1OE3A

Atomic resolution structure of 'half apo' nir
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 93
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe3A02
1TKWA 3N55A 3PCYA 4PCYA 1ILSA 1EZLA 4A2DA 4G72B 1ET8A 1CC3A 1KBVA 3OM3B 2XUWA 4A2HA 2IDFA 1KV7A 3FQYA 1OV8A 2HZHA 5D4IA 3NSDA 1GS6X 2QDVA 2XV0A 1GS7A 1M9WA 2XU9A 4HCIA 3SBQA 2B08A 1E5ZA 1OF0A 1M56B 3KW8A 1JERA 1AS7A 2DYSB 1SDDA 1J5DA 2MTAA 1JXDA 2FWLB 4N4YB 3FQ2A 1PZBA 1BEXA 1FWXA 4NAJA 1OE3A 1OCZB 1AZBA 4DP9X 3AZUA 1ID2A 1JVLA 3D12B 1QLEB 2BWDA 2XWZA 1N68A 2PP8A 1BXVA 2TSBA 5TK4A 3NSCA 1A4BA 2TSAA 1JOIA 1ZIAA 2X87A 2VN3A 1JZJA 3QQXA 1OCCB 3T6XA 4AKPA 5B7FA 3WKPA 4BXSV 3PAUA 2QDWA 2IWEA 1KCBA 6PAZA 3H4HA 1NPNA 3NP4A 2XX1A 3T6VA 3QJSB 1BXUA 2BP0B 2J57A 5F7BA 4HZ1A 3DIVA 2RACA 1MZZA 1X9RA 2P80A 3NJKA 2BWIA 2EIJB 1IC0A 1L9SA 3FPXA 4E9TA 2PCYA 3PAVA 4BWUA 1WA0X 1A3ZA 1MZYA 1GSKA 3T6WA 3AG1B 2H3XC 2XXFA 5B1KA 3GYRA 1GW0A 2AVFA 1CYWA 1TEFA 2AZUA 3TU6A 4EF3A 5ANHA 8PAZA 2XXGA 4F2FA 4KNUA 1V55B 3FT0A 4L0PB 2CBPA 3X2QB 3WG7B 2Q5BA 4A66A 4YSAA 5I6PA 2UXVA 4KOBA 2IAAC 2HX8A 4NB7A 4BDVA 1PLBA 1RCYA 2W88A 3S3CB 3S8GB 5IY5B 1ZPUA 2IWKA 1ETJA 1ADWA 1NDTA 4G70B 3OMNB 1XB6A 2CAKA 3WNJA 2LLNA 5B1JA 4A2FA 2FT8A 3EH4B 3X1GA 1IBZA 1W8EA 4E9QA 3IN0A 3FPYA 3OMAB 1J9TA 3TBBA 2CJ3A 3ABKB 3T71A 1ASPA 1AANA 3FQ1A 3X1NA 2B3IA 2IDQA 2IH9A 1PMYA 2YAQA 2FQEA 3H4FA 4QLWA 2DV6A 5AFAA 3JTBA 1GY2A 1SNRA 1VLXA 4Q89A 1KCWA 1AS8A 4KNSA 2PLTA 7PCYA 4RH4A 2PCFA 2YAEA 3PXLA 5B7EA 3FSZA 4A67A 1A8ZA 2UX7A 3TASA 2GHZA 1AS6A 1V54B 2ZWNA 1PNDA 4WKXA 2OV0A 2H5UA 2HX7A 3NJHA 4FA7B 2YAMA 1B3IA 4YSOA 1OCRB 5I6LA 2UXFA 1E30A 1NIDA 4MFHA 1F56A 1BXAA 1NIBA 3ASOB 3AG2B 2J56A 1GR7A 3EH3B 3X1FA 3CZUB 3S8FB 1BQRA 1NIEA 3AY2A 3AG4B 1JZEA 2PP9A 2VSKB 4YSEA 1AG0A 2FJSA 5AZUA 2IDSA 1RKRA 3CDZA 1E5YA 3FU9A 3OD3A 4NERA 9PCYA 1SDDB 2VM4A 3C75A 5B1BB 3NJLA 1W6WA 3CDZB 1AZCA 1CURA 4G7QB 3FSVA 1A4AA 1PY0A 1KDIA 1V10A 2IH8A 1NINA 2BZCA 3HB3B 3BVDB 1NWPA 1KYAA 3ABGA 4PAZA 3UAEA 3OQRA 1SHXA 1MG3C 1WAEA 2FT6A 1DZ0A 1NIAA 2NRDA 3WIAA 4DP4X 5EHFA 1OE2A 3MBWB 3S3DB 1PZCA 1XB3A 1SF3A 1PCSA 2PP7A 2QT6A 3ABMB 4E9SA 1ZDQA 4K9JA 1PF3A 4YSQA 1BYPA 4G7SB 1NIFA 1ZV2A 2PPAA 2E86A 4ZK8A 2YARA 1BAWA 1RZPA 4AZUA 4A2GA 2BP0A 4Q8BA 2BO0A 1SFHA 1ASQA 2EINB 1KGYE 1I53A 4AKQA 4AX3A 1GY1A 2IDUA 3UADA 3NJMA 4FAAB 4F2EA 4A68A 1WS7A 2EIMB 2P80D 3ZIYA 1ZIBA 4YSSA 2Y1AA 1IUZA 1PLCA 4GY4A 3UGEA 2ZXWB 3NJFA 2FTAA 3PAZA 1AAJA 1WA2X 3HEIB 5I5MA 3BQVA 4BWWA 1NTDA 2FT7A 4YSTA 3TA4D 1OOWA 3X1EA 2QPEB 5FC9A 3T9WA 3UACA 3FSWA 3UAAA 1AZUA 4GYBA 5F7AA 2GI0A 2XVBA 4DPCX 4G71B 1ZDSA 4KOCA 5B1AB 5PCYA 4YSRA 2GBAA 1AOZA 2Q9OA 4AKOA 5E9NA 5D4HA 1AR1B 4YVUA 2DY2A 4YSUA 3ZBMA 3FU7A 1J5CA 4QKTA 4JHVA 3NSFA 4DP0X 1N70A 3OMIB 1JXFA 1L9RA 2CCWA 3DKHA 1SHWA 1UATA 2YXVA 2WO2B 4GXFA 3T6ZA 4BDVB 2VSMB 1AZRA 2BP8B 5I6NA 2DWSA 1NZRA 2HRGA 4M3HA 4DP2X 4F7KA 3FU7B 4DP6X 1CUOA 1HAUA 2GC7C 1JZHA 2R7EB 5I5IA 4A2EA 3G5WA 3NSYA 1PLAA 1QHQA 2UXGA 4DP7X 1IBYA 3ABLB 4AI7A 1L9OA 1ET5A 3SBPA 1WA1X 2PPFA 2JXMA 3NT0A 1MDAA 1A65A 3DTUB 3EF4A 3NJJA 4HCGA 4BK5C 2UX6A 1CYXA 2JKWA 2XV2A 3QJRB 3ERXA 4KO7A 1SFDA 2JFCA 4E9WA 1QNIA 2YQBA 1XB8A 3CVCA 3GXUB 1KDJA 3UABA 3CVDA 4ENZA 4DPBX 1AACA 4HHWA 3X1BA 3EH5B 4DP5X 4E9RA 1GS8A 1JZGA 3SQRA 2FQDA 2BZ7A 3IEAA 5D4JA 3MX0B 2YXWA 3FYEB 3QPKA 3AG3B 3KW7A 2YAPA 3IBOA 4YSCA 4KO9A 2DWTA 2GSMB 4UAHA 1AQ8A 1L9TA 5B7MA 1KBWA 1A4CA 3L45A 3CG8A 2Y69B 1L9QA 3ZDWA 2IWFA 2WO3B 4HHGA 3WNIA 3PPSA 3QJTB 3QJVB 4BWTA 2I7SA 1XMEB 4HAKA 3EHBB 2BHFA 5I5JA 6PCYA 2I7OA 1AG6A 1T5KA 3SBRA 2VMJA 2I85A 2PPEA 2EILB 3N2JA 1ET7A 2XYBA 4UF7C 2VW7A 2ZONA 5I26A 2OJ1A 1FFTB 1RZQA 3ASNB 2WSDA 5PAZA 2CUAA 1X9UA 1NPJA 4DP8X 1BYOA 1TU2A 1YLBB 5I6KA 1IKOP 1NWOA 2ZOOA 3IN2A 4UANA 3IE9A 3QJUB 2HLEB 3NJIA 3AW5A 3FSAA 1J9SA 2J55A 2BW5A 1JZIA 1OCOB 4P5RA 1HFUA 1FA4A 2GB2A 3FS9A 3QJQB 2YAOA 4JKNA 2X88A 4DPAX 2HXAA 1W6LA 2CALA 4YL4A 3H56A 5TK2A 4HCFA 1MG2C 2HX9A 2FQFA 1BQKA 2J5WA 1URIA 3CVBA 2QPDB 1PNCA 3NP3A 4E9XA 1WS8A 2IDTA 4HIPA 2YAHA 3ZX1A 2EIKB 4KO5A 4GP8B 1PAZA 2PPDA 4E9VA 4E9YA 5B3SB 2A3TA 2XX0A 3NJGA 1JXGA 1J9QA 4DP1X 2W8CA 2VM3A 4M4RB 4CSZA 2HRHA 3FYIB 5I6OA 2AFNA 2YAFA 4WTQA 3TBCA 1SJMA 1ASOA 3U25A 1DYZA 2UXTA 1EHKB 1AZNA 1GYCA 1HAWA 5A7EA 4KNTA 2GIMA 1J9RA 1E65A 5I28A 4TXVB 4W1TA 4GP4B 4CSPA 4N8UA 2XLLA 4HALA 1R1CA 3V9CA 1AIZA 1BQ5A 4GP5B 1SF5A 1ILUA 1M57B 3GDCA 1L9PA 1TEGA 5B1JC 4G7RB 1E67A 2AANA 4KO6A 4JHUA 2XV3A 2VW4A 2FQGA 3WKQA 2PPCA 3PLYA 4YVNA 1JZFA 5LDUA 4BXVA 2GC4C 2H47C 1JVOA 3JT2A 2OCCB 4YSPA 5AKRA 2AZAA 2FNWA 1PZAA 3RYMA 2DYRB 3FU8A 7PAZA 4X4KA 3WI9A 5I6MA 3NYKA 4W9ZA 4YSDA 2MRYA 1OE1A 2BP8A 1NICA 4P5SA 2VW6A 2BW4A 3V9EA 3NJNA 2N0MA 3S3BB 2R7EA
chains in the Genus database with same CATH superfamily
