1Q9WA

S45-18 fab pentasaccharide bisphosphate complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
219
Chain Sequence
DIVMSQFPSSLAVSAGEKVTMSCKSSQSLLNSRTRKSYLAWYQQKPGQFPKLLIYWAATRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S45-18 Fab (IgG1k) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
total genus 47
structure length 219
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9wA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9wA01
4EBQL 3P11H 3GSOA 4PS4L 2X4RA 5IBTH 4F15C 3S4SG 4EOWH 2E27L 3OHXB 5ISZB 25C8H 1HHHA 1ZLWK 4K8RC 3BPOC 4HS3B 4WUKH 3W9EA 3SBWA 5DYOB 5C09E 5F1OB 5FM8A 4E9LA 4NCC2 4FQQB 3ARZA 4YHIB 3KLAB 1BBJA 3AXLA 4X80L 5SWZE 3HLAA 4I0PD 2YSSB 4PJ5D 5DGQA 4NNPL 4XZUB 4QGYA 1I7ZB 1L4IA 1PY9A 4FXGB 5F9DC 1L0XA 4RRPG 4ZXBC 4RBPH 2OQJB 5JOPD 5HGBB 1S7SB 3VXTB 2VB5A 3M8OL 3TIDB 3HE6A 3QT2A 2GSGA 4K3EH 2NY4C 2UV3A 4N0CD 4Y4KD 3SDDA 3HKFA 3KNBB 1XZ0B 4N0FB 1KLGB 1CZ8H 4L8CA 2NW2A 4EI6B 2VAAA 5JDSA 5CD5D 1L7IH 3LKOA 1ZTXL 2P47B 4TOYL 3A6CL 4AMKH 1D7FA 1CLOL 1AD0A 4RMVA 5J3HD 2NY5C 2EYRB 4ZFZA 3H7LA 3OKNA 1YN6B 4G9FE 1KGCE 1K2DB 2J8OA 5F9OH 3GI8L 2BOCA 1BFTA 3IJYB 3PWJA 2DJUA 4ZAKD 4U1KB 4KVCH 4X7TA 4NT6B 1ZA6B 1WTGT 1RMFH 5JIPA 2JE8A 4NWUH 3H7BA 2ZPKH 3C5SA 4LLQB 5CIPH 5L8JB 2GW5A 3QZWB 3KLHD 4HCRH 5DQDL 3WDJA 3MRNB 5IMKB 4H20H 5AYUH 4EI5C 4M1DL 2H45A 5D2NA 5TDPB 1U92B 3FB7A 3HE7D 2GCYB 1JFQL 5KSAA 2EDFA 3SKOB 1LK2B 4HUUA 4LU5H 1JWMA 3VD3A 4YC2B 3MJGX 4Y4HA 3GHEL 2DWEA 3EOTL 2CJUH 4PRHB 4NQSB 1BQHA 4YHYC 3HZYA 1FSKC 1HEZA 3VXQA 1RUML 1KT2A 2VITB 3B2UD 3EO0A 4PJ8A 1F45A 4ZFGH 3G08B 3WIHH 3GSRB 5KVFH 4XAWL 4KI5E 3WBDA 3OG6B 1LP9F 4K7PH 1G7HB 1VA9A 2ADGB 4MZ3A 1WIUA 3OJDA 1FFOA 4JO1L 1KACB 5T1LA 5E94B 4JFFA 5ADPL 5ESQB 3RI5K 3TPUA 5BVPL 2AP2A 2EKSA 4ENED 3MV8D 5IWLA 1IGTB 1NPUA 4Z7OF 3RVXC 1A8JH 1KLUA 1TZHA 4FP8H 1BZ7B 4MNQD 4ZFOL 2C1OB 5FXCH 2HA1A 1LVEA 3WJLA 3HZMA 2IEPA 5I73B 2AW2A 2VAJA 4UQ3B 5LVEA 2RIKA 3WLBB 1T1ZA 5KS9A 1QFPA 3BDBA 1G7LA 1MCPL 2QSCH 3CDCA 1FDLH 2PKDA 3P4LA 2PR4L 3AAZB 1A7PH 4NQED 3DIFA 1NANH 3KPRD 1UWEH 4ZFOB 1E4XI 3ILPA 3RTQD 3DX6B 2VDLL 1IGFL 2D0HA 4H5SA 1I4FB 1ZLVK 5I1CH 3O2DH 4URTB 3CGTA 4PD4K 2Z4QA 4JZNB 4MA1B 3RNQB 4HIEA 3BHBB 5E8OB 2ZSVA 3L3HA 4UBDD 1I7UB 4GRLD 4Y4FD 5C09A 5ID0B 2QKIA 2A6KB 4POUB 4MQ7A 4Y19B 4QWWD 4NQXA 5D93B 2JJSC 3WFCL 3QNYA 4O2FB 3VWKD 5LGKA 3ZL4L 4XPFH 2VDPH 5BZWB 4A2LA 2DTML 4G42A 5SWZA 1X5YA 4I48B 2HTKD 1RD6A 2RGSA 2OYPA 5C70A 1H3VA 2HT4D 2ZZUT 2ATKA 4G6AC 5TDOA 3ARFA 4B0MM 3BPLC 4QRPD 3U0PB 5IHUH 2MTPA 3UXFA 4ORZC 3O6FB 2AEWA 3F7VB 4R26H 2ICEB 4J1UB 5JR1H 4HC1A 3CCHB 3PDOB 1OQOA 5F3BB 5KANG 1MFCH 4IRSD 5DA0B 5ACMA 5CCKL 5A16B 1QA9A 5CMAA 3D0VB 1CTNA 3PL6A 4YHOH 5DVOA 1RZGB 2HJFB 1D5ZB 3DVIA 4GUPA 5C08B 2A6JB 3KPMB 3L6FB 4KXZI 2DL2A 2R69H 3TBWB 4U6HB 3ARGC 2FEDD 1IM3B 4G80B 4G9FA 4Q9QH 3CDYA 5J8OA 4U1IA 4LLDA 2W0PA 3C6LC 3QIUD 4MA3A 3EJZC 4FZEH 5GPRA 4JY5H 3EFFB 1JPSL 5J1SC 3KGRA 3IFNL 2N7AA 3RGHA 1DQML 3PDGA 2F15A 2W59A 3FAWA 4XMKL 5JQ6H 3PXHA 5J6GA 3LVEA 1U8OB 1JGEB 4DWHA 3PWUB 2DQTH 3ZE0F 2A2QT 4HGWB 5E08L 4Q9BA 3QULA 5FF6A 1YUHA 2BVOA 3CFJA 4Q58C 1H3TA 3TA3C 5DRXB 3IDJB 3OV6A 4NJ9H 4OV5B 3H3KA 4KH2A 3QCUH 1MF2H 4AL8L 1ZGLA 1MVUA 4XX1G 1KCLA 3VRIB 1ED3A 5AG9A 1HQRA 3NACH 3HUJE 1CF8H 4QTIH 4WHTA 4DKFH 1DQQA 3BGMB 3SDAC 5GSVB 1IGIL 4AK1A 1X4YA 1NGPH 1SM3H 1IL1B 4LLYB 5IM7B 4E42A 3MLPA 4MD5A 2OBGA 1KJ3L 4NRYB 5J11B 4HK3J 4U1SA 2FL5A 1FBIL 1QRKA 1NBZB 3QI9C 1YEFL 4JJHA 4IEFB 3QEQB 2FBOJ 1YMHB 3K74B 4G8FA 1RUQL 5ACZB 3VCLB 4IHOA 2ZSWA 4PP2B 3VG0H 2VWEE 4LLMB 1MIEL 3LD8C 4P5MA 2PYEB 3ELAT 4HWBH 1I7RB 3QNZA 5IB5B 3BWUC 1OLLA 5LGJB 3QIBA 4X4YB 1N6VA 2Y36L 2PW2B 2Y06L 3QH3A 2B20A 1J0IA 1XH3B 3D69B 1MFNA 3QWOA 1K5NA 2YKLH 3MX0A 3CK0L 5ACLA 5B3JF 1I8LA 3VA6A 3JV6B 5TF0A 3QUMH 1RUKH 2N56A 1BQSA 3QDGB 5GS1A 4ALAL 4YE4L 4KV5E 4MJ5A 4K94C 3MJ9H 5B4MC 3G04A 2AXGB 4PJFA 5IQ7L 2NZ9D 1YYLH 2V7NB 5EU7E 1D5XB 1UWGH 4WRLA 4PGEA 1DVFB 1G7PA 4DGIH 5E2UH 3QZWG 4XBEH 1ZXQA 4ZOAA 2OTWB 3VXMB 1BZ9A 1EFQA 4S2SA 3UTQB 5FYLH 5E8EA 2G75A 2VDML 1MI5D 4LCYA 3UJIH 3O9WD 4XC3H 2W60A 3P4OB 5FEBA 4UAOC 5GS2H 3MXVL 4HGMA 4EVNB 3U7WH 3MV11 1YECL 5ESVA 4TVSa 3EIFA 5TQ0H 1HHJA 4IIQB 3VU2A 1JYXA 3VXRB 2OSLA 1AKJB 4PJ9D 1S8DB 3O6KH 1ES0B 2CD0A 3FB5A 3O8XB 2YD4A 5JHLH 1A9EA 1JNJA 2F53B 3OXRA 1N6UA 5ICYB 1CGTA 3ULVF 1QR1A 4RISH 3MNWB 4FQ2L 1LO0L 3QEHA 3JV4B 4K3GA 1WEJH 3ES6B 4W4NA 5D7LD 4OQTA 5IJKA 5D1ZA 2G2RA 4I18A 1KIQB 1EAPA 5K9KB 5CAYB 2OJEB 2H2PC 3I75B 5T3XE 4QCIA 3GZKA 1A6AB 4ODSH 3HMWH 2F54B 3S97C 3WKML 3K1DA 4QOKE 2IH1B 2CUHA 3OJVC 1RJCA 2IGFL 3JBG7 4I77H 3VGAB 1P7QD 2DAVA 5HYSB 2N1KA 1EERB 2Q6WB 3EO1A 2PYFA 2IANA 3QWRA 4QHNA 4OTXL 5GRZA 3X12A 3N06B 5IHZB 5DD1H 2NZIA 1EUTA 2XN9D 4M43H 3O3EB 4JJ5A 3HUJA 2AJXL 5J0BA 2DQJH 4I4WA 3SDXB 5AYQA 4H25A 5JOFB 1MFAL 1BJMA 5FV2A 5GS0C 2FJFA 4FQJH 1MLCA 1CGWA 2NY7L 3BP5A 4OCNC 4G43B 3L9RA 2X4RB 3CLFL 1NDGA 5FKPA 4NZUH 5DS8A 1NGWA 4GSDL 2P5WE 2VDRH 5K93A 1QBLL 3W9EB 3QR2A 4GG6E 2R0LH 5J12C 2H9GA 4MVBC 3BGAA 2B4CL 4HMEA 1RURL 1I8KA 