1OE3A

Atomic resolution structure of 'half apo' nir
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 93
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A02
3WNIA 5B7FA 4AZUA 3OMNB 2UXVA 2PPFA 2DYSB 4E9YA 4UAHA 4DP1X 3FSWA 3NSFA 3T6WA 2DV6A 4DPBX 3TA4D 2R7EA 4HIPA 2QDVA 1A4CA 2TSBA 3ZDWA 2VW4A 1V55B 1NZRA 1KYAA 2XX1A 1PMYA 1AG6A 2IAAC 5B1JA 3NJHA 3GYRA 2YAHA 1DZ0A 2AANA 3NSDA 2XVBA 3GXUB 1F56A 1AAJA 1XB6A 1KV7A 2PP7A 3X2QB 1SJMA 5F7BA 3TU6A 1ZPUA 4YSCA 1CYXA 3FSAA 2H3XC 3FT0A 4PCYA 4CSZA 2UXGA 1L9SA 2HX7A 2XV0A 4YSRA 2HLEB 1SF3A 4Q89A 5D4HA 1JZFA 3NJGA 4KO6A 1XMEB 2IDQA 3H4HA 2BWIA 3AG4B 1BEXA 2AFNA 2FT7A 1PY0A 9PCYA 3WG7B 3ASOB 1ZDQA 3FYEB 1L9RA 2X88A 3IN2A 3FU7B 1SFHA 2JKWA 3NP4A 2VSMB 2FT6A 2PP8A 2B3IA 1VLXA 2BP8A 4CSPA 1PNCA 5I6OA 4YSQA 2WSDA 3EH3B 5LDUA 2OJ1A 3L45A 2BP0A 3FS9A 4NAJA 3DKHA 3H4FA 1M9WA 1NPNA 4E9TA 1N68A 4A2HA 4DP8X 2E86A 4HCGA 5IY5B 2FQEA 1AOZA 1ET7A 3DIVA 4F7KA 2BW4A 1KGYE 4KO7A 3ERXA 1J9RA 1OCRB 5AZUA 3OQRA 4KO5A 1HAWA 2XV2A 4F2EA 1SDDB 2GSMB 3CVDA 4HZ1A 2TSAA 5EHFA 3QJQB 2CAKA 2NRDA 2PLTA 1NIDA 3NJLA 4KNSA 1GYCA 4BDVA 4A2FA 1ID2A 2I7OA 2YAPA 1AIZA 4UANA 1WA0X 1BAWA 2FT8A 1QHQA 4W9ZA 1ET8A 4ENZA 1JZJA 1WS7A 2OCCB 4KOBA 1NINA 1JERA 2GI0A 3V9CA 2HXAA 2FWLB 1A4AA 1FWXA 1SF5A 1MZZA 1J5DA 3JT2A 3KW7A 3SBRA 2WO3B 2XV3A 1NWPA 2Q5BA 3ZIYA 3X1NA 1SHXA 1QNIA 2DY2A 1IKOP 1J9QA 3FPYA 3EH4B 1IBYA 2IDTA 2GC4C 1X9RA 3WKPA 2EIJB 2X87A 4E9VA 1MG2C 4E9RA 4A67A 1XB8A 2N0MA 2I7SA 1L9TA 3CVCA 3FQYA 4N4YB 3ABLB 5FC9A 4BWWA 4AKPA 2UX7A 3AZUA 3G5WA 4E9QA 3NSCA 1A4BA 1ILUA 4WTQA 1PNDA 1PCSA 3BVDB 4A2DA 1EHKB 2Y1AA 3MX0B 2HRGA 5PAZA 3T6ZA 1HAUA 2CCWA 4YVNA 4G7QB 4JHUA 1OF0A 3PAVA 5B1JC 3S3CB 3KW8A 1E5YA 4M3HA 3TASA 2GC7C 4P5RA 3T71A 3NJNA 1CURA 1L9PA 1ILSA 2FQDA 1J9SA 1WA2X 2J56A 1NPJA 4DP0X 2PPCA 3FU7A 3WNJA 1OCZB 4GXFA 2Q9OA 5F7AA 3NJIA 3QPKA 1MZYA 1NIFA 3EHBB 5AFAA 3S3DB 1E5ZA 1NWOA 3FU8A 1JXGA 1JVOA 3UAEA 1A65A 1X9UA 3IN0A 3FU9A 4DP4X 1OV8A 4HAKA 3FQ2A 2VSKB 2QPEB 4E9WA 4HCIA 2DYRB 2VM4A 1JZEA 2ZXWB 2XXGA 3CG8A 4AKQA 1OE3A 2XX0A 1CC3A 3NYKA 4E9XA 1T5KA 2VM3A 1UATA 4YVUA 2AVFA 1AZNA 3UACA 4NB7A 3UADA 5A7EA 2A3TA 3QJTB 4YSDA 7PCYA 2H47C 3OMAB 1J9TA 2FJSA 5B3SB 1AZBA 1RZQA 1A8ZA 1NICA 4G70B 2IDSA 4KNUA 4TXVB 2PCFA 3PLYA 2PPEA 1CYWA 5TK4A 4KOCA 4BWUA 4DP2X 2EINB 2IWFA 2Y69B 3ZX1A 3WIAA 2FNWA 3C75A 3NJFA 3T6VA 3T9WA 2UXTA 1GS8A 2PPAA 1TU2A 1W8EA 3NJMA 1WS8A 2XUWA 4W1TA 2ZOOA 3WKQA 1AANA 1PAZA 2YAFA 3FSVA 4QKTA 3ABMB 3S8FB 5B1KA 1WA1X 2GBAA 1JXFA 2W8CA 3HEIB 2J55A 1ASPA 4EF3A 4YSAA 1OE1A 2PP9A 1GSKA 1E65A 5PCYA 4M4RB 1TEFA 1ASQA 4Q8BA 2HX8A 1OCOB 3AW5A 3AY2A 4YSTA 2IDUA 3NT0A 1HFUA 1WAEA 1TKWA 3T6XA 4GP5B 1AS7A 3CZUB 3ZBMA 2GIMA 3ABKB 3RYMA 3ABGA 3PPSA 2MTAA 1I53A 3N55A 1ZV2A 2EIMB 3IE9A 1BXUA 1AR1B 1OE2A 3NJKA 5TK2A 2JFCA 2BP8B 1OCCB 2VN3A 3EH5B 4DP5X 1QLEB 3OM3B 6PCYA 4WKXA 1GS7A 4BWTA 4X4KA 1A3ZA 5I5MA 2BZ7A 1ETJA 2JXMA 1TEGA 5I26A 3X1FA 2P80A 1KBWA 1GR7A 2VW6A 1DYZA 2BP0B 3IEAA 1NIBA 2W88A 2DWTA 1PLCA 4HHWA 3SBPA 3IBOA 4BXSV 2CJ3A 3TBCA 3NP3A 3QJUB 1KDIA 1URIA 3FQ1A 4GP4B 4DP7X 4A2EA 5I6MA 3S8GB 3PCYA 2IH9A 1FA4A 2HX9A 2CALA 2IWKA 2EILB 5ANHA 5I5IA 3QJSB 4KO9A 4E9SA 1B3IA 3NSYA 2YAOA 4BDVB 1BXVA 1BQKA 1BQ5A 4DP6X 1E67A 4HALA 3GDCA 4DPCX 5B1BB 1BXAA 1BQRA 1AS6A 2BW5A 2VMJA 2YXWA 1GS6X 4A66A 3HB3B 1JOIA 2DWSA 4G71B 1JVLA 3EF4A 4YSSA 3AG3B 3OD3A 4GY4A 2UXFA 2XU9A 4KNTA 1RKRA 1IUZA 5I28A 1R1CA 1BYOA 3X1EA 1SNRA 1NIEA 3PAUA 3QJVB 2QT6A 4G7SB 3UAAA 2B08A 3MBWB 3TBBA 2XWZA 3V9EA 3PAZA 1JXDA 1OOWA 1SDDA 4YSOA 4AI7A 3H56A 4FA7B 1M57B 1ASOA 4BXVA 1KBVA 3CDZB 2YAEA 5AKRA 2RACA 1N70A 3FPXA 1JZHA 1PZCA 4DPAX 5I6NA 1GW0A 3ASNB 2PCYA 1ADWA 1J5CA 1ZIBA 1AACA 2UX6A 2YARA 2GHZA 1AS8A 1BYPA 1YLBB 2I85A 2QDWA 3S3BB 5I6KA 4MFHA 1GY2A 1L9QA 1NDTA 1E30A 2IH8A 6PAZA 2VW7A 1NIAA 2LLNA 1AQ8A 1L9OA 4G7RB 3AG1B 4YSPA 1W6LA 2AZUA 4HCFA 1IBZA 3OMIB 1V54B 3DTUB 3X1BA 1V10A 5E9NA 2R7EB 5B7EA 4P5SA 2FQGA 2H5UA 2FTAA 2AZAA 1AZUA 3FSZA 2ZONA 3SBQA 1AZCA 3QQXA 4YSEA 3FYIB 4RH4A 4A2GA 2HZHA 2OV0A 3N2JA 3QJRB 1RZPA 1EZLA 1XB3A 4L0PB 3X1GA 4DP9X 8PAZA 3CVBA 2GB2A 1M56B 2FQFA 5I6LA 3JTBA 4QLWA 2HRHA 4N8UA 3UGEA 2BHFA 2QPDB 1RCYA 1SFDA 5B7MA 5D4JA 1CUOA 5I5JA 7PAZA 3D12B 2BO0A 2XLLA 2XYBA 2BZCA 1JZIA 2XXFA 3AG2B 3NJJA 2YAMA 1PLBA 2IWEA 2MRYA 5D4IA 2BWDA 4AKOA 3UABA 1JZGA 4JKNA 4UF7C 4JHVA 4YL4A 2ZWNA 3PXLA 2EIKB 1MDAA 2YQBA 3U25A 4YSUA 4K9JA 1PZAA 2J57A 4AX3A 1KCBA 4F2FA 1ZDSA 4FAAB 1GY1A 4PAZA 2WO2B 2IDFA 3BQVA 1PZBA 2CBPA 1AZRA 1NTDA 2J5WA 3WI9A 1PLAA 4BK5C 1PF3A 5I6PA 1MG3C 3SQRA 4A68A 1W6WA 4G72B 1SHWA 1IC0A 3CDZA 4GYBA 1ZIAA 1ET5A 2CUAA 5B1AB 1FFTB 2YXVA 2YAQA 4GP8B 1AG0A 4ZK8A 4NERA 1KCWA 4HHGA 2PPDA 1KDJA 2P80D
chains in the Genus database with same CATH superfamily
