1J8HE

Crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
VKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSSTGLPYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Structure of a complex of the human alpha/beta T cell receptor (TCR) HA1.7, influenza hemagglutinin peptide, and major histocompatibility complex class II molecule, HLA-DR4 (DRA*0101 and DRB1*0401): insight into TCR cross-restriction and alloreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hE02
2R2CA 5EO1A 4LCWB 1AFVH 2W0PA 1ZA3A 3F5WA 4CN4A 3LD8C 1WEJH 2I27N 4PRDB 4E5XB 1YYLH 4AEIH 2WANA 4ZMAT 3RWDA 2LU3A 4NRYA 1H8OA 3WNOA 3AB0C 1BZ9A 3U4BL 3MJ9A 4M6NH 1AHWA 4PRHB 4OZGA 2IALB 1IM9D 1UM5L 1X9QA 3QUZB 3QCTL 1TVHB 4L8SC 5C0AB 4Z7UB 3LIZH 2VLRB 4J3WA 2QR0A 3TH3T 3C60D 3T4YA 3I75A 1AXIB 1CR9H 4NDMB 3NZHH 1PD6A 2NY6B 4IOFC 3REVB 4QO1A 4PJHB 3A6BL 1KNOA 2AXFA 1PEWA 1HN1A 3FRUA 3B43A 1KLUA 4FFZH 1DR9A 3TVMA 4PRNA 1OLLA 2CXGA 2G5BB 3DXAB 5IMMA 1JE6A 3RWGB 2PXYC 2ZG2A 5D72H 2E9BA 2OI9C 3H6JA 3P77A 2BSRA 1P9MC 2ARJQ 4PJCE 3VXMA 4M93B 3EAKA 2H8PA 1K8DA 1W8OA 3QIUA 3ARDD 3BP4B 4HPYL 3S7GA 3QI9B 1S7XB 1BBJB 3FQXA 4IEFB 4KTEL 4P9ML 2ZWLT 2W38A 5FO9B 3U4EA 3VWJD 2IGFL 4QOKE 4KJYA 5IK3B 4BH7A 1CLOL 2ICWB 4CNIA 3VWKB 1JUFB 1OCWL 1J0JA 4YNYB 5D2LB 4ZDHB 3DX6B 4ORGB 1A6PA 3QPXH 1RZFH 3KLAA 3TN0C 5BOZG 1YEKL 2NYYC 1IQWL 3EGSB 2X9XA 3CJJA 3N50A 1U0QA 3AS2A 1FFRA 2YD8A 5E9DD 3GJFH 1RULH 4TVPE 2WIMA 3AMLA 3BP6A 2B20A 2VSCA 5DJZA 5GGSB 5F71A 1VKXB 5IGXL 1ZGLP 1KTDB 5FGCE 1Q9KB 3MMEA 1IGJA 3SE4C 3HUJA 3T2QA 3WFCH 4F7PB 5C86A 4PG9A 3MO1B 5F9WC 4ZUWB 3RY6C 2CK2A 3ABZA 3FN9A 3QIWA 1ETZB 5I1IH 2FDBP 2F53E 4R2GB 4KQ3H 3CVHA 4Z7WE 5KG9B 1Q0XH 4PJAA 3THMH 3HZVB 2DQHL 4HGKC 5L8JB 4NYLB 4LAQL 3WEXA 5FYLE 4FFYL 1JNLL 2QSCH 3OX8A 4BFBD 3JTTB 4GG6E 1IBGH 4PJXF 1AP2A 2X42A 4JFZL 2ZSWB 4XWGH 2JIXD 5C0DB 3EOTL 5IFAL 3O2DL 3P0VH 2IH1B 4CADA 4EOWH 1JNHB 3JTSB 1JPSH 1T1ZB 1DVFA 3ME0A 4L9LC 1I8LA 5DHYA 1II4E 2EYSA 3MROB 3DV6A 3GSNB 1INQA 4YE4L 4FQXD 5KSAD 4MAUH 4XC3H 1QP1A 5HYIA 3D3VD 2R23A 5EOTA 1NMAH 1KLGB 1CFBA 5FYKH 5D1ZB 2Q76A 4G6KL 2IJ0C 3LZFL 4DVRH 1IGCL 4PB9H 4U1IB 4NJ9L 3BP5B 1KCKA 2H1PH 1QVOA 3CGTA 1PY4A 5HDBE 4NM4L 1SEBA 3ZT6A 3G6AB 1PLGL 5IBTH 5ISZA 5IF0A 2FGWH 2WLZA 5DXWA 5DJDA 2XZQH 4PP2B 2XYCA 3L3KB 1KTLA 3H9SD 3VGAB 3QUYA 1XAUA 2ZG3A 1C12B 4MWFA 3FFCE 4OF3A 1ZHLB 5EBWA 4C59B 4RIRB 1F3DJ 1W0VA 1DQML 2DQGL 3O6LL 1K8IA 1CE1H 3S4SG 2VE6B 4HKXA 3GBNL 1P5VA 4QRPB 3FO0H 5JQ6L 2A6IB 4P3DA 2ADFL 2F54E 4R0LB 4GAFB 4F8QA 3ZYZA 3IFPB 4MA8L 3ET9F 5CMAA 4Z7OF 3FOMB 3R0NA 3D2UB 3RWHB 3MGOB 4ZXBD 3CLFL 1XCQB 1NL0L 1ZS8A 1OGAD 2X89D 1WZLA 5ESVA 2IBGA 3O6MH 5FYJD 1DQLL 5IM7A 2I5YH 4PJDF 5H37H 3RZCC 2OSLB 4KI5C 1OF2B 1AQKL 3OKDA 4HT1L 1A0QH 5C6TL 4RMSA 4WCYL 1NCCH 5FOBB 4HLZH 2ZZUT 2W65B 4JQIL 3O11B 3V7MA 1FDLH 4Y1AD 4S1QL 2NW3B 5I8EA 1UA6H 2FEEL 4WENB 4D0DB 1NGZA 3L5XL 3WUZA 2ERJC 4PY8J 1QEWA 3U9PL 3LOWA 1KJ2H 2ARJA 1QR4A 4OTXH 3REWA 5TDNA 3PIQB 4PR5B 4JY6A 3WJJA 1I4FA 3IVKB 3LKQA 4DUWA 1VEPA 4WO4B 5DEGB 1V3JA 5HY9A 2AJ3B 2H9GA 3SCMB 1RIUH 1AIFB 1D5XA 1T1WA 2YUVA 4TN9A 4EZMA 4GRLD 3V8CA 3PNWB 2DBJA 4G9FB 5HSFA 2YPVL 3FO2A 4N8PA 4NUGL 3P11H 4PY7B 1VPOL 4IDJH 1MCJA 1PGRB 1CDIA 4YHNB 3BE1L 2H3NB 3MJ7B 4HX1A 2QL1A 5FKPB 4OLVL 3SY0A 5D96B 1S7QB 5HGAA 5GS0C 4HUNB 2W0LA 1MVUB 3O6KH 4OIIH 1XMWA 2VL5B 4I13B 1U8OB 3FT4A 1NBZB 1KG0B 3WLWC 1P7HL 2LVEA 3NA4A 4LLDB 4MQTB 1S7VA 3GB7A 5L88L 1YPZA 1FHGA 2PCPA 4GW1B 4RA3A 4NQEA 2YBRB 4Z77B 2VC2H 4Q97A 1Q9WB 3WUWB 4KROB 1H3UA 2BSSA 5HYJA 2BSTA 3V5KB 1N5YL 2AXGB 4I2XA 4CVXB 3F7YB 3MNVB 3MFFA 1WLHA 3DMMD 5I1JH 4OLYL 2A9NL 3PV7A 4P2CG 4X6CE 5DRZB 4U33A 4WRLA 1CGXA 3MFGB 3IDGB 3CH1B 4LSUL 2W91A 4BK4A 1QG3A 4YXKH 3RQ3A 1JGVH 4MNGA 4WHCA 3WCYA 1U8PB 1U8LA 4R26H 4OF7A 5F7EL 1AD0A 4APQB 1F4YH 3QP3A 4L3EB 5CJQH 4DVBB 3PQYE 3QEHA 4C58B 4EDXA 1ZHKB 4X7SL 5TJWK 3MLUH 4G8FB 1UM4H 1NGYA 4WW2A 4BJLA 1HCVA 3EUUA 4DKFL 1CXFA 2ZUQC 5BJTB 2HAZA 5IP4A 3OAZH 3TV3H 2HJFB 5J9PA 3ZKSD 5D7SH 5DUBA 4KY1H 4Y4HD 4P5TD 1QFWL 5ESAA 2ITDA 5LVEA 2WBJC 2IF7A 4YR6A 5GGQL 5C0NC 3M8OL 2ZNXA 5KAQG 1RUQL 4IRJD 3T3PE 3FO1B 1DE4A 5HHVH 4JRXA 4HC1L 3L5HA 2P44B 4KWUA 2O5ZL 4NWTH 2DM4A 3VFRA 4OD1H 2CKBL 43C9A 2BJMH 4WFEE 4WDIA 4K7PL 1JK8B 2NY2C 1TZHA 1OP3H 2DLFL 1SMOA 5HYSA 4XPAH 3UTTE 2AS5M 4YQXL 1FL6A 1F02I 1SJVA 4X9GA 3CMOH 3LEXA 3DNKA 4PJBE 1YUHA 5E08H 4TQEH 2JJWA 1YC8A 2NNAA 2D7MA 2HYMA 3MBEA 5L8KB 4OD2B 4RNRB 3GMNA 4I0PB 5DD5L 3CVIH 1OHQA 4QHKI 3QUXA 4XAWH 3LVEA 1MRCL 3E2HC 1F97A 3QXWA 1U8KA 2VLKB 2VIRA 4G6FD 4NPYB 4QRRD 5KVEH 5JPMA 5FUOH 1R3IL 4G7YL 1FJ1B 3GJEB 1KCRH 2OZ4A 5TE7H 1ZV5A 4AL8L 4U1SA 5GGSY 3EO1B 4LCYA 2GT9A 2AW2A 4PREB 4UDTB 3ARUA 1XEDA 3U79A 1T7WA 3SDCD 2YPLD 5JORA 3PHSA 1Z5LA 1J0IA 4GRWB 3O4LD 2QADC 4EQ2A 1LK3H 1EXUB 1NKOA 3VW3H 3VFUA 2VLJB 2UY6A 4E42A 4LIQL 1QYGL 5JLZA 1KB5A 3VFTB 3HZYB 1ZTXL 2AV7A 1FIEA 4K9EC 5DDHB 3T3ME 1WITA 1YY8B 1ND0A 4N0FB 2W0KA 3A67L 4XMKL 4O58L 1XIWC 2CK0H 5BCAA 2H6PB 4LSPH 2C3XA 3PG2A 1K9TA 3H3BC 4R8WH 3QULB 2CJUL 2NY3B 4U3HA 4JGJA 2XXCB 