3VFGH 1BBJB 3AXLB 4OIBA 3WV0A 5K59F 4G9DA 4YDVA 5HD8D 4TULH 3HLAB 1TCRA 1VCAA 3EYOA 1V3KA 4TPRL 3W2DL 4R0LA 1WIOA 4JHWH 2EH8L 3IDMA 4Z0XA 3KYMB 4HIJA 1FG9C 1MHPL 3VFOA 4TSAL 1KV3A 5F93C 1AGCA 2V9TA 3HE6B 2GSGB 1K8DA 4LPTA 1RZ7L 1F90L 4HLZG 1DQDL 1TQCC 3T3MF 5DK3A 5MEPA 4NO3A 3CH1A 3SDDB 5GHWH 4LARL 1RULL 4WIQA 3LKOB 1MH5A 4GKOA 4RFOL 3RAJH 3I02A 5DJYA 4MGXA 5JIIA 1W0WA 3T0AA 4PPTA 3VWJC 4ZFZB 3NZ8B 1F13A 3ZE2E 1KENH 4UMGA 2DQHL 3P0GB 4EI5D 1JV5A 4HAFA 1RAMA 3UTSD 3C8KA 3RX5A 5BVJA 2BOCB 2VLME 2WZPD 2XTJE 3GHBH 1T20A 5HGHA 4X6CE 3T0EC 4JEGB 4GQ9L 2AV7A 3H7BB 1NAKH 3K2MC 3C5SB 1M05B 5BS0B 5ADOH 1D5MB 2R0KH 1J9CT 1IT9H 1TTGA 3N85L 4BYHA 1P53A 4JE4B 3QFJD 5D2NB 3H8NA 1MHHA 2W9EL 1RHHB 3ARYA 3U9PH 5D70H 1EMTH 3OWEA 3V6BR 3OSKA 1BM3L 2CDGA 4JFEA 4Y4HB 3SOBH 2IQ9H 1N0XL 3QSKB 4KKCC 4JDZA 5C86A 1Q0XH 3MXWH 4HXAL 4KQ4H 3NABH 4YHPA 3B4NA 3VXQB 3B9AA 1VERA 3EO0B 4PJ8B 3RVXD 5B38A 3Q5TA 1MCFA 2WSKA 2EDXA 4ELKA 1XIWB 5F96H 1X5XA 3MYJA 4RSVA 3BKML 4YQXL 4X6BA 3OMZA 3MRMA 5FYJE 2WQ8A 1F3DH 2EIEA 5DLML 1Y0LA 1J0JA 1RZJH 1FFOB 3GEWB 4RA0C 4MD0B 3UTOA 5T1LB 3QXAA 4KGJA 1FO0H 4JFFB 2LAGB 3TPUB 3JTSA 4WW2A 2EKSB 3U4EB 1QHOA 1KLUB 3U7YL 1TZHB 2CXGA 4M62H 2EH7H 1Q0YL 4QOKA 4C59B 4PJXF 1JTOA 3SQBA 3DURA 2E6PA 4FG6D 1KC5H 3QUXC 5E03A 2VZTA 1JGDA 3V6OE 4IMLA 1VEPA 4JFQA 4IMKC 4DN4L 4PUBL 2XRAL 1T1ZB 4PJHE 2YEZB 1ZEAH 4K3JH 5AD0A 3T04D 2GITA 4B41A 1TJIL 3UBXB 3NMEA 1TCMA 2YRZA 3I84A 3LV3B 4L4VE 1I9JH 4ZS6C 3RU8L 5D4QA 4QHKJ 1UJ3C 4H5SB 3T0DA 4L3EA 1Z6JT 8FABA 4G6AD 2C26A 1BWMA 3UBXI 3GIZL 2FHBA 3T2QA 2P5WA 2ZSVB 2VZOA 4XCFH 3L3HB 4PRBB 4GG6A 3AGVA 5C09B 5JDJA 4HUXA 1UA6L 1WFUA 2QKIB 2XZAH 3DJ9A 3MLVH 2A1WH 3EGSB 4NQXB 2FDBP 1H5BB 3QNYB 3IKCA 3HTLX 1XGYL 5ITFB 3LOWA 4BQ9A 4G42B 5I8KH 5C0AB 3SE4A 1IAII 2ATKB 4X7CC 5FUOH 2GFBB 5TDOB 3ARFB 2HKFH 3QDME 4OBRA 3BQUC 5CGTA 2H6PA 1A64A 3ARGD 1YYML 4D9QD 2ZKHL 3QQ3A 1CICA 1A5FH 2AJVH 4XP1L 3JWDL 3HR5A 4MMXC 3C6LD 3PP3H 3LCYA 3EJZD 3L3IA 3V9FA 2Y7QA 5KSVA 3I3DA 3FQRA 2R9HC 5CMAB 1DDHA 3BZFA 1IQWH 3PL6B 2G60H 5EUOB 4ZUWA 2X05A 4GUPB 4XRCA 1OOAA 4N1EA 4TSBH 3D25A 4RX4A 4WJ5A 4RFEA 4XVTH 4PJAF 5EZOL 4PJ7A 1J88A 3GGWA 4G9FB 4LVHB 4U1IB 4MA3B 3RZCA 3TA3D 4OLWH 3PIQA 5E6IC 4G8IB 2I9LA 2IG2H 3MOAL 4ZG1A 3MZTA 3QEUA 5I75B 2COQA 4GMSL 4X6CA 4N8CL 3KDMA 3NAAL 2HFGL 2Q20A 1EEZA 3UTZA 2VDKL 2E9IA 2X1PA 2UZIH 1OAUL 3MLSH 4X83A 1A7QH 5J6GB 3QPXH 3SDAD 2WWKO 3QIWB 3SDCA 5HYSG 5GGVH 3RWIA 3QULB 1A0QL 5FF6B 1YUHB 2CKNA 3FQTA 2R56H 1BGXL 2XXMB 3ZHLA 4I3RL 4YAQA 1KJVA 2I07A 3D85A 1MVUB 3DX7A 2X10A 2XWBB 1ED3B 2AVGA 4MXVE 1G9NL 1HQRB 4NZRL 3RGVC 2J3SA 4KMQA 5F7KC 4CAGA 2B1HH 4CMHC 1OCWH 3PGCB 4O4YL 2LAAA 5IK3A 5E5RB 3VG9C 2NNAB 2Z8RA 2YD7A 4D94A 4U1SB 1EX0A 3R4DA 3MGTA 2RHEA 3L95A 1OGAA 3PQYD 4EBQH 5L8LB 4PS4H 2F8OA 3JV0A 4Q6IC 3W0WE 1CG9A 2E27H 1DE4A 4G8FB 4AG4L 2IQAA 1HHKB 4IHOB 1CK0L 1DTUA 1PW3A 2ZSWB 5CWSA 1DEEB 3Q2CA 3LB6C 4S1DC 4P5MB 4D9LL 3S3SA 4L4TA 3QNZB 4X80H 3KYNA 1KCKA 3D39E 3KJ6L 3V6OA 5C6WH 5DMKA 1HSAB 4NNPH 4P2CG 3A67L 1T4KA 1IEHA 3QIBB 3LZFL 4PJHA 3P4NA 1J8HA 2CMRL 2YXFA 3MRGA 4DOHE 4FZ8H 4BSJA 3R1GL 3QH3B 3OKMA 5EU6E 1HKFA 3M8OH 1T66C 4MQSB 4PRPE 3QWOB 1K5NB 2FX8L 3F7PC 4QXUL 3LSOB 4GBXC 1R3JA 3GSUA 5FO8A 1IAKA 3LKQB 1HXYA 3WFBL 32C2A 2H3NA 3T4AA 3O6LL 4E41E 3KXFD 5GS1B 1ZTXH 4TOYH 3Q6FA 3A6CH 1JYVA 3ET9F 3L5WB 3BKJL 3CUPB 5KS9F 1CLOH 3KPPB 3WIIL 2BRRL 1U95B 1U8PB 3K3QA 2O61A 5MI0C 5ILTL 4HPYL 1TJHL 4APQA 1MQKL 4PGEB 4KQ3L 1G7PB 3GI8H 1XR9A 5MEOA 3X3GL 4MAYA 1YN7A 4S2SB 1LEIB 5HHMD 5E8EB 2G75B 5CJXA 1F4AA 1S7QA 3QDMA 1ND0B 2W60B 6CGTA 3T0WA 5EO0A 1CD9B 3LN4A 4RFNB 4OD3L 2ZCHL 4LSSL 4L3AA 1NDMB 3LDBB 4XPAL 1YNKL 4CVUA 5DQDH 1GAFL 4M1DH 3QUYB 4P5TA 1MVFA 3MCKB 3B5HA 3FB5B 1JFQH 2H2PD 2WQRA 3FFCB 4HDIA 4HSQA 5I2IA 3L3GA 1IKFL 1A9EB 1OAQL 4FTVE 3OXRB 4Y16B 5SWSE 2ZUQB 2YPVL 5EBLA 3GHEH 3S37H 3EOTH 4BSWA 3QNXA 4R2GC 3MUZ1 1JNNL 3QEHB 3CSYA 4H1LA 4PLKD 5EORL 1IAIM 4XCNA 3TH4T 5IB3A 1RUMH 4XCYB 1OW0C 2BP3A 5DC4B 2CIIA 2B5IC 3PGFL 4XAWH 3RBSA 2HYMA 4Y5VA 2JB6B 5FGRA 2VYRE 1P4IL 1HILB 3TZVA 4JO1H 3OKDA 2OR8A 1HHIA 5ESAA 5ADPH 4RBPK 2QSTA 5BVPH 1CDUA 1JRHL 4GKSB 2OXGA 3EO1B 2CK0L 4RQQA 2PYFB 2ITCA 4IRJB 3N1FC 3X12B 4MVBD 4HG4J 1UZ6E 1BFSA 5HBBA 3INUL 3MA7A 3HUJB 3HNSL 3PWLB 3ABZA 3GIVA 2FATL 1VADA 2R1WA 5F6IB 2FJFB 1MLCB 1MCPH 3BP5B 3L9RB 1A1MA 2PR4H 1NDGB 5FKPB 2Z91A 5DS8B 1NGWB 4OGYL 3I6LD 1JTPA 2VDLH 3C8HA 3O6ML 1IGFH 2VQ1A 1ODAA 4KRLB 2H9GB 5FM4A 4M02A 4R8WL 4NNXB 1JRHI 1I8KB 3RVVC 4F7CA 3RY6C 1U8IB 3W0WA 4XNMA 3EYOB 3FT3A 1BVZA 3QG6B 4ZO6A 2Z9TA 4R0LB 2XV6B 3IDMB 1WITA 3VFOB 4KXZH 4R96A 1OAZL 3T77B 3WFCH 3ZL4H 3D39A 1UB6A 2DTMH 1ZGLM 3OX8A 2OTUA 4MQTB 1E27A 2F19L 3CH1B 1X5GA 4AM0B 3NPSC 3T65B 1E28A 1ZHNA 4WEUD 3T0ED 4OZFA 2PXYB 3DECA 4H88L 1CQKA 2YPLE 3L1OL 3DSFL 1MH5B 5D6DA 1KB5A 4KDTA 5HVFB 5E95B 2BC4B 3I02B 5DJYB 1E6OL 4P5KB 5CCKH 1QACA 1T2XA 4NO0D 2EC9U 4L3CA 2VC2L 3LAFA 3O3BA 1CXLA 3GSNL 1JV5B 2CLZB 3IDYC 4Q2ZA 1NMAL 3PHOA 4TUJA 4N5UA 5BVJB 4LCWE 3FZUC 4E41A 1CDBA 5GZOC 2E9BA 1SBSL 2ENSA 3UTTE 4BFEA 