1J8HE

Crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSSTGLPYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Structure of a complex of the human alpha/beta T cell receptor (TCR) HA1.7, influenza hemagglutinin peptide, and major histocompatibility complex class II molecule, HLA-DR4 (DRA*0101 and DRB1*0401): insight into TCR cross-restriction and alloreactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hE02
4C56D 2ZUSA 4FZ8L 4Y16D 2FD6H 1IM9D 2BVYA 3UTTB 4PD4J 5D7LB 4YEFA 1JNJA 2Y5EA 3WD5H 2Z93B 3TEUA 5F7UA 2I27N 2F54D 1FNFA 1N0XH 2DKUA 4G8IA 4JQIH 4H5SA 5JLZB 3ARPA 4Y5XA 3B2UC 5C08A 3CXHK 4ZUUB 3WFHA 1A8JH 2CR3A 1OGTA 3Q0HA 5SWSA 4NQCE 4OZIE 5CMAB 1A6ZB 3QUYB 4U1GC 2BNQE 25C8L 3TPUA 3VXUB 1LO4H 3X3FH 3QNXA 5HJ3A 4EUPB 1C5CH 4AEIH 3SGDH 5K9KB 3W2DL 3O9WC 3T3MF 5H35A 3MRGB 5IMMA 1H9VA 1IGML 5DR5L 1M71B 2BSRB 1F2XK 3JTTA 3PXJA 4H1LA 3FTGB 2HFEA 3GJEA 3I6LE 3CH8A 4FABH 1NBYA 4G42B 3LN5A 1KC5H 1AGDB 1KCLA 3HE6C 2VNCA 4XVTL 2FL5A 5IQ9A 3HMXL 4U6HA 3BPNC 3MRJB 3SDXE 2WK2A 2VISB 4Y89A 3MRFA 4RRPG 3QXWA 1NC4B 3NTCL 3TCXA 2VO5A 2GJZA 3PP3H 5IHUL 3HPJA 4N5ED 4KXZI 3QEHA 4L9LA 4YBLB 1I1FA 4JFEB 5D7JB 5FM8A 3MUHL 1E4XH 4FTVB 5I74B 1N7MH 1JHLL 5F88B 4JFYB 1SJXA 1OPGL 5IMOA 2CO7B 4JO4H 2XQYG 3WUWB 2YEZA 3PDGA 1A47A 4IRJA 1U8MB 1MFAL 2X7LB 1A4JB 5KVEL 3GHEL 1UQSA 5HHOE 4PRPE 4HUVA 3GFUA 2OS7A 1DANT 3UJIL 4HC1H 2C1PA 5FK9B 3CFKB 5F6IB 2DMKA 1KTDA 4NDMB 3SPVA 4U1JB 4LLWA 5I19L 1A9EA 1O0VA 4WEUD 1M05B 4OZGE 4I4WB 5FGBC 5E9DA 2OL3L 3X14B 1UCTA 1RJYA 1CT8B 3OJVC 5EPMA 1YPZF 1I9EA 5E5UB 4DTGH 4Q9QH 2BFVH 2YD9A 1C5BL 1FQ9C 2VZ1A 5CWSA 4XCCH 1EUTA 1GGIL 2BNUA 1U8HB 4TSAL 2J88H 2VLKE 3MREB 1DQLH 4NO2A 2ADFH 1DE4A 3SE3C 2ZKHL 3E8UH 3U0WH 1CICB 1QYGL 4YHOL 1T03H 4U1GB 4P2QB 3K1KC 5HHQB 3TN0A 4WDIA 3WJJA 5GJTH 1N6QH 3NPSB 4UZGA 4H88L 4KV5F 2ICWA 4B50A 4HZAA 3CUPA 4Z7UE 1PKQB 3U9UB 4I3RL 5J1SC 1OP9A 3O9WB 4R2GC 5EBWA 5DHVH 2GK0B 2W38A 4BQ6A 1A6TA 1XCQA 3NFPB 3DTXA 4CL7A 1HCVA 5DJAB 3BH8A 4WO4A 3R1GH 2VXTH 4X4XA 1R3LA 3TIEB 5AUMA 2VB5A 5MEQA 3D6GA 3KJ4C 1QSVA 1KN4L 2VXSL 3P73A 3MRIB 4QRQA 3HE6B 4R7NB 3HLAB 1UFUA 5D1ZB 1DQMH 1B0RA 5DFTA 1NMBL 3BPNB 2BDNH 4MJIB 3EKCA 3LKOB 4R90H 4L3AA 2ZNXA 4JJ5B 1DN0A 1CXIA 3PQYE 1FLTX 5EU5A 5HYSB 4MMZC 1DBBL 1UXWA 2H2PD 5BS0B 3D69A 1YUHB 3UPRA 3NIDF 3STBA 4UQ3A 1GAFL 2X4RA 1RU9L 3HNVL 3UPAA 3V4VH 5B38B 2O61A 3TA3A 3HZKB 1FFRA 3D3VB 4PJ9D 4MXQC 1QBML 3OKEB 4G5ZL 3BKMH 3RL1B 4LPCA 1DL7L 2NNAB 3H8NA 4LLMA 4YFDB 4D0BA 5JXAL 1QFWI 4L5FL 4HXBH 4BFIA 4NNPL 1OSPH 4M7KL 4CVZB 4DKAA 3D0LA 3W0WE 2Z8VC 2VLJD 3BZEB 3K2UH 4OLUL 4P5TD 1X5FA 3GHBH 1T80A 4F2MA 3DX7B 4L1DA 1RZIB 1I3RB 3KJ6L 1FYTB 3EGSA 4NC1E 4KKAD 5ALCL 4KJWC 1HYSD 3U48A 4YDLC 5IVXB 4Y2DA 5JHDA 1KFAH 2IH3B 5EZLB 1OAZH 3S5LG 3QO0A 5FO8B 3L7EA 2E9WA 4PJHE 4XAWH 5JW4R 3OZ9L 1LP9F 4JM2D 4WI3A 4YGVB 2FEEI 5GSRB 4NO0D 4ODUB 4R4BA 3QIWC 4RBPK 1FFPB 4HH8A 3RY4A 5FUCE 4NNYA 5C0NC 2P8LB 5DVNA 1XF4B 3DI2B 2J8UF 2ZG3A 3KLDA 1WK0A 2NY5L 4R3SA 3TIDB 3B2VH 4Z7WF 4M62L 3RPIB 4LHUB 2D03H 2FB4L 4LSSL 2FH8A 4IOFC 3WFCL 1BVZA 3VE0B 4POZC 3WL9B 4PRIB 4WFHE 3CH1A 3RKPA 2R8SL 2E8ZA 3C5ZC 3OWEA 4UNUA 4R2GB 4JB9L 4DCQB 1F3DH 1FZOA 5GIRA 1UVQB 2P8MA 2JB6B 1IT9H 3WFDH 5F3HB 5JW5B 3X11B 1C08A 4PFEA 1GC1H 5D7IB 3K4ZA 3P0YH 4LDOB 4XPHH 1C12A 5KZCB 3MNZA 1QR4A 4X7FC 2WWKO 1AFVH 1MRDL 4HWUA 4NM4L 1W0WA 1P4LB 3MODH 4YDJA 3MCLL 3V79C 4NQDD 1U91B 1HI6B 3RVTC 1IL1B 4LCCA 1ZKAA 4ERSH 4X5XB 4MCYA 1AO7D 5ESVA 2FJFA 7CGTA 1PW3A 3CC5A 3IJSA 2BOBB 4PYGA 3WFBL 5D2NC 3NN8A 1KSRA 1KCRH 4QOKE 3VRJA 5DQ9A 4U0RB 3MGOB 4TOYL 4F7MB 2CLRB 2VLLA 3DURB 4CN6A 2ZCKH 1FPTL 1G7LA 1IKFH 1BX2B 2IQ9L 4Z7NF 4MX7B 2A73A 2A9ML 4GW4A 4PRDA 2XN9B 1JHKH 2VLMD 4XWOC 1MHPL 1WF5A 1TJIL 4XVJL 2FRGP 2CMRL 4J2XA 4YHZL 3QDMB 1NBVL 2VTFA 3ARZA 3TESA 4HS3A 4HFUH 4EI5D 4Y4KC 4KDTA 4W68A 2GAZB 1J1XH 3QEQE 5JA8B 4U0QB 4HGKC 4NBXB 2QKIB 4KQ4H 1PGRB 2Z35B 3HZMA 1S7TB 1I85C 2VDML 2OTPA 2VABA 4XP9L 1HXYB 1S8DA 4LEXL 4I0PC 4UAOB 4FXKA 4M5YL 3EJYC 1VPOL 1PY4A 4MA1B 2CKBL 3UBXI 3MFFB 4G6JL 2Q86B 1ZANH 1PG7X 3RUGB 4HKZB 2FIKA 2A6IB 3PHOA 1U8NA 3WNOA 3NCMA 4JG0L 4NSKB 2AEWA 2V17H 1B9ZA 1QRNA 3GGWA 4JO1H 3EYOB 4BFGA 1G6RL 1RJZA 2ADIB 3D39E 3VWKA 1BD2D 3UTQB 4ODSH 4R8WL 5GXBB 3BN9D 4ODVH 5HY9B 2AJYH 3V0VA 3G5YA 2L4OA 3KVQA 5D7KE 4ODWB 4RMUA 4P3CH 4XGZB 2X9XA 1UJ3B 4AYFA 5L2KA 4J6RH 1D3CA 4U1MB 2BOCB 1TNMA 1NSNL 2VITB 4MNQE 1JGEB 3NACH 3VXNA 5F9WB 5KW9L 2P44B 4E41E 1XGYL 4I3SH 2X2YA 5DRXA 2X1WL 3JBG7 1VACB 3MYZA 1MFEL 1A6VL 5IGXH 1T3FB 1Z3GL 5HPMA 2JIXD 2I5YL 1I8MB 1S7WB 3QI9B 1SY6H 1RUMH 4A6YA 3HC0A 1FIGL 4BZ1L 4KZEH 3RVWD 1QFUH 3C5SB 5BXFA 2DQTL 3NFSH 1A14H 4Y4HD 4ZUVB 4JZJC 5FA4B 2DM4A 4XI5D 3VFGL 1SYSA 1LK2A 3DGCR 2X9WA 5AD0B 3O81A 3LQAC 3FFCA 3QNYA 3HMWL 5CBEA 1YMMD 1GGYA 3F58H 3H0TB 3GDBA 1URLA 4Y1AA 1J1OL 3WXVH 3U30B 1JWUA 3QEQA 5KOMC 2FGZA 4ZFZA 2HFGH 2OSLA 1MAMH 2WSKA 2UWEF 1I7UB 3DSFH 4GAGL 1V5JA 1RK0B 4NJAH 5TH2B 5ISZE 5ABDE 3MLZL 2F19H 5C09E 3HNSL 5CSZA 3ARYA 4O9HH 4LHJB 1CFNA 4NQSB 4ELKA 5TQ0L 4PJGF 3VGBA 1IGJB 