2H6OA 1XXDC 5ITBL 3EIFA 3KMDA 2XJKA 3LZPA 4ZSOE 2L8AA 3JVFC 1J8HD 2O5ZL 1M6OB 4G9FA 2NY3C 4QHLB 2VR8A 5ALBH 2ED6A 1QBLL 2VDQB 3V0GA 1Q72L 1MFDL 3F7QA 1A3RH 4XZ4A 4QNPF 1L4IA 5EA0L 1KPVB 1IGTA 3O4OB 4P48A 1AKJA 4FQCL 4X6DA 4KMTH 4WENB 1NBVL 1FHNA 1A22B 1U91A 2DF3A 3KXFB 4O02B 3PP3K 4LSTL 2N7SA 1LLAA 4QHMA 3OLEA 4F7MA 4NQEE 1OY3B 3HFFA 3X2QB 3TU6A 3K71A 4AW4A 1CDIA 4JPKH 1OPGH 4CRPA 2ZXCA 3K8MA 5AKTA 2AKRB 1CFNB 4PCYA 1MF2H 1N59A 4Y19D 1BSIA 4E0RA 1N18A 1E9QA 1RZ7L 3VWKC 4AIXA 4HQQH 5HGAB 4YSRA 3ROOB 4PRIB 1HOCB 5E1IA 5IW6B 3SJVA 2OL3L 2IDQA 3EG9B 5JZ7C 3NIDF 4LVEA 2XG4A 4OFIA 4UM9A 3W0WA 2AFNA 4QKXB 2Z35A 4NYLB 4WI4A 4OGXL 5LG1A 3PWNB 5J6GA 1JK9A 2XSKA 4JJHA 1HHKB 1SUJA 3WENA 2EACA 3FOMA 1H3XA 4PYGA 4Y88A 1LEKB 5IVXB 2BP8A 4WI2A 4Z1PA 1PD0A 1XL4A 5DD5L 1VZGA 3ESUF 3IAQA 3GUFA 3CHPA 5E6UB 4LLWA 1I9EA 5KSAB 4FFYH 3TL5A 5A40E 4QRPE 1JSYA 1FFPA 4A2HA 4DP8X 5TE6H 1PG7W 1R19A 1BFVH 2BW4A 4HJEA 2NY1B 5IQNA 4TVSa 2NX5E 1HAWA 2A74A 3EYUL 3PHAA 4YIQA 3U7AA 4F2EA 2N1TE 5IQ7H 1NCWL 2GSMB 4KK8D 4Y8AA 2TSAA 3PUCA 2SEBA 2BVOA 3GO1L 1DVFA 4ORGB 2VAAA 4NNYA 3S5YA 2QEJA 5HHOB 2ZKHL 3IVKA 4C57C 1YN7B 2OMBA 2APBA 1NM4A 1TTCA 4HETA 3IDYB 3MREB 2MQGA 5G4MA 5EU6D 1PSKH 1S9VB 5C0AA 2FJHB 3HLAA 5D7LD 3ILDA 2VABA 2F5AL 4WO4A 3HPJB 3CHRA 1LO2H 3GMNA 4CL7A 2H2PC 2WO3B 2OMTA 3VMOA 4HOWA 2Q5BA 2HLFC 4Z0XB 5EEYA 3F00A 3FT4A 3RFRA 3RKPA 3O2VH 4IBVA 2AEQL 4TMPA 1A9BB 4FXGA 1OALA 2ITCA 2WWMD 1DDHA 1RZ8A 4H8UA 4NUGL 3DK2A 5JXED 3LCYA 4H0IA 4FI8A 5LWYL 1NCBL 3PNWB 5DLML 4CMMA 3AY4A 3O8XC 2IMMA 2V3EA 5EIIA 2R23B 4PI0A 5T1LA 3QZPA 3X12B 1JYNA 5BRZD 3MRRA 1X7QA 1XB8A 3VD1A 4DO4A 5IWLA 5HGDB 2MOQA 1KIUA 3B9KD 3C8KB 3SQOH 3EJZD 4FCHA 3RNKA 5KBLA 3WHE1 1TTFA 4WI0B 2F15A 2UZPA 1S5HB 4HJUA 2A1WL 4ZOBA 4BUGA 3IAPA 2NXYB 4B95C 3KZ8A 3IRZA 5ACLA 4TQPA 3CLEH 2FX7L 4HWBH 3V6OE 3NFSH 3TA3D 3D3VD 5EUOA 4XO9A 4CDHA 4GMTL 4YVNA 3GBLA 3DUHA 1JCKA 2FL5B 4OJDH 1R3LA 4H4NA 2CK0L 2CHNA 5B1JC 3S3CB 1K6QL 5E8OB 4MNGA 1NBYA 5T1DH 3T71A 1FL6B 2UVEA 4OLXH 3DJTA 3EOBB 4PS3A 1ODAA 3SYOA 3W9EA 3VW3H 1E9OB 5SWSA 3MUY1 1LEIA 2B15A 5D7HA 1S9XA 3V9FA 2JLPA 3TBVA 3CN3A 1CGYA 1H3GA 3CH1B 5AOMA 4XN8A 3GXMA 5ESVB 4ZXBC 1S7RB 5KVDL 1HX0A 1KELL 3VSQA 3FU8A 3T3MF 5GGQH 2N3JA 2EVFA 4ACPA 2BIHA 2JKTM 5GGTA 5AVZB 3HKZA 4L3FA 5ETUA 2K7QA 2PYEA 1OV8A 3I9PA 2P7TA 4OCRH 5CEZL 4WUKH 2DQTL 1WFTA 3DMMC 1UZGA 5HDBE 2EE9A 2ED9A 5EEVA 2AJSH 3D39E 3MGTA 3KPRE 4KTDL 2GYSA 2IQAB 3MU3A 4YN3A 4FKKA 1MCWW 5KVFL 3HE6C 5DK0B 3QRLA 4EI6A 1E4KA 2R9HC 5JYLA 5LNDA 4NO2A 4XPFL 1KBBA 1QSFB 3QUKA 1WFUA 1XD1A 3T77B 2HG5A 1MHCA 2ED8A 5CD3B 2X4QB 1DJZA 2A83A 1BXXA 2D9QB 3FU6A 2WQUA 3QJTB 1HCZA 5JPNB 3OJVC 1ADQL 3CLFH 1AC6A 1AZBA 5F8RC 2FIKB 1HHIA 1M42A 3MRQA 5KTEL 1U8KB 2IV8A 4JW3A 2PPEA 4JR9L 3M7FB 1AR2A 4QRUA 2Z64C 5E51A 4CBZA 4XNYH 2YC1B 1V7NH 3M88A 4UMGA 3QZLA 1F4XH 4JZJA 2AXGA 2FNWA 3T6VA 4NNXA 4P05A 4L23A 1A6VH 1LK2A 1TZGH 2E4TA 2CO7A 4NZTL 2ADGA 1PEZA 4K5PA 5AW0B 3C8DA 5DEGA 1DBJH 1X5AA 2HTLC 4O02L 5F88A 4O5LL 2CDEB 3OKNB 5JA8B 3IGAB 3PRZA 3UZQB 3S4SA 2W8CA 3L1EA 4C83A 1UT2A 3CDCA 4N2DA 4ZUTA 5GGVY 4OCXH 1YYMH 3ULVL 2CBTA 1TZIB 4RFNC 1UOVA 4JFEE 1S9WB 4TV3A 3JUYA 1DLFH 4HSQA 5SWZD 4X6EA 5C3TA 4OCSH 1J1XH 1BZ9A 5BUAA 4GAGH 1ZTMA 1DN2A 2I9LB 4G6AC 4YBHA 4GP5B 1I7RA 4FLHA 5JLZA 1EJ8A 3LRLA 5E4AA 1WUNT 4Y2NA 2ATPA 5IG7B 1QHOA 1LO3L 4NJAL 2EKSB 5F3HA 4LHUB 4WFHD 4LOVA 4XMPH 2OAAA 4AEEA 4YHML 4Y16A 3EH5B 2VRAA 2WAQA 1F4YL 4C56D 4KVCH 3VNYA 1HL5A 2HKHL 1E9PA 2BZ7A 5D1ZC 1ETJA 3EF7A 4BQ6A 1Z7JA 3KJ6L 1DYZA 3IEAA 3IXTB 1P7QA 2AHIA 1U3HC 2DQHH 1I1YA 3HE7A 2V2XB 1JWUB 1MN4A 5IFHL 3EUUA 1BAGA 5AKVA 4Q4IA 5DUPL 2Y7LA 2AJ3B 1AJ7L 2X4PA 1RP9A 2LGNA 4Z7IA 3GPEA 5I73B 4IBUA 4ZFOL 2DYPA 1J0HA 4LQFH 4JNXA 2YKKA 1KCRH 3D48R 5FUOL 5I9QC 4WNQA 4AIEA 3L08A 2P43B 3GMOB 5ICXB 3CUPB 4UBDD 3TCLA 1NFDA 2EDRA 4XPAH 4YBQD 4BEIA 1JV2B 3RAJH 1MH5A 3QXVA 4Q7DA 1GH7A 4XXCC 2IH1B 4CC4A 1G7QB 2V9UA 3L5XH 3QCVL 5BRQA 4G8GD 4ELME 5JNYB 2EVJA 5DJXB 1NGXA 3BE1H 5F7FA 4OVVA 5ANME 5FW6A 1A6ZB 3QIBA 4MHHI 4X0NA 5EFIB 5IMKB 1GYWA 1MIEL 4LFHG 3TOPA 3U6RA 4I1NB 3G6AB 3GSOA 3ARXA 2H6PA 1H6UA 4NPJA 5INCB 4V33A 5HHXH 4S0HA 1RZGA 4GPVA 5L2KD 3AQZA 5EZOL 4N28A 1KB5H 4YSOA 2JI3A 1WO2A 2XWXA 3SDAA 4PJIB 5E6IC 3TO4D 4U6XB 4HS6A 4HUNB 3H9HA 4AH2B 1PZCA 4HGWB 3SCMD 5ACZA 1TTRA 4NAQA 4Q9CA 3P30L 4MB1A 4XCNB 5DEFB 1BM7A 1FAIH 4ZAKD 3HMXA 4B9ZA 4PG2C 1ACCA 1BYPA 4OZFB 4UNTA 5M94B 5D5MA 1UACL 2VJXA 2ICEC 3BSZA 3MV8A 5T1MA 5L88H 1AGEA 6PAZA 4APQA 2WJ7A 2N7BA 1PAMA 4TTDD 4G7YH 4NZUL 2V2WA 4PS4L 4PY7B 4R26L 4BM7A 5CR8A 3BD3A 3LIZL 5D1QE 4MXWH 1XGUA 4J3OF 5IBLC 4NO3B 2NY3D 5B4MC 3FSZA 5I75C 2HT2C 3MRGB 2OPCA 2X3BA 2A0LC 2D7MA 3CIAA 4M1GL 3DVGA 4Q52A 4X9IA 1ZT4A 4U1GB 5FYJD 2Z8VC 3QQ3B 3Q1SH 2XKSA 1P5VA 4BFEA 1EO7A 1DSFH 1U8HA 2ZOUA 4UOQA 5E99L 1WHOA 2AW2A 2GB2A 3MRMA 4LSUL 4Z7WF 1VEOA 1RIUL 2WD0A 2X4NA 3VX1A 3T4AC 2CR3A 2VDRL 3BJ91 3MX0A 3QIWB 5I16A 3GEWB 1N4XL 1UQSA 5D1XE 3UGEA 2QPDB 1U8CB 1GOFA 1NAKL 1YPZB 4EI0A 5EIQA 4IBQA 4PJEE 3VWKD 5LVEA 1I8LA 1ROWA 3SY6A 2J8UE 4LESA 5F70A 3QEQA 5J56B 2XYBA 2BZCA 4P46C 4NLHA 3HRZA 4ZZFA 1PLBA 2ZUUA 4WHCA 1O6TA 1JHTB 3FQUB 2Q20A 3MRNA 5HHNB 1HSAB 1J12A 5K9KB 4CVXA 4NZRL 4JKNA 2KLSA 4TUJB 2LV4A 5CN1A 1NMBH 5F1OB 3T8XA 1AD9A 2EH7H 1NQBA 1JPSH 