1OE3A

Atomic resolution structure of 'half apo' nir
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Reductase
total genus 93
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A02
2UX6A 1VLXA 3OMAB 1BYPA 1AAJA 4DP0X 4CSPA 2DY2A 2DYRB 2I7SA 2X87A 3AG4B 3QJUB 4F2FA 3CVBA 1A4BA 4CSZA 1ASOA 1J9TA 2UXFA 4UF7C 2MTAA 1MZZA 2LLNA 4G70B 4E9QA 1KDIA 2PLTA 3FSZA 4YSRA 1ETJA 1NIFA 4DP4X 3S3CB 2H5UA 2XV3A 1OCOB 2A3TA 4JHUA 3FSVA 1R1CA 2HX7A 2Y69B 3EHBB 4DP5X 1XB8A 3QJQB 4YSTA 4KO9A 2FJSA 7PAZA 1GSKA 2QPEB 1L9QA 1AS7A 2BP0B 4HCGA 2JXMA 2UXGA 4GP5B 3IBOA 1BQRA 1AS8A 3NJLA 2VW7A 4AKPA 2UX7A 4A2EA 1NWOA 1OCRB 1AZBA 4BWUA 5D4IA 2WSDA 2IDTA 3UGEA 1JZIA 1KDJA 2BP8B 3T6VA 5F7AA 2N0MA 1WA0X 1B3IA 4DP9X 4YSSA 2VSKB 2BW4A 2XXGA 3NSCA 1GY2A 2FT8A 1SFDA 4KOBA 5I5JA 3ABMB 2IDUA 4JHVA 1ET5A 4WKXA 3IN0A 3SBRA 4KOCA 1AQ8A 3S8GB 3SQRA 4GXFA 3BQVA 2UXTA 1SHWA 1WA1X 3FQYA 3OMIB 4GYBA 2EIJB 3AG2B 3PAVA 3WI9A 1IUZA 1WS8A 2YAPA 2PCYA 1GR7A 5B1AB 3T6WA 2P80D 2VW6A 3IE9A 4GY4A 2X88A 3S8FB 1PMYA 1KGYE 5I6OA 2VM3A 2PP9A 2PPDA 3ASOB 4BWTA 1A3ZA 2PP8A 4A67A 1JERA 3AY2A 2JKWA 3G5WA 3EH4B 4NERA 2WO3B 1DZ0A 4E9VA 1JOIA 1OCCB 2BO0A 1JVLA 1M9WA 4HHGA 1A4AA 1W6LA 2AANA 1WA2X 2FT7A 3FSAA 3QJRB 3ERXA 1PZBA 1MZYA 3GXUB 3D12B 1PAZA 2GSMB 2GHZA 3WNJA 5B1KA 4KNSA 3OM3B 2VN3A 1OV8A 2QDVA 1J9SA 3FPXA 3QJVB 2IAAC 1SDDA 2HXAA 1W6WA 1L9TA 3ZBMA 4E9YA 2H47C 5ANHA 2CBPA 1W8EA 2VM4A 4KO7A 3DKHA 1MG3C 4E9XA 3NJKA 1BXAA 3UABA 3KW7A 2XX1A 3AG3B 4YSOA 2XYBA 2YAFA 1PCSA 1WS7A 1FFTB 3PAZA 2JFCA 3FSWA 3ABKB 3RYMA 4DPCX 2BP0A 2CCWA 1HAWA 1TEFA 1AZCA 1CYWA 5PAZA 1KCBA 2NRDA 1GW0A 3C75A 4NB7A 3T6ZA 4JKNA 1HAUA 3PLYA 2YAMA 1PLAA 4ENZA 4HCFA 3NYKA 3ABGA 5AKRA 1RCYA 1ZV2A 3FU7B 1L9OA 2BP8A 4HCIA 3EF4A 3TASA 1NIDA 5B7MA 5B1JC 1PZCA 4N4YB 2FQDA 1KBVA 2QT6A 5AZUA 1AZUA 1TKWA 1AACA 3FYIB 1RKRA 4Q8BA 4AX3A 1E65A 1SDDB 2PPAA 3CDZB 1ILSA 1FA4A 3X1NA 2GI0A 2MRYA 1RZPA 3U25A 2B08A 2CJ3A 2J57A 1ZIAA 2OCCB 1PF3A 2XWZA 4EF3A 1JXFA 4F7KA 5D4HA 2R7EB 3T6XA 1BQKA 3NJFA 4QKTA 1NZRA 2FNWA 2FT6A 1PZAA 1N68A 4YVNA 4HHWA 2IDSA 1TU2A 2EILB 1A8ZA 1CC3A 1E30A 3ASNB 1ET7A 3NP3A 1GS8A 3WKPA 3WNIA 3CZUB 4A2HA 2DYSB 4DP6X 3OMNB 5LDUA 2OV0A 1E5ZA 2IDQA 2TSAA 3IEAA 1PNCA 3X1GA 1URIA 3AG1B 3X1FA 1M56B 1X9UA 2VMJA 2W88A 3IN2A 3UAAA 3FPYA 3CVDA 1ET8A 2FQEA 3EH5B 4HAKA 1J9QA 3MBWB 1L9PA 1OF0A 3CG8A 4X4KA 1E67A 9PCYA 5D4JA 4HZ1A 4BWWA 2IDFA 1UATA 2J56A 4G7RB 4L0PB 4PCYA 3NJGA 3FU8A 2PPCA 3FU7A 1CUOA 1HFUA 4HALA 1AG0A 4GP4B 2Y1AA 4FA7B 2BWIA 2FWLB 5AFAA 3UACA 1PLCA 3GDCA 4QLWA 4DP2X 3NSFA 2W8CA 4DPAX 3QQXA 4G7QB 1GY1A 1OOWA 2GC7C 3WKQA 4AZUA 4G72B 2GC4C 4YSQA 2EINB 1SHXA 3S3BB 3MX0B 3SBPA 1OE3A 2IWKA 3X1BA 2Q5BA 1L9RA 3CDZA 4K9JA 2QPDB 2EIMB 1SNRA 4PAZA 2XLLA 3H4FA 2OJ1A 2FTAA 5I6PA 1GS7A 2HRHA 1EZLA 1JZGA 1JZHA 1ASPA 2VSMB 3OQRA 2R7EA 3V9EA 1KBWA 2XUWA 3H4HA 4YSAA 1GYCA 1E5YA 1EHKB 5EHFA 5I6KA 3NJMA 1NIAA 2H3XC 2HZHA 1V54B 3OD3A 2IH9A 5I5IA 1QHQA 1V55B 3QJSB 2YAEA 3ZX1A 1J5CA 1AANA 4E9TA 1PNDA 4YSPA 5E9NA 1BQ5A 2PCFA 2YARA 4G7SB 2AZUA 1NTDA 4DP7X 2J5WA 3PXLA 1AZRA 3N2JA 4AKQA 1ZIBA 4N8UA 2YAQA 1A65A 3TA4D 4DPBX 2ZOOA 1L9SA 3FQ2A 3L45A 5TK2A 5PCYA 6PCYA 1JVOA 3NJJA 2I85A 2TSBA 2B3IA 1JZJA 4G71B 3DTUB 1XB3A 3H56A 4KO6A 3FYEB 1JZFA 4E9RA 4BXSV 2AVFA 4YVUA 4Q89A 1FWXA 2PPFA 4FAAB 1AR1B 3PAUA 5A7EA 2XV2A 4A68A 2DWSA 4E9SA 1NWPA 2BZ7A 4KNUA 1IKOP 2J55A 3FQ1A 3T9WA 5B7EA 3JTBA 2GB2A 2HRGA 2AFNA 3AZUA 1AOZA 1AS6A 3S3DB 1NPJA 2RACA 3NJHA 1CYXA 3HB3B 2VW4A 2PPEA 3QPKA 1ZDQA 3V9CA 3TBCA 4DP1X 1ZDSA 5B1JA 3GYRA 1RZQA 1IBZA 2BZCA 3EH3B 4YSUA 2GBAA 1DYZA 3UADA 5B3SB 1M57B 3X1EA 3PPSA 1BXUA 1BEXA 1NICA 2Q9OA 2EIKB 5I28A 2QDWA 5FC9A 1I53A 4AI7A 1ZPUA 4TXVB 4A2FA 5I6NA 3NJIA 1KCWA 2DV6A 2BW5A 4YL4A 4W9ZA 1IC0A 3ABLB 1CURA 4MFHA 3CVCA 3NT0A 2YXWA 2HX8A 5IY5B 2XU9A 1J5DA 2ZWNA 2ZXWB 3JT2A 2WO2B 3NSYA 1XMEB 3FT0A 2YAHA 3FU9A 1XB6A 1ASQA 2HX9A 1NINA 3T71A 1BYOA 2FQFA 2PP7A 4DP8X 3QJTB 4KNTA 3X2QB 2XVBA 3WG7B 5I26A 1SF5A 2IWEA 1V10A 4M4RB 1AG6A 2CAKA 4BK5C 5B1BB 1SF3A 4KO5A 3AW5A 3ZDWA 3N55A 1PLBA 2YQBA 3NSDA 1SFHA 1QNIA 2XV0A 5I6LA 1JXDA 5F7BA 4A66A 1AZNA 4P5SA 4ZK8A 1GS6X 1MDAA 6PAZA 4AKOA 4YSCA 4BDVA 1ILUA 1QLEB 3NP4A 4M3HA 4NAJA 5TK4A 8PAZA 1BXVA 2CUAA 3TU6A 1X9RA 1PY0A 2I7OA 4YSDA 3UAEA 2AZAA 1N70A 4UANA 2BWDA 2YAOA 4RH4A 2CALA 3BVDB 2BHFA 7PCYA 1ADWA 1MG2C 1TEGA 1NDTA 4YSEA 5B7FA 2GIMA 3FS9A 1A4CA 4F2EA 2E86A 2ZONA 4HIPA 2FQGA 3KW8A 4A2DA 2IWFA 4GP8B 4WTQA 3TBBA 1KV7A 2IH8A 1T5KA 4E9WA 1OE2A 4UAHA 2P80A 1JXGA 3NJNA 1NPNA 3PCYA 2DWTA 3DIVA 1NIEA 5I6MA 3ZIYA 1J9RA 1JZEA 1YLBB 3SBQA 3WIAA 2XX0A 1IBYA 1BAWA 2YXVA 2XXFA 1F56A 1OCZB 1OE1A 1WAEA 2UXVA 4BXVA 4W1TA 4A2GA 4P5RA 2HLEB 1KYAA 4BDVB 5I5MA 1SJMA 1AIZA 3HEIB 1NIBA 1ID2A
chains in the Genus database with same CATH superfamily