3ARFA 2NR6A 1JXKA 5JQ6H 1JPFA 4YLBA 3ZDZE 1BMWA 5FOBB 5DRWB 3PJNA 3P9MB 3O2DA 4JHZA 1IE5A 1W0WB 2YRZA 1QSEE 3K8KA 4Z7QB 5G4MA 3RU8H 4M8QA 3KM2A 5AZEH 4LGRB 3ARPA 4YIQA 3TH3T 4W9CC 3ELAT 3OKNB 3FT4B 1E8YA 4ZO7A 2FEEI 1TXKA 4M93B 3K1KC 1IFHL 3KW8A 3TV3H 3BIKA 5C0IB 5A2CA 4RMBA 1I8AA 3KJ6L 2DD8L 4D2NA 2LFGA 1A4JB 1G7PB 2YD9A 5FYLD 1RZ8B 3TBSA 3U2SA 4HOWA 1PTZA 4MDRA 3ME0B 4YDIH 1X5JA 3T0EE 3WO3B 4D9QE 4HP5A 3S0PA 1QATA 4OCXH 3GXDA 3D85B 4NAJA 5CHNA 1IM3D 1IZJA 1HILB 4XMLL 3FUDA 4DGUA 3VXTB 1ID2A 2O5ZL 3T0EB 4PJIB 1TYRA 1D5MA 1KV3A 3K6DA 3UIZA 4XNDA 1QLEB 1I1AC 2R56H 1J0JA 1N68A 2CGRH 1NGQH 4P57B 4XOCA 2O5NA 1UXLA 2VO5A 2WKOA 1ZTXH 5CMAB 4BZ1A 3O2WL 5D7LA 2I32A 4U0QB 1G9MH 4WIQA 4A6YH 2F8VA 4YXKL 4JE0A 2BK8A 3F8UB 3NP4A 4M1DH 1BXUA 4QRPD 4UNVA 4KJPD 4JG1L 5TDNA 4NO0B 2Q10A 1JNJA 3DUUA 2VR8A 2NY2C 4ONHB 3MU3A 4E9TA 3LS5L 3QCVL 5IHBA 4MX7B 1NAKH 2FX7H 4G6JH 1IT9H 4A38A 2DQEH 1FN4B 3WCYA 1MZYA 1FRGL 4OSUH 1C5DA 2VXSH 3O9WC 2HCZX 2DZEA 3T3MB 3RUGB 4PLKD 3C5ZC 1I4FB 5EUOF 2Z7YA 1TCRA 1BZ8A 4IU3B 1INDH 4ODXB 4YDZA 3RX9A 5KTEL 5IKCA 5CZRA 2VUKA 3VSVA 4NZTL 2CDFA 1NFDE 2EH8H 3V5HB 4NEHB 4JZOA 2AJ3B 3VB8A 1SXBA 2OTUB 1G1OA 1ZPUA 3HMXH 5BV7L 1GGBH 3B9KB 2OP4L 4JFUA 2RTTA 4D9RD 3CSYA 3GSOA 2BVPB 3V0EA 2YGVA 3SY6A 5DQDL 3II2A 2K78A 2IWGA 4LCWE 2CUHA 3QZWB 1QBML 3RZCB 2NY4C 2W0KA 1PX8A 5FW8A 3BO8A 3U2JA 4W9HC 2NLJB 3JV5A 4Q89A 1M42A 4LU5H 5I9QB 4PYHA 4DIXA 3LD8C 4LEOB 2JTDA 3FHQA 2R69L 3LEVL 4FXKA 1N12A 4DAGH 4MJIA 3CAFA 4LLQA 4QHLA 4PJFA 1IC7H 3PU7A 2GHZA 3GMPB 2J21A 2X09A 1G7QA 2F15A 2WK2A 3VB9A 3MA7A 2EYRB 3MUGB 5HVFB 1WF5A 3L4VA 4D9QD 2IO5A 4G9DB 3TEZA 4N2HA 4OCXL 3A4EA 3NIDB 1OGAD 2R15A 3OSVA 4GSUA 4I7ZC 3BN9C 4YZFF 5AG8A 1MHCA 5DHEA 5KYNA 1XHHA 3TWCL 2QZQA 2R4SL 2RH0A 3H9HB 2XQYK 3I9PA 1RK7A 4XCNA 2H8PB 3X14B 5EBGA 3ZUCA 2WXLA 3MLUL 5HHQA 4H8HA 5F9JA 5ALCH 4LEOA 3PABA 2AW2A 4BSWA 5F97E 2IDSA 1BVLB 3CFEB 2BOBA 4XPTL 3ATAA 1R3IL 3M45A 3UJTH 4UU9B 3L1OL 1NAMA 3V52L 1KY6A 4FXTA 1F4YH 3L7EA 2N56A 4CN4A 3BAXA 3CDGB 5SX4I 3ARSA 4JX0A 2D73A 4AV4A 4QF1A 3MO1B 3KLSA 1KXTB 1B9ZA 4NN6C 1QQDA 3LZFH 3MRLB 2OTWA 4IGBC 4ELMA 3FH7A 5DK0B 2CIIA 4QHMB 2EYTA 1A7RH 1Q90A 4TRPH 1B6UA 2ZWSA 3D1MC 3NEEA 4HU2A 5F1SA 1L7IH 5FW6A 3QWRD 2X2YA 1CFVL 2A9MH 2OMNA 3PGCA 3IDNB 1ZRUA 3IAGC 2NNCA 2IGFH 1OGAB 3II1A 5F3HA 4A39A 1L3WA 5B38A 1UG9A 2GKIA 4P46B 5HJBA 4Z5RA 1MJUH 4B97A 2OJZH 5LCVA 3FRPB 4GRWE 8FABB 1XR8B 5ERWA 4EJ1C 1H9VA 2NX5A 1X9QA 4A7GF 1U91A 3Q43A 4PJDA 3ZIYA 5I76B 4YBQD 1KG0A 4GY4A 4NPYA 1R3HA 3BC9A 5HDWA 5I73C 4NO2B 3J2PA 3HG1E 3IMRA 4ZNEA 1IVLA 5IB3B 3PAZA 3PY9A 5I5MA 5ICUA 2GT9B 5BO1L 5K9JH 2XIBA 2NUTA 5J5EA 4AEIH 1UQSA 2ZKMX 4ACTA 3C60A 1IC4H 4MA3B 4GXVH 3QJXA 3ARBB 5KYYA 2VDPL 1MLBA 1ZDSA 4DW2L 1RUPL 3UTZA 5AVXB 4JB9L 3K72A 3CLFH 4J28A 3ZYIA 3ZZLA 4YVUA 5MHSD 3MJ8B 1FO0H 2HT2C 4YSUA 1CI3M 1IC5L 1LO2L 3NSFA 2FGWH 4K9EH 2XPGA 4Y8DC 4X4YA 4JPKL 4FG4A 4HBCL 4X6DE 3T6ZA 2BIIA 3TC9A 3VVWA 4O4YH 2G0KA 4GG8A 5T1DL 1OF2B 1WD8A 2P5WB 1QSEA 1OAXH 2EDTA 3BGFC 3GGWB 3KGTA 4J3VA 3RUGF 1DQLL 2X6BA 2EUVA 5FHAH 5EU4A 1Q0XL 5CCHE 4RWYH 5DTFB 2A9NL 1TYEB 3MRKA 4NBZB 3GUFA 3RVWD 2UXGA 4P9ML 3LV3A 2E5EA 3IWUA 5DEJA 5EF3A 1B3JA 3ZT6A 3DIDA 4KY2A 3ECWA 1B4TA 2MPAH 4QYOA 5IHZB 1GZPA 1IFHH 4GQRA 1NKRA 2W60B 3G5YB 4AUUA 4JEGB 4XVTH 2EUZA 4D0BB 3P11L 2YMTA 1ZLUH 3K71A 5T3XD 1I3GL 1RHHA 1GZQB 5C0AD 3ZJAA 2UZXA 3U1SL 4F20A 3WTUA 2DI8A 4FLSA 4R0LA 8FABA 1OAZH 3FRPA 5LWYH 4JFZL 4DEWA 4GUCA 5LCVH 3VD1A 4PD4J 2NX5E 4AV0A 2NW2B 1GYUA 5IESH 4KK8D 1A6PA 4XMWA 4G8FA 1IGTA 2DWTA 2PYEE 3IBEA 4FFYL 1XF5A 1UM4H 2XIIA 3GF8A 4XBPB 1AQ8A 4HF5H 2ED6A 5D8JL 5IQ9A 3CSBA 5JOPD 3CPUA 3CX5K 4M3JA 3WO4C 1RZIB 1EZVX 4TNEA 4YDJA 3UC0L 3EHBB 1HL9A 4KXCA 3HN5A 4QD2E 4U6TA 1PSKL 3WY4A 1S7QB 2IANB 5AAPA 3O8XB 5HPMA 3CFCH 2VR9A 4ALAL 3FB5A 2K9UA 5PAZA 4Z3JA 4QUOA 5HHME 1K3ZA 1S9XB 1JBJA 4FKKA 4PRIB 3VYPA 4XE0A 2E7CA 2BNQD 5D1XE 3SDXE 3IN2A 3NZHL 4JDTH 4XXDB 3SDAC 2EIBA 3TO2A 4F7CA 4HV8A 1IBHA 3GJEA 3ROOB 1X5IA 4IBTA 2O5XL 3HI1B 5J1AA 4WW1B 3EYVA 2NSQA 5AUMA 2O6FA 1CG9A 1KCUL 2QR0A 1DQVA 4C56E 5E1GA 1TFHA 2OMUB 4NO0A 2OQJA 5I17A 4LVOB 1RZ7H 4U6HA 4N0UE 3G6JA 4JM4H 5DJCA 3S2CA 1CFQA 3DYMA 5D6CB 4GSXA 1O9WA 1U8IB 2R9HD 1KEGL 1A21A 2BSTB 1F45A 1MG2C 2HX9A 1PVHA 3G9AB 1PZSA 2FECL 3SD2A 4A1RA 5IMKA 2YAHA 4YPGB 4P9HC 2Y9RT 3NJVA 2DQEL 1EJ8A 2J8UA 2W9EH 4HIQA 3O8XD 5FYJD 1CK0H 3GBLA 4X0NA 1KGUA 4UIKL 3V10A 3BE1H 5F7YC 5HTSA 1R3KB 4B9IA 1C8PA 1HHKA 4PWIA 4AJYV 3QXDA 1RZ8A 4LQ1A 3TBTA 3U25A 1N5YL 1MAKA 1A4JA 1SEQL 1RQ5A 4HJIA 2AJYH 4KDTC 1NGZB 1UXMA 4TTGA 1JGEA 1AO7B 3IWVA 1J18A 5I28A 1ZD6A 3WTTA 3DX8B 4Z95H 4H25A 4FNSA 4NS0A 1NGXA 5J13C 3SGEH 4U7KA 4PWGA 2FEDC 1IGCL 4K4KA 4N8UA 4WK2B 3EJJX 3ZR5A 3GKZA 5DJCB 1MPAL 4X7SH 5D1XC 4HHAB 1JGUH 5TDPB 4I0CC 2BSRA 3I75A 5GGRY 3FO2B 5J1AB 5SWSD 3ZOAA 3ZT5A 3VE0B 2HMID 4TULH 3Q8BA 1NSNL 1GMIA 4JQXA 4X5QA 4UB0H 1E5CA 4U1KA 1T89C 2PPCA 2YXFA 3L8QA 3HG4A 2L3BA 4D9LH 2LVEA 4FNUA 1CDCA 3DO7B 1JVOA 4JLRA 5L4IA 1JDAA 1RPQA 3EYQD 2FNWA 3RYMA 3L3OB 3F5WB 4OLWH 4W9IC 5DFVC 1HCZA 4FTVE 4RZCA 3TNMA 1AYRA 3TEXA 2ZJSH 1JYWA 1NGWB 4HUNB 3GFUA 4KGJA 3BAIA 4U1IB 1V7MH 1RZKC 3L4YA 2N0MA 2W0FA 2VLJE 2LLLA 3NCJH 3EW3B 2VDQH 2X70A 4ENED 4OIAA 3NIFE 3GPEA 5I9QC 2F54E 3WS3A 4A2DA 4XNQB 3FOMB 