1OE3A

Atomic resolution structure of 'half apo' nir
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Reductase
total genus 93
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A02
3NJMA 4BXSV 1ET8A 3GYRA 5ANHA 1PZBA 5B1AB 3BQVA 1ET7A 3PPSA 4DP4X 1TEGA 3FPXA 1AZUA 4HIPA 3ZX1A 3SBQA 2CJ3A 5I6OA 2N0MA 3L45A 3AW5A 2YXWA 3T6WA 3ABGA 3PXLA 1OCZB 2I85A 1HAWA 4YVUA 1SHXA 3NP4A 1L9PA 2GSMB 2ZONA 1MDAA 1SNRA 4KO5A 1CYXA 4X4KA 3S3DB 1A4AA 4KOCA 2EILB 3WKQA 2XUWA 3NJNA 1YLBB 2XV3A 3FU9A 3FS9A 4G71B 2PPDA 1XMEB 2TSAA 1F56A 2BP8B 1CYWA 3CZUB 2J57A 4BK5C 1PNCA 4KOBA 4NB7A 4RH4A 3S8FB 1WS7A 4N4YB 1SF3A 3FSVA 2FT8A 1M9WA 1QNIA 4A2DA 2CCWA 1E65A 3IN2A 2PP9A 2I7OA 4AKOA 1E5ZA 5PCYA 4DP6X 2Y69B 3GDCA 3HEIB 4TXVB 1BQRA 2MTAA 4KO9A 4E9QA 1JVOA 2XV2A 5D4HA 2GB2A 3FQYA 4HHWA 1PZAA 1EHKB 3D12B 3QJUB 4A2GA 2JFCA 3NJJA 4N8UA 2PCYA 1AOZA 3ZIYA 4P5RA 2FTAA 2DV6A 4W9ZA 4M3HA 2WO3B 1J5DA 3DKHA 2XXGA 3EH3B 3FYEB 3QPKA 3TBBA 2YAFA 3N55A 2BZCA 5D4IA 1KCWA 1PCSA 4GP5B 9PCYA 3PAUA 1ZV2A 3ABLB 1R1CA 1FA4A 2VW6A 3MX0B 4G7QB 5D4JA 4DP5X 3NSFA 3NJKA 3DIVA 1TU2A 4KNUA 4QKTA 1JOIA 3PAZA 3NYKA 3WIAA 1OCCB 3FU8A 3HB3B 3KW8A 2BHFA 1SFHA 2YAOA 2IDTA 4A68A 6PCYA 2FT6A 3ZDWA 4A2HA 1MG2C 2HRHA 1GS6X 1M56B 4E9WA 3WI9A 3X1NA 2IWFA 2DWTA 1T5KA 1NICA 2HLEB 3N2JA 1JZFA 1KYAA 1V55B 2QPDB 1NIFA 4HCGA 3EH5B 2J56A 1ZPUA 3FSZA 1A4CA 2JKWA 5TK4A 4DP9X 1E5YA 1WA2X 3T9WA 1KDIA 3AZUA 3FU7B 1SFDA 1IKOP 5I5JA 3X1GA 2HX9A 1MG3C 4YSSA 3CG8A 5A7EA 3KW7A 1JXGA 3X1FA 3UABA 1MZYA 1XB3A 4A2FA 1WAEA 1X9UA 1ZIBA 3FYIB 3OMNB 4PAZA 1JZGA 2PPCA 3RYMA 4YSUA 5I6NA 1N68A 2I7SA 1NIDA 1NIBA 2BP8A 4E9TA 1OE3A 2H3XC 1WA1X 5B1KA 5I5IA 2TSBA 2HX8A 1MZZA 2BWDA 2VSKB 2BO0A 1HFUA 4PCYA 7PCYA 1OV8A 7PAZA 2Q9OA 3QJTB 4G72B 4GP8B 4AKQA 4E9VA 2FQGA 4YSQA 4YL4A 1ZIAA 2JXMA 2HX7A 2XX1A 2YAEA 4K9JA 3TU6A 2ZXWB 5I26A 2AZUA 2DYRB 4QLWA 2BP0B 2YAMA 2LLNA 2OJ1A 4A67A 1WS8A 1NDTA 1UATA 2PCFA 1AS8A 2BZ7A 1VLXA 5AKRA 1J9RA 1W6WA 5I6PA 1PLCA 1N70A 3NP3A 4YSPA 3QJQB 1PAZA 2P80D 1SHWA 2IDSA 1AQ8A 3PLYA 2QDVA 1A65A 2VW4A 1L9TA 2CUAA 2DYSB 1GY2A 1L9SA 1V54B 2EIJB 4KNTA 3ERXA 1SF5A 1JXDA 4GY4A 3H4HA 2WO2B 2IAAC 1BXUA 2UX7A 5I28A 3NSCA 4JHUA 2ZWNA 3FPYA 3T71A 1A8ZA 4G70B 2YAPA 1AZCA 3EF4A 4Q8BA 3SQRA 3BVDB 5B1JA 2PPAA 2AVFA 2IDUA 2VM4A 2GC4C 1JXFA 3TASA 4YVNA 2H47C 1HAUA 2QT6A 5I6KA 3H56A 2VSMB 1AG6A 2FQEA 2WSDA 2IH8A 2HXAA 2XYBA 4UAHA 4M4RB 4CSPA 4HALA 2FT7A 3EHBB 5B7MA 4GXFA 3CDZB 3ZBMA 4DPCX 1NZRA 3X1BA 5LDUA 2Q5BA 2BW5A 3IN0A 1CUOA 1DYZA 1PF3A 3S3BB 1AZBA 3T6XA 1OF0A 3TA4D 2B08A 4GYBA 2XWZA 1NWOA 1KGYE 3FU7A 1RKRA 1BXAA 2GC7C 4G7SB 2NRDA 3AG3B 4A66A 1NWPA 1E67A 3FQ1A 1GR7A 1AS7A 1ADWA 4WTQA 4FA7B 3NJLA 1BYPA 1BAWA 2OCCB 2XLLA 1X9RA 2HRGA 2DWSA 1PLBA 4DP1X 1PY0A 4G7RB 4F2FA 3OD3A 3NJGA 2IWKA 4KNSA 1I53A 4GP4B 1GS7A 4YSAA 5B7EA 1J9TA 3NT0A 1AIZA 2XU9A 3ABKB 4BWWA 1RCYA 3JT2A 4ZK8A 3NSDA 4HZ1A 4P5SA 1SDDA 1NPNA 1BEXA 1J9QA 4W1TA 4AI7A 4E9SA 1PNDA 2MRYA 1BQ5A 4JHVA 1RZPA 1OOWA 3FQ2A 5I5MA 4NERA 1NIEA 1AACA 3ABMB 2YARA 3WKPA 2VN3A 4E9XA 1JZJA 2DY2A 2VW7A 2BP0A 2GBAA 1AR1B 1JZEA 4CSZA 1ILSA 3TBCA 2IDQA 2UXVA 3UAAA 2UXTA 2W88A 4Q89A 3MBWB 4YSEA 4ENZA 4AX3A 1OE2A 2EIKB 2XXFA 1SDDB 4BWUA 4YSRA 1CURA 1E30A 3JTBA 1FWXA 1BXVA 3WG7B 2R7EB 3QJSB 1TEFA 3NSYA 3AG1B 1KV7A 2IWEA 5AZUA 1W6LA 2AZAA 3IEAA 1KCBA 1OCRB 3QJVB 3V9EA 1KBVA 1M57B 4YSTA 4DPAX 3FSWA 1W8EA 3UACA 1V10A 3X1EA 4HHGA 1BYOA 3U25A 1TKWA 3ASOB 2PPEA 8PAZA 1FFTB 1JERA 1ILUA 1JZHA 2BW4A 1BQKA 1GSKA 1NTDA 3EH4B 3IBOA 3PAVA 3UADA 4YSDA 1NIAA 2FQFA 2EIMB 1JVLA 2GIMA 1IBYA 2UXFA 2UX6A 2XVBA 3NJHA 3WNJA 3AG2B 2J5WA 1PMYA 4BXVA 2X88A 1A3ZA 1XB8A 4E9YA 2HZHA 3AG4B 3CDZA 5B1JC 5F7BA 3DTUB 3SBRA 3SBPA 4FAAB 5F7AA 2P80A 4NAJA 3OM3B 1GY1A 2E86A 1JZIA 1ETJA 3IE9A 1GS8A 3AY2A 3PCYA 4UF7C 1KBWA 2J55A 1IC0A 2FWLB 1SJMA 5B7FA 3C75A 1ZDSA 1URIA 4F7KA 1AG0A 1KDJA 1PZCA 2W8CA 4EF3A 1ASOA 1J9SA 2IH9A 3NJFA 4E9RA 1J5CA 2CALA 2GHZA 4KO6A 1IUZA 5EHFA 2AFNA 1GYCA 5I6LA 2FJSA 4BDVA 3S8GB 3T6VA 5B1BB 2YAHA 2B3IA 4DP7X 2QDWA 3ASNB 2EINB 2CBPA 1XB6A 1IBZA 3CVDA 1A4BA 2AANA 1QHQA 4HCFA 1AS6A 2IDFA 3WNIA 3OMIB 3GXUB 4AKPA 2H5UA 1AAJA 2PP8A 3CVBA 4DP2X 2PP7A 1L9RA 2FQDA 3CVCA 2YXVA 3T6ZA 1L9QA 4BWTA 4JKNA 2YAQA 1B3IA 4AZUA 4BDVB 2RACA 2OV0A 1GW0A 1OE1A 4YSOA 3S3CB 3H4FA 2BWIA 1RZQA 3X2QB 4DP0X 1AZNA 2YQBA 1WA0X 1L9OA 1AZRA 2PPFA 4DPBX 5B3SB 3FSAA 2PLTA 4L0PB 1NPJA 2R7EA 2XV0A 5TK2A 1ET5A 4A2EA 1AANA 3FT0A 2UXGA 1NINA 4WKXA 4MFHA 4YSCA 2FNWA 5PAZA 5AFAA 6PAZA 1PLAA 1ZDQA 5E9NA 2VM3A 2VMJA 4HAKA 4KO7A 4HCIA 3V9CA 2ZOOA 1ASPA 4UANA 5FC9A 2X87A 1OCOB 1ASQA 3G5WA 3OMAB 1CC3A 3UGEA 3OQRA 1DZ0A 1ID2A 2Y1AA 5IY5B 3NJIA 2A3TA 2XX0A 3QJRB 4DP8X 3UAEA 4F2EA 2CAKA 2GI0A 2QPEB 5I6MA 1EZLA 1QLEB 3QQXA
chains in the Genus database with same CATH superfamily