3LD8C 2YIHA 4ERSH 3TVMC 3MRDB 5DWUL 4FYSA 1MFCL 3ROLA 1T66D 1R3IH 3C5SB 4OZHF 3HPJA 4WWKC 4A38A 4H8WH 4HK3J 1SBBA 5F7DA 3ULVD 2FUTA 1SYSA 2XWJB 3KLAB 4KKQA 1Z0MA 1ODUA 3FUIA 1ACYH 2R4RH 1S9VA 2Q76B 4KY2A 4ZMLA 1EZVY 1TQVA 1XVSA 3ZTNL 4OCSH 4FFTA 5DT1L 5D6CA 1A5FL 2XG5A 4GBXB 4OBRA 4XC1H 5GGUA 1OCOB 4M6NL 2CSPA 3TFKC 5JHBA 3OG6B 3DX6A 3HKZA 1IEBB 4Q4EA 4EKXA 2GFBB 3QJQB 1UD5A 1B6UA 1OW0A 1A47A 2RA1A 3ZTDC 4MB3A 1L9QA 4M8VA 2OMYB 6TAAA 3HC3H 1Z9SA 2X3CA 5LXVA 1ZS8B 3R19A 1L4IA 4XBMA 3OF6A 4TQEH 1MAML 4PJBA 3TV3H 2P24B 3W11D 3B8YA 4QRBA 2P48B 3MRKB 1RIUH 5IQLA 2GTQA 3AQZA 4BV1A 1MFUA 4KXBA 2N0MA 1PZ5A 4LU5H 5EEVA 1K3IA 4GO8A 4LOVA 3H0TA 1CDGA 4MAYC 5MP6L 4FP8L 4LO9A 4D0CB 2WYHA 5HDBE 1RUQH 3SKJL 3ECVA 1J87A 3IJ9A 1KNOB 4NGHL 4NQVA 1FVDA 2Q6WB 3ZL4H 4WI6A 1TTUA 1HL5A 3VXNA 5EZOL 4MCYB 2EEDA 1MEXL 4I3SL 2FJFA 3ZMNA 2NY0D 3OKKA 1OAKH 1YEGL 4MD0B 4XWGL 1Q1JH 1FQ9C 1U8QA 2Y6SC 3SQRA 3WI9A 2R0KL 2UWEF 1MCBA 5I1DB 4FNRA 3AG2B 4PGCB 3M88A 2PTUA 4HKBA 2X6UA 1S78C 2PCYA 2F53A 1GR7A 3QEQD 4XP9H 4MMZA 2A9NH 1NCOA 3E9UA 2MCMA 1NGYA 3DXAA 3G6JE 4FFWD 4YBHA 3VXRD 4NZTL 2PPDA 1EHAA 4TQ8A 3ZDZB 1E4HA 2DQEH 4YX2H 3FUKA 1IGTA 4KKAC 3WKMH 1FV1A 4W9LC 3CFJA 3K74B 2V33A 2OI9B 4HJJH 1DZ0A 4OZHA 1JOIA 3VFMB 3CXHK 3OKDA 4BKSC 4EAEA 5AOMA 3ARDB 5C0EA 1DJXA 1GC1H 2VAJA 5IESH 4PRPA 3JTTB 4YUEL 1MUJB 2R23B 3AAZA 3DVGB 4NC0B 4TNEA 4P48A 5HVGB 3C5ZC 2BLFA 1BFOB 4AVKA 3GHBH 1HQRB 3UTSE 3VXUB 2VDKH 3L3GB 2NW2B 4X5XB 3GF8A 1U0QA 3GSUA 3QAQA 5FFGA 3HS0C 4AEFA 4IKKA 2BFGA 5I15L 1J0YA 2WXIA 4BFRA 5KBLA 2UYLB 1SJXA 4N8VG 2ICWJ 5IEHA 4KUCD 3B2DC 4AZ8A 4QO1A 1KCSH 3BSZH 3KD4A 4JHAL 3O9WC 2AJZA 2EDOA 2QPFA 3QWOA 3KJ6L 4YPGB 3MTRA 4WFEE 4XNAA 3GMOA 3IF1B 4M5ZH 1RAMA 3FRUA 2MH4A 3P9LB 1CFSA 3GSRA 2O6DA 1HJCA 3H2WA 5IWLC 1TEFA 3IMBA 2DH2A 5A2BA 3SY0A 2C9XA 3RVXD 2OXGB 2ZP9A 3PQYD 2P44B 4JKNA 2HKFH 3NFSL 1Z9NA 1HAUA 5FYLD 3BFQG 2J6EH 3LEXA 4F9PC 2NNAA 3O0RH 2ATPB 1JN6B 2ATKB 1N5YL 1KB5A 2X2HA 5DLML 2Y36L 1FAIH 3VRJB 3ZDYB 5IMOB 5L8JB 3C8DA 2ZXBA 5TE6H 2FEJA 4L8DB 2YMOA 3VRIA 3QIWC 2PABA 3RKDD 4MJ5B 3GZPA 3REVB 1KB5L 4QRUA 3LEYL 4JO1L 1E8ZA 4XMKH 4WLCA 4MNGA 5EIVA 4DJMA 4JGMA 5I1KL 1PLGL 4WEUD 5CNHA 3L4TA 3NBNA 2VDNL 2NPLX 1FA4A 1TTBA 3IDMA 3BC9A 1WDAA 3LKPA 4U1IB 1KTBA 5KWYC 3FF7A 3U25A 1KJ2B 1T66C 3LB6D 2YMTA 1QA9B 4FFZL 1YY8B 1INQA 4ZO8A 1PF3A 1NCDL 3VWKB 4ZG1A 4Y2DC 2Z31A 3OXSB 3ULVC 2YN3A 3KBHE 1TQCC 4LFHD 4YDKL 4FI7A 4M8UA 1WGOA 3RIAF 3BWSA 5DEZA 4QUOA 1OAZH 3BWUF 5JW4Q 5GGRY 4S1QH 1KCRL 4I0PA 4KTEL 1N68A 1G0DA 4LKCB 4RGNE 5CZVH 2JLPA 4GG6F 1RZ8B 5BO1H 2MKLC 3UZVA 1K6QL 2CNYA 3T0EA 1ZOXA 5IIEA 3OC8A 5HPOA 1Y18A 4LLYB 5JXEA 4H7VA 1RZJH 3LKQB 3WHE0 3B9DA 2WQWA 1E5ZA 3MJ7B 5HBBA 2W92A 4JY5L 5HDLA 1CDBA 4W9GC 5IB1B 3H3PL 4JRXE 3W11C 1URIA 1B4RA 4M8QA 5FW7A 2CKNA 4G6AD 4X99A 4X6BA 3IN2A 3QH3B 3NFNA 3CLWA 1D5ZA 2AVGA 4N5UA 1SM3H 4NCC1 5KVFL 3CVHH 2VABA 1E5BA 1BEYL 1VGEL 4O2FA 3WN5B 1E2VA 5L4FA 1KFAL 4GG8B 5E6YA 3IMWA 2AQ1A 1MCWM 4JG9A 4M62L 1NMBL 3HZYB 4LP8A 5ESQB 3ROOB 1FNEB 1T04A 2NY0C 4LRNL 5I16B 4F5CE 2CHWA 3FU7A 3ETTA 1HFUA 4IK7A 2Y72A 3L9RB 1WIPA 3ILPA 4LSRL 4MJHA 4PBWD 1MCIA 2DIEA 3W81A 4AMWA 3GIZH 3GSQA 3KGUA 1QBML 4XWOD 2LU7A 4DH2A 1X3DA 4NOBA 3D3VA 4F7MB 1DUYB 2VDOH 3GPSA 4IRZH 4MXWH 3L5XH 4WO4D 1SHXA 3B4NA 4UTAA 5BS0D 3IFOB 2GUOB 2DIAA 4H8QA 1GPOL 1R24B 3QA3B 3CMGA 4YGVB 1SNRA 1NOLA 4U1NA 3GMRA 1UKSA 4QHUB 2VN7A 3H4FA 5C07E 1IJNA 4WSKA 4B96A 2QEJA 5KYUB 4UTAL 1G6RH 3BAJA 5JMRA 4JHZA 2EUXA 2B15A 4GKZB 1FG2B 1AVAA 2DD8L 2WLLB 5C08E 5DTFB 5HVFB 1NBVL 1YNKH 4AENB 3BQUB 5C8JA 3UYRL 3HG2A 3V5HB 3BD4A 4RMTA 2D3NA 2A6DA 1RUPL 1MHEA 4JKMA 3ZZLA 3OD3A 1TNNA 4DZ8B 2YAEA 1J5CA 2BMKB 3QZBA 5E0QA 1UZ6E 4E5XG 1FFPB 1KCLA 1U93A 3LRHA 4R2GB 3V52L 2AZUA 1VHPA 4XMPH 4K0OA 4GQ9H 2OR9H 1U6AL 1RI8A 3BCFA 3MROA 3W1ZA 1ZIBA 4ZXBB 3MRGA 3Q2CA 3RVXC 5DJZA 1AOHA 1MW1A 1XIWC 1IQWH 3LZLA 2WUCH 5HHOA 5F1OB 4P3WA 1S5HB 2ZOOA 2KDGA 3Q5TA 4D8OA 2IAMD 4FA6A 5T1KB 3NABL 5T1MB 1QABA 3DTUB 3FOLA 1XB3A 2AP2A 4KX9A 4QOKE 5HVHB 3H42H 3PAUA 4G3YL 1H8NA 1ZTMA 4G11A 1YDPA 2FBRA 4PRBB 2VL5A 1OIOA 5T3XE 3CN3A 4N87A 3ECWA 2DLHA 3TZVD 2L04A 3S3DB 2QGDA 5F1NA 3INUH 2RACA 3V4PB 1Z0NA 1R3IL 2ZPKL 3TBCA 4H8WL 4XOBA 5D2NB 1S9XA 3FB8A 3QFJE 4XN1A 2Y5TB 3MGAA 1EWHA 1OK0A 3RGVA 1AZVA 2R4RL 3GI8L 1TEYA 5DI8B 3DGDA 3MX0A 3HZKA 4OCSL 3WHXB 3S8WA 3PV6A 1P9MA 2W60B 3E1F1 2ZX9A 4XC1L 2Y5EA 3KYAA 4MD5A 4KC3B 3HMXH 3KH4A 4X6FA 2D0HA 2VMEA 4HT1L 5EU4A 3ABLB 2X1OA 3NT0A 2C4FU 1XGPB 3L3KB 3NZUA 3A4AA 4Z7VE 3HC3L 3SKUD 1N64H 1HXYB 3BVNB 4H8UA 3TF7C 3GXPA 3V0VB 4Y88A 2HYMA 1AKJB 4MJIA 3M07A 1I9JL 3A4EA 3QQ4B 3TV3L 2BOCB 2FD6H 2D7NA 1I9IH 2X28A 4XP4H 3T2QA 3CIAA 1B0RB 4G6AC 4ZMNA 1RIUL 5EU6D 4KMLB 3W3BA 2YPLD 2CJUH 3VGFA 5JDJA 4LU5L 1CE6A 2IXQB 3VDBA 2HFGL 3ZW3A 4K71C 2DM4A 2GBTA 3HB3D 5FGCE 4CNIB 5E1QA 3APFA 4WFGE 3QRGH 1RUQL 3RVTC 3S36H 5AW0B 1QNIA 4OF7A 1X5IA 1DDTA 5DD0L 1DSWA 4WF7A 4KQ4H 4N22A 2OKMA 4DGYL 1MCOH 3B37A 3A6CH 3Q05A 3UO8B 1J12A 1H3XA 1X9RA 5C92A 1I8KB 4YSDA 3DO7A 4F7TA 4XP9L 3ULSB 4TNVK 1KYOK 5JDSA 2WXKA 5CWSA 2A9NL 1G0YR 4NRYA 4XWOC 4Z7OF 1GZHA 5C0CD 4AC4A 4J23A 2Y3NA 4Y19E 5I1HH 3VFTB 5ISZA 2BHZA 3BPNC 3ZLQC 2V2TA 3K6NA 5BQDA 1CD1B 3WKML 4Q7DA 4WO4C 4NQXB 3LRGA 2ITEA 2CDFA 2YA1A 3T8MA 4Z7NF 