3BDYH 5FDYA 1ET8A 2LLGA 1KBVA 2AQ1A 3SDCC 4A2HA 1TDQA 4L3CB 2GK0B 3MRQA 1O7DC 3LIZA 3LD8B 4LLWB 2NQCA 1OV8A 3RWGA 4PW4A 4C4KO 2QSVA 2ZAHA 4BD4A 2XU9A 4GI6A 4PVNA 5KS9A 3CMOH 3WS6A 1OF0A 5EN2B 2Y3AA 1AS7A 4N2KA 2F8OA 1A6ZB 4MXVF 5TE7H 1TVDA 3DDGA 1NCIA 4OZGB 4XHJD 1EDYA 4FRWA 1WIOA 1I7UB 1CDGA 1MIMH 4PJ7E 2XBZA 1U8MA 4MB1A 1JN6B 1G7IB 1RHFA 4K15A 4HWBA 1K85A 1JVLA 5C0FB 3OKEB 5E8NB 3MV9E 1PKQE 4DERA 3FL7A 3GLEA 4U33A 3WFDH 1DDTA 1OQOA 1CGYA 1J11A 3QJHB 4ZX5A 1LLAA 5JIMA 1PAMA 1PZ2A 4P3CL 4TMPA 1ITBB 4I48B 3QNYB 3AXIA 1JV2B 5KJ7E 3HI6L 5LNDA 3OSKA 3IKKA 2VH5H 3CQPA 4PJ5E 5CBAA 2HLFD 3MV9A 2P80A 4QNPF 1UUSA 2H7WA 3H7BB 4JPWH 4XAKD 3T1FA 4NAQA 3V0DA 4HMCA 1G6RA 1SYVA 4GW1A 1GJWA 4NQDA 3UAFA 1NCTA 1WICA 4LOFA 4XNUH 4CADA 4WWOA 3PAVA 1O6SB 4PIBA 2OYMA 4H0LC 3TPKA 1QFWI 2V7NA 4GSDH 3SE6A 4GOSA 4P2RE 4KRLB 2PTTB 4GKZB 2XN9B 4OGXL 35C8L 4E42B 3GBMH 3FQUB 3RL2A 4F7MA 3V6FA 3TU6A 3GIZH 1LDPH 2NY5L 1R75A 3UH8A 1MCFA 1Q0EA 3P4OA 4GRWB 4RNRA 3GJFB 1VAHA 2JB5L 4WENB 3QDGD 3ETBF 4U1MB 1F90L 5FWQA 4AQ8C 4ORZC 4LFHD 4TVUA 4LVOC 4WWID 2N59A 4BFKA 4KOBA 4NI6A 1QW9A 2OBGA 2OR7A 1G0YR 2YGPA 4BRJA 1BX2A 1E27A 4OM1H 4LHJB 1UWYA 1ADWA 4BKLB 3CGTA 3VUAA 1JVKA 5TE4H 1H3PH 1HWWA 3IN0A 4YGVA 2P46B 4KKCC 4PJBF 5C0JB 3MJ7B 3X1NA 5FDWB 5DVLA 2DM4A 4EI5C 5CEZD 3KGSA 3QWNA 1Y1DA 2C8NA 4XT1C 3PXHA 3DO4A 4EOWH 4OVUA 1PU0A 2IXQA 3HG2A 1P6WA 4A7VA 1JD7A 5D4QA 4OFDA 4I9WD 4DZBB 1TENA 2V9QA 1KCWA 4TNWK 2CLZA 4K7FB 2BVOA 5EFIB 4KX8A 5EC2B 5BUGA 4M5ZL 1FG9C 4F27A 1GC1L 4EUPH 4FI7A 3MLVL 5D55A 4ONOA 1JWSA 4FNLL 1MRCH 4PJ7F 5SWSB 1T03H 3CVHL 3P11H 2Q7YB 3EGDA 4KZCA 2BIMA 1U3HB 1X5XA 4F8PA 1LK2B 1MW2A 2ARWA 3QNYA 4YHLL 4I48A 2J8UF 1FI8C 4X6FB 4IRSD 3NJHA 2W95A 2APVA 4YN3A 1N5AA 3KCPB 1JUFA 3MMEB 1UWFA 3RG1C 3V5KB 2DQCH 1T0OA 4P0DA 5TF0A 3F04A 2FX9L 3UBXA 3RPIB 4Q9RL 4EVNB 3TNNB 4HJUA 2Y7NA 2YD6A 2F8IA 5GGQH 4MB4A 1GTFA 2DPKA 5E2UL 4CDHA 1G5AA 4EO5A 2QADB 5C07B 1B4JL 4HIJA 4QWWD 3FO0H 4POUB 3DNKA 3UTTB 4AE1A 4ELME 5ADOL 5C2BH 1VFBA 3H9HA 5LDSA 3C12A 1L3NA 2YHGA 5FA3A 2QSQA 1LE9B 5I19L 1SBBA 3GD1C 5FM5M 4ZTEA 1L0XA 3HZVA 1CURA 4PJ5D 4UM9D 1JZ8A 4QJ4B 3FSVA 2DJMA 1JS4A 4EIZC 4TSAL 1ZLDA 1YPZF 5DZVA 5ENWA 4G8IB 5IM7A 4OKVA 3L3GA 3QUZA 1BVNT 4Z7OB 4MKMA 1H8LA 4U7MA 3F84A 4LCIL 4E41D 1EHLH 1DZ0A 2Z34A 3OMZA 4RMUA 3OKDA 4S0TD 2ENSA 4PRHA 4XP5H 3S5LA 1OGSA 4AQ8A 3QXVA 4F8QA 1XB3A 4ZFFA 1E9OA 1PCSA 2AXFA 4ZXBD 3RY6C 1CGUA 2ZWZA 1P4LA 2H8PA 2XIDA 2ZD0A 5AOMA 3BUYA 2ENJA 3FUNA 2K4WA 4RMSA 2G3NA 4B9ZA 2YARA 4HSQA 4OJDH 4X6BA 3GI9H 5K59F 3K4AA 4ZSOE 5HDBE 4RZCB 2PWFA 2WN2A 3F7LA 2Y07H 1K4DB 3IU3A 4BH8A 4BHUA 2ADFH 5KSBB 4MD4B 3EO9H 2ENYA 3NJMA 3SQOH 5T3XL 1M2VB 4F57H 3APFA 1Y7VA 1JZ7A 2QKIC 2M83A 1I7ZB 2GK2A 4N25A 4WFEE 1P0SE 2GJ6E 1TVHA 4OF8A 2IFFL 2NY0B 3RA7H 3U46A 3SDAB 3TA4D 1W72A 3BE1L 4WI0A 1UHVA 4HXAH 4JY6B 4W81A 2CHNA 3FO9B 1JFHA 5HHPB 3FFCA 5HJ3A 3UIYA 4KNQA 4WKZB 4GYBA 4S10A 5PCYA 4H4NA 3KYKL 4GRMA 5F89A 2Q7NA 4L8BB 3U9WA 1FYTD 3LQAL 4QO1B 1AR1B 2DY2A 1KLUB 2D3VA 3QUMA 1WQVT 3FU7A 2DJSA 3NABH 5T3XE 3G6DL 4OZIA 4NM8L 3HPLA 2R29H 3IDJB 3QDMA 4HKBB 5I1KL 3FMGL 5C0RL 4K71C 4KDTA 2DWSA 1AFVH 3V5HA 3AT9A 3T4AB 5BQ7B 3CHPA 3VXUA 2X28A 1DCEA 2QJDA 4YDVA 4C4KT 3HCVB 2R7EB 4BQBA 4A2EA 3R0NA 3V4PL 3FUEA 4JM2C 4YHML 2ZP9A 5IOKA 2Q8BH 2BNRB 2OMTA 4HBCH 1ZEAH 3A6BL 1HSBA 4EKJA 4ZS7H 3CU7A 5DT1L 1FZOA 3QUXD 5IJVA 4GO6B 4JO4H 4HFWA 1E50A 3LN4A 1Q72L 2WOBA 3EG9A 4QKXB 1ECYA 3HE6B 2BS8A 1MW1A 2VTFA 5HYIA 4PJBB 4J4PA 4DQOH 1K6QL 2BC4A 4APXB 2OQJB 1UD5A 4YE0A 3UABA 1BZOA 3DSNB 4DPBX 1TZAA 1ZMYA 4X9BA 3X1BA 3ZDZB 5JQHC 3SY0B 5LJYH 2E8ZA 1KLGA 5F7WC 3AREB 5L8JB 1VEMA 5D7LE 1EAPA 3VJ6B 2VZSA 4JRXB 1YMHA 2CLVA 3DHUA 4U6VH 1XH1A 5EEZA 4QY8B 1AD0A 1QBLH 4FHJA 4WW2C 4PJXB 5CGTA 1N4XL 4YSCA 3UTSE 5C0EA 3WTWA 1W0WA 4JZJB 1GGUA 4FEIA 4MA7H 1I8IA 4BUQA 2WBWB 1ULVA 2YEZA 3BAWA 2O6EA 3N5AA 4I2XA 1ODUA 2WO3B 3HZMB 3ISYA 2D0GA 1Q38A 1RULL 2Z92B 4MJ5B 3SYOA 2XC8A 4JFQA 2BHFA 5CF3A 2X4RB 1W72L 4WHTA 3SDXF 3EDEA 3FFCE 5CEYA 3TBSB 1YAZA 3QFJB 3WYRA 3U2SB 1QFWH 2AK4B 3OB0K 1G7PA 4B9FA 4ABUA 2YMXH 3QO0A 4XNUL 3CXHJ 4FLOA 3C60D 4B7IA 2OJ1A 5HHXL 1FFTB 2UWEB 5MEQA 4PJ9D 1MCWM 3WS6C 3CLWA 2X2HA 2MKWA 4WFED 4P06A 2C1PB 2CM5A 3C6LC 2H3NA 3D2UB 1G6RL 4R2GD 4W9LC 3F7VB 4AT6A 5ESVA 3MRJB 1YA5A 1KTRL 3GEWB 2H0FA 2BVYA 3LZPA 3CH1A 3IE9A 2VLJA 3FB6A 2NW2A 2WQVA 1VZIA 5I8OL 1VPOL 1ZXQA 2DL9A 1KYOK 3RX7A 4YE4H 3UAJD 5GHWH 4Z7AA 5IG7A 5KSAC 4Y19D 4I5BA 3CSGA 4O2CB 3CIQA 1X4YA 3FONB 3CZFA 2D7NA 1JDDA 3P9LB 1DJGA 3L5WA 1FFQA 3QJOA 3NEOA 1W6LA 4AIEA 3NRQA 1VGEL 2CA4A 3GSQA 3NGBC 2HWZL 2WQSA 1MCPL 3BCDA 4JM2A 2EE3A 2J5WA 4OZHF 5KSVA 1C16B 1Z0NA 3J07A 4QTFA 4ONGL 1SXZA 3RI5K 1ZHNB 3EH1A 3GXPA 4YHMH 3V8OA 1BZ9B 3VXRE 4AT6B 1IIKA 2A77H 2Q20A 1H6UA 1CLVA 2A99A 1G7JB 3CFDB 2DQDH 4KKRA 4MNQA 5E8OB 3MPCA 1FDLL 4KTEH 1FG2A 4PH8A 1CPUA 4ZFOL 1UGKA 3QO0B 1A3LL 3HKFA 3LNDA 3P2DA 3I6LD 3OWRA 5IF0A 3H9SE 1PZDA 4PJHA 5KEZA 3P1VA 1PEZA 4NN5B 1NKOA 2GJ6A 3MN8A 1P1VA 4IRZL 1U93A 4M7LH 2K7PA 2J1WA 