5FEBA

Crystal structure of the voltage-gated sodium channel beta 2 subunit extracellular domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
121
Chain Sequence
SNAMEVTVPATLNVLNGSDARLPCTFNSAYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNYIMNPPDRHRGHGKIHLQVLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium channel subunit beta-2
publication title Binary architecture of the Nav1.2-beta 2 signaling complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 121
sequence length 122
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5febA00
1HHKA 3WS3B 4KY1H 4M7LL 3ARSA 4QWWC 4D8PB 3DTXA 3F7VA 1YN7B 3KLSA 3I6GB 2VITA 2PF6A 1MI5E 5EU7C 1I85C 3OBAA 1FHGA 3KPLA 4ZSOB 3U4BL 4TTGA 2X09A 1DBJH 4TVPE 2BNRD 5JHLL 4PJBF 4XVUC 3H9HB 1MY5A 2VZ1A 1KBGL 1KUMA 4Y4HD 2F8VA 2VLKE 4JANB 3PWNA 2M8XA 5EA0L 2FJFA 2EDLA 1YZZA 3F8UB 2AQ3A 1NAMB 2LU3A 2I27N 4O51B 5EZJA 4AT6B 1HSBA 4M93B 3MBED 5FK9A 3DMMD 4YWGH 4F7MA 1BJMA 2YXMA 4XTRC 3V5DA 1JWSB 4MJIA 5K9JL 4JPIA 5I74B 3PDDA 2E7CA 3SDDA 3VXUE 5KN5A 5MENA 5IG7B 1JPGA 5E2TL 1F4AA 4ALAH 4LSTL 4Y7MA 3WIHH 2P42B 2I60H 4XNYH 4NO5A 3IGAB 1U8LB 5D8JL 3D39B 4XVTH 4QHUB 1JMXA 4G42B 4F15B 1WEJH 3O3DB 2W07A 4WFFE 5CZXC 4C4KT 4LK4A 3O0RH 4XMPH 4APQA 1RZGB 5IB4A 4LVNC 3VGAC 1OAKL 1I8LA 2W0FB 5C07D 3U0PB 2JCCA 3UZQA 3B9DA 4YHMH 1DR9A 5D7LD 3BZ4B 4FTVA 2Y5TA 2YMXH 4LCUB 3BE1L 2D4FA 3GSVB 4WUUB 4JZNA 4MCZA 4OLZH 2DI7A 5CILL 4YAQA 2WV3A 2QL1A 3WUWG 3MV9A 3HRZA 4XNQA 3MJ9A 1X5FA 3R0MA 8FABA 5I8OL 4YHOL 4NQUA 5TF1L 4ZUUB 4NQEE 3GMNB 2XZAL 1E4JA 2GQHA 1OQXA 4WTZG 4OD3L 4JFHD 4RGNC 2JIXB 2B2XH 3PQYA 4WW1B 5IV2A 2YN3A 3MXVH 4LU5L 4XPTL 3IFNL 4RIRB 4LF3A 1A6VH 2R23A 3U36B 1FC1A 1MAKA 1MCBA 3CLEH 3KDMA 4OI9A 4X4ME 4JFFB 4LEOB 3RWJA 1M1SA 4JFYB 3OJMB 2O5YL 1MFDH 3U7YL 1QBMH 1SY6A 4MXVF 3W9EA 3ZDYF 4HS3B 4TUJA 4ZTPL 2OJZL 4L8DA 2NY0D 3NFNA 2AJXL 3V6ZA 3IU4L 3QXAA 4J4PD 1YPZE 4DFHA 1EO7A 2KQMA 5F7NC 4KK6C 2A6IA 5IWLC 2W1NA 2E7BA 3ET9F 1CG9B 4OZFB 3GB7A 3ULUE 5MEQB 4H1LB 3KLAB 4LPUA 5DVLA 2R0ZL 1K85A 4OLUL 4EDWL 2G60H 3B9KB 2KBGA 1A14H 3U2SA 4R9HA 5EWIL 4QOKB 2CO7B 2BX5A 1X7QB 3GMLB 3L5JA 5T1LD 3MMEB 1R3IL 1PQZB 4RBPK 2CLZB 3B8YA 2GSGA 5EU6D 3BO8A 1MCIA 2DD8H 4Z8FH 1CYGA 4TQEH 1S78C 4DUWA 1RJZA 2AXHA 3DRQB 4DVBB 3V0AC 2H2PD 5F9JB 1JWUA 1NJ9B 3P9LA 2BRQA 3MPCA 2ZUQB 1B0RA 5E03A 2NPLX 3P40A 2WM0A 2D7PA 3OSKA 5IESL 5D9SB 4XPAH 1PFCA 4FQHB 2YRZA 4QRPD 1UJTA 4K3JH 4G9FD 5ICXB 5AEAA 1J11A 2R4RL 3SE8L 4P5TD 5T1DL 4NM4H 1WCBA 2VXVL 4PRBB 1NCCL 3O4LE 1Y6MR 4ZD3L 4JO3H 4X6FA 4A6YB 1VENA 4PUBH 4JQXC 5E6ID 1KJMA 4KJPD 4LNVA 4L4VB 3QO1B 4YH6A 1DL7H 4E41B 4POYA 1RV6X 3C9NA 4WO4C 1NCDH 1NGZA 4LGRB 4JY5H 1I1FB 3MR9B 4YFLF 2A74B 2LQRA 2CXKA 5BVJA 1U8MA 