1KULA 3N5AA 5AD0A 1QR1A 4IMLB 5A2KH 5KSAB 2BNQE 4RMWA 2IWFA 1T0MB 3L1EA 3B8SA 3SHSA 5KBDA 3TBBA 3G6AB 4X6CE 1TMQA 3EO0A 3GS7A 3OKOA 2BOLA 3U7AA 1LWRA 3KYMA 5D1ZD 1UHVA 3GHBL 3BSZA 4ZAKD 5GGVH 2X2UA 1Y0LA 1G6VK 1SXBA 4IIQB 1G9HA 1TTFA 2XFXA 2UZPA 2KUTA 2W1NA 2ENJA 3CV5A 4MMYA 4NENA 1GYWA 4AM0Q 2YXVA 1F1AA 4PJCF 3BSZL 1QACA 2G75A 1DEDA 1XTMA 5AAPA 3ARGA 1A9BA 1DQDL 3HMWL 3I9IA 3CTTA 1MY7A 2J6EA 2V5MA 4FXLA 4S0TD 5E2UL 3ZKXB 4EIBA 1KEGL 1UWFA 4M5ZL 2FO1A 2WBXA 3AWGA 4N8VB 2DYRB 3K80A 4O2EA 2X0VA 3NMEA 1S7RA 2HRPL 3H2PA 1IGYB 3K71A 2V9RA 4KQ0A 2MTAA 4Y5XB 5KJRL 2P5WE 3OX8B 4KDTA 1X7QA 3DRTB 2J6EL 3WIIH 1N5AB 2D31A 4E9QA 3D0LB 2P5EB 3EJRA 3BYTA 2X2JA 3MRFB 2IAMC 2XV3A 4FQIH 1FAIL 4W9EC 4M4RA 5TE6L 5GZOA 3D18B 5KAQF 3FDWA 4X0NA 5I30H 4K3GA 4XN4A 2ZF9A 3I6LD 4YSTA 3OGOE 3WUZA 1LHZA 3AUVA 1GH7A 4XMKL 4HCGA 4ZNEA 5HHVH 3Q2WA 1FYTA 2EO1A 5EOCJ 1TJHH 5KJ4A 3NN8A 3VQLA 4Y9FA 5BQ7A 3PHAA 1WHPA 2WC7A 1IC7H 3FCTA 2F8IA 2KQNA 2WKGA 2WNGA 3KVPA 1I1AB 2WLZA 3FOMB 5IQ9A 4ZFOA 5J4MA 2W59A 2FO4B 4RFNC 3BRGC 3IDYC 3SGDI 2IANE 3GS4A 2E7CA 2EE6A 1QRNE 2IH3B 4RGOL 1J5OH 1LE5A 4JQXC 1YYMH 1SPDA 3DUUB 1BECA 4ZFOL 4X6DE 1HKLH 1D5XA 4PR5B 5D8JL 5DZLA 4EIZC 4GRWB 1OAZL 4WNQB 2IOIA 3FU0A 5BZDA 4QTHA 3IDNA 4YHPA 5CILH 4I87A 4N3TA 5F6IC 5I17A 1CBJA 5ETUB 4AGOA 2DMBA 2UWEE 2UUDK 3S48A 4DO5A 5CZVL 5JIHA 2VDQH 4MNGE 4G1MB 3BQVA 1TT6A 2R59A 5E6ID 4NQDA 1I4FA 4XPHH 3VM7A 4TSBH 1F3JB 4PJCA 2AJSH 1JBJA 5B1AB 2W80C 1EXGA 4YDLB 1SN0A 1WEJL 3S8FB 2J1WA 4QYOA 3TJHD 2EECA 4IRSA 3VI4B 4F8OA 3CVHA 3UPAA 3HI5L 3MNZA 3RURA 5DVMA 3B1UA 3TNMA 4KK5C 5I8CA 2OP4H 1AP2A 4HOMA 1OCCB 2BOBA 2K7PA 1UD6A 2COQA 1M9WA 3J2PA 4KI5F 3ZDZF 3HB3C 1SM3L 4Y9EA 3QJRB 3CVHL 4DGIL 2WQSA 3GNML 1WAPA 3ILDA 1QSEB 3HHRB 3E2HC 2XWJA 3KLAA 5CR8A 5KSBF 1AJ7L 4JDEB 3T0EE 4LGPB 3DJRA 2Q76A 4ORGA 1HI6B 3HE7B 1QX1A 1FDLL 4WI8A 5EFIB 4OY9A 5CAYB 1MVUA 3O3UN 2X9YA 1UJTA 5F9JB 4IRZA 1L9TA 1S9WB 5MEQB 4GBXA 2EC8A 3MFFA 1T6VN 3GIZL 3PWLB 4ODHH 1P4IH 5FOBB 3KLKA 3JYCA 3UYOD 2WP3O 3UROR 2GFBA 4I3RH 2VXUH 1RL1A 3Q6FA 4XCCL 2BVOB 1A3RH 2VDOL 5HD8D 3W82A 4IRZL 2ORBL 2JCWA 2OMYA 3QORD 5CZKA 4HV8B 3D06A 1G6RA 1A25A 1ZS8A 2QJDA 3NFPB 4OBSA 1DJSA 2N56A 5E4AA 1RK0B 3IWVA 3IJYB 3UXFA 1MI5E 3MRKA 1SLXA 3QB7C 5C0FB 2ICEA 5D1ZC 3VD5A 4ZAKC 1G6RL 1QZ1A 2BSRB 3V0EA 3JWDL 3TASA 3K1KC 2XQBL 5DJXA 5C6TH 2WLNA 4P5TC 5B1JC 3GSVA 3ZHDA 4D0CA 2F54B 1VACB 4LCWE 3TBVB 2WTPA 2A2QT 1HQ4A 3NAAL 4PIBA 4JO2L 3CLFL 2Q6WA 3ZDYF 1N59B 1UACL 4AQ8A 3GKWH 1BFSA 5GS0L 1TKWA 4MCYA 1KXTB 4XOAA 1K85A 5FB8B 2PPAA 1H3PH 5E00B 5T1DH 4NUQA 5I1DA 4WFED 5DHMC 1URLA 4PGCA 4QT5B 4UT7H 4GINA 4XMPL 1DBKL 1TZOA 1F3RB 2JV6A 2OR9L 1AXIB 2K6YA 1G7PA 2GK2A 3P3TA 3CK0L 1CFNB 1ZGLP 3MRJB 2GSIB 4OCXH 1UEMA 1ZTXE 2WUCL 2D2OA 4E5XB 1SMAA 1PFCA 2DLTA 5IJBC 4HWEL 4K3HA 1NMAH 2CHZA 4GG6E 4NI6A 3ARDA 4P4KA 3VCLB 4L4TB 4PWFA 3QULB 3QAZC 1NCBH 2BVEA 3JTTA 3US9A 5IQ7H 2R23A 1S9YB 3DGGB 1BFOA 3H42L 5EOCL 2NR6D 2K45A 3VXUA 1ZHLB 3L3GA 1X5HA 3WY4A 1BWMA 1ZE3H 2CO6B 1RV6X 4X5XA 4ZDHB 4ELKB 1NCWL 4OD3H 4X5QA 1A64A 4UM9D 4XNXL 1QBAA 4OCNC 5EH1A 4QRQB 1PNCA 3SDAA 2UYLA 5CJXA 2NDFA 4AYDC 1RP8A 3INUL 4U1MB 3MREB 2Y4SA 2CKBH 3D6GA 3A6BH 2ZWSA 4YPGA 5H4YA 1JTOA 3L4CA 1ZT4B 2ESVA 2FQEA 3EH5B 3KR3H 4FG0A 4HAKA 1M9SA 1TQSA 3GLEA 3WELA 3IF1A 3KGSA 2B16A 3KCPB 2QVKA 3P9LA 4FNSA 3RKPA 2ZX8A 2NT0A 5ID0B 2W81C 1R3JA 4UOJA 3SE3C 4L3EE 2OXGA 3AWEA 3PWPB 3GLAA 3QDAA 4PUBL 1YAZA 4S1DD 4E0RB 2LT9A 1JTTA 1WF5A 2IDFA 1EO5A 4RGND 1CIDA 1JN6A 5F3HB 3TA3B 2ATKA 4Q9QL 4Q14A 3SO3B 2B1HH 4HALA 5E6IC 4RFOH 5IMOA 3VRJA 3FK3A 4EBQH 3DBXA 1EV2E 2FX7H 2J5LB 1DVTA 1L9MA 3PP4H 1RZ7H 4NO0D 3IFPB 1XBRA 5EWIL 4K8RH 4AMKL 3QQXA 4FQJL 3TJHC 3VGAC 2KLSA 3RB7A 3NCEB 2GC7C 1G9EA 4OLYH 3U1SH 5ANMB 2XY1A 1I9IL 2QELA 4FQPA 2XN2A 5L9DH 4GEJA 4JRXD 4RQQB 1ZLVK 3MGTA 5DRXB 1E3XA 4U1JA 4EJ1C 3E8UH 3C09C 3CNKA 4LVOC 4GLRH 4PJ8B 4R7XA 4U1IA 1D6VH 5JW5B 1S7WB 3U30C 1KJ2A 3QRGL 3SE6A 3S36L 1YY8A 4J3VA 4JBSA 2I27N 3VWKA 5IOPA 3QJFB 4M8RA 2C3XA 3MA7B 3IJSB 5AOJA 1EZLA 1L6XA 1JZHA 1PW3A 1QSFA 3DJ9A 3RA7L 3OQRA 3EO1B 1FNAA 3LY6A 4YHYB 5D70H 1KJ2L 1E5YA 1Q38A 1HCZA 1G5GA 3I2CH 2ZNXA 5GRWA 3NK3A 4XMVA 5EHFA 3QG7L 5FX3A 4LKCA 3KMDA 2H32B 2ZG3A 4ADIA 4MJIE 5JLZB 4IBUA 3MLYL 2X4PB 1NL0H 3QJSB 3FH8A 4K15A 1RZ8A 3N04A 5MEPB 3GHEH 3MLXH 1CICB 5HD8C 1C5CL 4JO5A 4AQ1B 2H0EA 5SWSE 3QORC 4LLYA 4FZ8H 5GGVY 1NMCC 4Z78B 3LKQA 2P1YA 4AQZA 4WSGA 3HCVB 3MJ7A 1SXCA 1NEZG 4ICWA 5IB1A 4DGVL 4M02A 3NIFB 2KT6A 5AW9B 2HAZA 3ES6A 4PRHB 2DQHH 4ZFQA 3HN3A 5C07D 1YJDC 1I8AA 3QH3A 5BRZE 4MA1C 5FUOH 1PQZB 4AL8C 4B0MB 1HX0A 3W0WE 5CJ5A 3TFBA 4KNQA 4K94C 4BCYA 1RIVH 5C08D 1Z3RA 1FWXA 2PPFA 4B7IA 4NRZB 3LMJH 3TLRA 1CGXA 1FP5A 2BY3A 3FL7A 4GG8A 4H0HB 4IDJL 2P8MB 5I1EL 2VITA 3HZYA 2DMGA 5L0QC 1YPZA 5ESQA 1FNEA 2HRGA 2YUVA 3L9RA 2FSEB 4OF8A 3D0AA 3P9WB 2X41A 4JPKH 2GT9B 5GGQH 1OAUH 4CU7A 4BFNA 3FZUD 5DGRA 2CA3A 3X12B 3B5GA 1HS6A 4XP5L 4F7MA 1KCVL 3MCLH 5ESVA 5TPWL 3B7YA 1BJ1J 4MVBD 2DMHA 4X9FA 3RIFF 5KBPA 3IFOA 2GUOA 2GJ6E 3L3DB 