2LVEA 4JPWL 3MJ6A 2XFXA 3ULVD 4M7KL 1T20B 5IEHA 4KKCD 5E9DD 4RGMB 4PJIE 3QXUA 5HPMB 2YD2A 5C07D 2VXQL 4J6RL 2C3XA 3GSNB 4OSUL 1ONQA 1JPSH 3CXHK 1MHHB 4P9HL 1D3CA 4Y2DC 3IFNH 4NC2B 3HG1B 2VSDA 1DQMH 1AXIB 2AK4B 5B8CA 4XMKH 3QCVL 1R5WA 2YOCA 5IJVA 1KCSL 3OB8A 5IP4A 2E7CA 4JDZB 4RGNE 2DQCL 1VACA 4I1NB 3CLEL 3NZHL 5J4MA 5E08H 4PJCE 5IHBA 5E4EB 4PJFF 3PWNB 2CPCA 4P9ML 4Y5XB 5B38B 5HHPA 4ELKB 4AL8H 4HZAA 4FTVA 3MRPA 3MOBL 4L1HA 3C09B 5SWSA 5DMGD 3B8SA 4MB3A 3MRMB 3BXNA 1L6ZA 1HSBA 3TNNA 3GMNA 4C56E 1A7RL 4NBYB 1Y0LB 4JRYD 4UNTA 3VFVB 5J13B 3QXAB 1EZVY 3KYOA 1IGIH 5JLZA 2EXYC 4LKXA 3JTSB 4WW2B 1N2RA 4JFDD 3MMEB 2HFTA 1FNHA 1KJ3H 3B3IA 3Q5OA 1T04B 2CRMA 2VLKD 4LLVA 4ZS6D 1FBIH 1RK0A 3LKRA 4YGVA 1YEFH 4RAVA 5D7JA 4NNYA 3ARED 2GSIA 4W6XB 2D03L 2VJXA 1JGDB 4OCWL 3SCMA 1UM6L 2RBLA 2UVEA 5F72S 3ZTJH 1BP3B 4JFQB 1MUJA 1T89A 5IBLC 4NDMA 5FOJA 2ZNWA 3NCYS 5AD0B 1MIEH 2GITB 4PV8B 1BJ1H 4O9HL 5JPNB 1WBYA 3RQ3A 3HC4L 5BZDB 2ARJQ 5GJSL 1FRGL 4G8GD 2Y36H 4P23A 2Y06H 4JANA 4LLWB 5D7IF 3MRLA 4F2MA 2R23B 3BQUD 4Z0BL 2YHGA 2FX9L 2P5WB 4UDTB 2ED8A 1OAYL 3QA3A 3QYCA 4F7TA 3CK0H 5B21A 5D1XC 4GG6B 4X6DF 3ULUL 2YN5A 1EHXA 1QSED 4MDIA 4LBEA 2VR4A 4NN7C 1NMCB 1YY9C 4M6OL 2FECL 2EE9A 3IKCB 2IH3A 2R9HD 4LGRB 3D1MC 1EFXD 2VKXA 4ALAH 4YE4H 4LVOB 1T1YB 4TNVF 1U41A 4W70A 5DJZA 1IE5A 1EGJA 2EE2A 1KN2L 1O0VA 1G9ML 2H6PB 4PJ5E 5IQ7H 3QDJA 3FO2B 1AQKL 1UH4A 1CICB 2NCMA 2FHCA 2OXHA 4P4RA 4MSWB 1FZKA 3HR5B 4KKNA 5JOPE 3VXNA 5HYJA 3TJHD 2Y7QB 4NHUA 2VDMH 5KSVB 1EUUA 3K2UL 5E6ID 2EIZA 1KIRB 4ZUWB 1NAMA 2DN7A 4U6VL 3DXAD 4YGAB 3EHBD 4XRCB 3GKZA 3MXVH 2YPLA 2O5ZL 2DMKA 3AB0B 1YECH 4M8VA 3D25B 1JP5A 2I24N 2FECI 4RFEB 1BF8A 1DBJL 2WLYA 3GGWB 4X99A 4HG4K 4GAYA 2EDHA 1U36A 4HX1A 1J1OL 1VDGA 2Y23A 4LCWA 1OP5H 2BMKA 3QEUB 4FQ2H 1LO0H 4X6CB 4OZ4A 2GJJA 4NKOA 4L4JA 1EEZB 3UTZB 4PJIA 3HZKB 1YY8B 4P4KC 1M7DB 5EC2A 5K9QI 3RVUC 1I1YB 2W07A 4FQIL 3TPKA 3RWIB 2E9WA 3CJJA 1ZT4B 3FQTB 3M07A 3WKMH 2F74B 5I1DB 4OV6F 4DK3A 4YAQB 3TJEL 1BQLL 3D85B 3HNVL 3S88L 3DUHA 3DX7B 3KYKL 2E5EA 2IGFH 5JA9A 2HRLA 3BOVA 4PJCA 5EZLA 4WO4C 4L29A 2QSVA 1RZJC 4A6YA 3C2SA 2CXKA 4KROC 4NZTL 2AKRA 3DMMA 2OR7A 1I3UA 1I7TB 4OTXH 1DJSA 2F8XC 4MA7H 5MENA 3LB6D 4S1DD 3QFDB 5F1NA 5IK3B 4C56A 3RHWF 1K8IA 3ZT6A 2AJXH 2FYYB 4JFZL 2J7LA 1W8OA 4P2YA 4I13B 1MFAH 1NC2D 3MJ7A 2NY7H 4AZ8A 3LIZL 5D6CB 4HJ0C 3CLFH 3N9GL 2DWDA 4GSDH 1CG9B 3IU4L 1DE4B 1X4XA 2IQAB 2J5LC 1QBLH 2EO9A 5CWSB 5DTFA 5I1HL 5E24E 5I0ZA 1G9EA 4L8BA 3MV8E 5GJTL 5CEZL 2VMFA 2B4CH 4GBXD 1RURH 1QFHA 1RIHL 1KJ2A 4CVWA 3ZYZA 4MNQE 2V17L 3OJMB 3ARBA 1A47A 3W2DH 4PJHB 1UH2A 4NN6B 5CBAA 2EH8H 3ARVA 1MHPH 3MRGB 5KSUA 5CZVL 4I3GA 4TSAH 3ZTNL 3OKMB 4IOSD 1FE8L 1MRCL 1BOGB 1BIHA 4L4VB 1GOGA 4GW5B 1D9KA 1RZ7H 3IAGC 1F90H 1IM9A 1DQDH 1R3JB 3GSUB 5FO8B 4NQEE 3KPRE 1IAKB 1IKNA 4K71C 1HXYB 4LCUA 1HZHH 1BLNB 3CFEA 4LARH 1RULH 32C2B 2H3NB 3T4AB 1MHEA 3WHE1 4RFOH 2EYTA 3Q6FB 5DUPL 4WTZG 4OT1L 1AJ7L 1A6VL 3SPVB 3S3JA 2O61B 3GNML 3BP7A 4FQLL 1EO7A 3K4ZA 2DQHH 1G7QB 3BIBX 1I3RB 3ZSSA 4HZLB 1XR9B 5F9WC 5FECB 4MAYB 5ABDE 1YN7B 2AV1B 4IJ3B 1MREL 1S7QB 4JHAL 3T2PA 3QDMB 5CEXA 5IVXE 4GQ9H 2DDQH 4I0PA 4IOFC 4PJ5A 1Z5LA 4R2GD 5EO0B 2W0KA 2A6IA 1GOFA 1YNTA 4QRPE 3N85H 3N1GC 1OL0A 5BV7L 3U30C 4ZS7L 5DJAA 3ZT7A 5KZCD 4P5TB 5TE6L 4QO1A 2W9EH 5B38G 1T5XA 3FO9A 1U91A 2DICA 5I2IB 1NCTA 3P4MA 4Y4KA 1BM3H 4NO2A 4QRSA 5EBLB 4BSWB 3QNXB 1N0XH 1WBXB 4OF7A 3B2VL 4HXAH 3CSYB 4H1LB 4TVPL 4XCNB 4LCCA 4B53A 4U31A 2CIIB 3SE9L 1OT2A 2DI9A 3BKMH 4YQXH 1BIIA 3IFOA 1ZT1A 4KTYA 2IAMB 2KZ1B 3MOQA 1U2HA 5DLMH 4UUJB 5IW6A 3WO3B 4ZAKA 3TZVB 1QLFB 4M5YH 1HHIB 5ESAB 2VLJA 1FNGA 5EOCJ 2CKBL 1FZMA 4PJ7F 4KRNA 3U7YH 1S7UA 4RAUB 4RQQB 1Q0YH 3JWOL 2Q7YB 4WWKC 1CDJA 3DUSA 3HE7A 4UINL 4LL9A 1TPXC 3RVVD 1UEMA 5F9AC 4DN4H 4PUBH 2XRAH 3GIVB 3TO2B 3TBTA 4YJZL 1VADB 1QFUL 3FONA 3C87A 1C12A 2CKBB 1A1MB 1V3JA 2XWTA 1TJIH 2BSED 1AP2A 3BT2L 1T0NA 1YC7A 3ZT5A 3F6IA 5DK2A 4GRMA 3RU8H 4M00A 4PGDA 5GRVL 2C7UA 2VQ1B 3WNMA 3MFGB 4OJFL 5HYEA 2NXZB 5F70A 4F7CB 2G9HA 3GIZH 4WGVB 1NBYA 3W0WB 3R0NA 1M6OA 1PG7L 3KHQA 1ZAGA 2Z35A 1UA6H 1BHGA 4M93C 1KUMA 3AC0A 4GG8A 5C0DA 1Z9OA 4KTDL 1XGYH 1T22B 3D39B 4JG0L 3QAZB 4LSPL 4MNQA 2R39A 4BKLA 1EHNA 4M61A 1J0KA 3S36X 1E27B 3FZUD 5GZOD 3JVGA 4XPGL 3MRHA 5C0EA 4DOHB 4M7JH 4BA8A 1E28B 5INCB 4OZFB 1YYMH 2C4FT 2ZKHH 5EU6B 5GS2D 2P4AB 1KB5B 4PRPB 3OR6B 3RX8A 4XP1H 3JWDH 4EIZC 2ID5A 4ZTOL 3KPRA 1MOEA 1GC1L 3RTQA 4WEBL 2Q7NA 3O3BB 2YBRA 4GRWB 1A6UL 2PNDA 4Q2ZB 4TUJB 4Y2DD 3I85A 4E41B 2VDQL 2OZ4L 3B8YA 1H3PL 2XFXB 1MCEA 4DEPB 1WFOA 3N1MC 5EZOH 5IEHB 2D3VA 1D6VL 5I8OL 4GRLA 4J4PC 4PTTA 4HUVB 3FRUA 5F88A 2XG4A 1ONQB 5D9SA 1P84J 3MOAH 1WAAF 3VWKA 2RR3A 4GMSH 5IVXA 2NY6C 4N8CH 3H9YA 2HFGH 3NAAH 3OKEA 4Z7UE 4Z7VE 2VDKH 3NA4A 4U3HA 1OAUH 5FGBC 5B8CB 1MI5E 1HCVA 3O2WL 5BRZA 4QRPA 4PV9A 5IJVB 1NUDA 4Q9CA 3ZE1F 1FZOA 4WW1A 1A0QH 3KS0H 4OKVB 4RMQA 3O4LD 4IRSA 1BGXH 4C58B 4I3RH 1CDCA 1BPVA 4FTVB 4F57L 5SWSB 4YDJA 4HS8L 1FGNL 3CVHL 5C71A 3BXNB 1HSBB 3TNNB 1G9NH 3MODL 5I73C 4NZRH 5JXAL 3BW9A 4ONHB 4OUUA 1P1ZA 