5LCVH 2WYHA 3TNMA 2BJMH 2CM5A 4OR1A 5D1QA 3GJEA 2WP3T 1U58B 1T3FB 2ZWSA 1ET7A 3ZE0B 1X7QA 2YZ1A 1AZUA 2E5EA 4HIPA 3NOIA 4LQFL 2N4IA 3MLVH 3RFZC 4OI9A 3RB5A 4F2MA 5FF6B 4PJ9D 4NQSA 3NCJH 2HSIA 2FBOJ 2ZOLA 3SDXF 2I85A 5AWNH 2ADGA 4MCYA 4WSGA 4OF5A 4WU7A 1SHXA 5T3ZE 3DSFL 5K59F 3MRJA 1HNYA 2EXSA 2OMNA 4R5XA 3SPHA 4EZMA 2IFFL 1YNTA 2YEZB 1A4AA 3L08A 4R4ND 5INDB 3C5SA 3LKRA 2VDNL 4S1DC 1ORSB 1B0WA 4XNZB 2NZIA 5EN2A 4O02B 5I0WA 3WSQH 1QFUL 5MEQA 3T77A 1LO4H 1NBQA 3QJOA 1HXYB 1KBGH 2IJ0C 4HUVA 4G80B 5EU6B 1OSPL 2NNAB 5C09B 4YMPA 4EI5A 5DFVD 2F61A 4ZFOA 1KTJA 4N4YB 4JG1L 5BOZG 2ESVE 1MCIA 5BZWA 3AVEA 1B2WH 1HN1A 4QD2E 3K6DA 2UY7A 1TTFA 4CU6A 4HBCL 1P6AB 3NEXA 2EH8L 2ZT9C 1UD3A 1M71A 2Y69B 2WLJA 3A6CH 4TXVB 4A6YL 5B8CB 1BQRA 2IG2L 3IKKA 5CJXC 2B2XH 3FDWA 3QAZB 3UIZA 1U3HB 3ASWA 2LLLA 2ZUUA 4H0HB 3D12B 3OZ9L 3QJUB 4B3VA 4GRLB 1J5HA 5DD1H 1K6QH 4J8RA 3KPPB 1BIHA 2VXTH 2WWKO 3I02B 1S5IH 2CPUA 2WVUA 1MHPL 3D7PA 4GJTB 2D03H 4N90E 4B50A 3EH3B 2YGQA 1SJHB 3MVSA 3ULVF 4LPVA 5SV3A 2ADJB 4PY7B 3RPIB 2FBRA 5JPMC 5BXFA 1FA4A 3FH8A 4OLZH 1GGTA 1QRNA 1EZVX 4PRNA 4G7QB 3DGDA 1XSOA 1CL7I 5GGRB 3VXUB 2WBXA 2BY0A 4AVJA 7FABH 1KN4H 3ULVH 4DP5X 3RWJA 2EDDA 5HVHB 5HGDB 2VZUA 4OV5B 3R06B 4K7PX 2O5YH 1LWHA 4YAQB 2IDTA 2DN7A 1QZ1A 1FVCA 5GGRY 1ITCA 4GPVA 4WEMB 5DSCA 2FT6A 3WS3B 6PCYA 4NQQA 3AADB 4YZFF 2WZAA 3RTQB 5T33H 4CL7A 4KV5F 5DLLA 5EA0H 2BCKB 2FGZA 2Y24A 3SKMA 1WE5A 1ZHKA 1XGUB 4HIHA 3SHSA 1ZAGA 3ARDB 2Y6SD 5F7EL 1SLUA 4GAJH 2VWEC 1CTOA 3L16A 3RNQA 4AQ1C 4M7JH 1SN0A 5I1IL 1NJ9B 1H3VA 1T22B 5TPWH 3Q8CA 2EO7A 4X6FB 4WDIA 5K9OA 1WWWX 3MCKA 3DX6A 4WI2A 4HP5A 3X1FA 5LXVA 1R3KA 3SDCD 3K1KC 3N3EA 3IGFA 3MRIA 4Z95H 1L0PA 3L3HB 4NNYA 2XXCB 2O6EA 2PR4L 1U2YA 3ATFA 4AENA 1S7UB 3IMTA 3O11B 4P4RB 4XVJL 5HY9A 1BPVA 1AE6H 2P3YA 1PVHA 1OE3A 2QQLH 1EHAA 2VIRA 4PRHD 4LSQL 4JLRB 1GGYA 1T66D 2CO1A 5IQ9B 2JI2A 3QIWA 1K4DA 2NY0C 5F96L 3ILPB 3S34L 1M9SA 3GBEA 3FQUA 2JTYA 1Y0LB 3MZTA 4QXUL 4GBXA 4QHMB 2Q9OA 3ME0A 3HUJF 4NIYE 1ZIAA 1UD4A 4PJGB 2HX7A 4MGXA 3P73A 3S36X 2GUYA 4G42B 4RX4D 1HHGA 3RU8L 3SDAB 4MZ3A 2HWZL 4Y5XA 1R3HB 1SLXA 1DBJL 3MV8A 1TZOA 1WBYB 2R23B 1A7OH 2D31A 1BECA 1N70A 1MUJB 1JUFB 5BS0A 1RZFL 5AW2B 1DQML 5E2VL 4TSAL 2KDYA 1FDLL 3QQNA 4EBQL 1L9TA 2AJSH 1FGVL 4MMZB 3SDDC 5HHQA 1WFUA 3U0TB 3FT3B 4KKBD 4RGMC 1FZOB 3QCTL 4QRRE 3FT4A 4GKSA 2CXKA 2ZAHA 1HQ4B 4C47A 4E0RB 3MX0A 3WE1A 2WVVA 3C5ZD 4CMHB 3EYQC 1DTUA 1RK1A 2L7EA 2YMXL 1S7VB 4MAZA 5E95B 4RAUB 5HI4D 4TQEH 2F54A 3G04A 4W68A 3D1MC 2D73A 2NQCA 3C5JA 3C6SA 2WIMA 4X9HA 5AZEH 5D6DC 2E8YA 4WW2A 5E6RB 1TQSA 2GABA 2D9CA 2W5PA 2IH8A 4XH2A 5F9OL 5DJCB 1J5IA 4L1SA 2G60H 5D7IB 3BKYL 4LRIC 4P9MH 4LVOC 1DQQB 4U6XA 1USZA 5CGBA 5KOVC 5C3TA 5E2UH 1NGQH 3K0WA 3RLSA 1X7SA 3KYOB 2UY6A 4OFDA 4M6ML 1S9YB 4JDTH 5E0FA 1OD9A 4PJAE 3IDJB 1MCRA 2EJ1A 4BFJA 3MGOA 4IGBD 2WXNA 1NAKL 1FO0H 4NQCE 3DUUB 1F8TH 4PRPD 4L05A 3U7YL 5ACZA 4CMMB 3L3OA 3ETBF 4Z7UB 2FIKB 2GJ6D 2KHAA 3SO3B 2WPGA 1BYPA 1R47A 3N0PB 2VDRB 2HRGA 1Q0XL 3WE6A 4OZGF 1HL9A 3D9AL 4IBLT 4KZDH 4MS8C 5T1KD 3X17A 3E9UA 4FJ6A 3IU3A 5IEKB 3OKDB 2OP4H 4Z7IA 3BP5B 3C12A 3KBPA 4JPVH 4ZMTA 6FABL 1DFBL 3N41F 1D7BA 3AUWB 3QXDB 1BIIB 1RCYA 5DK0B 4PTUB 5AVSB 4HZ1A 4P5SA 5C6TL 2CWRA 1OTUC 3HNSL 3IDNA 2D4DA 4XXCA 5E5LA 1MCJA 3QCUL 4R7LA 3OB0K 2QZQA 3HMWL 5LGHL 3QEGH 3W0WD 2DEXX 4GRMA 3CDCA 3KPLA 2GK2A 4NWUH 4Q4IA 1U93B 5I8KL 5I5MA 1NIEA 3KPSA 3B7TA 1KLFA 1FUNA 1JWMB 2Z91A 4J2QA 4L5FL 4XPHL 3S37H 1M7DB 1WFMA 3KJ4B 2LU5A 3VCLA 4QO1B 2VW7A 4G6ML 2LHAA 1P69B 5M95B 3HC0A 5FX3A 1D5ZB 4JFEE 2IQAB 1FVDB 1IGTB 2OJZH 3EZJB 4W70A 5HHXH 3K46A 2R83A 2JF1A 3OXRB 5D1XE 3VFTB 4X4MA 5CIPH 5GGVY 4FKKA 2E27H 1WJ3A 3UCQA 2ZF9A 1GAFL 5IJVA 3EGXA 4N22A 2R56L 1DBAH 3TBYB 3F7RA 5CLXA 3O2VL 2R0ZL 3TNNB 5FGCE 3QUYB 5C0CE 3HRPA 5AAMC 3O4OC 3SPJA 2XPGB 1W6LA 4KUCD 2OR8A 4DO5A 3EJZD 1KJ2B 3V4PA 2MJWA 2AMUA 3QEHB 3RDTD 1NKOA 3P54A 2JELL 1KUMA 12E8L 5IKCA 2YFOA 1JPGA 2X1XR 1CK0L 5GXBB 5SWQA 8PAZA 5GZOC 5IVZB 1GIGL 4LPYA 3PWNB 4YUEH 2IADA 3TZVB 1I1RA 3VQMA 1M6OB 1Z9MA 4GT7A 4UUJA 4ZTPL 1DJGA 4YE0A 1LMIA 3MGTB 1QR4A 4ODVH 4CUCA 4PJ5B 2AEQL 2B1OA 4ZAKC 4JFEA 4MX7B 4XMVA 4GSDL 2P7TB 3MOAL 1NEZA 3WUWA 1WIPA 3TNMB 1RZ7L 4KTEH 3PCYA 1NCUA 5L4FA 4M9OA 1N0XH 5D1QB 1IC0A 1RV6X 3GJEB 4Z76A 3RAJH 1A6AA 4PJ8D 3COOA 1L7IH 2FEEI 3OAYH 1X7QB 5EEUA 3MODL 1J5CA 4K7PY 4OW6A 4D0BA 3VQ1C 4F2MB 1FNSH 4JMXA 2BJML 4MBOA 5EBMA 4NQSB 5D7JD 1KTRL 3P0YL 1H8NA 2ZOLB 3GBMH 1EAPA 1RPQA 1CXHA 3QZOA 2ADGB 4MCYB 4YDJA 4WU7B 4IKLA 1P4LA 5EG6C 3T6VA 1ZT4A 3GSUA 3UZVB 3MRJB 4OJDH 4TVPE 1YNTB 4DUVA 3K3QA 2FL5A 3C5SB 3LKRB 5AWNL 1SRDA 5E5MA 1AS6A 2EE0A 1JNNL 5EN2B 5MEQB 1JHLL 5CN3A 3T77B 2YD8A 2ZP9A 3IBEA 4JRYE 2P8LA 3RIFF 1OAXL 2H5UA 4ZNEA 5BV7B 4HUVB 3GI9H 3K6NA 5B1CA 3IPBA 3NPZB 4X5QA 3R7RA 4EI5B 1YVLA 4H5SA 2VDLB 1CLYH 2HFGH 5KS9E 2FLRT 4ZFOB 4XP1L 3WSQL 4FQLH 2Y7LA 1LO4L 3PAYA 5BZWB 5JHDD 1Q0YH 3UPCA 4N2CA 2EAEA 2RACA 4KY1L 3GNMH 2UY7B 3KL3A 2L7UA 3N91A 1IC5H 1M71B 4PJIA 5T1DH 2DJMA 3GLDA 2DKSA 2NT0A 5EZOH 4FDWA 1X6LA 5I15L 3V0WL 4UM9D 5DLML 1CDGA 2PWGA 2H6UA 2DM3A 4I48A 4L0PB 1V7ML 5I8OH 4GNKB 5JHMA 4J8RB 4LL1A 5BO1L 1PU0A 4XMTA 2FO4A 4TTDC 3SDXE 3WS6A 5BUAA 3VI4F 8CGTA 4B5ZA 4YK4B 1ZT7B 3MV9E 5EF0A 5BXFB 1K6QL 1UT1A 2NY4B 2WQ8A 5E9NA 