3MJ6A 1IKNA 3G5XB 4BIKA 4YGVA 4JDVB 2PXYB 3U9PH 1A6TA 2EKSB 3S35X 1UURA 4AI7A 4L0ZA 4EO5A 2WZ6A 2NR6C 1MHCA 2O1AA 4HMEA 4QOKD 3D4GA 6FABH 1NANI 4BM7A 1SOXA 1KELL 4GKZA 1FG2A 2WLLA 5EUOB 2BY1A 5HHVL 4RAUA 5DTFA 1AR1D 2CE6A 4V2CB 1CXEA 2FB4H 5T3XD 4AENA 1QKZL 3HAEA 3BQUA 1AXSA 5FOJA 2FATH 3V6BR 3VD1A 3UDWC 1KWKA 1NCCL 5FYKH 3QJXA 3SZKC 4HK0B 4N2NA 2J4WL 5DZPA 5TH2B 2BMKA 1J5OL 2CO1A 4PP1D 2X12A 1FFPA 4ZUUA 1R46A 3QFJD 1A2YB 5DA4A 4XB3A 1LLAA 4L2LA 4HLZG 4OGYL 4ZXBA 2JQAA 4WWPA 2IV9A 5KVDL 5CILL 1G43A 2JJVA 3HUJF 2D4FA 1HWHB 2AQ3A 2LU5A 3FO2B 1G9NC 4AKOA 1G9MH 4RGNC 3C87A 4ETYA 3F12B 4ZNEE 4I4WB 1JS4A 2VDQL 7FABH 1FYTE 1QLEB 3FO0H 4Z7OE 1BLIA 2HKAA 5T1KA 3I50L 1P5VB 1JPTH 2WIMA 4NXKA 2GHWB 4L1LA 4TSBL 3EGXB 4XPHL 4UANA 2AJSL 4B7LA 1WWCA 5FW6A 1SXAA 4HXAL 2JSFA 1MFMA 1M05A 5LAXA 2ZX6A 1R5WA 4K4KA 4U3SA 1IZKA 1WH0A 3HJEA 4PRBA 4LPCA 2YSSA 3QUYB 4WJG3 4CRPA 4Z77B 2EYSA 2E47A 3L3JB 3LKRA 3BP5B 2A38A 2VGLM 2A0LC 1MKFA 4KKBC 3RAJH 2NXZD 4RBPK 3PABB 1KGJA 3MLUH 2G5RA 3OHMB 2EAEA 5FPIA 4WFGD 4JFPB 3WJJC 1KBGL 4ZO9A 1BVNT 3KYKH 1UZGA 2Y5TA 1EX0A 4NUJA 4PU2A 1BIIB 1F42A 3BUYA 4NFCA 4N1HB 3PWUB 2BDNH 5DI8A 3KPRE 1FSKC 1HJBC 2LFGA 4B60A 3IAGC 3CXFA 2UZYB 4OQTH 1KSRA 5CEZD 2EVHA 1WZ1L 2DQMA 4HIJB 4ODHL 1KGCE 4BDVB 4YSRA 2R0ZL 3FQUA 5F8QC 5K9OB 4I3RL 1VLXA 3ZJAA 4Y19D 3EBIA 1AAJA 1A3RL 5IK3B 2DWDB 3L3KA 5J13C 43C9B 3PV7A 4EI6B 3AG4B 2JCCB 3VDCA 3BVNA 3G5YA 4GAAA 4Y4KB 2J1ZA 2BHYA 3V0VA 3WO4B 4P46D 1CGTA 1AKJA 3RX5A 2XWDA 3QQ4A 2BNQD 4KTDH 4M5TA 4UNVA 1GXEA 1OTUC 3P4OB 4MJ6B 1B0RA 3KLLA 3SCMB 2F58L 1SLUA 1ETJA 2JK5B 5J6GA 3CFNA 4WUKL 2IXQA 4G80B 2WVSA 3AM8C 3LH8A 2LR4A 4CNIA 3U1PA 1WUZA 2OMZB 5B8CC 1RUKH 4RETB 2KC0A 2ZKMX 3QR1A 4Z3IA 2A74C 1S46A 3FFDB 1S6NA 2Q8AH 5IW6B 2GKIA 5DVKA 3PWVB 3SGEH 4PJHB 5IZ7A 3WG7B 3Q06A 4X4ZA 1EO8H 1QO3A 5F93C 1TJXA 5T1DL 3D2UB 2ATAA 3LNFA 3QS2A 2BERA 4BQ8A 5LNGA 1AZBA 2R69A 1I8KA 1IV8A 4ACTA 4MDJB 2IDTA 4B0MM 1KTLB 4NC1E 2BP8B 1QQDB 3ULAB 5CSGA 5DC4B 2OJZH 3FZUC 3VFTA 2YD4A 1DFXA 1GL4B 2XXGA 3NSCA 2P5WD 4OCXL 4MVBC 1CD1A 2R69L 1HWWA 4NQXA 2X6AA 1C16B 1NMAL 1ET5A 4JS7A 3E8VA 4M00A 5CN2A 1R47A 5DWPA 4JGJA 5KSAA 1YUHA 1T0MA 3LN4B 1EUUA 1NCBL 1H0DB 3G6AA 4GRWF 5BZXA 4HULB 3BPCB 4JFZL 5ACZB 4JM4H 4B41A 1NCJA 3F04A 3C8KB 2ZXAA 3VX0A 1K5NA 2ZWZA 2OBGA 2ADJB 2Z3FA 5IVXB 1A3ZA 4I3GA 5B39G 1JERA 1D9KD 3SKNA 2Y06L 1NFAA 4XNZB 3JXAA 3EOYG 3H55A 4KI5E 2FL5B 3RDTA 2Y07H 3ZDZE 2DQCH 4QTIH 3A6BL 3QBTB 2ZKYA 3H7LA 3VI4F 2IAND 2AJYH 2N1TE 1OP4A 2IBBA 3KR3L 1MFEL 1QBBA 3IWUA 4HHGA 1QRND 4PP1C 4BJLA 1CU4L 1T21B 1BXXA 1CF1A 1WA2X 4KV5F 1FZOB 2FBJH 1QSVA 5M94B 3ZQXA 1MZYA 1R33A 5KSBE 3FT2B 3Q1SL 4LSUL 4Y5XA 2EUZA 3OX8A 3DRTA 3NTCL 1N5AA 1NBYB 1NBCA 2PW2B 3D0LA 3VXUE 5EULV 4YHLH 3HFFA 3RVVD 2AMUA 1HIMH 4Y7OC 4NQEB 1SDDA 1YEJH 1G7MA 2B8OT 4HWZB 4RFOL 3PNWB 4XO8A 4EBQL 1YA5A 3EGDB 4GQPH 4ODWA 3D18A 3PP4L 4PN6A 4MYWB 1PFOA 1BXAA 3UABA 3MOAH 3KW7A 2G3MA 2KKQA 2YD7A 2DTSA 1BFVL 1OF2B 4OLYL 4JKPL 3BVXA 3U1SL 4PWGA 4HIHB 2IGTA 5BVPL 4PCTA 1UM4H 4OFKA 1DCLA 4P2QB 1W16A 4XX1E 1AZCA 3C75A 1DR9A 1NM9A 2C3GA 2OSXA 1TYRA 1A02N 3FOMA 2NXZC 1D6VL 5BZWB 2FO4A 3ULVH 5AKRA 2O93L 3DYPA 5GGSY 4NKOB 4W4OA 2ZE0A 1M1SA 4PJDB 3DUUA 4P57B 5DD6B 4PR5A 1R3LB 4WNQA 3OV6A 4BH7B 1TVHB 2DWYA 2A9ML 1F0LA 1NGZB 4V1DB 2AJVH 3I2CL 5GSRB 1FVCB 3MXWH 2FGWH 4XVTL 4PJAB 1AZUA 1JZ6A 2VDKB 4LVHC 2X4RB 3BT0A 5LWYL 4F7CB 4G1MA 3GHEL 3MLXL 4AJVA 3N06B 5HJ3A 1ZSDB 4YAQA 1F3JA 1YEFH 5AW1B 5E1HB 2XWZA 3R0MA 4AQAB 2OQJB 1D7CA 2AI0L 3SE4C 4P46C 1JF1A 1SVZA 5DQDH 5AWNH 3ULUL 1LVEA 1N0LB 3B7TA 3S88H 2P4AB 4DPRA 2DQHL 5TJWK 2QKIC 5IMLB 4QKTA 2C3WA 1QWNA 1MI5D 2FNWA 4YE0A 3TC9A 5KW9H 1MQKH 5CP3A 4M1GH 4XGZB 2XVLA 3OAUH 4HHWA 4Y0GA 2DLFH 1HZLA 1I8LA 2EILB 4G9FB 5J1AA 1QSEA 1SZNA 2PCXA 5CD5C 3BRFA 4LCWD 3QXDB 1D7FA 2ZCHH 5I19L 3UMNA 1SLWA 5F0MB 4JDEA 5BV7H 1HI6A 3HE7A 2Z34A 3LAFA 2ROYA 3TCLA 2TSAA 1JDDA 1SDYA 5F9JA 1UCBL 2BFVH 4CMHB 5MEQA 2NUTB 5F0LB 4OVVA 1ZANL 1KGWA 3PWLA 1VZGA 4JPKL 2VMJA 3F05A 4FQXB 4G8GB 1OEZW 5GGQL 3L95B 3EYFB 4LAQH 5CCJA 1KTCA 1MCSA 3U7WL 1Q9WB 4M7LH 4U3XA 3AY4A 1V05A 3F7PC 3QUKB 4PW4A 1E2ZA 2Q0ZX 3VG0H 4HV8A 2EDDA 5KTEL 3NFPA 1XF5B 4Y2OB 1RK0A 2CXKA 2Y7LA 3IJYA 4G7RB 4Y5VC 4RMQA 2VMCA 2YUXA 5CJOH 3ZT5A 5C0FA 3CLEH 4UZUA 3RQ3A 4LCIL 1XO8A 2BSRA 1IC5L 2YD3A 4H88H 4ATWA 3K2UH 1KLUA 6FABL 2C7UA 5DMIH 2BK8A 4P3CH 2YEZA 1TPXB 2F54A 1YEKH 4K2UH 4YDJB 2FB4L 3TBVA 4XPFH 3MUGA 1QNZH 2FATL 3P0YL 3DHPA 1N59A 4OCWH 2A9BA 4LRIC 2R27A 2L0DA 1B88A 3A5VA 1KXTA 1TZHB 2O6FA 3DDGA 4P2RB 5D7JB 3O81A 4Z95L 2QPDB 5E00A 3VWJB 2ZKHH 5A6IA 5IW1B 4F1SA 4LHQB 5AAWC 3FB5B 1I31A 1XGTB 4NQTA 1E8XA 3I3DA 3F7QA 4W70A 4L3ED 1CFNA 3JV0A 1NUDA 1IX2A 1H3VA 2EZ0C 2GSIA 3KLQA 4MMXB 4PJGB 2IBZX 3AXHA 3MNVB 1FIGH 3RVVC 2MCPH 3W9EA 4E5XA 5C2BH 7FABL 1JMZA 3STBA 4GFTB 2H3XC 3VCLA 4L4TA 4HSQA 1IBFA 1RMFL 3QULA 4P9ML 5HDRA 1Y1DA 3Q9PA 5GS1B 3ZL2A 1AANA 1S9YA 4X80L 4ATTA 3DGGA 2WLIB 2FIRT 4TUKH 4LP4A 2ID5A 3M17B 4PJIB 4DIXA 2CO6A 1PCXA 3Q2VA 4ZDHA 1CXKA 3CQQA 3F01A 