1DLFL 3MCKA 1RK1A 4X4XA 3BH9A 4Y2DC 4YEEA 4NM8L 4YFLF 1FAIH 4ZD3H 3DSFL 1O0VA 2OL3H 1MH5A 3WNKA 1WK0A 1I1CA 4NO3A 1FFNA 3VGEA 4N0UB 4PRPE 4E9LA 3HZKA 4HK3N 4QWWC 3B4NA 4R3SA 1KCUH 1S7UB 4EBQL 1TMCB 1Q1JH 3OR7B 5JW4Q 5HHOB 5C7XL 2P8PB 3ZDZF 4GXVH 4OCWL 4PJGA 4NC2B 5HTSA 3UBXA 4EI5A 3OJDA 1CFVH 3L3JB 1DBMH 1RPQA 3O4OC 4GLRH 4WEMB 1FG2B 2BOBB 2NX5B 4Y7MA 3VXTA 3JV6A 3QFJD 3EW3B 5GSVB 3HKFA 4LOUC 2CIIB 3AAZA 3KGRA 2UWEB 1DQJB 4KKBC 3I50L 1CK0H 3IAPA 3KJ6H 4RWHA 3F7RA 4BSVA 2EEAA 2VXSH 1KEML 1BLNB 1A47A 1IFHL 3PF2A 3ZKMC 5HBBA 1KEGL 1DBBL 3OKLA 1RZIB 1CGSL 4HV8B 2J1KA 4YUEH 1NEUA 4ORZC 3LKPB 4AIOA 3B9EA 1DZBA 2B7DT 2E5EA 2CO6B 4CRPA 3HAEH 4P59L 4N9OB 3LKSB 2HVJA 1MCDA 1AD9A 1GGCL 1NJ9B 5T1LB 3VFMA 1FO0H 3OKNA 1CFQB 1S7WA 3NACL 3HI5H 4F7MA 2A38A 3ES6B 1WBXA 4FQ2H 1KJVB 4ZFOB 4P49A 4NBXB 4XNZB 5IHZB 4PJXA 3O9WD 5D7IB 3CFCH 3PGCB 2MHAB 3Q6GH 2JLLA 5EUKA 3W5NA 4QY8B 3S96A 5EIQA 4FQ1L 3ARGC 1U2CA 5IFJB 1RUKL 2Z4QA 3L5WA 1MHPH 1KTRL 5CJOL 1BD2B 4MAYC 4TRPH 1G7MB 5HVHB 6FABH 3QIBD 5CCKH 4PV9B 2PETA 2Z8RA 1H3GA 5HHXH 2DWEB 3EZJB 2EXWD 1N3NA 5CGTA 4AJ0A 3ZL4H 3CSGA 4YBHA 1V7NH 3FB5A 3V0VB 1TCRB 4ZO8A 1CQKA 2IAMD 1LP9E 2D7PA 4X98A 3HCVA 1IMHC 4KVNL 2R0WL 5IV2B 1XF4B 4XVSH 4RAUB 1J1OL 1U8IB 2FYYB 5E8EA 1FNGB 4HSQA 3KPPA 4M7KL 1KIQB 1N0XH 3S4SB 1WISA 2APBA 1J5OH 2XKUA 4XBGA 2G9HA 1TNNA 2HFEA 4FQLH 1U92B 4AIZA 2RGSA 2HKHL 2NZIA 1OTTD 4LRIC 4MA3B 5I1AB 4Q7DA 5MERB 1LO3H 3IDIA 2DI7A 4NNPL 1A1NB 5I75B 2BCKA 4U0RC 2GJZA 3BN9D 3OSKA 4K3HA 3WXWL 1QLFB 2D03L 1DANT 3WLBB 1A6WL 1IAKB 1ZLWH 3QDGD 3BHBB 4JZJB 5LAXB 4KK5C 5HVWA 3KYNA 3W5MA 3LEVL 3E8UH 4XPTL 2Y7QB 1JHTA 3TNMA 3FCTA 4IOFD 1RIVL 4G6AC 3EO0A 2Q6WB 5MENA 3G08B 2ZOKA 3D5OF 1XGUB 4O02H 3RGHA 5GS0L 2FHCA 4ZTPL 4L8BB 4NO0B 4CMMA 3SHSA 3BZEB 2Z93B 3RL2B 2VDKH 4GQ9L 1T0PB 4QNPE 3ROLB 3QHFH 1RJLA 4PJDA 5K93A 1MRFL 2ICEA 2P49B 4HFWA 1J0KA 5ETUB 1G9EA 1UKQA 4RGMB 5GIRA 1M6OB 1ES0A 4F57H 5DA4A 2ICWJ 3V5HB 5AYUL 2PXYD 4WUUB 2XACC 3STZA 3N1FC 3PWNA 1MUJA 1NMBL 1VFUA 3HNTL 3SE9H 3U2SA 3RIFF 2VO5A 1NAMA 3IU4H 1RVFH 1MFNA 2OJZH 4Y5YA 3LPWA 4M8QB 2HT4D 3I6LE 3D25B 4A6YL 5JW3L 3DETD 1IAIH 3QXAB 5C0IA 5IVZB 1DBAH 2FZ3A 4OJFH 1T1XB 1RURH 4TSCH 5JO5B 4HWBL 4P5KB 1BJ8A 3ARTA 4OM1L 4G43A 5DMIL 1DQQB 5K59F 3TN0D 3TVMD 4PGZA 2GSGA 2J88L 1G6RL 4POZD 4ZFGL 1AGEB 2E8ZA 3RX8A 3RUGF 2XKNB 1WBYB 1BX2A 5I15H 2WINB 3D39E 3Q3GA 4M8VA 4KRNA 4P4RA 3MBXH 4NP4H 1R3KA 3HC4H 2GQHA 3IDXL 3S88H 4S0SD 3QIUD 3IXAA 1N64L 5IB5B 4X5WB 1EA9C 3C6SB 4L4TB 3CFKA 1T2QL 5F6IB 2W59A 5HYEA 1D5ZA 3SE3A 5ID0A 4HS8L 3CFJB 4PJ9A 2FH6A 2BP3A 3DHMA 4M7ZC 5BRZB 3GJFK 1FFPA 4OFPA 1KBGL 3F5WB 3I85A 5CEXA 4WY7L 3KXFA 4HBCL 4XXDA 3LKNB 4PJ7B 3W11C 5JR1L 3QUKB 4KPHL 5GS1C 3LS5L 4OZGB 1A64A 3PP4H 5F1OB 1MCSA 2DAVA 4J1UA 3RWFA 3CC5B 1NBYA 1U42A 3KVQA 3NH7L 4JFYB 2PW2B 5C0FA 1OGTA 3BZ4A 3QPQD 4IM8A 4NZRL 5L6YL 5C92A 2QR0B 1J1PL 1XF2B 3BMWA 1NAKH 2HVKA 4NRZB 1F3JA 2VDML 1BIHA 3U0WL 1HNFA 3BPOB 3JVGA 2O26U 5H35B 1RZ8B 4DGYH 3H8NA 4JM4H 4HK0A 3OKMA 1X5XA 3SJVE 1FSKC 4J3TA 4PRNB 3BKMH 2VQ1A 1WT5C 3GMMA 4LHJB 4YDLB 4B7LA 1NFKA 3MRRA 1BGXH 1JGEA 1F2QA 2AKRA 1DVFD 1AJ7H 3QRFM 2VL4A 4GG8A 2Z31C 1MY7A 2DD8L 2H8PB 5CBEA 1M05A 4OZHF 3FQXB 1S9XA 2YD1A 4RGOL 5ALBH 3NFNA 1J18A 4JO2H 4PD4K 4F3FA 5I8OH 4Z7QE 5BVJA 2YWZA 4BH7B 3SOBH 4MNHB 4ODBD 1BOYA 3QHTC 4LCWE 1CFNA 2J4WH 3C6LC 4JPWH 5ICYA 1UWGH 3ORJA 5F1SA 1BJ1J 1UWXH 3GDBA 2OTWA 1A3RH 4ELMB 4P23A 1WJ3A 5JZ7C 5E8NA 4PRHE 1REIA 2EC9U 5FUZL 2GFBB 3HE6A 3RIAF 3EYSL 2DMCA 3KPOA 4U2ZA 4OAWA 4YX2H 3QUYD 5C0AE 4Z7UE 3RZCD 2XT1B 4JAMB 4K94H 4PJCF 4OUUB 3HUJB 5EWIL 3LSOB 4NUJB 3PJSA 1TDQA 4HJJH 5C0JA 5F97E 3IJYA 3P2TA 1UM6H 4KKLC 2BSED 1I8MA 4QRTB 1I1FA 4PJHE 1JGLL 3MLZL 5E6IC 3DRQB 4HUKB 3UTZB 1IEAB 1EERB 2X1XR 4KI5F 1SJEB 1TQCC 4Z78A 2H2PD 3BDBA 4PY8I 3FT2A 1SYVB 3O3DA 2WW8A 3OX8B 1MFDH 4G7VH 4R7DA 4LARH 4DZ8A 5LBSL 4PTTA 3DXAE 3GSWA 3HFML 2DQDH 2V7HA 3WJLC 4WFGD 2NQCA 2C5DC 3QH3B 4C83B 2FGZA 4CADB 5J1AA 5L8LB 2BX5A 3V4UL 3RWIB 2XZZA 4CAGA 3DIFA 4K23L 3SGDI 4Z6AT 2WWMD 4NQSB 1INQB 5T3ZH 4L8DB 4PLKD 2IANB 3TBVA 3IETA 3ARWA 1FLRL 1MNUH 1AGCB 5D2LE 4O5LH 1EMTH 3H42H 5AG9A 4TSBL 1S7TA 1CXLA 3ILPA 1MRDL 3QHZH 4DKEH 4G6MH 3T1WA 3HMWL 4Y4KB 4KHXL 3RVWC 5EBLB 5CEZE 3WO3B 5CIPB 4RQQA 1A7RL 2IH3B 2RAMA 1SEBB 5GZOD 3H0TB 1S78C 5GJSL 5DO2C 4DW2L 1GIGH 3EFFB 5FGBC 2RCSL 5ACLA 4Y89A 4K3JL 3TO4B 2W92A 5TE4L 1MI5B 3GI9L 1QLRA 2F58H 5GRZA 2DM3A 4IHOA 1P7KB 1P4LB 4UZGA 1FIGL 4LSSH 4XHJD 4CW1A 1IGML 1KPRB 1SYSA 1UJ3B 4AYFA 1W0VB 4LNRA 3ZTNH 3KPSA 1K8IB 5E6YA 3HC0B 3LMJH 4ODWB 4PLNC 4HKXB 1DQDH 4JG1L 4NSKA 5I16B 2BHUA 4YHOH 4M6MH 1TVDA 5DVNA 4OLZL 2HLAA 3C5JB 1ZSDB 5F7KC 5FUCE 1UEMA 2IPTH 1HDMA 5EDXA 1T22A 2AERT 5E5MA 1I1AA 1J9CT 2XFXB 4AH2A 4Q9QL 4XCEA 4AT6A 5HDOA 1JTPA 3O0RL 5IM7B 1RQ5A 1EBPA 2ED9A 3TZVB 4FTVA 1R5IB 1SY6H 3H9HA 2BRRH 4JM2A 1FVEA 5LGKA 4XGZB 4X6BA 2P5WA 1E27B 3MCLL 1NUNB 1YZZA 5HXMA 2ZCKH 3IXTA 2OTPA 1IGFL 1BBDL 5F1IA 3NGBC 1TJIL 1YEDA 2GUOA 3FN0L 4HUVB 1HIMH 3OJ2C 3OAZK 3TPUB 3MNWB 1VACA 2ARJB 3LS4H 3TCLA 4GQPH 4JY6B 4PJ8C 