3WEOA 2G5BA 4CSPA 4ZMTA 1WAAA 3QC5X 4JFPB 4ZFZA 1YQVL 2FUTA 2FL5B 1J0IA 4XNXH 5A16B 1QFWM 2F54D 4PD4K 1T1WA 5FO8A 1E2WA 3MYJB 4GMSH 5CP3H 2XT1B 4JRYD 3G5XA 4N0CC 2PWGA 3QFDA 1TPXB 4PPTA 3O4OC 4IMKC 3U7WL 3VFVA 3WFDL 2F61A 2F58H 5AEAA 5FO9B 4BXVA 3EYFB 3NFNB 4KI1A 1BA9A 1HHGB 4XCYA 1YHPA 1YUHB 4YBHA 3WGVB 3KPQB 4HDIA 4NUJB 1O6VA 3UZVA 3R06B 5HI5C 1BFOB 3KPLA 1NC2B 2CLRA 4LVEA 5C7XH 4Z7WA 1PZ5A 5GJSH 5C2UB 2MRYA 4XMUA 5KYXA 2VR7A 5SX5H 3QUHA 2DQCL 3B7UX 4FJ6A 3KPMB 4PRPD 1OT1A 1MCKA 4DKEL 1TKWA 1GGCL 4ZQKB 4IMKA 2OMVA 2Q0ZX 3O41B 3RVXC 3VRLF 1QX1A 2MQ0A 2BSRB 4FZEL 3SJVA 3WLBB 4L8CB 4HS3A 4XP6H 5LGJB 1NCCH 1LDPL 2NY5H 3N1PC 3OM3B 4RSYA 4FQXB 5IMMB 3LNIA 1U58A 3MNWB 4PJXE 3JV6A 2BNUA 5L8LB 3M1CA 4HEMA 4Y7MA 3BWUC 2LT9A 4MLIA 2B08A 5E56A 3V8CA 5D2LF 2D31B 5INDA 1MEXH 2GIYA 4Y16D 4NQXB 3T3PE 4PS4H 5A3ID 1KYUA 2C9XA 4PJEB 3SDYH 3UERA 4JFDD 2AMUA 2UUDK 4KHXH 4BCZA 4JVWA 2APWA 3WEXA 2DOCA 1CIUA 1Z9MA 1ZY9A 2IQ9H 2QADD 5ISZE 1S7WA 4NLHA 3U0WL 2GQHA 3LS5H 2D3JA 2EXSA 3LXAA 3QCVH 5EF2A 3SPVA 1D7BA 3V4VL 5BOJA 4U7SA 3VD7A 3H3PL 4KI5C 2IV9A 4HKXA 2XWJB 5T1LA 2VERA 3QQXA 4G9DA 4M5ZH 1RZFL 2BSTA 5HVGB 1A14H 5D6DC 3LEXB 4GBXD 2R0WH 1UJ3C 2DLGA 4IRZH 4M7LL 4WHCA 3MLSL 3QHFL 4XNMA 4LIQH 2XCMC 5F3BA 3ATEA 2WOYA 5E99L 1T5WA 4NLAA 2FYYB 3P3YA 2ZSWB 1JPSH 5SX5K 1XAUA 2E6PA 5F7EH 2L7JA 1QHPA 3TVMC 1T4KA 1L6ZA 5EO1B 1T89A 3RA7L 4PP2A 1SDAB 4NKOA 1QZNA 3IJYB 4EDWL 2LU7A 2UY7B 5HVHC 1DQQA 2APXA 4L8DB 1TEFA 5H8DA 4BE6A 3DXAE 4OFYD 3X11B 1QEWA 1TVBB 2XG4A 4BFIA 2H41A 3W2DH 2DLIA 1M71A 2H32B 3T09A 3I84A 2W94A 2Q5BA 3T0ED 3FTGB 2VDMH 5DJXB 5E00B 2ADIB 2KLRA 3IJ7A 4WFHE 2WHVA 3NESA 5C09D 1YEEL 3BUIA 3LAFA 3MNVB 2NSMA 4LL4A 4B95C 4ZZFA 3VDAA 4BZYA 5M94B 4G70B 3WNJA 4TTDD 4F5CA 2LLNA 4AGMA 5C9JA 5JPNC 4HPOL 1JWUA 5KBLA 4WGVB 1OB1B 3RVVC 1MWAL 4ZSOB 1J7VR 5HDBB 3KWUA 5FEBA 2ZCKH 1EO7A 3SHSA 1IC4L 1KTBA 2AEPH 3O81A 3R8BB 4RZKA 3BI9X 5GRUL 2ZXAA 3H9SA 4PS7A 5FUZL 3TWCH 3PWLA 5KBMA 2AXGB 4HWUA 2BCKB 1LEIA 2N7BA 2I25N 4L3FA 3IDMB 5E1IA 5EC1A 3BGMA 3CLEH 1X7TA 2CCVA 2NUPB 4P4RA 2X9XA 2X10A 3OKMB 4ZUWA 3S36X 4H0IA 1NMCB 3VH8A 4LP8A 4Y1TA 4OV5B 1T0PB 2L7QA 1W0VA 2WSKA 1N0LB 1ACYH 4MNHA 1OAXL 3MRPA 3TCTA 1D5ZB 3B6SB 3M86A 3IFLH 4L4VD 4MS8C 3PWVA 4ORGB 2CO7B 4ATWA 3JWNC 5I1EL 2AJSH 4WNSA 3DTXB 4LU5L 3GDBA 3DV4A 2XWTB 3AB0B 4NNXA 4N0UA 3S8FB 3OZLA 3WHE1 1XO8A 2AQQA 3AG4B 2OTPA 3EDJA 4J1UA 4X6EA 1VCBC 1NDMB 1T66C 1T5XA 5C0GB 1LYQA 2YS4A 4UZUA 2RQEA 4WTZA 4M29A 3FU6A 1W6WA 3Q2WA 3SGDH 3F64A 3PQYE 1G87A 3W81A 5CCGE 3K0WA 3CIAA 4UTCA 3S35X 1UEMA 2IH8A 1TQCC 4N1EA 3QIUB 5C2BL 2Q8AH 1QYGL 3NA9L 1YY8A 3C2SA 3L13A 5EA0H 3A0OA 1T7XA 2KUTA 3QDGA 1T04A 3QS3A 4WUKH 5IHUL 4OGYH 4Z0XA 4OVVA 1QUNA 4O58L 5AYUL 3GSNH 4PRDA 4X7DC 2HN7A 4FQ1H 3T0BA 2WWNA 2WLIA 3DECA 2SEBB 3RWEA 5BNXD 3GHBH 4Y4FB 3NCFB 5EOQL 4R8WH 5JPMC 4AQOA 2ARJQ 3S98A 2JKJA 4M8UA 1CL7L 3QEQD 3KYOA 1UOWA 4Y5XB 2B4CC 2BCKA 1LEIB 3QG6B 2AXGA 4RAVA 1G7HA 2FIRT 5JXAL 4MCZB 3ETSA 1HHHB 4JHWL 5IG7B 3UADA 1OP5K 5JORB 4QNPE 3VI4E 1V05A 3DTXA 2Z4QA 2V0AA 2X4UA 5E03A 1IL1A 5H4YA 2YA1A 3SN6N 4AYEC 3VMNA 4LNRB 4JKKA 2YJLA 1DZBA 2FT7A 1JN6A 1G7IA 1NMBL 1RJYB 1FYTE 2R2HA 3PYCA 3FSWA 3LB6C 1QBMH 3GXIA 2IV8A 4PI0A 3REVB 3UAAA 2V8LA 2R27A 1ONQB 1Z66A 4KOCA 1RZGA 4XWGH 1TJGH 3SE9H 3KDMA 2Q3ZA 3SKMB 4FL4B 4YHYB 1G43A 2CIKA 2MPAL 4PLNC 1JK8A 2EYSA 4JN1H 3BW9A 1HSAA 1WFNA 2YXVA 1AXSB 5F7DA 1MELA 1NEPA 1JPTL 5AZEL 4LBAA 4AEEA 3O3DA 4LKCB 4ODSH 3EH2A 5EIQA 1FNHA 3G5WA 4HIIA 5ID1A 1QHQA 5IW1A 4RETB 1MHEB 4ONFL 1ROCA 4OT1L 1WBXA 3INOA 3VWKD 2PCFB 3DBXB 5JLZB 1IEAA 1S7XA 2VQ1A 4PJBA 4CN1A 1C16A 4JDZA 2JKWA 3IFOB 4OZGF 3MUGA 3E1F1 1SVBA 3CDYA 3MRIA 2XG4B 5J11C 3B9EA 5LXGH 4N90D 3IJ8A 4DVBA 5A2FA 1NJ9B 1A7NL 5T1KA 4H8UA 1Z5YD 3ULSA 2E0PA 4PJFB 3UTPE 5DZAA 4PJ8D 3ZKMC 5GJSL 1U3YA 2VABA 4O2EA 4RWYL 4WNQA 5DMIH 3D07A 4M7LT 1QWHA 2BIOA 3MXVL 1KELL 1I31A 4KTYA 3DUSB 2P43B 2X44D 3BKYL 4ZMQA 2YAPA 4S1QL 3I9GL 5GS0C 2ADJB 1TPXC 4UT9H 4BQ6A 3HA0A 2A38A 3S3PA 2BHUA 1I3RB 3BUBA 2H32H 1HEZB 1FRGH 3UO8B 4M61A 1I3GH 1A3LH 3KXFA 1AG6A 3POCA 1COBA 2N1TE 3U1QA 2ZUYA 3I85A 1OTTD 4WWPA 4PVBA 1FCCA 1NUNB 5F96H 5TF1L 1X7QB 2IDCA 1M7IA 2CE6A 1K8IA 3T77A 2A6IA 1GIGL 4HS3B 2WXRA 3BT2H 4PJCA 5JYMA 3W57A 4IRJD 1WWAX 2GBVA 2AI0H 3BZ4A 2X4RA 4XODA 2CO4A 2WSDA 1EO8L 2RALA 1FO0B 3HVDA 3RTQC 3WEXB 3IKCB 3WXVL 1KMGA 4MMZB 2IAND 5GPRA 4NFCA 5JOFB 1BYOA 1SJHB 2F7OA 2E7LC 4OFKA 3BZFA 4BK8A 3QR0A 3AB0C 4PREA 3DLQR 5T3ZD 4FQQA 3U0PA 3BDYL 2HLEB 4NZRH 4XNZB 1KJ2H 5DHXB 1J9SA 4ZUUB 5F0MB 3UZVB 2VJ0A 2XKNB 3VAEA 5FYLE 3Q1SH 1S7RB 2HXAA 3L9EA 5DRZB 3REWB 2CRZA 2WGNB 3ZIMA 1OSZB 3QXDB 2ZAIA 4PJGB 3IDUA 1LK3L 2VXQA 1FFPA 1BD2A 5EO0B 5AUMB 4DEPB 1TKWB 1CXHA 4L3EA 3DJTA 4O9HL 3QSKB 1IGIL 4G80A 4P5MA 1PG7H 1PNCA 1X5AA 3BKJH 5L2KB 1YMMA 3L08A 4BINA 3WKYA 1NC4B 1R19A 2PPDA 2Y06H 2V8MA 3QW9A 4TYUA 5L4FA 1XVSA 1ZLWK 4A7TA 1HOCB 4IKNA 1KT2B 3UZEA 4X4XA 1M7DA 3SCMD 1OW0A 2W8CA 4JDEA 4K7PX 3HZYA 1JK8B 1I9RL 3BWAB 1T20B 2JK5B 4AUYA 1KCRL 3FYIB 5CINH 4PJCF 