3I84A 3SKUD 2Y06H 5GHWL 4KPHH 4MWFB 1M7DB 5KSBA 2B0SL 4K2UH 4LSVH 3V7AE 4HEME 1AQKL 4PGCA 2PW1A 4FXGA 5E8EB 1PG7H 2CD0A 2AS5M 3U7YH 3HCVA 5IVOA 3U9PH 1CFSB 3DUUB 1NDGB 1P9MA 4LBEB 3GKWL 2W9EH 1LEIB 1FV1B 2VDQH 2VXVL 5DVMA 3ARED 3TC9A 3HKFA 4ESKA 4PS4H 1ADQH 3DROA 5J6GA 5HI5C 43C9A 1WT5C 1EAPA 5B8CC 5JORA 1RZJC 3RWFB 2QQKH 5L7XL 3LEYL 1LILA 4Y5YB 4OCWH 5BV7C 1IC5L 4HWZA 1CD0A 1D5MB 1N64L 4N0YL 3BKYH 5DD0L 4JY6B 5JQ6H 2MHAA 3SDCD 2WP3O 1U8QA 1TTUA 4JR9H 4LF3A 4OF8A 5H94A 1ZA6B 5GGRA 1QSFD 2RIKA 4ZUWB 5I0ZA 5T5NG 5I76B 4S1QH 4LGPB 5ESQB 3CVHH 4BA8A 2Y6SC 2RHEA 1WFTA 3EOBA 4G9FE 1T2QH 1CXEA 1JFQL 5DMGC 3BZFB 4HX1B 3U4EA 4PB0H 1CXHA 1J88A 4AY0A 4PJ7E 2GTZB 5E4IA 3EO9L 5K9JH 1BREA 3C6SA 1OW0A 1WIOA 4CRPA 1MVUB 3ARBD 4N90E 1R3HB 5FOJA 5I1GL 2KKQA 1D5ZA 3C60C 4JRXB 3V8OA 3OGCA 1GOHA 2YWZA 2R56H 4WV1C 2RB8A 1C8PA 1J5OL 1UB6A 4NM8H 3KS0J 3PWPD 1JF1B 4YX2L 1MCRA 3DJ9A 1TVBA 4NUJB 1I9IH 3MLYH 1ED3B 3BUYB 3HG1D 1HN1A 5DSCB 5I1KH 5EO1A 5KANI 4UB0H 5EB9A 1EBAA 2BSTB 1LMKA 2J6EH 1TVHA 1XIWA 5JIPA 4PJXF 2OR8A 3QO1B 1ZGLB 1V3LA 4J3VA 4GG6B 1VGEH 3EJZD 5TDNA 3EW3B 3HA0A 2DWDA 4DWHA 5KSAC 4M03A 5KVGH 4NQXA 2NX5D 4OD2B 5GGTL 5EZOL 1W0VB 1J0YA 3H7BB 1QQDB 5JO5B 1NFDF 5FDWA 3VFRA 1LK3H 3FO9B 4P9ML 2DOCA 1ZT7B 2YSSB 4HIJA 4HV8A 1NMAH 3VXQB 4ZSOA 1WITA 4KI1A 5C71A 3LV3A 1U92A 3P4MA 4QXUH 1D5BA 2DTMH 3BO8B 1LVEA 5E0QA 5C0FA 5EC2A 3TVMC 3KWWA 5I8EB 4KK5C 2MCPL 4XBPB 3VWJD 1QG3A 1KJVA 5HYJB 5B8CB 3SE4C 3D18B 3JWDL 2JJSC 3DHJA 3MQIA 3JWNC 3LIZH 3B9KD 5CD5C 2IBGA 4TQEL 4NC2B 2JCCA 5KSVA 1F00I 3VFMB 2XWBB 2CJUH 4HDIA 1MJ7L 4JM4L 2OTUB 4I0CC 1AGEA 3WLBA 1JRHL 1NUDA 5D2LA 5IG7B 2IJ0C 1NL0L 2XI9A 3O3BB 3WIHH 4BELD 1W72A 3KDMA 4F8TA 3FOMB 1TQCC 3C08L 3LDBB 1P4IH 4LCUA 4XAKD 5IQ7H 1AKJD 2KZWA 2WV3A 4PJ7A 4OM0H 4Z6AT 5CZXD 4JKMA 3MGAA 2GW5A 1H3PL 4IRZL 4ETQA 4XC3L 5GJSH 3QA3A 3KYMB 5B4MC 1JZ6A 3RNQB 5JPMA 3AS1A 1OGAD 4L8CB 2GKIA 3QQNA 5BMFH 1I8KA 2B1HH 2FIRT 4TULH 1CBVH 3I2CL 1J0IA 3QQ4B 2ZCLH 1FRGH 4L8SC 5MEND 4H0GA 3O4LD 1EDQA 2DYPD 1PKOA 3OKKB 4J3XA 5A2FA 4LCWE 5F7LB 4XMPL 4JG1L 3F8UB 4KJQC 3G08A 1EO7A 1AY1H 1B0WA 3QQ3B 1TZGH 3QZWB 4X9IA 3SDAC 1QNZL 3B6SA 3V0AC 3QUZB 1G7MB 4CJ0A 4J12A 3KYOB 2NXYD 4HWBH 3U7WH 1Q9KA 2IBZX 4GQPH 3QUXC 4XNXL 2GT9B 5SX5H 1ONQB 5SV3A 5KS9A 4OB5H 1JMZA 2YRPA 1IAIH 1DEDA 4YIQB 4AEFA 4RGNB 5T1KB 2IMMA 4LEOA 5C7XH 5KSAB 1T83C 3V0WH 5HYQA 4EN3C 1VADB 3UEZA 4UOJA 2FSEA 3BRFA 4S0TD 2HWZH 5BZDB 2NXZD 1JZ8A 1II4E 2WBJC 4WHYG 2YD1A 2H2SC 1TJHL 3LPGA 4Z8FH 4QHUB 3ME0A 4HIXH 2H3NA 1FBIL 3TVMB 3C6LA 3SKOA 2V5RA 3ULUD 4OLWH 2F8VA 1FVCA 4JQVA 3MJ9H 3WCYA 5IEHA 1IEBA 1ZEAL 2X6MA 2IAMD 3VXRA 3QSKB 4OF7A 2FWOA 1MFCL 4P2OA 3VGHA 3O6FB 4GAJH 4XP1H 4WY7H 1JNNL 1FYHB 3BP7A 3G6JB 1NEZG 4FQJL 4XPAL 1Q72H 3CXHJ 5FGCE 1KELL 2P47B 2W9DL 1JPSH 3BKJL 1T1WA 1S78C 2ZCHH 1G7JB 3Q48A 2Y36L 4DK3A 3VGAB 2NY1B 3JV4B 4HIEA 4N0CC 2EIBA 3PWLA 3C8KA 5HDQL 4MNGB 4OKVB 8CGTA 5E94B 1O7SA 4NN6B 5E8OB 5IWLC 3PGDA 4P48A 3KPSE 1DQQB 3DVNA 3RWEB 4DKEH 3CSBA 3T4AB 5CIPH 3BN3B 3BPCA 4EOWH 5J7CC 1FVEB 4KTEL 3H9ZA 4LQFH 5IMKA 3RRQA 3EJJX 1EEZB 4O51A 4M48L 3CMOL 4UDUB 3Q3GB 4RZCB 1XH3A 2HTKC 4U31A 1UYWL 4LQ1A 2Q6WB 5BRZE 1RIHH 1QFWM 3S7GA 4XVSH 5J12C 2GY5A 8FABA 1FSKB 1FNSL 4PLOB 4OLXH 5IIEB 4YHPA 4UBDC 3V6OC 1CU4H 5J57B 4WUUE 1KPUB 4OQTH 3BSZL 2YD6A 2AERT 5TPWH 3TBVA 1I1YA 3T2NL 1MAKA 4HBCH 3GJFB 2XTJB 2DDQH 4JFDB 1IAKA 3O2DA 4KWUA 3H9SA 5IT2H 1L6XA 3OSKA 4P4RB 2QADC 4HUWA 3NGBB 4ZOAA 5ILTH 3VD7A 4HLJA 3I75B 3LQZA 5SWZE 3VG0H 3EOTH 6FABH 3X17A 1D6EA 3NCFB 3VU2A 3RX8A 1WCQA 2VZUA 4GBXB 3M8OL 1P7HL 3C9NB 1U8KA 3UJTL 3GBNH 1QA9A 3FN0H 4PR5B 4ODTH 3STLB 3QXTA 5E1AB 1GCFA 4LDEB 4Y7MA 5C0DB 4UIKL 4NQED 4YQXH 3LS5L 3QEUB 4FQHB 3TWCH 5EUOB 4PTTB 3RWDA 1NKRA 3NIFF 2H8PA 4X7TA 1CD8A 2BP3A 4MJ6A 3SO3C 4GMTL 2AP2A 4FFYL 3NH7L 4PRNA 4UV4H 4HSQA 4Y5VA 2YWYA 4P3DA 5FKPB 4EXPX 1WAAE 3FQTA 1KJMA 4M5ZH 3VMNA 2EYSA 2X5PA 3P9LA 2PTVA 5C0GB 2ZOKA 5IJVB 4MAYA 1CFVH 3CFBB 4EQ2A 3GUTB 1JUFA 3BKCH 3HHRB 7FABL 1AXSA 3HNTH 3REVA 3V4PH 3O11A 3N1FC 3L6FB 5C70A 4GMSL 1YY8B 3KXFA 3T4YA 2NY3C 3HR5B 5EG6C 2BCKA 4X6FA 3TZVC 1KLGB 1UWEL 1H5BB 4U1NA 1CN4A 4LU5H 2EDOA 4AMKH 2Q7YA 4PBXA 4OCLC 4F7CA 1XGUB 5ICXB 1O7VA 1F4XL 4QHNB 4AL8L 4LLQB 3ZDXF 1G6VK 5AG8A 2R4SH 1ZSDA 3ZTJG 4NKIL 3ECBB 4QRPE 1DEEB 1GGCL 3BMWA 2AK4B 4LCIL 2JJTA 2F53A 5BRZA 5DK0B 2W0FA 2OR9L 5H37G 1HNFA 1YQVL 1QSED 1Z0MA 5LXGL 3IAGC 2VQ1B 3PGCA 4MD0B 5D5MA 5I17B 2G60L 4ZODA 3F7PC 3T0EE 1BFTA 1YN7A 3VW3H 1ODAA 4XWGH 1TPXC 3TYFA 3DXAE 3V5HB 2Y4SA 2ITDA 1WWWX 5FF6B 5CAYB 3V6ZB 1J8HA 5FYJL 4L4TE 5CD3A 5EU4B 5DUBA 2DQCL 3BQUB 3LS4H 4I0KA 3MV7A 1A2YA 2YR3A 2Q3AA 3G5VA 5DMIL 3H3PL 3L1OH 1OAQH 2IANB 2XZCH 5D70H 1ZHNA 2QHRL 5L6YH 4XHJC 1YY9C 2F8XC 4K8RD 5IW6B 2NW3B 4EIGB 4Q2ZA 3JTSB 4C83A 2W92A 3MR9B 3RVVC 3GM0A 2F74B 1G7PB 3AB0C 5GS1C 5IV2B 4KTDL 2DQUL 2I9TB 4U6XA 1BBJA 2VXUH 3LAFA 1KEML 5GGQH 4J23A 1M7IB 3MUZ1 3D25B 5HDBF 5DS8A 1NAMH 1U8IA 1MLBB 5BVJB 1BM3H 2XZAH 1CDCA 4JFZL 1U41A 5DJ6A 2PYEE 1N5AB 5E6ID 3PP3K 3R06B 2P5EE 3HC4H 1KB5A 3BOVA 