3KE0A 2YQBA 3LKOA 1PZAA 1UD6A 2DS4A 4LLMB 3B4NA 3B2MA 1A3LH 2HWZH 3F58L 3G6JE 3DJRA 4BFBD 1H0DA 3GIVB 4I48A 5I2IA 1P1ZB 2YGQA 1MVFA 2EDKA 2EYRB 2KUTA 5DJ2B 4JDEB 4YHOL 4D0BB 5F9WC 1H3TA 2C7UA 2GAZB 5HDOA 4ZFZA 3STLA 3EOTH 2GUOB 1AHWB 3IFOA 3LN5A 5B21A 4LOUD 4KK9C 4P3WA 4EXPX 4RNRB 4GYBA 1ZLSH 3BT2L 3MLXH 3Q2WA 4JRLA 3SPIA 2XFGB 4NERA 4HHGA 3QORB 5FGCB 1DBKH 2FATL 5IGXH 1P6AB 4XT1C 5CEYA 3LH2L 2PYFB 2NY7L 2R1WB 4CN1A 1SVCP 2FB4H 4JFXA 4P2OA 3VGAC 4I88A 4U1JB 5C0DB 1K4CA 5AW4B 5ENWA 4NO0A 3K6SA 3QEGH 2W59A 3DECA 1BREA 4JY5L 4NUJB 5HHVH 4XGZB 3NSFA 1H6EA 3L7FB 5E2UH 2QDVA 5KN5A 1FZKB 1ZJAA 4ZT1A 5DUBB 1JGUL 4NI3A 4JM2C 1U8OB 3NJHA 3VSTA 5ID1A 4ZI8A 5GRUL 1XCQB 4QHUB 1DJXA 1XV8A 3PHQA 4PJFA 4MAZA 3VFGH 1KCUH 1GL4B 2ZG2A 3UBGA 4HP5A 2HFTA 4XO3A 3QJFB 3ELAT 3GSXA 4MAUL 5F7BA 3RVXC 3U82B 3FT3B 5J4MA 3GHEH 3TH4T 1C5BL 3LX9A 3K81A 5T3ZL 4FQXA 1DVTA 4P59H 2IANA 1CG9A 4GRLC 4Q89A 4WW1A 43C9A 5BO1H 3INUH 4Y5YA 1DJHA 4NQQA 5LO7A 2WLYA 1AHMA 1OAKH 1Q0YH 1MEXH 1OW0C 3AUWB 3HTLX 4Q6IC 1YMMB 4FFYA 1MRCL 1ZWIA 1G7IA 4OJFH 3SYCA 4G1MA 1B90A 4PTUA 5J5EA 4LAJH 2OYKA 1BIIB 5F1NB 3GF8A 1RULH 4AL8C 1P4BL 4U4IA 1XAUA 2V37A 3KLSA 1SBSL 4J2QA 2DTSA 1JS4A 1OXYA 1A7RL 5ECJE 4Q9QL 4KFMA 3SB3A 3SBWC 3UG4A 4FHKA 5TQ2L 4RFOH 3K1DA 4TOYH 1VFBA 5ICZB 1OSPH 3LV3B 4ZXBD 3NABH 1WT5C 4UV4H 2Y7SA 4KKLD 1KJ2A 3L7EA 4F33B 3GMLB 1GC1C 4FFZA 5E70A 4F93B 3TO2A 4KK6C 3A4AA 2G30A 5D96C 2OZ4A 1SLXA 3VD4A 3EYOA 4ACTA 4K23H 2DH2A 5IB1A 2ZX5A 4DVBA 4ALAH 5DJAB 2CHZA 3NCMA 1N64L 4NC1E 5I74C 2IEPA 5DQDL 3MROA 4JANA 5IT2H 2WQ8A 1QHQA 4HF5L 1D9KD 1JWMA 1JERA 2ZSVB 3HE6D 3RIFF 3VU1A 1VGEH 3KPNB 5EF1A 3KW7A 5C0RH 2R9HD 2WLIB 3K4AA 2HUEA 3QHZL 5IW3A 5A2FA 1UCBL 3MV7B 1T22B 2R0LH 2NTSP 2FEJA 3GHPA 5A6IA 1VEMA 4URKA 3B7RL 1KWGA 1OWWA 5MEQB 3K0WA 5I23A 5CFHA 1QKZL 4HUXB 4IHOA 3LXCA 2ZG3A 1X5FA 3GPSA 5KYWA 4HWBA 4QLRA 2VLJE 1RHHB 4L9LB 1RK0A 1KN4L 3MXWL 4JCLA 5H2BA 5GRJH 4A37A 3WDHA 2BXZA 3BP7A 4IGBA 4JN2A 5FV1L 1DEDA 1ETZB 1H3VA 4ZS7H 2HTLD 4YHIA 2WVTA 1FDLL 3MRLA 1WIPA 3NESA 4WTQA 1EV2E 4DO6A 1O5PA 2DDQH 4Z23A 3MLUH 3ZGIA 2Y72A 3H85A 4MSWA 4N2KA 4GFTB 1JGVH 2BFVH 5EZLA 1HAUA 1QI3A 3FUMA 4XVTH 1OF0A 1AO7A 3OGOE 4YXHH 1PJWA 2XA8L 4ZTEA 4BFJA 1I1AB 4AIZA 1IARB 4DOHE 4MQSB 2WP3T 5AVYB 2NY0C 3KBFA 3TTYA 4J4PC 3FFDA 1XWVA 2GCYB 2WTPA 2XN1A 4MYWB 1PQZB 3SO5A 4FP8L 1KG0A 4F7PA 2X9XA 4OD3L 1OSZB 1LE5A 3TF7C 3OC8A 4G80B 5CJXC 2XWBB 3QFJE 1QSEA 5F7AA 2WUCL 2YEZB 3ISRA 4I9XA 2Y36H 2Z31A 5FA3A 1Z2KA 3WLWC 4NN7B 1GYVA 2OXHB 4HKBA 5HTSA 4XVOA 2BJML 1J8HB 3IN0A 3ARSA 4EVNA 4X9YA 3D25B 3NZ8A 1A1MB 4PI2A 4AVKA 5BZDA 4N0YH 1XBDA 2XN9E 5D2LF 1JV5B 1JPGB 1U3HD 3VH8A 2QPEB 4DH2A 1HDMA 1FLTX 2ICWA 4LLQA 1S78D 5GGRA 3UYRH 4PV9A 3N91A 3GMRB 2JIXD 4PM1A 3VXRD 1HSBB 1NDGA 15C8H 2UZYB 3U48A 3JWOH 1YEJH 3VA2C 2CUMA 5A7EA 5I19L 3OMAB 2FX8L 4HJGB 2FJSA 4ABQA 4Y19B 5B3SB 2LT9A 1I3GH 2NTFA 4Z7VB 2AJYL 1V27A 1RQ5A 3UAFA 1BLIA 3NFPB 3CBRA 4ODBD 4BHUI 4OBRA 2BNUA 2AQQA 3LEYH 1WD8A 3HZVB 5D70L 3C8HA 4N25A 2VXQA 3EO9H 4EMZA 1S7WB 5CJQL 5IV2B 1E50A 1T2QL 1ORQB 4PLJC 3QI9C 3C5JB 2XY1A 4PJCB 4PRAA 1A1NB 4NQDD 5IBUB 1VJSA 3S8FB 4PRHE 2Z1KA 3LRGA 1VSCA 2X89A 2O5ZH 2ESVE 3U46B 4FCAA 4PIRF 4YHPA 4PY8I 3KWTA 3IWUA 1JZDC 4EXKA 5IB2A 1JXFA 3Q2NA 1QBLH 4ANKA 1Q72H 4EF3A 1MFDH 4HAGA 4X6CA 4F7TB 2HTKC 5J8OA 4M1CC 2D0GA 3KPRA 5IOKA 5EA0H 1DUYB 4M4RB 2FEEL 4R7VA 2PR4L 4QMEA 5DRWA 3AW5A 3GKWL 4N8VB 2C3XA 4FQCH 2R1YA 4NQXB 4EZJA 5GIRB 1ZGLB 3R06A 1NBVH 4LCCC 5FPIA 2JSFA 3V4PL 4AGQA 5JHMA 3BAWA 4LSTH 3TEUA 4J3OD 2COQA 4I9WD 2P46B 3JV4B 4NUQA 2HJFA 2QPFA 1BD2E 3OKDB 5BQ7A 3DHPA 3TIEA 5EH1A 1HTYA 3LEXB 1DQQA 1TJIH 2BVUA 5TK2A 2N1KA 5EU6B 3AT9A 3I6LD 3A6CL 2J72A 4MCZA 3FQNB 5D7LB 3SD2A 4DGYL 3L54A 2OL3H 3DV6B 4HBCH 4JRXA 1IE5A 2DJUA 3I6SA 5ERWB 2JJTA 3CPUA 1ZA3B 5B4MD 2XI9A 2HT2D 1KT2A 3EDFA 4HX1B 1PLCA 2A0LD 3TZVD 3MJGX 3TBWA 4HH9A 3ARBD 4OGXH 4MNQA 4WTWA 5CFAA 1U4EA 4V1DE 1YG9A 3FQ1A 3CXFA 5KUKA 5CU9A 3PCYA 3T4YA 2C34A 4HIJB 4N5EC 1HQRB 3V5DB 5DD5H 3C08L 5CGMA 4JFDD 4PBWD 5ADOL 2OMWB 2GT9A 1JUFB 2NSXA 2C4XA 2A4CA 2V7NB 3N41B 5BRZB 2X10A 4GAFB 1OTSD 5CCGE 4FXKB 3B9KB 4UOW0 5EEZA 4I77L 2V5SA 3MRPA 3P11L 4PJGE 3LZOA 4RBPH 3UH8A 3EYUH 3LJ3A 4C4KT 1ZHBB 1NCWH 3TA3B 1XEUA 3D3VB 3BXNA 3UTQB 4CVZB 3GO1H 4WK4B 2J3SA 1SGKA 3VFMB 4QYOA 5EB9A 2ZKHH 4A38A 2J1YA 2QHLA 3C6LA 2HPOA 4TQHA 2QT6A 3BGMA 5DURD 5F72S 5KVDE 2A6KA 1P84K 3ZRSA 2F5AH 4JQIL 2CQVA 4O51B 1XD0A 4FNUA 4XN2A 3X14B 1TQSA 3LRMA 1T5WA 2HFFB 4FEIA 4K3JL 1MUJB 1WFIA 5DLLA 2X1PA 1R17A 1K9TA 3US1A 5CEZE 3ZIMA 4NS0A 1SXCA 4RCAA 2BWQA 1IBDA 2VDPH 2YJQA 1QQDA 1MCNA 4NUGH 5DRNA 4KK9D 2YARA 1A02N 5LWYH 1NCBH 4QHPA 1UD8A 4LDOB 4ZOCA 5DLMH 4MYPA 4GG8A 5KVFE 3H6JA 1PX3A 4G8IA 1AHKA 3FTGB 2B7DT 2A74C 2Y2TA 4TL5A 3C60D 4APXB 3LKNB 4N0CD 3O3BB 2X0VA 3AG1B 4FZ8H 1DVFC 4KU1A 4M7ZC 3RVUD 2A6JA 2YRBA 1QW8A 4KRPD 3D18B 3EJUA 1W72B 4IBLT 1SJVA 3KLQA 2FX7H 1E4XI 1BMGA 2MKLC 1INQB 2BOLA 4WO4C 4GMTH 3MLVL 3MGOA 1NBZA 1TQVA 5B39B 3BAYA 1K6QH 4Y1AA 4JM2D 3DX9B 4PWEA 3KXFE 