4PB0H 3SKMA 3SYCA 2VUYA 4G8EA 4K5LA 2G2RB 3REWA 3ZDXF 5DK3A 2F53D 5F0PB 5A7EA 1J9RA 2V3DA 5BQDA 3A6CL 1K8DB 1S7VA 5ILTL 3VU2A 5EZLB 3KXFE 2AK1H 3NACL 4PRAA 4IBVA 5EDSA 3Q2NA 4EZKA 3WIHL 4OLUH 5BV7B 5DHYA 3FQWA 3VI3E 4KDVA 1BM3H 1M57B 3GDCA 5AAMA 2Z4QB 1K2DB 1NCBH 1D6VL 4W4NA 1DE4B 1T2XA 2V3FA 3V6ZB 1FO0A 4U3XA 1PD0A 1YEJH 2YZ8A 2R2EB 4MRBA 1CL7I 1WRFA 2XRAL 3N44F 4PGBA 4PV8B 4EN3C 5BRZB 1MCIA 4G6FB 2YC1A 2EVJA 1H8OA 1E28B 2GITA 2W65B 3QNFA 2XXMB 4QXGH 4QJ5B 4GAFB 1R9FA 4PRIE 1RIVL 3WFBL 1A7QH 3P73A 4ISVB 1A25A 1SJXA 2ICWA 5DD5H 2BVOB 5GS0L 4LNRA 1ZOXA 4X4KA 3PV6A 3TIDA 1H3PL 4W9ZA 3DYPA 4QOKD 4XB8A 3UAJA 2PXYD 3OC5A 3P0YH 2IANE 4IEFB 5LCVL 4MHHI 3TF7C 4OBSA 4X9YA 1KLFA 2OZ4H 4G8GD 4OUUB 5TFSL 4KRPC 5LG6A 1WV7T 2WSPA 2YGOA 1R6VA 3Q8FA 5LBGA 1E42A 4M5TA 1OAQH 1G84A 3O11A 1ZA6B 2VDOB 3PCYA 4FD0A 4JFTA 3TYFA 1E3ZA 3AROA 4QRPB 4NM8H 2X42A 3RILA 5CIPH 2Z93B 3WFEL 5IFAL 1TFPA 1QI5A 4OJEH 4NUMA 1WO2A 5D4IA 1D5IH 2VDML 1T20A 4Y2DD 3P9WB 4LOEA 4HCIA 2VSCA 4AVKA 3WENA 1IBGL 3TESA 2CQVA 3HFFA 3L4UA 1J8HE 2OJEB 4HJ1A 2CNZA 4QRQB 2PO6A 1CXKA 2CKNA 3CTTA 3WJJA 2EIZB 3R7QA 3VXMB 5GS3A 4L4TB 1MSPA 3NQKA 4J6RL 4KUZL 4FZ8L 3VJ6A 3JZYA 3RWJA 3Q9QA 3BUQA 5C7ZA 4H8WL 4NI3A 1AY1H 1KCVH 3NSCA 1JOIA 2BSCA 3UZQA 4ZUWB 2GJZA 1B0WA 4UILL 3DI3B 1AGBB 2CR3A 4J3SA 1JZJA 4MJ5A 4RAVB 3VX0A 3S36L 5TE7L 4KITB 2QEJA 1FNAA 3H4HA 3PS6A 3FTZA 3D0LB 3T6VA 2FEJA 1J8KA 4JHWH 4UDUB 4CN6A 1AD0B 1JI1A 1TJHL 2NUTB 3LZNA 4WFFE 1L0YA 1L5GA 3Q1EA 4ZS6C 3HLKA 1SEBA 2DMBA 3GLDA 2J7LA 1SY6L 5IB2A 5L0QC 1WA0X 4Y4FD 3NK3A 4GAJH 1OEZW 4HUMB 4XCCH 3HE7D 3RWIA 2FIKA 4U1HA 5DO2D 3CZNA 1MRFL 3MAWA 4G42B 4UOJA 5EU5A 3GLZA 3ZE2B 2AVFA 2OTWB 1TIUA 5C0JA 2PKDA 3OZKA 4MAYD 1BQLH 1WFTA 1SUJA 3JVGA 1ZT7B 3V0WH 4AQAB 3FT0A 5CS7A 3P2TA 3TZVD 3DGGB 5KS9B 1MFDL 4TPRH 1DBMH 5I6PA 1A6WH 3MBEA 2HX8A 3LN5A 4BDVA 2NQ3A 2Z93A 5C0BE 5I74C 4ABVA 2ZYIA 4FNPA 1IJ9A 4L4VE 1MF2L 1E40A 4PWKA 1ETJA 1NDTA 4P3DA 4UINH 5LAXA 1XCWA 3NOIA 5IT2L 1PFCA 2VOTA 1XCTA 3BP7A 3K4DA 1VPOH 2BPBA 3OMAB 4PJCB 5SX4H 1KACB 3MV7E 3QDJA 3VI3B 1M3IA 1XIWD 1Q9OA 3Q8EA 3BLKA 5AW3B 2OSWA 5MHSE 3QUXC 1MLCB 2YAQA 4RIRB 1E4WH 3EJSA 4B50A 4IGBB 4AK1A 5BVPH 2KDGA 1OZTG 1VLXA 4YHPA 1U36A 1GYVA 3DX6B 2CO3A 3HZKB 3AFLA 2PLTA 4ETQB 5AOJA 1TVBA 3EDFA 1BREA 3B1TA 5KBNC 1ZVNA 1KJ3L 5ALBL 2GTQA 3V0JA 3DXAA 2YAEA 4A67A 3FSZA 2BS9A 3BWZA 1A8ZA 4PRNA 4C47A 1EFXA 4G9FE 2A5UA 3V7AG 3U6XA 1GGTA 4DGWC 2P24B 3B7SA 2YN5A 1JL8A 5FA4B 3MXVH 2FBJL 2UXFA 3CFTA 1AXTL 1HNFA 4W9DC 4Q6KA 1FVDA 4X6DA 2RCSL 4BFBD 3IFPA 3HE6C 4OGZA 1GR7A 3I02A 4XXWC 5CM1A 4E0RB 4KVPA 1D5ZA 2J8HA 2A4CA 1KXVA 2XZAH 2JJWA 1ZGLM 4OFIA 5F3FA 1RUAL 5L9DH 5FCUL 5C8JA 4RISL 5EBWA 2VWEC 2H0JA 2XQ0A 4KK6C 1E4XI 4Q14A 2IADB 1CFSA 3QI9D 3TA3B 2ADGB 1E4JA 4UIKH 5DJ0A 5JPMA 2E3VA 4P3CH 1JPGB 2BSSB 4HXBH 1MCOL 1AZCA 5CEZE 1ED3A 5EH1A 5DC0A 3W56A 5HI4C 1GPOH 3QZMA 3FTUA 2WXNA 1KSRA 3RZCA 5D72H 1AXSA 2X1PA 1MG3C 3F7RA 2BVUA 2ZAGA 4U1GB 5CSZB 4MJ4A 1KC5L 3AVEA 4DKTA 3OAWA 3HNSH 1O9VA 2G3XA 2K8MA 3GSOB 1FFNA 3LIZL 4FYSA 2OR8A 1N8ZA 2QT6A 3ABMB 4G1MA 4V2CB 1AGBA 1WCBA 3J7HA 4NP4H 1N7ML 1ZV2A 1CFSB 3O2DH 3W9DA 3K46A 1OSZA 1RUKL 1XQ4A 4CA4A 4JQVA 4B9YA 4MS6A 1A5FL 3RFZA 2WB7A 1ZLUK 5C8JB 5KAQG 3DX6A 3G5VB 3HZKA 4JK0D 1BW8A 1OP4A 1PDKB 1BLNB 4CVZA 1I53A 3RU8L 2IDUA 1WGVA 1DBJH 3NPSB 1T04B 2EEFA 1YNTB 5F9OL 1ID5I 2AQNA 3GZPA 2OYKA 5J89A 3D25B 2X6AA 1FN4A 5TE4L 3UBGA 2LAAA 5DMYA 4DW2H 3SGJA 4TSBL 1QSFE 2P24A 3F6JA 4HSCX 3CFKB 4GT7A 5DO2C 1OWWA 4NO0D 5AVVB 3S96A 4YAQA 4ANVA 1ESOA 2ZUQB 2QPEB 3L3HB 5BVPL 1AKJB 2I26N 1CGSL 3VGEA 4F92B 4BFFA 3VXSE 4TUKH 3LKNA 1JF1A 3MLYH 4JCLA 2WNXA 2X2IA 5INDB 4P8QA 3G3LA 2K9FB 1CICA 4ELMF 5AW8B 2GTWB 4DZBA 2WNGA 4DK6A 4JRXE 4BA8A 2J1ZA 4L4TA 2ICEC 3KWWA 4PGCB 3OVUB 2GJPA 1HL5A 1XGRA 3DKHA 5LBSH 3ZMEA 5D1ZD 4ADIA 3LZFL 3SPVB 3VFNA 1WFMA 4NRYA 4YDLB 4P9HL 4PJIA 1XF3A 3BPCA 1Q1PA 3C6LA 1MFEH 4KVNH 2ZPKH 4LLUA 4NQCE 2JCCB 5C92A 3VGAB 2NY7H 3RWFB 1PLAA 3ME0A 2DIJA 2JJTA 1HH9A 3KYKH 4R7NB 1RUAH 4GO9A 4AI7A 4HT1L 2YD3A 4LHUA 1WAAE 3GSQB 3O3EA 1DVFD 1WA1X 2NUPA 3BIKB 3N41F 5C0IA 3CH8A 3RDTA 5K9KB 3NT0A 3K71B 3D0LA 4KTDH 3KPLB 3C5JB 3BH9A 3EOBA 2UX6A 3VMPA 2CMRH 2R2EA 1O0VA 3O4LA 5IHWA 4NQCB 3WEAA 1NM4A 1SJEA 4Z7NF 2D2CC 3P3RA 3L5IA 2W59A 4FQXA 1NGYA 4MYWB 4XBEL 2GAZB 1FYTB 3O4OB 4HX1B 4HW6A 1NH6A 5EUKA 3G5VA 1W91A 2BZ7A 3DOSA 3KYNA 4R6UA 4I4WA 5D93C 4WV1C 2ICWB 5ANME 4A2MA 1L0PA 3QHZH 1LEKB 5BV7C 5IV2B 4AM0Q 4UILH 5FGCE 5E7FA 4LBEA 1KEML 1QSEB 2AGJL 4I18A 4NCC1 4F37K 2R69A 1QW8A 3O6FB 1AQMA 2AK4A 2Y69B 1EAJA 1TMQA 1BV8A 1I3VA 4NENB 3PPSA 4YO0A 5CLTA 1IMHC 5BZWB 1H3GA 3VG9C 1IEBA 3KPOA 5EPMA 3SBRA 4A6YB 5DJAB 1YY9C 2PPEA 4I1RA 5E6UB 3STLB 3VH8G 3VXSA 5LLIC 3MV8D 3B2UD 5GGUB 4K07A 3HS8A 4FXGA 5DS1A 4IKJA 3UMTA 3W0WE 2ZYHA 2XBTA 3TXAA 5BMFL 5ESAB 1UWXK 4UT6H 1M6OA 4RFEA 3CZGA 3W38A 3D08A 3B2VL 4MDJB 4QRFA 3Q8AA 1F3JB 4OQ1A 4KRPB 3GBDA 3V0WL 2WO4A 2JI2A 1IKOP 2WLYA 4C4UA 1AY1L 1KCVL 5GGVH 1HE7A 4DKAA 3NJIA 4MZ3A 5IMLB 2QVFB 5EF0A 5CEZH 1PIFA 