2NX5B 2NCMA 2VIRA 4YBLC 2ESVB 4MNGB 2EICA 3LRSA 1A2YB 4JGJA 2X6MA 1P4LB 5EBLA 5DMYA 1FE8L 4KRMB 1FP5A 3I6LE 5T3XH 1TFHA 1M7IB 1FL5B 1NKOA 3KAAA 2EZ0C 4XCFL 1XIWC 1CLZL 4IRJA 1CFTB 1PG7H 4L9LA 1UGNA 4LLWA 5DMIL 3LIZL 3G5YA 3C2AL 3C5SA 4U2ZA 4XPHL 4XVSL 5FF6A 2HFFA 2MFNA 1OGTB 2IH3A 4JRXA 1AJ7L 1AO7E 1ZTXH 4P9HC 5FYKD 1ZHBA 5GHWH 5F3BA 5T33H 1NGXB 3VFVB 5I1JH 1FORH 5I1LA 4JM2D 4XWGL 1UWGL 2WAHA 3GK8L 4Z95L 3EUUA 2CUIA 5TQ0L 5I8CB 4DW2L 1U8KB 1OWWA 4KJYA 1FN4A 2AEPL 3EDDA 5FM8A 3W0WD 1WBYA 3BP7A 4Z7UA 3AY4C 5GGUA 4QNPE 2P8LA 5C0CD 1BVKA 4CVWA 1IC7H 3S34H 4X8JB 3UJJH 5DK2A 4Z7OF 2KH2B 3UZEA 3QUZC 4XNZB 4RAHA 3NN8A 5FM4A 3QDGD 4POUB 3WE6B 5DXWA 2Z8VC 4YDIL 4HWZA 1SY6H 3RWGB 1DBAH 3HN3A 4A2MA 5EO0B 4F7PB 1OB1B 1NPUA 3DXAB 3O3AB 1I9JH 3ALXA 2Q76A 1F11B 2X70B 2GITA 3AVEA 2NR6C 3EYVA 3F7PC 1L0XA 4Z7QF 1LO4H 1ZLUH 3MSPA 3QNYA 1FNLA 1H8OA 4R90H 2X1QA 1K4CB 4GS7B 5JHDD 1XF3A 3RKDD 2HKHL 3RZCA 1HI6B 1MHEA 3QEGH 4PJEB 1BJ1H 4ODBD 5GISH 4ONFH 1WIOA 2V5RA 2H32B 5A16B 5TE6H 3VXSA 3ZHLA 1U8IA 4YHNB 1JBJA 1MFNA 1R5VB 1VESA 4HHAA 4OM0L 3IXTA 2R4SL 1MFAH 1FGNL 2VC2H 4ZODA 2YEZA 5GGVH 5A3ID 4M7JH 4OTXL 3GSUB 5F1NB 2YPKB 4QHMB 4WDIB 1N0XL 3TWCL 2B0SL 4JVWA 2FWOB 1I9RH 3BFOA 4P4KC 4R26L 1X4ZA 2EIBA 2NXYC 5FGCE 1NC4B 2DLFH 2MSPA 3H3PL 5JO5A 3T3PE 3S96A 3ARBA 2O5XL 3Q2CA 5FOBA 1YN6B 2FIKA 3PWJB 5BJTB 2KL6A 4PB0L 5GZNC 2H3NA 3MRGA 5L2KE 3WHE0 1J5OL 1ZHLB 5TE4H 2HMIC 3S37X 2GK2A 4OF7A 4WI4A 5L8KB 35C8L 2V6HA 1QR1A 1JGDA 3NCJH 1TIUA 1I3VA 5D7IF 3RVUD 5ENWB 1S9VB 4BQBA 5J6HA 4R7NA 1PKOA 3HZMB 4WW2F 2QADD 4PJ7E 3QDJB 1ZHNA 4KI5D 4X6CF 1S9WA 4I3GA 1EAPA 1TJGH 3RHWF 2HYMA 4HS6A 3LRGA 3D39D 4MD5A 5JOPE 5D70L 3ARFD 4YQXH 2LE9A 5ANME 2GIYA 1CFQB 5HYJA 1JTOA 1U8JA 5JA8B 4NN5B 1KCKA 2VXQL 3NCEB 4XP1H 4C83B 3KPRE 2RB8A 4XH2B 4P57A 3AROA 4KV5F 1F4YH 3EYSH 1HXYB 5LWYH 2R0LH 1WLHA 2ICWB 1RHHA 4Y19A 2G5BB 1FNHA 3BZEA 4FABH 5ICYB 1RUQH 5AZ2H 1U3HB 1HINH 5C0GA 5HGHB 5EU5B 4P9HL 4WUUD 4MVBC 5IMKA 2VJXA 3LN4B 1I7TB 4DOHE 3OJDA 5BV7H 3LVEA 4XAWL 1MHPL 3ULVF 2C1PA 4ALAL 1FYTB 2OL3B 4NWUH 1QUNA 3BPCA 4RMWA 1D5IH 2CIKA 2IPTL 3H7BB 4XNYL 4XVTL 2OTWB 4RMSA 4I9WD 5T1KA 4W68A 1CD9B 3UP1A 1J05A 4XMPL 3MRHB 1NMAH 2GFBB 3BPOB 1QOKA 5J9PA 4TSAH 3CFDA 1ZS8B 1UXWB 3C2SA 4APQC 4Y5YA 3EYQC 5GGRB 5C2BL 1I8LC 1BIHA 4MDIA 3IKCA 2XWBA 4HDIB 3HUJB 4NQCB 4PJBE 3BRDA 3SJVB 1VSCA 3UTSE 3WEXA 5CEZL 1FNSL 4OLZL 5DRWA 3ARDB 5DJZB 4NJAH 1NFDA 3ESUF 3PWPE 2ENSA 4FMFA 4NM8L 4G6FD 5BRZB 4AL8H 4KTDH 4HKZA 1UADC 2IPUK 1P1ZA 2WWMD 1OSZB 4N1EA 4DZ8B 1L6XA 5CZVH 1FO0H 1WZ1H 2MJWA 3BW9B 4YNYB 1GOGA 4U3CA 1ED3B 3G6DH 4WI2A 1A7NL 1K8DA 2B2XL 1KT2A 5C0AD 3EGSA 1A6UH 3MXVL 2HLFC 3RDTB 4N0UB 1W72B 5DS8A 3CLEL 4OZHE 4P3WA 1MVFA 3TT1H 4PREB 