1A6ZA 4EDXA 1QRNB 4PRNB 1MF2L 2VLME 3BUBA 5CLTA 3RP1A 4ANKA 4UTAH 4TUUA 4WUKL 4EOWL 3VXPA 4KVPA 3HAEG 2LVEA 2GVYA 3RWJB 1GXEA 2MCAA 4OIBA 4IRSA 1KCSH 5AZ2H 4OLZL 3V4LA 4GFTB 1FVCB 4F7PA 1GZPA 5DSCB 1XCWA 5I1GL 1IFRA 1KN4L 3SYQA 2HTLC 2VDOH 3LPFA 1B88A 5D8JH 4LCYA 3SKMB 3I74A 5EUKA 2J71A 1ZHKB 2O5YL 2DYPD 4HIHB 4IU3A 1PW3A 3KPRE 3HC4H 3RNQB 5HJDA 3B9AA 3BUPA 1DVSA 5AAWC 3RFRA 4WDIB 5FM5O 3ZQWA 3MCYA 2VTFA 4V33A 5K9OB 2HRLA 4KUZH 1BVLA 3MCKB 5E1GA 3DX6B 1MDAA 3VWKC 1M1XA 4EXPX 1F4HA 1R3KB 4AT6A 3S3DB 2AJXL 1HEJC 5GJTH 3F7YA 3MRIB 4NNYB 4IK6A 1IAKA 3QCVL 2V7HA 4D9LH 4YFDB 4AENB 3LPGA 3QR2A 3HZYA 3NFNA 5HY9B 3ZW3A 3ULVE 4FMFA 5CSBA 1CB4A 3SODB 2VMFA 3FQTB 4J28A 1GA2A 1BLNA 2VIRB 5DD0L 3F01A 1NBVL 4KOBA 3HMXA 1S7RA 4Q56A 5DA4A 5K93A 1LE9A 3QIWB 5BQDA 5F1KC 3TWYA 2IQ9L 3QZMA 3FQUB 2VUKA 4HSAC 2AEPH 4GI9A 4GBXB 2ZX9A 4ZW3A 3ME0B 2H0EA 4N86A 3KEHA 4V2CB 4XNUH 1XEDA 3P73B 4AQ8C 4YZFE 1HHGB 2OXGA 4KV5E 3VTTA 1A6PA 1V3KA 5AW6B 3ARGC 3DVNA 4MA3A 2PO6A 4Y5XB 3SBWA 5IW6B 1YC7A 5E4IA 3MV8B 1OQOA 1WYJA 3JSSA 1KEML 2X2JA 5TQ0L 2D31B 3C2AL 1KXVC 2PUQT 2H2PD 4XN8A 5BS0B 4GO9A 1KC5L 5F72S 1PG7X 5T1LA 4Z7VA 3QPQC 5HJGA 1I8UA 2Y7OA 2NUTA 2QGEA 1Y6KR 2YAFA 5HHQB 3U82B 5I1KH 1GGBL 1N7MH 2DH2A 3EYFA 1A7OL 3FT4B 3JV0A 3NEOA 4GKSB 1OT4A 4H0GA 1UFUA 2C9VA 4MJJA 4X42A 3MX0B 1U30A 2AAAA 2WVVB 3RQ3A 2L7JA 5F1IA 3NCBB 3HKFA 1RK1B 3GIZH 4NHUA 4G8GE 3FAXA 1KJ3H 1JOIA 1UZGA 2F54B 1CXKA 3G04B 4FP8H 3C5JB 1H8LA 2OSLA 3NH7H 2YAOA 1RZJC 2F5BH 3C6SB 4JO3H 4CNIA 1IILE 4WW2B 1ITBB 3NPSC 4YL9A 4JM2D 4A2HA 2GJPA 2HRPL 5FGSA 1I7RA 3VFNA 3WHXA 4XH2B 4TQEL 4LOFA 3AMLA 2R2HA 4NUJA 1DUYA 5EORL 4U6XB 25C8L 4X6DA 5JW4Q 5AZEL 2IAMD 1DDHA 3NZHH 3OX8A 3HUJE 1OSYA 4MZRA 3HI6H 5JQHC 2X4QA 3LNDA 2FHBA 5CU5A 5FYKU 1HYSC 1G9EA 4LOVA 5HPOA 2FVNA 5EZJA 4RGND 4R26H 3K81A 3MGOB 2NYYC 4P9ML 2PCXA 3A6BL 4MVBD 2I60H 5CD3A 1UB5A 1YCSA 3MLYH 1KGWA 5E2UL 1MG3C 5ACZB 3L3OB 2MIZA 1YY9D 5GSVA 1Z9NA 4XI5D 3S98A 5GZNA 1F1DA 2AK1L 5D93B 1J0KA 5L4MA 3PQYD 1FO0L 3WE6B 1F8TL 4JFFD 1MCQA 3WNPA 3CSBA 5ABZA 1TQTA 1T21A 3MRNA 3OR7A 2OZ4L 1NIBA 3FH5A 5KAQF 3IU3B 3GEFA 4I77H 4NQEA 1JGUL 3QDMA 3VI3F 3QE5A 2YSSA 4NQDD 4R7DA 4ACPA 1C08A 5IR1B 3N9GH 5LQBH 3IDNB 4DEUA 3LQAC 2OULB 2Y06H 2WXQA 4GRMB 3AQXA 3KPLB 2HPOA 2OP4L 1BP3B 4G72B 2XPZA 1UT2A 4GP8B 3P30L 4JPVL 3ZDYF 3WKNA 1IVTA 4E68A 3KPSB 1IBBA 1KLFB 3FZUD 1LQSR 2Z91B 2YJLA 1A7PH 3FBKA 4L9LC 1AGBA 3H6AA 2IOOA 3PP3K 2QTVA 5JZ7C 3VW3H 3IDUA 3RY6A 1RZJL 3QEGL 3SJVD 3VCLB 5A3IC 4DHLA 1E3XA 2A9BA 1K9TA 3Q5OA 4NWUL 5KUKA 3HC0B 2EUXA 2E56A 4CVZA 1A21A 1QBML 4NO3A 3S37L 3ZJAA 1T1XA 2EEBA 3KPOA 2P80D 3UTSA 2N56A 3QDHA 4QMEA 1N4XH 5IJVB 3EGXB 1L6XA 2JQMA 4BUGA 15C8L 5DMGD 4CA4A 2OJZL 5HHXL 2F8XC 4FTDA 2XI9A 4O2CA 4U6HA 3WTXA 1QKZH 2Y9RT 2Y4SA 2R2BA 4M48H 5TDOA 3NSCA 1A2YA 5KSBA 1D5IH 2E27L 3V4PB 5ILTH 4HOMA 5TJWK 1DBAL 1SHMA 1ZA6A 4OZGE 1H6TA 1U8HA 4Q8BA 1D9KC 2GFBA 5J1TC 2A73A 1JPGB 2WYTA 1QTSA 1QZNA 5SWQB 1JNJA 3MRFA 1PKOA 1YYMH 2QMKA 1OARL 4NN6B 3WNOA 3HLAB 4UUJB 1T20A 5IM7A 1LO0H 4I88A 5JHLH 1P7HL 4DPCX 2FYYA 1E9OA 5LXGH 2YZ8A 1LEKA 4JFEB 1S9XA 2L04A 2O6FA 3WDIA 4R6UA 3JTTA 3LQAL 1NEZB 3FUEA 4WY7H 4XVUD 4YUEL 4FNPA 2E3VA 3E38A 1QPPA 2RD0A 3SE4A 3WUWB 4PS8A 1YEHL 5GGVH 3S9DB 4Z76B 4KKRA 2PWFA 1A6AB 1NBYA 3MV7D 5IHBA 2K9FB 4WIQA 5DI8A 3TN0A 4KX9A 4PJDF 1U8CA 1TITA 1IAOA 4D0BB 1JNLH 4M7LT 4AK1A 4JG9A 2JWYA 4WGWB 3KWWA 2K70A 4KTEL 5EBMB 4PJHA 5I1JL 1EAPB 4ORZC 1CXLA 3PWPA 4YDJB 3E1F1 3OR6A 2XXMB 1P4LB 4Z18A 3B2VH 3UERA 1JYVA 2VZVA 2YXMA 3MLSH 1ZT4B 2VERN 3GSUB 3MBED 4N2EA 5DU7A 2VXQL 3NIDE 3POHA 4OT1L 4ELMF 1VPOL 4OTXH 1J9TA 3UIYA 4A1RA 3BSGA 5DC9B 4DTGL 5FYKH 2FL5B 3C87A 3LIZA 2ZKWA 3THML 5E5MB 3NSDA 2FEDD 4X7FC 4XNZC 1BEXA 4MJIE 1JVKA 4PYGA 1U2HA 3LN4A 4GFXA 3KJ6L 4J27A 5DT1H 2P8LB 4E9SA 4JO2H 4MAYD 4AIZA 4QXWA 3ZMEA 4F9PA 2OW7A 3PHAA 4UM8A 1A9VA 4NERA 1CGSH 3R19A 3VXRD 1XGZA 4H5SB 1IKNA 5L6YH 1H19A 3KS0H 4YE4H 5E2TH 3H9ZA 4NSKA 2EEDA 2F8IA 4NDMA 3GI9L 3A67L 2BH0A 4K7PH 5JQ6L 1AO7A 1CYGA 4XMPL 2TRYA 1JF5A 4RDQF 4PJIB 4MA8L 4NPYA 5IT2H 4HWNA 5B8CC 2AV1A 1UM6H 1Q0YL 3BVTA 4YC2B 5D71L 3QDAA 1F97A 1DO6A 5IBTH 1U3HC 3LPPA 3GNML 1RFDH 3LKPA 4I48B 4GRLC 1J11A 1KXHA 3RIAF 5T1DL 3HTLX 1E7UA 2L0DA 1E4HA 3AGVA 1KV7A 5AZUA 5C0IA 4MSWA 2KQNA 2B59A 2FO4B 4PB9H 3VXSD 4KKAC 4YSTA 4IBWA 1KTCA 1FN4A 1KULA 4MJIA 2N7BA 4FKEA 3NGBB 3ISWA 3LSOA 1U36A 2VXVL 5M94B 3BH9A 1A6ZB 2K6ZA 4EDXB 1JZHA 1EPFA 4YHKH 1JVLA 1BM3L 1CFQA 4FFYH 3VXPB 3WXWH 3B6SA 2DI9A 2UX6A 4TLUA 4ZPTA 3MLWH 1IC4L 1RJZA 5C0ND 3QWNA 4F57H 3SD5A 2YUZA 5AVXB 1KBPA 5HVHC 4PH8A 1ACZA 2I32A 4QRPA 5T3XH 3GMPA 3GXTA 4ZSOA 4F7PB 4QRQA 1GZPB 4QNPE 1JZIA 2YBGA 5TFSL 4UTAL 1MFUA 3P69A 1A5FL 3RTQC 1IT9L 4LCYB 1U4EA 2OL3A 4UF7C 4MYWB 1DQLL 5EUKB 1KCSL 1URIA 1KDJA 5F44A 4ZOBA 1UJ3A 4ZXBA 1FYHB 5GRWA 4TNEA 3ARDC 4IU3B 2V2WA 2Q7AA 2XQ0A 4JKPH 4QR7A 4ODHH 1EO8H 2VDOL 4AL8C 4MNQE 3WV0A 2WLLA 3D34A 3S36H 4DQAA 1KCKA 3NUKA 1BCIA 3MLUH 4Y4KD 3IRZA 5I6LA 3KH4A 1T03H 4BDVA 1INQA 4W6YB 1BVLB 4KJWD 4WHCA 