1K4CB 4M6AA 3H54A 4N0RA 3N1QC 4LLMB 5T1MA 2B1AL 3O6FA 4HH9B 3RDTB 3DGDA 3FOMA 3UEQA 4KKNA 4WSGA 3FTWA 3P9LA 1BJMA 1BG1A 4X6CB 2D3LA 2QPFA 5JOFA 2B0SL 5D2NE 3VWKA 3WKMH 1URIA 4FFWD 2YSSB 4NXKA 1RJCA 4YXLL 4MD5A 5KG9A 1TETH 4N2GA 2P8MA 4L48A 2GVYA 3PIQB 3CVHH 5DCCA 2L7EA 1GXEA 3QDGB 2A3TA 2YD5A 1G7MA 1HCFX 4O2FA 3B83A 1PPIA 4Z7VB 3T8VA 1H3TA 2PR4L 1JGEB 1XD0A 1DVUA 4TQ8A 4ZMLA 3RPKA 4IJ3C 3SO5A 4GMSL 32C2A 4EN3A 1OF2A 1Z5HA 5AW1B 2NZ9C 3BSZA 1WZMA 4KNTA 3ZKXB 2NZ9D 4H1LB 3HCVA 4JANB 4MTMA 3HE7B 2N7SA 1HOCA 4G9FB 5GIRA 3GHBL 3TS8A 4TSCL 1FHNA 4PU2A 1ORQB 1YNTA 1KEMH 5HJGA 1XZ0B 3KS0J 5EZLA 4EUPG 3NK4A 5T3ZH 4ZAKA 1F0LA 5AB1A 5BRQA 3UTSA 1LILA 2NR6C 1FYHB 1X5ZA 3G6JB 5FOJA 2JCWA 3AS1A 4KJWC 4FG6D 4X8JB 4XP5L 1RUQL 2GC4C 2WZAA 5FCSH 1MHEA 3RTQD 3JT2A 2I5YL 1KB5H 4L5FE 5JIHA 2AQ2A 4Y1AD 1KB5B 1DJIA 1HIML 3THMH 4H8WC 4X80H 5I6MA 5A6IA 3SD5A 2X40A 1D9KA 3I50L 3MCKB 4PMEA 3QXAA 4R4FH 3HNSL 3WL9A 4FG0A 3GM8A 3I3DA 1A7QL 1NOLA 4MMXA 3MLZL 1OGAA 5AZ2L 3QFJE 2V5YA 3HUJB 2WMPA 1F5WA 4KKQA 5BJTA 4LP4A 5GS0H 5BZWA 1EAPB 4IK7A 1J1XH 1RJLB 1UTDA 5IQOA 4LNVA 5MI0B 2ZCHH 4RRPA 2EVIA 1BD2D 4P48A 1CBJA 5HPMB 3LZOA 1LGVA 1WBXB 5I8OH 2GJRA 4WWKD 2UWEF 2VZOA 3HAEA 2HJLB 3FQYA 5DQJA 5DHVH 2G75B 2XV0A 4RDBA 1YY9D 2AEIT 2P8PA 3HNVL 1KFGA 4LLAA 3WIIH 3TTYA 3BCFA 4YHKH 1R5WA 3WFHB 4R90H 5F89B 3F7PC 4OZFA 4JFPA 5DS8A 5HDQL 2EXTA 1MCPH 2KMWA 2XWRA 2ZUSA 2WQUA 4PG9A 5DVPA 1X5YA 3GRGA 4OT1H 4AGNA 2P5PA 5DC4B 4OQTL 1EEYA 4Y4HB 1HHHA 2VN4A 1ED3B 1E4KA 3D12B 2PYEA 2QHRH 4W68A 4WJ5B 4NYLB 1HXMA 2OSLA 1IIIA 2XWZA 2EDBA 4ONHA 5TK4A 2NY6D 2R1YA 2VH5L 3AS2A 1PKQB 1UASA 1WP6A 4WI8A 3HRZA 2GSIB 4AE0A 2SEBA 4BXSV 4M48H 3QJZA 5EUKB 1R3IH 3VFRB 5I1IL 1GTNA 1QASA 3ROLA 5EV7A 5ITFB 4D0DA 2F5BL 5L6YH 4O5LH 3E9TA 2XKUA 3IF1A 4MD5B 5KG9B 2EADA 4RBPK 3U6XS 3MV11 2EH7L 1YMME 2DJUA 4U6YB 3UYPB 4JUTA 4EQ2A 1UACL 1J8HA 2XXFA 3RIFK 3PDGA 4YLCA 3P4NA 3MNZB 4UDTB 2ESVD 1D7FA 3N0PB 1FL5A 3CCHA 4PEEA 5DQ9A 3OAZK 4CBPA 3IDYB 5C08E 4MQSB 3T6QC 4LHQB 2F54B 4TQPA 5C09B 3T3MF 3B2UC 4X9IA 4DKFL 3DMMB 4C56A 1HTYA 4FI6A 4YSAA 4BH7B 4PBXA 3FCTB 5AQ0A 4BFGA 2GG1A 1LWHA 4I3GA 2IAAC 4Q58C 3E7JA 3D51A 4Y2NA 3O2VL 3O9WB 3MJ7A 1F4XH 5LGJA 1M6UA 4OFPA 3OGCB 3UL4A 4Z95L 3L9YA 5JUEH 2UY6B 4R7DB 5IIEA 1L9MA 2IOOA 3X1GA 3PDOB 1FJ1B 4L23A 3SY0A 1KOAA 2A6KB 2QGCA 2DWXA 2PF6A 3N1GC 1JNNH 2R0LL 4XP4H 5FHBL 5LGHL 4F2MA 4J3UA 4A2LA 3D50A 4ZS6D 1KIUA 3HE6A 3D9AH 1OO2A 4MCZA 3II3A 2X1WL 3HZYB 5J06A 1ZK9A 2X6CA 3DJSA 3ORJA 1INEH 1MQKL 1N8ZB 1UZ8B 4N2FA 4Y4KD 3X13A 3WNNA 4XZUA 3ZZ1A 3H9SB 1JHTB 1R3LB 4LLDB 3TYGH 3D25A 3OF6D 4F7MB 3ZGHA 3PWNA 1NCWH 3GS4A 1MCDA 4IRSC 3L7FB 4HIJB 1XBRA 3GMOB 2MTPA 1IFRA 1A6AB 4JRXA 5KVDH 4RRPG 4BZ2A 5JXED 3ZHNA 4AYBA 4WKXA 2RMNA 2OV0A 3GHEH 4U0RB 3WOVA 4OR1A 5DD1H 4C8XA 1MCEA 4FA7B 1AO7E 2VLRA 3NZSA 1LL1A 4NNYA 3QYMA 5HHOD 1NBVL 2X4NA 1CE6A 5E0QA 4R7LA 5FUZH 3HLAB 4MQXC 4BELD 2I60L 1BQSA 1AHWC 4BH7A 3IJHB 5DDHB 3X13B 1ZK5A 4BZ1L 3WU1A 3MV7A 1LWRA 1KLUA 1WLHA 2XYCA 5E4EC 2NCEA 2FJSA 2VR3A 2Q76A 3EYSL 2OL3B 5TPWL 2VC2B 2IIJA 5DD3L 3VG0H 9PCYA 1BF5A 3MNZA 4UDTA 4LGSB 3ULUH 3LEYL 1S3KL 1YPZA 4GMTL 3SPIA 4BQ8A 4ZW5A 1FDLH 1KBPA 1M7UA 3U1PA 2ZXEB 2ZF8A 2QTEA 3MZTA 1V10A 1AKJD 3QRFM 2Y24A 5T8IA 1CFBA 1NEUA 3O9WA 5T5FH 3UAEA 4YXHL 4FXGC 2WWOA 4HC1L 5D5MB 4E5XB 1P4IH 3MA9L 4YK4C 2APBA 4PJCE 2F74B 3UO1L 3QWOA 5F8RC 3VFRA 3E6HB 1PZCA 5DUBA 2EP6A 1CO1A 1KXQE 2UWEE 4HT1H 2NDGA 2P5EA 5D8JH 2GSIA 3QXTA 2OXHA 1MJ7L 2EVFA 2AK4E 2DQUL 2E86A 3FFCB 2JJSC 1DFBL 2J43A 5KS9E 3PABB 1F11A 3NCWA 2Z7UA 3C9NB 4J3OH 4AX3A 2VLJD 2F58L 4Z76B 2V6HA 3TTSA 2GIXA 4E42A 4KUCD 2VRQA 1P7KA 4FTDA 3ELQA 4HIHB 1IAII 4ZNEE 4XVSH 3VD9A 1PDKA 3ECUA 3HEIB 3IRCA 4LEEA 4LCUB 5C9JB 1A1MB 5DZJA 4K9EC 2FHCA 2P8PB 1CXFA 4FFZA 5HYSB 2HJLA 3OZ9L 1LE9A 2CRMA 3QUYA 5D5MA 2K70A 2ZWKA 4XC3L 3WIFA 4YSRA 4C4BA 4PJBE 5IW1B 4N8VG 3RAJH 5DURB 5CJQL 1CDYA 4NDMB 3AREC 4ZFFB 2FSEA 1F58L 3PWLB 3O41A 2B1HL 2OMXB 2WD0A 3ZN6A 4GKNB 3ZBMA 5LAXB 1FLRH 1R3KA 2CK0L 3K7UA 3CN2A 4N2NA 3MLZH 2HJFB 4ZFQA 5EEVA 1WIPA 4JM4L 4JFHE 4IOSD 4AOFA 5J7CC 1SN0A 4XXWA 5JW4R 2HRGA 4PJFE 3BFQG 2J5LC 1R5WB 4NPJA 2VXTL 4RAHA 1OAYH 2AAVA 3QI9A 4MX7A 1ETB1 5FGBA 3OXSA 3EO1A 2P42B 3QCTL 4QIRA 3SE9L 4OTXL 1QLRA 2PW1A 3IDYC 4PS4L 4X8JA 3BKCH 5EN2A 4GSDL 4BYHA 5I17B 1ODAA 1E90A 1R5VB 3MROB 1XTLA 2VDPB 4Q56A 4ZAKC 4OZ4A 2X6VA 1OGTA 2V2XA 1HNGA 1VKXB 5IFHH 3RZCC 1L5GB 4IGBA 2BM3A 4KO7A 1Z9SB 3D2UD 2DTML 4ZUVA 5IGXH 1FIEA 3RKPA 2X4UB 2P5WE 4XCCL 1S78D 1AACA 4HHWA 4XMLH 4XE5B 1HN1A 1UXSB 3SQBA 5DZNA 5E6ZA 5D4JA 4J3XA 3ZY7A 1A4KA 1HI6A 5ECJE 2YXWA 3OB8A 3RVXD 2RBLA 3RQ3A 2GJ6B 4ES8A 3WSQL 3AG3B 4PLJC 1EO8H 3C5ZD 1N64L 3EBGA 4HIEB 2ILLA 5JNYA 4R96B 3BISA 2QGBA 4JQVC 2FSDA 4RGMC 5GZNA 5K33A 2V5SA 1QFWL 2J1XA 3N42B 12E8L 2H1LM 2YEVB 3L2LA 4UINL 1HL8A 2CSPA 4LSPL 4PTTB 2K6ZA 5C0CA 3FHEA 2BSEA 1VACA 1UD2A 2LR4A 3TA3C 1SN5A 4KAQL 4QRBA 5CKGA 3QAQA 4J2XA 4PJHE 3FCGA 4Y5YB 1LNUA 1HESA 1NCDH 2C1OA 3OR6A 4GKOA 4YBLB 2X4OA 4YFDB 1KTDA 4XVSL 1NBZB 