3PGFL 1MFDL 4GRLD 5K9OB 1N5YH 4JDZA 1S5IH 4LPXA 2PYEE 2Q87A 4U6YA 1TTGA 4Z5RB 4L9DA 3VXMD 5BS0E 3WFBL 5GJTH 1ZT4A 3JV4B 4ONHB 3KPOB 5KS9A 2XN9B 3G5VA 4JCLA 2AS5M 3TBTA 1AGCA 1EAJA 4GRWF 4PG2A 3SQBA 4I2XA 2GUOB 2R2CA 3CPLB 4WEUD 5FOJA 4S1DD 1HE7A 4OV6F 2B1AH 1A3LL 3CD4A 1RIHH 1S7VA 3OWEA 4RZCA 4LCWD 3REVB 2X4QA 1DQTA 1OSPL 3CSGA 2K7PA 3UYOD 4U6VH 3WXWL 5GGVY 4MQSB 4UBDD 1IGTB 1UXSA 2IADB 4JO4L 4YE4L 5CCKH 4GUPA 1HYRC 2DD8L 1PG7W 3R1GH 4Q9BA 4FQXA 3MNZA 2EDFA 5J89A 1RK1A 4P2RE 3OKMA 3EZ8A 4URTB 3ZKXC 3BWUC 3QUMA 4ZPTB 2IAMB 2NW3B 1PVHA 4JFDA 4NQDE 1OP3K 3CMOH 2R0KH 3M8OH 4YK4B 1QSEA 5ESAA 2EDWA 4MXVE 3K8KA 3AU1A 3LHPH 3FONB 3QBTB 5FYJD 4IM8A 4XPAL 2Z4QA 1BF8A 4R3SB 4BKLA 5HTSA 1R3JA 3RVTC 3VW3L 1QNZH 4NM4L 1NUNB 4JO3L 4XP4L 3EFDL 4NRYA 3WNOA 2AKRA 5I1AB 3FFDB 2CO6B 2ITCA 5BW7A 3PHQB 1QFWH 2IFGA 5DC4B 3RHWK 3IDIA 4MA1C 1XGRA 2VZ3A 4PRIE 3RL2B 2XT1B 4U1JB 1F6FB 4X5XA 2OSLB 4ORGB 4X6DE 4JY5L 2FEDC 1XF4B 3GMMB 5DHVA 3Q6FB 4Z9KB 4LCCA 3I50H 1K9TA 1X5XA 4GG6F 1MI5D 5DYOB 2CGRL 2WIIA 2BNUB 4C56E 3H42H 4TVPD 4BSVA 2J8UF 1SJVA 3ZKQD 2VLKD 4Z0BL 3KHOA 1GOFA 4Y5XB 5K9KB 1N26A 3JV6A 3REWA 2FECL 4RQQA 1F90H 1J0ZA 1SBSH 4LVHC 3EJJX 2BSSB 3FCTA 4IMKC 3NGBB 4MQXC 3HAEH 3VXUD 1YEJL 4GQ9H 4L9LC 2IANB 4EXKA 5C0EA 32C2B 1K8IA 1ZTXL 3RA7H 2ATKB 5FUCC 1T83A 4M6AA 5GHWL 2DM7A 1KB9J 3W5NA 4JKWA 5E94B 5EUKA 5T33L 1N64H 4OFPA 1A6ZB 5I1JL 5F1KC 1FJ1A 4GKOA 5BV7C 4YFDB 2YPLB 5GPRA 4XHQA 3SY0B 2H9GA 5IOPB 4KKBD 2V7NB 3EOYG 3VWJB 3MJ9L 4WFFD 2DQTL 1SEBB 1HSAB 2ITDB 4OCSH 5BZWB 3FHAA 3KYNA 3MRIB 2O93L 1HILB 1ACYL 2PO6D 1C12A 5IMMB 5GRVL 5JOFA 3UTOA 4F9LA 3S34L 4GFTB 5DURB 1J9CT 4PLJC 5I8KH 1QKZL 1XR8A 1T66D 3QCVH 1LEGA 2HTKC 3MRFB 4K7PH 3RKPA 4UDUB 4LLMB 3SCMA 1INDL 4HLJA 4CDHA 5C0DB 1E6JH 1SY6L 1JRHI 4UTAH 1QA9A 4NQED 3L3HA 5B8CA 4X5WB 1E6OH 2EXWC 4HZAA 1T21A 1DVFD 1YUHA 3DV4A 4U1LA 2Q86B 1VADB 4ELKA 4S1RH 2AEQH 2BVQA 2W60B 1XF2B 2MHAA 3DARA 3T4YB 4J3TA 5EBWA 5B4MD 3CGTA 1LO4L 2CLRB 3KXFD 2AJ3B 2ADIA 3VXOB 2BCKA 1IAIH 4R90L 5AG9A 4LCYA 1NCUA 4EIGB 1LILA 1B6DA 5TDPA 5I6XB 4X6BA 3JTTA 1RVFL 3AS0A 1DUZB 4MDJB 5GISL 2CPCA 1CL7I 3RZCC 3K7UA 1FG2B 2YD9A 1X44A 1KLUA 2NY6C 5IFHL 5FHAH 3QQ3B 3VXQB 3ZHDA 3ULUD 1G6RB 3DOSA 3LPFA 4Z7NE 1UQSB 1LEKB 3GMOA 2VC2L 5IVNA 3QUMH 3N1MC 5GGVL 3DIFB 3E3QE 2VISB 5F8QC 5C09A 1TQCC 5A1AA 2DM2A 3MJ7A 1T2JA 5I1KL 4K8RD 4JO2H 3C09B 3K8LA 1IGYB 5D5MF 1JTPA 5IW6A 5IEHB 3PDOB 5LBSH 2CXGA 2VKXA 1X4YA 2MKLC 3VGEA 1TVBA 2AJSH 3CFJB 1HOCB 5EC2A 5TE4L 3QIWB 1ZVSB 4X7TB 4KH2A 4OZIF 4K3HA 3MOBL 1AXIB 4RFNB 4GKSB 3WUWB 4G7VH 5CJXA 4IBLT 1AKJB 1YMHB 5DHVH 1QLFA 1MIEH 1TJGL 3S88L 4WHTA 4IRZH 5B3JF 1CDYA 2SEBA 4X8XA 3O4LD 3IDXH 3O8XA 2X4UA 5IJVB 4MD0B 1JPST 3WLBA 4ENEC 