4HKBB 3EYFA 5JLZB 4K9EL 2FZ3A 4LKXB 4AYFA 4O4YH 3BE1L 2PW1A 5D7LE 4CN1A 3QIUA 3AM8A 2XTLA 5CP7B 4M9PA 4LLVB 4TNVK 1RK0B 2HVJB 2P7TA 3CVHB 3GMRA 5E00A 1HH9A 4FA8A 4QRRB 4PIRF 2WW8A 4NNYB 4HT1L 1VFUA 1QRNA 3KPNA 3SCMB 2J1KA 3MO1B 4AG4H 1CGUA 1MUJB 5E2WL 1CK0H 4QXGL 4LF3A 3PP3K 4NDMB 5D8JL 3GK8L 5D1XD 1AXTL 1PKQE 4KK8C 4D9LH 3MV7D 5GRUL 1X6LA 3KJ4B 2X9WA 2FHFA 1YY9D 2J8UE 4BZYA 1PG7W 1WBYB 3KJ6H 3TIEB 3STLA 4IDJL 2R2CA 5D93C 3J8F7 1A1OA 3A67H 3GMMA 3LZFH 2NQCA 2CMRH 2UUDH 1EZVX 4X6FA 2XN9E 4P23B 1GOHA 4JANB 4OFYD 3R1GH 3MRLB 4F2MB 2APFA 2EDOA 1F3JB 4LHUB 1LGVA 1T83C 1Z9LA 2C5DC 4F7TB 3O6FC 2FX8H 4QXUH 2HMIC 3BZ4A 1LHZA 1FZJA 3FKUS 4MDIB 5CKGA 1AH1A 1I3VA 4G6KL 4MHHG 4CNIA 4CJ0A 2R29L 3ESVF 3QQNA 3WFBH 1RQ5A 3R0MA 1Z0NA 4V2BA 3NOIA 3O6LH 5GISL 3AVEA 3QXVA 2IJ0C 4WV1B 4JQXA 3BKJH 4PRNB 3S6CA 1A7BA 5DJZB 4Q74A 1KYOK 1U3HA 3WIIH 2BRRH 2UWEF 3VJ6A 1U9KA 5KSBF 5ILTH 4WHCA 4LFHG 4HPYH 4GAGL 1TJHH 1R3HA 1MQKH 4KQ3H 4P4RB 2LTQB 4GKNB 5C0BD 3X3GH 4Q0XL 2DIBA 5IQ9A 3JUZA 3VXNB 5E4IA 4NHUB 1XGPA 2V2WA 1U8MA 3BPNC 5H35B 4R4NC 5HI4D 3SE3A 1FGVL 4XH2A 4NQDB 1JVKA 4OD3H 1GZPA 2ZCHH 4LSSH 3TF7C 4XPAH 2ZUXA 1GAFH 4P4KD 5D1QC 3ZDZF 4H1LG 1NGXB 3RVUD 1CGXA 2BZDA 2EDLA 4X99B 4GAYB 3SGJA 1UWXH 1MWAA 3IS0X 1NCNA 1JF5A 2OTPA 4NFBA 3WE6A 1IKFH 1MCWM 4KRPC 1OAQH 4LCWB 3UTTB 5EOQL 4I5BA 2YPVH 2Y9RT 3S7GA 3VRJA 1JNNH 4OZ4B 4NKOB 4NRZB 2JTDA 5EORH 3G6JE 4PJIB 1JUFA 3TN0B 1A6ZB 4WO4D 5EC2B 3MROA 2W1NA 4ETYA 1JPTL 3PGFH 3B5TA 4KROD 2I25N 1QSFA 5E5MA 1P69B 4HXBL 1EXUA 2Q1EA 3BGFB 1NMBL 4Z7QE 1U3ZA 2Y5EA 4S0SD 4LEXL 3VXPA 1P4IH 4Z7UA 5CJOL 4Z7VA 2QADB 4JO3L 4PJEE 3QFJE 3O9WA 1UZ8A 3WS3A 1JRHH 4R7NB 4RGNB 4H8WL 3GM8A 1UB5B 2DQGL 1C16A 1KCVL 3BDYL 4PJCB 5EZLB 2EDTA 2CK0H 1IQDB 3LPGA 1JYNA 2AKRB 3DMMB 1ZSDB 1ADQA 1VGKA 4ZUVB 4PJ9A 1SYSB 5FDYA 3INUH 3GJFB 2WUCL 4C56B 4QKXB 1K8IB 3HNSH 3MACL 1TMCB 3HCVA 2DJ4A 2FATH 1PJ9A 3A6OA 5H2BA 3MJ7B 1WUNT 2NY1B 5FO9A 1HWHB 2GTWA 1T3FB 2DWDB 1H3XA 4OGYH 2XQYK 3O6MH 4OZHF 4R8WH 4L8BB 4NQTA 1LE9B 4EN3C 2IAND 4O2CA 1ITCA 3VFSB 2NY2D 2F58L 1KJ2B 3ZYIA 3HI6L 5JW4M 1DANT 4KK9C 1WFNA 1OQXA 3ARBB 3HS0A 1FPTL 3RIAF 2EDWA 1VENA 5CBAB 5C7XL 5KSUB 4OZFG 1GGIL 1OAZH 3TBVA 1P7QA 1ZA3A 2PO6C 2X44D 1AE6L 3VFNA 5L6YL 2H1PL 4OB5L 5BW7C 3EOYG 1M71A 3O3AA 1IM9B 1OAKL 1GGUA 1DVFC 3VGEA 1UJTA 2F19H 1OLZA 5DDHA 4LCUB 2R2EB 3CFEB 1BBDL 2XN9A 1MHEB 4H88H 3L1OH 3DSFH 2VLRD 4E5XA 5I1EL 4IOFD 2EYTB 4EDXB 1NKRA 2AQ2A 3O0RL 1KOAA 1INQA 1Q9KA 4O2EB 1E6OH 4ZXBA 1G7MA 3BP7B 2OCFD 2FD6L 5JUEL 2VC2H 4MJ6B 5CBEB 5KVEL 1R5VA 3GSNH 1BX2A 1NMAH 1WQVT 3SO3C 5IR1B 1NEZA 5LAXA 1TIUA 1IC1A 2EIBA 1SBSH 4WI2A 1Q9OB 1EV2E 3O8XC 4JPWH 1ZWIA 5TQ2L 2CDFA 5E2JA 5F7HA 3FAXA 2DS4A 4M7KH 5CILL 1U8JA 5CEXB 4HS6B 3H9HA 4WDIB 4I0PB 4PJ5B 1Z5LB 1EIBA 2A6IB 2NYYC 4M7LT 3ZKQD 4CUCA 1HH6A 2VXQH 4J6RH 4OSUH 3IF1B 5HDQL 2F5BL 1J0ZA 4D9QE 2EDEA 5DJAB 4P9HH 4E0RA 5F1KC 4WFHD 3FO9B 1HCFX 2CDEA 1JPFA 1ETZA 4P46C 2IBZY 4Y4KB 5JORA 3U83A 2JJTC 3QCVH 4NO2B 3DUUB 3H9SE 4GAJL 4PREA 3OJ2C 1KCSH 1TVBA 1N6QL 4R4BA 2DQCH 3CLEH 3NZHH 1LNUB 2NY0C 4P9MH 4RCAA 1NJ9B 3DI2B 1AGFB 3MOBH 2CR6A 4MB4A 4WWKD 4QHLA 1BIIB 3IFOB 1XAUA 3RIFF 4EI5A 3B5GA 5EBWB 1A7RH 3R8BB 1GZQA 3G6JA 4ZAKB 5GRYA 2HFFA 4YHZL 5HYQB 1LP9E 2H32H 3O45A 2AK1L 1FL5A 4NOBA 1TETL 4JM4L 4JFED 3MBEC 4JFXB 4OF5A 4B5EA 1SY6A 1FZMB 2DKMA 2X4SA 3RNKA 4QHKI 1S7UB 3P9MA 3S5LA 3GMOA 4HMDA 1AC6A 1F2XK 5DD5L 4PJEA 4Y8DC 3QFJA 3DUSB 3HE7B 2B1AL 4Z7OE 4HWEL 1S9XA 1CFVL 2D03H 4OCWH 1KELL 1UM6H 3QP3A 5DQJA 1WSST 3MLTA 1A22B 3TBTB 5IFHL 3FONB 1QNZL 1JYWA 2XWTB 1J1PL 1NH6A 2ICCA 4LP4A 4O9HH 2ED7A 4PGBA 1T1XB 4LHUG 1AP2B 1T0NB 5CUSL 1S7VA 1MCRA 3FTGB 4GRMB 4O5LL 3MNVB 4OLVL 4DUVA 3HC4H 2ZCKL 4OFDA 2C7UB 3CDFA 1EBPA 4PR5A 1AHWB 2X4NB 2M8XA 4S10A 5GJSH 1FRGH 2B4CC 1DUYA 1T6VN 2G9HB 2X70B 4IS6B 4Z0BH 1LEKA 1NBYB 4DVBB 2FX9H 4WU5A 1OAYH 4MCYA 3PQYE 4YBLB 4XVJL 3ULUH 4WFGD 3MV8B 1MSPA 4QXTA 4M6OH 1CFSB 4GG8B 3UROR 5C0DB 1LEGA 4UQ2B 1QBML 1XCTA 4PJDB 4BKLB 3HAEH 2DKSA 3RJDA 4ETQA 1KN2H 3MRHB 4Y7MA 5C0EB 4UILL 5I1KL 4GXUM 1G9MH 2W9DL 4L3ED 5GGSB 1AQKH 2R2HA 5GGUB 1LD9B 3DYPA 4XNXL 1OVZA 1UACL 4J4PD 5CGYC 4PRHD 1OB1B 1QSVA 5DJ0A 4NQEB 3KPRB 2XNAB 3K2UH 4JPKL 3MBXL 3U36B 3RTQB 3K80A 2JJSA 1IZKA 1EVTC 1RZIA 2DRUA 4MLIA 4U6VH 2ORBL 2NY6D 2O5ZH 5I8EA 2DYPD 5IV2B 5DJ6A 4JFHD 3C2AL 1QPXA 4NSKA 1JWSA 2P24A 3KXFE 1DBJH 3WHE0 3S96A 3AS2A 4GRLB 4Y4FB 1J1OH 5HHNA 1LO2H 5F88B 4XP4L 2EZ0C 5D9SB 1XIWC 1WVZA 3AU1A 5DURD 5GGTL 5IVXB 1DFBL 3OKEB 1FNLA 1UCBL 1OAXL 1NGQL 5HHME 3TH2T 4UNVA 2B39A 5H37G 3V52L 1JNHA 4PV9B 4QRPB 1W72A 1JN6A 4YXKL 1FZOB 3ARGA 2P8LB 4GO6B 4FQIH 1KULA 4OGZA 2VNCA 4LPYA 3ECBA 4IRSB 2JIXD 3C6LA 2BVTA 3TJEH 3V8OA 2O26U 1I1AC 1BQLH 3ZE0E 3RZCD 3H0TB 3HNVH 3H9SA 3S88H 3KYKH 1JNLL 3V8CA 1DEDA 4NFDA 2MQ3A 3BFOA 4JHBA 5TH2A 1ZVSA 4NZTH 1P1ZB 1N0LA 5DRWB 3EYFB 4PRAB 4X9HA 1JZ5A 5DK0A 3RL1A 2NY5H 2HVKA 2PW1B 3PGDB 4N68A 1IC7L 3QIUB 4LPVA 3SDCD 4ZNEE 1B3JA 3TA3A 4JFZH 4K3HA 1PVHA 3AS0A 5J57B 2P7TB 3GMRB 4UDUB 5E00B 4AENA 5FFLA 1C5CL 1LP9A 3ORJA 5IHLB 5L0QB 