2X89A 3NRFA 4M4RA 5D7IF 5KVFE 1BX2B 5IJKA 4WEBL 1Q0YL 4FF9A 4JKWA 1TJXA 1TJIL 1QLEL 3ES6B 3GK8H 3TN0A 1PG7L 2G5RA 4GRLB 4NZUH 4Z7OE 1FL3B 3UG3A 2J4WH 4WLCA 4K73A 4C59B 5MI0C 1NAMH 4TLSA 1IAOA 1I82A 1XT5A 7TAAA 4H20H 3K8LA 1THAA 5BVJA 1JDCA 2HTLD 5E2WL 3L4CA 3SB3A 1FLRL 2CK0H 3GSUA 3HRZC 2MPVA 5HGGS 1F1DA 4LSDA 4XOAA 2CALA 4R3SA 1XTMA 5FV2A 3RX8A 5ISZD 2KI6A 1SEBB 5TK2A 2UYLB 4BQCA 1ZA3B 4J6IA 1S4IA 1YN7B 3WXWH 1BOGB 1I8MB 5IEHA 2Z91A 3SE3A 4XXDA 4XB3A 4DGVH 4WUUE 2XTJE 4QGYA 5KJRH 2VQ4A 1JJUA 2C9VA 4TVSa 1AKPA 1NJ9A 5T1KB 4G8EB 2XX0A 5IB4A 3H1ZA 4ECNA 2LQRA 4AIOA 3VSUA 1M7XA 4MMYB 1XEDA 4AZ8A 4Z0BH 4DN4H 4JHAL 4NGHL 2CIKB 2FO4A 3KPSD 2XVKA 1SJMA 5JZ7D 2JQZA 2NY0D 1U95A 7CGTA 5DS8B 1RK1A 4QT5A 3M8OH 3ZMNA 2GIMA 2R1WA 5CZKA 1CF8L 5F7MC 2YMXL 3ARBC 2UY6A 4FQ2H 1YN7A 3ZQXA 3SE3C 1UB5B 2F7QA 5IR1B 2X7LA 3NRPA 5KVEE 5HDQH 1BEYL 5C0CE 2WUCH 1KWGA 3CFBB 2C7UB 4R3SB 4GIAA 3TFKC 1ZE3H 4BCYA 3FN3A 2OMWA 2VLME 3P02A 4FADA 4IBUA 4L8SC 2A9CA 2O5ZH 3L2NA 2X4PB 3VA2C 2G4EA 2XXCB 5BVJB 4NUQA 1FIGL 2XETA 3HC2A 3SE4C 4QRUA 5HGHB 5E2TH 3UYRL 2XA8L 2YPVH 3PLYA 1XGTA 3VU1A 5JTWA 1GYAA 5KN5A 1SLUA 1KIPB 2AJUL 1FL3A 5J1TC 3BQUB 3ARBA 1HCVA 3V7MA 3QDAA 2OAAA 4EQ3A 3KVQA 1UKTA 1FG2B 1VGEH 2CLVB 4HJTA 1MFBL 1UYWL 1H8SA 3DOSB 3KYNB 2D9CA 2XZZA 3C6EA 4GI8A 2K6YA 2WQAA 2Z9TA 4IRSA 4KGLA 3MGTA 1UZ6E 3ZE2E 2A0LC 5F9WB 2WYZA 4HK0A 3VFOB 4JO3H 3SE8H 3MBXH 4HFUH 2D0FA 5HDLA 3IPEA 2F1AA 3LQZB 1AXIB 5EZOH 4BK4A 2ODHA 4X80L 1ILSA 5D2NC 4Y9FA 5ADPL 3KBFA 5MENB 5C6PB 4ODVL 3V4PH 4PREB 3LPWA 2GBTA 5DUPH 4E5XG 5ACLA 2VQTA 1PX3A 5FYKU 1J86A 1HSBB 4WKZA 5KZCD 4LDCA 4Z3TA 4BIKA 4JY4A 3MUJA 1YEGH 4QOKE 3A24A 4WI9A 2GFBA 1AQDA 4ZO9A 4PG9B 1LNUB 5AOLA 1FHGA 2F2HA 3D3VA 1IM3B 1NANI 4PLJD 4DVRL 4QHMA 3ASWA 3S4SB 1IB5A 1L7TH 4XPAH 4HPHA 1ZXKA 4S2SA 1C08A 2HLAB 3QQ4B 4M7JH 1FWXA 1DSFH 1CDHA 4X5RA 1MDTA 5DJ6A 2P48B 5F7NC 1G7LB 5EU6D 5B39A 1BXVA 1U9KA 3CDCA 3D85D 5DRZA 1WT5A 3ZKSD 3EYVB 3ZK0A 4ZW3A 1MRDL 3L3HA 4OIIL 4I0PD 1E4XH 5B7FA 3SDDB 6PAZA 5JPNB 2DLFL 1VEOA 3LH2L 3Q48A 4JFEE 2YPKA 5F7BA 4PJEE 4NWUL 5F3HB 1NC4A 3VXQB 1CU4L 3DTDA 4N8VB 5IB1A 4LXFA 1G9NC 3LNFA 3HKZA 4AM0A 2E47A 1MHHB 2DEYX 2QVTA 3OKEA 5IVZA 1KENL 2GT9A 2DMCA 1B0IA 3O6KL 3BXNB 3QULB 1UFUA 3V5DA 3AJ7A 3Q6FB 3IGKA 2KDYA 2DRUA 1BM7A 1BWWA 1I7UA 4KBPA 4YK4B 4Y1AA 4LLYA 3FFCD 2AZUA 5JHLH 2EXYC 3OC8A 3GXTA 3NDZE 2EH7H 1QABA 3F58L 2DI9A 3O2DL 4KROC 2CDFB 1IT9L 2XWBA 3B37A 3PXJA 1N10A 2XN9D 3L9BA 1SVCP 5ESAA 4TL4A 3VVVA 1JZDC 4U1JB 2MCPH 1EJFA 3RFRA 1S3KH 5CSZA 3B2VH 4F1SA 3US9A 4UNIA 2EC8A 5BRZE 4DKFH 2WNWA 4QXTB 3QEGL 4TLKA 5IY5B 2FO8A 2XFGB 4O4YL 2FJFB 1I8KA 1CGWA 3PQYA 4B9CA 2CDGB 5KTEH 5CO1A 4OCYH 2HB0A 4LDOB 5EOTB 1B6DA 1JNLL 4LSUH 3FPYA 3TT1L 4B41A 1MW3A 3NMEA 4JGMA 3UTTD 1ASPA 3T77B 1KYFA 1AANA 1OXYA 2WYHA 3AUWB 4LLYB 1IE4A 4JJHA 2G3MA 2IOMA 1XZWA 3QIUC 5K1VA 3KXFB 4ABWA 4BEIA 3MLYL 3Q6FA 3LEXA 1PSKH 3MRDA 4LCWD 5EMYA 5CGMA 1N0XH 4Q97A 4H5SB 5J13B 2X0VA 4WFFD 2HSIA 4GEIA 4K7PH 2IFGA 4FHBD 3KL5A 3PIQA 2GY7B 4IU2B 4KMTH 1LO3H 1A7BA 2YA0A 5JPNA 1PNDA 3NTCL 4ZTOL 1T4KB 2F9BT 3BYYA 1HILA 3VFMA 3S88L 1R5IA 1MIML 3X14A 4K3DL 4WO0A 1DSFL 1HEHC 2JXMB 1NIDA 4MFHA 3B9VA 2AV7B 3QNXA 2AXHA 3AC0A 3BW9B 4HG4J 1KXHA 3JWOL 4Z1PA 3EH3B 3LPOA 3U82B 4OKDA 2OL3A 2Z35B 3F7YA 5GGTL 4P4KA 3DGGA 1E6OL 2XWCA 3QZOA 2IALA 1F41A 3MXWL 5D7JA 5AZUA 4ZFOB 3T65A 1E9QB 1ZLVH 1E5YA 3FU9A 3TPUB 2VZVA 3VFNB 3FZUC 2VDRL 1RIHL 2VM4A 3MRRA 3S35L 1W0YT 2DM3A 4LIQE 1CTMA 4W4OC 1E9OB 2JJSA 5CR8A 5EDXA 4PN6A 3CVHB 4G7QB 3FUIA 2ICEA 3IDIB 4JO2L 4JE4B 1PY0A 3KLAA 4ODHL 4PLOB 5F44A 1NINA 3GGWA 3AU0A 4FQ1L 4IHOB 4YGAB 1FLTX 1YPZB 3NZUA 1QSED 4WJKB 3STLA 5I1GH 4OV5A 3ZRFC 3SDYL 2FT6A 2OMYB 4CAGA 1YZZA 2QVMA 2XFXB 1PLGH 4XP9H 5GS2H 4Z8FH 4B7LA 4LSQL 2HKHL 1JNHA 1RP8A 2DKMA 2AXWA 4JHBA 1KYOJ 1MH5A 1SF3A 4E9SA 1ZDQA 4RMWA 4U3SA 3CN4A 4F24A 1YUHA 2Q7YA 3G08B 4ZPVB 1FQ9C 1P4IL 2AJ3A 3NCYP 3QUYC 4ZK8A 2PTTA 3C60B 1XR9B 3MSPA 4GKZA 4NNPL 4L8CA 1Q94A 1NCCL 2NTFB 2ATPA 4IU3A 3HMWL 4PI2A 5IQLA 4MNHB 3AREA 4NQDB 4M1CC 1GY1A 2AEQH 4F2EA 4EI5A 3FN0H 2EIMB 3VGGA 1FSKB 4U1NA 1AD9B 3OKMA 4Z77B 2GPZA 5KJRL 4QRRB 2AJSL 4QF1B 4P23C 3JUYA 1J8SA 1WA2X 4E36A 4NT6A 3FTGA 5DJXA 3P30L 5CHNB 5J3HC 1OOWA 4BKLA 3T9WA 4MNQD 1BF8A 2VZ1A 3GRWA 5CJ8A 1RFDL 1KBKA 1Q9WB 4JPIB 1A9VA 3RUGE 3K1DA 2ZX9A 4LOVA 1KB3A 4JKPL 1XGUA 4DK5A 1EFQA 3PHAA 2VLRD 4TNWF 2AKRB 5E9NA 1QRND 4WRLA 2ZP8A 1KN2H 1TQBC 1TTRA 2AJYL 4AL8L 2DQIL 3CQFA 1VFAA 2P5WD 2C9SA 2GJ6D 4NRYB 3VI3F 1M9SA 4P57A 4AQ1B 5BS0B 5K9QI 1VENA 1UATA 1ZS2A 3TX4A 1PFOA 2BY0A 1YYLH 3CK0L 1YYCA 3CFNA 5CFHA 2J1YA 4DP6X 2O1AA 1BD2E 5ADPH 4XMXA 5I5IA 5KSVB 4HUWB 2WKOF 5D1QA 3T3PB 1GAFH 4KPHL 4DP7X 3OTTA 1ML0A 2CO6B 5FPIA 4MS8D 1FVDB 1EANA 5ADOH 2FAUA 5L9DL 1QI3A 1MCCA 1A65A 4P3WA 4PJ9B 5HDOA 1WBZB 1A6UH 1DP0A 1ZWIB 5E2WH 1WFUA 1IU1A 2NY3B 5LBSL 3ERXA 5ITBL 2WXPA 2TRHA 2FYYA 2VB5A 2KLTA 5EEXA 4OQTA 5LN4A 2COVD 5FECA 4FGMA 1BZ9A 4UZSA 3ZTCC 4UM8B 1VEPA 1PW3A 4OB5L 1JZGA 3OXRA 4Q9QH 3S34H 5DJDB 1M3JA 2OA9A 