5I18L 3OSKA 3OHXB 5AYQA 3ARRA 5ABDE 4AEHH 1N8ZB 3MLUL 1ZJBA 4U1HB 4U1MA 2JI1A 3BPOB 4NAMA 5PCYA 4YS4A 6PCYA 4KHTH 3JWNH 1JF5A 1ZT4A 1UUNA 3V0FA 4IBVA 3NIFF 4B5EA 2I85A 2TSBA 2FJHB 3QDHA 2EO9A 2WXLA 5ID0A 2BDNL 2OSLB 5ELIA 1IM3B 2Y22A 3RZCD 4OQTL 3PWPA 4BK8A 4E0RA 2H1PH 4FYTA 5CIPH 1RJLB 2ARWA 1R5IB 3L4UA 5F3HA 3TA3A 3BW9B 2QSCL 3AZUA 4HD9A 1AS6A 4JGUA 1OARH 3RHWK 2DQUL 3PGFL 2N7SA 3II1A 4Q9RH 4R90L 2VKWA 3IFPA 5SWSD 2VJ8A 4KDWA 2M8XA 4C56B 1OHQA 1AD9A 1TJIH 5FHAH 5D2NE 5ANMA 4KTDL 2CO7B 3MUJA 3SDDA 4RQQA 4WDIB 4UT6H 3KLSA 1VKXB 1U4EA 1Z9OA 5BRZD 4PJ8A 4DEUA 4OGXH 1B2YA 2KL6A 5I6NA 3MLVH 2DV6A 3W9DB 3W0WD 1UD3A 1NAKL 1VF5C 4ONFH 2BRRH 1QZNA 2Q8AL 3QJFA 5JYLA 2NT1A 2J1XA 4Y16D 3COOA 3EO1A 4TVPH 1X4ZA 4XB7A 4B95C 1JXKA 4JG1H 1MCPL 1OAYH 3WMSA 5I0VA 5ERWA 5EUOF 2H32A 1C08B 5D96C 1MHPH 1UT2A 3S35H 4L9DA 5T1JA 1UWGH 2OJZL 4QXTB 5MEPA 2DF3A 3B9AA 3D85B 4AQ1A 3IGFA 4MS8C 3FT9A 2X3BA 4LP5A 5D7SH 3WNPA 3HUJE 4YZFF 1K72A 5FYJE 4Z78A 2YUWA 1D5MB 4F2MB 3K1DA 2GJ6D 3NPSB 3HCVA 5HDWA 3ZYZA 5FO9B 5E94B 2AXWA 1GS6X 4AH2A 1KTDB 3QUGA 4H5SB 5GJSL 2C9VA 1ADQA 3NP4A 3LRMA 4JM4L 3M8OL 2W0LA 1FIEA 1MFDH 1PQZA 2DQ6A 5D1QA 4BFBD 4V33A 4KX7A 1FJ1B 1FCGA 4LE8A 3B9KB 3QNYB 4W9FC 1A4CA 1ADQL 3NRPA 1JNNH 1ZK5A 5DVOA 5KZCD 2BSED 2P8MA 3CFMA 4NN7B 2FQGA 4MWFB 2X4UB 2DQCL 4P2OD 2YD8A 4HPOH 4N0FB 5L7XH 2ZOLA 2FSEA 3D0VB 3V0HA 3ZVVA 4DVBA 1NEPA 2IH8A 4LOFA 5BW7A 2VR3A 5B39B 2P47B 5FUZH 2GT9A 3X12A 3DIVA 1RUMH 4ES9A 1N6UA 4KUZL 1AZZC 5K39A 1RULL 3EJZC 3FTXA 5KBKA 3L3DA 4Z6AT 1BAWA 5F71A 4NJAL 5DMGC 4G6MH 3G5XA 4JDVA 2PXYA 4RBPH 1CDUA 3EYVA 2GJZB 3BJ91 2ZWYA 3N91A 1T2QH 3WIHA 4K7PH 4LLUB 4HD5A 1WBZB 3MACH 4DP0X 4PJ5E 1UM4L 5EUOA 1JGUH 4A6YH 1KYDA 1P6AB 1IGJB 1MFVA 3BCDA 3LNHA 3WIHL 5JZ7D 3RUGB 3IKCA 5LGHL 1U8JB 2JCCF 1A14L 4YAQB 43CAB 4U49A 5DHYB 4DP4X 1T3FB 3OPZH 5TH2A 2P5EE 2YWZA 5EU5A 4WO0A 3JVFC 2A3TA 3GZKA 2I25N 4AVHA 4OZFG 2L7QA 4YEFA 2HX7A 4RISL 4DQOH 1MWAH 1NLDH 2ENYA 3B7RL 1A2YA 3D87B 1ONQB 3VXTB 4X4ME 2ZCLH 1CTMA 3SPCA 3S98A 3RZCC 3U6RB 2AJVL 3KPRD 5EMYA 2X53A 4NT6B 4PYGA 2NSXA 4YXKL 3UBHA 3P9MB 3GTNA 3MLZH 3F12A 1HNGA 4I4WA 1KGCD 2EH8H 4XTRD 1IAOA 2NY1B 2PCPB 3E6FB 3ZGIA 1D6EB 4FQLH 4PJHF 3L16A 3EGXA 2F8OA 4WRLA 4RWYH 3KWUA 1JHLH 3ARSA 4JFFB 1BVZA 3IDUA 5DQDL 3REWB 5EZIH 1J1PL 4R0LC 5EBLB 4WK2B 3SOBH 4QJ4B 3QUYA 2WTOA 4Z77A 5KW9L 4QPEA 2YD6A 3B6SB 4LLVB 1GMIA 3GWJA 4M1GL 3BP5A 3IGKA 4GRWE 4G5ZL 3OAUL 2NY3C 3SPGA 3HBGA 4R26H 3PABA 2RBLA 2OL3H 1T0PB 3QUMH 4GBXD 2YD2A 4JFPA 4X8CA 4OCLC 3FQYA 4MGXA 1SY6H 2ZCHL 3IJEB 5CU9A 1MJ7H 4Q6IB 4Y16C 1BIIA 2CH8A 5B21A 2B7DT 1CB4A 3IE9A 4RRPG 1BMWA 4I9XA 2BFVL 4BWTA 2UZYA 4J1UB 5JQ6H 4IBLT 2NZ9D 1MREH 3VI4E 1DBBH 4HIJA 2X1QA 1T1XA 4AWJC 3FT1A 1DVFB 4LAQL 3IMVA 1RURH 1LO3H 4LFHG 5IVXF 1INEL 3KPQB 3LD8B 2D7TL 2JB6B 3OAZK 4MTMA 2DWDA 4I5BB 4M7LL 5DVPA 3TVMB 4HC1H 43C9A 2BCKA 3RTLA 3MRQB 3VG0L 4NNYB 4O4YH 2VE6B 4Y4KA 4EN2A 1C5BL 3LVEA 4WWKB 1A1NB 2ALAA 4OJFH 4D7PA 2EJ1A 5TF0A 4JVUA 3P4OA 3V4VH 4MJ6A 3SCMA 4LIQE 5IJKA 1IVTA 2JK5A 2HXAA 3CLEL 2DIBA 5ANHA 4G80A 2MQ3A 2VLKE 5DMIL 3QEGH 3BP7B 3AU0A 2OMZA 12E8H 1RHFA 2OS7A 3EDKA 4K2UL 3VQ1C 5KANG 4XPFL 3FFDA 1KOAA 1YEHL 1PCSA 2OMXB 3LPOA 3NH7L 3ZIMA 1OP3H 5JIIA 3PWVA 4Y2NA 3OKMB 5EF1A 4LPYA 4N0YH 2ZOKB 1T83A 5C0IB 3WO3B 1KG0B 4GT0A 4P2OC 3ML9A 3O2VL 4KI5D 2AJUL 1UZ8B 2ZUQC 3D2UA 1J7VR 3E9TA 3CZJA 3NYKA 4MDJA 3DYMA 3LPPA 4GXVL 2BP8A 1QQDA 2EDLA 2Z4TA 2VR6A 1NLBL 3VFRB 4X9BA 4KXAA 1JGVH 1FIGL 2ZT9C 1C16A 2Y24A 3VFVA 3QCVL 3K6SB 1P1VA 2F54E 1F6LL 4PJDF 4OLZL 4HUVB 4BFFA 2WKLA 3H3BC 3LN4A 4EI0A 5EOQH 5CZRA 1OSPL 3QK0A 5FR3A 1E65A 1H0DA 1ZLUK 2HPTA 1IC4H 3V2AR 4XP1H 5DRWA 1V7MH 3BPCA 5T3ZH 5DVLA 4AVIA 1OANA 5ACZA 5FGRA 1EEQA 2CMRH 4ZTPH 4M48H 4BEIA 1XL4A 1T6BX 3C8KA 1AFVH 1FL6B 2EADA 4AYSA 4F7KA 1O6SB 2Y2TA 2ADJA 4OCYL 4FXGC 2BIMA 1JE6A 2BVPA 4JFUA 3T6XA 5JZ7C 5GZNA 1VCAA 4UQIM 1MFBH 4QYAA 3RX8A 2FL5A 1IGML 1XSJA 2OZNA 3OL2A 4UCFA 1SLVA 2BVQB 1ZXKA 3RTQC 1JGEB 1QD0A 1T21A 1OP9A 4JFDB 3MV9D 1S2EA 2IOOA 4OLVH 5K1JA 2B59A 1UWYA 3C5ZB 3FT2A 3RILA 4ZQTA 2NX5B 3D48R 3O8XA 4QHMB 4YL9A 1NBYA 3OMNB 5JR1H 2NTFB 4JUTA 3HS0B 1DN0A 4NQEA 4XTRC 4MZ2A 4PRIB 2IGLA 2ZUUA 3X1FA 3PNWA 2B1OA 3EGDA 3OJMB 4UT6A 3L3OC 3SQBB 1Y6KR 1MXDA 2NZIA 3ZK0A 3UAAA 3O9WB 4XOEA 3VG9C 1ZPLA 1P7KA 3ME0B 3A0OA 3MBWB 4RNRB 1AXTH 1U8LA 4FJYA 4HIHA 5CBAB 3VE0A 3H6AA 3K72A 2LAGB 2ZF8A 3RDJA 4P2QA 4CDHA 4U3CA 4UT6L 4YWGL 4XX5A 5HI4D 4PJXB 5G4MA 1U3HC 3QZPA 3T65B 4OGXL 2J56A 5BZWA 3MLVL 4GQRA 1N0XH 2V7HA 1TJGH 5IMMA 2BRRL 3J8F7 4JFQA 4KI1A 5DUMH 4DO4A 4NKOA 2DICA 3C6LC 4PJDA 3GC3A 2EVJA 4NQCD 4P57A 5DD6A 4ZX4A 1UQSA 4I13B 1R3LA 1DANT 4BH7A 3QIWB 4JG1L 1NGZA 1OAYL 4U6YB 4P9HC 5GSRA 1FVCA 3AMKA 2NZ9C 4HJSA 4PJAA 3WFZA 5ANME 1MHPL 1MRDH 1L9RA 2Y2YA 5J12C 4NC1C 4TOYL 4F7CA 2WOYA 1ZSDA 1ZK9A 3ZO0A 2FTAA 1VCBC 5D7SL 4AT6B 4N26A 4AQAA 5I9QC 1AGEB 2OQJA 3UPRA 5FLUA 4XPGL 1N0LA 4Y2DB 1BFTA 5SWQB 1XV8A 4XMTA 1OO2A 3PWNB 3NCJH 1TQCB 5IMLA 1XH1A 3DNKA 2VDMH 1X5KA 5AG8A 3ZO9A 1LEKB 4XGZA 1IBHA 