4G8GD 2OX5A 3TJHC 2V9QA 2ZJSL 2A38A 4N0CC 3LKOA 3WNNA 3U30B 2N7AA 2V5YA 2BNRA 1Z0NA 3EYSL 3MFFA 1AD9B 3S35L 3HTLX 5CEYA 2EDNA 2R0LL 1XR9A 3CX2A 4RX4A 5IW3A 2XIDA 4FABL 1QEWA 4Z77B 1BWMA 1RUQL 1OTUC 1TJIH 5AZ2L 2F53E 2E27H 2R2BB 1JNNH 4MMZC 4LKXA 4M5ZH 1H0DB 2FH8A 4LPTA 1D7FA 1U8OA 2X4PB 2A6JA 1GGUA 5BV7L 5IIEA 3ABZA 2V17H 1Q9LA 5IEKA 4NN7C 5CJQH 4H5SA 2DKUA 4NWUL 1G7JA 2DQHH 4U6HA 2NY3C 4GLRI 2DQDL 3LMJL 3MLRH 1CGXA 2CMRH 4NRXA 3ZE2E 5E99L 3EHBC 4P4RB 2BSTA 4I1NB 3E6HB 1BOGB 1CR9H 3U7WH 1EFXD 5FYLH 5DZLA 4RFOH 5FB8A 2CKNA 5B22A 3QULA 3S36H 1QLEH 3N9GL 1NMAL 4LBEB 1AO7D 1ULVA 5LQBL 1AGFB 4TSAL 4HC1A 2RR3A 1FCGA 3GBML 4ELME 4XP5H 2VLJE 2Y5EA 4NKIH 3QB7C 1LNUA 3T3MF 3BZFA 4Y5YC 3U9PH 4MB4A 3T2QA 4NZDA 4I0CC 4Y2DB 1JF5A 4NJAL 3GBNL 1CDGA 2C1OB 1LP9E 4KTDL 1YEHH 5I76A 3A67H 4YHKL 5DUPH 4K7PY 4ZTOH 3KWWB 4KROC 1VCAA 4H0IA 1UZ6F 2F54A 2FIRT 3EZJB 3RPIA 6FABH 1VACB 4RNRA 5F7LB 3V6OA 3G9VA 1A6UL 5D2LA 3ZO0A 5IF0A 3CCHB 4GW4B 3RQ3A 2BDNH 5C7XL 5C86A 1KJVB 2UUDK 1IEBA 4QTIL 3F7YA 3SKOA 2HT4D 4B7LA 1NGQH 3PV6B 1RZJC 5ID0A 5HI4D 1ND0B 4WENB 1CXLA 2IAMD 3MV8D 5GJTL 5SX5K 1CTNA 1ZEAH 2EEDA 2ARWA 4MJ5A 1EUTA 5E8OB 4X6EA 2YOCA 4X0KB 5DMJB 1MCRA 5J13B 5KSAD 4HLZG 5HI3D 4OGAC 3U0WH 1J87A 4P5MA 3TN0D 3GM0A 2Y36H 5GSRB 2YUXA 3RWIB 1A21A 2VWEC 3BDXA 5D1QD 2B1AL 3ARGB 4PG2C 1VERA 2H6PA 2EE9A 4GW5B 1CE6B 1RIHL 1VGKB 1FFNA 5I1DA 5D1XA 43CAA 2N1KA 4PV9B 1N6VA 2IPKA 2YPVL 3T09A 1G1YA 1EA9C 3RTQB 2R8SL 3MRNA 2BMKB 4CN6A 2FYYB 4RA3A 2AK4E 4ZFZB 5CCKL 4TUOB 3L7EB 3MV7E 3R1GL 3WN5B 4HV8B 4YHYC 3EYFB 2EDEA 3LV3B 1H15A 4QY8A 3TO2B 3D0VA 4FQXC 4ZPVA 1IVLA 1MFBH 3ILPA 3PHOB 4PJGA 2RFXB 4P5KA 2EC9T 3M8OL 3BUYA 5EU7E 4P23D 3TA3A 4U33A 1TZHB 5ESVA 4EXPX 4M8QB 4JRYA 4X4ZA 3T1FA 1D3CA 3P9MA 1QNZL 2BRRH 2NYYD 4P5TA 1DLFH 3GSQA 5LKNA 4JHAH 1CFSB 2DQFA 1M7DB 5DJ0B 2J4WH 4KK8D 3SQOL 3MZTA 2VQUA 1WBXB 4I0PB 2FX7L 2IAND 1QBLH 4I5BB 3SHSA 1MNUH 1UCBL 1RIVL 5BW7C 5ID1A 1WZLA 1Q9OB 5JOPD 3V2AR 3MRBA 4XP9H 3OG4B 5D71H 1CFBA 4XGZB 3TP4A 3C8KB 3H42L 4W4OA 4LCCC 3KPRD 3CSPA 5ETUB 3Q3GB 2H1PL 3KYMB 4DCQB 3OL2A 5DURD 1FG9C 1F90L 3HLAB 5HXMA 1A5FH 4PJDA 4WCYH 4NSKA 3RWHA 3JWOH 1XGQB 3GMPB 3ARED 3FL7A 1B2WL 5JQ6H 3ARXA 5FGRA 5CJBA 4PJXF 4K3DH 4P2OD 3SDYH 5CP3H 5H37G 3L3DA 4M62H 1H3GA 1TVHB 2HTLD 4LMQE 3RA7L 3IFOB 4PP1C 1J1OL 3WFZA 3P9WB 1KYOK 2QBWA 3BEWB 3W11D 3CZFA 4UQ2A 1IAMA 3B2UD 3D0LA 3HR6A 5DHYB 1BFVH 4YUEH 1T83C 3CVHL 2VXTH 3BISA 2DLHA 4QCIA 3VWKD 4J3OC 4OCSL 4PLOB 3LN5B 2ZSVB 4BH7B 3B9AA 3QCUH 2MCG1 1UCTA 3QIUA 2R29L 5HHOA 2R2HB 4LSRH 1SJEB 1UM4H 4YC2B 3TYFB 4PJ9B 3QA3B 3QCVL 2FGZA 3PWUB 4F9LC 5C0BB 4K7PL 1FVEB 1KELH 4JFOB 3UTSD 3G9AB 1KN2H 2BC4B 1RZJL 5AUMA 3U0TB 1O0VA 4HPYH 3PWPD 1G9MC 3ECBB 1GGBH 