5HPOA 4F9LA 1QO3A 4HH9B 2H9GB 3GSXB 4P2RB 1T1WB 3CCHB 4C55A 2A73A 3CFEB 4LPTA 1Y0LA 1GPOH 3KHQA 3DUSB 5CJBA 5D5MB 3UEZA 1W72L 5EZLA 3WDHA 3T2NH 4YHML 2G2RB 5FCUH 2BMKA 3VDCA 5BV7C 3FQTB 5KW9L 1GGIL 1T21B 1CU4H 3D18A 1P4IH 3GNMH 3UDWC 3BAEL 3SY0B 2HLFC 2BHYA 1RI8A 3ZDXF 1IT9L 3MRHB 3VMNA 1QSEA 3D0LA 1MLBB 3AS3A 3HZMA 2Y9RT 2Q7YA 4JRXD 3GGWB 3DV4B 3UTPE 1MJ8H 1AKJB 1EJOH 4QRPE 4X4ZA 5KSBE 3RX5A 1OT2A 3TFKD 2V2WA 4F33A 1T6WA 2W9EH 4BQ8A 4IMKA 2EEDA 4NQXB 3DX9B 4Q58C 1P6AB 1A7NH 2YHGA 3HNVH 5I1KH 4JGMA 3V2AR 3P4OA 1EFQA 2QADD 2PUQT 2Y5EA 4M7JH 2YD2A 4CDGC 5HYJB 2BY3A 1D5BB 4UB0L 5INCA 3S35L 4KZEH 5CSZB 2OYPA 3OG4B 3ZKXB 4PUBH 5TQ2L 2FJGA 1YEEL 4ZOBA 3V95A 4ODXB 3BWUC 1F6AB 3MGAA 1UACH 1X7QB 4L8SA 5TF1L 3X3GH 4HC1A 5EORL 2O61A 3NIDF 4OLXH 4NJAH 5HDQL 1NCTA 2ATPB 4JANB 3VGFA 5ILTH 3CU1A 2IMNA 5J12C 1ED3B 2CR3A 4L29B 1AXSA 1ORQB 1U8LB 1AD0B 2PYEB 2XTJD 1L7IL 4JB9H 4NFBA 2XN9A 4M5ZH 4H88H 2YRLA 4LAJH 4Y5VA 2QSQA 4WW2B 3OHXA 3EJZC 1MCWW 5T1KA 4XBPA 2ESVB 2C7UB 4YXHH 4G9FE 1UEYA 1YMMB 3BPNB 1SM3H 5F7FA 4HIHB 2H26B 3IAGC 5CHNB 5DUBB 1OPGL 2LTQC 3FMGH 3ZLQC 4JDVB 4N0CC 1XCTA 4GKZA 4MCYA 5B8CC 2QQKL 5FM8A 1C5BL 3IGAA 4MMXC 2K1MA 3FB7B 5IVXF 5EU7C 4ONFL 2XA8L 5EG6C 3MJ8A 1CGVA 2JB5L 3RUGA 3QEGH 4LOUD 1BAFH 4OM0L 3CVHH 5B22A 4RFNB 3VXRA 4ZO7A 2FWOB 3BRGC 2R4SH 5SWSD 5GZND 4F7EB 3L3GA 4YHPB 4OT1H 1I7UA 3WN5C 4XNQB 3ZKMD 5C0BB 1NDMA 2VDPL 2HTLC 4E41A 4FNLH 3H3KA 1BIIA 5DT1L 3UO1L 2MQ3A 2V9QA 1WZMA 5DQJA 5GGRB 3DUHA 1FFOA 4RMTA 3GSUA 2C1PA 5T3XE 4RZCA 2VIRB 4OLWL 3VFVA 1N4XH 4I1NB 2VQUA 4J2XA 5FB8A 5JPMB 5HYQB 3FQRA 1FCGA 1FE8H 3O3EA 4HIXL 2YKLH 4UOW0 5J7CC 3OZ9L 4U1SB 4L3EE 1CLZL 5DJ8A 1VB9A 3GMLA 3TYGH 3WIIH 3RDTA 5JORB 2DM7A 2XQYK 2D7NA 1QRND 5JHLH 1Z5LB 1EHAA 4LVHC 5C9JA 2W0FB 4MAYD 3F12B 4PG2C 4PGDA 2AGJH 2E6JA 4HG4J 4H5SB 1JPGA 4ODSL 3VFUB 1A4KA 5KVGL 1T2XA 1CDYA 4JFEA 2AXJA 4PJBF 5I1HL 1MWAL 1CT8A 2J5LC 2NLJB 4J23A 3DHJA 32C2A 3SO3B 5J3HD 2I9TA 5HPMB 4MHHG 4JFFD 2BXYA 5J1TC 1NLBL 4Y5XB 4G9DB 2V2TA 3MCKB 1MCOH 4RX4A 4EUPB 4X4XB 2EDEA 1CIUA 2OJEA 1I75A 4HS3A 5DD1H 3MLWH 1MH5B 5E8PA 2C9AA 1T0NA 2P7TA 2D2OA 4OZHA 2VTFA 3B2UC 3MA9L 4QXTA 3WS6A 4JQXA 5EU6D 1WCBB 1MF2L 5AZEH 1VEMA 4AZ8A 5DFVC 1OOAA 3OJVC 3VD7A 1N6UA 2CMRH 2KUTA 2VLLB 2VLKE 4KK5D 1TZIA 3U36A 4EI5B 1GZPA 3Q5YA 4XH2B 4GW5B 4S1DC 2VISA 3VXTB 1I7ZA 4EEEA 1Q72H 5JOFA 5BMFH 5C09D 4G6AD 1PQZA 2VZTA 2YN3A 1K4DB 2VDOH 1ZGLB 1BP3B 1FGVH 4UV7L 2UVEA 4BSVB 1QRKA 2XWBA 2E7HA 3LB6C 2K7QA 4XT1C 4GRWE 5I8CA 4NKIH 1ZLWK 3O3UN 3TM6A 4PJCA 1VADB 3GM0A 2VITA 3IDJA 3L7FB 2VLJE 1NCAH 3K4DA 4PV8B 5IROC 1H3PL 4LCUB 4KK6D 1H0DA 2MTPA 5FDYA 4NFCA 1A5FH 3UROR 2DTML 2FB4L 3Q1SH 3QCUH 4QOKA 4GS7B 3VD4A 1NMCB 4LKXA 3OXRB 1QHOA 4F7MB 4GKOA 5ITFA 1S9YA 3RWJA 3LQZA 2GTWB 5BVPH 4OFDA 3DO7A 2P5EB 4D0BA 2AEPH 5EUKB 3BYYA 1BM3H 1L7TL 3D85D 1RU9L 4NQDB 4CN6A 1BQHA 2FATL 2Z4QB 3GMOB 4IRSA 4PRID 4FQIL 3IAQA 1E4KA 1HHHA 3KG5A 4BH8B 4KHTH 2PF6A 4KC3B 4N0UE 5ENWA 3GSRA 4GMSL 1G0XA 1PBYA 4GMTL 2ADIB 3DRTA 1IM3B 5IT2H 2PTTA 3S36X 4YO0A 5HHOE 3GZKA 3GO1H 1TTUA 2MSPA 3TWCL 4URTB 3VXQB 2F53A 3FB5B 2GEEA 3NCBB 4X98B 4Z7WA 1QBML 3IDNA 4XPGL 2R1WB 1F58L 2NX5E 3T08A 2EDXA 1P84K 5E8EB 2V9RA 4WIQA 1RUAH 2UWEE 4RDQF 2JJSA 2X1PA 2EXYD 5CGMA 1BEYH 3MNZA 2CGRL 4K55A 4JG0H 5CJXC 4XBGB 1NC4D 4F7CA 3VRJB 4H1LG 1KFAL 1YEIL 3MV9B 2AEWA 4J6RH 2Y36H 4OFIA 3UAJC 2VERN 1R24B 1KC5H 3P4NA 5DJCA 4F58L 1IC4H 1TJHL 2FD6H 4WI2A 5AZ2H 4QHUB 2B1HH 4Z95L 1T66D 1I3GH 2QQLL 4RGNB 3RWCB 1Q94A 1HHGA 1X5LA 3T0EB 4HUXA 2GIYA 4JFQA 3KYNB 5GGUA 1R6VA 2DQTH 3AREA 5BV7L 2HT2C 3O6FC 4D9QD 3TNMB 5DZLA 1RK0A 3RY4A 1V5JA 1T83C 4EN3A 5D7IE 1FRGH 5DS8B 3EO0B 1CLYL 5T33H 4GXUN 1MPAL 4JY5H 1MJUH 5ITBL 1UJTA 2F8OA 1UWEH 5E99L 1BD2E 1NBQA 3BIKB 4LSQH 4OI9A 4HFWB 4HGWB 3MV7D 4F15B 3QG7H 1LO4H 1OARL 3FFCA 3T0XA 4M48H 3TLRA 3PWNB 5AWNH 4FQHB 3RL1A 4LVNC 2EE9A 4P0DA 4OFKA 3L7EA 2EIEA 1GAFL 5BZDB 5LWYH 2EDWA 3DUUB 2WBJA 4IJ3C 1YEHL 2F54A 1FZOA 2DYPA 2ZOLA 5CEYB 2YEZA 2FZ3B 4X83A 4XPFH 5JOPD 1I7RA 3OTTA 2N56A 4QTIL 3LV3A 2OZ4H 2IBBA 4UIKL 3N0PB 4WFHD 5TF0A 3GRWL 2XNAB 4G43B 4OGAD 2HH0L 2O5YH 3EYUH 4R96B 1LO0L 3R4DA 4MXWH 5SWZA 1H5BA 3U0PA 3ULVC 2RBLA 2BDNH 3QNYA 2R0LL 5JMRA 1F42A 3OF6D 1JNNL 5EU5A 1S7RA 3SKNA 4GLRI 4ZS6D 4J8RB 4GRLB 4P4RB 4ZAKC 1A7QL 3UJJL 4GT7A 2VDQL 3GI8H 3ZE0E 3TH4T 5H2BA 2R2BB 1R3KB 1J8KA 1KB5H 4XNMA 2HN7A 4I3SL 4KK9D 1ZT7A 3TIEA 4EDWH 3Q6FA 1VFAA 4M62L 4XCFH 4M1GL 1QSZA 4YGVA 1J86A 2XG5A 4KUCD 3W0WD 1UWXK 3CFKB 4K3EH 3WS3A 5E6ID 4KMTL 5C0CD 1A7BA 1G6VK 4O9HL 3OKOB 4FMKA 4F37F 4U1GB 2EIBA 3K8KA 3RVXC 4F7TB 1BVLA 2NY4B 2AV1B 3ISWA 4GJTB 1A14L 2YUZA 3MODH 3KXFB 1KENL 3QWOB 4PTUB 4P23D 3QUML 4KV5F 3NVQA 4K07A 4WUUE 3HE6D 1I3RA 2R1XA 1QA9B 3PWPD 4F8TA 4J1UB 4QKXB 2HKFL 4N8VG 1GZQB 4LF3A 1JYXA 1NFDB 4UQ2A 1U3HC 1OGTB 5DYOB 4LLYB 4K7PX 3PE9A 1GJIA 4O2CB 2D4DA 2ZPKL 3JBG7 4X7EC 2DWDA 2P24A 8FABB 5SX4H 2MPAH 3BD3A 4R97B 1VDGA 3IFOB 3CUPB 4JHAL 1HQRA 4DWHA 3MRFA 4HK0B 5I73C 2VDNL 1CZ8L 1XZ0A 1WBZA 3Q48A 4KGLA 1JP5A 3GMMB 4F2MA 1FBIL 2Z8SA 1U2HA 4U1NA 