1MFDL 4TSCL 2QVFB 3EYSH 1EJFA 1FNSL 1TQWA 2ZXCA 1L0XA 1NEZA 4D9QE 1NCUA 3MC0A 4G9FA 4J39A 2RIKA 5E8DH 3QXDA 4Q9BA 3IETB 4TUUA 2C1PA 4KPHH 1B4JH 3PXLA 3HZVB 3HR5B 4B97A 3DO4A 3EBHA 4KI5C 4AGQA 1XH3B 3LRLA 3QDME 5L7XL 4ABWA 1BZQK 3HPLB 4H13C 4NIKB 1ZJAA 3JV6B 4PJ9A 3NIFE 4FQXA 2JB5H 5LBVA 4OJCA 4G8GA 4PRHE 3L95A 1E6OH 5JPNA 1LEGB 2CLRB 1Q9WA 3QUKA 3KNBB 4K7PY 2AVFA 4JN1H 5LAPA 5FFLA 3MV8A 4PJ6A 4UMGA 5IHUH 2VXSL 5DHVB 4Y2OA 5CSZB 1IBDA 5SV4A 1IKOP 2CDEB 3Q6GL 3T9WA 1Q0YH 4JE4B 2Y23A 4LCCA 3U2SB 1CK0H 2A6JA 4K7PL 4IS6B 1AOZA 2NY0B 1FLTX 2C9UA 4HQQH 5DJ2B 1FN4A 4LESA 3RX9A 3BKMH 3D25B 1CYXA 1U3JA 4X7TB 1B6DA 1NM4A 3VB8A 1JGUL 1CFMA 4A2MA 4MQXC 3QEQB 4XE5B 1XSKA 4GKNA 5GGSB 5KUKA 4OIAA 4YDJA 5FKAB 5D7IF 1MWAA 1OSZA 3VXRB 2EDHA 1YG9A 4AQOA 5EUKB 3Q8CA 1N3NB 5HY9B 2VLRE 5D7JA 4P2RA 3ZSTA 3U9WA 3X1EA 3RFZA 3V6OA 4B27A 1SXZA 3HBPA 3VWJA 1SJHA 5IW1A 4KMQA 1MWAL 3FB5A 2MHAB 1IC0A 3KPNB 2E76C 2XU9A 4JNXA 2ZWNA 3L4WA 3H9SB 3LHPL 3SPHA 3ZUNC 3WAJA 1IILE 3MJ9A 1ZD6A 4MX7B 4W9IC 1ZGLA 1GTNA 4MMXA 4BE6A 4PJGA 2FWOA 3MOBH 4J4PD 2EH8L 4JG0H 4OZFB 5EUOE 2F61A 3CN1A 1J05B 1SHSA 2WSKA 3MRHB 5JHLA 1LYQA 3QE5A 4OJAA 3QDGA 4UZSA 4RWYL 4PJEB 5GS1A 2WLIA 5F7WC 2Z64C 4YZFE 4KO5A 4DZBB 5EZIL 3L9EA 1XTLA 3IFLH 3QUMA 3M17A 4PJIA 3SOBL 1OGAE 1C9SA 3ZTJG 5JIDA 3T4AC 3ARQA 1IIKA 5DUPH 3TL5A 3PQYB 4R26L 3VFGH 5EBMB 3HA0A 3GRBA 3QUML 1XIWB 3L5IA 4XCFH 1ACCA 3QC6X 5K5YA 2CUAA 4ODXB 2ADFH 3TU6A 5JORA 3H9HB 1DTUA 2F7RA 3IGLA 4TULL 4GH7B 2FJHA 2YA2A 2QSTA 3DRQB 2OSLA 3S5ZA 3B2UC 2Q7NA 1IM3A 3CZNA 1KY6A 1MREL 4PHXA 2BRQA 4LL4A 1VENA 5IV2B 2D7MA 5AENA 3GM0A 1RJLA 3T2LA 1R5IA 3BW9A 1RURL 3SYCA 2MOGA 4L1HA 4HC1L 3ZTCC 2AC0A 3UTOA 4O4YL 1F4XH 4HEPG 5FYJD 4C56A 3AVEA 2DWTA 2BVUA 5JOEA 3DPDA 3STLB 2CO7A 2JIXD 2GYSA 3JTSA 4WDIA 1A6PA 1F86A 4ZBJA 3P3UA 4HJEA 1HWGB 1EVTC 1VKXA 2BXZA 1UD8A 3EZ8A 3MFGB 3QEGL 2EXWD 2ODHA 12E8L 2A1WH 1WRFA 4MYPA 3W9DA 2YLHA 4I1RA 3S2CA 4OSUL 2XBZA 2W9EL 4N2HA 5SX5K 2EE3A 4U6HB 5TFSH 4OCRH 3RWCB 4HKJB 2VCOA 3LPFA 4ZSOE 4NQQA 1F11B 5H4ZA 1RJYA 2JCCE 1PD0A 4PVBA 2LLNA 3GSNH 4NI3A 5EBGA 5T5FA 2XT1B 2R2EB 1BQUA 3SD2A 3B43A 4A63A 1C08A 1WBYA 4GAGH 4MA3B 4CVWA 3B9VA 1T5XB 3U0WH 4QXTA 2EIBA 2LE9A 3B2MA 1J48A 3D85A 3RUGF 1LWHA 1MF2L 4IW4C 4K71B 1RZKC 3UJJL 5I1LA 5T5FL 1E4XI 4UUJA 1XB8A 5LBSA 3CZEA 5IB3A 5HJBA 4AITA 5FO9A 3BD5A 1B0IA 5E94A 1CMOA 1YYCA 3RL2B 1KTDA 4C4BA 1O9ZA 4DCQB 1CBVL 1IC4L 4H5SA 4PJHE 3BE1L 3QHFH 1V7ML 5JIMA 1U3ZA 2JI3A 4G8AC 5LBSL 1P84K 4GUCA 3GI9H 4PJ5D 1AFVL 2AQNA 1WA0X 3QNYA 1GOHA 4MNQD 4YSSA 3VFPB 2Z8VC 1GGIL 1TTAA 3BPNB 3TOPA 2V0AA 1MFBL 3ABMB 3RWHA 4MWFA 1BA9A 1E9PB 2X4UA 4WO4B 1UFUA 4HAGA 5IROA 4KOCA 4N0FA 2P5ED 3GFUA 4PJFA 2WXPA 1TJMA 3S8GB 3DTXA 3QUZD 5B39A 1P7BA 1BM3L 4UQCA 1SHWA 1CFVH 2YD9A 5KANI 5L88H 5ID1B 4LXFA 4Z23A 2LU4A 2K7QA 3T6WA 5DGQA 2J88H 2NXYD 5GRXG 2HFEB 3QWNA 5JR1L 3LPGA 4J4PC 1RVFL 4XBEL 3EYOB 1BMZA 1DJZA 2BC4B 3IMTA 3BMVA 5IF0B 1E28B 3A6OA 3N43B 2XQYK 3A24A 1T89A 5IVXE 3LRSB 1MIMH 1ZEAH 2GJZA 4JY4B 4JFXA 1YN6A 2JKNA 5K93A 1I1AD 4Z3GA 2W0KA 3B3BA 1W6LA 3U2IA 4LLUA 2APFA 1WBZA 2FT7A 4HIEA 1W2KT 3MRPB 2E8ZA 4OQ1A 3V5DB 1Q4NX 3GXUB 3TO4A 1YMMD 2KZ1B 4H44C 4IHBA 4KNSA 1ICTA 3I6KA 5D2LB 5C1MB 3RUGA 5ESAB 3T77A 4LSTH 4HJ1A 1W0WB 43CAA 1KB9K 1DVYA 1TJGL 3BFWA 5DHYA 2LLGA 3LTVA 5FM5O 3CXHJ 5DUML 4E9YA 3OAZH 4KO7A 3ZZQA 2IAMB 2CBOA 1VJSA 3BO8B 2QR0B 4BK5A 3CHSA 2EEBA 2NYYD 2ZYRA 4U1SB 1MFAL 1ONQA 1SUHA 4U6VH 4XHJD 3VXTA 2YAFA 3TGXA 3F85A 2JFCA 4OU3A 2VXTH 3NZ8B 3I84A 4NT6A 1Y7VA 5ICZA 3P9MA 1MRDL 4L3CA 4BSWB 2AXGA 4Z3TA 4KXZH 2PCPA 4H8HA 1PLAA 5E70A 1D6EA 1NCNA 4YLQT 1JTPA 1OSYA 3BVUA 4M4PA 5DS8A 4RFNB 3RU8L 3DETC 3IDYB 4ANVA 4JFFA 2AERT 4OLXL 2B4CH 1OPOA 1TR7A 1BZ7B 3REWA 5EBLA 1PZCA 4JFOB 4PJDE 2BS9A 1P5UC 3N9GL 4ONOA 4F3FB 4X9GA 4ZMAT 1HE8A 3B6SA 4LLVA 4WI4A 3VGEA 2EDQA 5D71H 1BGXH 4LSSH 3BVVA 4JCMA 1WJ3A 3CD4A 1NGXB 3POCA 4LOEA 4V1DE 2EXWC 4X5PA 2BVYA 2VLKD 1KPRA 1WFNA 2IBZY 3UIYA 5F6IB 1UD2A 5DJCB 3WGUB 5BOPA 1KIPB 1U95B 3K6FA 2O5XH 1C7SA 4JPVH 4PPTA 3PL6D 1ZIAA 4KPHL 3IBEA 4L29B 4PS4L 1KN2L 4JO3H 2VERN 4J1UA 4LLMA 2V37A 5E0FA 4G8EB 1H19A 4GAYB 2BY2A 5EU6B 3OAYK 2YPLB 1LO4H 1X9LA 1I1YA 5HJDA 5BMFL 1E6OL 4FQCH 3KPQA 3CVIH 3ZN6A 1A7OL 3U7YH 4X8GA 3TYGL 3BT2H 3MRQA 2CUIA 3LXUX 4NNYA 1D5IH 2VE6A 3SE9H 3WL9A 3NP3A 4N1EA 4WWKA 1A1NA 5IHUL 4Q6KA 3RWFA 5JIKA 3TYFA 4ONHB 1Q8MA 3WKPA 3E2HB 1SOKA 5AVTB 2EYRB 4RFEA 2DN7A 4YNYA 5J56B 5BUAA 4XXWA 2DQFB 4Z8FH 1HH6B 2AQQA 4BQCA 1X9UA 1IBGL 1BZEA 2AXJA 1C8PA 1ORQB 3BP7A 3P30H 2YQ3A 5C0CB 2PTVA 2APTA 4O02B 2EDXA 2YGQA 2OMXA 2WVTA 4M1CD 4G8GE 3EHBD 2Z91B 3F6LA 3O6MH 4K9EL 2E4TA 3OKMA 4Z1PA 4X4KA 4DVRH 4PG9B 5C0IA 3SDCD 1KG0A 4F7PB 5E2VH 4QEGA 5AVQB 4A1RA 5AG9A 3GMPB 1ZRUA 3HOGA 4UQEA 1XGUB 1QBLH 4KQ3H 1V3JA 4R84A 2FRGP 3QUZC 4YLCA 5K9KB 4J3SA 1XGYL 2R29H 2DDQL 1YECL 4PJXF 2WZPA 1JYNA 5D1ZB 3VFRA 4UILH 4ZAKB 3CQPA 5IUCA 1J0IA 1F6FB 2AABH 2X09A 2JKIS 1PLCA 1GGBL 2GSGB 2G5BA 2NXYC 3T0VA 3NSFA 5DD3L 4MAYA 2BS71 1G1OA 4P5TB 1K2DB 4LEXL 3PJLA 