2HKAA 1L6PA 3AAZB 4I4WB 4Z7WA 4FXGC 3IDMB 4HIQA 3DRTB 2CRIA 3QNXA 3E3QE 1RIVL 3AY4C 3HC0B 3RVXD 4N8UA 5HYJD 3VXSA 3Q0HA 4Z9KB 2DH3A 5FXCH 3DSFL 4N8CL 3RHWF 3ULVE 4ZQTA 5DS8A 4HG4J 5KVDH 5IWLC 1KELH 3P4NB 2BO0A 3EO1B 5EO1B 2EC8A 4HFUL 5DJDB 5BV7B 5EC1B 2BNRD 2APXA 2Y2WA 5F7MC 5CEZH 3L48A 5I0DA 2DQTH 4L8BA 3SGKC 3PXLA 3RFZA 3MYJA 4KTDH 4KXCA 1OB1B 5IVXE 5KBDA 1ZK5A 2K3HA 3M17A 1E5AA 1FHGA 4JE0A 2A7BA 4IOSA 4RQQA 5DDHB 3CVHB 1JRHI 2GITA 5SWZB 5KVFH 1WCBB 1J1PH 3K6DA 4WCYL 3RIFK 1XGRA 2VRQA 1M7IA 2EXWC 5FFOA 1TTBA 3OLDA 4MJID 3IGLA 2AGJL 4XPFH 3IMRA 3PPEA 4PJDE 3CJJA 4EN2A 2DM7A 1MLBB 1ADQH 2D7TL 3CN4A 4FABL 1IC7L 2B14A 4WFGD 5KTEH 4Q0XL 4C56B 2BK8A 5A2AA 3K2UL 3PUUA 4JR9H 4R7NB 5C09D 1KEGL 4AUJA 2EDDA 1SHMA 2ADYA 5BZWB 1X7TA 3G5ZB 5AQ0A 2P9RA 5DQJA 3ZDYB 5DC9B 4LBEB 1MFAL 1QP1A 3DUSB 1RI8A 5K39B 4NZTH 2HT3C 1A7QL 2J8UA 5T5NF 1KB9J 1TKWB 4O5LH 4EBQL 2E27L 1PCXA 1TTGA 5E2VL 4PCSA 4LSVL 2PUQT 1CDHA 4N0UA 4LKXA 3VJ6B 1KGJA 3DA0A 3OWEA 1CYGA 2VDOB 3E9UA 4M1DL 1E4KC 3CDGB 3L9RA 5FKAB 5LN8A 3IGUA 4OGYL 3KYMA 4FNQA 3STBA 2G4GA 2IAAC 4X6BB 4BZ1A 3ULVH 4F7CB 1FJ1A 1MI5D 4G8GB 1YEHL 2OA9A 4YUEL 1ZE3H 4S1RL 1GZHA 1LO3H 1A7BA 3FSAA 3PABA 5HGHB 4A39A 4ONFL 4JZJC 3DVNA 1NGYA 4ODVL 4M93B 4OZHE 3FOLA 3Q2VA 4YHMH 3HZMA 2X5PA 3TWCL 5D4HA 1F4YH 1YECL 5E95B 5KAQG 3GSNL 2WBJB 3TBYA 2PO6D 2HKHH 3GSQB 5JORB 5L2KB 2OQJA 3DV4A 2FT7A 2BM3A 2R69A 1BECA 3KJ6H 4LVOB 3MJ7A 4KUCF 2JE8A 3TO4B 3NRFA 2F1AA 2X70B 5FLVA 5IFHH 3SCMB 5DUPH 4NENB 3BEVB 4DGIL 1EEZB 2XZQL 1AJ7H 3QWRD 4J4PD 4PY8J 4R4BA 3K91A 4ZAKB 5LCVA 1E3FA 3I3DA 3UYPB 5E03A 3L45A 3LHPL 4JO5A 1PBYA 1LK3L 5FUOH 4POYA 2A77L 3T1FB 3H4FA 5IMLA 1M9WA 1ONQB 2QV4A 2LU4A 5FWQA 5TDNA 4F7KA 4J6IA 3U2IA 5ILTL 1M2VB 4I3RL 4C47A 4U7SA 4HIHA 4WLCA 1LWJA 5L2JB 1GCFA 3WUWB 3OX8A 1TJXA 3I85A 4Y16C 3WXVL 5EHFA 3RNQB 4D94A 1MIEH 3SDCA 4G9DA 1RJLB 3EHBC 1T0MA 3MUZ1 1QFHA 2C5DC 3BUQA 2YAPA 1DQVA 2CM5A 1Y1UA 1F4HA 1CWVA 3HE7C 1YEDB 5IR1A 3QR0A 4X4YA 5EZOH 3SBRA 3L2NA 4XZUB 4U33A 3ZIYA 1HEZA 2CIKA 2BSSB 1KPUB 4HJIA 4LKCA 1U8NA 2WXLA 1XFPA 2Y24A 3P73A 1MFNA 1UZ6E 2DY2A 1INDL 3HNTL 4LLYA 1UD5A 3B1TA 2EDOA 5KS9A 1IBYA 5FKPB 4DFIA 3VWKB 2GTQA 3P30H 5INDA 1E4HA 4WFFD 3EBAA 5HDLA 1T6VN 4NO5A 4CC4C 4UQCA 1UACH 4PR5B 2UZIL 1R0AL 1XDTT 5IB3B 3VGBA 2W1NA 1I7TB 2WOYA 3SGEI 1ACXA 1IGYA 4PGDA 3QIBC 2W0KA 3IJ8A 5FM5M 4HG4K 1T0NA 3MUGA 3I6GB 3EYQC 4RLDA 4WIQA 5E8NA 3SPJA 4NZUH 3O6FA 4EDXA 4PS4H 3AGWA 4HWEH 4R26H 3EJTA 3MTRA 4HKJB 3LKQA 3LIZH 4PRPE 4MQ7A 4PV1C 2VUOA 1RV6X 4KJYB 3JWNG 3QGVA 3OLIA 3S35H 1QATA 3LNEA 4G7QB 3HG3A 3OGCB 4M1GH 2AXFB 2HTKD 3DI2B 3U0PA 4YZWA 2NNRA 2PMZA 2J21A 4OKVA 4PJHF 3SDAC 3F7VA 3V79C 1IAKA 3U9PL 5E99H 1KGUA 3JTTB 4RBPK 3U9UB 4LSUH 1OCZB 1RIUH 1Z9SA 2VDRH 5CHNB 3REVB 3NJIA 1N4XH 3L3KB 3ARFA 4PJ9D 3SYAA 1NAKH 1E5ZA 3CIQA 5F0MB 4BE5A 3CVHL 4APQC 2R1XB 3ORJA 1KCLA 4JFPA 4IHBA 3JWNE 1NOFA 5A16A 3IXAB 4JZNB 3O3EB 3QRBA 3CVIL 2GJPA 3CXHJ 2F54E 1BHGA 1X9UA 4OLEA 5DSCB 3TX4A 1W0VA 5FDWB 3N42F 2PWEA 4NZRH 1IL1B 2HT4D 1HHHA 4G9FD 1NGWA 2FX9L 1JZEA 2X4TB 3F01A 3OKLB 5T3ZE 2RCSL 4IYKA 4WU5A 4BFNA 2ODHA 5TQ0L 4ZUUB 2QTVA 1AKJD 2VM3A 4P3CL 5L4MA 1F2XK 1HQ4B 1YSOA 4JDZB 3FCSB 5E6SB 1AGBB 5C0NC 1BBDL 4YHOH 5IB5B 1DE4A 1PFOA 4G5ZL 4UZUA 4HUCA 3W5MA 1EO5A 3KJ4C 3DJZA 3VAEA 5KSBB 3WS6A 4C4UA 1A7OL 1B2WL 1WBZA 3QEUA 5AD0A 4GUPA 5CCJA 4JCWA 3OR7A 4PVNA 1G6RA 2EZ0C 2AITA 1I8AA 4YHNA 3BT2H 4BWUA 4XB3A 4HT1L 1JPST 3QPXL 1I8LC 3B7SA 4PHXA 2VDOL 2XTJC 3B5HA 1JPTH 1ODUA 1PKQE 5GSRA 2FATH 3MNWA 3SQBA 3HRZC 1HYRC 2UXTA 1F42A 1BZ7B 3LH2H 2NY7H 3W0WD 3FN3A 5D7IE 1SQ2N 4WSKA 4KXAA 2EDYA 4X0KA 5CP7A 5A2BA 3QEHB 1IIKA 1WFMA 1KYFA 5CO1A 3RDTD 2X40A 4P2AA 4UTBL 1UASA 4JMXA 3O81A 1KZQA 4JY5H 3DDGA 3ULUF 2TRHA 2WLLB 1FNSL 4W4NA 3KWWA 2X4RA 1JGUH 1UOWA 3N1MC 3IMVA 3JWNH 4Z7QF 5T1KA 4JN1L 4KQ4L 4ZXBB 5I5RA 5FUZL 2APTA 1H8NA 4X9GA 4Q2ZA 4QCIB 5GRUH 1NH6A 2OL3A 2ZXAA 4MJ6B 4ZNEA 1CL7I 2A38A 2Z7UA 2G5UA 4MAUH 4MVBC 1AVAA 4XP6L 3IKKA 2VR9A 4RSVA 1EEYA 1PZ5B 1Q8MA 1UGNA 3PPSA 4H7VA 1J10A 1KXQE 3CLWA 4QJ5B 2JELL 1C5BH 3IE9A 4P2QA 5DWPA 2EXYD 2E9WA 3RHWK 5T3ZH 2VIRB 1BCIA 1D9KB 4P2OC 4J39A 5D6CB 4XNXL 2DZEA 1MFUA 5CGYD 1T4KB 5I5MA 3HE6B 5C0AD 3X1FA 2DKSA 4R6UA 4NBYB 3O6KL 4KKAD 1NIBA 3X3FL 2ODIA 5AW9B 3BMWA 5J6SA 4TSAL 1MRCH 1V7ML 4WWID 5GGRY 2ICCA 5KOMC 1T6BX 3IKCB 3NP3A 1YQ2A 3IB4A 3RY6A 1TQBC 5C9JB 3OKKB 1P4BH 2CO2A 3H7BA 1TPXB 1SBSH 2IFGA 3IDNB 3QJSB 1A7RH 2B9AA 4Y89A 1M2OA 5ALCL 5DJ6A 4Q9QH 3KCPA 4BSVB 4HULB 1F5WA 1BXVA 5TQ2H 5T1LD 4CVWA 4OZIF 1WHPA 2BDNL 4XMXA 1OP4A 4L37B 2X7LA 3FAWA 1N8ZA 1IAOB 4LPTA 1OD9A 1KIPA 1MJJA 2BNQA 5KANG 2EVGA 2A2QT 1SZNA 4X4XA 4FQXC 4H5SB 3IDIA 4GIPD 3TIDB 5I0YA 4JVWA 4AGOA 1VKXB 4MS8C 1WV7T 2C1PA 3EYFA 5JW5A 4XXWA 4K9EL 4Y5YC 5FYKU 5C0EB 5AZEL 4XRCA 3V5HB 4I0CC 1MCBA 1BYOA 3MRIB 3ABZA 3Q1EA 1QRNA 2VJ0A 1U93B 3L4CA 1JNJA 1FYTB 1HK6A 4AMXA 1N64H 3PAUA 4IRZL 4AG4L 1A25A 5DQDH 1NLDL 1E28A 2OULB 4HF5H 4LSPL 1R34A 2B0SL 2K0RA 4XBGB 2UZXB 2CU9A 3B8SA 2EXWD 3U0WL 1RJYA 3QHZH 4ESKA 