2IPKA 3DECA 4LPTA 3O2WL 5E7BA 2GY7B 1RI8A 1MREH 1KTLA 4PJFF 2HA1A 4GKZA 4XZUB 4L4VB 1S3KH 1QPXA 3QJHA 1CGXA 4X5WA 3D0VA 2VSCA 1OAUL 12E8L 4GKNA 3CZFA 3KYNB 5C0AD 2IPUK 2AJSL 4PJBB 2A83A 4ELMF 4MD5B 4L9LC 4D0CA 2X05A 1PLGH 1KJ2A 3UC0H 4OF6A 5EOCL 3RJQB 5H2BB 2X4SA 1FE8L 4IMKC 1YYMH 1BZ9B 3CX2A 4S1DD 4F3FA 3EYFB 4JO2L 5C0BD 4ZDHB 4F7PA 3WS6C 1L0XA 1HZHL 1T20B 1R24A 1NGWB 4PJEF 1JWSB 4P4KA 1U3HD 4FQLH 5LKNA 2Z4QA 5E2VL 3O3EA 2A6KB 3IDIA 1JPFA 3PABB 1T5WB 4S2SA 1KGCE 1WICA 4P23B 5E8PB 3FCTB 3Q1SL 3WBDA 5DT1H 4OCSL 4XVUD 1MEXH 3FB7A 4I5BA 1OM3H 5DFVC 2DKSA 4QLRA 3LSOA 3DPBA 4LOUC 2NR6D 2HAZA 2EC8A 1S7RA 3ARFC 1HEZA 3HS0A 1KLFA 3WO3B 4G8IB 5JMOC 1YEKH 4H5SB 4X6CF 1NDMA 2CK0H 1OTTC 4R97B 5F7WC 2NZIA 5E2UH 3FAXA 4Y5XB 4NO3A 1KIRA 3ORJA 5C08B 4XP5L 2HT3C 3MRNA 2CSPA 3RVUC 4M7LH 3WFHB 4X4ME 5IR1A 1OGTB 4OV5B 2C3VA 5SWSB 1A6UL 4IIQC 3S35L 4F37K 3TPUB 1B88A 4NUGH 4YC2C 3S5LA 3MV11 3QNXB 1MCKA 1F5WA 5HJ3B 1MQKL 5JIHA 2BMKA 2AEPH 4KY1H 3OBAA 2OTWA 5C9JA 3QDGD 1NCWH 1N4XH 2EYTA 5AYUL 5IMMB 3HUJA 3NABH 1OAXH 3L5IA 4GXUM 3JTTB 4H1LB 2HFEB 3GJEB 1CGTA 3MZGB 3ARDC 1NBYB 4DZBA 3LN5B 5HHMB 2EC9U 2P48B 3S37X 5I2IA 4HBQA 2FL5B 5D9SA 4ONHA 1UWXH 4U6HB 3LQAL 3KYKL 5HVHC 4FFZL 5FGRA 4FG6C 3DMMD 3ULSA 3ZL4H 1RJLA 3MRFB 1WGOA 3K4AA 4Q0XH 4PY8I 5DWUH 3B8SA 2Z92A 2D7NA 4LLYA 2GJZB 2VZOA 1DQDH 3GJFH 4UI2A 4ZAKB 3HPJB 3UTPE 1D5IH 3QEHB 4K8RL 4L9LB 4ISVA 1I1FB 4BUHA 2Y5TA 2EE6A 3HMXA 3FB5A 3RBGA 1JPST 5TJWK 5I8CA 2C26A 4HUUA 3SCMC 4C56E 4LSRH 1BZQK 5IMOB 4YZFE 5EO0B 5FECA 2YEZB 4IRJB 3E3QE 5E08L 5I73C 1UQSB 6CGTA 4LP4A 1AJ7L 1NFIA 2BVTA 4HUVB 5C0RL 5L9DL 1KENH 2F5BL 2F54E 5I6XB 4ZMAT 2EKSB 2DL9A 2C1PB 1R3IL 2R9HC 1YZZA 3A67H 1KTDB 3LEVL 3SPVB 2NTSP 3ZYOA 4LLWB 3GBML 1A9EB 3P0VH 4AM0A 5F6HI 5E9DB 4ZD3L 1UM4L 3ROOA 2Q20A 5C3TA 4I77L 1RJYB 5EPMB 1ZVYA 1BEYL 2VC2L 1RZJL 4X4MA 2D3VA 4KROC 5IFAH 1QOKA 1EX0A 4NC0B 2EEAA 1C16A 3IETA 4Y4FA 3K4DA 4P46A 5CGMA 1FNEA 3GMRA 3MROA 1HINL 5LGHL 2BNUB 4FN0A 1T6VN 2VUYA 2DQEL 5TF1L 4EI6A 3MBXL 3MA9L 1BAFH 4NO2B 1DE4B 2X89A 3DBXA 2QTEA 4G8GD 2XFXA 4X6EA 1GPOH 1MRCH 4XNMA 5CILH 4CW1B 3EAKA 3TN0B 2E7MA 4WDIB 1GRWA 1AI1L 5DUMH 4C54A 1G9EA 3BWAA 1RZ7H 1NUNB 3HE7C 2ICWB 3WEXA 1E4WH 1BFSA 3QWOA 5EBWB 1RMFH 1LDPL 3BP6A 1A6TB 1QPPA 1XCQB 2ESVD 3QIBC 3SJVA 5I8KL 3SE8L 3DTXB 5JTWA 4J4PC 1DVFD 3ARGC 3BH8B 5JOPD 4WO4B 4DZ8A 3GK8L 4X4XB 2AXGA 1EEUA 1K5NA 1R3LB 2HKHL 1I8IB 5AUMB 1SYVA 3ZTNH 5MEQB 1R0AH 4POYA 2YPLD 5CUSL 3L3IA 5DF0A 1WWCA 3P73B 2N4IA 4QRQB 1UKTA 3BT2L 3VFOA 1MY5A 1FL5A 2MTPA 3S37H 1B0RB 3RTQC 3CLFH 4TSBH 3VXSD 4RAUA 5MHSD 4OUUA 5C9KA 1YPZA 2ZJSL 1DN0B 4L3EA 3IDYB 3KHQA 5EU5B 3ARXA 5D1XA 4G3YH 1P69B 1UXWB 5I18L 4BSWA 3CJJA 3D69B 5F21B 3UPRB 4UQ3B 3TJHD 2M1KA 2X4RB 2O61B 1RZFL 3TA3B 4AEEA 4KQ3H 2DM7A 3OF6D 1IM9A 4OCXH 2MOVA 5CLWA 1V3KA 1C1EH 4UT7H 4H8WH 3N1MC 5H8DA 4LLMB 4D0BB 5L8LB 2DKMA 2F54A 2A6JA 4BFIB 4NC1C 3CDFA 1S9YA 4PV8A 3FQNA 4ZFOL 1ZS8A 3D0LB 4PJ8A 1JZ5A 2ZPKH 3NAAL 3FONB 5CCKL 3GMMA 2X4NA 4F2MB 1IILE 2DLFL 2X1QA 4M6ML 3EGSB 2X4PA 2OJEB 5JZ7D 4FA8A 1IGFH 1GSMA 2RCSL 5KVFH 2NLJA 5J3HD 5L2JA 2PO6C 4Y2DB 5JHDB 3VXOA 3QDJD 2FD6L 2N7AA 1QKZH 4HLZH 3L7EB 5FUCC 2EDTA 5L0QB 3RZCD 1I1AD 1GGTA 4JN2A 3WD5L 1IQWH 5CGYC 3CAFA 4YUEH 4R4BB 1N0XL 4JQIL 1UM5H 5DD5L 1A7QH 1BECA 2VZTA 4NNYB 4JKWA 5D93B 3TO4D 4GXUN 4ZPTA 5LG1A 4R3SB 1G7IA 3VWKC 1JGDA 2YOCA 3W5MA 3DARA 2NY6D 5DQDH 3UDWC 3LCYA 5DHYA 5I71B 3MLPA 3TGXA 1LO0H 1LO4L 4WTZG 3X3FL 1CG9A 4ZNEE 1X5IA 3CH1B 1C5CL 1H8OA 4ZXBC 4AEIL 3ULVH 1FZOB 5GIRB 2P8MB 4R4ND 4JRYD 3BYYA 1RIVH 4YLQT 1C08B 4MAUH 3V8CA 4IMLA 3O8XD 4FABL 3VD3A 2GFBA 4JY5H 1C12B 2PXYA 4TN9A 3MV8D 1A3LH 5JNYA 3MNZB 1KC5L 4J3OC 4NKMA 4MQSB 4ORGA 4PGZA 2EDWA 5L8KB 4PJAB 1X4YA 4UNTA 1W0WB 4YDJB 3MO1A 1YEEH 5FFLA 1LP9A 2ZUQB 4U4BA 1X5XA 1E27A 3EO0B 5E8DH 1R3JA 3GM8A 1OD9A 4LCCB 3FFDA 5AAWA 1QEWA 5ESVB 2FJFB 1MHHA 3IFOA 3IJSB 4BZYA 4CVUA 1T7VA 2Q1EA 2J8UA 5EU6D 3NN8B 1R5IA 3VRJB 5DQ9B 4Z7WA 1U3JA 1N2RB 1VFOA 1H8SA 2VLLB 1E4XL 1G7LB 1CLOH 2VYRE 4XB7A 1KUMA 1N7ML 3RGVC 2CDEA 2A73B 2HRPH 3F62A 4GW4B 4PRDB 5DC0A 1BFOA 4TSCH 4JO4L 3DO3A 4I1NB 5I1EH 3MGTA 4BH7A 3E2HB 2MQ3A 4J7RA 4YK4B 4H1LH 1L0YA 4HS3B 4FZEL 2GSIB 3KPRA 2QHLA 3JVGA 3TLRA 1IJ9A 1S7UA 3I3DA 1K6QH 1MH5A 3HZMB 2VABB 2QR0A 1S8DB 4ENEC 4FXKB 2CXKA 5CP3H 5ELIA 3UTTD 1D9KA 5DRNA 4KKBC 5D7LD 1IGMH 2FIKB 3PHOB 1U8NB 1EEYA 4DTGL 1T0NA 4Q9QL 1AP2A 2BFVL 3QIUA 2AQ2A 4RQQA 3BXNA 3TCLA 3K46A 1QRNB 3GGWB 1GXEA 4V1DE 4XCCL 3VFUA 3M45A 4ZNEA 1RJZB 4ODHH 4F37F 2J88L 2V9RA 3T1WA 4K7FA 1DQLL 2ADFL 5D71H 1CR9H 1UCBH 3E8UL 3U0WL 4ZS7H 3V0VB 3G5YB 1T03L 2DMCA 3N1PC 3QUYD 1W2KT 1NLDH 4PYHA 4J3TA 3ZT5A 4D9QD 3VXUD 3BE1H 5GJTL 1BQSA 1N6QL 5L2KB 1EZVY 5F71A 1MSPA 4KKNA 4QRSA 2IQAA 2B39A 3VXNB 1CD1A 1A6AA 4NQDE 3TBSA 1G6RA 1I3VA 3E6FA 4FQXA 5DRXB 1FG9C 3IAQA 3R1GL 2VXTL 4AIXA 1X9QA 5SX4H 5HPMB 2LTQB 1AO7E 5E4EC 5C07A 2DICA 1DQML 3PWVB 5I1IH 3RP1A 2BVPA 2BDNL 4A6YB 3HC0B 3FQRA 4R90L 4CDGC 2VLJA 1T1XA 1ZOXA 3GHEH 5BXFB 4XCYA 4AQOA 1NC4D 2YRZA 1TZHA 3K8MA 4K3EH 3OAYH 2O5XH 1SYSB 