1RUAH 4UQ9A 3K6SA 4CN4A 3FF8A 3OZLA 4DUXA 1DLHB 4HUVA 4JL1A 4P0DA 2EUWA 4UV4H 5DUBB 5HXMA 3TJPA 4E41D 5IUSA 4HUXB 4L05A 4XPAH 4UINH 2B3RA 5LNDA 1UWEH 2XLLA 3EJUA 4NS0A 4P2RE 2Q8BH 1RZFH 1GS7A 2QHLA 5K9JH 1UM5H 2X3AA 1FL6A 1H5BC 3NACH 4FRWA 4DWHA 3CSPA 4PLKD 1O6SA 1NGQL 2FJGB 4LK4A 1ASPA 5DUPL 3VM5A 4OD2B 1DUZB 3VFGL 3ISYA 1CQKA 1HHKB 2D2CC 3H54A 2HJLB 3QEUA 2ZUWA 1EHKB 2ADFL 2H2SC 1DVUA 3LRKA 3O45B 2BVQA 2NY7H 4NO3B 4ZTOH 2HZHA 1JGEA 3CZSA 4Y4HC 1M7XA 5I5IA 2VAAB 3FTUA 2NYYC 1FNFA 4WY7L 1JPEA 2N1KA 1CXFA 3MRNB 3QAZB 4JFDA 4QY8A 1U4FA 1Z5LB 2J5WA 1NTDA 2X70B 3AABA 1CCZA 2NX5A 3BFOA 3H53A 4AUYA 3W38A 4JDTL 4AKQA 1H3GA 1VEPA 5GGTA 4GSDL 3KS0H 5D1ZI 1JNJA 3CUPB 4X2UA 1RJCA 5I1JL 2VRKA 2Q7YB 2VR5A 4PRIA 3JWOC 1NC4D 4XRCA 3ATAA 3GJFK 3SQBA 1L9SA 3FQ2A 4IGBD 3O9WA 2MPVA 5HPMB 1F4XL 5GGTL 3ME0A 1JJUA 1GA2A 1OHZA 4NLAA 3WY1A 2DBLH 1BDYA 5AW3B 3FTSA 3MBWA 4BKLB 5I1IL 5H37G 1AGCB 2EH7H 4DAGH 4IMKA 2WYTA 3WN6A 2A9CA 2CR3A 5IWLA 2ED6A 2Z6FA 4R7NA 4O9HL 3T65A 2B0SH 3F58H 3CFKB 1BF5A 5DZJA 3U46B 5KOVC 4D9QD 3GSNA 2B2XL 3C12A 4F37K 4IKLA 5AZ2H 5E6IB 3PL6C 4OCRL 3P3SA 3ARUA 1AMXA 3CFCL 5D7IE 5IT2L 1CICD 1KN4L 5F7KC 1ZDSA 5DVNA 3UTQB 2DM7A 2VSCA 2V2WB 1HN1A 1OKEA 3VGAB 3GSNL 4U6YA 3QDMD 2RD0A 4LF3A 4GAGL 4JZNA 2ZG2A 3U0WL 4PRHD 1AE6H 3F7LA 3C09B 1WBXB 4LVOB 2MNWA 5I71B 1CURA 1S7XB 3U30B 4O00A 2YXWA 2HX8A 1ETB1 4AT6A 4EVNB 1KCKA 2D3LA 1AGEA 1UT9A 2DWEA 4Y2DA 5SWQA 3BX7C 1OQOA 3PWNA 2HH0H 2WBWB 4DP8X 4HUKB 3OXRB 5GRJH 5JHDB 1G7LA 1WFJA 3B34A 1LEKA 4E42A 2KS0A 3IRZA 3HTLX 2XVBA 1DDHB 3ULVL 3GI9L 3SPVB 3RJOA 3WOVA 1QUNA 2IWEA 4U6TA 1ZLDA 2Z7YA 1KGXA 4OZGF 3N0AA 3EHBC 4KJQD 4L5FH 3N42F 4KUCF 1X5YA 3G6JB 5KYXB 3D9AH 1ZV5A 5D7KE 3HZVA 3SDCC 1NMCB 2VLJE 2VLRD 1YZZA 1R3KB 4HBQA 4KY1H 4N3UA 2QTVA 4FNLH 4OJDH 3V0WH 2C9QA 3HPLA 4WHDA 4F2ME 2MEJB 3DOSB 3F7KA 2FVNA 3JV6A 5TK4A 2QSVA 4JVWA 1XGQB 5C9JB 3O6KL 5L88L 1LEGA 2CLRA 4MA1B 4D94A 3KNBA 2WMPB 1MG2C 2C26A 1NDTA 4WW2A 1CLYH 4P23D 3VTAA 3V9FA 4KX8A 5LLIC 4KAQL 5IBTL 1A7NH 3PRZA 3QQ3B 2E86A 5DHVA 2CDEA 5FCUH 3CDFA 3U2SA 5L0QB 1CLVA 2D0GA 1CLZL 4OGZA 5DJ2A 4O51A 3ZRSA 1A7PH 3D25A 3FRPG 5EF3A 1JK9B 4S1SL 1OGAD 3GBML 3QEQA 4UAHA 4PLKC 3PCYA 5FKAA 5T8IA 5TQ2L 4NZDA 3K6DA 2NY2D 3VXRA 4NPJA 3FUDA 5EUKA 1IC1A 4UQDA 4Q58C 3FAXA 5HHNB 5HY9A 4HVBA 2R0WL 1F13A 1Z1WA 1WAEA 4Z7QE 3QC5X 5DEJA 1IRAY 3MYJB 1HINH 2VDPH 4FERA 1JK8B 1YNLL 4POYA 1XF2B 5DJYB 4XPTH 4J3WA 2MHAA 4U6VL 3KPNA 2AXFB 1PEWA 1NGWB 2WWKO 3KL3A 3H9SA 4W6WB 5FKPA 1JDCA 4PWIA 1VFMA 4MDRA 3O3EB 4NZRL 3CVBA 4KZEL 4BZ1H 4IHOB 3CFBB 4OZFA 1QSZA 4CSSA 3NCFB 4UM9B 2EXYD 3MRHA 1J05A 1UB5A 2O5YH 4K73A 2OYKA 1FAKT 2XWBB 3BEWB 4IGBC 3SYOA 4PJEA 3S3CB 4B5ZA 1NKOA 3NZHH 2VR9A 1A9EB 5SX5H 2B4CL 2ETWA 1KXVC 1GIGH 2PMZA 1WAAF 4KJYA 1T6WA 2L7UA 2A6IB 4KO9A 2FJSA 4N8CH 1JPGB 2QMKA 3FTYA 3QYCA 1KBPA 2R51A 1IAII 3PQYA 4R7VA 5A2AA 5F97E 3TWCH 3HVNA 1CZ8H 1T5WB 1UYWL 5EBMA 4GRMB 5DYFA 4IJTA 4ZS7L 5I6XC 3CCHA 1OAXL 4RGNB 4YXHH 3RWJB 4ODXA 2F15A 4PEEA 3H9HA 1WWWX 1X5XA 2O5XL 3RY5A 1JZIA 3IB4A 1IGFH 3T6VA 1I8MB 2R15A 5FYLL 3KPSB 4UDTB 5LVEA 1EFXD 3WFEH 4AIZB 2IPUG 2J2ZB 2J72A 3BPLC 3IDIB 3LNDA 4QXVA 3HIZA 4JPSA 2FAUA 3DVNA 4JRXB 1CL7I 1LO4L 4HH8A 1FPTH 2YUZA 2BSBA 2VQ4A 3QNXB 4A6YB 5DEFA 5EF2A 2HVJA 2HFTA 4RRPA 4S2SA 5DU7A 4I18C 4DERA 2D03H 3BT2L 4N6QA 5IHLB 3DX3A 1D5IL 3SE9L 2RQEA 2EIJB 4I1PA 4H0LC 5JHAA 1E4XL 1HOEA 4AM0A 3K6IA 4J6IA 2XZAH 5DK2B 3LZFH 2F68X 3JQOB 2H26A 5I6OA 2XA8H 4YMPA 1BQHG 1FSKB 3BUPA 5C0GB 2VTFA 5FW8A 5HGAB 3D2UD 4NAQA 4NNPH 2D0FA 2WZ0A 3N43F 3KWXA 5F0PB 2Z35B 4U6HA 5C3LD 1TZAA 5J13B 4JHWH 4N2GA 4DVRL 1N12A 4QRSB 1MLBA 3FCGA 2ED9A 3BXNB 5I75C 2IMNA 1AI1H 2J1YA 2EDKA 4ZI8A 4R83A 3KWWA 2QDVA 4KKLD 2IAAC 2OLDA 4MA3A 3R1GL 1HTYA 2R29L 2OMVA 2ZXGA 1T5XA 5F89B 2H47C 2YC1B 1AHKA 5E8EA 3WD5H 5IW3A 2C8NA 4MCMA 1IM9D 4P23C 1DBJL 4WWID 5AUMB 1CG9B 5B8CB 5CD3B 3NVQA 2C34A 1ID5I 5C08B 1DVXA 2OL3B 4R4BB 3WNKA 4OAWB 3QNFA 4AJWA 3CHQA 2A74B 2VWEE 2LTQC 4JLRB 3RYMA 3UG4A 3PWJB 4DPCX 4LSQL 4UV4L 1IFGA 1HAWA 3IXTB 3RL2A 4DCQA 3FQXB 3HRZC 4XPAL 5F9AC 1XCXA 3PE9A 4Y9BA 4R5TA 1LE9A 5L6YL 4FN0A 4ODVH 2FCBA 3HI6L 4I0PC 1RZFL 3VXQB 3ARFD 5DJ8B 3LS5L 1UM5L 5IB5B 1MWOA 4UB0H 4EIGB 3D50A 1UA6L 2VR4A 2NY2C 35C8H 3P2DA 5ALCL 2ZJSH 3VFPA 5J5EA 4TF4A 2PWDA 4PBXA 4WO4A 2H45A 5BS0A 4KK8D 2D3JA 2A83B 3LKNA 2RJMA 2A77H 1VRSA 4ANUA 2ITFA 4N0UB 4TPRH 1BOGB 3CDZB 5DRNB 2DTMH 3WEBA 2VR7A 1EAJA 1IAIM 3X1NA 3EFDH 1ES0B 4OLWH 1ETA1 4GMTH 2A9AA 4QOKB 2VH5H 4YPJA 4J3OH 4U1LB 3SYAA 5AOIA 2HFEA 3BI9X 2WGNB 5FFOA 3V4UH 1UT1A 5D4HA 2BC4A 5DMJB 3C2AH 4BZ2H 5HYJE 3OZ9L 1E28A 5FUCE 5IF0A 5J1SC 4KBPA 4Z3JA 1MJ8L 3LRSA 4JY4A 1UKTA 4MSWB 4EDWH 1DJHA 1DL7H 5LGYA 5JPMC 4D0DA 1MJUL 1E40A 2EH7L 4P59L 3MRPA 3QFJB 4DTGH 3V5DA 4IOIB 1G0XA 4N28A 1K3ZA 2YFNA 3ARZA 1JPSL 4OZIA 1YY9D 2BNUB 1BX2B 3EGSB 5F88A 5D2LA 1WYJA 2PWGA 2Q86B 2B0SL 2N4IA 3QHZH 1W72H 4DP6X 3WNMA 3B2PA 4V1DD 3UPCA 1W0WA 3X1GA 3OAYH 3V0AC 3T5WA 3SIKA 2BINA 3OTTA 2IAMA 1JUFB 5AZ2L 4NP4L 3LKOB 4XNMB 3BO8A 2OAAA 