3P9MB 5IROA 3PWLA 1MCCA 5SWSD 4KKBD 1Q38A 4R7LA 3VXTB 5KYYB 1KTLB 4UAOB 1J0KA 3MLYL 2XWCA 5JHDD 5DHDA 1WWWX 2X05A 3VE0A 1QKZH 4TUUA 1U2HA 3IJ9A 5DGRA 4JDVB 4RIRA 5KG9B 2B5IC 2F7IA 2LR4A 2VKWA 4LGPB 1J1OL 3PIQB 1KN4H 3MXWH 5I1AB 2DWEA 2W65B 1FIEA 3G6DH 1U3HB 4FLQA 2OMXB 2AZUA 5TPWL 4PJGA 1Z5LA 3T3PB 2HT3D 1YMHB 1J8SA 2WW8A 2JIXB 2R7EB 4D9RE 3MLWL 1O7SA 4RDQF 1FDLH 3ES6B 3VXRB 3RUGE 4MX7A 1NC4A 3BPLC 1SVZA 3FT1A 1LO0L 2E46A 5D2NB 3VD5A 5C07D 1LP9B 1PYWA 1HKLL 4I89A 1P5UA 4BIKA 4PFEA 3D9AL 4K7FB 2P5EA 4Z7UB 2XA8H 4QY8A 2BOBB 2HJKB 1QTPA 1J0JA 1QTYT 3RWFB 4JKLA 4JKKA 2IFFL 1T1ZA 3LRSA 4AV5A 4EJ1C 3LPFA 4FP8H 2FCBA 4OD3H 2OMUB 3CCHA 4WHYG 3HG4A 3TNNA 3JTBA 2HRHA 3B9DA 4PMEA 3HI6L 3FFCD 2WUCH 4TF4A 2D7NA 1U8JA 5CWSA 1B2YA 4R7DB 2H2SC 1OARL 3O6LL 1NUGA 4YHYC 3Q8BA 4V11A 3CFKB 4I2XA 4NQDB 5KSUA 4HKZB 2G2PA 3VFPA 4IGBC 4K5LA 3VGFA 2BJMH 2VLKA 4AYFA 1HS6A 4Y5VA 1JNLL 1SYVA 5F96L 3GM8A 1XGTA 3K3QA 1RAMA 5JW4M 2HLAA 1WTLA 4ZNCD 4XODA 3VGDA 3ALPA 3RU8L 1IGFL 1YNKL 2YGVA 2WYHA 2DOCA 3L13A 3CSYB 2IWGA 4QPEA 3E9TA 3BQVA 1D7DA 3MBWA 2ICEB 4CC0A 1A3QA 7CGTA 3BFWA 3RZCD 2BY1A 1RPUA 3TBSB 4G7VL 2WBXA 5IMOA 5BS0E 3DSNB 3DX8B 2FX8H 4QTIL 4D0CB 2K7PA 3H53A 5DJCB 5B38B 2VWEC 1TCRB 3RDJA 2Z31C 4X5WA 3REWA 1QEXA 1RZIA 4OIBA 4XMKL 4QRTA 4G6FD 1UURA 1LQSR 1KCWA 1TLKA 4ZDHB 2Z7ZA 2W0FA 4G43B 3BKML 4W9DC 5D70H 1WBYA 2IADB 4W9EC 3EHBD 3KYNA 4NIYE 3TZVB 4RMSA 4M56A 3ARBB 5CJQH 4Z3TA 5CP3A 2XKNB 1T2QH 2DL9A 1XMWA 1KV3A 3HE7D 3W56A 3OMNB 1TG8A 5EU3A 1EMTL 5AAPA 1BQLL 3LQZB 4JFDB 3KYOB 3NN8B 4FLSA 3K2IA 3MV7E 3DYOA 1KYOK 3ZDWA 2DYPD 2I60L 1GOHA 4D8PA 1VHPA 4KI5C 4PGZA 2WZPD 4N5UA 5ID0B 3SPCA 2PR4H 3GKWH 5AEAA 1LNUA 2QL1A 4K3DL 4P2RE 4FGMA 4BFIA 4AQEA 2YMTA 3S5LB 1E5BA 5GISL 3WEXA 3JTSA 2Z8RA 2WCSA 3BVVA 4L3AA 4RMTA 4PJDA 1CYXA 1HXYB 3BPCA 1T7WA 1JPFA 1BIHA 3HI5L 3N40F 5IB4B 3QIBD 3HMWL 3RVVD 2WANA 3WKML 5DURB 3TT3H 1SF3A 5A2KH 1DQDL 2BP5M 3LKPA 3A6CH 4BCZA 1OAYL 3HG1E 4DGYH 1FSKB 4IEFB 5DHYA 4JUSA 3ZUCA 4ANWA 2NYYD 1PU0A 1XTMA 1I8MA 5FUCE 4CMHC 5F0JB 5F9WB 5HJDA 4HOXA 4PJBF 5FYLD 3SDAD 3TV3L 3QNYB 3BQUA 3PWUB 4R4FL 2R2BB 4YSQA 2WSDA 3GRWL 3DO7B 3MNVA 5DD6B 3C08H 1MIML 3V10A 2JCCA 5ADOH 1M05B 3NPSB 4MMXA 3C60B 4MNHB 4HU8A 1T6WA 2CMRL 1F8TL 2J5LC 2WHVA 3ECUA 4E9LA 4F9PA 5CSGA 4LL4A 4FYTA 4APQD 1OCRB 4XE5B 3P11H 4PRNB 3QDGA 5I1KL 2OI9C 4WJG3 1D6VL 43CAA 2GTZA 2IPUG 2UVFA 4KRPB 4HXAL 1OTTC 2P52A 2CAKA 3D69B 2PLTA 4MB5A 2WXQA 2BXYA 1JI1A 2JJTC 4WV1B 4OF5A 4R9HA 5DVKA 1A6TA 2BIOA 1IM9D 3THML 1C08A 4JM2B 4W9ZA 2G5RA 1TO5A 3FT2A 3HNSL 5EOCJ 4AENA 3SHSA 3ARGA 4FADA 1BJ1J 2BCMA 1OGAE 4JQIH 3T0EE 3UO8B 1RY7B 2XWJA 1UT1A 3QYMA 4K3JH 4R7XA 3HBGA 3EJYD 2BSRA 4FI6A 5HYJB 32C2B 5JOPD 2WGXA 2CLVA 4BJLA 3QZWB 2ADJA 3EH4B 4KHTL 1N3NA 1T04B 3BP6B 4AYDC 4LCWD 4N9GB 5C0IA 4ONHB 5MEOA 4NQSB 4F7EB 2MEJB 2UWEF 1FO0L 3ML8A 3QEQD 2QQQA 2BNRB 2EDQA 1KLGA 2GW5A 1OL0A 1CFSA 5FC9A 1XCTA 4JPIB 4LASL 1OGTB 3FN0L 4OQ1A 3VRJB 2JB5L 4PS8A 3LZFL 2Y2YA 3UTTE 1NCIA 5BVJA 2OFQA 3N1GC 2ATAA 3C6LC 2WYIA 4ZPTA 5BPPA 3FF8A 1A2YB 1O6SB 1E8YA 3CZFA 3E7JA 2G0KA 1F1AA 4IJ3C 4MJIB 4JHUA 4NHUB 1UFGA 3FQRA 1M7XA 2O6CA 4DKDC 5IP4A 3NCYP 1DDTA 1IBHA 3CAFA 3MJ9L 1KENL 3EGSB 3MMEB 4K2UL 4X50A 2ALAA 2FQDA 5IJKA 2PTUA 1EHNA 2F74A 1FG9C 2IAMD 4BK5A 3PE9A 4QJ3B 2ALWA 5C09B 3QXDB 1OAUL 4XXDB 3KGUA 1RIVH 3L95A 4MVBD 3UJTL 1NEUA 5DF0A 2DN7A 2PR9A 3DSFH 4N8CH 4AJWA 3LH9A 1CXFA 4UZGA 3OXRB 1IJ9A 1KB3A 3R4RA 5LDSA 1TVBA 2NY6C 1BQUA 4HFWB 4YEEA 1LQBC 1AGFB 3ZDXE 5J9PB 1WWBX 4HFUH 4JQVA 3F6LA 2DQJL 3OWRA 4O58H 3OR6B 5DQ9A 4E9WA 2COVD 3SE9L 4BRJA 3ZDZF 2CKBB 1R6VA 5DGQA 1UZ8A 4QHNB 4E42B 3F12A 4ODHH 3U1SL 3NZUA 3NYKA 4KJQC 3AMKA 4MXQD 1MI5B 2DMBA 2P3YA 4ELMF 4WCYH 4P5MA 1Y0LA 3BSHA 4YO0A 1PW3A 3NSJA 2AGJH 1ED3B 5E7BA 4ZUWA 3I02A 5J12C 1JF5A 1P4LA 5I6XC 4W6WB 4PGCA 4YH6A 3N1QC 4RSYA 1K85A 4Z76B 1OKEA 4IU2A 4BFKA 2VLLB 4FABH 1IC7H 5TK4A 1URLA 3EFFB 4Q0XH 4IMKA 3ALXA 2PXYD 3CC5A 3TV8A 3K2UH 3UJJL 2IAND 2PO6B 5DD3L 4BSWA 1BDYA 2XDHA 3ZX1A 3EGDA 3ZTNL 1TTAA 2R15A 4CJ0A 4NZ8A 1VADA 2JLLA 1GYAA 3LVTA 3SO3C 1MFAH 1R3IL 1RUML 1AANA 2QKSA 1TDQA 1ZS2A 4ECNA 3FSVA 1OTUD 3RTLA 3RFZC 5C92A 4EBQH 5KBKA 2E27H 2GBAA 2RGSA 4GRWF 1R5IA 5E2VH 3QZOA 4ZOAA 4LSVH 5TDOB 4Z7NE 4M1DH 5C3IA 2PCXA 1MWAA 4WFEE 2QJDA 4FFWC 5PCYA 5GS2D 3K46A 3VWJD 2V6HA 1NAMB 1OCOB 4OGYH 3NT0A 2OSLA 1FNGB 1T0PB 1BFOA 3TS8A 5IOPB 2B1HL 1YEHH 4YUEH 1SM3L 2IH3A 2ZWLT 4S1RH 4ZMLA 4Y1TA 2H0PA 2IXQB 4XMLL 4Y4KA 5MI0B 1G7JB 2DLGA 4QXUL 2ATKA 4C8XA 4NQED 1ZV2A 3CSTA 4NKMB 3MOBL 5GGSA 2MIZA 4M8QB 4ODVH 1V5JA 1BYNA 1GOGA 2JFCA 3T0AA 1OCCB 2W9LA 1RK1B 2WIIB 1M7DB 4AEFA 2UYLA 3TWCH 4JHBA 4LRIA 4U1SA 4WKXA 5DJ0B 1YECH 3ZE0F 3GSNH 5CU5A 3QBTB 2VMEA 4BBWA 1PKQA 1UC6A 2K45A 3GJEA 3KPMA 5E5MB 1DBML 2K6YA 5I1EH 3DX6B 3IJ7A 5D7IA 3AWEA 5DI8B 3MN8A 5GS3A 5T5FH 3TYFA 1A66A 1D6EB 2IH9A 1BWWA 4DGIH 2XZQH 1FFNA 4TNGA 2EILB 4XE0A 5ANHA 3H42H 3PYCA 2K6WA 2PN5A 2L7EA 2PTTA 2V2TA 2LFEA 3L2LA 3FTXA 3LHPH 2YAOA 3L4UA 4PGBA 3KVQA 1LK3H 4OZIA 2ZX9A 4AT6A 5JHLL 