3KNBA 1U91A 1U3YA 35C8H 4QXUH 3VCLA 1S78D 5DO2D 5ID1A 2G75A 1DL7H 1JHKL 3NTCH 2CDEA 4GG8B 5F93C 2X05A 4Y4HB 1I9RL 1M05B 5TE6L 3TO2A 1S9XB 4PYGA 2EKSA 3ZE1E 2EH7L 4L4TE 4IRJB 1EAPA 5KTEL 3PQYA 1Q8MA 2EC8A 5JPNA 3QXUA 4HJGA 1ZLSL 5BRZE 5JA8B 1JI1A 3ZMRA 4HS6B 3S5LG 5IVNA 4TUOB 5E0QA 4U1MA 2RFXB 1PYWB 1VGEL 1ZVSA 2BVPB 2VAJA 2XY1A 1SMAA 2X4NA 4PJ7E 4NNYB 3IYLW 1C16A 1KN4H 1CICB 1FYTA 1I85C 3T65A 1BOGA 3K0WA 2JTDA 2HWZH 5HI4C 3BQUC 4W6WB 5IQ7L 5IW6A 2NXYC 2NTFA 5EO0B 5E94A 4MX7A 5C0JB 5D7JC 4C54A 2Y06H 2VXVL 1H3WM 2EYTA 5DD3L 1I1FB 4MVBC 4L3CA 4HJ0C 5I1GL 4U1JA 4XP5L 3QO0B 2DLTA 2VR9A 1XGPA 4TNWF 4Z7QF 3K74B 4KRPC 1UB6B 3BGFC 4JFOB 4L4VB 5IMLB 4MDJB 4PJBA 4NQVA 2KL6A 1C5DB 1G7LA 2YPLB 5FKAA 3O3DB 8CGTA 2LE9A 4DZ8B 4ZOAA 4PTTB 3TA3C 3IFLL 1YNTA 4TOYL 3ZHKA 1IAII 4AENA 3DVNA 2L0DA 3RA7H 3JV0A 5FOJA 2JKXA 4JM2D 1NGXA 1FV1A 2YD4A 2HLFD 1QFWM 4YAQA 3EZ8A 4O4YL 2P5WD 5CD3A 2BFVH 4XVUC 5DHVA 3CZJA 4M43H 1ZEAH 4KFZC 1FNSH 1YDPA 4LSVL 4OBSA 3IDYC 4PJHF 5H94B 3VXOA 5D70H 4FZ8L 5EZJB 4JJ5B 5T5NF 1BZQK 1MCNA 1JWMB 4M7LH 4WTWA 3TP4A 3CMGA 4ELME 1NCBH 2ZNWA 4WWKC 4XP1H 4HCRA 1OAXL 3MJGX 3O41B 2VDLL 5DD0H 3RVUC 1NKRA 5DJXB 4L8CA 4JKPH 5F9JB 2Q20A 3BEVB 3HUJE 3ZKNC 5IQ9B 3LDBC 1D9KC 1NAMH 2D7TH 1QSED 3ARBC 3KPSB 1JWSB 4Y19D 1I1RA 5D2NA 3SPVB 1B2WL 1MHEB 3L6FA 4NSKB 2BERA 5I76A 4JPVH 3QFJB 3V6FA 3BUYA 2XICA 4X6EA 1R3JB 4PRPA 2X4QB 2AI0L 3IKKA 3T8XA 4HUMB 1HDMB 5H8DA 4MZ2A 1T22B 2EDLA 2G60H 4XCEB 1CG9B 1C7TA 4P9HC 2Z92B 1BVZA 4XWOC 1R0AH 1IE5A 1U6AL 2E27L 2C1OA 3I2CH 1IKFH 2ADJA 4CUCA 4L1HA 2O5XH 3G5ZB 3GHEH 4FTVB 3C87A 1Z6JT 4MD4A 3TC9A 4LFHG 3MA7B 2CH8A 3HRZA 1FVEB 4DOHB 4H0HB 2IANE 3CK0H 4WI4A 4OQTA 3B2VL 5I6XC 3QYCA 4X6BB 4WHYH 3CXHK 5FGSA 4ALAL 1MFEL 4Y16C 4Y4FB 4LMQE 1DEEA 2YC1A 3QNXA 2HRPH 1VACB 5GHWH 1R3LB 3DI2B 2HFGL 3TCLB 2AJXL 5ACZA 3VDBA 3DECA 3GEWB 4H1LB 1WCQA 3S37L 2ZJSL 3MX0A 1QOKA 2NW2B 5DQDH 5I1EH 1AI1L 4P48A 4KXZH 4GAGL 1Y0LB 3RTQA 2HTLD 3QIBB 2DBLL 1HZHL 1MI5E 4LLUA 3P30H 3GBLA 4MQXC 1JPFA 1M7DA 3VXUD 3ULUE 1A8JH 3EDKA 3NPZB 5I19H 4X80L 2NY7L 2Z8VC 3EIFA 4HUWA 2YXFA 3V0AC 3O8XC 4D9RD 5D6DA 1K6QL 2P8LB 1CXIA 1LHZA 4FQPA 1MHHB 1J0HA 4HW6A 2FX8H 5I17A 4XVJL 5JNYB 1GGBL 4MD0B 3SDAC 2XXMB 5TQ0L 4LDOB 3LD8B 4OLUH 2Y1VA 2FJHA 2XWJA 1INDL 2I60L 3TYFA 4MGXA 4E41D 3ULVL 4XCCH 3AB0B 3QA3B 2V5MA 3L3DA 3G5VB 4X8XA 1VENA 4WHTA 2BNUB 3RPIA 5MI0C 2EDNA 1RUML 4CVWA 4L8SB 3RJQB 3IDMA 5D8JL 4JO3H 4KH2A 2O61B 5MEQB 1JZ6A 3MR9A 3VRLE 2UUDH 1EJ6A 3RP1A 2CKBB 5D1XD 2NY1C 3OAUH 4Q9RH 1CN4A 1KPVA 3RGVC 5KSBF 3DBXB 5SWQB 2XN9B 2B5IC 4L1DA 1HXMB 2RB8A 4FFYH 1JNLH 5E8OA 1RHHA 3MYJB 4P2RE 1JGUL 3BW9B 4HIJB 5T1KB 4IIQC 5D5ME 5J06A 4JFZH 2EH8H 4OIBA 5IB3A 1LE5B 1MCIA 2D0FA 2PXYB 3I3DA 1GHFH 1VCAA 2OI9B 3NFPA 5DFVD 3P9MB 1RAMA 2JK5B 4YE4H 1P1ZB 3LEYL 3IGAB 1BFOB 4QCIA 3ARXA 4S1DD 5HHQB 3HE7A 3RUGB 2Q8BL 1KUMA 3KYKL 3JUYA 1DN0B 5F6HJ 3VA2C 1HK6A 3VXRB 3HMXL 4KQ4H 2PW1B 2OLDA 3BGMA 4RX4D 5F1NB 3QXDB 4PRBB 1U8JA 3BOVA 1SVCP 1AR1C 2EDBA 4M61B 5EU4A 4QXGL 3L3GB 4EIGB 1RZGA 2UY7A 3U30C 1I7UB 3TN0B 4MB5A 4X4MA 1R5VA 2DQIH 5SV4A 3L3HA 5HYJE 5J13B 2YK1L 3HLAA 4IS6A 4WHDA 3BKJL 4ZUUB 3QQ4A 4Q2ZB 2VABB 3VE0B 1MJJB 3QNZA 4LSTH 1ORSA 1UKSA 2XQBH 4QHNB 5A1AA 4N8VB 1Z3GL 4LPUA 4K7FB 4X4YB 5I74C 4ODVH 3SDYL 1A9BA 4PRAB 5F96H 3S36H 3PHQA 5F9WB 2X4OA 4HXBH 4R4FL 2PYEE 4UU9A 2NR6C 5JQ6H 3BH8A 5DJ8B 2ADFH 3X13B 4OKDA 4AM0A 3GMLB 1LEKB 3OR6B 5FHBH 3U7WH 1QHPA 1Z9LA 3BT2H 3D39A 3BESR 4WI5A 2VN7A 1W2KT 3C2AH 1CI5A 2ESVE 2ORBH 4DKDC 4YFEA 4XTRC 1YMME 1A2YB 3CLFH 3G04B 2DI9A 3SDDA 3U7YL 2APTA 1EGJL 2QQQA 1CT8B 2R56L 3N9GH 4MB4A 4QOKD 4KDTC 5D9SA 5C6TH 4DKAA 3V6ZB 2J12B 5L2JA 4L9LB 32C2B 4D94A 2CLZB 5ADPL 1BVKB 4JQIH 3TT1H 3DGGB 3HHRB 3UTQB 4R7NB 4J3SA 3RNKA 4OCXL 2WM0A 2HJLB 5DK0A 3WHE1 4D8PB 1UCBL 2GAZB 3N85L 3E6FA 1BZ7B 1VFOA 3G5XA 2OJEB 5DWUL 1D5MA 4TVPD 4V1DB 3MRPA 3S5LB 1EO8H 1XF3A 2DKMA 5C0BE 3VI4E 4L5FH 1XGYL 3I02A 1T0NB 3UAJD 1A1MA 2NXZC 4OZHB 3RU8L 4P3CH 1AY1H 5CP7B 3D69B 4HUUB 2MCG1 2F9BT 3FAXA 3JV4B 1S8DA 3UX9B 1MCQA 3O3BB 1A02N 2BHZA 3O2VL 2F53D 1XGRA 3BO8A 4MCZA 3PL6C 2CR6A 3U36B 3NA9L 1GZPB 4PGBA 4LLWA 1QLEH 1JMXA 4H20H 4OKVA 3SJVA 3RRQA 1PZ5A 2L7UA 3DX8A 5FXCH 2C3WA 4JPIB 3U0TB 3VFPA 2IPUG 4JKMA 2VZ3A 5CS7A 1C08A 4R4BA 2EDFA 5IESH 3SKMA 5KANG 3IDJB 3OGOE 3GUTA 1QUNA 1CGYA 2KZWA 1KSRA 2LABA 2XZCL 2HG5B 1H0DB 3AY4A 4NT6A 3PV6A 5E6ZA 5K9JL 1N6QL 1UXWB 3MRCA 1HXYA 4HKJB 3IS1X 4CKVX 4OLEA 2N7BA 4QRQA 1Y18A 4XBEH 2YSSA 2F15A 2P8MB 1KIPB 3RZCB 1GGUA 4NNXB 3VH8A 5BW7C 4W6YB 3UPRB 5J6HB 4LHUD 1JTTA 4PRDA 4E5XA 3DO7B 4MLIA 4J4PC 4UINH 1WFOA 5DRNB 2ERJB 4PRHA 2IALA 2XG4A 4TUKL 1QNZH 1E4XH 3QUZA 3ULVD 1J8HD 4DKFH 1TVHA 5ENWB 4MS8D 4GRWF 4N0RA 4XNXL 5C0AA 4KJWD 4Z7UA 2VXTL 1CD1B 3X11B 3MOBH 1FCCA 5SX5H 5BS0A 1I9IL 1MAMH 4RBPK 3RFZC 4YWGL 5F89B 4JFPA 1FGNL 1YNKL 4P9HL 3REVA 4WEBL 1EEYB 1T04A 3U46B 4PJHA 4P2OC 1RUQH 4JREC 1HKLH 3KDMB 1HILB 3LN4B 3MTRA 3IDNB 4AIXA 2DYPD 1F90H 4J7RA 5KVDH 4HC1H 1F8TH 5M94B 2VB5A 1LDPL 2OX5A 3H3PH 4NKDB 5C3LD 1CDCA 2H2SC 1YYMH 3LRGA 3DXAA 