1JFQH 2QR0A 4S1RH 5FYJU 1AQDB 4Z7VB 1PBYA 2NNCA 5AB1A 3NZ8A 5EO1B 1CDYA 3C9NB 4UU9B 3ARED 4CJ0A 1UJ3B 2G60H 5D4JA 1AE6L 3ZRCC 3TZVA 1LMKA 4PJXE 1U8MA 1JZDC 2NXZB 5HI3D 3G04B 2XJLA 1M42A 3RIAK 2ZSWA 1OZTG 1XL6A 3PXJA 1T1YB 2G0KA 1IARB 2Z8WC 5HYQB 2F7PA 1PGRB 2PR4L 1BZ7A 4JQXA 4LCVA 1V27A 4HU8A 1Z3GH 4F3FA 5GRJL 4ZFGL 5C9KA 1WCBB 2QV2A 3B5HA 3PF2A 3OKLA 1NGXA 3EJQA 4JO8A 1OE3A 4JO4L 4OFIA 4LVHB 2CGYA 3VRLE 3U0PB 1ND0A 1KIPA 1KGUA 1J88A 5B1CA 4GPVA 2VLLB 4J12A 1A7QH 4X5RA 1U95A 4Y19B 2AV1B 2FLRT 4AC2A 4WGKA 4D8PB 3KBPA 3DK2A 5B38G 4L29A 5LUMA 3FO9B 1TNMA 3GM8A 2XZQH 1JZGA 3GSXB 4FNLL 3AGVA 4P46B 3V0WL 1KBWA 1GJWA 3H4HA 3FCBA 4HJ0C 5DR5H 4A7VA 4DKFH 4KKLC 3ELQA 3LSOA 4G8EA 3C8HA 4GAYA 3FMGL 1BIHA 4GXUM 2X4SA 4H8WC 4LVEA 5EU6A 4X6CB 2YPLA 4HX1B 4F33A 2AAAA 3C6SB 3VFWB 5I6KA 2R8SL 3GMNB 4UYQA 4XN7A 2ERJC 1CD8A 3S3SA 1FFOA 1PZDA 5FCSH 2MOQA 3D7PA 1PNDA 3UP1A 2YARA 4G7SB 1CN4A 4ONHA 1NSNH 5HGDB 3TN0D 3ZDXB 3EBGA 4KMTH 2EYRA 2X4OB 4N8UA 3EUUA 5FV2A 2WW8A 2X7LB 1H6EA 1P9MC 2EIZB 1CTNA 1HH6A 1A65A 3BAIA 4P2RD 1A7PL 5E8PA 4ADGA 5EEXA 1ODAA 2K3TA 3ARFC 4G2AA 2H6PA 1CYGA 1ORQA 3DPBB 3DMMD 1RFDH 3L08A 5C0CA 2IIJA 3UZQA 4LCYB 4TRPL 5E24E 3BIKB 3MGOB 1JZJA 3VAEA 2HG5B 2P5WB 4WI2A 5TF1L 4PG9A 5FM5M 4KK8C 3FRPB 4F7PA 1HEZB 3RX7A 2VDPL 4NC2B 2R1WB 3GJFH 4HOXA 1XGUA 4UIKH 4PG2C 4Y5VB 5LNEA 2AFNA 2DQTL 2R1YA 5K9KA 4YQXH 5AZEL 3QISA 2VMFA 3LCYA 2HP4A 3M45A 2EDFA 3MNDA 4UT9A 5D1ZA 4ZAKA 4QRPE 3SY6A 4R3SB 1A3QA 2PPEA 2GSGA 1ZDQA 4Y1AE 4BZ1L 1IBBA 1M7IA 4F8PA 2GTZB 4O2CB 1K2DA 5B1JA 2FEDD 5JQHC 1RZQA 3QEQE 1GYUA 1F4YL 2BSSB 1AH1A 1DLHA 5DUBA 2RR3A 3VXRE 3R06B 1J0JA 4HUXA 3PPSA 4OLUL 4U0QB 3OAWA 2V7NB 2IANB 2RMNA 2F08A 5FV1L 2SEBB 3NJIA 1QRNB 5E2WL 1W0YT 2FEEI 1QTSA 1MCEA 4X6DB 4N8CL 2QBWA 4M43H 4U7SA 2FJGA 4KK9D 1GC1C 4OD2A 3H9SE 1DUZA 3VXSE 3POHA 2OULB 5INDB 1L7TL 2PP7A 4XR8C 2E74C 4IBTA 3UCRA 4Y2LA 2UWEB 3AWFA 2OMWB 5GISL 4TSAH 4LNRA 1CDIA 4DGWC 2K1MA 2M26A 2ZXQA 3L6FB 4OZGE 4DN4H 1SF5A 2IH1B 3MRNA 2VJ0A 4L8SC 1UGNA 1CD9B 2O30A 3WFEL 4HZAA 4JQIA 1DBMH 2X70A 3BZ4A 1D7BA 5ITBH 4XVUD 1NAMH 3F7RA 1H3WM 3AREC 3DX7B 3CUPA 1FFRA 3B7SA 5CJQL 4QXWA 4DGUA 1FFNB 2MIZA 3GTTA 2KLTA 4DOHB 4LKXB 3G6JF 4M6OL 3CN4A 2AW2A 4YSCA 3W2DH 5HI3C 4JQIL 3D4ZA 3P0GB 4M3HA 4EUPH 4X83A 1BXVA 4S11A 3ARBB 2VZSA 1SUJA 3G6DH 5A2LH 4BKLA 3C5XA 2CALA 4X50A 2BHFA 2MNUA 1AGCA 3PAYA 1RP9A 2XZAL 4XODA 2Y7SA 1EHLH 4J6RH 2YGOA 2F1AA 4PS7A 5T1LD 2J8UB 3UJIH 1KLGB 3SE3A 3N1QC 2K8MA 4I88A 4HEPA 3LX9A 2OSWA 3U46A 4ECNA 3VA2C 3RPIB 9CGTA 2AITA 3O3AB 3EH1A 1TZIB 1LO0H 1SHMA 5E6IA 4QF1A 4CU6A 5GZOC 4DUVA 1BQHB 5D7KD 5DWUH 4CILA 3ASWA 2VLJD 2V2WA 5FYKE 2GK0A 4PBVC 2HJKB 1TUPA 1EZSA 3WIAA 1XF4B 2NLJB 1FUNA 1IBYA 1XXFC 2ZP8A 2OFQA 2EVGA 3BLPX 2X5PA 3I9GH 1OCZB 1MI5B 3THMH 2YLKA 3CZFB 2X0UA 1WBXA 2KPNA 3TM6A 1KXHA 3ZTNH 4NM4L 1MW0A 2QQLL 5A43C 4EVNA 5DFVD 2HJFB 3K2IA 1A1MA 1A5FH 3VU1A 5JA8B 4M6NH 4F57L 5C97A 4CSPA 5F1KC 3TN0C 3B9KD 4CVXB 4JANB 1TENA 2O61B 4IRJD 2HN7B 4PCKA 4ZOEA 1E90A 2R83A 4AIEA 5CCKL 3OXRA 4U6XB 1SMOA 2VUOA 4FDWA 4J8QA 4YDIL 3RWIB 3VXMD 3FSZA 1DDHA 1RZJC 5CLTA 2CHNA 3DMMC 3SPVA 1WAAE 3EFFB 5D96B 4XO4A 1MAMH 3VI3B 2FYYB 2XN1A 3G6JA 5KYXA 3HHMA 1XHHA 2HKHL 2XWEA 3HRPA 3QORA 1U3NA 2DKSA 1R3KA 4NZ8A 1TZ8A 4FQQB 4FP8H 5E9AA 1J5IA 4TPRL 1PVHA 4GG6B 3ARXA 3DOSA 4RAVA 4NGHH 3BDYH 3VMOA 5I66B 5C9JA 1EDHA 1EQWA 1WIUA 4OLWL 3BIBX 5EZOH 1ACZA 1EA9C 2VH5L 4JHBA 1FZJB 1MEXH 2WMPA 4I3SH 4YFLI 4Y89A 1YEGH 4E9LA 4ZX6A 2FEDC 3C2AL 2KYIA 2AEWA 4BYHA 4BQ9A 2X2IA 3QQ3A 2B5IC 2ZXEB 2E6QA 2IDUA 3F83A 2X6BA 3QXUA 4EDWL 4K94L 3UZEA 4TV3A 1HL8A 1JK9A 2E27L 3QFGA 2UZIH 1QHPA 5AL0A 3HI1A 4KK9C 1WC7B 4YUEH 2P80D 1YC8A 3QHZL 5FO8B 3OB8A 1FBIL 3ENEA 2K8QA 1HHJB 5HHNA 3VD2A 3CSBA 3HBQA 4ZFFB 4B9KC 5CP7B 1WWAX 1JK8A 3BH4A 4GI9A 1JFQL 1JFHA 4QRTB 5DJYA 4ZQKA 3RY6C 4XX1G 4E9VA 5I15H 2AXFA 1GKOA 1A4AA 1LK3H 5DK3A 2ICEC 1NGWA 3K2MC 3Q7JA 2IQAB 4F15C 1IFRA 3FSAA 4EPSA 2NDGA 2NR6A 4M9OA 1WO2A 3O3EA 4XVUC 4Y1SA 2C5DC 3TIDA 4BCXA 4R4ND 4IHOA 2WP3T 2GHZA 3IGAB 4HEME 3WNJA 4V11A 4UM9A 3UTTE 3AU1B 1OV8A 4G1EA 3QR0A 3QJVB 3UDWA 1RH8A 1CL7L 3OKNB 2XWBA 2VIRB 1GTFA 2KZBA 3DV6B 1A9EA 1LO2L 5D1XE 1BG9A 1KY7A 3IDXL 1B90A 4HFWB 4XCYB 4UZGA 5LO7A 3GJEA 1N5YH 3WEXB 1WGVA 1Z3GL 1KUMA 2Y36H 1RZIB 4RIRB 1BBDH 3GXFA 4GFXA 5E51A 1OCWL 3RZCB 3ARTA 1L0PA 1JGIA 2YKLH 5FGBA 1T5WA 1TFPA 4GRMA 5PAZA 3DX2A 3KL0A 4PCSA 3HBZA 3RWJA 1W80A 2IDCA 4JO1H 1Q9LB 3I6GA 1PTZA 3ABGA 1PL3A 3P1VA 3JVGC 4P4KC 1ZV2A 2ISDA 1DVFD 1FHGA 1MJJB 1PLGH 1T20B 5IR1B 2VDNH 4NO0A 4Z7UF 1JZ4A 3D09A 1I8MA 3OWRA 5SWSB 3E80A 3TVMD 1OSEA 2YPKB 3KPLB 4UDTA 4ZPVA 5EORH 1NIDA 5J3HD 2J2ZA 3IDIA 3KH3A 1UH4A 1WE5A 1G7HA 4R0LB 1NCDH 3CX2A 2Z93B 4JRXA 2VC2B 1LXMA 4HJGB 3V55A 2Y25A 1Q72L 2QT6A 3WGVB 3SDAC 4YDKH 5B38B 3V4LA 3VVWA 3NA9H 5BRZB 2NY3B 3MBED 4HS8H 2JKXA 1H3UA 4PGZA 5DFVC 1Z6JT 1ILSA 3W0WB 4OW6A 3VXOB 4KTEH 5EZJB 1RZPA 3UGUA 1NSNL 4Y16B 4IRJC 3PJNA 2HLFD 3FH7A 3MODL 1K6QH 1XZ0A 1EMTL 1MHHB 5DJAB 1J86A 2WBKA 5C0GA 4F5CA 5M7QA 4CJ1A <