2I07B 2Q1EA 1X5HA 4HALA 2GEQA 3C5SA 1GZHC 1BXAA 2Y5QA 2VNCA 2ZWSA 2BW5A 1MFVA 2D2CC 2VMJA 4QRPD 5ILTH 1DTUA 1GS6X 4I3RH 1EAJA 2Q2LA 2DWSA 2Y7OA 4MBRA 4YBLB 2DIEA 3Q13A 4AM0A 4ZZKA 2EYTB 4MJJA 3QE5A 2ROYA 4PEEA 3WXVH 2NX5D 1PZ3A 4GIAA 2UXFA 4F37F 5H4ZA 1AXIB 1YUKB 1NIEA 3L4VA 4ONOA 3S9DB 3P1VA 3V7MA 3W81A 5I71B 3BDBA 1AO7D 3DO4A 1AZVA 3V9EA 1RSYA 4QO1B 4KWUA 5E8EA 2B4CH 5H37G 1KNOA 1YNTB 4AI7A 3GZOA 3F84A 3MJ8B 3Q9PA 1GKEA 3NA4A 2VL4A 3VSVA 5I1GL 4BXVA 3V4VL 1GTFA 3FPXA 4XVSL 5IM7A 1FFRA 3DUUA 4HJTA 4PJ9B 2IPKB 1INDH 1Z9PA 3HNTH 4YE0A 5EZJA 4AL8L 4DZBB 1QSED 2UX6A 3V8OA 1AS8A 1YLBB 1JN6A 2I85A 4C56E 4B50A 1ZSDA 1VENA 4KMLB 3F7RA 4MTMA 1R0AH 2UZIH 1JGIA 1ZHNA 1SYSB 1QMUA 1ZT7B 5J11C 3RVWC 3SDCC 4M5SA 1A7NL 1BX2A 3U0TA 3V6FB 3VTMA 4OBSA 1UA7A 1GC1L 3T65B 3HR5A 3UDWA 1AKJB 5GXBB 1DQKA 4UUJA 4X6DB 4LMQI 4FULA 5GRXG 1FAKT 3QDME 1CE6B 2Z4TA 4K7PY 2EDJA 4H1LA 1P4IH 3HUJA 3N6YA 2YFNA 3BP5B 4KDVA 3QJRB 4KI5D 5M7QA 4HD5A 1A64A 2EJ1A 3NG5A 3VFWA 1TMQA 1NKGA 4Y4HA 3CDYA 4XNMB 5IF0B 4E0RB 1E9QB 3ARED 1FFOA 2CKBL 2XIIA 4OTXL 4QOKE 1XT5A 5JIHA 1YEEL 5AAWA 3RIAK 3W0WB 5D4JA 3FBKA 5IK3B 5FDYA 5FGBA 3GQFA 3AG2B 3CVIH 2YAMA 4QRSA 4MA7L 1PX4A 3RDTB 1JK9B 5I30L 5DS1A 1DHKA 3O6FC 1K8DA 1EANA 2LABA 4MMZA 5KSVA 2FZ3B 3A4FA 2F6AA 4BUQA 2A9CA 1KTRL 2CJUL 1FRGL 2CH8A 2EIKB 1O7DC 2FX9H 4AW7A 4M5YL 1G9HA 4WGWB 1MDAA 4YSUA 1QWNA 4LLWB 4W9HC 2WLZA 2RCSH 3D39D 3KPRD 5CLYA 4RMQA 3RUGA 1FH5L 3NGBB 5TQ0H 2X4OA 1FFPB 1X44A 4P3CH 5ESQA 4DZ8A 1TZ8A 3FRPB 5I8CB 3ZYJA 3SGDI 1PLAA 1BBDH 4Q74A 2A74B 4G5ZH 4YIQB 1NFIA 2Z3FA 4EUPG 2ARJA 2Q7NA 3V4PB 5IHWA 5H37H 2DW5A 5FB8A 3OKEA 4NQVB 1B2WH 2BVOB 4GB9A 4JBSA 1V3KA 2VAAB 1ULVA 3ARFC 4NNYB 3QULB 3MLSL 4M7ZB 4OF8A 4DCQB 2YXVA 3WO4C 2F0CA 3EBIA 1EZVX 4HT1H 4WNSA 3U6XS 4UQ2B 5C0AB 4PRDA 2KMWA 5KYUA 4WO0A 1OP3H 1G4MA 2CUIA 2VGLM 4N2OA 4O00A 2WYTA 2X2YA 3GMNB 1KF9B 5EO9A 3TURA 4FFTA 2BS71 4CNIA 1U95B 1QSVA 1TZAA 3QUZB 4EOWL 7TAAA 4MNQD 1ZMYA 1DQJA 2PPFA 4IIQA 1FG2A 4UTBH 3HS9A 1DDHB 2IALA 4BQBA 1P7KA 1Q9WA 1FNSH 1A4CA 1R5WA 4EN3D 4CMMB 4JFYB 1NZRA 3ETBF 3GXFA 5T1LB 5CCKL 3GYRA 4HCRA 3TFBA 3B5GA 3Q2LA 4MAYA 1WRFA 4WU7A 3E8VA 3EJPA 4JN1H 4KQ4H 5FUZH 3WS6C 4JFED 2Z6FA 2DQFA 3RNKB 2Z34A 4MJ2A 4TVUA 3MOQA 5DHXB 4LXFA 2GKIA 1RLWA 4XP6H 3FH7A 3X3GL 3FT0A 1BVNP 4GXUM 1L9SA 3HR6A 1VESA 3SODB 3Q5YA 2IPUK 3U30B 3CPLA 3ECQA 4M48L 3X13A 1XMEB 5EOTA 4LEBA 3H4HA 3K6NA 3CSBA 3GLDA 3C6LD 4XNXH 2GJZA 4LNRB 3H9ZA 2XJLA 4MNGB 5K59E 2AAAA 4HMDA 3O6KH 3RWGA 3X3FH 4S10A 2XKUA 3W9EB 4JFUA 5SWSB 1S7UA 4TSAH 1L9RA 1A9EB 1V7MH 4LSDA 4PJ7B 1FNFA 4GRMA 5JHDB 3APMA 3TBVB 2FT6A 4LBAA 3B34A 4BD4A 1VLXA 3AS3A 3P4MA 2NDGA 4HJ0C 2Y4SA 3OLGA 4Y4FD 2CRZA 5ALCH 3WTVA 2O5YL 4CW1A 1N6QL 3TF4A 5JW4N 4OF7A 2WYZA 5I18L 1BAFL 4B9PA 2E86A 4EI5C 5IJBC 2EUZA 3DIVA 4NPYB 4KZEL 1YAZA 4NDMA 3ERXA 1MFCL 2P7TB 3CN0A 4ZFFA 2AV7A 3LQMA 1OLLA 4JQIA 4EUPH 3SKMB 5C07B 5JQ6L 4K9EH 4RGOL 3BUPA 5AZEH 3D0VA 3HZKB 4IRZH 5JO5A 5HDRA 4AG4H 1Y07A 1NLDH 1ZT1A 1MCOL 4LSPH 1MHCB 2FWLB 2B0SH 3I9IA 3QPQD 1MZZA 3ESPA 3ECBA 3RY6C 4M5ZH 4L29A 2MHAA 3DPBB 4ZMYA 2H3NB 3HJEA 4YDNA 4PH8A 1HHIB 3WY1A 5BOJA 1XF5A 3MRQB 4N20A 4MMYB 1SHXA 3FFCB 3VCLA 3MLYH 1UOKA 3OKMB 4JZJB 2AXGB 1PPIA 4NNXB 4ZJ9A 4QF1A 2BCKB 2EADA 4FQ1L 2UWEA 3UX9B 2EIJB 1BFSA 2YO3A 2X87A 2CO7B 4X80L 4LFHD 1MG2C 1Z0MA 4FX5A 1J1OH 5DEGB 3KHOA 2WNXA 1LEGB 4IKJA 3ABLB 2Z92A 4KK5D 4XXWC 2UX7A 3S4SB 5TPWH 1HHJA 4ZQKA 3TN0A 4C83B 3FJTA 4ZUTB 5I76B 2FIRT 4OFKA 4K3GA 3MLWH 3C9NB 3GXPA 3TJHC 4EZKA 1RERA 4RGNC 1J7VR 1LO0H 4U1HA 1HKLH 5D1QD 2GJ6B 2JTDA 2ZX7A 2J44A 3WY2A 3RZCB 3FB7B 3D9AH 4K5NA 2DIBA 5IVNA 4FFWD 1ML0A 2OSXA 3PHSA 3CZKA 5IROC 2VDNB 4H88L 3FUIA 1A6AB 1V05A 3ETBJ 1F90L 3IU3B 1L6XA 2ILLA 3ME0A 2IFFH 2LU5A 5F3HB 3E6HB 4LSSL 1OGAA 3D33A 1NPJA 2LVCA 3COOA 4WVRA 3ULSB 3F62A 3MCKA 4FERA 4G6FB 3TLRA 1TZOA 2EIEA 3T08A 2K6ZA 4HJ1A 3HI6H 2C3HA 1NIFA 3EHBB 5F93C 3V0FA 2QFRA 3KPSA 1HXMA 1ORSA 5D1XD 3ARQA 1OARH 1BQHB 1X9LA 3O6LH 5D71L 2HVKA 1BZDA 3BPOB 3VI4B 2VM9A 1JXGA 3VFVA 2AS5M 3HE7B 2DWYA 1NA8A 2WN3A 3VX0A 2AV1B 3D1MC 4X8XA 3WL9B 4IRJA 3FQ2A 1ZGLP 1F58H 1JNLH 3EDDA 5BCAA 3OAZK 2HJLA 2VLRA 3GBML 3DGGA 3UAJA 5F96H 2AQNA 2DYPB 5E4EB 4JO3L 1P5UC 4JRFA 3L17A 4WNQB 4PJAE 4JAMB 2WXFA 3B2XA 1NFDB 1T5KA 1IGFH 1YNKH 3NIFB 1MH5B 4NRYA 1EDQA 4OLUL 3EOAB 4QXWA 1EAPA 4IU3B 4NP9A 1NGXB 2CGZA 1BWMA 1JVKA 2F7RA 3MRCA 4G7VH 2YZ1A 3FO2B 4NKDA 3QIBB 4QTIH 1JE6A 5EN2A 2PCFA 4M6NL 1KWKA 1KLUB 2JI2A 2Z7YA 3FQTB 3L3OA 4WTZG 2V0AA 4XMKH 5K9JL 4L8DA 1ACZA 4Z7OB 1RZGB 3BKMH 1M4KA 3SDXE 3BRDA 1U2CA 2C9AA 3A67L 3F5WB 3IFPA 4Y5VC 4GG6F 2ED7A 3DXAA 3KHQA 4JJ5A 2XWTA 3TJPA 1WJ3A 1H6FA 3SDAB 2QGBA 3MRFA 5I1LA 3HNVL 4WTXA 3K5RA 2BVPA 3L4XA 4HS6B 1EMTH 4UYQA 2H9GA 4MJ5A 3K0YA 1BQLH 2VL5A 5ACZB 2O30A 1QEWA 3NIGE 3AMLA 4ERSL 2HN7A 2QFPA 1E8ZA 5FHAL 5J3HD 2I60H 2JJSA 2P5PA 3R19A 2FH8A 3MNZB 5T1MB 1L5GA 1AGEB 4APQB 4K3DH 3CFQA 3AGVA 1FVDB 5G55A 5ABDE 2IPTL 4R2GC 5GISH 2EDBA 2V2WB 4DGVL 4DIXA 4YMPA 5DZOA 5F6IC 3HI5H 4WJ5B 1K2DA 3RVWD 3L9BA 