2WC7A 4L1SA 5HXMA 3ULUF 3IXAA 2FJGB 4JRYB 4X5WB 3US0A 5F1IA 5I16B 1IM9A 1Z7JA 5I0XA 3TBWA 3BKMH 2E27H 3LPFA 2Y5TA 4PCTA 3BOVA 4ELKB 5FKPB 2IOIA 5EU3B 2G2RA 5A3IC 1HKFA 1U8OA 2YFOA 1MW0A 2ZIDA 3ZLQC 1FFNB 1EDQA 1MFCL 3K6NA 5D7EA 1QEWB 3UP6A 4BFIB 3SDCA 2VMJA 5AVTB 4JPWL 1ZCRA 4Y1AE 2ORBH 3KR3H 2VW7A 3DVIA 3EFFB 4PIRF 4RSVA 5ENWB 2DICA 1JWUB 4U1JA 5LN8A 3W9EB 2FD6L 1RZQA 1U92A 3QHZL 4MXQD 3RVUD 1U8MB 4O51B 5DR5L 3NCCB 3BX7C 1X9UA 5E7BA 3K5RA 1TU2A 4LOUC 3FTYA 4OY9A 1YEWA 2ZX7A 3GIVB 4FMFA 1U2YA 3V0AC 3B5HA 1F90H 3FUJA 4OLYH 5JDSA 4NKIL 1Q1JH 5FYLH 2A74C 4XBGB 1JZIA 2QSCH 4JAMA 1IV8A 2WBJC 4WUUA 3FUFA 5E6YA 1KWKA 1BZQK 2VXUH 5K59E 3ZKXC 4MAYC 1WTLA 2NY4B 1MCQA 4APQC 4NQEE 2FEEL 4PRIA 4L0YA 3ULVD 2OL3H 1CN4A 2MSPA 3LRSB 3RX5A 5DYOA 3VFGL 3HE7C 3F12A 2GI7A 1MOEA 2ZKXA 1AVAA 1PZUB 4XPBL 1RLBA 3HC4H 4LLVA 1A9EB 4KXDA 3QDGE 4H8PA 5GISL 4OLEA 3PWPA 4FMKA 5GS0D 2BY1A 1K5NB 5HGAA 2ZPKL 4HKBA 2JLPA 4X99B 4DP1X 2B59A 1GC1H 4DOHB 1DN0B 3MYJA 1ZTXL 3FQRA 1HEZA 1C12A 5EBLA 4UTBH 1PL3A 4RIRA 1U8JB 5HY9A 4YXKH 4O2FB 2W9EL 2BMKA 3EFFA 3AS3A 3S4SA 4FQQB 3U0PB 2UXTA 4APQA 3X3FH 1QRKA 4U4IA 1RZFH 1F8TL 5I1LB 3HE7A 1XCTB 4XMZA 3O4LE 2W0LA 3IE4A 4ERSL 4XMVA 2JIXB 4OB5H 4YDVB 3WJMA 4C83A 1YECL 4LSVH 5EUOE 3VXUB 4KZDL 1SEQH 2FYVA 5AW5B 5JW3H 5F70A 1K8IB 3TZVA 1RHHB 3RB7A 3H3KA 2Z3FA 3NZ8B 3VFSA 2VDKL 4M7JL 4Z7VF 5IMKB 4B3EA 4QXGL 2AANA 2ZE0A 3APNA 4X7FC 3BMWA 3I6LE 4KXZH 2HFFA 1A1MA 3S5LG 4K71B 4HUKB 2PCPA 5L2KD 1K4DA 1X5KA 3FCBA 5AENA 1ACCA 3GSRB 3HJEA 3RWIB 4DESA 5B39G 1VHPA 1F3JA 1TQBB 3QDJD 1S9KC 1LO4L 4ZQKA 1Q4NX 4HD9A 2VUOA 3U7AA 3GMMA 4B0MM 4CADB 2NY1D 4HIXH 4LMQI 3VWKB 1A2YA 3U6RB 1RURL 5CBEB 1N7MH 3GMLA 2QQLL 4CC4C 4EZMA 5EU3A 3AU1A 3D69A 1E6JL 3HNVH 4XNZC 1BF2A 1AGDA 1T0MA 2CK2A 3JV4A 2JKSA 4X8XA 1NICA 3D0VB 5B4MD 1EJOL 2DH2A 5JQIB 2X0WA 5ANMB 3V9EA 5KSAA 3CVIL 3WIHA 2CWRA 4XO9A 4PM1A 2WCPA 5AB2A 3RWHA 5J6GA 3EYUL 1BWMA 3CSYB 1EFXD 3LXUX 1YEHL 2NYZA 5KSBF 1RUQH 2YEZB 1KCRH 2NCMA 5JHLL 1MJJB 1X6NA 2QSCL 3QQDA 4G9FD 4E5XA 1CC3A 3AAZB 2VN5A 5FA3B 2PMZA 5C0FA 1XMWA 5EZOL 3G5XB 3TYGL 1P2CA 1EUUA 2QDVA 1BGXH 5IVNA 1K8DA 1S7VB 3B9AA 3BMVA 4N9OB 3QYCA 5J4MA 2OLDA 2AKRA 1CXIA 1M56B 4HZLA 4XCEB 5AZ2H 1A22B 2J8UE 3UBXB 1NA8A 1KCSL 2MTAA 1D3CA 1CGTA 2AI0L 4N4YB 3VFWB 4NQSB 3LOWA 4LCIH 1EHLL 3TWYA 4X8GA 3BEVB 3HG5A 3NG5A 3WTXA 2XTLA 2X3CA 3RWCA 1AQKL 1C7SA 4MZIA 5E8PB 5DMIL 3D6GA 4MXWH 5DF0A 2TSBA 2PXYB 1X44A 1ORSB 3KGRA 1AIFB 3QIBA 3UTQB 4PRBA 2NT1A 5B8CB 3O11B 4PGDA 2Y5EA 4UT9L 5I2IB 3T6XA 4GMTH 2JKLA 3QUKB 4AKPA 3QORA 4DN3L 3ZYZA 5KVFH 1ZA3A 3LRGA 4FI8A 2CXGA 1NPNA 3SGDI 1Z5LA 1BD2B 1A6AA 3EJYC 1J05A 1G6VK 1U3ZA 4HZ1A 2I27N 2RACA 2VKXA 3D4ZA 4KKBC 4AWJC 4Q6YA 1L0QA 5J6HA 4N9GA 4ZPTB 3G08A 4ZPVA 5BZDB 1QBBA 3FTSA 3MMEA 5CGYC 3MRKB 5IK3A 4KK5C 1L9SA 4OZIB 1AC6A 2WIMA 4PJ7A 4M6ML 4MGXA 5D1ZC 3T6WA 3S7GA 1GCYA 2YQ3A 3IYLW 3FXIC 4P23A 5H94B 4OF6A 1HH9B 3CFEA 3VXMD 2FBRA 3MRNB 4KNUA 4HD5A 5AWNH 3ESUF 4L0PB 3NIFB 3MXWH 3OKNA 2R0ZH 2AHIA 1KN2L 1MCHA 1TZIA 4NP9A 1R4XA 2CHXA 35C8H 4U3CA 4L9LC 1DBKL 4F33B 3ESPA 4JQIA 4Z7UE 3FCTA 1YC8A 4Q4EA 1XB6A 2CAKA 4N2MA 5JHDA 1UACH 5B1JA 1JNHB 4GW4A 3V0HA 3QUZD 2VXSL 4KHTH 4KWUA 4ZD3H 43CAA 4O9HH 3D4CA 4GRMB 1R24B 5J9PB 5D7KD 1T7WA 4WDIA 5ABAA 4P23B 3D4GA 3QH3A 5HGDA 4Z23A 4HGWB 2P45B 2FLRT 3N91A 2FR4A 1U6AL 3BUYB 4YHIA 4AYID 4ZXBA 4DJMA 5CD5D 1RLWA 3EG9B 5HGBA 1AS8A 1M7DB 1WHPA 2H45A 4WWNA 5I0YA 5HPOA 2C5DC 5BZDA 5D7JC 3PXLA 3GMRA 2EE9A 4P5TD 4BRVA 4YHNB 4OCWL 1A9BA 4XPTH 5GGTA 2G30A 2YLKA 5IQMA 4Z3GA 5KSUA 3L3OC 1VKXA 1JFQL 4AQ1C 4UQCA 7FABH 1F3RB 2V5TA 4OJFH 2JTYA 1RY7B 1DQJB 5FFLA 2VLLB 1E30A 2CG9X 4FN0A 1LO3L 5DK2A 2ICCA 3AG2B 2KL6A 4URKA 1N4XH 1OTUC 1QQDB 4N2CA 3PNRB 1UUNA 2OXGA 3CZUB 3VQMA 1RK0A 1BQRA 2Y25A 4MBRA 3U36A 3PGFL 3LJ3A 3TLRA 4WW2A 1WZLA 4CMMA 2E56A 4BGLA 4KQ3H 2GUOA 3PP4H 5JHMA 5HP5A 1FH5L 4UV7H 5GS1A 4PV1C 4WCYL 2ZUQC 1YNLH 4OBRA 4HA1A 2EDHA 2DM7A 2HJFA 1FVEA 3CDZB 4G8IA 2BMKB 3AADB 5IM7B 2O93L 4RCAA 3ZVVA 2BZDA 5KYUA 2YLHA 2BVPA 3EF7A 4N5UA 4EIUA 1QACA 5EZIL 4ZMZA 5TGBA 2OJZL 4B53A 1SBSH 1ACXA 4PSPA 5FUCE 1KYAA 3ET9F 1VZHA 4QR7A 3OQRA 5FK9A 1B2WL 3L1EA 1NIAA 4PW9A 4ENEC 3JYBA 2M26A 1DUZA 1N26A 3WIAA 5ACMA 5EHFA 5IKCB 3KBHE 3S3DB 3TNMB 3B2MA 4ZQTA 4LDLB 4S1RH 2KERA 4PJXF 4ZS7L 5KW9L 2E6JA 2KT6A 4PRPE 1ZLWH 2J3SA 1U41A 3PQYD 2XN2A 5T1LB 4M6NH 3IFPB 2CXKA 3IK2A 3QWQB 4MD0A 4QHLB 1UB6B 3GRWL 1JGVH 2Z64C 2ESVB 2BJML 5CZVH 2BP0A 2LV4A 3ULUC 3SO3B 4N0FB 5JW4N 1SFHA 3U30B 4WO4D 4WNQB 1ASQA 1KGYE 1TQTA 1ADQH 1YNKL 2UZXB 1W8NA 1YSOA 4ODBD 3AWEA 4K2UH 1WS7A 4A68A 3ULVH 1FO0L 3I75B 3PL6B 5E8DH 1IUZA 4G83A 4YHZL 2LABA 3TO4A 2AJVH 2QL1A 4NKMA 4KRMB 2GSGA 1DLFL 1IO4C 3K80A 5I1HL 4MBOA 1NTDA 2IGFL 3GJFA 2RAMA 4R4FL 1DN2A 1IZKA 5D1XD 3L3DB 3VYOA 2DDQL 1RSYA 3HOGA 5GZNC 1KJVA 3IMVA 1XH3A 1UH2A 3TURA 1IQWL 5D93B 1OKEA 2IFFH 3JV0A 1A02N 5CSBA 2YPLD 1NEZG 2YA2A 1SXSA 4M56A 4F3FA 1JF6A 1LO0L 1SY6A 3EJQA 5GGSB 1MAML 5C3TA 2MFNA 1S9WB 4GXUM 3BVNA 5DLLA 2WO2B 4X5LA 4P4KD 5ABDE 3MV9B