3LIZH 1FIGL 4J8RA 3N9GH 3QUZC 3KPNB 2KUTA 3IU4H 3MCLL 4PG2C 5BQ7B 2GT9A 3SDAA 4MCZA 1UXSA 4ODVH 5I1HH 3DPBA 3G5XA 2HMID 5GJTH 5CEZH 1ORQA 3OR7A 3QJHA 5F44A 2A83A 3FQXA 4JFYB 3QQ9C 1RIHH 5D72H 3MRFB 2QQNL 3OB0H 2V17H 1RIVL 1WCQA 2M26A 1H5BC 4WI9A 3GMMB 2WMPA 3QI9A 3WMSA 4DN3L 4XT1C 1X7QA 5EZJB 3ZTNH 1OGAD 2WM0A 1WBZB 2H41A 4PY8J 4HHAA 3IXAA 1FE8H 1MRCH 4PRDA 2YZ1A 3VE0A 1TZGL 2ZOKA 3BZ4B 1FZJB 2VZSA 3VGBA 1JI2A 2CK2A 3I6LE 1WJ3A 4CNIB 1T7YA 1F4YL 1CFBA 4L4TD 2CLRB 4YXLL 4R4ND 3GSQB 1R0AL 3T2NL 5DUPH 4OT1H 1AJ7H 3PQYA 4KC3B 1A6VH 4MMZC 3GNMH 4FQLH 1J8HD 5D1QD 1X5LA 3WN5C 3E0GA 4HK3N 3NFSL 5E8NA 2J6EA 1TVDA 3JWDC 2VXUL 4JM2F 2MWCA 2UZXB 4N0YL 1MREH 5KVGL 1AR2A 4KRPD 5E7FA 4JHAH 3CFKA 1XGPB 4WUUD 2V2WB 1U8MB 4OI9A 4ZOCA 4ZQKA 3WIFB 2BY3A 2E3VA 1MQ8A 1G6RA 5AAMA 1GZPB 2ZJSL 3FL7A 1KF9B 4RDQF 3T0EE 5BV7H 4ZS7H 2P48B 5TE6H 2BNRD 3PWPD 3QIWC 3B9KC 3T1FA 4APQD 3T08A 3G5ZB 1DR9A 2VL4A 3WE6B 2NMSA 4XNYL 1C7TA 5A2LH 4OLXL 4I5BB 1OP3H 2XKSA 4J3SA 5LCVL 4LGPB 3VRJB 3B2VH 3MSPA 3MUHL 4TVPH 4LVNB 3S37X 4PJBB 1JUFB 2WINA 5EPMB 3E3QC 4FFZL 2YA2A 3ULVE 5AWNL 3SE9H 2AJYL 3MROB 4PGCA 1S7XA 2A77L 5A2IH 5E9DE 1DCLA 3S98A 1EXUB 3Q0HA 5C07E 4Z7UB 4Z7VB 3RIAK 2HJKA 3JUYA 5C0GA 4U0RC 2ZUYA 4I3SL 1MI5B 3O9WB 4K2UL 2ED9A 3CDGB 5LGHL 1JZ8A 1UZ8B 5T3ZL 3WS3B 4WTXA 1G9NC 1RJYB 5FB8A 4XXDA 1TTFA 2CKBH 1L0QA 4DGVL 3DYMA 1C16B 1Q72L 3LKSA 1BECA 1PYWA 3JWOH 2DL9A 4OBSA 5DGRA 2YN3A 4I2XB 1Z9MA 1KIUA 4PJ9B 4UINH 4EN3D 2Z0BA 1DQLL 4DAGL 4Z7WA 5H94A 3HCVB 2VN4A 4KK9D 2IPKA 1QFUH 1KXTB 3GB7B 5FO9B 2KL6A 2GTWB 4JRYE 1XGTB 3BT2H 5EB9A 4OAWA 5E8DL 5ANME 4MJ2A 5D7LB 2PO6D 1AXSA 4ZNEA 4RDQG 4JFOA 5FGCE 3TP4A 2AS5M 1HDMA 2N4IA 4OJFH 3FT2A 4JFDE 2EXWC 4HQQL 1DVFD 4O2CB 2EEBA 1EHLL 3CX5J 5CLTA 5DJXA 2VLKE 5FUCC 2CIKA 1PG7H 2OL3L 3HS0B 5A43C 1BFVL 1EO8L 5K59E 1PKQB 1P7QB 1ZA3B 2A9NL 4HMCA 4XGZA 1T1WA 3VFNB 2O5XL 4KTDH 1GH7A 2J8UB 4JG0H 3IGAA 4LSPH 3BPOB 1V05A 3O3AB 3H42L 4GRWH 1R24A 5HXMA 3N0PB 4JGUA 4RZCB 4XPGH 5DDHB 1ORSB 5CP3A 1JHKL 5DSCB 3DYOA 1CU4L 1PAMA 3C5JB 4AQ1B 3GJEA 5HGAA 4E5XB 3T3ME 2BERA 5J9PA 2GK0A 4G8GE 1INQB 1FFNB 1Q9KB 3QISA 2Q76B 4BQ8A 3PXJA 4ZTOH 1G7MB 5FGSA 3RIFK 1EEYB 3VXSD 1GC1H 3LDBC 4WEBH 1A14L 1R5VB 5KAQF 3P77A 1A6UH 1IARB 3SDYL 1BX2B 3O4OC 5LAXB 3QUYC 1QSEE 3M45A 4JM2C 1KN4H 2VDQH 3QG7L 4P46D 2OZ4H 1H3PH 2CDFB 4NBZB 5BOZG 3T8XA 1U8JB 4Y16C 3H9HB 2BJML 5EO9B 5HJ3A 1D6VH 1QUNA 5I8OH 4NOFA 5D96C 5JMRA 2VDNL 2BSSA 2NY0D 1N59A 4UI2A 4F7EB 1HH6B 4X9FA 3P9LA 4AH2A 3VWJA 3GRWA 1IGJA 4E0RB 2OR9L 3FOLB 2CDEB 1JPFB 1ETZB 5JORB 1UGNA 4X4ME 3O2WH 2HP4A 4LOUD 5EG6C 3DXAE 3T0EA 3BI9X 4JY6B 1XF4B 3MBED 1ZMYA 1J18A 3ZYOA 2ADJA 4D8PA 3PHSA 4NO0A 4F57H 3CSGA 3GFUA 4O58L 1X44A 4HS8H 1FGNH 3CVHH 1PQZB 2HJLA 3RI5F 4EI5B 4F9PC 3UTSB 4KMTL 4IRJC 3MODH 3WDIA 5JXAH 2X4OA 1GZQB 2A73A 3G6JB 2HFFB 3RBGA 3ARQA 2DI8A 2D7QA 1OWWA 3O45B 1GIGL 4K9EH 1WK0A 2V5SA 5KTEL 5L2JB 1I1FA 1IEBA 2CR3A 5E9DA 3F6LA 2UYLB 3RNKB 1FSKB 1IFHL 1NFIA 5C07A 2C3GA 3S5LB 1R5IB 3GMOB 3HMXA 4HD9A 2IBZX 2X6MA 4BH8B 3X11A 4PJEB 5KAQG 1W8NA 2LU4A 5BXFA 3SO5A 1S9XB 4HT1H 1WTLA 3VFRA 5CEYA 5DQJB 5E2WH 2W9LA 2AEQL 4PJXE 5D8JH 3GK8H 3V4VL 1AXTH 3JXAA 4PGBB 5GRUH 7FABL 2FWOA 4BH7A 3RJQB 4ZUTA 1S7VB 2HKHL 2JCCB 1FV1A 4BFIB 1SVZA 4IDJH 1J0HA 4QRQA 4PR5B 1KSRA 3HNTL 2BHUA 4CL7A 3WHXA 3V6ZB 5B39A 3DRQA 3I2CL 3QUXA 4JRYA 5M95B 3P73B 5D7JD 1NCBL 4WU5B 4L5FL 4IMKA 2PXYC 1U8KA 3DVFA 5I19L 3ULUF 1VFBA 4UT9L 1SJXA 4JFDA 4G6KH 2RCSL 3ZDXF 2R29H 3CXDL 4OD1L 2HH0L 2AJZB 1LEGB 2VLKA 5HI3D 5GISH 3IDGA 1UJ3A 2IPTL 1NBVL 5HY9A 3LKPA 3V79C 5EU3A 4Z95L 5T1KD 4GAGH 2R2HB 1PZUB 3N1PC 4Q0XH 1RZ8B 1OF2B 1KBGL 1SJVA 2IFGA 5DJ0B 4CVZB 1XF1A 1T6WA 2EZ0D 4XI5D 3W5NA 7CGTA 1JMXA 1QHPA 1FGVH 3ARTA 4M6ML 2VIRA 2KKQA 4PLNC 5M94B 5I8EB 4NQCB 1VPOL 4G8GA 2VLLA 2IFFL 1UVQA 4H0IA 3U2SA 5A3IC 5DJ6B 3SJVA 3MLZH 2J4WL 3BQUA 4NSKB 1JWSB 5DQ9A 4BJLA 3S96B 3QHTC 3QDJD 4QRUA 5EOQH 4PJAE 1LILA 2I5YL 4Y5XC 1NFDF 5GS3A 1I1AD 4RNRA 4RWHA 5HYJD 3AU1B 3OGOE 4P9HC 1EFXA 2DM2A 3C09C 1SEQL 5KOMC 4M3JA 3VI4E 4LIQL 2YPLD 4X5XB 1SJEA 1JPTH 3GMLA 3D0LA 1F6AB 1C1EL 1JN6B 1LE5A 4JY4A 3ARGB 5ENWA 4L8DA 5F8QC 1KEML 4HXBH 1NMBH 2HT3D 3ECBB 4LEXH 4U1LA 1JZ2A 3ARDC 3C6LB 5CIPA 5CJOH 5CFHA 2Z31C 3TVMC 2A6DA 1QTYT 2XOTA 3GJFH 3KG5A 4JO3H 2D7MA 5DR5L 5IFAH 4HCRA 4X4MA 5E6IA 1M7XA 2UUDK 4M7ZB 1T0MA 1FNAA 5EIIA 3DXAA 4H8WH 2C4XA 2DQGH 1KCVH 3BDYH 2FB4L 3QUZD 5TH2B 5CKAA 4TQEL 3ZLQC 5D7SL 3UDWC 3UAJC 4UV4L 3NCFB 3IDNA 3OAYH 3M1BA 2QQKL 3W39A 2QQQA 2WUCH 5EO1A 1I8MA 3QPQC 3TA3B 3MACH 1XF3A 2MCPL 3WIHA 5F7NC 1YEGL 4AENB 1LP9B 3T0XA 3WL9A 3MRKB 2OS7A 1CXFA 4J8RB 1FLRL 5C0AD 4ZO9A 1V3MA 3E6HA 2DF3A 3KPQB 4CBPA 3RGVA 1YEKL 2GT9B 3EYQC 3SDAB 3LEVL 4MCZB 1UXSB 5JNYA 3PP4L 1BD2D 1ORQB 3OR7B 3QJHB 4OCSL 4UV7L 3FQXB 4YHLL 2F58H 5MEND 3OGCA 4X7DC 1NMCC 3HI6H 2ITDA 1V3LA 5TE4L 1FPTH 3G6JF 1F97A 1INDL 5C7XH 3MRDA 4JAMA 3DLQR 1X7QB 5JW5B 4OM1L 5BJTB 1GGIH 4U3XA 4Q6IA 2VSCA 4HHAB 2NTFA 1AE6H 5CD3A 2HAZA 5JZ7C 2BDNH 3OPZL 4EXKA 5L6YH 2H1PH 4OB5H 5HPOA 4Z7QF 1OAKH 3ULUC 1MHCA 5CSBA 