5T5FA 3ROLB 3SDCD 5F7HA 1IM9B 3QUYA 1DQDH 4K8RC 3ULVC 1SOXA 3VXRE 1OAYH 1XGQA 1ZT4B 3GBNL 3QHTC 4MD4B 2UV3A 1KBWA 1ZVNA 2AVGA 3J8F7 1OANA 1P5VB 3NQKA 3BYTA 4MJ4A 5GGTL 5FGRA 2XACC 2NNAA 4JKWA 4YDVA 4GO6B 3OXSA 5I6MA 3T2QA 3TV3H 5I16B 1UWXK 3MKKA 3UIZA 4LCWB 1BPVA 4DO5A 1T1WB 1I3VA 3GRWH 4CVUA 2QBWA 3HPLA 3MFFB 3NSYA 1Q94A 1MIMH 3IF1B 5DS2A 5SWQA 3ZOAA 1LHZA 5GHWL 1XF3A 2QV2A 2CMRH 1F8TH 2R39A 1GPOL 2FUTA 5HI4D 2YXWA 5JMOC 5I1KH 1XF4A 1TTUA 1D6VH 1L0PA 3MVSA 5IVXF 1QUNB 4KFZC 3ZE2B 4HXAH 1AD9B 1KJMA 3O6FD 5DHVA 3T8XB 1I8IA 1IBFA 4I5BA 1K3IA 4J5VA 5IVZB 1F6AA 3U2JA 3RWDA 1S46A 2A9NL 3I75B 3BWUF 3THMH 1X4YA 2ISDA 3HNSH 1CGWA 5DZNA 2C7UB 1JXDA 1AR1C 2VOTA 4OJEH 1T1XB 2IAMB 3BQUC 4NZFA 3LN5B 2O6FA 4U6HA 5AW6B 1M57B 1AIFA 2OXGB 4XNQB 4U1MA 3ZW3A 4KHTH 4MMXC 5JXAL 1DN0B 1QA9A 4F9PC 1U33A 5IEHA 5KVMC 1XZ0A 1VFAB 3FO9B 1L9QA 2O6DA 4YS4A 1K4CB 1LWHA 4I18B 5ENWB 1FO0H 1E30A 1IAII 3K6SB 3RWHA 2VLJD 1MDTA 1PGRB 2IOMA 2CRYA 1TJMA 2YSSA 4U3SB 1JWSA 1ND0A 2Z93B 4LASH 3BISA 1JZ2A 3FN0H 4JLRA 2Q76B 2FYVA 2JB5H 3RGVD 3GMPB 1TQBB 3LZFH 3QZBA 4Q14A 5KN5B 2FQGA 3KLKA 4ATWA 4XC3L 1KCSL 3ARGC 1JI2A 4UT9A 1ZCRA 3PQYA 1VACA 3CZSA 1C9SA 3PHQB 4PJFB 1EHXA 1QG3A 2W60A 3GUTA 3GSXB 1HEHC 4B9JA 3CN1A 3MJ9H 1LDSA 4K2UH 4Y8DC 4N2HA 1E2WA 5IHZB 1IFHL 4JPWL 4JPVL 2PXYB 2DL2A 3RWCB 2IANB 1CG9B 3BH9B 1K5NB 1FL3A 1OAUH 3BT0A 3LYRA 4DUVA 43C9B 3MV01 3UJTH 4Y5YB 3VRLF 1FNLA 3QFJD 3GJFK 2DJMA 4KKQA 1BOGA 1YEIH 3PY9A 4EE2A 4YXKH 4LF3A 5FGSA 4G1MB 4PTUB 1CFBA 3L8QA 3G5XB 4ZO7A 1H3UA 5H8DA 4AJVA 3V5KA 2NOYA 4ZSOB 5G4NA 2XZCL 2DQJH 4YDKL 4L8CB 3SE9H 1R5VA 3GGWA 3QZNA 1AXSA 1MQ8A 2XN9D 3VWJB 3BH4A 3FO1B 1K5WA 4U1KA 1E42A 2XQ0A 2WXGA 3U1SH 1OSEA 4QD2E 1QBBA 2YOCA 4P4RB 4MQXC 4HJ0D 4PJXA 2MTPA 5DC2A 2B5IB 2F19L 4ZPVA 5T1KD 4ABUA 1O9VA 1TFHA 3GSWB 1QX1A 4M61B 4U6YB 4W9FC 5IJKC 1R3JA 1QRKA 4BK5C 2I24N 4OZ4B 4EI5D 4JFZL 3C6SB 4NQEB 3FMGL 6CGTA 1DBBL 1SHWA 3D05A 4X6FA 3UBXG 4MQTB 4DVBB 2N01B 3U4EA 2GFBA 1UG9A 5I0XA 4W81A 2VZVA 1I8UA 1U8MA 2R59A 5DD3H 2F58L 5B22A 3M45A 5BQDA 4LEOB 3ZTNH 3AVEA 4B53A 2J8HA 4AIOA 5FECA 3FONB 4JQVC 4M3KB 3MLRL 3SGJA 1W0WB 2F53A 3Q3GB 1VA9A 4WKZB 4UDTA 5FFGA 1RUMH 3BH8A 1CE1L 2UXVA 2EABA 3HKFA 3VACA 4QRRA 3LTVA 1HOEA 2G0LA 2GPZA 4HEME 2CDGB 3T6WA 2VE6A 4RESB 2ZQKA 1IFRA 4MD0A 4PRHD 4PWHA 2E47A 4ELDA 2L4OA 5LNGA 4G82A 1V55B 2P8MB 3AADB 1GGBL 3VFNB 4LP5A 1RK0B 5DFVD 3ARDD 3NEXA 1DZ0A 1ZA6A 2ZNXA 4QRPB 2XVBA 4X7TA 4A7SA 2B1HH 5EEXA 2BRRL 1SM3H 2J25A 4Z3HA 3BP7B 4LPUA 5HVFB 2XQYG 4XMLH 3T0BA 2NX5B 4QXUH 1PDKA 4IMKC 4U7MA 4CA4A 1OAXL 4MSWB 4X5QA 3D50A 2N59A 3AC0A 4IOIA 4J8RA 1B0WA 3KPOB 1AO7B 5CIPH 5J13B 4K71B 2Q10A 3TJHD 4X99B 4ZTOL 4XN7A 1JMXA 4AIZB 2KDGA 4F8OA 5LKNA 1SN5A 1NGPL 5C7ZA 3MODL 1DBMH 4UWQB 3U7WL 2X88A 1K3ZA 5MEPA 3ZZ1A 1LE5B 3NP4A 2O26U 4P4KD 4U7KA 4L4TE 3T04D 1QSEB 2YN5A 4MCMA 1L0YA 1UJ3A 5F8QC 3RIKA 1MCDA 3VI3E 4F8QA 3P69A 1H9VA 5LGKA 2H1PH 1S7TA 1AI1L 2DRUA 1S5IL 3GJFA 2YPLE 4XPGL 4MA8L 5JHLH 2XN2A 2WPGA 1AOZA 4Y4KC 4HVBA 3B2UC 1ACYL 4EVNB 4HK0A 5BZDB 4F3FB 1NDMA 3A5VA 3EXLA 1AFVL 3UCRA 2ICWB 4LLQB 1OB0A 5TE7H 4XH2A 3F64A 4PJ8A 4HWZB 1CDGA 1HILA 4UM8A 3PHOA 3M1BA 3PWPE 4IIZA 4LRIC 4UIMB 5BRPA 1NC4D 1A4JA 5CLWA 1NDGB 2ADFL 4LLDA 1ET8A 1HH9B 1JZJA 3HLKA 4WSGA 2XTSA 4N0FB 3SDDD 1KY6A 4FQHA 3V9CA 4P5TD 3AJ7A 3JWDC 3ULAB 3S8WA 1IQDA 1KN2L 1X5XA 5JMRA 5DZ9A 1SRDA 1CLZH 2AF2A 2J2ZB 2FUQA 2WTOA 3CMOL 3TT1L 2NZ9C 3AREB 3MBEA 1HI6B 5I1GH 3A4DA 4J3BA 2IC2A 2G2RA 3DIFA 3V4VH 4XVSH 3ILQC 4MXVE 3ZR5A 1TLMA 2A9ML 5CEXA 3PGFL 1B0IA 5CEZD 1H6TA 4RX4A 4AL8H 1RUQH 1K8IA 3P9LA 2GK0B 1XSKA 1YO4A 1DQTA 4KHXL 5F0LB 5EG6C 6TAAA 4AC4A 2FBJL 2X4SA 3PWJA 5F7KC 3RLSA 4ZYKA 1SXSA 1JFQL 5FAAA 3FRUA 4M9OA 2P5WE 5IFJA 4HGMA 4PJIF 2XZZA 4AKPA 5IB2B 2VQTA 4OZGE 3FB6B 3QO0B 3G5WA 4E9QA 2V5MA 2Z4QB 1EA9C 2ITFA 3NFNA 2Y7QA 3OAYH 4XTRD 5HDBB 1A7NH 2NW2B 4KJPC 2MNUA 4X4MA 3P3YA 3D39B 4NAMA 3KPRB 5LAXA 1F6FB 1HCVA 1GC1H 1FORL 3W11C 3FZUD 1UXWA 25C8L 3Q5OA 1SMAA 4S0SD 3T6ZA 3C12A 1X5ZA 4C4BA 1DJWA 4GXUN 2R1YB 4I87A 1T3FA 1SJEB 1H19A 4ZD3L 4UQ3A 2J7LA 2FEEI 3ZHNA 4FFYL 3KDMA 5E8PA 1WA2X 1EK3A 2A4ZA 1CFTA 4LRNH 1BFVL 2OI9B 4FG2A 5ISZA 1NKRA 1DQQB 5KYXA 4R2GD 3IJEA 1MRDL 3QRFM 3D6GA 1WFNA 3AQXA 3G04A 4G2AA 4OTXH 4KTEL 5TDPA 1YEEH 1V3JA 4KJWD 2YEVB 1FL5A 1G7MA 2AERT 4DEPC 3Q9QA 4HH9B 1CD8A 3ULVD 4HZLA 5JPMA 4PWFA 4MA7H 1QD0A 3BKJL 4WUUE 1KJ2L 5JA9A 1RFDL 2YN3A 4TQ8A 3VYNA 2BS8A 3T4YB 4FFZL 4YL9A 3T2OA 3UG3A 4AXWA 3UDWC 4EN3B 4NKOA 2AQSA 2OZ4L 1T7YA 1C16A 1FRGH 2CJUH 2CHXA 3MNMA 3CZEA 2AXWA 4Z3EA 4M5YH 2GT9B 4GW1B 4HUWA 1YPZF 2APSA 4IKNA 4N6RA 4F58L 1YEWA 4WFFE 1NJ9A 3KPQA 4NRZB 2P24B 5F3BA 4JFEB 5EZPA 1FUNA 1ROCA 1W80A 4Y4HC 4NB7A 3KPLA 2R2EA 3ZZLA 1AGDB 4H8PA 1J9TA 1KB5B 3BAJA 1JK8B 1KXVA 2X44D 4UQAA 1I8KA 1A9VA 1QFWL 5KYNA 4XMTA 2GSIA 3QDJE 1NSNL 3SKNB 2OCFD 4OV5A 1FZJA 1E4WL 3KBHE 5AAWC 1F00I 4QYOB 3MLSH 5D55A 4GO8A 4HLEA 1OGPA 1NCCL 1CXHA 4R3SB 4BA0A 2HMIC 3C6LB 5FGBC 3BGMB 1DQLL 1OZTG 2R51A 2WXMA 2A6KB 4IDJL 5HJ3A 4Q6KA 4GG6A 