1LK2B 2VLME 3MSPA 4LVOC 4LVHB 5MI0B 3V4VL 5IFHH 5F9OH 4M6OH 1Y6KR 1KF9B 1Z9SA 3FFCB 2HYMA 3QNYB 4JFED 5D7JD 2OL3H 3BKML 5CBEB 4FMKA 3PL6A 1L9NA 2D0HA 4FTVD 3U0TA 3UYRH 4Y1AB 1SM3H 5JXEC 4WCYH 4HXBL 1P4BH 4ZFZB 3QHZH 5LGJA 1OSPL 2OSLB 3LKNA 1HHJA 1UH2A 4PP1D 2D2OA 1YECH 3EYQC 3K2UL 3FO1A 3GHBL 2FHCA 5F9JA 1GL4B 3KPMA 2V2XA 1XIWC 3P4OA 5CSZB 3ZT6A 4J1UA 1CFNB 4ELKB 2ATPA 5DVLA 4WI2A 1B6DA 2BK8A 3OV6A 1KFAL 5HHVH 2PTTA 1SEQH 5EZIH 1OAZL 4X4YA 2XZZA 4FQPA 5KSBB 1BD2E 1FL6A 4XAWL 3C2SA 4PGCB 3VXTA 2HG5A 2PW1B 3MOBH 4NHUA 5EC1A 2A9NH 4YWGH 1BQLH 4PLNC 3HCVB 4K7PH 4MQ7A 1UZ6F 3T8XB 3BPOB 4GUPA 2M26A 5DXWA 2XWTB 3DROB 3B2VL 5J6GB 1CICD 1YMHB 5HI3D 43C9B 4GRLA 5FYLH 1EAPB 5T5FH 2D03L 5JORB 4P2QD 3OKNA 4POUB 5GRZA 1MFBH 2F58H 3GMPA 4DEPC 1OB1A 1AO7A 2UWEA 1M4KA 2ARJQ 1EFXA 3PWNB 4O2FA 1N26A 1IT9L 1LNUA 2MHAB 3WFDL 5C8JA 4M8QA 3OKLB 1U8QB 4LF3B 5H94B 3GMNA 3WNMA 5GGRB 1GC1L 3OTTA 4KKCC 3RHWK 1NFKA 3P0YL 1U8PA 3U7AA 4XPHL 4QXGH 4PJGA 4YHLH 3EOBB 1H15A 3FZUC 2MCG1 3HE6D 4JQXA 1R3KA 5D1ZD 1AFVL 1EFQA 1INDH 1BPVA 1NC2A 1JPGA 4MJID 4PJXE 4D3CH 1YMME 1RUAH 4FMFA 4W6WB 4ERSL 4MDIA 1NEZA 5BS0D 1D5ZB 1U8LA 4YFLF 2UV3A 1G9MH 3OGCB 5SX5K 3SGJC 1XGPA 2I07A 5ERWA 1KCRL 4DGVH 3D3VD 5GRUH 2CR6A 2YPKA 4F7TA 1CVSC 3IDJA 1UB6B 1YJDH 1TVBB 4KAQH 1MPAH 2ZCKL 2D9CA 3DWTA 4IRSC 1IKFL 1CIUA 1J86A 5KSUA 2IPUG 1JHKL 1ZE3C 3GSVA 5EO1B 2FEDD 3CNKA 1ZVSB 1TVHB 4HFUL 4QTHA 1XIWB 1CF8H 1J1XL 3VXMA 5MERA 4MJ4A 3BZDA 5HYEA 5I1AB 4KQ4L 5TDNB 4PRAA 2VZVA 4JDTH 5IW3A 4NQXB 3BIBX 4K71B 1T04A 2Y07H 1VKXA 3QPXH 5F3BA 4DUVA 3I9GH 1UT9A 5C0CA 5FDWB 1ZANL 3VFRB 1J9CT 5DJ0A 4HIJB 4HV8B 4RIRA 2NY7H 4ZSOB 4LASH 3LV3B 1U92B 3P4MB 5ITFA 2V17L 4RAVA 1D5BB 4JO1L 5C0FB 5EC2B 3KWWB 1YEHH 2WINA 3DX8A 1HHHA 2VR5A 2X40A 3EDKA 1XMWA 4ODSL 4JFHD 1FDLH 3P0GB 4ODVL 4JQVC 1KJVB 2AJYL 4JLRA 3MBEA 3DO7A 1QSFE 4LHUD 3BP4B 4P3CL 2NCMA 1S5IH 3BEWA 3JWOC 2JCCB 4PRID 5KSVB 4J6RL 1TITA 4KUCD 4P2OC 5F7KC 4DEPB 4HDIB 4OZIF 2APBA 1AGEB 1MFDH 3PNWA 4R2GD 5D2LB 3WLBB 2WUBH 3TH4T 2DMBA 5ANMA 1W72B 2J4WH 3KDMB 3HFMH 1HQRA 4I3SL 3K3QA 4LCUB 4PJXA 1J1PH 1U36A 5IGXL 4GG8A 1YMMA 1MF2H 5KZCD 4C59B 4ETQB 4AEHH 4LFHD 4K94H 1SY6L 3OKDA 2CK2A 3QA3B 2QSQA 2OR7A 1RUML 1SMAA 3OAZK 1XF2B 5JPMB 1NFDA 4KZEL 1UH4A 2EH8H 3PWPE 1QFUL 1YC7A 1I8KB 1I1CA 1D5XA 4Z76A 2P4AB 1A14L 2Z31A 3NFSL 4KXZH 2HMIC 3SDXF 1HHIA 3HG1E 3SDYH 4K23H 2KQNA 3BAEL 4MXQD 4IHOA 3TPKA 3LN9A 3G08B 5FM4A 3F58L 2PYFA 3B6SB 2FJHA 3VCLA 3WXVL 5DJXA 2J12B 2XN9D 5EO9A 1Q9KB 2B20A 1MAML 2HFGL 3GI8H 2NX5E 1IKNC 2L7JA 3GNMH 4YFEA 3DSFL 4N1CA 1FAIH 2R4RH 4PGDA 4NJAL 3F7RA 2HRLA 5KS9B 3QDMD 2F19L 1Q9OA 3WIIH 5FGSA 4O9HL 1XZ0A 2VAJA 3CDYA 4YHNA 4HKBA 4LEOB 2Y06L 1JYNA 1SVZA 5HYQB 4KPHL 1RZKC 4YDVA 4X8XA 1QBBA 4A6YH 4K2UL 4LSVL 2ARJA 4OFYA 2FSEB 5J89A 3UX9B 4QHKJ 2MFNA 1PG7L 3U7YL 3O0RH 1MWAH 1HH9A 2X10A 3U9PL 1OF2A 4OBRA 3EYVA 1FG2A 2H3NB 2XG5A 3EFFA 2W9EL 4G43A 5DGQA 4Z5RA 1MJUH 3C6LB 3SKOB 2VDQL 2R2HA 4OFIA 4WTWA 4QRUA 3VFNA 4PS4L 5HYIA 1ADQL 5SWQA 5E2WH 4XAKE 5IEHB 3QNZB 4X99A 1IEBB 1EZVX 5DYOA 2QQKL 3VXRB 2D7PA 4G9DB 2FWOB 4P2OB 4OCWL 1E6OH 2RAMA 4HMCA 3BP7B 1EEQA 3BKYL 3BYTA 2D7MA 3B9VA 4LVNB 5JQ6L 1IC7H 1L4IA 4Z7UF 1OGAE 3UMTA 1T1WB 4JR9L 1PY9A 4UV7H 1YDPA 2ARWA 1K8IA 3DGGA 4HIEB 1P2CA 3PWLB 4S1QL 3C8KB 3WN5C 3CVHL 1CLZH 1WWAX 4JFXA 5IMLA 1T2QL 2HVKB 1MVFA 1XAUA 2HFFA 5MENE 4KRPB 5C0IA 2JJTC 3PGDB 3QI9D 3IU4H 3O4LE 4PB0L 3DVNB 5IB1A 5KTEH 2DIAA 3BPCB 4F33B 1GHFH 5FXCH 1MELA 4Z7QF 5IMKB 3WDIA 5K9JL 1JYVA 4O51B 1QRKA 2KUTA 5CSGA 1OTSC 5IB2A 1WTGT 3K74B 4PGEA 4CNIA 3BVNA 3OR6A 1NJ9A 2BHYA 8FABB 5GHWH 2R56L 3W39A 2YBRA 1QFWH 3TFKC 1H3TA 2B5IB 2NX5A 4YHPB 4XP4H 3T0BA 4BZ2H 1HHGB 4NM8L 3KPLA 1RK1A 3VI4E 1I9IL 1NMCC 3MLYL 3TBVB 5DGRA 1IAKB 4NCDA 3H9SB 5I1KL 4ZFGH 1RHFA 2UZXB 5JW4M 4HUWB 4UB0L 5DO2D 2C7UA 4OFVA 1EBPA 3HAEH 3LQZB 3SE3A 2EE2A 2Z0BA 2J6EL 2R2EA 5LWYL 4R96A 1D6EB 3VWJA 4H8WC 4AJ0A 1ZXQA 1VGEL 1U8KB 1FO0A 1WZ1H 3O3UN 3FQUA 5HHNA 3IXTA 3ULUE 5KVGL 3B43A 3H7LA 1AGFA 1VFAA 4NYLA 3LB6D 2WANA 1EGJH 3RWDB 2H8PB 4U7KA 4X7TB 1LK3L 4PV9A 4F80A 1EHLH 4MJ6B 1NMAL 4PJHF 1BVLB 1CE1H 4KMQA 4PRNB 4GSDH 4Y5VB 5E6YA 4P3DB 4QWWC 2ZSWA 2DTML 3WE6A 5CINH 3FQTB 3WO4C 2UZYB 2EYSB 2YD2A 3P9LB 5HGAA 4MAYB 1JUFB 5AZEH 4GS7B 4IDJH 2C3XA 1AXSB 4WJ5A 3REVB 4MMXC 5GRVK 3LIZL 3UXFA 3KXFB 2HT2C 4OTXH 3RUGF 3T4YB 3G9AB 4JFQA 4HD9A 3VRLE 2CJUL 1F3DJ 2BCKB 4X6FB 1H3XA 4TVPD 4U1NB 3KPOA 2Q7YB 4P2YA 4HK0A 3WIHL 5A2KH 5DI8A 5DQJA 5BOZG 4F7CB 2EICA 3STZA 4E42A 3RVXD 3NCBB 1P4IL 5F72S 4L9DA 5IQ7L 2UZIH 1ZSDB 5F7DA 4JZOA 1XCTA 4OM0L 4FFVC 4O5LH 3T0EC 3IDMA 5TDOA 2ED7A 4WWKA 3A0OA 2ZZUT 2F53B 4M9OA 5GJSL 2W0FB 5ACMA 1BHGA 4UT9H 3QG7H 4ZTOH 4EXKA 5C2BH 3PGCB 5D5MB 5BMFL 1NQBA 2B1HL 2CUHA 3K8KA 4PJIE 1YN7B 2XY2A 5HVFB 1TETH 4TULL 1J0KA 1BP3B 1CBVL 5GS0C 3TYFB 3UROR 2ZCLL 4LNRA 1FRGL 2ITDB 4D9RD 4JRXD 2APVA 1J8HB 5CD3B 5DUBB 5TQ2H 2NZ9D 1Q9WA 4Y19A 2Y7QA 3MV7B 4OZHE 1A2YB 3WYRA 3G5VB 1AY1L 1TZGL 5C09D 4PJ5A 1ZHNB 3QIWA 2CRMA 5F97E 1RULH 5T3XH 3ARQA 5D1QC 3U7WL 4HWBL 4NQEE 2GJ6A 