2EICA 1F58L 3LD8B 4PJEF 4OD2A 1BBDH 1U6AL 1CIDA 3QJFA 5HDLA 2ESVB 2FCBA 5I1EH 5DHYB 3O0RH 2D7PA 3GSWB 4Z76A 3O2DA 2AXJA 3HI1A 1G9MC 2FD6H 5JUEH 5KVEH 1KB9J 3ZHDA 4JDVA 1XCQA 5EOCL 1NGYA 1S9VA 5F89A 3B9KD 1Q9WB 4GBXA 4XWOD 4FFWC 5TQ2H 3FB6A 5BCAA 1MCQA 1WICA 3CFKB 3WUWA 2WIIA 3O11A 5CILH 5IMMA 4ZQKB 1K9TA 5F7LB 1L6XA 4WVRA 4HIIA 1G6RB 5LXGL 5HDQH 2F5BH 1XGUA 2HRPL 3TO4C 1ZGLP 1ACZA 3HZVA 2JJUA 5HHOD 2FNBA 4XVUC 2VTFA 4N8VA 4U1HA 5ID1A 1B2WL 1VEOA 2H26A 4GAJH 5I18L 3QRFM 2I9TA 1N6QH 5F7YC 4Y5YC 1M1SA 2ZG1A 3KXFB 4UAOB 3OG4B 1MCKA 2FJGA 4NQVA 4ERSL 4PGCB 3LQMA 1S7XB 3ARWA 2KH2B 4PJAA 2ZUTA 4YLQT 2MMXA 3DO7A 3ILQC 3KYAA 3KPLA 5ETUA 4LQ1A 3S5LG 4LKCA 1X5JA 4F9LC 3UPAA 4YHZH 5C0GB 3EDJA 2ZUVA 4R97C 3T09A 1TZIB 4V2CB 4NJAL 2AK1H 5ALBL 5LBSL 1TXKA 2ARJA 4JM4H 5FB8B 3ROLA 4XXDB 4XB8A 3MGAA 5J1TC 2X40A 5GRXG 1OW0A 1PYWB 3WO4B 3FN0L 5DD5H 2XQBL 4M6NL 3FFDA 2B1AH 1Z9SA 4OCLC 3BEWA 3O4LE 3MRJA 1CFVH 4HWEH 4C4KO 5HYIA 1KELH 1NCDL 3C6SA 5H94B 4YEEA 4FXLA 3DNKA 3GI9L 2IPKB 4X0KA 5IFHH 2M2DA 3STZB 4G7YL 1QNZH 3L3JA 3MRBA 3CPLA 1T5WA 2JLLA 1J1PH 4XCEB 2VLJD 2V7HB 4OAWB 5CUSH 5IMOA 3O81A 4O5LH 4AIZA 3LH2L 3PJSB 3OF6A 4OLVH 1FC2D 1MCHA 2ZCKH 4JFOB 1N3NA 1X3DA 3J7HA 3D48R 3FT2B 3LN5A 4KJPC 2B2XL 4N90D 4WI4A 3VFTA 5DF0A 1T21A 1QLEL 3VH8A 1JCKA 4DUXA 1CS6A 2X5PA 4XVJH 4CMMA 4MNHA 2XZZA 1S9KC 2N7BA 3QDAA 2IPUK 4PLJC 1AGDB 4XGZB 1T1WB 3TNMB 1QBMH 3IGAB 3RWHA 3NIDF 3QBTB 5J12B 4HIXL 4JM2D 4KKBC 3MV7E 5HHVL 1H3UA 4HWBA 4UILH 3FFCD 5I1KH 2X4QB 2W9DH 3RY6A 3BMVA 4YDLC 4Y16D 2ZG3A 3GJEB 3ROOB 5DJ8B 4DJMA 4XNXH 5J9PB 2GK0B 1E4XL 1UACH 4KJYA 3UZEA 6FABL 4JPKH 4WEMB 3MBXH 4LDLB 3TBSB 4BFBD 3P77B 1XR8A 2ORBH 4PBXA 4B7IA 2X4TB 1C08A 3TCXA 2GAZA 2QR0A 4U7SA 5CSZA 5TFSL 1TQCB 5C2BL 5L88L 3C2AH 3T8XB 3ZKSD 5IIEA 3QUMA 3NTCL 5HJ3B 1S5HA 2D31A 1U3YA 4RWYL 5KJRL 2BSSB 3MJ9A 4XXCC 4NGHL 1FLTX 2BHZA 4JG1L 3EYUL 4XP4H 3P9LB 5BV7C 1UKSA 1IGJB 2FGZA 1RVFL 5GGTH 3VGFA 5I1LA 5C0BE 1DFBH 4IRJD 5FYKD 1UCBH 1OAXH 1NGQH 2IAMC 1GGYA 1IRAY 1WGOA 4P3WA 1RJLB 4HV8A 4PGZA 3V52H 1H0DA 2ERJC 2PTTB 4YXKH 3T0EB 3ULVL 3NCMA 3RL2A 2FLRT 4X7SL 2ADJB 4D8PB 3EYVA 4NO0B 4MXWL 1FCGA 2XA3A 4PJFE 5CJQL 2HJLB 1F11B 3DROB 2OM5A 43C9B 1AGBB 1DZBA 2ATPA 4Y2DA 1QFWM 2E9JA 4Y2OA 1ZT7A 2X4OB 5C9KA 1T7ZA 1MAJA 2A73B 3FQWB 5HSFA 5DRNB 1X6NA 4U49A 3RWCA 3RP1A 5SX4I 2V2TB 5BRZD 5E9DB 5DRZA 4WHYH 2YXMA 1IC7H 1D5IL 1DQTA 1NFIB 3C8DA 2R0WL 5C07B 2ENYA 3JWOC 5TGBA 1R3LB 1C5CH 1HK6A 3EUUA 4EUPH 4PGJA 4PJGA 1FIGH 1ZHKB 5BXFB 2MJWA 3VFRB 4YR6A 5CEYB 3MCLH 4BK4A 2MQCA 2RJMA 4TSCL 4KVNL 2O5YL 3MLRL 3TT1L 1J1XL 5F71A 1A6WL 5T5NF 4BH7B 2QQNH 3O4LA 1CYGA 1RIVH 4HW6A 1U42A 2QBWA 5I1JL 4QRQB 3UMTA 3QAZC 1AD9A 4DN3H 1A4JA 2BCKA 3DRQB 1I1CA 5FKAB 1G84A 4JRYB 5ANMB 1QRND 4KUCF 1TZGH 2C9AA 1XGRA 5FGCB 4FQXC 4QNPF 2EC9T 4XHQA 3BIKA 5D7IE 4JFDB 1RIUL 1F4HA 1F4YH 3CFDA 2VLKB 2AXFA 5HDBE 4YXLH 3IDGB 1R0AH 4X6DE 4Z7WF 3B6SA 3AY4C 2IANE 3D2UD 3T2NH 5HY9B 3LKPB 5IW3A 5EU3B 4X6EA 4W6YB 3NA9L 2HTLC 1IEAA 1QR4A 2FX7L 3AREB 4HFWA 1FL3A 1GPOL 5DI8A 3UP1A 5LG1A 1QOKA 3A6BL 1W0VB 5I8CA 2GIYA 3NFSH 1I8IB 4G6FD 2VXUH 5D1XA 3P0VL 2YMXL 4N0YH 2BSRA 2CUIA 1YEDA 5KVGH 3MV7A 3C08L 4JGMA 4EZMA 1U93B 3OKOA 1GC1C 4X9BA 2GK2A 1RU9L 1GJIA 5E8PB 1KIPA 4IBLT 3M17B 1W0YT 2ZJSH 4HWZB 2VLLB 1UVQB 4HWUA 5IF0A 4OFYA 3MNZA 3BQUB 1MRDL 2YPKB 5DQ9B 3KAAA 1BVKA 1U3HD 2VLRE 4GS7C 3VXUA 1N7ML 5DO2C 3CZFA 1ZLVH 3NGBC 1QSEB 2UZYB 3Q48A 3ARDD 4XNYH 5GIRA 2Z31D 4OLXH 3TVMD 3WS6C 4J7RA 1CDIA 4RNRB 5LCVH 1CXKA 1EFXB 3WFHA 2IBGA 1XEDA 4FHBD 2AAVA 3DVGA 2IMNA 4FFZH 2K1MA 5AWNH 2AJYH 1L9NA 4KAQL 1SJEB 1A3QA 3GMLB 2A77H 4KKLC 3TWCL 4JY4B 1SEBB 4ELMA 5ENWB 4S11A 4L8DB 5JOEA 3IU3A 1KPUB 3TESA 3HPJB 4U1LB 1X4ZA 5C0BA 3BZDA 1QQDB 4KY1L 2HG5B 3QPQD 2A6DB 12E8L 4EQ2A 3HC0A 4I3SH 5E6IB 5FDWA 1NGZA 3ULSB 4K2UH 5LGHH 4WFHE 1YMMD 5T3ZH 2MPAL 5EIIB 1HXMA 4ODHL 5C0JA 3DXAB 3EW3B 5DHVH 3G5YA 1X5AA 1OGTA 3GBML 4DGVH 1Q72H 4RMWA 2X4UA 5C0FB 4UOW1 5TDNA 3TYFB 3UYPA 4HKJA 4LK4A 4P4KA 3IDNB 1XF2B 1YEEL 2HN7A 4K9EC 1J10A 3MQIA 3FHAA 2HLAA 1DQLH 1YNLL 1QSFD 4DAGH 3REVA 1I8MB 2ADFL 2VL5A 4F7MA 1PX4A 3RFZC 1MAKA 4ZUSA 2Q8AL 1OP9A 1U3JA 3CC5A 3WL9B 5IW1A 1H3WM 3UO1L 1KFAL 3CH8A 3NFNA 3E6HB 5E8DH 3T3PF 1ZVHA 4WO4A 5IROC 4HAGA 4XP9L 2R1XA 3TV3L 3UC0L 4BUGA 5JNYB 3WEXA 1FO0A 4JFEE 3ULUD 2VKWA 4HQQH 4CMHB 1OM3L 1EHLH 4BZ1L 3OGCB 1FFRA 3L7FB 2GY5A 2ITDB 2XA8L 5FO7B 4P0DA 2OL3H 4Y88A 3MA9L 4JPIA 4PJXB 1BJ8A 1XT5A 3MRDB 1BFVH 5FYJU 1EO8H 2R1YA 4WV1C 4HK0A 3ALXA 4Q6IB 2A9NH 2NTFB 2O5XH 5I1CL 1PY4A 4LDEB 5EWIL 4IRZL 4KI1A 3H42H 3BSZL 1MHCB 5DFWH 3FRPA 2V5MA 2BNQD 5IMLA 3TFKD 4FFWD 4OD2B 1JHKH 4X9GA 1OPGL 3BESR 1CU4H 1I85C 1YDPA 5HGGS 3S36L 1NC2B 3AFLA 3X14A 5D7IA 3BRDA 1A14H 3TO4D 3ARPA 3SDYH 4C83A 4OFPA 1XCQB 4ZOEA 3RKDC 4DW2L 2FGWL 5EZIL 4XVUD 1S9VB 1B0RA 5F89B 4X8JA 1NCAL 1JGVL 4WFGE 4X6DA 4MLSA 3QWQB 3QG7H 3EJJX 4GBXB 4K8RD 5FCUL 4QT5A 4UNUA 4LSTL 3FB6B 5C8JA 3O11B 5LQBL 5F1IB 2BJMH 2VXTH 5DEZA 1T2QL 5DFVC 4HIIB 3ZYJA 2VDNH 4YHOL 4OF3A 1P5UA 1GHFL 4L3EE 3S35L 3TN0C 3E2HC 1XGUB 3GSOB 