4M7LT 3RUGA 1E6JL 4J1UB 2DTMH 2PTUA 1XF1A 2AP2A 4WWKB 3SCMC 3MA7A 1F4WH 4HJ0C 1BQHA 1E6OL 3ZE0E 4N9GA 5B8CC 4PRHA 2DQUL 2X4TA 3MRMA 5EUOF 5HHVH 4U6XA 3N0PB 5E4EB 2VXSH 4X9BA 5IP4A 3NMEA 2NY7L 3QFJA 5T5NF 1YA5A 3FOMA 5E8PB 1IAIL 3IF1A 4LLYB 5E2UH 5C0RH 4Q6YA 4N68A 1VFAA 2PYED 3BAEH 2VR5A 3QIWD 1UB5A 1J0IA 4UILH 1CFNA 4BQ8A 4PRPE 5IJKA 5EO1A 1KXQE 4IHOB 1A6TA 5FHAL 3S3SA 3BWAA 2JELH 3T04D 3MUGB 5EBGA 1D5BA 3QUML 1FFPB 3WS3A 2MQ3A 1XCTB 4U1MB 4Q97A 4D8PA 4RMVA 1YN7A 3FJTA 1KYOJ 1IL1B 1AC0A 4ZSOA 5JDSB 1NKRA 1M6OB 5CD5C 3OAUH 3O81A 3H9HA 5INDB 3A0OA 1AD0B 5LBSL 2WQ8A 4U05A 4JANA 4R2GC 2AJSL 2Y1VA 4MAUH 4N9OB 3IS1X 3QCTH 4P2RD 3EDJA 1F2QA 1NAMA 4O51A 4AT6A 2BOCB 3BN9C 4KAQH 1IMHC 4NQDD 4O02H 4GKZB 1BLNB 2VXUH 2Z8WC 5ERWB 4LDOB 3L1OH 4QXTB 2H8PB 1KB5B 1JWSA 2J7LA 2K9UA 4IOFC 5HPMB 4QKXB 5IG7A 1ODAA 3H2WA 4IRZL 3VFNB 4G3YH 2DYPD 3IDXL 4EKXA 3IGAA 1QD0A 1U8LA 4JFPB 3D39A 5CEXB 4QHUA 4G42A 1FDLL 1CDUA 2EXYC 3AB0B 3CDGB 3O3DA 3O8XC 2JTDA 4E0RB 3CIQA 2PTTB 1NUGA 1RZGA 2UWEB 3ZTJH 2E5EA 4PRID 2W0FA 4QLRA 2GCYB 1FAIL 3HI6H 3U0PA 4PJAB 4X80H 4M4RA 4YDLC 3BZ4A 1VFBB 2ZCLH 4PJCF 3MUJA 3QISA 2VE6B 4LCUA 4C56D 3D6GA 3GSVA 4WUUA 5I15H 1T89C 3HRPA 2V17L 4TOYH 5CJQL 4UT7L 1HIML 4Y16D 4OSUL 4ZUUA 2DQHL 3GMNA 4U0RB 2PW1B 3PL6B 3MLRL 3P4OB 3MLSH 1ZLUK 2JIXA 2OM5A 4WW1A 4KKAD 3MCG1 4NZUH 5F9DC 3HC3L 5FYLL 4RIRA 4AEIH 1MAML 3WIIL 3U36A 3NCFB 1B6UA 1RJLA 4LEOA 5F88B 4XAKE 4JFYA 2R56H 1KTKE 2WANA 3CFCH 4NN6C 4C55A 1G9ML 1MEXH 3MO1A 4XP5L 4XPFL 4HS3A 5CEZE 1QQDB 4ERSH 3GIVB 4F2MB 5GRXG 3RVWC 3T1WA 2H45A 5H2BB 3U9PL 2FEEI 1QRNE 3PDGA 1NFIB 2F74B 1OTTC 1FIEA 1CG9A 4OZFA 1YEHL 2BSED 2APWA 2QSCL 5DUPL 5MEQA 1INEH 4H1LA 3KLAA 3N85H 3ZYIA 4OLEA 4NZTH 3S37H 3B9KA 1OM3L 4H25B 2HT2D 3FB7B 4QOKA 3GMLA 1X7QA 4KJWC 2BDNL 4X99B 3V6OC 5JXED 3MMEA 1PQZA 2XZZA 2CLZA 4O58H 4LSDA 4V1DE 2LU7A 2DDQL 5JMOC 4M1GH 4S2SB 4HWBH 4O4YH 3DRQA 4DVBA 1TDQA 2IWGA 5KSBF 5F9JA 2WWKT 2GK0B 4L3EB 1NJ9A 4RGOL 1ZEAL 4FG6C 3RGVC 4YFLI 5D96B 3HE6B 3C60B 3UJTL 2HG5B 1L7TL 3QHZH 1U8HB 1PZUB 5D9SA 2Y36L 3R8BB 4FQHA 5ICXA 5C0JB 3JWNC 4JZJB 4PRBA 1RIUL 1DQMH 4NGHH 3LSOB 5DC0A 1OAXL 4A6YA 1KJ2B 1MCQA 1XGPB 4EN3B 3VXRD 1EBAA 2YKLL 1RJCA 5D1XC 3NAAH 4YDJB 4L4VA 3QO1A 4Z7WB 1F3DH 4E41A 4UINH 1T1YB 2DIAA 2C3XA 1QFUH 1CF8H 4JG0L 1I1FA 3MR9A 2UV3A 5DQ9B 2WIMA 2A74A 3S97C 3W82A 1MFBL 3HC0B 2R1XB 3WKMH 1XZ0A 4W70A 2VDNH 2NX5A 5LAXB 3U4EB 2ESVA 4MNGA 1A2YA 4HXAH 1SMOA 3VA6A 5D2NA 1P4LA 1HHJB 3TA3C 3TF7C 1M7IA 1FL5A 3DETC 4CL7A 2ED9A 5I1EH 3UBXG 4G6JH 1CFTA 3UBXI 4PJHF 2ICEB 4PJFF 2LU4A 5IVXB 5CLWA 3OKLB 2IPUG 4U49A 5JXAH 3UDWA 1DBKH 1OGTA 4GSDL 1NCAH 4DGYH 5D72H 2IG2L 3A6BH 4MJIE 1MFCH 4AY0A 4WY7H 1U8NB 3NPSC 1ZLSH 1NGXA 2X89D 5KVEL 