1HWHB 3O45A 4U1SA 2HKFH 4Q2ZB 3D5OF 5ID0A 4C83B 4OB5L 1DFBH 5JIKA 3WNLA 3O3DA 4MLIA 1IAIL 1LO2H 4P0DA 2BC4A 1UWXK 4U6XB 1BBJB 4APQD 2YMXH 4DJMA 3D9AH 5C7XL 3V0WL 1JN6A 3C5ZA 2JB5H 4X80H 5DS8B 5I1CH 1RUQH 1U8IB 3GSQB 4KVCH 4JPIA 2HWZL 2X44D 3FT3A 4D9LH 3SOBH 5DJ6B 5K9QG 5B38G 4KHTH 1HE7A 4UILH 1H3GA 4Z8FL 1LE5A 1KB5B 4HIXL 2PCPA 1A9BA 4OLWL 1CXKA 2DQIH 2IPKB 4F15B 3B8YA 3MJ9L 4PJDE 5HYJD 4UTBH 1KTLB 4GKZB 3QJHB 3D0VB 4GKNB 3S34H 3CZFB 4GAJL 3PJSA 3MNVA 4XP1L 3G6DH 4WY7L 2A83B 2E6JA 4LSDA 5HPOA 4G9FD 4D0CB 4X6CE 4N0FA 1KJ2B 5D2NA 5K59E 2X4SB 1Q72L 2ZUXA 3IU3A 5GRJH 2EO1A 4F9PC 1QSEE 1JPSL 5FYKD 5A16A 2ZCHL 4F3FB 1ORQA 3MRLA 3P4NA 5C92A 3HRPA 1FN4B 1VFMA 3TBTA 4F7PB 5HD8D 3DRQA 4P2RA 1R24B 2Y6SD 4NZDA 4P4KB 4PTUA 5DMGD 1JBJA 2Z4QB 3O3EB 3IDIB 1JPFB 4DKEL 2YD3A 4S2SB 4EOWL 4M1DH 3M17A 4LQFL 4DKFH 3I50H 4Y4KA 1TCMA 4V2CB 2P5WA 3FB7B 4I5BB 1RIHL 3LSOB 4X7DC 1I85A 2VXQH 2DIBA 5CBAA 4XVSL 1S7RB 1HEZB 4I0PA 3HS0B 3G9VA 1MI5A 4UDTA 3V4UH 2ED9A 3T3PE 4DOHE 1CU4L 4FQCH 4LCYA 4PJFA 5KN5A 4K7PY 4OQTL 4NO3B 1KIRB 5TPWL 3QUZD 4TVPL 4HBCL 1M1SA 2DDQL 4ELMA 2GSGA 3DIFA 3MRNB 5IT2L 1OCWH 5IR1B 4WI6A 2C3VB 5ILTL 4ZS6D 1A7PH 4Z7VE 3VG0L 1JZ7A 3EOTL 6FABL 5I1JH 3S5LB 2WAHA 4RX4A 1D6VH 3VGGA 2BMKB 3R0MA 4YXLH 2OTWB 4RGND 5C9JB 4PJEA 2EYTB 3GBNL 3FN0L 5T1KD 4C57C 3HUJB 4ODTL 5KSAD 3L7FA 4YQXL 3B9EA 2XZQH 3TWCL 3AY4C 4PG9A 4DZBB 3CGTA 5JIIA 3WNKA 4U1IA 4UV4L 5D9SB 5C0AE 4ONHB 3TBWA 4M5ZL 2QQLH 3ULSB 4WTZA 1CFVL 5J11B 1RJLB 4N0UE 1G9NH 3BKCL 5GISH 2J5LB 4OF5A 3MRMA 4X6CA 2MPAH 4XCFH 3V4PL 3HNTL 5C0BE 3TNMB 3U1SH 2Z92B 4MVBD 4LLYB 1NGYA 1OHQA 4QY8A 5EFIA 4NKDB 3O6FD 4JZJA 5GGVH 3DUHA 2AGJH 4Y16C 1CGYA 3OJ2C 4ISVB 4LU5L 4AMKL 5DTFA 2R0ZH 2Y5TB 2OXHA 1FHGA 3DVFA 3FB5B 1JZ4A 3E3QC 3PDDA 5ADOH 5I8CB 1TMCB 1U2HA 4HUUB 2NY1D 4YO0A 2R4SL 4O02L 4DQOH 2AV7A 3AFLA 5FECB 1LWRA 3AM8C 1TXKA 1NFIB 3WIFA 4NFBA 1A7NH 3PXHA 2VSDA 2DLTA 1KOAA 1AE6H 2NY4D 5FKAB 2IH1A 4IJ3B 3VW3L 5IM7A 5IHZB 2APWA 1Y0LA 4XWGL 4AM0B 2DI7A 1DQJA 2X1PA 3ROOB 2A0LC 3LMJH 3GSNH 5L88H 5C0EA 4U05A 2HTLD 2YN5A 3LS4L 4AT6A 4NIKB 1C16B 3GO1H 3IETB 3QWRA 4Y4FB 3L1OL 2C3HA 4P46B 5HVWA 3GMRB 1OAQL 3MROB 2XZCL 2YA0A 2DI9A 5D70L 5L6YL 3QDGE 1KEGH 4EI6B 4RGMC 2XTJD 1ZT4B 2DBLH 4JFDD 4XBEL 3Q5YA 3DBXB 2EDHA 1ACYH 1TQBC 2XFXB 4X6EB 3WSQL 4Q6IC 4XNMB 4I3GA 1HHKA 1DSFH 2I9LA 2EDJA 4HWNA 3SO5A 3HRZA 3BWAB 3MV9A 5JW3H 5BVPH 1YJDC 3NPZB 3WEXB 3PWUA 4GBXD 4L8BA 1AC6A 3GI9H 3BIKA 2VXUL 1MHCB 5GGQL 3SJVB 3UP1A 2DRUA 4N0RA 3ZKMD 2A1WH 4DZ8B 1FLRH 4F57H 1NAML 3VI3E 4GRWE 1K5NB 1BM3L 1XGRA 2XZAL 1SYVB 2NY5C 5CJXA 3L3IB 4CMHB 1A64A 4QRRA 5AZ2H 3VFOB 1FL5B 5C0BA 1EO8H 2HT4D 5EN2A 3HC4L 2FGWH 2EC9T 5CJOH 4RAUB 4RGOH 4OUUB 1J87A 1JGUH 2QQNH 4NJ9H 4NP4H 1YPZB 4L3EB 4M7ZC 3U79A 4F9LA 1MREL 5D1XB 3S3SA 1X44A 4BSWB 3AROA 1NGXA 3FQWA 1S3KL 3L95A 4JFFA 4M00A 1ZLWH 1N6VA 2EDNA 2ZSVB 3C60A 1INQA 1T0MA 5CJQH 3ULUH 1PLGL 3UC0L 5GGUB 2D4FA 1YYML 2G75A 2VL4A 4WIQA 1ZLUK 2F54B 2E9JA 2A6JB 5GRVL 2JLLA 1S9YB 4PV8B 3ZHDA 1JIBA 5T3ZD 1ZS8B 4PJ8B 5J9PA 1VA9A 4FQLL 2AK4D 1CD9B 2X4NB 2V7HA 1J7VR 1I7ZA 2VJXA 3U83A 1ND0A 2X4PB 2E7LA 1IAIM 1MHEA 1HOCA 2NLJB 5L2JB 3VXOB 1IGCH 1KB5H 3PWJA 1CFTA 5DT1L 1OM3L 1MEXL 4MB5A 1OP3H 3U0PA 1P7QB 4WW1A 4K94C 1D9KC 4G8GE 1E4KA 3HI6H 4WNQA 4JN2B 1TFHA 4JFOA 3BQUD 3TBYA 5E7FA 4OAWA 1YEKL 2EDFA 1JZ3A 2CK0L 1JK8A 2IAND 5J4MA 5E2UL 4DK6A 1JI2A 4HQQH 4N9GA 4NBZB 2ESVE 2VIRA 4R7DA 2QBWA 4Q9BA 1G7IB 1JGDB 3QXUA 1KJ2H 4M7LL 5JOPE 4HUNB 5DHYB 3KPTA 2VZSA 2YPLE 3V9FA 4NUGL 4I2XE 1F6LL 2JJSA 3KGRA 1A7OH 5LBSH 2AEPL 2H2PC 3AS3A 4HK3J 4KY1L 4LLDA 4MHHG 1NCWL 1N4XL 3VXSE 2IMNA 4GRMA 3NABL 4OF0A 4D94A 3RY6A 3LRSA 1OAXL 3O4OC 4CAGA 2Y72A 1O5DT 5DFWH 4LPUA 1FH5H 4OFPA 4IMLB 3SQOH 3OAYK 2PXYB 3N1QC 5JNYB 4NKMB 4ORGB 4JO2H 1QUNA 3RFZC 3MO1B 2V6HA 2YUWA 3QAZB 2VE6A 1LP9B 1E27B 2H1PH 3WJLC 3ZL4L 4BQCA 4M7ZB 1R3JB 4P5TC 4R0LC 3FFDB 3LKSB 4Q0XL 4NZUH 1QEWB 3N85H 5DWUL 5GGSY 2ILLA 1MHHB 4L4VD 3PIQA 1NUFA 3IFOB 1HYSC 1GYAA 1DQDL 2Z91B 2J8UB 2O5YH 4YHIA 5FOBA 4DAGH 1D5IL 1R5IB 4Z7WB 5B3JE 5CEXA 4L8SA 3I3EA 1JNLH 1GGBH 1WSST 4AG4H 4JM2C 1EHNA 2DLEA 3RNKA 4IOIA 1PJ9A 1BFOB 1P7KA 4LSRL 3QDJE 1U3YA 4GKOA 3SDAA 1FCGA 5FUZH 2DM3A 3ULVD 3MGTB 4BH7B 3VG9B 3AUVA 1BQUA 2Y25A 3QUXA 1WZLA 3KPRB 1KENL 1I1RA 1S7UB 1MH5B 2EKJA 4GXVH 3A67L 1B0GA 3CVIH 4P23D 1UB5A 3SKMA 2AEQH 2QR0B 3ZDYE 3P0VL 4P49A 3GEWB 4D0DA 1D9KB 2VH5H 5DRNB 1CLYH 4KJPD 1QVOA 4ZFFA 3GIZH 1U93A 2NPLX 1EEYB 4UQ2A 1T0NB 3TNNA 1AP2B 3QIUB 5IFAL 4RQQB 3BXNB 1AGBA 5CSBA 3TCLB 2BERA 5IF0A 2WBJA 4QYOA 2YUXA 3VFUB 4HC1A 4YHYB 3AU1A 4DN4H 1AH1A 1BAFL 2NY2B 4JRYE 5C08D 2YPVH 1P1ZA 5IKCA 5SWSD 1GPOL 1CK0H 1MRCL 5CILL 5AG9A 3QULA 3RIAK 5DUML 3MV8E 4ZUSA 1RZ7L 2NY0B 1E4WL 2M8XA 1MCSA 4QRSB 1RMFL 5DMYA 2IQAB 3R8QA 3G04A 5EWIH 1NPUA 1F45A 5TE7H 4J8RA 1CD1B 1A6AB 3TBSB 1G6RB 3E6FB 4FQXB 4HJ0D 3MOQA 2RGSA 3ZTNL 2Z8RA 1ZGLM 2EXWD 5HHMD 3KLHD 1K9TA 4HEPG 5C07B 3S37L 5EU6E 4ZQKA 3CLFL 4TSBL 2BVPB 1JZ2A 3SDDA 1Z2KA 4JCLA 2ICWI 3FQRB 1U9KA 5DHVA 2VLJB 1T1XB 4WI9A 4XCYB 2LE9A 3QFJA 