5EEWA 1HL8A 1TCMA 1L4IA 1G7QA 1M1XB 2PR9A 3ARBA 4FNLH 4JRLA 4AT6B 1J1OH 5HI5D 3V8OA 5GGQL 1JTTA 2B16A 2J1WA 3F7YB 1QHQA 1IAKB 2KQMA 2V7HB 3F58L 3OMIB 1N9PA 2CO7A 1N10A 5ECJE 3VI4E 3HZYB 3NFNB 1D6VH 4G3YH 5LN4A 2XJKA 5EWIH 3ZKND 3MA9H 5EB9A 5C07D 3CVCA 1BLNB 3IRCA 3QQ4A 5DJ8A 3MUY1 1S7RB 4M9PA 4Z1PA 1LE9B 1BZ8A 4GG6A 1H8SA 1R6VA 4EPSA 1XTLA 4KX8A 2XWEA 1R4XA 2F53A 4F37F 3FUNA 3NCYP 3NQIA 4F33A 3RX8A 1E8ZA 3A3YB 4N0CD 4L8BA 1IGYA 2OXGB 3O2DL 3S88H 3SDAC 4ZTEA 3VFGH 3DVNB 3VUAA 4MA3B 2PO6B 2EDXA 5LBVA 4AGMA 4XBEL 3MRKA 3P02A 4WZ9A 4N25A 2RHEA 2OTWA 5T1LB 2A77H 3EFDH 1S6NA 4Z7VB 2RGSA 1JGVL 1W80A 3FT0A 1G87A 1S3RA 4HUKB 4MMZC 2D7MA 2V3DA 4AL8L 2FNWA 3EYFB 4WGKA 2BVOA 3QIBD 5G55A 3WLWD 4MHHI 4C8XA 1DVFC 2HKAA 1ZE3H 1PYWA 2K8MA 2A7BA 3NQKA 1IX2A 4OLYL 1OM9A 5F1IB 2X9WA 5CZXC 5F3HA 2GIYA 3FT2A 2X87A 1BJ1H 3HG1A 4U1KA 3BLKA 4G83A 2ZJSH 4M43H 1HL5A 4NHUB 5I1KL 1N7ML 4V1DE 3A4DA 3IK2A 3CFJA 2J8UF 3RRQA 4ZFZA 4J4PA 2OSLB 1KFAH 3H9SD 4DGUA 4KMLB 4CNIB 1QLEB 2Z0UA 2WHVA 1OALA 3U9PH 5JUEH 1I7RB 4A38A 5JYLA 3VFNB 5EU7E 3WHXB 3FCTA 5DVOA 1KJ3L 1DBMH 5BRZA 3R7QA 2R2HB 5IVXF 3HAEA 4LHUB 3CSGA 5IBLC 1U8JA 3FQXA 1DUYB 1MW0A 3PNWA 1KPVA 2F5BL 4NUJB 4ZX5A 4X6DB 1MWAH 4AEHH 1DDHB 3OX8B 1JSYA 2JH2A 4L4TA 1AJ7H 4HISA 2X4QB 4S1SH 2FNBA 3QR0A 3IGAA 1O7DC 3PXJA 5EZJB 3T3PF 3ZHKA 4GAFB 4ZUUA 1FFNA 3L3IA 1JRHI 1MELA 1UB5B 2YPVH 5SWZA 3ROLA 5CD3B 1WAAA 2O72A 2PXYD 4GUOA 3HI6L 4U3CA 2Q1EA 5GSVB 3GUFA 3P4NA 1XO8A 3SO3C 4R26L 3KWUA 1NM9A 5F7HA 3SPCA 2C1OA 1SJXA 3BEWA 2I60L 5FKPA 2XTSA 3LEVL 2OYPA 3QPXH 2PPDA 1T21B 3MRNB 3AQDA 3OR7B 5ENWA 4I1RA 2FZ3A 5IW3A 4YJZL 1VKXA 2QKIA 1AVAA 1UB6A 4NQEB 5F6IB 3QDMB 4ZMXA 1I8MA 3S8FB 4NB7A 2YSSB 4R7DB 1L6ZA 4AG4H 3FFCA 5LGJA 3FUIA 3H7BA 4L3AA 1QSEE 5J6GA 2OMTA 3CK0L 1S7XA 1TENA 2C3WA 2XTJD 3HC3H 4K8RH 3UFIA 1RIVH 2I7OA 3TCTA 1G9MH 4WAFA 1GRWA 5CKAA 1AGBB 3KJ4C 3MNZA 5A6LA 4G7VH 4YOKA 2DMBA 4FG2A 3VG9C 4GSQA 1SLWA 5FO9A 4WWKD 4D94A 2D7PA 4CVZB 3E1ZA 4NO3B 1A7PL 1T1XB 1IQWL 3WIHA 4H40A 2DV6A 3KPOB 3L6FA 4XP5H 3VW3L 4OLEA 3UTSB 2WO3B 4D8PA 4R7NA 3KPNA 4HCRA 2IGFH 1V8HA 3DYOA 3VH8G 5I30L 1AZZC 1WEJH 1OLLA 2H2SD 4O2CB 3U4EA 4U6HB 4FFVC 3QUYC 4ZI8A 2EVGA 2R2BB 5TDOB 5KSBB 1A2YB 4S2SA 3F2LA 3RKDC 3ZSTA 4QRTA 1ZA6B 4HQQH 4XNXH 4QOKE 2GFBB 1QSEA 3DNKA 1T0PB 3FN0H 4OD1L 1FH5H 2A73B 4KX7A 3SOBL 6CGTA 3FBQA 3O9WD 2VDRL 4M48L 3AT0A 3MRFB 2X2IA 1D5IL 3MOBH 5AQ0A 5I73B 3VI3E 3AAZA 1AGDB 4A37A 3TZVC 1NOFA 1S46A 1T20B 4G7YH 5IM7B 4ZYKA 2ZIDA 4G9FD 4YFLI 2C7UA 2FYYB 1E9OB 3GSVA 1XIWA 1LEKB 2YPLA 2CH8A 1S9XB 3BMVA 4UINH 4NCC2 1YYML 2IH3B 3QJZA 4OM1H 4OLVL 3TONA 4HC1H 3ZDYE 3JTTB 2OAAA 1HZKA 1LEGA 4M62L 2VDPB 1G7IB 3RBGA 5GRVK 3TXAA 4OLUL 5D1QC 4DQOH 1NBYB 4E41A 4L1HA 5DI8B 3TN0B 5LXGL 4K23L 2WLHA 1PQZA 1U8CB 5F1NA 4FJZA 1IAOB 3KW7A 4DN3H 2HJKA 1O0VA 2QVIA 5E99H 1MJUH 3KWWB 3ULSA 2C4FT 4PJHB 1MZYA 3ZSSA 4X7DC 4LPUA 5GGVL 4A2FA 1WAEA 3FUDA 3C09B 2CGYA 2IBBA 3PWPB 5F6HI 3OR6B 4LLAA 2BPBA 3ULUD 4OZGB 3L4XA 3VG0H 1XVSA 1RZ8A 2R2EA 1BVOA 5EZIH 3B83A 1A3RH 1RU9H 1SOXA 3BEVA 3MBXH 4JFYA 5DMIH 3TV3L 3QXTA 2G75A 2O6DA 5EZPA 3OKLA 3RPBA 3VWJA 3F04A 5FKAA 2K1MA 2G5BA 3LN4B 2UYLA 5H4ZA 1J9CT 1QASA 4OTXL 4AIZB 3WO3B 4YR6A 3ZKSD 2D2CC 4UM8B 5BV7C 1KJ2L 2BSSA 4J3OG 1X6NA 5F70A 4EI5C 2BSTA 5SX4H 3JVGA 3RZWA 1PEWA 4QAWA 1DE4A 4NSKB 5ICYB 2XCMC 4P57B 5JW5A 5K33A 1EX0A 4ALAH 4NDMB 2C9AA 1AO7B 2CU9A 4XWGL 5MENA 3EYUH 1UUSA 1T2QH 4ODSL 5L6YL 4NPYB 4JL1A 2AV1B 2COVD 1SXZA 2EIJB 1J12A 1EZSA 4GY4A 2CZNA 3LKPB 2OBGA 4PJDE 3MU3A 1GCYA 2VR7A 1RJYA 3NIDB 4WFED 4F8OA 4HFWA 5F9JA 1YN6A 1VRSA 1CGVA 2IANA 5C0IB 4MSWB 2B59B 5LLIC 1X7TA 2H6OA 2O26U 3EOBA 3SCMC 1AZCA 4JG5A 1FN4B 5FYKE 4MJIB 3SQRA 3G08A 4UV4H 5B1JA 1XT5A 1I31A 3C6LC 3LSOB 4RQQA 3SYOA 4YK4C 4ETYA 1LEIB 2IDUA 4AUJA 3BH9B 2NY4C 4QRSA 4IRZA 4ELME 4KJPD 5H2BA 2QT6A 2VDQB 3ET9F 3RWGA 4XXWA 3AACA 1CFQB 1F3DH 2APSA 3BDYH 4ZPTB 3HBGA 1RJZB 5FWRA 1XX9C 2EABA 2RJMA 5DZOA 1HX0A 2BXYA 4OF8A 1BA9A 4DT2A 1CN4A 3FOLA 3OJMB 4QRPB 1DBKL 5HDLA 5CJQH 3GMPB 1AI1H 4QRQB 3DUSA 3WXWL 1RAMA 3A4EA 4ZMYA 2X7LA 5LJYH 4GUPA 3MLWL 3Q6GH 2OL3B 4AXWA 2AQTA 2GTWA 5BV7L 1RKRA 1UWGH 4FQJL 3TTYA 1UJ3B 1WZMA 4ZXBB 2VDLL 1BQUA 5JMOC 1FGNH 2V2WB 4UQDA 4YX2H 2ODHA 5HHOE 2WLLB 3INUL 1ZEAH 2XT1B 3WEAA 3QORD 4MKMA 4NKIH 3K2KA 4LCIH 4P4KD 1INQB 3ZTCC 3FUKA 1NC2D 4JKPL 1G7QB 3ARBB 4ODHL 4AGQA 4GP4B 4B9GA 3IFNH 5AYQA 3MLUL 1PG7H 3TIDA 2XWDA 3OHXA 4ZK8A 3QWQB 4TTGA 1T03L 1OLZA 3GXMA 4HUUA 4P06A 2CO7B 2ICCA 4CDHA 3KNBA 4ZJ9A 1MN4A 4JQVA 2ZCHH 2R59A 3QFJE 4XCFL 1OOWA 5MERA 3ARUA 2J2ZA 3QQ4B 1EVUA 5DJ8B 3UBHA 4KFMA 1SUHA 3RVVC 3N06B 3K0YA 4HJ1A 4GG6B 4MMYA 3QIWC 5T3XE 1YA5A 2BP0A 5DD5L 4XR8C 1S7SA 5EWIL 4MJ5A 3D85D 1GPOL 4GBXC 2HUHA 3RGVA 2IDQA 4F33B 1Q9WA 1JDAA 1IGYB 2WGNB 4L8BB 3ATAA 5HHOA 2YOAA 4Q89A 3TFBA 2A6JA 1TETL 4AX3A 4R4FH 4NBYB 5T5FH 2XXFA 5BVJA 2BNQE 3MOQA 3J8F7 3WTTA 4J3VA 4Y5XC 3CFUA 4JANA 3MRKB 3BGFB 1J86A 1MHCA 1UWYA 5FDYA 1TQBB 4AY0A 1HINH 1A66A 2OTWB 3R8QA 4M5SA 5AYUH 3QJVB 1NCWH 1BG1A 4DGVH 4X8JA 