3VFVA 5MENE 3E8UL 1C8PA 3SOBH 1DZBA 1B90A 3ZDZF 5I8CA 1KPRB 1U8KA 2HAZA 4BZ1H 3TESA 1WFOA 4KMTH 2NY5C 4W4OC 4ODXB 1KCUH 2CDEB 3FRPA 4X8JA 1A5FL 2F53D 4LHJB 1Q72H 2VAAB 4WCYL 3IFLL 5FCUH 2ZUVA 3WE6A 4U1GB 4F7CB 4HC1L 3LEYH 3MBXH 4FTVE 4K3DL 1QPXA 3KLHC 3MROB 5CJOH 5EO0A 4F7PA 1OB1A 3NCMA 2PUQT 2Q3ZA 3KJ4B 4JEGB 1IQDB 3MV9E 1EPFA 4JFEB 2EDQA 3DXAA 3O3AA 1BFVL 2YA2A 1LE5B 3G5ZB 4MAYC 1JGEB 4NKMB 3OR6B 1F11A 2X70A 3ARYA 2ZOKB 2VDLH 4AIXA 1MF2H 4QO1A 3LQAH 3QCUL 4H1LH 4KKCC 5D6DA 3V52L 5C70A 3PQYE 2DBLL 3I2CH 1K4CA 3NTCH 5HHMB 2VLJD 4Q6IB 1UM4L 1HI6A 4YX2H 4OBRA 4EI5B 3CLFL 1BP3B 4PJEA 3QIUC 3CH8A 3BKYH 2H32A 5A16A 1P53A 1XAUA 5KVGL 4HPYL 1GH7A 3BPLC 4LIQH 1GGBL 4PJIF 4YHNA 2EIZB 2DTML 3CH1B 4Z18A 5MEPB 1R5VA 5EZIH 3WFDH 3R8QA 2F8XC 3BH8B 4IJ3B 2BVEA 1RZFH 1RU9H 3H0TB 5FXCH 2CRIA 3C6SB 3GSUA 5F1NA 2YPKA 2IBBA 4QHMA 4WDIA 2QEJA 2AK1H 2VERN 3ETBF 3QUZB 4NOBA 3WD5H 2FWOA 2VXSL 1QHPA 5IHUH 3PNWB 1NC4A 3GSRB 4G8FB 5JIHA 4QXUH 3WV0A 2GJ6D 5E2UL 5DA4A 5F3HB 1YN6A 3PWJA 5BJTA 4HMEA 3DUUB 4LRIA 1ZHLA 4UILL 4N5ED 5IBLD 2BVOB 1FZKB 4HCRA 2Q8BH 4ODUB 5ENWA 1S9VA 3U83A 5IJKC 3HZMA 2NQCA 4KXZI 4HUVB 3QDJA 1KPUB 1YEDB 1IGFH 5ACZB 1UM6H 3ROOB 1JN6B 4OF6A 2J5LB 1HH6B 4CJ1A 4RWYL 4DGVH 1CFQA 1MIMH 3HHRB 1G7QB 1JPTH 1T6VN 3RY5A 2AK4D 4XH2A 1WZMA 3HCVB 5K9QG 3MV7D 2I07B 1HXYA 1HH9B 1OT1A 3LD8B 4YHLL 5K9QI 2ICWA 4K3EH 3QG6B 2G5BA 4MAUL 1NCWL 4GBXD 2ZKHH 5ICYA 3CAFA 3QNZB 1U3HA 4KAQL 4QWWD 4JFXB 5HGHA 1CFVL 4N90E 4KTEL 5EU5A 3LPGA 1WCQA 2VXUL 4CNIB 4EZMA 5KZCB 3CSBA 4Z0XB 3AAZB 1MCFA 3LN4A 4M93C 1I7TA 1NGPH 5A2KH 4XVUD 3LOWA 3VMOA 3FB8B 3SKJH 3FN0L 1ZT7B 5DEFB 1FYTA 2OL3A 4XB8A 5I74C 3QUYB 3SDCB 3H7BA 3MTRA 4DKFH 3OG6B 1BZQK 2OTWA 4YZFE 2NY5L 4U1NB 1KENL 4TVPH 3VXPB 4XTRD 4GOSA 1C1EH 2P7TB 3LS5H 4F15C 4JPVH 1R0AH 2GFBA 3B5GA 2X9YA 1L4IA 1GOHA 1MOEA 3BGFB 4QHKJ 3UO1H 1ZS8A 1UXWA 1OL0A 5GGRA 2XTJB 4X80L 5CZKA 3HC4L 1U2HA 5FUCE 2ZCLL 4HDIA 3HUJA 1XH3B 4NQCA 4JRXE 3SJVA 2P5EB 4P46B 3ARDA 5DJZA 5BRZA 4AK1A 1D5XB 1LE9B 1X3DA 1WC7B 1OSZA 4DZ8A 1EX0A 3BW9A 1JV5B 4YNYA 1ED3A 1KGCD 3B4NA 2FNBA 3GZKA 1KF9B 4Z7UE 3FAXA 4XNXH 1CDCA 4NZUL 4HJJL 2XV6B 3RDTA 5KTEH 4N0UA 4AEIL 2IC2A 5K59E 1W72A 5ITFB 3D3VB 1NH6A 1X5IA 3N1QC 2IMNA 4PREA 4XCYB 3ZDXF 5F6IB 1SBBA 4G8EB 2E9WA 4HMCA 5K9OA 1MEXL 1B0WA 4AMKH 1NLBL 4NFBA 2H32H 4N0YH 4Z5RA 2MTPA 4RGND 4WUKL 3ZMRA 3GGWB 5C0IB 4GMTH 5JR1H 3JV4A 1I3RB 5EB9A 4ONHA 3KPOA 2XN9A 3L5WB 3OGCB 1DQJB 2CUMA 4M3KB 1AXTL 4CW1B 1RQ5A 4OLXL 1ETZB 5SV4A 2GUOA 3CPLA 3N85L 2ADFL 1DFBH 5DWUH 4HUUB 2YC1B 1Q0YH 5EOCJ 4F57L 3REVA 2EO1A 2XZCH 1GZPB 2M26A 1OP9A 1PZ5B 4KK6D 1LK2B 5CD3B 3G6JB 4JPWL 3B9KC 4ONGL 3CFBB 1PW3A 4NKDA 1IGTA 2IADA 4Q9CA 5SV3A 5C08B 3QJHB 3VXSE 5F1IB 4OD1H 