3QJFB 4GKNB 3RVXD 4ISVA 3RWGA 1QSFD 4K7PH 1MCBA 1IC1A 4RISH 3WE6A 3S3JA 1CGUA 3JZ7A 4WU5B 3TBYA 4X7FC 3X3FL 3UTSA 1JJUA 3BP4A 3MOQA 1J0ZA 1OAZL 1S7XA 3QI9A 4I9WD 1BBJA 3PDDA 1T3FB 4YFDB 1TETL 1NFIB 5I71C 2NY6C 3KPRD 1ZLVH 4LMQI 2ICWA 2EE2A 2KQMA 2C3GA 4A6YB 3VWKA 1JUFA 5D2LA 4YNYA 4DCQA 4ZDHA 3DX6A 4ORGA 2A77L 4GBXA 1J12A 3EGSA 2P5EE 4Q6IC 2ZG1A 1A7PL 1CFSB 5EO9B 1FNFA 1JYVA 3RHWK 4NQDE 4UIMB 5EN2B 4YDVB 2R39A 1ZKAA 2UWEF 3IJSA 1ZAGA 5C0GA 5DK2A 5ICXB 3ZTJG 1G6RB 1XF5B 1VKXA 3JWNC 1KJ3H 3FL7A 4M93C 5C0RH 1YC7A 3M1BB 5D7LB 1Q9KA 4WV1C 3U6RA 3BISA 2ZUQB 4F7PA 1HHJB 3VXNB 1S5IH 4FXKB 5BXFB 5C07D 3B3IB 1ETZA 2AK1L 4K7PY 4EVNA 2DQCH 1I9EA 2X6MA 5FM5M 3VRIA 4G6JL 4MA1C 1S7SB 2YA1A 5KG9A 4A2MA 1MFBH 3C5ZD 43CAB 2WBJB 4XMKH 5DVKA 1FFQA 2VLME 3SO5A 1AFVL 4NYLA 5CILH 3PWLB 1JPST 5DD6B 1YJDC 3LV3B 1WEJL 3JTTA 4AEIL 1LGVA 1PKOA 2EZ0D 4ZPTA 5IKCB 5D7IF 4W6XB 1DLFH 3M07A 2ZSWA 3MV9E 3S35X 4M6NL 5SWZB 4HKBB 4NM8H 1H5BB 3DSFH 4XNUH 3QNYB 2IH1A 3DO3A 3EDJA 4WTXA 1JNHA 3JTSA 1ZA6B 5FAAA 2NY2B 2QHLA 4GSDH 4ESKA 3MROA 3OKKB 3GSNA 3SKNB 3C60C 5DURD 2LAAA 3LIZL 4QGTA 1M7IB 2VH5H 4ZUSB 3DURA 4RGNE 4EBQH 1FNEA 3KPTA 3OJMB 4F9PA 1FN4A 1WIUA 1ROWA 1KLGA 1ZXQA 3T0EE 4XNMB 1ZK9A 1CR9L 2NXYD 5D1ZA 2J6EA 4X5XB 2QKIB 4U1IA 1G9MH 4MVBD 1HHKB 3R8QA 1QD0A 4WU7B 3MRJB 3DVIA 3OPZL 4FFZL 1KB9J 2NY0D 2V5RA 3HR5B 1BVLB 4KRPD 3R8BB 1RZKL 1KF9B 4QGYA 2VWEC 1XGTA 3EBAA 5D72L 1IFHH 2Q86B 1P7QA 3QEQA 4P46D 1C12A 4HMCA 3BP7A 3B5TA 3ARDC 2QADB 1ZHLA 1I3RB 2R1XB 4RIRA 1X6NA 5FYJE 3VWJC 2IADB 4KRMB 5HGBA 1QQDB 2VE6A 4QRPA 5KSBA 2DS4A 4JKWA 3EO9L 3NACH 4YK4C 1K85A 1L4IA 4ZUTB 3T0DA 2LAGB 2P24B 4XVUD 3BKYH 3QPXL 1XIWB 1RZFL 3FOMA 3UTTD 3MGOA 1HQRB 4YHZH 4M5YH 3MRFB 1RUKH 2APVA 1XCQA 4HZAA 1RULL 1WBZB 2QQNL 4DK3A 4Y2DB 4OGYH 3VXSB 1YEGH 4WWKD 1OF2A 2V7NA 3VCLB 4JQVA 1AE6H 5IVXB 5FOBA 2ZUTA 3WFCL 2W65A 5E1HB 2CDEB 4ZUVA 3D9AH 5DEFB 2NW3A 5I1IL 4D0DA 3ZKND 3KYOA 1D9KD 1IC7H 4KQ3L 2EKSB 3FRPA 1DDHB 4RRPA 4R0LC 1EAPB 2R0WH 2XY2A 4KVNH 3CXDL 1X5YA 3PIQA 4PR5A 2A9MH 2DMKA 3THML 4ZPVB 4WO4A 5DEGA 3O4OB 1F3RB 1I3UA 2W60B 3LPGA 4I18C 2AJ3A 2QSCL 3SCMA 1F11B 1AIFA 1NCWH 3BDYH 1SJHB 1FZKB 1IBGL 1WIPA 1HH9B 4PJEB 3KXFE 1ZVSB 3IF1B 4QT5B 2YN5A 3VFSB 4TVPH 2X4NB 1D5IH 3VG0H 5SWSB 1BQSA 2X1OA 3P0VL 4I48A 4YHNA 1JPSL 5IWLA 1FYTB 3MJ7A 5KSAC 1NLDH 5EOCH 4XWOD 5FKPA 3WXWH 1S7QA 4YBQC 1NFDE 2OCFD 1A6WH 1MVUA 1CVRA 2C3VB 2VL5A 5IW6B 2LV4A 5DGRA 1M71B 1NBZA 1NMAL 3HG1D 1KG0A 3LEVH 5FYKL 4LLDA 1J05B 4XPTH 2WSKA 3FFDA 1RHFA 2YD9A 3ZE1F 4DVRL 4PB9L 5A2LH 1YN6B 1AC6A 1I8KA 4Y16D 4Z77A 1A6ZB 2VR4A 4ZTPH 5FYLH 3WUWA 2AAVA 3MPCA 5KJRH 3V5KA 3ARGB 5IBTL 4GKSB 4DAGH 2FGWL 1G7LB 4CVXA 3P0YH 1ZVYA 3F7YA 3MNVA 1P2CB 4P4KA 4OCNC 2A6JB 2C4FT 4MAYB 2GYSA 4PJ7F 3QEUA 1LO5A 4XNYH 5AYUH 5IEKB 5DRZA 3DVNB 5EULV 2YZ8A 3IDGA 3PHOB 3CH1A 2J8OA 1JI2A 4U1KB 4HWNA 1NGXB 1U8PA 1JMZA 4APQA 5FA4B 1ZHNB 1JF1B 4L3EA 3FO0L 4DVBA 3P9WB 5B39G 1KCVL 2MNUA 2HTKC 5MHSE 1ZHKA 5KAQF 1CWVA 1B6DA 4G8FA 1V3LA 3Q2CA 2WV3A 2X9YA 3BMVA 1JVKA 3WNLA 3WO4C 5BJTA 3P4MB 2P47B 4ZXBC 4NQCB 2HJFA 3N1GC 4XC1H 1ZT1B 1OW0A 4NRXA 1A6AB 3C09C 3MLXH 2I5YL 3RTQD 4U4BA 4MJ5B 3FO1A 5CUSL 1R5WB 1A0QL 3SGKC 4U0RB 5EIIB 3WMSA 3T0AA 1MIEL 3V52L 5EU6B 3DROB 1T89C 5F72S 4BA8A 1EO7A 2JJUA 1L9MA 4LPWA 1FQ9C 4BK5A 5D2NB 3RY5A 1KJ2L 1GGTA 3L9RB 3P3YA 4OTXL 5I18H 3O6FA 4K71C 5I76B 5EA0H 2NY1D 3V6FB 4L4VE 3BUYB 1WZ1H 4K8RD 5CBAB 3RGVD 3BI9X 4X6EB 2YA2A 3MSPA 3GFUA 1RIUL 5D71H 1YQVL 3WFBH 3WNMA 2YPLE 4XI5D 4WY7H 5TDOB 4OD2A 4RNRA 4I0PA 3QQ9D 4Z18A 1TPXC 1E4WH 1MQKL 5JR1H 1EK3A 4ELMF 4QXWA 3UBXI 1W72B 5SX4I 4XX1G 4W70A 2VLKA 4NPYA 3IS0X 2Z91B 2V5TA 3CFBB 4MJ2A 3MV8D 1FJ1A 3GJEA 4YDKL 2UUDK 3N1PC 3O6KL 2C4XA 4HQQH 3EO1A 2MWCA 4UDTA 2VDMH 3U0WH 5E5UB 2DMBA 4CU8A 4H8WL 4U0QB 3CDCA 2YC1B 4P2QB 5I9QC 4OGXL 3WHXA 2WP3O 1NC2D 5INDB 2VC2L 3D85B 2VLJA 5F3HB 4MNQB 1FYHB 3ZDZE 3VFTA 2X09A 3HZYA 2JJTC 5F7DB 1JGDB 3DMMC 1YY8A 4I3RL 3UYPA 2WWKO 3JV5A 5I1JL 1M7DB 1VEOA 4KUZH 2DD8H 3I3BA 4FQCL 1F6LL 3QULA 5D93C 4YXKL 5IJVB 1JGVL 4QEGA 1YEFH 5CFHA 4HUWB 3KPSE 3B8YA 4R26L 4XB7A 4FXGB 1F4YL 5CJQL 4DQOL 1HI6B 3CD4A 1A9EB 3QFJE 3MLUL 3ZYOA 1KYOK 1UM4L 4ODHH 1MAKA 4N0UA 5C08B 4IBLT 4OD3L 3WFDL 1MCRA 4ZFFB 1YJDL 4M7ZB 3TV3L 1NC4B 1B6UA 1S7UA 3EYQD 4P5TC 3OR7A 5D7SL 2P8PA 2FJHB 4KY1L 1UB5B 1T20B 1GVIA 3L3DB 3L3JA 5EC1B 3I6LD 4X7CC 4HPOL 1FG2A 2NX5A 1KTKE 4Z5RB 5HHVL 4JDZA 5GSVA 3SKJH 4DOHE 2CIIA 2UWEA 1DQJA 3ULUF 5D7KE 4NWTL 4OD1L 2BNQB 4DGIL 1A6TB 1FPTH 2BJML 1BLNA 3MR9B 5IJKA 3CSBA 3M17B 4HXAH 1RZIA 4HV8A 3CMOL 3LKPA 1OSPH 4O51A 2GW5A 5E08L 4OCYH 4TQEL 3LKSA 5F8QC 3KAAA 1Y6MR 1FSKB 3KPMB 1HINH 1NJ9A 5J0BA 3CVIL 5T1LA 3MV7B 1MFAH 2AJUH 2NXZD 1CFQA 1L6ZA 5FEBA 1NCDH 3QR2A 3ES6A 3V4UH 3TPKA 3MLPA 1BPVA 5KVEL 4K23H 1KJVA 4ZFOA 5FUOL 1MCFA 4LCCC 5IHZA 5D7IA 1KCRL 2MHAA 3PGCA 3PWVA 5TE7L 5I1DA 2Z31B 4QY8A 3ZSTA 2Q8AH 2ENSA 3PL6D 4U1LB 3RWEB 3SDCC 3MC0A 1VFBB 4QCIB 1V3MA 1BD2A 3HE7B 3OXSB 5GRYA 2E7MA 1G7MA 2A0LD 4TSBH 1FNHA 2EIDA 1UGNA 3S3SA 3C6LB 1EHLH 1LK3L 3ARSA 3VW3L 4PV9A 5EPMB 3DTXB 