5MI0B 4WFED 4ZXBD 3HZVB 1AO7D 3OAZH 2OR9H 1YJDL 4N8VB 4UIMA 3ILQD 4PRHE 1HHHB 3GMQA 1TJGL 4U1HB 5ID1B 2LE9A 1FC1A 4L9LC 3PNWA 2NY4D 3PWVA 2I9TB 3BN9C 4WNQA 2R8SL 4P2OC 2VLRA 3RWDA 4NQVB 3U9UA 2NTSP 1W2KT 2KZWA 1JPGA 4RGNC 4Y1AD 4JFHE 2DLFL 1U8QA 4NBXB 1UM4L 2H2SC 4PJAB 5K33A 4KDWA 4O58H 5I1AA 3MZGB 4ZPTA 3DO7B 4KMTH 5ETUB 4JR9L 4LKCB 1R3KA 4K7FA 2XKNA 4JKPL 4YH6A 4S1QL 1GIGH 4LP5A 3OKYA 5KTEH 2ARJB 4L8CB 1B0WA 4H8WC 2NW2B 1OD9A 1OSZA 2VAAB 5JDSB 4U6YA 5C0IA 3L3DA 1IFHH 1J11A 3F7YA 3ZKNC 2D0FA 4Z18A 1AD0B 1II4E 3RWFA 3FFDB 5KZCB 4OFKA 5CEZD 4ZTPL 3D3VD 4ORGA 3OKNB 4KJPD 4PJ7E 3BEWB 1BEYL 1KTRL 3U4AA 2AEQH 4X0KB 3PWJB 4KUZL 3L3JB 3WCYA 5C0CD 3V4VH 3CPLB 4PTUA 4X7TB 1T5WB 3GSXA 2EDRA 5I76A 4JZJC 7FABH 1VEMA 4C4KT 5SX5K 3VW3L 2HKHH 2VISA 3BKYL 4XPBL 1TITA 1N3NB 3VGHA 3LY6A 5J6HA 3HNTH 1WWBX 3OHXA 3BVNA 5ISZA 4WWKA 3LN5B 4HS3A 4KKBD 5DYOA 3BN3B 3VFTB 1T21B 1X5HA 3I2CH 3FB7B 3QO1A 2EC8A 1NCBH 5K9OA 4L5FH 3VD5A 3VH8B 2YC1A 5KSAB 3KLAA 4HUUB 1JWMB 4CMMB 5I19H 2YSSA 3TGXA 3KPOA 4UT9H 2R4SL 2DWEB 3WNKA 4CN6A 4JLRA 3CXDH 4OD1H 2YRPA 2HH0H 4ZO7A 1BQHB 3RWHB 2OQJA 3CD4A 3HZYB 1HEZB 1KT2B 5HGBA 2DLHA 3VXTA 1MCSA 2IPTH 1NBVH 5C2UB 4JFPA 4LSQL 5L8KB 1FVDA 4PRID 4Z95H 1J5OL 1G1CA 5JW4R 5DC9B 4UIKL 1DN0A 4ZSOE 3KNBA 4OZIE 3OJDB 3B9DA 3VDCA 1KBGH 4KJYB 4XTRC 4J3VA 1OGAE 3UCRA 2ICES 1UXWA 1G7JA 2A74A 4M48L 4M6MH 3LQZA 2GAZB 2QR0B 4ONGL 5CSZB 1K2DA 1U58A 1VPOH 2IFFH 3VRLF 3HZMB 1Y6NR 2M1KA 1QLRA 4L4TE 2J4WH 4Y89A 5D2LE 3MGOA 3NPSB 35C8L 5IIEB 3QUMB 2W65A 2D31B 1ZANL 4TVPD 2AXHA 4XC3L 2P49B 5KS9B 2VXVL 1J8HE 1G7LB 2I5YH 4LLQA 2C4FU 5GXBB 1IAIL 1EO5A 4LCIL 1WZKA 1OTSC 3DIFB 3FB8A 4Z5RA 3ILPB 3IDYB 1SEQH 2KQMA 1YEJL 5TDPA 1U92A 2GCYA 4LIQH 4N0RA 4FMKA 4WUUE 2V5RA 1WAAE 4JRXD 1H0DB 1C1EH 3SKOA 3MRCA 2PTUA 4PY7A 3RDTC 1KEMH 1TVHA 2Z4QB 3I3BA 4HIEB 2D2OA 3RL2B 2PF6A 4J4PA 3PV6A 4PRHA 4NQSA 1SJHA 3TM6A 1ZHBA 1OSPL 5DR5H 3ZE1E 4HC1L 2VITA 4ISVA 1YEIL 4MQ7B 2BNRE 3BJ91 3PWPE 4NHCL 5DMJB 3GSRA 2ZWLT 3SKUD 2W91A 4DCQA 3EAKA 4Y2DB 4NM8L 1G7HA 1ZT7B 2FB4H 2ADGA 4LHQB 4TQEH 5SWZB 2DYPA 5D7SH 1MFDL 1CD0A 5FGBA 1MIML 1YC8A 4RIRA 4UV4H 4F58L 2QQKH 1KCUL 2MNUA 5ESQA 3QEQE 3DX8A 2MCPH 3LS5L 1YEGH 1NC4D 1BZ7A 1AHWC 3IDXL 2C1OA 5JXEC 1QA9B 4QHUA 5B3NA 2APTA 1FLRH 3H9SD 4PY8I 4D0CA 1INEL 1MCIA 4LPXA 4OGXL 1YEKH 3LEVH 5E2TL 3VFPA 3C5ZC 3PP4H 4FQXD 1ZV5A 4OCSH 4UV7H 4YBLC 4YHLH 2MKWA 2F5AL 2VDOL 2EDNA 3O4LB 4ENEC 2JIXA 5HVGB 2X41A 1EHAA 4LLDB 2FH6A 4ZFOA 5TE4H 1PEZA 1AD9B 3VI4F 2Q3AA 1INDH 3JWNC 5GGRY 2BCKB 3NIFF 4OM1H 1WWWX 2X9XA 2DLGA 4D0BA 2HTLD 2XKUA 3OPZH 3ZHKA 1YPZE 5DHXB 5MP6L 3VFGL 5GGQL 1XGRB 4UT6L 4XPTL 4CDGC 3BIKB 1HN1A 3MREA 3TCLA 1GGCL 1F58H 4YXHL 1U6AH 4FMFA 3MV01 5ID0A 3ZSTA 1DN2A 3CFDB 2L7JA 3IXTA 2AXFB 2BVOB 4YZFF 2FLBT 3CFJB 1H9VA 3B6SB 4UU9A 3MRIA 4XB7A 1ZGLB 5HYFA 4X6EB 4U7MA 4KHTL 4I48A 3QI9D 4EQ3A 4HFWB 3D5OF 2JB5L 2RFXA 4WHTB 5DO2D 5EOCH 1T83A 2QHRL 5I8CB 1DQQB 1Q9LA 3O6FA 5D1XB 2BSRB 2UWEE 4Y4FC 5KSBE 4F3FA 4YK4C 1V7ML 3OKOB 4N8VG 4E42B 4QWWC 1CFTA 3HC3L 4MD5B 1RZFL 5A16A 3TBYA 3VXRE 3BD3A 4ZSOA 1KIPB 4OZIA 2FL5B 4ZUUA 3EJYC 5EOTA 3WYRA 2MKLC 1D5ZA 2X1XR 3BISA 3OAYK 5C08A 5IF0B 2HT4C 5LXGH 2A6JA 2JJVA 3MNZB 1MLBA 2HRPH 3KPMA 1BVKB 3L6FA 2FO1A 2C3HA 3CNKA 3BDXA 5GIRB 3ZDZE 1B2WH 4HPOL 3VXSE 5I18H 3AMLA 5D2LA 2LU7A 3EFFA 4YFLF 4ERSH 5ICZA 3DVGB 4QRRD 2XG5A 3IFLL 2EKJA 4KHXL 1MPAL 5EIQA 1QBBA 5D1QA 5B4MD 4DFHA 3LPWA 2EYSA 1AI1L 5LKNA 3IU3B 4ZMAT 5C0BB 1WC7A 4Z6AT 3HFML 1CXEA 2L4OA 4NJAH 3AM8C 3EKCA 4WUUA 3IDJA 1WAAA 3V0AC 2DQDL 5ALBH 5LBSH 4N9GA 1HXMB 1PDKA 1OGTB 4D3CL 5L0QC 1CVSC 2X4UB 4MJ5B 1IAMA 3FN0H 4HKJB 4P4KB 3G04B 2XQBH 2EEAA 4M6NH 4LQFL 4MDJA 2BNRA 3PWPA 2HLAB 4PJFB 1FHGA 3REVB 5L7XL 2VL5B 4F7MB 1NCDH 4F8TA 3MR9A 3GI9H 3SEPA 1BZ9B 4G7YH 4NRYA 3CC5B 5IW1B 3JTTA 5AZEL 1AC0A 4LCYB 4LPCA 5IESL 3NFNB 3VH8G 4K7PY 4WO4B 3LH2H 3QEQA 2R1XB 4KUCD 1YMHA 5ESVB 4KROB 3WEXB 1FO0B 4DK6A 5ACZA 4KZDL 1HHJB 2B2XH 4PP2A 4LLMA 1BQHG 1IVLA 4OQTL 2OSLB 4C55A 4JQIL 1MJJA 1QLEH 5DJDA 2DLTA 3H9ZA 4OZHE 1Z3GL 1YEHL 4JPIB 1ZOXA 2NXYC 1QR1B 1V7NL 4BQ6A 5D71L 1RZKL 2R1YB 2EE6A 4NQDD 4HK0B 3LS4L 4BELD 1F02I 3RKDD 3E8UL 4HIXH 1XH3A 5D1ZB 2G2RB 4I18B 5HHVH 1EAPB 4EN3A 5IMLB 4ACPA 4O51A 2VQUA 4PJGF 3WKNA 4V1DD 1YDPB 4QCIB 1YPZA 1E4XH 5DFVD 5E6ZA 5EC1A 1XGQA 2AEIT 3X14B 2VERN 6FABH 2K9UA 5GS0D 5D7IB 2D9CA 3S34L 1DANU 4OFIA 4L8SC 2PO6A 1G0DA 4C83B 4X8JB 3EZJB 5BW7A 4X6DB 1D5XA 2IANB 5TFSH 5L2KD 1DVFA 4MWFA 4QHNB 5C2BH 5I9QC 2NY2B 5L88H 5C8JB 4K71B 3ZKXB 3VXMA 5EFIA 4OCRL 3NTCH 3UTQA 3BN9D 4P2OD 4JJ5B 4RWYH 5KJRH 4I4WB 2Q8BL 4F37K 4H25B 4OCXL 4FQPA 4NGHH 4JG1H 4EVNA 3EYUH 2UWEA 1QZ1A 5KSBA 1CFQA 1MJ8L 1RVFH 1HNGA 5SX4H 3VGGA 4PD4J 1MJUL 4G6ML 3VXRA 5F9WB 1S8DA 3PNWB 3O8XA 4PB0L 3QCTL 3PWVB 1LK3L 3IS1X 4WNQB 3ULVH 4HEPG 1FVEA 1EJ6A 3LRSA 4G9DB 1VGEL 4JZOA 3MNWA 4YDVB 3U9UB 1TCRB 1JPGB 1RSFA 4BSVA 4X7SH 4S1RL 4LRIC 4MXWH 4Z0XB 3BWAA 4HIJB 3VXSA 3ZKND 4KGLA 2K7QA 5CJQH 3QDJE 1KIQA 3VWJD 1AGCB 4HLZH 1R3KB 2OJEA 4K7FB 4P46A 2XKNB 5E99L 4OZGF 3T0VA 1K8DB 2JK5A 2Y1VA 