3VE0B 4DKEH 4Y5VA 5E7BA 1MCWW 3RI5F 2OJEB 3PXHA 2YKLH 3WLBA 1U3HC 2YMXH 3DIFB 2X7LB 3K1KC 4S1SL 4CL7A 3TN0C 1YEJL 4JG0H 2WBJD 3OB8A 4I0CC 3DRTB 5TPWL 1T0MA 1YEKH 2FWOA 1WEJH 1BIIA 4JRXE 4NHCL 2IMNA 3NCCB 4E5XA 3WL9B 4WWKB 4P5TA 4ZXBD 4JAMA 4JN1H 5H35A 1K8DA 1ZVHA 2D0HA 4JFOB 4LLQA 2WINA 2BMKB 2QLVB 2WBKA 1EJ6A 1P9MA 2FEEI 3THMH 5LGJA 4OI8A 3F7YB 5IB4A 3B4NA 4R6UA 5C8JA 5IV2B 3HI1A 1JGLL 3F8UB 3KXFD 2Y23A 5EBMA 1IGJA 3C08H 2X4OB 4TN9A 1HQRA 5D2LB 3ESUF 1I9EA 3MXVL 1HQ4A 3L95A 3ILPB 2JIXA 1YYML 1FGVH 3KR3H 5GGTH 1Q72H 5KVDH 4OCLC 5JPMB 2J6EH 4AQOA 2EH7L 5AD0A 1MJUL 1U6AL 5CD5D 1UCBH 5JORB 5ELIA 2BVEA 4FFWC 3VFVA 1C08B 3I2CL 4W4OA 2FZ3B 3W5NA 3O4OB 3QO0A 4X8JB 3GGWA 1U3JA 2VXUH 1DN2A 5GGRA 3ARFB 3EO0B 4HFWA 2ESVA 4OLUL 1FIGH 3RWDA 4K94H 5GPRA 1HWGB 4YDLC 5ICZA 1PD6A 2VKWA 4P2QD 1ORQA 2V2WA 4LAJH 3MNZB 4YDJB 3VXQA 4PRPA 3H42H 3EO9L 1YMHB 4NUGH 3MTRA 1GHFH 3MGOA 3HZMA 1SYSB 4TVPE 4P3CH 3O4LD 5IP4A 5I8OL 3KDMB 1RURH 5DURD 1F58L 4R2GC 2VMFA 1K5NB 1X5GA 2C4XA 1QLRA 4AL8L 2Q7YA 1CE1L 5F7DB 5AUMA 4XXCA 3VXUB 2Q1EA 5DO2C 1G7PA 3HC4H 4ENED 3MLPA 3VFTA 1ZA3B 3X3GH 1S78C 2QQLL 2APVA 5FCUL 3E6HB 4GRLD 4AH2A 1I1AD 1J1OL 2FEDD 5T1KB 5CD5C 2AK4B 2DDQH 2XI9A 3H0TA 5I18L 1FFPA 3LQZA 4ZFZA 2Y9RT 5BVPL 2WK2A 3U7AA 2Z31D