4ADGA 4IJ3B 3ECVA 1W8EA 1UFUA 2XXCB 2L7JA 4MMZC 5E94B 3W1ZA 5HHQA 1PAZA 1QZ1A 4EOWH 5ICYA 3BW9A 3ZRCC 4B3VA 2G75B 1WA1X 4NOFA 4OLXL 5F9OL 1QQDB 3BQUD 2X4UA 2J55A 4Y4FB 5DRNB 1OE1A 5HYSA 5DTFB 1YC8A 4IBTA 4WGKA 5E9DA 3AY2A 5D7KE 5CCKH 1RSFA 1DVZA 3KWVA 1TVHB 3OPZL 4KQ0A 4QHLA 1CS6A 5GGQL 3QNZA 1QABA 3QDGD 4YWGL 1KCVL 3UTOA 2A6JB 1I53A 4JFFE 3X3GH 4G9FE 5I1JL 3F6JA 2JKNA 3P0VL 5LAPA 4WI3A 2WTRB 4R90L 2VZ1A 6PCYA 3MGOB 4M48H 2E9JA 4X4KA 2EH8L 1XX9C 3VMNA 1TEGA 2X6VA 4Y5XA 4X6DE 3CFMA 2QQLL 4IIQC 4RETB 4NT6A 2AKRA 4X5XA 3DTXA 3WNNA 1CFNA 5FYKD 5J12B 1URIA 4DP7X 5EZIL 3ROOA 4PRIA 3E8UL 4IQHA 3EG9A 4MAYC 5DS8B 4BDVB 3SJVE 2O5YH 3P40A 1VPOL 3ZE1B 3BD5A 1N6QH 1DEEB 1V7NL 1BQKA 4NZDA 4P2CG 3PWNA 2MJWA 4ZO6A 5I18H 1BAFH 2YD2A 4TSBL 4WTZA 4D8OA 4DPCX 4LVNC 2HFGL 4KZEH 3SO3B 1LEKA 3WBDA 4B27A 5DRXB 3MV9E 3GSUB 3WNLA 1N10A 4OIAA 5JQ6H 1D5ZB 2DPKA 2YR3A 4RGOH 4RQQB 5D1QB 4AGMA 4F24A 4R97B 4O2FB 4FYRA 4D9LL 5JDSB 1XGRB 4X7SL 2VXQL 2W9DL 2B08A 4OCXL 4O4YL 3OHXA 1XR8B 1LVEA 2RQ8A 4H0GA 4OCMC 1MCOH 1YHPA 4X8JB 2HB0A 5D93B 1MRFL 4FXTA 3Q48A 1XF1A 3H56A 2JJVA 2QR0B 1Y6MR 5HHOA 5CF3A 4D0DB 4WW2B 1YN7A 1NUDA 3A21A 1S9VA 3HBZA 2A9BA 2DQDL 3L5JA 2EDNA 5D1XB 5EIIG 2Q86B 3EFOB 3S3BB 3HPJA 5DD1L 4FQ1H 3EJCA 4PJEB 3VFSB 1WC7B 4X80H 2J8UB 4XN1A 4KVCL 3QO1A 2FAUA 1NIAA 4PRBB 4AEIL 1UVQA 1F3DJ 1L9OA 2B20A 5FM8A 1A9BA 4PP1C 3VXPB 4LKXB 1JYVA 3PNWA 3L9RB 1CU4H 2IGFL 4Z7AA 2R23A 1P53A 2AZAA 3A23A 3KYMB 1X5IA 3R8QA 3X12A 3ZMRA 4L1SA 4OD1L 1AZCA 2WJ5A 4PRPD 2FHFA 3G6JB 3FYIB 4RH4A 2OV0A 4OD2B 4WI0A 2VZ3A 1S5HA 3BVUA 3AB0B 4H88H 1T1YB 4M5TA 2W91A 3VG9C 4EAEA 1F90H 3Q8CA 3FQWB 3PABB 4LSSH 3L5XL 5DHEA 2ICES 3DVNB 5ABAA 3BE1L 1YYLL 2HUHA 2WCPA 2DI7A 2FL5A 3P54A 1QVOB 1E8WA 2NXZC 4QXTB 2YXMA 3BYYA 3CZGA 5E8OA 3TBYB 4JGNA 3QFGA 2P1YA 1QWHA 3OKYA 4HBQA 5EUOE 5HY9A 4ZMWA 5FS5A 1FL6A 1NMCB 3QR1A 2YGNA 4RAUA 2DJSA 5D71H 1E9OA 2V33A 1OT2A 3TN0C 1P2CB 1OO2A 1CF1A 2BWDA 2NLJB 4PV8B 4ZMZA 2EDXA 4HS3B 2F54D 2HYMA 3CH1A 3LPWA 2H4EA 3GBMH 3LY6A 5ESVA 3FQ4A 2WN2A 5DD0L 3EOYG 4XOAA 1LD9B 4JO3H 2J4WL 2XN0A 4MDJA 4GKNA 1DJYA 3K2MC 5T3ZD 1OK8A 1AZRA 1CICC 3LN4A 4OLUH 4M6ML 1D5XB 1CVRA 2X0WA 1PF3A 5I6PA 3DVIA 1GJWA 3Q8EA 1SXBA 3BUDA 4KX8A 3B2UD 2PYEE 4G59C 3O9WD 4MDIB 2FWUA 4NQTA 2JV6A 4G9DB 3SDCB 4HC1H 4JFQB 2YUXA 1T0MB 1GXEA 4I0PD 4M6NH 1D2PA 5DK0A 5B1AB 2NR6A 4PSPA 2AABL 5F6HI 1AG0A 1CT8B 3K1KC 3EXJA 1QSFA 3T77A 1VFUA 2OLDA 4LK4A 3TC9A 5K9JH 1YQVL 5IR1B 5CD3A 2I27N 2WXIA 2F8XC 3CFDB 5JPNA 3A67H 4IRJC 4DW2H 1IEHA 2GIXA 1HEZB 3S2CA 1BVLB 2KZKA 4NKIL 3UAJC 5J1AB 1WLHA 1UA3A 3PJNA 2BVQB 4LKCB 4Z7VF 2LW3A 1SUHA 3S4SG 3C09C 3FTUA 4DFHA 1IVLA 1CVSC 2YC1A 2JJUA 4LLYB 2Y6SC 4DP1X 2DV6A 5KS9B 4GEJA 4TLKA 2GIYA 3BZ4B 4ERSH 2ZZUT 3HHSA 3U4KA 5FHAH 1DVQA 3ILQD 1AG6A 2Y3AA 3DYMA 3FTSA 4XMZA 1D7FA 1WF5A 3MDJA 3O3DB 4NXKA 5CIPA 3OKNA 1E40A 4PJCF 5I66B 2WSKA 1T0NB 1XTLA 3MUGB 5E8NB 3UZQA 3ZQXA 5IESL 3PP3H 1T7ZA 2IPTH 4YSCA 3O6FB 4DGVH 3WOVA 4W9JC 3L3OC 2JF1A 3IJSB 3QIUA 3ENEA 1TZIA 4BRVA 4FXLA 3LH8A 4LAQL 1M71B 1Z5YD 4JO2L 3KL3A 4KH9A 3U0PB 2I9LA 1JPSL 3GBNH 3W11D 2J88L 5IG7A 1HJBC 4P8QA 5GGTH 1MCSA 1ZDQA 2EKSA 1KEMH 3GWJA 1XZWA 2B77A 1L3NA 4AGLA 2I9TB 1QPXA 2E6QA 2JJSC 5CNHA 5DUJA 3EH3B 5HHPA 1UB6A 2YGOA 5C0BA 1F3RB 4JG9A 3QG6A 1B4RA 5CSZA 4JFPB 1JG9A 3IXTA 1GGCL 2CHDA 5A16B 4UTAA 1N68A 4M4PA 2V2XA 2PTVA 2FQEA 2VLJB 1JWUA 1FCCA 2FECL 3IS0X 5IGXL 5GHWH 2AJ3A 2VISB 1GPOH 2FB4L 3BLPX 2X6UA 1QYGL 2ZCLL 3LAFA 3RGVB 3QUYC 2WB1A 1C8PA 3OJDB 2JB6A 3G5YB 3GMOA 4WU5B 5ICXA 3TEXA 1Q9OB 4DF9A 1NCUA 1O0VA 1XEDA 1AIZA 3N41F 5MENA 2IH1A 1BAWA 4XCFH 3B8YA 1AKPA 3IU4L 1G7QA 3PNRB 1WS7A 2A9NH 5JNYA 3OB0K 3LRHA 1DE4B 1SF5A 5C08A 4DOHB 3AT0A 3IMBA 4X83A 3DBSA 3QEUB 4HLZG 5AD0B 1NEZG 3KH4A 1UENA 3G6AA 4O2CB 2EO9A 3L6FA 2IF7A 2FJUB 3ZKMD 4BK4A 3V0VB 2CO4A 5INCA 3QFJB 5GSRB 5JXAH 4BZ1L 3VSUA 2Q0ZX 1YEGL 1NGZB 3FCTA 4GAJL 4Z7OE 2HMID 3CVCA 4PJIA 1BVKB 3ET9F 2B4CC 1H8SA 4U6XA 5IUCA 3RI5F 4ADIA 2VDLH 2XNAB 4RGMC 4F80A 4OI8A 2XN9B 4QHKI 4XCNA 3LPPA 3ZKSD 4OZFA 2X4RB 1PKOA 4ZMQA 1PZ2A 2D31A 4D9RD 5T1KB 1FH2A 4XC3H 1KCSH 2R2HB 2ZYHA 1ICTA 4Q2ZB 2PETA 1GIGL 2OL3B 4MCNA 5D5ME 5E1AA 4N2GA 4GIOA 2R69L 3TASA 2LTQC 3MV8E 4EI5B 1MW2A 1XCXA 4PY7A 4TOYL 3RPIB 4DP0X 3GBDA 3FU7A 4BFRA 1IAMA 1FZMB 1QR4A 1IFHH 4JPWH 3MRGA 3W38A 4JPVH 3LD8B 3MCLL 2QSQA 5LCVL 5C0JA 1Y6NR 4KRMB 5BOZG 4YDZA 3QQ3A 1OT4A 2BSDA 2RAMA 4LARL 4HA1A 1TJGL 3MO1B 4GSXA 3BMVA 2FSEA 2W07A 4FOMA 5TF1L 2M83A 5IQMA 1A65A 2CBQA 3GM0A 5IVOA 2Z0BA 2NCEA 2ZG1A 4NQCA 1JXKA 3OZLA 3QIWA 5KZCD 3MA7B 4HCIA 2XZCH 3H7BB 4PRHB 5C0RL 5I8KL 1U8CA 1B0RB 1YPZA 3VGEA 5DJ6B 4NI6A 1ECYA 3KCPB 4AZ8B 3ARDB 2VTFA 3MLPA 3P2TA 4YVUA 1JHTA 2F19H 4MAYD 1HSAA 2X38A 2XTJE 3QEQE 2D7PA 2CM6A 1HIML 1DO6A 2XPGA 4TUJA 4CJ1A 4FNPA 1OOAA 4FMKA 4JFZH 1A8ZA 3FMGH 4LCIL 3EYFB 3T6QC 5JW5B 4F5CE 4TXVB 3EYSL 5GRJL 1CGSL 3HS0B 2YOAA 4HLZH 4LLMA 5DMIL 5GRZA 1IFGA 2UY6B 5BS0D 3I9GL 3D52A 2VDPB 3MXVL 3GIVA 2EYRA 1E28B 5DJ2A 2F58H 4D0BA 3LDBC 4LOFA 2OK0L 1IM3D 1KFGA 2PPAA