5HGGS 2DWEA 5A43C 4XPBH 3F58H 1A7RH 5IIEB 1OAYL 1YQ2A 4JVWA 1JPTH 3V0VA 1TCRA 5ACMA 4YHLL 4DW2H 1NGPL 4PLOB 1RSFA 2QEJA 2SEBB 1MWAB 5D5MF 5IV2A 3QNZB 1XF4A 1EUUA 4FXLA 4O2FB 1BFTA 4RAUA 3OQ3B 2CK0L 2EDHA 1U8IA 1UQSB 2ID5A 1FNAA 1G9NH 3FO9A 4IRZH 3EKCA 3FRPG 4JKKA 1FIGH 4BSJA 4RRPG 2N4IA 1KIQA 4R8WL 1I9JL 1A9BB 4RFOH 3W9EA 3PHQB 2X4OB 3KWWB 1U92A 3JUZA 3ARFA 3SJVD 3W0WB 5I1AA 1S5HB 3PUCA 3DARA 4K3DL 4ZD3L 1EBAA 3UCRA 1A1NA 2OL3L 5E6IB 4Y8AA 5C0CB 4AM0B 2XN9E 3FZUC 4Z7NF 1F3DH 5HDLA 5D1QC 3AGVA 2VXQH 3WLBA 1IAKA 1TQCB 1KCUL 1Q1JL 1TENA 3GK8H 5LAXA 4Q9QH 5JIKA 4HCRH 2GHWB 3HPLB 3O2WH 4GXVL 4NCC2 5LXGH 3PWPB 1B0RB 1N8ZA 1HH6B 1KXVC 2GK2A 4TPRL 1DBML 4H26A 5GISH 2Q6WA 3G08A 5D9SB 3ARQA 5L2JB 1GOFA 5K59E 3ESUF 4L8BA 4NO0A 3BZEA 4LCWD 2Z93A 3RL2A 2E6PA 1CK0L 3RUGE 3ROLA 4KXZI 4ZSOB 2VXSL 3EJYD 4XP6H 5ETUA 6CGTA 3FN0H 1M1SA 1M6OA 3V5HA 4PRHD 5SX5K 3ZT7A 4CVZA 4G42B 1A6VH 3MRPB 1ITCA 2DICA 4WUUA 4YUEL 3CDYA 1F6FB 1X5FA 2UV3A 3ALWA 3D0VA 5JXAH 3QQ3B 4JZJC 5C0AD 2VLRD 4LIQE 4UV4H 3IRZA 3MUHL 1FO0L 4M8QA 1OWRM 2FX9L 1UXSB 2IQAA 3D25A 4KMQA 3HI5L 3QXAA 2NY6D 1GGIH 4C57C 1T1XA 5JO5A 3O9WC 4FQ2L 4P5KA 1WTGT 1IT9H 3Q6GL 2AJZB 4OQTH 5F9OL 1DQQA 4TNVF 5IMOB 1OAKL 5EZOL 1AGEA 3RIFK 2XKNA 4TRPL 1KT2B 3ARYA 3PABB 4GH7B 6FABL 5CCKL 1A6UH 1PW3A 2EXWC 4R4BB 2D9QB 1ZLVK 3GUTB 3VI4F 3CU7A 1QKZH 2IAMC 1V7NL 1T5XB 4UB0H 5IB5A 4U6HB 3C6SA 5TQ2H 4L4TA 4KKAC 2AQ2A 4XVSL 3UYRL 1K4CB 1NBVH 3VJ6B 4YEFA 3VWKD 5BRZA 1N0XL 1IGIH 1JFQH 2Q87A 4XAKD 2PO6C 1OTTC 5B39B 2BOCB 1G1CA 3DI3B 1EUTA 3LKNA 4PJ7A 3VI3E 1CL7H 1LO3L 5HHMB 3QUKA 1L7IH 3BN9C 3NGBB 4V1DE 4K8RH 5E4EB 5MEOB 3CC5A 1J7VR 1PG7L 3FONB 1UC6A 4XCYB 4PJ8B 4JFYA 2C4FU 1EAJA 2XA3A 4OZHE 3ZTJH 2PW2A 3NCMA 2BVQA 3B9VA 1XF2A 3B9KA 5IB4A 5BS0B 1I7TA 4BELD 4NO2B 4NRZA 3ULSA 5EFIB 4JFPB 3E8UL 1OPGH 1MCWM 1T04B 4R2GD 4AG4L 5H35A 5BV7B 1CDJA 1CLCA 1YMHA 1RZ8A 4GXUM 4S2SB 2DJUA 4O02L 3MRIB 2YA0A 4M00A 2CRIA 1BF2A 1NSNH 2JB5H 2VDKL 3O8XA 3EYVB 4U7KA 1HSBB 1U58B 4N8CH 1AHWC 1KCLA 4KKNA 3S8WA 4ISVB 5DI8B 4F57L 2YRPA 3WE6B 3TBYB 4NHUB 1B0GB 4LLQB 3HA0A 3SE9L 3UTSB 1ODAA 3HNSL 3IU4L 1RVFL 1DBJH 2HT4C 2OJZL 3DETC 5ECJE 2ZKHH 2F8XC 1UENA 2J8HA 2FJFA 1FZJB 2NY5H 3BJ91 2WUCH 1BECA 1DBAL 4KI5E 4MNHA 5D1ZD 1RURL 4TSCL 2DLEA 1LEGB 3GMRB 4NZDA 1T5WB 4LPXA 4DCQB 4UT7H 3SQOH 2A1WH 4GBXB 2R8SL 2KH2B 3RI5K 3TVMC 1HYSD 2FECL 1B0WA 4POZC 4Y19B 3OZ9H 4GAJH 4ELMA 2QSTA 4YDIH 1YN7B 5L2KB 5J12B 5FK9A 3IJSB 5C0GB 2GFBA 5DK2B 5I15L 3NN8B 4H25A 5KZCB 4JO4H 5I1LB 1OAUH 3MBXL 3QIUC 3U6RB 2WAHA 4JAMA 4OUUA 3K8MA 3LSOA 3BGAA 4NUJA 5D4QA 5KVGH 3S88L 5B3NA 2M8XA 2FEEI 4Y2OA 4JO1H 4QRTA 4X8JA 1FL5B 4EVNB 4MYWB 5I1HH 5HJ3B 3EOAA 1HCFX 4J3UA 4ZQKB 2GY5A 3VRIB 3AM8C 5TPWL 3DRQA 5FM5O 1EDQA 2LTQB 3UTZA 1IEAA 4JN2B 5B8CB 4N1EA 1H9VA 3RIAK 1SJEA 5TGBB 1SYVA 2ARWA 3D2UD 1NANH 4ZPTB 3WFHB 3D6GA 2FLRT 5DJAB 4LKCA 3ELAT 5HVGB 5KSVB 3QH3A 4ODTL 3QUMB 4C83A 1MCCA 4JJHA 3RWIA 2ZCHL 3QPQC 4PYHA 4NQSA 4WFFE 5K9OB 4GAYB 4L8DA 3QDJD 3BFOA 3L5IA 5J6GB 3QIWC 2IANA 3DURB 3BWAB 1FNEB 4YBQD 5C70A 1FN4B 1J11A 2QLVB 3LQAH 3V6OC 2HMIC 1AGCA 3MXWH 1T2JA 5JHDB 4OZFG 4DGYL 3IKCB 4U6VH 4JM4L 5LGHH 3MREB 1G7HB 2R2EB 3QDMD 2YUXA 4Y4KA 4YHIB 5EBLA 1RJZB 12E8H 4WO4D 5CIPA 1OT1A 2IH3A 3SE8H 4QTHB 1EVUA 4YC2C 3FHAA 3H0TA 2CLVB 5E4IA 3EFFA 4G9FD 3TO4A 1XGTB 1DVFC 1MI5A 4LHQB 1P7QB 3QEQB 1I8LC 5IW3A 5D7LE 3BP7B 4LVHB 5I2IA 1P7KA 3F7VB 1P4LA 2OK0H 1AJ7L 5ANMB 4PB0H 1CQYA 1KPRA 3W9DB 1UJ3A 4ONGL 3RNQB 1KJMB 1NGQH 3DGCR 1P53A 3HC0A 4ODWA 5HGBB 2MQCA 5I16A 4JO2L 5I8OL 3QISA 5KSBB 2J5LB 1E4XI 3SOBL 3WV0A 4C56B 3R1GL 2FNBA 4JPWL 3C5JA 1ZSDA 2HTKD 1A7OL 3SGJA 1GSMA 3GIVA 2XFXA 4KROD 3UZQA 5SWZE 3C8DA 2W9DH 1XH3B 5CP3A 1FZMB 3QUYC 3WL9B 3EOBB 2Y23A 3TZVA 3ZDXE 3BPCA 1R5IA 4GMTH 4YX2L 2V7NB 2W9LA 4U7MA 1TQBC 3NCFB 5GRVK 1MLCB 5T3XD 4HJJL 4XGZA 3BKCH 1E27A 4BZ1H 4ZUVB 1UM6L 3RBSA 5CWSB 3KYOB 5DUMH 4HUVA 2X4TA 4APQD 4OZ4B 5DFTA 1QBMH 3MNWA 3TPUA 4XPGH 2XWTB 1AO7A 2H2PC 2ZUVA 5EB9A 4HH9A 1KXTB 4OF0A 1RUPL 3GSXA 4U05A 1MFDL 4G7VL 3CCHA 4P2RA 1C1EH 4LARL 1URLA 3CFEA 2DQDL 3DUSA 4JRWA 5D5MA 1AGFA 2G2RA 4NQTA 3Q5OA 3FQTA 1JZ8A 5B38G 4M1CC 2WWMC 4I48B 1T21A 3NIDE 2VZVA 4PLKC 3MRHA 5C6WH 1MLBA 1QFUL 1K5NB 3GGWA 5E2WH 3DV4A 3WKML 5DJ6B 1AKJA 3LKOA 5DGQA 3CX5K 1MNUL 5FCSH 2NZ9C 1IKNA 1E6JH 3ILQD 4NQXA 4O5LL 3DX9A 1EMTL 3FFDB 3H42L 3WJJC 4PJIF 3QHZL 3WDIA 3C8KA 4G6ML 3ZZ1A 3INUL 2ICCA 1I8KB 1VSCA 3GSOA 2IC2A 5HD8C 5GZOC 1MPAH 4AQ1B 4PFEA 1G7PB 3CLEH 5E99H 1D5BA 2GITB 4FG6D 2WP3T 3SEPA 1GIGL 5CSZA 2YPKB 5EC2A 4P4KB 3VXSE 3SBWA 4ODXA 2WK2A 4XHJC 1FORH 1F6AA 1X7QA 2Q3AA 1GC1H 3QEUB 4OZIB 1LO5B 5IVXE 4B41A 2VLKD 4LSSL 4N0YL 4AQOA 5EZIH 2I07A 2ATPA 4JANA 3ZTNL 4LEXH 2WWKT 4BQ6A 3ZHLA 3W2DH 5DA0B 1NFDF 1ED3A 3DPBA 4L29A 1ORQA 4MQSB 3LMJL 1DQDL 1B4RA 2PYEA 1HSAB 4YHOL 1GCFA 1N59B 1CGWA 3U9UB 4P2OA 2ADGB 4M4PA 4ZNEE 2DQEH 3BYTA 5E2UH 4FABH 2IPTL 3G6DH 5CEZH 4PJEE 2ESVA 2C7UA 3NIFE 2VLJD 1YMMA 1LO0H 1ZMYA 4HIHA 2H26A 4HF5H 5SWSE 5CHNA 1OSZB 4NRXB 1FYTE 4JDVA 4S1SH 5GGTA 1SY6L 2YUWA 2BRRL 3ARVA 3UJJH 