1H3XA 1KGXA 4Q9RL 3OKKA 4C4KO 2Z4QA 2BVOB 3H9HA 8FABA 5KZCB 2ZX6A 2E9IA 1RZKC 4IBZA 5DXWA 3WO4C 2CBQA 1AQDA 5D96C 1PYWB 4ACTA 5F3HB 4GXVH 2EIMB 3FT2B 1ZA3A 4BM7A 1BFSA 4AM0Q 3HG1B 1TJGH 1UD8A 4U1KB 4KI1A 2X6BA 2BLFA 1FNEA 1NANI 3FF7A 5CP3H 2BSDA 7TAAA 1IGCL 4ZFZB 1ZPLA 3S3PA 3DTUB 4AJVA 1UD6A 1NMAL 5GS0C 2VQUA 1CFVL 2XQYG 4PRBA 3GHBH 4UT9H 4WW2C 3QQ3A 3FB8A 1FYTD 1R17A 2P1YA 2VERA 3BWUF 3FCTB 4DERA 5BRZB 1CFMA 3HAEB 2VC2H 4S1DD 1O5DT 1U8JB 3FQXB 3JYCA 1KFAL 1KPVB 1YEGH 3ARSA 1UA6H 1ASOA 3N1GC 3PHSA 3EH1A 4EF3A 3OJDA 4L4TB 1BFVH 1QD0A 4FC3E 2XKUA 3IGAB 3WL9A 3MRGA 3L81A 4XE5B 1FFNB 1TCRA 3L3IB 3ROLB 3O4LE 5SWZB 5EF1A 3CFMA 1AJ7L 4DP7X 3L3OC 1ZCRA 3QEQD 4WI4A 3P4NB 2EINB 2HLFC 2M2DA 1E5CA 3GKZA 3CVDA 4LCWA 4ZTOL 5D93C 4JPSA 5D4QA 3WNIA 2C1OB 5LDSA 3BEWB 4ISVA 2YPVL 5FKPB 5C7ZA 4F7MA 4ZX4A 4MB4A 1G1CA 1NCOA 3B2MA 5ENWB 4DESA 3FCSA 1VKXB 2FZ3B 5JNYA 2QKIB 5TF0A 1W0YT 1EJOH 1UB6B 1I8MB 4I9WD 4M1GL 3ZDZF 1T6BX 4BFKA 2YHGA 4KKLC 4NRYA 2C3HA 2WOYA 1CGTA 3FFCB 5LGJB 2O6CA 3H7BB 3QPXL 4XXCC 1RZKL 3U7AA 4RA0C 3DGGA 3SGDI 4IIQA 1TTGA 5JHLL 5J6GB 2ZXQA 2J8UE 2OMTB 4FXKA 1S7XB 4N26A 4W9KC 4EIZC 3U36A 3SY6A 2IBZX 5E1HB 4NYLA 4AG4L 2KL6A 5FYJL 2JCWA 4NUMA 3MNZB 4QKXB 2X05A 5GS0L 2AJ3A 2FJFA 4EDWL 1MQKL 1DLFL 5IVXE 4P2QA 1H3PL 3HC3L 5C97A 1E5AA 4WHYG 1RIVL 5B3SB 4AIXA 4FABH 5IB1A 1RUQH 4XCYA 1G9ML 3L6FB 3GINA 4NIKB 5CR1A 4D8PB 4Y7MA 4R7NB 3KPNB 1FIEA 4G7VL 3N44F 3T3PE 3N6YA 1WCBA 3IAPA 2WQXA 6PAZA 3IETA 3D07A 1B0IA 4XVOA 3U4EB 5J5EA 1S7QA 1YMMD 1XGRB 2X4PA 3H2QA 4G6KH 1GYVA 4S2SB 2IGFL 2XN9D 4R5VA 3IFOA 4QRTB 1BZEA 3LPWA 4PJBA 4PUBH 5DUJA 4JRXD 2R29H 1GTFA 3FW6A 1QSEB 4JFDD 4LGSB 4K15A 4XCCL 2ZX8A 4J3BA 2ZCZA 2W9DH 4YXHH 3AAZB 4BXSV 5L2KE 1IM9A 3FU3A 2ENJA 3R1GH 4NN6C 4XNXL 1UM4H 4JM4H 4ZYKB 3P9WB 5IBUG 1RHHA 1ZVNA 2V33A 2C7UB 2YA2A 3CN1A 5FV2A 3FPXA 3GSVB 1XIWB 2AJZA 2CK2A 2YPLB 2B9AA 4MNGE 3QUKA 2X1OA 1LEGB 3ABGA 4I89A 3L54A 4UZGA 4F7EA 1CI3M 4G7YL 1BJ8A 2DQIH 5E9DA 2IWGA 4YDVA 5FHAH 2QVTA 2Z8SA 1L9PA 4E41B 4OUOA 4UINL 5IB4A 4DGIH 4OCYH 1PQZB 5F1NB 2A74A 2JI1A 2LV4A 2NX5D 3BAIA 1DVQA 5JXAL 2HJKB 4FQCH 3ULSB 2FGWH 4AQEA 2V9UA 1CD0A 3MPCA 2EIEA 4DQOL 2X0UA 2WIIA 2A9MH 3OAZH 3BZ4B 3T0BA 2IPUG 2A6KA 4G71B 3VVVA 4I2XE 1BREA 1P6FA 1U8NA 4XNYH 3SPGA 4XNDA 4YQXL 1TZGH 1RZ8B 2R2EB 4DN3L 4FTVA 1F56A 2CRYA 3PJSA 1MJUL 1MW2A 2LFEA 4Z5RB 5DZPA 2ENSA 1EHNA 3BEVB 4JFYB 4JFWA 3D52A 1I3GH 1FORL 3GS4A 3IPFA 4RH4A 2G75B 5JIIA 1PEZA 3OKLB 3QDGA 1FFOA 4RZCA 4H25A 4NP4L 4YHIA 3O6KL 3VWJB 1SF3A 5E6IA 5FKAB 3VG0L 2G5BB 1BQSA 2UYLB 3VFOA 2FUTA 4JGMA 4M5YH 1A3RL 1L6PA 1QNIA 3LZOA 4YR6B 3MBXL 4A2DA 3IN2A 2PP9A 2BSSB 3OWRA 5DMIL 3SDDD 1GYWA 5KVEL 3KGRA 2AABL 4TUKH 2BSTB 1ZGLA 2QQNL 1DJZA 3EIFA 1DE4B 5D4HA 5D5MA 5DHVH 5JW5B 3EYQD 3P11H 4LLQA 5FFGA 2X4TA 5DQJA 3BUQA 4MXVF 4XPGH 3ZIYA 5MENB 4Y88A 1NAMA 1YPZA 5DRXA 3TPUA 4GRWB 4HAGA 1BEYL 3VFPA 4NZUH 4RFEA 5HHVH 4YC2C 3MRMA 3RVXC 1ZSDA 1OIOA 2GT9A 3FQNA 5GS2H 1PCSA 1T89A 2LE9A 4L4VD 3EYUL 4DFHA 1RJYB 4HFWB 5F9JB 1YN6B 3CVIL 1CBJA 4X80H 2IANB 5SWSD 1BG9A 4UOJA 4A7TA 3VX1A 2E7HA 3EOBB 4G8FA 3ALWA 4NXSA 3VH8A 3G08B 4RQQB 3WIAA 3NGBC 1QSFE 4C58B 4QRSB 4A68A 5H2BB 5DRWA 3RWGB 3BN9C 4P9HH 2NY3B 2Y36L 4YWGL 5FYLD 5DCCA 2PABA 2QHLA 2VE6A 3LHPL 3GM0A 4PD4K 5DHEA 4OKVA 4OQTA 1N12A 4P2RA 3DX4A 3CIAA 4OKDA 1JZFA 4IRSC 1V55B 3FB7A 3FOLB 1MFDH 1QI5A 2L3BA 3DUSB 3LZFL 1DP0A 1YN7A 4MS8D 1DCEA 2X7LB 4DP9X 4GUPB 2WXIA 3MREA 1USQA 4PQXA 1OGAA 4JE0A 4RWYH 4AXWB 1AMYA 1WT5A 2J4WH 1SOKA 3UTTA 2DQCH 1OTUD 2WTRB 5L8LB 2VLRA 2VR5A 1JXGA 2ORBH 3TEXA 1U0QA 4ZQKA 5KVMC 3SYPA 4U33A 5HDBB 3Q6GL 1DFXA 1CICA 4N0RA 2I9TA 2Q3XA 3OMNB 1VGEH 4U0RB 4M7KL 3ZDXF 3ZOAA 1FGNL 2QHRH 2MNWA 4NC1E 3Q9QA 4YX2L 1AKJD 2YFNA 3BVNA 3TF4A 2W80C 2B8OT 3B1UA 2V37A 3TIDB 5B1KA 3OHXB 4N2NA 2QBWA 5CN2A 4LCIL 1JPSH 2C26A 4HUUB 2A99A 2WC7A 3KNBB 3V0HA 4HF5L 5BRPA 5MERB 3TEZA 1PG7L 2J2ZB 1XL4A 3FTUA 2PTTA 2MPAH 4MMYB 2CO6A 4AMWA 2BP0B 2YAMA 3RHWK 2LLNA 1S7SB 1W91A 4FQXA 2NSXA 5HYQA 3FTGA 4MJ5B 2XQYK 3RGVB 1TQWA 1XGYH 1I9EA 4ETQA 1Q9WB 1PAZA 1L9MA 5HHOB 3RJDA 2A6JB 2YKLL 1C8QA 3TH4T 4Y1AE 5HXMA 3MUHL 3NTCH 1THAA 5GZOD 5AL0A 1Q1JH 2OCJA 4PJFF 2C7FA 2XKSA 4X0KA 2BS9A 1H6EA 2PO6C 4JANB 3SBWC 1DEEA 5GSRA 3ROOA 1MHCB 2Q7YA 1XH0A 3BLPX 2DIJA 3RUGF 2H0FA 3D4ZA 2FX7L 3O6LL 4BQ6A 2DEYX 4D3CL 3GO1H 5KTEH 4ZAKD 4WO4A 1T2JA 1WWCA 3CWGA 1E6OH 4DSYA 2Y72A 1J1PL 4U1MA 4X8JB 1J8RA 3OKKB 5MI0B 1OZTG 4HA1A 2Z4QB 3H9HB 8FABB 3DXAD 1W8OA 3CZJA 4ELDA 1AQDB 3BZEA 3WKYA 3HBQA 5EBGA 1CT8A 1ZA3B 5L4JA 5F7KC 2EDJA 4JFSA 1FNEB 1TJHL 3ZBMA 4FQIL 2DKMA 1MREL 2ZXGA 3OG4B 3WMPA 4PRBB 2UWEF 3KGTA 3QQ3B 1TJGL 2W9EH 5FA4A 2ZG1A 4B9PA 2GC7C 5AB1A 1NA8A 1VF5C 2N1TE 4C56D 3IU4H 4JPQA 3HMXL 4ZW6A 1B4JL 3SGKA 3OJDB 4IOSD 4PJCA 4Q6KA 1UD2A 3ZRFC 5J13B 3E9TA 1AS7A 3UTQA 5CZVH 3BKCH 1C12A 3NDZE 3MRGB 4JO1H 4Q52A 4WLCA 1HH9A 2NY5H 1YEGL 1TCRB 1UA6L 1MNNA 2Y5TA 5T1JA 1A14H 5IEHA 3LNGA 1UEYA 2IMNA 3LKQA 3AGWA 1C5BH 4FXGA 5JIDA 3F64A 5HDWA 2H26B 1OVZA 2F68X 4ANUA 4IDLA 4H7VA 5GZNC 