2JJTA 3LEYL 5HYJE 5C3TA 5MEPB 5AZ2L 3NCYP 4NO3B 3DETC 4LRNL 2IH1A 3GO1L 1A9BA 2ICWA 1OSZB 3BYTA 4U6YB 5C0IB 3L3DB 5JHDD 3WFZA 1D5IH 4NC0B 2R0WH 4HFUL 3NCBB 1X9QA 3F7YB 1CDGA 1JHLL 1W0WB 4N1HB 5SV4A 2JF1A 2HT2C 4ORGB 1GRWA 5C6PB 2HFEA 2NY3C 4TUKL 3VXOA 2X1QA 5IHZA 3C8KB 1VKXA 2VZ3A 1H8NA 3R06A 4TSCH 1FG2A 3T4YA 4KVNH 3O3EA 1DUZA 2NLJA 4JVPA 5F7EL 2O5YH 2Q87A 4PTUB 3SDXA 3GSXB 5I76B 3MLRH 3TT1H 5DMYA 1J1XH 5HGHB 1A6WH 3MBEA 4OCYL 4ELMF 2AV7B 2BX5A 4G43A 5KOVC 1L0YA 2VISB 4UOW0 5I1JH 2R0ZL 5J6HB 3NFPA 1JZ7A 3BVNB 4WWKB 2HWZL 4FABL 4XNUL 1QP1A 1E4WL 3QO1B 1TPXB 2W0LA 5I71C 1TDQA 5K9OB 2QLVB 2X2YA 5JPMA 2YC1B 5F6HJ 1WZLA 2R4RL 3KPOB 2CDGB 5C0AE 5HHQA 4JFEB 4XTRD 1RIUH 4JLRB 4KWUA 1QEWA 3KYMA 1SYVA 5IGXL 1FYTD 4FZ8L 4YHPB 3VDBA 1FQ9C 4OZHA 1BD2E 4JFPB 5C92A 5T3XL 2D7TL 1FVDB 3IKKA 3MYJB 3NA9H 2APWA 5MENE 2FX7H 4TRPL 1GPOH 4X6BB 3PABA 3A6BH 2CGRL 4ZOBA 1GGTA 5E56A 1DN0B 2DIAA 4YDIL 5CGMA 3QUXD 5HD8C 5EUOE 1GYAA 2G5RA 3U46A 2LVCA 3P0VH 2YMXH 4QRTA 1S5IL 3B9VA 3C08H 3FCTA 1UXWB 1ZKAA 4M93B 1G7JB 2A74B 3LRGA 4OLYL 4NO5A 1OTSD 1RU9H 3LQZB 3NZ8A 3NCEB 2H8PA 3FN3A 4R90L 5AUMA 3CZJA 1WT5C 1U58B 4U1GC 4QOKB 1KJMA 4JB9L 1QLRB 4OI8A 3MGOB 4P3DA 3VD9A 1MRDH 3DURB 2W65B 1RK1A 1N7MH 3IFPA 3RDTD 1NEUA 3N1QC 4IMLB 3EDEA 1IZJA 1RUQH 2FRGP 5DVNA 4S0TD 1M05A 2E7MA 1P4LA 5BS0A 5I74C 1D5MA 2Z8WC 3FB8B 4Z5RB 1T0PB 1A2YA 1RHHA 4UTAL 2XXCB 4KAQH 5T1KA 5FYKU 4WI5A 4L3EB 8FABB 3TWCH 3MRCB 4PY7B 3SJVD 2RAMA 1CWVA 4GXVL 1TVHB 1FJ1A 3S37L 3CIQA 3E3QE 3PV6B 4KY1H 1SJHB 5HDBF 12E8H 1ZHBB 4HUXB 2BVUA 4ISVB 5HHOE 2MPAH 1XIWA 4ODHH 4DCQB 2NY6B 5JXED 3CMGA 3GBMH 3S9DB 5MHSE 4ODUA 2DYPB 4JREB 4M3KB 1MNUL 4RIRB 4PG9A 1YEEH 3C5ZD 4GW1A 3IYLW 4MD0A 2WWMC 1S9WA 2CO6B 3RWEA 2FSEA 1YNLH 4X9IA 3BD4A 3DX8B 2ADFH 3QQ3B 3U4EA 3DRTA 4X4XA 2Q8AH 1I1AA 3L3IB 5DURB 3UO1H 3QXDA 3FQRB 1KFAH 4IOIA 1DDHB 3BZFB 4LSVL 4QHUB 4D0CB 1D5BA 5JTWA 3MLWL 4NN5B 4XP9H 1HI6A 3TV3H 1OD7A 3UC0H 3VFPB 2QL1A 2BK8A 4XC1L 4WJ5B 1JZ4A 1OM3H 2YEZA 4BZ1H 3I6KA 4PJ7B 1MCLA 2JIXB 3DBXA 3UBXA 2XA8H 2BNUA 4M5ZL 3FRPG 1N64L 4MAUL 3RZCB 3RUGF 3LV3A 3MA9H 3IRZA 3PIQB 2I9LB 5A2JH 2XTJB 4X98A 3L3OA 4D0BB 2WAHA 3DGCR 3WNNA 3QUZA 4QYOA 3KDMB 1MRFL 4FG6C 5FUCE 3OZ9L 4PG2A 5CS7A 3UZVB 5EWIH 4IRZH 2E7LC 2E6QA 3VFUA 3BSZH 3U0WL 1P5VA 3RGVD 2VLJE 3MREB 3TCLB 4PRBA 1MJ7L 2DM7A 1A6PA 3JZ7A 3HR6A 3SDCB 1OPGH 3B9EA 3IXTB 1PSKL 3EGSA 2EO1A 2Q86A 3S36H 5CJ8A 1H5BA 4UU9B 4N90E 4XPHL 5ITFA 3MRIB 5FYJL 1KJVB 2I07B 3EJYD 1P6FA 5C0AA 2C3WA 3DV4A 4F7PA 2RFXB 2VXSL 1K6QL 2GFBA 3BYYA 2P43B 4DW2H 2FGWH 5EZIH 3GDBA 1Q9LB 3VI3F 1NCAH 1JGVH 1BD2A 3C60C 5FCUH 5DMIL 4F3FB 4LSTH 1KXQE 5LQBH 1CFTB 3BZEA 3UZQA 3TBYB 2DMCA 2G5BA 4XNZB 1AIFA 4ZSOB 4OZIB 1T2QH 4M6AA 4OF6A 1MEXL 5DWUL 1QVOA 1Y6MR 5EUOA 4ZUUB 1F5WA 3MGTB 2V9RA 5EOTB 3SKMA 3FFCE 1GHFH 3L95B 3SGEI 1OGAB 3S35H 1MLBB 1YZZA 1KCRL 1YJDH 4HUWA 3O41A 4WY7L 3WN5A 1TJGH 1T66D 3OAUL 5ITBL 3KPSD 1YQVL 2WBJC 3F58L 4L4TB 3BPNB 2YUZA 5D2LB 2R8SH 1WZ1L 1T80A 3KYNB 4G8IA 4M7ZC 4HKZA 1EAJA 5E7BA 5ICZB 2GUOA 5DMKB 5D5ME 4TPRH 1MAML 1T4KB 2DLFH 1IC4L 3P4NB 1GL4B 1J8HB 1UM4H 5D1QB 3L5IA 1EPFA 2EYSB 2CH8A 3V7MA 3QIWA 4JR9H 4EIGB 3B9KA 1WC7B 2DI7A 4KRPB 4JKPH 1ZLUH 4GFTB 4S1QH 1T7WA 4WUUB 1JPST 3BH8A 4AEIL 4AY0A 4N9GB 5FYKE 3MFFA 2XWBA 3IJSA 2SEBA 2Z92A 4JN1L 2J2ZA 2AQ1A 2F8VA 3NBNA 2OP4L 4DKEL 4MDJB 5HHOA 4JO2L 4ZTPH 2BNRB 3PWPB 1P9MC 1I9RL 1BEYH 4APQB 3PGCA 1CTOA 1BVLA 5E5UB 3MR9B 5JW3L 5MEOB 5IKCA 2NNAA 4P2QD 4KUZH 4XBPA 1URLA 1QSZA 2YZ8A 3JTTB 2NXYD 5C0NC 4U33A 3VW3H 2WIMA 3BKYH 3LN4B 4MHHI 4OLZL 4XPBH 3MRRA 4G6JL 5BRZE 3ZKMC 1I9IL 3ALPA 1K3ZA 1HHKA 3IB4A 4NZDA 3WDHA 1DEEA 1MJJB 5DJDB 1H15A 1GGBL 4HDIB 4OGAC 3L3GB 5HVHC 2BHYA 1HSAA 4POZC 2R4SH 4FQHA 5HGDA 4HF5L 3D6GA 3OAZK 5DD3L 4J3XA 4NCC1 3QDHA 4OM0L 5IB3B 4RMRA 1E4KC 2Y5TA 3OF6D 4KU1A 4P2RD 4G5ZL 4LSQH 4EN3B 3ME0A 4Y5VB 3LSOA 4O51B 1J5OH 43CAA 3LKQA 1Y18A 3CSPA 4UIKH 1YPZB 2YRLA 4K7PX 2V6HA 3NCJL 3OKDB 5EC1B 1Q38A 1XGQB 2PTVA 1SQ2N 2R15A 1ZVYA 3L5WA 3IETA 2GQHA 1QRNE 2PO6B 3CUPA 3Q1SL 3KPPA 4M48H 1U95A 1U8PA 4Y0GA 3GSVA 3UJJL 4ONGH 1R6VA 2ITCB 4MWFB 5EFIB 35C8H 1LEIA 2XQYG 3MA7B 1ZANH 4HIHA 3HRPA 1ND0A 2DTSA 4ZD3L 1PLGL 2APVA 3HG1E 3ZDYF 2VXVH 2R1WB 3PUCA 2AK4E 2UWEB 5KSBB 1CFQB 1IAIH 3UYRL 2Z91B 4LCIH 1NDMA 2VUYA 3VGDA 5HTSA 3DSNA 3SO3B 1YEJH 3QUYA 4JM2A 3MCKA 5IEKA 3VD7A 2CUMA 3FFCA 3GBNL 3LRHA 3SY0A 4Y16A 2AI0L 3DETD 3SGKC 1FVEB 2ZOLA 3LRSB 5T3ZD 4CN4A 3EDKA 4JZOB 4XNMB 3FT3B 4BSVB 1OSPH 2WK2A 4HC1H 3BWAB 1KB5L 4XCYA 3VXSB 3WO4C 5L9DL 1YEIH 4NM4L 4R96B 4NHCH 3EFDL 2HT2D 4NM8H 4FQ1L 1UB6B 2NY3D 3QUKA 4P46B 4XP5L 1MFDH 2JB6A 4OZIF 3OX8B 2JK5B 1MIMH 2OTUB 3BUYA 5D5MA 4F58H 2DD8L 1HILA 2DMBA 5FYLD 1A9BB 2ICWB 1KCUH 1HYSC 5DJ2A 1ZHNB 2FEEL 3V95A 2I60L 2NY0B 4X5WA 4PLKC 4YBQC 3LS5H 5DEGA 1NUFA 4GKSA 1DQJA 4Q9RL 3IDXH 3CFIC 2DQUL 4L3CB 2ZUUA 4F9PA 4IRJA 2HFEB 1INEH 5D2LF 3VXOB 2ICWI 4MA7L 3PHOB 4OGXH 1VKXB 3NH7L 5GGVY 3R06B 2XYCA 1FG2B 5E2TH 3T4YB 1YMME 1DUZB 2NLJB 1BZQK 3PWLA 4R6UA 3TT3L 2F5AH 2VDOH 3BH9A 3LQAL 3MBEB 2BOBA 4YC2C 1J7VR