1A7QH 4P5MB 3V0WH 2VAAB 3FB7A 3K81A 1Z0MA 2R29H 4RMVA 4BM7A 4GRMB 4I3SH 2ZUWA 1ACYH 2ZCKL 4OCSH 5HHPB 3RKDC 2NY3D 3VFWA 5T1MB 2FWOA 2OP4H 4YXLL 4WW2C 3LS4L 3O6FB 4YHPA 4F7EA 2I24N 4KMTH 4O9HH 4XNQA 5C0BA 1UYWH 4MJIB 5TH2B 1JHLH 2EC9T 3TJEH 4K2UH 4JY4A 3MRDA 2FRGP 1DFBH 3MJ6A 1GPOL 3MJ9L 4I77H 2IQ9H 4S11A 3T2NL 5HHOD 3D1MC 5GGRA 5FCUL 1EFXD 1CU4L 3QFDB 3GSNH 1P4IL 3PGFL 4UTBL 3OKYA 5HYQA 3HS0A 3E6HB 4LVOC 3TFKC 3T77B 2YXMA 2AJSH 5AAMA 3EHBC 3AS0A 4LVNB 1MJ8L 1EJOL 4RFNC 2J6EH 2W9EL 1PKQB 5C0EB 4IJ3B 3HI1B 4NZTL 4PJFF 2CD0A 2W0FA 1WVZA 5I1KL 2EE3A 3E3QC 3F12A 1IZJA 4H5SA 3FQWA 4NQCE 3WHXB 3FB6B 2FO4A 4LK4A 4M7JL 3MBEC 4NQUA 1A3LH 1J88A 5IMKA 4KKCD 1IM9A 3QUXC 2AJYH 4KZEL 3QZWA 3ZSSA 4Z7VB 4PUBL 1J8HB 2NLJA 5T1LD 3TBWB 1A3QA 1MQ8A 3WFEH 5J89A 3GSVA 5HPMA 5EU6E 4NO5A 3X3GL 4LCIH 4ZAKB 1X4XA 5CZVH 3P9LB 4Y5XA 1H3VA 4HFUL 2XTJC 4G9DA 5TE6H 3T0BA 2WZPD 2EECA 3LAFA 5D2NE 4ZNCD 2A83B 2I26N 4EUPA 4J12A 5T5FH 5E1AB 1N5AB 4JB9L 1K3ZA 1BD2D 4U6XB 3LHPH 3T1FB 4YPGB 4MXVE 1P5UA 4M5ZL 5DK3A 4H88L 3QCVH 5A2FA 1FVCB 3GHBH 3FZUD 3BDXA 5ICZA 1JN6B 5DVMA 4XVTL 5D1QD 4UNUA 4D2NA 3X17A 1WCBA 4JRYD 1QSFB 4LP4A 4YXHL 3MLRH 1SM3L 4N9GB 2EE6A 3HRPA 5E00B 2VLLA 3ARDA 5IG7B 2G5RA 4XH2A 4GW5A 3T0VA 1BJ1H 5KBNC 4PJ5B 5IQ7H 3FQUB 4JDZB 3LN5A 2UZIH 2EKJA 3KPRB 3MUGB 3W81A 1GXEA 1K4DA 5DQ9B 2WMPA 1U3HB 1ZGLA 3QEGL 4DK6A 1BAFL 5IBLC 4XCNB 3CVHL 4I4WB 2PTUA 3F8UB 4UT9H 3KLSA 5GZNC 4XP5H 5I0DA 2R4SL 1CDHA 5F9AC 4P2QE 5E8DL 4OT1L 1VADA 3L7FA 3LH2H 2OR8A 4PV8A 1LK2B 3MLYL 5K9QG 4LCUA 4O51B 4MNQE 1SHMA 5I73B 4FNLL 4Z0BH 3STLB 1WWCA 5T3ZD 3QWRD 2W1NA 1F00I 3BXNB 4N68A 3WIFB 2DF3A 3OXRA 4X5LA 1N4XL 2GTWA 1IJ9A 1SBSH 1ERNA 2P5EA 2WBWB 3PWVB 5I1DB 4NQDA 2DB8A 5IFHH 1P6FA 2QSVA 2CUIA 3GMOA 3TYGL 3WIIL 1QBLH 4OZFB 2EDDA 4BH8A 5JHLL 4HKZB 2GI7A 5L7XH 2M1KA 1GL4B 4PBXA 4YLQT 5C08E 4UQ3B 1A4JB 2ADIA 3NFSH 3MRLB 2GJ6D 1IM3A 3VDAA 4I18A 3JWDH 1T0MB 4X6FB 4LEOB 3B83A 4AEHH 3VXQA 5GPRA 1INEL 5ALCH 4A2LA 1M4KA 5J3HC 1ADQL 2R1WA 4FQXA 4I5BB 5DJ2B 5KSAA 4P57B 5T3XH 3LRSB 2N7AA 3FO9B 4KKAD 5DEZA 4FFVC 3DYPA 5KVMC 3BQUB 2NXYB 3W9EB 1YECH 2BNQE 4QYOB 4JFDD 4TUJB 2GK0B 3VRJA 4D9QE 5ERWA 5D7JB 1MCOL 3MV9A 3V7AE 3ARFB 2PO6D 3G9AB 4X6DB 4KJPD 5DD1L 1R24A 1AXTH 3TIDA 3MLWL 4HGMA 4RMWA 3U4AA 4JDTL 4YHKL 3RAJL 4LRNH 4QHUA 4KRPB 4NZUL 2AI0H 3VGHA 3RWCA 4DFIA 4QHMB 1GH7A 5AZEL 1CS6A 3MV7E 4Z8FH 3OG6B 3T0EA 3DWTA 4HEME 4WNQB 2FX7H 1U6AH 3TA3B 4L4TD 1N8ZB 1ZWIB 1CVSC 4H26B 5DS8A 1Q72L 4OV6F 4X0KB 5BMFL 4UT6H 2Y5TB 2EDOA 5BRZD 2VDOL 3S98A 1FGVL 2Y72A 3BIKA 5DLMH 3RZWA 4ALAH 5JOPE 1Z9SA 3KHOA 2D7OA 3QSKB 4HGWA 3L3OA 4NKIL 4N90D 5GRXG 4WFHE 3N06B 4CVZB 4KK6C 3WSQH 3IDYB 5C3TA 5C1MB 2AJXH 1X5HA 3QJHB 1NCAL 1XR8B 2KPNA 5H37G 4X4ME 2OMBA 1QSVA 1FVDA 3D0VB 4FQHA 5BZDA 2F74B 1OB1B 4GAGH 3UC0H 5B38B 4WWKB 3BPLC 4HLZG 1A5FL 3DUUA 4DN3H 3Q1SL 3F65A 2IQAB 2ZUSA 5CEYA 2OBGA 4DZBB 1NEZA 3SGKA 1T7ZA 4WW1A 5BVPL 1IZKA 3WIHA 3O3AB 2FLBT 4X80H 4C4KO 3DJ9A 1BQLH 2AEPL 1N6VA 2XNAA 3LDBB 1W0YT 1Q9OB 2ED7A 1BM3L 4HZLA 2J2ZA 1KV3A 4R96A 5D6CB 4XRCB 3W0WE 1K6QH 4KV5E 3ARBB 1D7FA 1T4KB 4NIKB 1OL0A 5C0CE 1PJ9A 4GRWH 4KHTL 3P40A 5DMJB 5F8RC 4BSWB 4XVJH 1P4BL 3OBAA 1F4WH 4J8RA 3BSZH 4GRLA 4ETQA 1JYWA 1LWRA 1CDUA 1F4HA 3OGCB 3VXMD 1JRHH 2R2BA 1INDH 1EIBA 4Y5YC 1CBVL 5CSBA 1Q9LB 4NC1C 4HWEH 3PWPE 1KULA 2YOCA 3MLTB 1RUMH 2LFGA 2EXYC 3OKOA 3T4AB 5D8JH 1RUAL 1L9NA 3HG1B 1UZ6F 4F7TA 3BD4A 2AV1A 1IAOB 3Q5TA 4ZSOE 4RAHA 3O45B 25C8H 5EUOB 3QWOA 4BFIB 5IHLB 4J6RL 4PTUA 2Y36L 5BO1H 3PWJB 2ZP0T 4MA7L 1CFTB 1RFDH 1KC5L 4KTDH 1IC4L 2FD6L 1QA9A 1CIDA 2P1YA 1T66C 1GZQA 2B1HL 3GSQB 5J8OA 1NFDA 3HC3H 1J10A 5EH1A 1I3GL 4KI1A 5CJ5A 4F37K 2BVQB 3B9KB 4JZOB 5IB4B 5DYOA 1JYNA 4LLYA 5GS2D 1I7TB 4O2CA 3ULSB 2DQTL 3QIWD 2R4RH 2GCYB 8FABA 3GBML 3SE3C 4PJ9C 1KPUB 2HMID 2HA1A 2WIIB 15C8H 3IFOA 1YMHB 3CUPA 1FRGL 2NY4C 1E6OH 3MLVH 5T33L 4JY5L 1WFTA 1MJUL 4QRUA 1HKFA 4M1DH 1MCEA 1UWEL 3O8XB 1UH3A 4LSQL 4NWUL 2JELL 3V4PL 4DUXA 1U8NB 3UTOA 2Y4SA 1VFMA 3QG7L 3VI3F 5GGVH 3QZWG 1LO4L 4AEFA 2N1KA 4O00A 3SDAB 4M48L 5AWNL 4Y4HA 5FO7B 4P5TA 5LWYL 3NABH 3IJHA 2IAND 4IRJA 3MXVL 5GRWA 4K9EL 3JVGC 2FJFB 1Z3GH 4JFXB 2F19H 5DRXA 4XPFL 2BNRB 4EUPG 1FL3B 4HS6A 4OGAC 5MI0B 4TUOA 2RFXA 4Y4KD 1GRWA 1PYWA 2BVPA 2O5YL 2VOTA 3BIAX 4MXWL 2B0SH 2BDNL 2R2HB 5HHME 4NNYA 5KVFH 1DJSA 5FK9B 5ISZD 4ZS6C 5AD0B 1CICA 2XKSA 1V7MH 2NY1B 4NKOB 3O2DA 2CUHA 4MXQC 3RGVB 3TO4D 4JFHE 4H25B 2B5IB 4EKXA 3BN3B 3GI8L 4KK9C 5BS0E 5EO0A 1KB5L 5MP6H 4IIQB 1KACB 4HD9A 4MSWB 2LU7A 4X8JB 4PJFA 1FP5A 2H41A 4XCFL 3EOAB 2JB6B 5GGVY 2XI9A 1LMKA 3MV8B 3QO0A 4K3EL 3CZFB 4HAFA 1RZ7H 1UB6A 3DOSA 4JFOA 4L4VA 5IMLA 4MDJA 1WSST 5HI3C 1C5DA 2IG2H 2YPLA 4P23C 2YMXH 1K3IA 2AEQH 3BRDA 1UCBH 3O4LA 4LKCB 4U31A 3HE6C 4JR9H 4QHKJ 5DWUH 1NC2B 5JUEH 1E28A 4DUVA 1XT5A 4M1CD 5DC4B 5DR5H 3IT8D 3U30B 2YD5A 3UTSE 2ZUYA 3K7UA 2FCBA 4D3CL 4TNWK 1CD8A 1FH5L 4AK1A 4XX1E 4M7LT 4OI8A 4DN4H 1WQVT 1VHPA 3MRQB 4TTDC 5H94A 1NDGB 5J57B 2NZ9D 1DCLA 5EZJA 3EDDA 2JF1A 3WFZA 4JJ5A 5I74B 1JWMA 4Y19E 4PP1D 5L2KE 4FA8A 5HD8D 3O41A 