1G84A 1WAAF 3F7QA 3SE9H 1TZHB 2DBJA 4G3YL 3ZLQC 4UU9A 4EI5C 5I8OH 4QKXB 3LEVH 3UO1L 4ZAKD 3L3DA 3BDXA 1RD6A 4KQ3L 5EUKA 2ZOLA 2EE3A 5A2LH 4OCXL 2MQCA 3PHQA 5ID1A 4P5KA 3RZCA 1C1EL 4UT7L 4H8WL 3PL6B 3BIAX 3U0TB 5MEPA 4ONFH 3V6OA 3GSRA 4PJCE 2FECI 5LGJB 2VLRB 3LKNB 4PY7A 1HHJB 4AIZA 1AXTH 2EDKA 4OT1H 5IUSA 3NA4A 1OAKH 3UTTE 5E99H 4OI9A 1G1CA 2ZPKL 1EH9A 2ENYA 4IRJD 1T2XA 3FO1B 5D7LE 1T2JA 5F9JB 3KPMB 1DQTA 3THMH 4GAFB 3P4OB 2GTWA 3BN9C 2A6DA 4J1UB 2ATPB 1IGFL 4K3DH 5KVFL 4W4NA 1MCPH 2PTTB 5FO9A 1WBXA 1X5AA 4X4YB 1NCDH 1QKZL 1AHWA 1FL6B 5DZNA 5E9DD 3QXDA 2ZUTA 3VXTB 2HG5B 2WMPA 4NHUB 1IQWL 3FO2A 5EC1B 2VN4A 1EUUA 4YUEL 1JPTH 3MRQA 4D9QE 3VXUE 4RNRA 1IVLA 2LQRA 4NCC1 1A7QL 1Q8MA 4GUPB 4N5UA 5IROC 2XICA 4JHZA 4S1RH 5FM5M 4NZJA 3LD8B 1F2QA 2H9GA 4O4YH 4CADA 4GRLB 2B2XH 5DQDL 5T33H 3OR7A 3VFVB 4LVEA 5C6TL 3RVWC 5EIIA 1LO0L 1A5FH 3GMPB 3TN0D 4CVXA 1FVDA 2IG2H 4NN5C 1CIDA 1ZMYA 2FZ3A 2YA1A 1OB1B 3KHOA 3OKOA 4Y4HC 1AO7B 3ULVL 1G1YA 2UWEB 1C7TA 4LKCB 4XI5C 1EFXB 4Z18A 4O2FB 1LNUB 5C8JB 2Y9RT 3TZVA 1RIVL 3QR2A 4M8QB 1UM6H 4WO4D 2CPCA 1WZMA 3GMNB 2X70A 3GIVA 4MAUL 1IE5A 1U8PB 2X41A 3B3IA 4JY5L 4LAQH 4PJGB 1A3LL 1H15B 3JWDC 5EZJA 3KLSA 3N06B 1R3KB 1L6ZA 3ABZA 4L1HA 1NC2B 4ZYKA 2W1NA 1JPGB 2BHZA 4JFEE 2EDEA 1QR1A 1IARB 4RFEA 5E8DL 2VDRH 4FTVE 4MDIB 5BZWA 1NEZB 2Z31C 1U8LB 4M7JH 2C4XA 1XGPB 2I07B 3TA3D 1X7QA 4NRXA 5DJZA 2CIIB 1A7RH 1X6NA 4F7TB 3IDJB 2YA2A 3VA2C 3QDAA 4GRWH 5FYLD 5TGBA 2BNRA 3RY5A 4NT6A 4YXKH 1CLOL 3CSYA 3DYPA 2HRPL 5KSUB 2GK2A 5HDOA 5DD5H 4TSCL 3GSVB 1Z5LA 5I1EL 1KN2H 2GIYA 3D85A 3AREC 1UKQA 4QTHB 1Q1JH 1H3UA 3DSNA 3VXMB 5MERB 1C7SA 3MUGA 1K6QL 4U1KA 3MRBA 1IAMA 4Y2DD 1KCUH 4PRAB 5JHDD 1BMGA 5DUPH 5J1AA 5GS1A 1R5WA 4XPBH 1T04B 3X3GH 1VKXB 3N0PB 4LPWA 4MS8D 5F3BB 5C0CB 4FXLA 4P2QE 5DJ0B 4RIRB 2OYPA 5FCUH 1Y6NR 5J06A 5ITFB 3S36H 4RAVB 5E00B 1PKQE 3BJ91 4O2CA 2VMFA 2WINB 3DX8B 1F3RB 1HHHB 2OQJA 3OMZA 4ODHL 5JQHC 5D71L 1CR9L 1UCBL 3JV6B 5EU3A 3EDJA 1BIIA 4ZS7L 4JLRB 3MBEB 4DUWA 3DO7B 1T22A 1IAOA 5AAMA 1UENA 2PR4H 4NBYB 1NLDL 3BEWB 4G6MH 3BE1L 1FJ1A 3GMOA 4PREA 1FFQA 2J8HA 1MCIA 2OI9B 5DRZA 1N8ZA 5ANMB 1UJTA 1L7IL 4MJIE 3QCTL 1HQRB 1WV7T 4QGTA 3V5DA 4IMKA 4GG8B 5EOQH 1TZIA 5BS0E 32C2A 1YEGH 5F7MC 4JVPA 1YEJH 3WS6A 5I1IL 1ZT1A 3BP5B 3D3VE 1Z9LA 4DVRL 4LSUH 3MCKA 4Z77B 4PLKD 5B3NA 2DD8H 5JDSA 1NFDB 3QQ9C 4Q9CA 4DW2H 4FZEH 1T4KA 1D5XB 3A6BH 5DK2A 4Z76B 2Z31B 5K9OA 3IVKA 4K3EL 1HHIB 1V7MH 2O5XL 4YHKH 1KJ3H 1RV6X 5IFJA 3O3AA 1FZJA 5IFHL 3EYSH 1NBZB 4U1JA 4JFPA 5F9OL 4M6OL 3UZQA 3KPNA 4IHOB 1SY6A 3ARFA 4JO3H 2YRLA 1FYTE 1TTFA 3DVGA 2PYFB 3UYRL 3VCLB 1SM3L 2JK5A 4G6FB 4WCYL 4A2MA 2VKWA 5DJXB 4NQCA 4OZIA 5IVXE 1P4BL 5EO9B 3QHZL 2BNQA 3I6KA 4FQ1H 1MY7A 5JMRA 1KBGH 3VJ6B 3S98A 4JKLA 1YECL 4PGDB 2E8YA 5GS3A 3A6CH 5FYKU 3C8DA 2P24A 2X4QA 1Q9OB 1GIGH 3P4LA 4YZFF 4JVWA 3EUUA 3VWJC 1IRAY 4IIQA 1XZ0B 2WLZA 2AJXH 4YHNB 4HKBB 5HHVL 3V7MA 3B9KC 1J11A 1SEQL 1ES0B 5EZIL 3LEXB 3OX8A 4YDVB 3GMQA 1Q0XH 4JFHE 2H32H 5F9AC 3MOBL 2H26A 3ZYZA 4R6UA 5CGYD 2A9NL 4YWGL 4J3WA 1BQLL 1HH9B 1IC4H 4K7PL 3ARDA 1OF2B 5LAXA 3SDXA 3EYVB 4PRIE 2XXCB 1FG2B 4Z5RB 4G43B 4OLYH 4U2YA 1ETZA 5CZXC 1ZLVH 4OSUH 1UG9A 2DIJA 2R2HB 4Z7QE 1UZ8A 3CDCA 4QRUB 3RIAF 3VFNB 5KJRL 5SWQB 1Y18A 5FYLL 2A38A 5T5FL 3NVQA 4X99B 5D7IE 5E70A 4P9HH 5DYOB 1MFBL 2F58L 4KRNA 2CLZA 5L2KD 3SGEI 4A2LA 2WWMD 3MLXH 3U36A 3U4BH 5EDXA 2O26U 5C86A 1T89C 4XPFH 2X4OA 1SQ2N 5DVKA 1FNLA 4MXWH 1YDPB 1WC7A 2VDNH 3DGGB 5B39B 1P2CB 4QXGL 5HHOA 4YHLL 4PRPA 4JFXB 5IMLB 5FV1L 3SCMA 2HFFB 5F89A 5C0IB 4HWEH 4WWKC 1INDL 1BJ1H 5IB1B 5ECJE 1TLKA 2NXYC 2OJZH 4NKQB 3WLWD 5DJCA 4Q74A 4D3CL 3BZEA 5IBLD 4XNZC 1RUAL 4OZGA 3QXVA 5IB2B 1IBGH 3IXAA 3LHPH 4CNIB 2XN9E 1TTGA 4RFOH 3BVNB 1G9ML 3IKCA 3OR6B 4OCRH 2FX8H 4OD1H 1NJ9B 3CVHA 4DGVL 3T65A 3W39B 2YBRB 5GRUL 2YXFA 3FFCD 3QDME 4PJAF 1AR1D 3KPLB 1RK1B 2VLKA 4JKPH 3S6CA 3CPLA 1YJDL 4KAQL 4LPYA 1IGYA 1MPAL 2BVQA 2NXZC 4Y1AD 3OXRA 3D48R 2OP4H 3RWHA 4NO5A 3VGFA 1EVTC 2DWEA 2C7UB 1KACB 4Z7UA 2I24N 2R2EB 4FNLH 4MXVE 4NQTA 4R96B 3RUGE 5T5NF 1CF8L 4TPRH 2VR4A 3I02A 1FO0B 1JTPA 2IAMC 3FQUB 3ARVA 1DBKH 3HE7A 4JDTL 4WGWB 3IXTB 5HHNB 3VE0A 1AGFB 1VFAB 3CFIC 4V1DD 2Y07L 4HPOH 4NYLB 4GKSA 3QPXL 4ZTPH 3QIBA 2AEIT 3I9GL 4KKBD 4J4PA 3ARGA 1BQHG 4PV9B 3MX0A 5DMJB 2NY7L 2FH6A 2BXZA 1SJVA 2OMNA 1AQDA 3CFDA 4LASL 2J6EA 3KJ4B 2ZSWB 3WE6B 1OARH 3PQYA 2XACC 5HGAB 5JPNA 1YEHL 2BJMH 4XBGA 3ARUA 2ERJC 3J7HA 3RTQA 2XA3A 1EO5A 1FDLL 4K9EH 1V3JA 4WJ5B 4PUBH 1S5IL 1U91A 2P8PA 1IL1A 4OGAD 4JFQB 5GQBA 1MFDL 1YNTA 2OZ4H 4LLUA 1PZ5A 2WUBL 3KPOB 4PLJD 4M4PA 4HK0B 4WFFD 5DQJB 1MCOH 2J4WL 3STZB 4E42B 3HFML 1TIUA 4WHTA 3T0DA 3W0WA 1J1PL 5F7DB 4JZOB 2DJUA 4F7MA 2YD8A 1MF2L 1MCWM 4M1GH 4AEHL 5BJTA 3IDMB 3M1BB 4K94L 5TDOB 4WWKB 4BH8B 4EUPH 1MCCA 3MLVH 1NGZA 4DUXA 2R15A 1I8LA 1XEDA 2EH8L 3KPQA 1VESA 2A77H 5DMKA 4PJHA 3SEPA 2VDLH 2DQJH 4FP8H 2BY1A 5DC9B 4LNRB 1YNLH 4YDLB 3MTRA 3SDYL 2PO6A 4QEGA 2Z35A 4K23L 4G8EA 1MCWW 4KDWA 1Q9WB 1SJEA 3VFTA 4Y19B 2XWJA 1UKSA 2Y7QB 4G80A 2WLYA 1Z6JT 3QUMA 1BZ7A 4PJ5B 4HF5H 