4O4YL 4XX1G 4HCRH 3X12B 1P4IH 1ZHKB 4MCYB 4OM1H 4ZPTA 2IAMA 2NW3A 4MLIA 4K3GA 3MV8A 3TT3H 1U8PB 3ULUH 4XCCH 2Z35B 4KZDL 3QHZL 3VG0H 5L2KB 3FONA 5C2UB 4R3SA 2ZUQC 1J8KA 5KVMC 4OCWH 1DQML 4NGHL 1S78D 3ARUA 2OR9H 1HQRB 4PRPD 4K8RH 5I1AA 2CLVB 2D31B 3FFDA 1CD1B 1QFWM 3N1FC 3PHQA 3NAAL 4XBEL 1KTDB 3BDBA 3CFEB 1UH4A 4NUJB 3DO3A 3RL2A 1NAML 4U1JA 1QFUL 2OSLA 4ORGA 5EPMB 3RNQB 1CF8L 5I9QB 4DQOH 1XF4A 3GMMA 3VGGA 3Q6FA 3VD3A 5HHXH 2HFEB 3WKML 2VDNL 5DYOA 2BNUA 5IHZB 1J8HB 4S1QL 3QEUB 1VDGA 4NCC2 2V5TA 2OL3H 5ESQB 4DK6A 5HYJE 4Y5XA 5K9KA 4WO4D 5L8JB 4FFYH 3RU8H 1JJUA 5I1EL 2BSSA 4UT9H 3H7LA 4Y19E 2Q8AL 1ZA6B 4OFYA 4YBHA 5JXAL 1IJ9A 3EYUH 1DBKL 2IANA 32C2A 1ZVYA 2ATKA 4LHUD 4DGYL 1RUML 5D72L 3A6BL 4WY7L 1V05A 4OZGB 4WFEE 5E94A 1WGOA 1A6ZA 1QP1A 1RZ7H 2EZ0D 3LQMA 4FFWC 1XIWD 1MREH 3D25B 4XI5C 2YPLA 3STZB 3GSOB 3SY0A 5IOPA 3GMQB 3X13B 5DR5H 1F02I 2V7NA 3VWJA 5BZWA 1EDQA 2ITDA 1SEBA 1HSAA 3PWLB 3MRIA 4ODVH 5GGQH 4BZ1L 3CK0L 4I3RH 5C9KA 1E4KA 2OZ4A 1VGEH 4HH9A 4MNQB 3V9FA 4PJBB 4J6RH 2X1WL 2CK2A 1IC5H 1RFDH 1J10A 1D6VH 4OCNC 1KCVH 4D0DB 1W72H 1MCKA 3MRFA 5FCUL 3G6AB 4UDUA 4LLMA 1B4JH 5ISZD 4XNZC 3LEYL 3MBXL 5C0DA 1S7SB 4Z7VF 1HQ4B 3OF6A 3QIBB 3VFUB 4X5WA 3SGJA 1P6AB 1NFDE 4L4TB 4NIKB 2Q86A 1VADA 1EFQA 2W60A 1XF2A 5FO7B 3AMKA 3T4YA 2VDLL 3V4VH 2CLRA 2AJ3A 4XAKD 3RY4A 3TH2T 3VXOA 2VL5B 1IGMH 2X1PA 3I2CL 3D9AL 5BS0B 3NTCL 4UIKH 2NY2B 5HHPB 5D6DC 5CEZD 3NFSH 7FABH 1DUZA 1A6AB 4GS7C 4MDJA 1Y6NR 3BKYL 1QRND 3QJFB 1FG2A 2W91A 1RUAH 3TYGH 2F15A 4R0LB 1NSNH 2NR6D 5IVZB 3QQ3A 2AEIT 3VXQA 5JW4M 4OCYH 1G6RA 1UQSA 5KS9E 1LEKA 5HDQL 1RU9L 4HIJB 2VWEE 4FMKA 3DIFA 4MGXA 2VISA 4I2XE 2EYRB 2VH5H 4DAGH 1FL3B 2XA3A 3NH7L 4MQTB 3U1SH 1B88A 1JVKA 5IHUL 3GKZA 4K94H 4OUOA 3UYRH 4LOUC 3QXVA 4LQFH 3HKFA 1IGYA 4QXUL 3B83A 5IEHA 3PDOA 4KTYA 4ZUWB 1KXTB 4V1DD 3QDHA 4A6YL 3CFJA 1HOCA 5DEZA 3QIWA 1ZVSA 4X7TA 4BZ2H 5EU4B 3L5HA 5JW3H 2Q8BL 4LRIC 3W81A 4P4KD 4GKSA 2NXYD 2QSQA 3WUWA 1R6VA 1B4RA 1AKJA 4JFDE 1YMHA 1WVZA 1HHGB 4FQ2H 5LXGH 4WTZA 1SM3H 1ZGLM 5GZND 5IJVA 4MD0A 4NOFA 2HMID 1MIML 4WI3A 1QBBA 2DI8A 4NO0B 5KSUB 3SE4A 1JPTL 3IU3B 1CE1L 2WUCL 4H0HB 4WNQB 5KOMC 4NN5C 1AD9A 3KGRA 4K3EL 4FQ1H 4CRPA 2MQCA 4Z77A 4UT6L 4JM2F 1S9KC 1AGEB 2R2BA 2FBJH 1EO8H 1GGIH 2XWJB 3V7MA 1H0DA 3H9SB 4FFVC 5GIRB 1U3HC 2X4PA 3B3IB 1A47A 3KPSB 5J7CC 1VKXB 4MQ7B 3SKJL 3PE9A 1GZQB 4LCIH 1NMBH 2E3VA 3D69B 4DKFL 2NY4B 3SDXF 5D93B 4EQ3A 4P4RA 5GGRY 3OHXB 2C3GA 1TVDA 1BOGA 3DX9B 3E6HA 3WYRA 4MVBD 1C1EL 3LS5L 1HKLL 5SWZE 4JPVL 2X1XR 3NOIA 2CDFB 4LBEA 1BM3H 4DUXA 3CXHJ 4NO2A 1MCNA 4NPYB 2ZWLT 5IKCB 3UO1L 1MSPA 1AGFA 2GJZB 4MJID 1V7MH 4HH8A 3BPOC 5MEND 3VJ6B 1VEMA 1X5YA 4NQSB 4W6YB 4Y2DA 1G84A 5DVKA 3VE0B 4LSSL 2C1OA 4ZOCA 