3GJFB 35C8L 4KAQL 3UJIH 5DJXA 4ZO9A 5TFSH 5F9JA 4UMGA 3BEVA 3ZDYF 5I2IB 5JW4N 5IQ9A 4CMHC 1AGDB 4IMLB 4D9LH 2XZCH 3KPLB 3KPQB 3NMEA 4G8GB 3ARPA 1JWSA 3SPVA 1CL7I 1MHEA 5IOPB 2BVTA 2EDQA 2MMXA 1Q0YH 3QFJA 1Z2KA 2R0KH 3DVGB 4B5EA 1R3JA 2X4QA 3DYMA 3LN9A 5FA3B 1J0YA 5EU7E 1A22B 3H9ZA 2AABL 3TBSB 4NQED 5F21B 5LQBH 3GIVB 4S10A 3IFNH 2XQYG 5HYJD 1CG9A 2Z92A 3HAEG 3L5JA 1DSFH 1KN4L 4TUKH 4Z9KB 2VSDA 1MHCA 5GRUL 1RIHH 3G5ZA 4XNXH 3BPCB 4EXKA 2VXTH 2HWZL 3MA7A 4WJ5B 1LVEA 1QFHA 2NXZB 3HB3C 4YWGH 4JVPA 2AK4B 3ROOB 3TNNA 2Y06L 5GQBA 4XMPH 4WVRA 4WEBH 3VXUE 4Y4FA 2XPGB 2X4TB 2PYED 4FQJL 3RKDD 4W4OA 2YD3A 4E0RB 5JHDE 1OD7A 3O9WA 1AQDB 1R3LA 1AO7B 3PL6B 5KSUA 3I9GH 2IPKB 4MJ6B 4H1LA 7FABH 1HEZB 2EIZB 2NW2A 1I1AC 2ESVD 3QIBA 2ATKB 1AGFB 4FMFA 3L1OH 4UAOC 1VESA 4XPHH 3QEQE 4MMZC 4LLVB 5ANME 3RA7L 4JM2C 1JBJA 3V6BR 1NEZG 3SKUD 5DUPH 2IAMA 1OP3K 5AAWA 3MUZ1 2P8LA 4R90H 2BFVL 3LKOB 1ZEAL 1FNSL 1LO2H 3EHBD 4C56E 1MHHA 3MQIA 3WD5H 5JXEA 4WGWB 5JNYA 1WGOA 5D70L 4ZTOH 2Z0BA 5DF0A 4F9LC 4MD0A 3C8KB 1DUYB 3ZYJA 4P2YA 4M7LL 3GSOB 4LLAA 2X7LB 3VG9C 1NCBL 5DTFB 4XP1L 3QA3A 2DQFB 3MBED 3G5VA 5DD0L 5EC2B 1PVHA 3ZKQD 3QUXD 2VRAA 4WWID 2BNUA 4JKPL 1LEIB 1F5WA 3GIZL 2OR9L 5IB1B 3PDOB 1NAML 4NGHH 2I07B 3C9NB 2PYFB 2D7TL 1NANI 5MEQA 3NCJL 2CKBA 2OS7A 4IMKC 1AR2A 5J1SC 2VZ1A 3GMQB 2ZSVB 4JPVL 1KJ2B 3DBXA 3PGDB 4P2OB 3KR3H 5SWQA 4JREB 1CDGA 3VFOA 5I1CH 1HXMA 4YIQB 1ONQB 4LQFL 3EFDH 3MYJA 2VDRH 3BW9A 4HIJA 3T2PA 1YEJL 4NHCH 1TIUA 4LGPB 1MJ7L 2G60L 2X4RB 1LE5A 3TJHD 1R0AL 2PXYA 3I2CL 1FLTX 5GJTL 3NAAL 1IKFL 2B1AH 3C5SB 3P9MA 2O5XL 4I3GA 1P9MA 3GHEL 2JK5A 1P1ZA 3ECBB 3CIQA 1D6EB 1BFOA 3CK0L 5GS2H 3VXPB 2J8UB 3R06B 5JW4R 5HHQA 4CN1A 1T03H 2WUBL 5I71B 1DN0A 3SKOB 3VFWB 2PW1A 5F1NA 2HRPL 5IBLD 3QXDA 4PRBA 1PG7X 4Y5VC 4M61A 5GHWL 3OPZH 3TN0A 4Q6IB 2X70B 5DQDL 5I1EL 4ZOCA 5LCVH 1RZKH 4JY4B 3MRDB 5LKNA 1TZGL 2VZSA 2QJDA 4PJEF 4ZUUA 4Q2ZA 2VABA 3NIFF 3VE0A 1MJJA 2Q7NA 4QHNA 3VD9A 5JQHC 3CH8A 3ALXA 3P30L 4N8VA 4OZIE 4K7FA 4X4YA 3RHWF 1MCKA 5A2KH 3MOAH 4EI5D 4PRAA 4WV1B 2V5SA 4Z76A 5C71A 5I19L 3SE4A 4DGVH 3RY6A 3HS0B 2VMFA 5HI5C 4PS4H 1M7XA 3S34H 5C8JA 3BEWA 4TTGA 3SDXB 3EO9H 3X13A 3AM8A 4MA1B 1LEKA 3OR6A 2FX8L 2R0ZL 4B7IA 5IEHB 3EYFB 4PJGF 3NBNA 5CIPH 3FQWB 5J13C 4OLUL 4AY0A 1A2YA 2FO4B 3G04A 4QHLA 4XCCL 5IMKB 4ENEC 4UNTA 2QQNH 1IM9B 3HI6L 3QZWB 2Z8WC 1IEBB 1DUZA 4KVCL 4XMLH 4UBDC 3V6ZA 3ULUH 4L9LA 4TULL 2CLZA 3GSVB 3MGTB 1BVKA 4JO3L 3C60B 4NO5B 1DBKH 1C8PA 3S97C 3DGGA 4ZS7H 3UTQA 4R7NA 5D1XC 1N7MH 3NPSC 2P5ED 4FZEH 3V6OA 4FFVD 2HJLA 1U95B 4D8PA 1UG9A 5A40E 2FBJH 4NQDD 2GAZA 3RDTC 3TGXA 1BZ7A 1D6VL 3OAUL 4Q9RL 3CXDH 1IQDB 1TJGH 4V1DA 5C2UB 3S5LA 1TCMA 1PFCA 4MJIE 3PWUA 2CLRB 1S9WB 5B4MD 5HHNB 5CP7A 3D69A 4HUUA 5ICZB 3JV4A 2EH8L 4N5EC 3O3BA 5CP3H 1GHFL 5IVOA 5I30H 3K2UH 4OV5B 3H7BB 1L0YA 1G9MC 4GUPB 3ARDB 5JW5B 1OVZA 2VLMD 1FC1A 1KCSH 4PBWD 3LN5B 3VWJB 3QG6A 5BQ7A 4JPIA 3U0TA 5LGJB 1PKQE 1U9KA 1MELA 4KQ4L 4YK4B 3MV9D 2QHRH 4JN1L 3FT3B 4RFEA 1P69B 1LD9B 2CRMA 1U3ZA 4MXVF 1T1YB 3P73B 3WS6C 1R3HB 2DQIL 3QXVA 4JQXC 5E9DB 2HG5A 1IGTB 2DQJL 1IGYA 1UXWA 3RVTD 4Z7VE 4MB3A 3ULVE 4RGND 4JHWL 1J8HE 2ICWI 4HKJA 3MACH 4LSTL 2XQBL 3T0ED 1NCUA 2P8MA 1H3XA 1KIPA 3RZCA 1ADQA 4MLSA 1KN2H 4NNXA 1OP9A 1WAAE 4MDIB 5T1DH 5FO8A 2YR3A 1GOHA 4ODVL 3UPRA 5J6HA 2IFFL 5F96L 3CDGB 3IU3B 4HBQA 3S36L 5ADOH 1YNLL 5MEND 4HXBL 1F4XH 2DDQL 4HIEB 5DRNA 1KCVH 4C4KT 3LRHA 3KS0J 5FHBL 3U7WL 2GTZB 2J7LA 2OL3B 4FS0A 2DI8A 5CD5C 3BT2L 1ZLUH 3L95B 2DN7A 1MIMH 1CD1A 2IBZX 3X11A 3C2AL 2ORBL 4I18B 1QSFE 5I8KH 2JIXB 5F89A 3X12B 5DMKB 1EEYA 3U46A 4FP8L 4R4ND 3N9GL 1K2DA 1V3KA 2ITCB 3KDMA 5FDWB 1HILA 5CUSH 3LN4A 4I9WE 4FQXB 5KSAB 1MIEH 3QDJB 5BOPA 4PJ5E 3V52H 1EPFA 4ELKA 3D3VB 3KPRE 4HDIB 5KS9F 4M6OL 3TT1L 2XRAH 4UILH 4NKDA 3L3IA 5JDSB 1CTOA 1MCPL 4XXCC 1GOGA 1IAIM 2JE8A 3QJFA 4GKNA 3BZFB 3CFDB 3H2WA 3HPJB 4IRSC 3WXVH 1E4KC 5DRWA 5ERWB 1U36A 4JVUA 4WU5A 3QDMB 1EO8L 2X41A 1I8IB 5FYJU 3TIDB 3IRPX 4L5FL 2DQUH 2FSEA 4NN5C 1YQVH 4P3CL 1AY1L 1T3FA 4NN6C 4X7TB 3K4ZA 3HAEB 1CF8H 1NFIA 2HP4A 4PPTA 1MQKH 3H9SB 3FQNB 2NPLX 3TCXA 1FO0B 5DMGD 2DLIA 5GGTH 4A6YA 4CGTA 2DIJA 5C07E 1QLEL 4YDKH 4HWBA 2EICA 1SEQH 4JZNA 4PJ9D 1CFSA 2JJSC 5EO9A 4H20L 4UIMA 5EN2A 1MFCH 4YDVA 2BVOA 2NY4D 5F88B 4YHYC 5ICXA 1G6RA 1XF5A 3KXFD 4H8WH 1U8MB 1IL1B 4UTAH 3L3OB 4OGXH 3M1BA 3MUJA 5D7LA 5IESL 1HHJA 3WO4B 3OKEB 3VXNA 4FXKA 3NIGF 1G7IA 1OTUC 1S3KH 5BXFA 4ZXBB 5K9KB 3B3IA 2B2XH 3F6IA 1FVDB 1OGAB 1T7XA 1WWAX 1S7SA 3AREC 4UUJB 3C09B 5F1KC 4I3RH 4XBEL 43CAA 3ALPA 5C2BH 5IW1B 3EJJX 3K3QA 1NEZB 4EN3C 3MRNB 3PWLA 3JWOH 4WW1B 4OCRH 5DD6A 4FQCH 4Y1AB 5EBMA 4JHBA 2YS4A 3AROA 4BQBA 5IKCA 1FAKT 1OAQH 4G5ZH 4UINL 4HZLB 2CQVA 4HKBA 4DQOH 4X6DE 4MQ7B 1QNZL 4MS8C 1ZA6A 1KELL 1E4XL 4KJWC 3FB8B 4X9IA 4L4JA 1KLFA 4K71B 3OKKA 4OD3H 2XIDA 2ICES 3WFDH 1SQ2N 5IHUH 2EDRA 1YJDH 1M7IA 4MXQD 3MOBL 1Z9MA 4ZUSA 4ETQB 1MAML 3MRKB 3V79C 4PGCB 2DJ4A 1HE7A 1TPXB 2BC4A 4X5XA 2QKIA 1G7QB 1A1OA 4PJIB 1U8QA 3V4VH 1HKLL 2R1YB 4HPOH 5MHSD 1HHKA 4HIIA 4WU7A 3MRJA 4X7DC 1F90L 4G3YH 5KVDL