3RUGA 1A4KA 3QIWB 5J13C 2WWKT 1U0QA 5BOPA 3ILPA 4NSKA 4N1EA 4LGSB 3LPFA 2GJ6B 3GI8L 3O45B 4U1SB 5I1HH 3GNML 4OZ4A 1FAIL 2R4RL 5ID0B 3O3DB 4JGUA 4BQ8A 3WIIL 1VEMA 1XIWD 3UDWA 2DTSA 1ZV5A 5LQBH 2BC4B 4JM2F 4I13B 4BKLA 3JV5A 1ZAGA 1JN6B 3C5ZB 4MNHA 4TUKH 1U6AH 4IOSD 4JAMA 4ZXBA 4RBPH 5IEKA 4A6YL 3ZO0A 3D2UA 3V6BR 4HWBA 3FT3B 1MJJA 3O0RL 1MWAL 3IDGA 2VUOA 5EIQA 4XXDA 1LE5B 2PCPB 4TVPE 3RIFK 1MJUL 1RUPH 3N50A 4PIRF 3O2VH 4Z7OE 3T2OA 5E2WL 5E2TH 4L8DB 4QOKA 1WUNT 1TENA 2IEPA 3PJSB 1E6OL 3MNVB 4ZO8A 5T3XD 1JTTA 4NCC2 3ESVF 4N0FB 1CYGA 5HXMA 5D2NB 1HKFA 1IC7L 3IU3B 2QJDA 5A16B 1VCAA 3BAEH 4UV7L 4KK8D 1ORQB 3MRLB 3P4NB 3OB0K 3WXWH 5DD3H 1G0XA 3TBTB 3DRQB 3MJ9A 4MSWA 4P2RB 4ORZC 3RGVA 1CLZL 4PTUB 4GO6B 4MQXD 4D9RE 4JRXE 3IU4L 1KCVH 5KTEL 2XKUA 4ONOA 1GHFL 3M17B 4TUJA 5DJ2A 4K8RC 1BOYA 2DQDH 2E6QA 3GKZA 5CEZD 4Y4KB 4JHWH 5D96C 2JE8A 2P5WB 3FB6A 3LRHA 1IGTA 5E03A 4I0PB 1L7TH 1MI5B 1QFWL 4UDTB 4XP4L 4BZ2L 4LSTH 4LCYB 4PJFB 4B5EA 2PW2A 3D39A 1MNUH 5KN5B 5CIPA 4PGJA 4GG6E 5J13B 5E6IC 1KCSH 4ELMB 5I16A 2GSGB 3DIFB 4ZFGL 2RFXA 1F4AA 5EBLA 4WFGD 4HFWA 2D4DA 4MNQA 3UAJD 4KZDH 4E41A 4MD4A 4JHAH 1P6AB 2R23B 1WZ1L 4PJEB 4OQTA 1RURH 2FEEL 3L7FB 2DQFA 1FL3A 2J2ZA 1EGJL 3PP4H 4S11A 4PG9B 9CGTA 5HYJE 5AYQA 2BY0A 5CJXC 1EHLL 3MJ7A 3ZMRA 1CE1L 4MCZA 4OI7A 4ALAH 4U1IB 5EBGA 4GSDL 3QEGH 1LHZA 5CINL 3TBWB 5ESQA 3C6LD 1CZ8H 3ZKXC 1U3HC 3BZFA 1U95A 4WU5A 5AZEL 1S9XA 2GUOA 3Q5TA 4X6CB 5FYKE 4IDJL 3V6FA 4F9LC 2D0FA 1FZMA 1WLHA 5IK3A 1NGYB 4OTXL 3E0GA 4QY8B 4KK9D 5EFIB 4JZJB 4KI5D 1S7SA 1MCQA 1KXTB 1SHMA 4HUXA 5DTFB 4ZO7A 2NR6C 1WCBA 2V7NA 3P3YA 4M1CD 2UZIL 5CKGA 1HDMA 4YO0B 3EHBD 1FO0H 3L5WA 3INUH 5ISZA 4OZFG 1JF1A 2AV7B 4O5LL 5BQ7B 5JXEA 2R39A 3F12A 5C09A 5GS2H 3HI1A 1IFHH 4E5XA 1U2CA 4J3UA 4KRPD 4PB9H 5HSFA 4EDWH 4UT9L 3WIFB 2V5MA 1GVIA 3QG7L 4ZTOL 5C2BL 2E7LC 1GGUA 3T09A 2IH1B 5LWYH 5HHXH 5IM7B 1TETL 5J8OA 1Y0LB 3L3KA 1DQJB 1EXUA 1NLBH 4APQA 1TJGH 5TQ2L 1E4KC 2WP3T 5C0EB 1F02I 4AT6B 5D7SH 1W0VA 3BMVA 1KIPA 2B4CH 3G6AA 4QCIA 4RGNE 2CQVA 2AV1A 5HYFA 5T3XL 1RULL 3MFGB 1CL7I 3FT2A 3H9SD 2R0KH 1BOGA 2HKFL 1FORH 1HHKB 4OCYH 3DMMC 1DFBL 3HRZB 3FOLA 1LO2L 3MV9B 3PWUB 3JUYA 4L8BB 3BIKB 2YMXL 3D9AL 2NW2B 5BV7B 2E6PA 2PF6A 3RY6C 2MKLC 4DVBA 2JB5L 4X80L 2XWBA 5I1CL 1RUQL 4G9FA 4KVCL 1XGRB 3SQBA 4D9LL 2HJFA 5A1AA 4CJ1A 5DJDA 3SOBL 3RKDC 4F8QA 4X5LA 4KHTL 2YD4A 4UILL 2P46B 4QRRB 5C0BB 5EN2B 1JNHA 1WBYA 4XX1E 3G6JE 2DQIL 4MAYD 4PRBA 3NZ8A 1V7NH 3BD5A 4UTBL 3RNQA 1NGXB 3FQWB 1NAMA 2HJLA 3L95B 4JFFB 5GRWA 4M6NH 2Z9TA 4MNGE 3S34L 3KXFD 3ZE0F 3B5GA 3G6DL 3C60B 1INQB 1T0MB 3SGJA 1QLFA 5GRJL 3UZVB 4EDXA 4WV1B 4HH9A 1LE9A 2G75B 4RA3A 1JYXA 5ETUA 1AIFA 1QHPA 4IRSA 4FQQA 5J9PB 2V7HB 1HIMH 2F53D 4GAYA 4KVNH 4B7LA 1I7ZB 4YBQD 4M1DL 3S35X 2XPGA 1MHEB 3MYJA 1HOCB 5T1LA 4DKFL 3BH9A 1WIPA 3I50L 4TTDD 1I7TB 2WQ8A 2EIZA 3PWJB 1CFTB 3U0PB 3DUSA 2XTJE 4JFDE 4WW1B 3O6LH 2VXQL 1LEGA 1J8HD 4WNQB 1NEUA 1AR2A 4HIIA 1V3MA 4JFOB 4LSPH 1DVFC 3TBYB 3V4UL 2M2DA 4FQCL 3MV7D 3W9DA 5ACZA 1JCKA 3SHSA 1JK8B 2YD5A 4EVNA 4M02A 2EIEA 1A6WH 4N9GB 2FYYA 2VIRB 4R7DB 3HAEG 1A02N 3ZKND 1OCWL 4JANA 4NRZA 5EUOE 4EEEA 1Q0YH 1A7PL 1JMXA 3S97C 5I1JL 4MA7H 1D6VL 4YXLL 4LLDB 3RA7H 2W65A 1MCNA 4GRMB 3TT1H 2V2TA 3TJHC 3LRSB 2WQRA 4B53A 5GZOC 4DFHA 2XZQL 1NCNA 1F3JA 1TQCB 3RIFF 1KLUA 3EDDA 2ITCA 3IRZA 1NCTA 1DUZA 2AVGA 1RJCA 1BGXH 2VE6B 2QQLL 3SDDC 4YGAB 4BM7A 3CK0H 4MB3A 4NRYA 3WDHA 4DGIH 4MA8H 4I9WD 1G9NL 5GISL 4I48A 4KJYA 4XCFL 2MPAL 2IWGA 1BBDH 3H9YA 4OI8A 3U1SL 2I25N 3PIQB 5JZ7C 4LCWA 5J3HC 3Q3GA 5T3ZE 4YHIB 5FOBB 5GGVL 5J0BA 2AGJL 2AK4E 3W11C 2Q6WA 5KAQF 1SBSH 4L8SB 4RWYH 2R0ZL 3KPPA 5CEYA 3RZCC 3DX9B 2BSSA 1I1AC 3T0XA 5TE6H 5ADOL 1NGPH 3RNKB 4IOIB 4JHBA 4UTAH 2OLDA 1P7KB 4DQOL 4HUMB 3SDAB 3AS2A 3S4SG 3CFCH 4FFWD 4P4KD 4TVPH 3VD9A 4JPVH 2XQBH 3QUXB 1IKNA 1L0QA 3WNNA 2PUQT 3OAUH 2WNGA 1A7NL 3CDGA 2NY6C 5DC4B 3K7UA 1AE6L 2IANE 1UB5B 3SKMB 1OP5K 3O41A 3MACH 1QLRA 3B83A 4K3GA 4D0DB 5C0JA 1DP0A 4MDJA 2XV6B 1AHWC 3KNBA 3LMJL 3GSNL 1QVOB 5L88L 4R4NC 4EN3B 1U93B 1K3ZA 3MRHA 3BGAA 4UQ2B 3TNNB 2Q87A 3QPQD 3GO1L 5E95B 1AGBB 5IF0B 1OTUD 3O8XC 1CGWA 4EBQH 2WBJB 1AD0A 4QYOB 1KEGL 1INEH 4NWTH 3AU1B 4ZNCD 4PRHD 4N8CH 3VI4F 2DBLL 3ARWA 1P1ZB 4LMQE 5IKCB 1ACYL 2B8OT 4LLVA 5FKPA 1CFQA 1JGLH 1GZPA 1DSFL 3QULB 3UBXG 4HMEA 2P7TB 4E0RA 4ZUSB 5JW3L 5BVPL 2LFGA 5IHLB 3GI9L 1LEKA 3VGEA 5I1DA 3G04B 3RDTA 3MRKA 3OG4B 4JDVA 4J8RB 4U1LA 3RZWA 2A1WL 1NCBH 1FLRL 4F57L 4NQUA 3LKPA 3ULUF 4QTIH 3KPSA 2KH2B 4L4VE 1EK3A 5AZ2L 4HKXA 4L3CA 3X13A 4TUOB 4ODXB 1EO8L 5A3ID 4ZQKB 3WN5A 4O02H 1FGNH 2FGWL 5CJOL 3C87A 4PJBE 4RGOL 3SDDB 4RRPA 1JGUL 3PUCA 5DHVB 2QQNL 4NJ9L 4NP4L 1LO3H 4LK4A 3QFJB 5IHBA 3EOAA 4Z78A 3SY0A 5F7EH 4UU9B 1F11A 5AWNH 4M43H 2BZDA 5JR1H 1GC1C 2JJUA 3L3DB 5I9QC 2CH8A 3ULVE 2DM2A 2P49B 2ZOLB 5EUKB 4WUUA 1EJ6A 5CJQL 3ZKSD 4W70A 3ULUL 5IB4A 5IBUG 3PHQB 5ID1B 5J12B 3RZCB 3VRLF 2AXJA 4K9EC 5MEPB 1UACH 3GSRB 3MC0A 1P84K 4ZOEA 2Z8SA 4RMWA 5SWZA 4PY7B 4AIZB 5BV7H 4WFED 5KVMC 2W0KA 1ZHBA 4XBEH 5IB5B 5JUEH 2QADB 4OGYH 4HAGA 3WSQH 2A6DB 