3EH2A 4LCWB 4F7MB 4ISVB 5L8JB 1QX1A 4JMNA 2E6PA 4XB7A 3FCSB 3ES6A 2MRYA 4HLEA 5JNYB 2JKJA 3TL5A 4FCHA 2FJGA 1DQIA 1ZK9A 3ABMB 3QUZA 4GT0A 5F6IC 1K72A 3HFMH 2FLBT 1J05A 1RUPH 5F9AC 4NRYB 5EZLA 2E8ZA 4BH8A 3DGGB 1AR1B 4IIQB 1IC1A 3DX8A 4TTDD 3B7YA 3P77A 4FXKB 5EOCJ 1EJOL 3U36B 4Z8FH 5JXEA 1KB5A 4M4PA 4NYLB 5C0AA 3T2OA 4QWWC 2FD6H 1WUZA 5B4MC 3S35X 1CF8L 3O3DA 4TVSa 2EIKB 2DQUH 2HFEA 2AJ3B 2FJFB 3EOTL 1ANUA 1QLEL 4P2QB 1I75A 5IB1B 1FWXA 1PD0A 1XCTA 4OGAC 4XCYB 4HJJL 2VOTA 2ZAIA 4QRFA 1MI5E 3IEAA 1KCBA 3RIKA 2G2NA 3BP7A 5FV1L 3RDJA 2OTPA 1WCBB 2HTLD 3O6MH 3UACA 1HHKA 4PRID 1PZSA 4ONOA 1RUQL 3IETB 3GTNA 3EJRA 1HH6A 3MYZA 1S7QB 3ASOB 2EDYA 3LV3A 3IBOA 1G1YA 2CUMA 2X4PB 3EH4B 2ZUTA 3ZL4H 2A9DA 3ZTNH 2IPUK 3IFOB 2UXFA 4HPYH 1PSKH 4PJBB 3VXME 3RWIA 3ZT5A 5C0BE 4P3WA 1EBAA 5E8OB 4E9YA 2HZHA 3CDZA 1G6RA 4X9FA 2SODB 3VD7A 4JNXA 2EDFA 3MXWH 5GHWL 1CDHA 1E9PA 4UNUA 5CINL 3NCYS 4D7PA 3VWKD 4Q74A 1DJHA 4KXZH 4UI2A 3V4UH 1IM9B 3ZDZE 5EDXA 5I73C 1KBWA 1WSST 2J55A 4I0PA 3ARRA 2WN2A 1SJMA 5CILH 4DK5A 1RHHB 1ZDSA 5DWUL 4K7FA 2VLKD 4ABVA 3QUKB 1MJ8H 2YUVA 1M2VA 4LAQH 1YNLL 2XQYA 4KKCC 1YEJL 1UUNA 2WWMC 4F7EB 1UM4L 3QZBA 3SE4C 2Z7WA 1X3DA 3QYMA 1U8LA 1OP5H 5E9DB 5CBEB 2X28A 1SN2A 4NO0D 5IB4B 3TN0C 2A74B 3L8QA 3MDJA 1MRFH 1X4ZA 2BIPA 3A22A 4AQEB 1BFTA 4L1LA 1IBZA 2DQIL 4OJYA 4UNVA 2WIIB 5FHAL 2A6KB 4DGIL 1U8NB 2KI6A 1LGVA 4FTVB 3MRHA 4FQCL 3PJSB 1AAJA 3CVBA 2PP7A 3ARGD 4POZC 3RWEA 2A9ML 2Q2LA 5L2KB 3QDGB 4RZCB 1FFOB 4YHIB 4H25B 2Y2WA 3VSQA 5E6IB 2YC1A 1TZGL 2OI9B 1B3IA 3VFOB 3QPQD 4FG0A 3L3JA 3OPZH 1T80A 1FL6A 4F9PC 3CFCL 3LEXA 4UBDC 1ZGLB 1IKNC 3NK3A 2BWIA 3CFQA 5MP6H 3VGBA 5DMYA 2NDGA 3P9LA 4PBXA 3IKCA 1FSKB 4L2YA 3JWDC 4LLQB 5C9KA 2X4TB 1XXFC 5DQJB 5BMFH 4MAUL 5CS7A 4F8QA 1NPJA 1NAMB 1YPZB 5DRXB 2HJFA 3TPUB 3VFPB 2UXGA 3F5WA 3FB6A 3CUPA 3P11L 3MRMB 5E5RB 4K94C 1ZSDB 4J3UA 4P0DA 2GT9B 3ZY7A 4DGYL 3B56A 1EK3A 4G6FD 4B60A 5JHBA 2O5ZH 9CGTA 4WI8A 5ICXA 4PJ6A 4KO7A 3V9CA 2N3JA 5AOIA 2ZOOA 3L3KA 2FLMA 5HHVL 4QJ5B 2CMRH 1ASQA 3UGEA 1GC1H 4G8FB 5DJAA 4Y7OC 1HYSD 1DZ0A 2FIRT 2Y1AA 3DX2A 4TPRH 2P52A 3EJQA 2ICWI 4HKJA 3T8VA 3VH8B 3QUXA 4DP8X 1E42A 2CM6A 2DTML 2GBVA 1IE5A 1X9LA 2NYYD 4E5XG 5C08A 5AG8A 2GSGA 3JV6A 3DHMA 5DRWB 4RZKA 4KXAA 3AMKA 5ICUA 2LU7A 5TGBA 2VE6B 3VXTA 1NEUA 2X5PA 4MCNA 4OKVB 4P2RB 3GK8H 4C83A 4YEEA 4PCSA 4EVNA 2XVLA 4U1JA 3FB7B 3LIZL 4L37A 1KYUA 3AW5A 3BJ91 2P9RA 1YN7B 1OHQA 1YY8A 1FBIL 4KRPB 3GSNA 5T5NF 3MREB 4G6JH 4JRFA 4XPBH 1OGAB 4FZ8L 2GY7B 5EU3A 1YEDA 5F6HJ 2WXOA 3VYPA 3WNKA 5SX5K 4OCWH 4QYOA 1MFDL 1UJ3C 4ZXBC 1MCBA 3UTTB 4IBUA 2VLRB 3DO7A 1CYXA 4PWJA 1NCTA 4Y19D 4ZQKB 4MXVE 1BZDA 3JWDL 4IBYA 2I9TB 2EILB 2YN5A 2J4WL 3FU9A 1ZLUK 2DQCL 4L8DA 3CFBA 5JZ7D 2WUBL 2XBZA 4XN1A 3BVNB 3ARBC 5A3ID 3JWNG 2EKJA 2VLJE 1QSFB 4U1SA 3IWUA 4K94L 4LSSH 4XGZA 2JCCA 2OSXA 5HVFB 4J6RH 3EYSH 1ZANL 3NABH 3T4AA 4I5BA 4EJ1C 1TEYA 1Z5YD 3D2TA 2X89D 3K2MC 5INCA 1OK0A 3BRDA 5FPIA 4MDJA 2VGLM 2EQDA 2J3SA 4M1CC 4UTBH 3EJCA 2PTTB 4Y2DA 2YGPA 3FQ4A 3ECWA 1K2DA 3FUJA 4KO9A 1JVOA 1KCUH 5CKGA 2PYEA 3MJWA 4K5MA 4D9QD 4RFOL 1RXLA 4H44C 3R4RA 4FQXB 4JHAL 3O3EA 3FTGB 3W2DH 5HYQB 2VDQL 2JKLA 3ELAT 1YYLL 2E7LA 5I17A 1RSYA 2BNRE 4Z7WF 2ZCLH 1D9KD 4X7EC 4ETQB 2H45A 1J8HD 4NOBA 4RMRA 3L1OL 4PGEA 4XP9H 4X0KB 2Q8AL 1DBBH 1W72A 2Z8WC 3FCUB 3LD8B 1DEEB 5GSRB 1XGYL 3ROOB 4WJKB 3V5DA 9PCYA 3BGFC 2FECI 2AJYL 2Z31A 4NN7C 2Q7YB 2OL3L 2N7AA 1TQBC 1AYOA 3NTCL 5F7LB 1WGOA 5JOEA 4WO4B 4WFGE 3ATBA 2DI7A 4OZIF 5DTFB 5JW4N 4WNSA 4U1MB 1TU2A 3MO1A 1F45A 4M6OH 3ZDXE 2F1AA 1Y7VA 3SE3A 5DZNA 3LOWA 1WUNT 3UJTH 3BZEB 5KTEL 2P5EA 1MCWW 1Z9LA 2R4RH 3ZDWA 1CT8B 3TJPA 4TQ8A 2ICES 1E6OL 4Q9QH 2E7DA 3WCYA 3F62A 3IDXH 5K9JH 1BV8A 3FAWA 1CXEA 1KACB 4J4PC 1N5YL 4CSTA 4XPTH 4PS4H 1EA9C 3CLFH 3GPEA 4PWHA 5FA4B 3P4LA 5ELIA 3HPJA 2FJUB 3ZTJG 1Y1UA 4H8VA 3UJJH 3RZCA 4AYGA 4PJCB 3LZLA 3N0AA 5DRZA 2KLTA 2E7CA 4HUMB 3UABA 3UTQB 4B9CA 5D72L 3C2SA 1C12B 1JZGA 5EU6D 4PJEA 2EZ0C 3E3QE 3ATEA 5C09D 1HH9B 1MY5A 1PZ3A 4PJFE 3I85A 2Y5TB 2OA9A 4JY6A 5IEHB 3RA7L 2BP8A 3LKQB 2VMCA 3O3BA 2Q8BH 4QUOA 4JDZA 1MRDH 4FXGB 5CZVL 2IFGA 3T0AA 1WA1X 3RUGE 4JO1L 3RVTC 4K3HA 1F4WH 4GW1A 2AKRA 2F6AA 1QBBA 3OF6A 5AW5B 1A14L 1KIUA 1OGTA 2R69A 2JKNA 5BJTA 1OO2A 3ES6B 1OV8A 7PAZA 4HJSA 4HU8A 2E59A 4DNLA 2FJGB 4IOIA 2QKIC 4J23A 1U3HD 1NOLA 3QUZB 3SKUD 2XQBL 4S0TD 3EO9H 3N1FC 1J05B 4GRLD 5EZLB 4BH8B 5I26A 2E7MA 4UT7H 3KLKA 2KUTA 3ZL2A 3DX8B 5D7LA 5F21B 4Z9KB 1LO5B 3P77B 4JDVA 4KKAD 3CQFA 4Y5VA 1KB5B 5C0AB 3V5HA 2UWEE 3GKWL 3JV4A 1ADQA 4PV9A 3O3DB 5CFHA 3SQOL 3W11C 2Z92A 2HFEB 2VAJA 2VNCA 1IJ9A 3CX5J 5C6WH 4WK0B 1SGKA 4KNTA 3PDGA 1NUNB 3OKEA 3U7WH 4OZFB 3VXUD 4CILA 3FT9A 1R24A 2Z34A 5D1ZI 5AOKA 1JNHA 1MCWM 4PLNC 1RI8A 1XCTB 3UJIH 3ZLQC 2WNXA 1GGCH 3OKMA 2DQUL 1VHPA 2XFXA 3FPYA 3BP7B 1N5AA 2UVEA 4AYBA 4BZ2A 4X6BA 5IQMA 1HHKB 1SVZA 3RTQD 2VDMB 2PPAA 3Q6FA 2AVFA 1HH6B 4MJ6A 2GC4C 5AOZA 3UPAA 1JXFA 3EBHA 3D0AA 2Y7SA 3LV3B 5BW7A 5ADOH 3EADA 3ARDD 2FO8A 4KXBA 1RIUL 3RWIB 4BFOA 2BDNH 5I1CH 2DW5A 1VJSA 3CDZB 