3CSGA 5FYKH 2MWCA 1OOAA 1T21A 3QUYC 4WU7A 5BW7C 1MIMH 1JV5A 1WBXB 5FO9B 4X6DB 1G7PA 1KB5L 1IGCL 1ZWIA 5C08E 2VWEE 1AHWB 3BFOA 4PJIF 4DGYH 3QXDB 3HI6L 5SWSE 4CVWA 3FO2B 5MP6H 1YEIH 1WAAA 3D25A 3MRQB 2V5TA 3DETD 4RNRB 1MLBA 3HI5H 4Y4FD 4P46D 3TJEH 2XA8H 3SO3B 5GRYA 4HQQL 4OZHF 5E6ZA 2H9GB 1QACA 1KJ2L 2X89D 4CADB 4YBHA 2V9TA 1HSAA 3OR7B 3DYMA 5EIIB 1HCFX 1E6JH 1K4DA 1P5UA 1FVDB 4CVXB 5HHME 1S7XA 2XOTA 1A7OL 3L5JA 3OKOB 5LBSL 3C09C 3MLUH 1G7QA 4F7EB 1ZK9A 5DEGA 2NY3B 3SJVD 3GRWH 3TZVB 2EZ0D 2X70B 3GIVB 1JP5A 4QRPA 1FH5L 3SQOL 4YBLC 5D7JC 3B3IB 4RA0C 2BXYA 5EZJB 5I74C 1T7YA 4XNYH 3UTSB 3TYGH 3L9RB 1T1YB 3WFZA 5JHLH 1CGVA 4XNUH 3T0EA 1UH3A 2R1YA 1QR1B 4PP1C 2H1PL 4MGXA 4RFEB 3DXAA 2DQHH 4L3ED 5DEFA 2N1KA 1KT2A 5D1XD 4OM1H 5BZWB 4L4TA 4TVSa 4NZUL 3BDBA 3N85L 4JJHA 3K80A 1BJMA 2DL2A 5EULV 5I9QB 5F6IC 2O5YL 2E7BA 2MQ0A 4GJTB 1X7QB 4PJDF 5E8PA 1TPXB 4NRXB 4DAGL 5DJZB 3FCTA 4JN1H 2C4FU 1JNLL 1EMTH 3TT3H 1GGBL 5TGBB 4WENB 2BNRB 4AG4L 4NT6B 4MZ3A 3CSYB 3BD4A 1N59A 2Q8BH 5K59F 1I4FA 3VFSA 1DZBA 2FATH 2GQHA 1Z5LB 5FUZL 2BSED 5FDYA 3VRIA 5D72H 1WVZA 4PJ8D 3D85B 5HHPA 5E9DE 1W8NA 5D1QA 2HJKA 3FHAA 3FT4A 2QQQA 5KAQG 1CICC 5HI3C 4OV5A 3MUGB 4GXVL 4U1KB 3CVIL 3MRBB 3T0AA 1G7HA 4LRNH 2EXYD 1ZLVK 2FX9H 3AB0B 5J1AB 5GS1B 1R5WB 2UYLA 2AEQL 3O6KH 5FEBA 3S88L 1RAMA 3NPSC 1YYLH 2PYEA 2VQUA 3OKMA 5H35B 1P7QD 2VH5L 3P9WB 3LN4A 2NQCA 3F6LA 2P5EA 1CLYL 2A0LD 5GZND 3GIZL 5KANG 5FUOL 2FDBP 3AAZA 4O2CB 35C8H 3T3PF 2AAVA 1QBLH 2OQJB 3ILQD 4DN4L 3DOSA 3QCVH 2YPVL 5IQ9B 2CKNA 1OSZA 5D1ZC 5EU3B 1BIIB 2VN7A 1CK0L 5CP3A 1T22B 1IAOB 1OVZA 4OIBA 5DURB 1FJ1B 3GMOB 4HCRH 3DVIA 4OLVL 4PREB 4U3XA 3WKNA 3C09B 1FAKT 2FCBA 4Z7VF 1LDSA 5EWIL 1FZKA 2X4TA 5DRZB 1BQHA 1N8ZB 4XNQA 3L3OA 5TE7L 3L5XH 1X3DA 4ZAKA 3IDXH 4H0HB 1OT1A 1NAKH 3V5DB 1SEBA 4F9PA 1A1NA 1TZIB 2PXYD 3H9HA 32C2B 1PX3A 4LHQB 3RWCA 3OXSA 2W59A 4X4ZA 1A3QA 2DQGH 1ZT1B 3RPKA 3MCKB 5CJ5A 1H3VA 5JDSB 5EO0A 4IM8A 3BRGC 1UGNA 2FEDC 5FYLE 5IBTH 4BFBD 1T4KB 1DR9A 5DK2B 3SE9L 3RU8H 5I8OL 5K9OB 3IVKB 2EKSA 4ZOBA 3GBLA 1A1OA 4YJZL 1AXIB 3FN3A 3O3AB 1FZJB 5IFJB 1X4ZA 4YE4H 1T5XA 4JFPB 4CU6A 4WW2F 2J7LA 3KPNB 2EECA 3IJYA 1FC2D 3ARFB 4WHDA 5F1IA 3T1FA 2DB8A 3DVGB 5JA9A 1JHTA 2KDGA 2JK5B 3BHBA 4ONFL 1YQ2A 4NQCB 4OZIB 2G9HA 2PN5A 2YD7A 5JHDE 1UXSA 5BO1H 4OGXH 2BNQB 4OF3A 3I6KB 3PV7A 4Y88A 5CWSB 1AXTL 4OT1L 1OAKL 5E99L 2YKLH 1F8TH 5LVEA 2B7DT 2P24B 3K2MC 2X4QB 3KPRD 3THML 4UT6H 1QLEH 4IIQB 2ICEA 3WHXA 4LARH 4K3DL 2OL3A 4YC2B 5LGKA 2DLGA 4CW1A 1MCPL 1GZQA 3U2SA 1NCDL 3OX8B 2C3WA 3CUPB 2BRRH 5T3ZH 3GMQB 5FO7A 3UPCA 3L5HA 1CXFA 3MXVH 1D9KD 1DDHA 2RJMA 2H26B 3DRTA 3NMEA 3ZE1F 4ZPVA 1JPTL 3AY4A 3ARDB 3QIUD 5LAXB 2UVFA 3ZE2E 3SDXB 2ATKA 1I8IA 3SKJH 2HN7A 1ETZB 4S1RL 4W4OC 4QGYA 1UZ8B 3I85A 2NY2D 1UC6A 4O4YL 5HVHB 4NZTH 1Y18B 2B2XL 2V5SA 5T33L 4LIQH 5DRWA 3IDNA 3CFJA 1A5FL 4XMKH 2EDLA 1CLCA 2CLZB 2IG2L 2NY0D 2JJWA 1N5YH 3U36B 2Q76A 2B4CC 3MZTA 4HJGA 3FB8A 3OG6B 1HILA 1VENA 4PJAE 3UO1H 1B4JH 2GCYA 4HS6A 1XF5A 4X8JA 4C56A 2X4OB 4Y16A 1UM6L 5F7HA 1F90H 4FQXD 2WZPD 1WC7B 4U0RC 1NH6A 3AVEA 3VXPA 4LAQL 4GOSA 5HHOB 4PRPB 2CGRH 1VSCA 3GSUA 3SCMB 3VI3F 4GRWF 5F89B 5C07D 3AM8A 3OGOE 2D9QB 5DA4A 2WUCL 1I8LC 5DJCB 5I73B 1IMHC 3ISWA 3FONA 5FM5O 1EJOH 2VDRL 3C2AH 4OZGB 5INCA 5I15H 3IF1A 3UTZA 3IXAB 2FX7H 4LSQH 2AXHA 2OJEA 4M7JL 3IKCB 2ZUVA 1EV2E 5J6HA 3CVHB 3T65B 3RJDA 2CDGA 3QO0B 3TH2T 1A7RL 3MOAH 2IC2A 4NN7C 4UAOC 2VLKB 3CPLB 1JWMA 4MA1C 1IGYB 3PL6D 2BVQB 1CDHA 4YXKL 3OXRB 4KROB 3FO0H 3RWHB 4NO5B 2OM5A 2VLRD 5M94B 2DWEB 1QO3A 1KN2L 2VDOH 2NYYD 4Z7UB 4IS6A 3ESUF 2LU7A 1Q1JL 1V05A 4Q6IA 4KRLB 4K55A 3I02B 5C6TH 1UA6H 1KCUL 1QRNE 1IZJA 3HE7B 5DUPL 3R0NA 1UJ3C 4NGHH 4CBPA 4XPBL 2ADGA 2VAAA 3LZFH 4GKSB 3X3GL 3QIBB 4GQ9H 4LKXA 4Z0XA 4ONGH 3ARGB 5F9WC 1LD9A 5INDA 2QLVB 5IJKA 3VH8G 4ZO9A 5FCUL 1D7FA 1AQDB 3CFDB 1DLHA 1I3GH 2YUZA 5L2KE 3S36L 5HI4D 3PQYB 1OD7A 5JPNB 4JE4B 3DLQR 5M7QA 4XBGB 4NNXA 3RTQB 1U8JA 4BK5A 2HLFD 4P57A 3QI9C 4PJAA 4GRLD 2R0LH 1IEHA 4Z0BH 2WBKA 3CU1A 5CFHA 2PR4L 1S7VA 1JE6A 1MUJA 2P8PB 4G6ML 3EO0A 2F15A 3D87B 4MCYB 4XTRD 4LLUB 1YNTB 1PZ5B 4M4RA 3CC5B 4TNVF 1EFXD 1RY7B 4JKKA 1X5YA 4U3HA 3BESR 3GSOA 5EOCJ 4WHTB 3LY6A 3W0WB 3MCG1 4BK4A 4Q6YA 1N2RA 5EOQL 2O5ZH 4YDKH 3ZDZE 5J56B 3L3HA 1YEGL 1RUKH 5BJTB 1VFUA 1YEJL 3U30C 1NGZB 1GH7A 1NC2D 4LSUL 1LQSR 3AMLA 2DD8L 3FFCE 4KMTH 4U33A 4DW2L 3KPQB 5DO2C 2IBZY 4JY4A 5DMKB 4PJHB 3A6BL 4TRPH 2GSIA 4Y1AE 1WFUA 1YEFH 4OLEA 3BJLA 3WHE0 2CXGA 1MLCA 1V7ML 1DUYA 4YHKL 2PO6B 5CJBA 1KJ3L 1PEWA 1PFCA 4WUKH 3WNPA 1HK6A 3GMLA 4G8EB 3EYSL 1DBAH 1SJEB 3VFTB 1PX4A 4NN7B 2XWJB 4G80B 1ZTXH 2R0WH 4OZFA 3QUMB 3GZKA 3BWUC 3LB6C 4JO3L 1BZ7B 5B3JF 1A4KB 4R26H 3IFPA 1U58A 1JRHI 4JGJA 2AJZA 3ILPB 4P3WA 1CTOA 4FQ1L 1KBGL 2AXFA 1RZGA 5KSBE 4OZ4B 2JELH 5A43C 3VWKB 4RWHA 3A6CL 4M7LT 1GIGL 4XC1H 4DN3H 5CZKA 3WS3A 2VRAA 3QHFH 3RAJH 3VXMD 2AJXL 1DJSA 1HKLH 2CKBA 1VHPA 4Y8DC 4BKLB 3IDUA 4MNHB 1DLFH 4UIMA 4Y5YC 4JAMB 4ZXBB 5IEKB 4I18A 1VERA 1Q0XL 1ZA3A 3D2UB 5F70A 1KTRL 1L7IH 5C0CD 3ZDYF 4QXWA 3QCTH 4WTXA 4PJ9A