1G6RB 3KH3A 4UV7H 5DDHA 5IJBC 1E9PB 5GRZA 3TT1L 3ZL4L 5GGSA 4PW4A 1CUOA 4G5ZL 1DYZA 4HPYL 2GAZA 1PSKL 4H1LG 1TSHA 4TL5A 2LLGA 5J0BA 4I0PB 4Q0XL 4N2OA 1OB0A 4I4WA 2LU4A 5JW3H 1NMBH 1ESOA 2X2HA 4G7SB 4K7FB 1XIWC 3MLZL 3P3RA 1E4XH 1ADWA 4XNAA 1M2VB 3WLBA 4QI3A 4LSUH 3KDMA 3EJTA 3MLXH 5CILL 5C3LD 1CWVA 3DJ9A 1U8LB 3K8KA 5FUOL 3GHEL 4PRHE 2BY2A 3D69A 4JM2F 4U7SA 5FO2A 3W9EA 1BOGA 3V7MA 3CFNA 2GSIA 3JUYA 2M8XA 4XVTH 5IQ7L 4PVLA 4BWWA 1DVYA 3TO2A 1CQYA 3TM6A 2YKKA 4HPOH 4NJ9L 5ICZA 3K6SA 3WIHL 4M61A 3MRHB 2GBUA 5A2AA 2DJUA 3SDAD 4FI8A 1ZTXL 4KXCA 3V0JA 1K3ZA 1HT6A 2W60A 1UD5A 3RWEB 2B20A 1KN2H 3NRFA 3VWJC 2YC1B 4OI8A 3MYJA 2BVPA 5DZLA 1AD9A 3L3JB 3TBCA 4OFVA 2BINA 1FL6B 3LQMA 3S2CA 2Z3FA 2VZSA 2V9TA 4LL4A 3B3BA 3IGUA 2D2OA 3JVGC 3NZUA 3P9LB 3IKCB 1DVFD 3D39D 3L3GA 2H6PA 1FLTX 5FW6A 1HSAA 5AALA 5CZXD 5I19H 4UT6A 1R5WA 2O30A 3OPZL 4NM8H 3US1A 1NKRA 5DF0A 3LH9A 1JD9A 4F1ZA 3NSYA 3AG1B 2HJFB 3II3A 5MP6L 2C5DC 3SZ6A 4APQC 1NLDL 4G82A 2VDKB 4LBEA 3F5WB 3FB6B 3CUPB 4URKA 4YDZA 1BPLB 2EEXA 5D70H 3CHQA 4TNWK 2K0RA 4CW1B 1WO2A 2WUCH 2AF2A 3PABA 4NFCA 5ICXB 5IBLD 2CLRA 1OSEA 5F9WB 3DHJA 3NZSA 4DUWA 1AHMA 3CHSA 3CZNA 4YDIL 2NXYB 4CJ1A 2WBJA 5DJAB 2J5WA 4QYAA 4JQIA 3KPQA 1DJSA 4HKJB 1U41A 3KWVA 3QUXB 2O5ZL 4RBPK 5B1JC 1EEYA 1OTTC 3T0EA 4P5MA 5C08B 4KK5C 2CKBA 3JV6B 2HKHH 2K3HA 1RUAH 4XXWC 5FR3A 4PRPE 2C1PA 1HU8A 2NY3C 5TGBB 3VXTB 1S8DA 5HDQH 4CU8A 4Y5YA 2D3LA 2R4SH 4C83B 3HE7A 2EVHA 3OSVA 4LDOB 3GC3A 2GJ6E 5DURB 4FQ2H 4EVNB 3JBG7 4U1JB 4Y4HA 1LJMA 1T7WA 3C5ZA 4L37B 4BIKA 3RE0A 3DJTA 1YY8B 5DEJA 1KENH 3GSNB 1I8IA 3W82A 3H3PL 3GK8L 2GTQA 3CZSA 5ACLA 5EU3B 4OGQC 5E94B 1YEDB 4HZLA 5DJYA 1L7TL 5IBUB 3S8GB 2Z8VC 1P4BL 4QYOB 1M7IA 2EVIA 4FYQA 1KTDA 5TQ2H 3SE9H 4XPBL 3ZZLA 2F74A 3M1OA 43C9A 1WD9A 1P9MA 2CSPA 3W0WE 5G4OA 1MRCH 1KIQA 3AM8A 2FJHA 4OCWL 1GJUA 4L8DB 1C7SA 1KIPA 2CA4A 3O8XA 1KFGA 1QFWM 3D3VA 4J12A 7CGTA 2QGDA 4U1SB 3IFPA 3HE6A 4XGZB 2VH5H 2JCCB 4H8WC 5C0DA 1YQ2A 3LNIA 2DQGH 3OHXC 2XPYA 1QQDA 1TNNA 3T4AB 4I5BB 4DKAA 3PPEA 2RIKA 2NY6D 5FO7A 4JQVC 1EHLL 5D7SH 5INCB 3T2PA 2DLGA 4XVSL 2G30A 2WTPA 4L48A 4MDJB 4YSOA 1B6DA 3L1GA 4XPAH 5AB0A 4XC3L 4Y2DB 5FUCC 4XO5A 3EYSL 4FFVD 3QUYD 3NABL 1K2DB 3RTLA 3QWOA 2PYEB 3TYGH 1E2VA 1WA0X 5C0RH 1AY1H 2B9BA 3RKDD 3O3EB 1KIRA 1AOHA 4TF4A 3KWXA 4IBVA 5I17B 2IEPA 3RGVC 1YYCA 4JFOA 2PW2A 1KCUL 2Q6WA 1WZLA 4PGEB 1Q0EA 1SY6H 1W72B 4PJ7A 5PAZA 3TZVD 3NIFB 1KB3A 3X3FL 3V5DB 2Z31B 1F02I 3LS5H 4PJ5D 2X9XA 3MRPA 4Z0BH 4XAKD 2BERA 1KB9J 3IMWA 3ZZ1A 3HHSA 1TU2B 3MO1B 2V4LA 3EO0A 3SPVA 3BRFA 3JVFC 5D1QD 2DQHH 5KJ4A 1ACYL 2P5EB 3OC8A 1NBCA 4ADGA 4YHZL 4NZTH 2BOLA 3BYTA 1KCVH 1KG0A 3OZLA 1LXMA 4M6OL 1PZBA 4PJXA 3BIKA 1A4KA 2X38A 4H8WL 3ZX1A 2CJ3A 5BQ7A 4E5XA 4OM0H 3MKKA 3FU0A 5HHMB 3BT2H 1HAWA 1G7LA 3IDXL 4LEEA 3F8UB 3HPJB 3PRZA 3P0GB 2GSMB 2GJZA 1SEBA 3RZCB 5DQDH 5J13C 4N2DA 5JYMA 4X4KA 3D05A 4I1NB 4LEXH 2WJ5A 5DRZB 4Z7WE 3BPCA 4BZ1A 4X6CF 1UJTA 5EC1A 4YDKH 3U0WL 4PJEB 2XV3A 4N0FA 4EI5D 2FBJH 5DR5L 5J11C 2XETA 1EUTA 4JY6B 1SDAB 4EUPG 1QR1A 1CCZA 2BP8B 3O3BB 3MC0A 4WI7A 3POCA 4JDZB 3WELA 1CR9H 2A5UA 5JHDE 3UYRL 2E46A 4GW1B 5GRVL 2AKRB 4RETB 1HIML 4W9DC 4GSRA 4OZIE 4Y1SA 3F05A 2MFNA 5FECA 1OGTB 1KIUB 1RIHH 5BJTB 2Q8BL 4X4XA 1FVEA 2HP4A 1WFIA 4HJGA 4IOIB 3RL1A 1F4WL 5J89A 2ZXEB 2BRRH 1BF5A 1WC7A 4ES8A 3L4YA 4E9QA 1GHFL 3GGWA 4NZJA 5L2JA 1HKFA 1AR1C 5D7LB 4IIQC 1EHKB 4JDVB 3SCMD 4FXKC 4FLHA 2PCYA 2VM9A 2FTAA 3EO9L 4Z7OF 3BO8A 3C6LD 3V5HB 3JV4B 1HI6A 1CE6A 4N2MA 2NY4D 4O9HH 4AGNA 2Z92B 1QRND 5AVUB 2X1QA 3LRSA 4F15C 2OXHA 3OKEB 4DKDC 1XR9A 1R24B 3PAUA 1JNHB 3ABLB 1I85A 5GRXG 5D4JA 1CDBA 3HI5L 1OAUH 2JKIS 2KC0A 2HVBA 2XFXB 3MUZ1 2HG5A 1Z9OA 1N5AB 1SMDA 1IE4A 4PGBA 4X6BB 4HK3J 1A7QL 3NYKA 5FAAA 3Q6FB 4MJ6B 4HH9A 2BHFA 3LRLA 6TAAA 3DIDA 1GGCL 1UXWA 4LP4A 4OD3H 5KYWA 2M26A 2AQ1A 3QRFM 1MG2C 2CGRH 1F86A 3ZQXA 2J1XA 3F7KA 3O6FA 2YEVB 3ULAB 3EJUA 1Z32X 4X7SH 3MJ7A 2F18A 4N24A 5J6HA 4UILL 2ZKXA 1SM3H 5DDHB 1FG9C 4HGMA 1UQSA 5GGSB 5KYYB 3BN3B 1F4YH 2JKWA 2GAZB 3BSZA 4OZHA 1E5YA 3GJFH 2X4SA 2DQ6A 4I4WB 2M1KA 3RL2A 3MJ8A 3WFEH 3X1GA 4XMKH 3P2BA 1XFPA 4P23A 1EAQA 3PV7A 3ZU8A 5EEYA 4OF7A 3WLBB 3QJXA 4WO0A 1XB3A 3FCGA 3KDMB 2KMWA 1U2CA 2NTSP 1EJFA 5F0PB 2AQQA 2PPCA 2QPFA 3DSNA 2PF6A 1F58H 3RVVD 3RYMA 4U3SA 2CRZA 2Z35A 4F9LC 3D69B 1JPFA 3Q8EA 32C2A 3QIWD 2A74C 3ORJA 1J10A 2K3TA 1BOGB 1N64H 1BSIA 4NLHA 2O1AA 2VXSL 4GBXD 5DZ9A 3TO2B 1Z5LA 3X11B 4E36A 1A7RL 1ES0A 1BQHG 4U1GB 4EAEA 4NUGL 3WGUB 5ICZB 3K6SB 3EJSA 4M61B 3TT3H 3M8OL 4LQ1A 4X9BA 3C08H 3QJTB 3QC5X 4MHHG 4YLCA 4XVTL 1QBLH 3P4OA 4UAOB 5DYFA 3L5XH 2W60B 4BV1A 2OMVA 5EOCH 4DVRH 3MV8D 2RTTA 4EZJA 2JLLA 2ED6A 3MYJB 5E6IC 5BS0D 2OI9C 2DQJL 2LT9A 2BVPB 1AD9B 4YNYA 3SGEH 3VRIA 4FNTA 2XSKA 3NSXA 1J9RA 1SEQH 1TVDA 1KN2L 1BBJA 2E74C 2QDVA 2ZPKH 3D87B 1M4KA 1MCOH 2VW4A 3L3GB 4DKFL 4HIQA 2H6PB 4M5TA 1JZ5A 1FSKC 1HSAB 2VZTA 1VFAA 1R5WB 1K5NA 4Z7NB 4F8PA 1C8PA 3VFMA 1YEKL 2YRPA 4RFNB 2ATKA 4PVMA 5FYJD 4FMKA 1VADA 2F54D 1TO5A 2R0WL 5GS0D 3CD4A 4GS7B 4LBEB 4N8CH 2IO5A 2NT1A 2YAPA 5I19L 4NM8L 5L8KB 2R51A 1QYGH 1QI3A 2J6EA 3V7AG 1UWXK 2CDGA 3LN9A 1T89C 3T4YA 2TRHA 4UQ3B 3PABB 3QXUA 4GKNA 1J5OL 2CLRB 2CR3A 1EFQA 5I6KA 3CZEA 1LWJA 2J1YA 2HXAA 2LTQB 3PFUA 2WBJB 2CHNA 1AQMA 3KPQB 5B7MA 3UH8A 3UZQA 2WUCL 3DVFA 1EEYB 3BWAA 3BMWA 4JREB 4P5MB 3T0EB 4XB3A 2CKBB 4PFEA 3H55A 4RGNE 1HILA 1RUMH 4LNVA 5J06A 2ATAA 1X5FA 1QA9A 4J1UA 3S3BB 3RJOA 1URLA 2C1PB 1WBXA 1S8DB 2HLFD 1KGYE 2BS71 4RCAA 4Y5YB 3HE7B 1XV8A 4YDLB 2NRDA 4Y4HB 5EOQH 5EEVA 3C5ZB 4JM0A 4AIOA 4F24A 1RUAL 2APFA 2VJ0A 5HGHA 2GITA 3PQYE 4OCXH 1PX8A 4JFFE 2CDFA 2YGNA 1X9RA 4H1LA 4KTDH 1LQBC 2R4SL 2DWSA 2YD7A 4HZLB 4HKBB 2G2PA 5DJYB 3WEOA 4BSJA 1WT5C 4KKLD 3VM5A 4X8GA 1M7IB 4NQDE 3OWEA 4JN1H 2NZ9C 3DBXA 4D2NA 1KENL 1KTDB 3LRMA 3NT0A 3EXLA 4S1RH 2F74B 2X53A 43C9B 1CICC 3F84A 1LO2H 1EAJA 2HFTA 1WV7T 4MQTB 2DQDH 3ZHNA 3DDGA 1KIQB 3KPSD 2FJHB 5SX4I 4PBWD 4AI7A 4CC4A 4N2BA 1NAML 2WAHA 1KIPB 2OX5A 3DO3A 3O8XB 3OKYA 4I9XA 4ODUA 1KGUA 3D3VB 1V05A 3KLQA 4WUUD 3IFPB 1NH6A 1WVZA 3HE6B 2WZ5A 2AITA 3SJVE 1MVUA 4A2LA 5C0DB 1UCBH 1CVSC 3RI5K 1MRCL 4CRPA 2KLRA 4O00A 3WY1A 1KYOJ 1QQDB 4S0SD 1RPUA 1A3LH 5FO7B 4DEPB 2R27A 5DJDA 1MPAH 5KJ7E 1HOEA 1MWOA 5TE7L 3ULUF 2DQGL 3N43B 1UA3A 3X3GL 2IPTH 2W95A 1E8XA 3QWOB 1QLRA 1DANT 1SDDB 2IOIA 2DQEL 1MCFA 4YSRA 4FQXC 1KIRB 4OZ4A 1SXSA 3ULUH 2ZUYA 5IV2A 4XPAL 4WENB 2AK4A 3O2WH 4JFOB 2YK1H 4J3OC 3DX3A 2PW2B 4UOZA 2Q6WB 2WKGA 4Y16A 3V9EA 2QLYA 1AY1L 1MLBA 4ZFGH 1RMFH 4YFLF 2BFVH 4X5PA 3BPOB 3ALXA 3NFSH 2Z1KA 2ICWJ 5DK3A 5HYJA 3LD8C 4ICWA 3ELQA 2QSCH 4PP1C 3BD4A 1HNGA 1F4XL 2PN5A 4K5LA 4Z78A 4YXLH 3SJVA 5IB3A 1V5JA 4WO4C 1JWSA 4EIUA 4HWBH 1RUKH 1F3RB 3HHSB 3ZTDC 4BXVA 4W9GC 2APBA 1TZHA 2D7QA 1QNZL 3CZGA 3EO0B 3SPVB 3LS5L 2P80A 1IVLA 2WVTA 2N7SA 4A04A 1KTKE 2B0SL 2YN3A 4WV1A 3MV7E 2M83A 1RK0A 4PJXB 1NCDH 2UZIH 3BIKB 1E3FA 4NQVA 1A4KB 3WXVH 1AC6A 1IZJA 5AVYB 4AJ0A 2XZQL 5BQ7B 2XKNA 4E5XB 1DDTA 2ZX5A 3KDPB 1GOGA 3M17A 2WD0A 4NZTL 3GRGA 4XAWL 1KZYA 2G0LA 1G7LB 4NJAL 5DVPA 4HWUA 4PG9A 1JI2A 4GIPD 1KV3A 3SKNA 4AJYV 4X0NA 2GJZB 1T0OA 1SEBB 3GB7A 1LK2A 3GS7A 4EI0A 1XH2A 3SGKC 2F7RA 1L3NA 1CIDA 2YQ3A 2V3EA 5BUPA 3AS1A 3BT2L 1WICA 2DIAA 5EC1B 3HRZA 4GSXA 3GQFA 4N0FB 1DJIA 1JPTH 4U6VH 1FP5A 3DARA 3VXRE 1S2EA 2YR3A 4AEIH 1QR1B 3ZZSA 5D2NE 1L9RA 4KY2A 1T5XA 4FXGC 3S35L 1NCAH 3DOSA 4YDKL 4CC1A 3UBXG 5J12B 1CZ8H 2EXYC 3QUMB 4O51A 4BWTA 5DS8A 5J7CC 4JO4L 1O6SA 4Y1AD 3FO0H 5FECB 1SLVA 3GRWA 4A2MA 4X4XB 4TL4A 5CLWA 1FVEB 5DZAA 4HJGB 3V10A 4OFQA 3RVXD 1CR9L 3RL1B 4U1IB 4KQ3L 3QUZC 3I3EA 5TE4L 4RRPG 1WC7B 2WSPA 5L2JB 3GGWB 2GY5A 1LP9A 4NWTL 1AZRA 3QQDA 5LB1A 4W9LC 3VD4A 3TH3T 4YBHA 2J43A 3VXSE 4CKVX 1OL0A 1R3IL 2JNZA 5JXEC 5L9DH 4XXDA 3BO8B 2VUOA 3AXIA 2ZSVA 1HI6B 1CE6B 1H3GA 3FFDA 3LRSB 3BN9D 3ZHDA 2OXHB 3DSFH 2RQEA 3I6LD 4WJ5A 1XR9B 2F7QA 2VL4A 4IRJC 5FF6A 5I71B 4HCIA 3SIKA 2AEIT 4K4KA 4A7SA 4IRSD 3UAJC 3MJ9A 5FHBL 5FC9A 4X6CE 3ZGHA 2HG5B 4GQ9L 3VA2C 4OZIB 3IDGA 4PGBB 1QFUH 4F93B 3NJIA 3M7OA 1WRFA 1QPKA 3BIBX 1I3VA 2GI0A 4HH9B 4I3SL 4HVBA 1UXWB 1LEIA 1I7UB 1YUHA 1OSPH 2AV7A 5KYWB 1MVYA 2DL2A 3BPNB 3O6FB 3QIUA 5KANI 4MYPA 1S3KL 1DJWA 5B1AB 2XZAL 4MJHA 1J8SA 3GFUA 1A6UL 2J21A 4JJ5A 3MJ7B 4Z3FA 2A2QT 5J6HB 4HFUH 1G7HA 4OD3L 4HBCH 1KSRA 1UQSB 2EH8H 3ARZA 5DHMC 2YXWA 1NQBA 4A6YH 1K85A 4OZHB 1TPXC 2IG2H 2X4SB 4X7SL 2DBLH 3AB0B 1I1AA 4NO5A 4I0PC 1NGXA 5ESAA 3RL2B 3FRUA 4LPWA 3MJ8B 1NLBL 2W38A 5B3NA 1G1KA 2ZONA 3QZLA 4TLTA 3OZ9H 4P23B 1V3MA 1F4YL 2L8AA 3QHFL 3QYCA 2OYMA 2NQDA 3WKQA 1MHPH 5JLZA 1E6JL 3DSNB 4G9DA 4LPXA 4NNXA 5C07E 4U3SB 1KB5L 5FGRA 2Z35B 1JPFB 32C2B 1KGJA 4OFPA 4XWOC 5LHDA 2CJSA 4M8UA 4PRAA 1NCBH 5DVNA 1SOSA 1KCRL 1PNCA 1G0XA 1Z5LB 1PY4A 2ZUQB 1ES0B 2KDGA 2P43B 4F7CA 1UT9A 3V6OE 1N64L 2BP5M 3DETC 4GAGL 4EUPA 5CEXA 1TUPA 3P4OB 3ML9A 1E5ZA 2PO6D 4KHXH 3VDBA 5L2KA 2OMVB 1Z5HA 1MQ8A 1ZS8A 5ID0A 4JGJA 1MJJA 1NC4D 3BQUA 5T1LD 2VJ8A 2OYKA 3CXHJ 1NCIA 2CHDA 4YNYB 3VRIB 5F7EH 1ZHBA 3NJJA 2ALAA 4HETA 4AZ8A 1E50A 4DVRL 1BBJB 4IHBA 1WZ1L 5D55A 1U33A 5FUZL 5I1IH 1HQRA 1SZNA 3SE8L 5MHSD 4ZMWA 1VFAB 2D0GA 3QPKA 5KW9L 1K5NB 4KK8C 5KJRL 1SEQL 4XT1C 3VFMB 1B4LA 2ATKB 1R1CA 2P5WA 1DQKA 4PWEA 2VW6A 4RRPM 5K1VA 1A3QA 4WI3A 1GTNA 1NANH 1VADB 1KXQA 2ZPKL 2F8OA 1MCOL 2ZZUT 3V52H 5J8OA 5I9QC 1BVZA 2XN2A 3KVQA 2PR4H 1KLUA 3DIVA 2EDHA 3H9SE 3QK0A 3BFQG 1U8QA 2CDGB 2K4WA 1Q4NX 1S4IA 1RSFA 4LSDA 4X7TA 1SFHA 3T4YB 1YEIL 1MDTA 1HZHL 1HTYA 4GKNB 2ROXA 5F9WC 1ZLWK 2HRHA 1ACXA 1M56B 2NXYC 2Y2TA 5AVTB 1QYGL 1S7UA 4M93B 5F96H 5I0VA 3S34H 3JV5A 5DJ0A 3ARYA 3N2JA 3DMMA 3FTXA 3QUXC 3UZQB 2P46B 4QXUH 4HH8A 4LDLB 3TBWA 1C16A 2F0CA 1HILB 5GGTA 4TMPA 1DN2A 1V3JA 1QA9B 1BD2D 3LMJL 4J1UB 1CD1A 3UZEA 3N50A 1WBXB 1KDIA 3RU8H 1TJMA 1U8KA 2HWZH 3N1MC 4K5NA 1AQKL 5GZND 3R18A 1M7XA 3IT8D 1DBJH 3PFQA 2F15A 5HGHB 2GITB 1RZIA 3KBHE 5FCUH 4KJYA 3B2PA 2CDFB 4MCZA 5IFHH 5KVFL 4RGOH 4H1LB 1ZIBA 1FDLH 1PKQE 4EBQH 2N59A 4MQSB 3AJ7A 1FGVH 4NQED 3QDMD 3F7VA 4WNJA 1WD8A 4GG8A 2X6CA 3F85A 5EOQL 2BFGA 1NIDA 3QCTH 4G1MA 3DBXB 1JUFA 5KBKA 3G6JF 5IB2A 5CLYA <