1CVRA 1YEKL 3QDAA 3ARDC 5DRNB 3KWWA 4APQD 3EYQD 3W5MA 5AWNH 4KRPB 5FYLE 5C92A 4LPYA 3MREB 1IEAA 4XNUH 1P2CB 1CK0H 5KTEL 1OAYH 3MYJB 1FL6B 2FCBA 2CKBB 3CCHA 4GW4A 4FTVD 1KJVA 2V7HB 3D2UB 3RDTC 3RAJH 4Y1AB 1EHLL 2XZQL 3PV6A 2EDKA 2LABA 3GHEH 3MV9D 4ZXBB 3TLRA 4AMKL 1ND0A 2X4RB 3SBWA 5JR1L 3C5ZB 1MCOH 4GAJL 3X17A 3RPKA 2HLFD 1G6RH 2B5IB 5E8OA 5FUZL 4X0KA 3ARPA 3PQYD 5LCVH 1TNNA 3P73B 5GSRA 3RWIA 2IFFH 1G9NC 3ARGA 5DWUL 1TETH 4GW5A 4FZ8H 5K33A 2P4AB 1CE6A 1JNLL 1Q0YL 1VGKA 2QQKH 1JPSH 3UBXB 5HYEA 1V3JA 2XZCL 4PV9A 5F72S 2BY1A 4G6MH 3ZSSA 5BZDB 3RGHA 3RTQA 2AJVH 1MRFL 2BMKA 2O5ZL 2FYYA 1P7KB 3MLXH 4ZFZA 4WEBH 4GXVH 4KI5F 5GZOC 4TUOA 4WHCA 3L7EA 3WN5A 4HV8A 3EYFA 3CVHB 3LV3A 5BO1H 3TO2A 4QT5B 4ZO6A 1NANI 4HCRL 3GBLA 1YYMH 3PHOA 3TNMB 3IDGB 5DK3A 5T1MB 1F58L 2RFXA 4DJMA 3TT3L 5BQ7B 3VD7A 1OGAB 3OKOB 4XCCL 5C09E 1TZHA 5GS1B 1MHHB 3VG0L 2EC8A 3NCCB 5DSCB 3MLTB 4YK4C 5HYFA 1CCZA 1N8ZB 4M8QA 3CU7A 1A7RH 4OCWL 2OR9L 1OQOA 3S6CA 1A1MB 1CFSA 5DJ0A 1M7DA 4G80B 5IT2H 1EK3A 1UWXK 5EO9B 1WBXA 1T22B 2J3SA 4LSUH 4I0PA 3NIGE 4I5BA 4HK3N 1LDSA 1JFQH 4N8CL 4ZUSB 2DQCH 2XQBL 4OF3A 5J3HC 3RVTD 3WSQH 5ICZB 1CDHA 3LEXB 4XGZA 3C8KA 1DBBH 5E7BA 2AV7B 1X5KA 3FB6B 3HB3C 3Q3GA 5ETUA 1OF2B 5ADOH 1V5JA 3WL9B 3KYMA 4MNQD 4DCQA 1OAQH 3MLVH 4N5UA 3HLAA 2BNRE 1LD9B 3QWRA 2FEDD 5DDHB 2HRPH 3RU8L 4Y5XC 4N90D 4UT9L 5DRZB 3T2OA 4OUUB 1XGQA 3GMPA 3KLDA 1NBVL 1I1AB 3GUTB 2WBKA 4QXGH 3K81A 2IGFH 3IDMB 3EYUL 3NCYS 3NGBC 3NPZB 4KUZH 2DJUA 2G75B 3UC0L 1TVHA 1WICA 2E9JA 1G0YR 4AG4H 3IFOA 3BVNB 5D7IB 2JJSA 5BOZG 3BEWA 4PS4H 3IDNB 2WBJB 3QWQB 4WW2B 2BOBB 4U1KB 3WO4B 5DHYA 4X6CB 3E0GA 4V2CB 4UOJA 4BSWB 1RPQA 3O41B 3O9WB 2ED7A 4P59H 5IBTH 2J6EL 4XT1C 5DR5L 1T03H 3NCBB 1TMCB 3LN5A 2ZSVA 4MQXD 5GGQL 5GS0H 4BH7A 2D9CA 1RMFH 4JKMA 4OGYL 3VWJC 3DSNA 3K80A 3BJLA 2MOVA 2R2HA 5T5NG 1EEZB 1IC5L 5DJ8B 1SJEA 3UMTA 2J2ZA 3UTQB 3TYFA 4PJ9A 3QA3A 1KIRB 1Q8MA 4HUWB 4JRXD 4OIBA 1KCVL 1W72L 3PWUA 3FT4B 5C0BA 4JFOA 1K6QH 2BC4A 4Y4KC 2COQA 2Y6SC 3U0TA 1FAKT 2XPGB 4RSVA 3ECBA 2XFXB 4J1UA 1IARB 2J12B 3MODL 4WWKA 1ZXQA 2HWZH 3VH8G 1J18A 5EC1B 1NCBH 4PLJD 1EUUA 3SGJC 4YFEA 2HTKD 1NL0H 1T7ZA 1G9NL 4GG8B 1DSFL 1A6WH 3V4VL 1M71B 4ETYA 4J3WA 1N6QH 2F54E 4OF8A 3V6OE 1IGML 5E8PA 4LLYA 2XRAH 5D2LE 3BT2H 4UIKL 4KVNL 4HIEB 4POZC 2EXWD 3NFSL 2R0WL 3ARQA 3BJ91 4U31A 3S35X 5KVFH 3PJSB 5I6XC 3TYGL 4IHOA 2FO1A 6CGTA 3WJJA 1PY9A 4H20H 1O7SA 1FPTH 4OCYL 1Q0XH 3MUGA 4D9QE 1DQLH 3HNVL 3ROLB 3ZTNL 1FFPA 5GRUH 4NP4L 4UAOB 1XCTA 4U1MA 3QT2A 5F7EH 3TH3T 4DAGL 2HKFH 1IL1A 3RZCD 5JDSA 4MA7H 1M6OA 1J12A 2WP3O 2NY6D 2VZVA 1U41A 2X42A 5INDA 4Q58C 4FA8A 5DJAB 3VXSD 5JQHC 3C09C 3GNMH 3X3FH 1CT8A 2BOCA 3TO4B 1ZOXA 4BZ2L 4M1CC 4GKZA 1BLNA 2XTLA 5ERWA 5CJ5A 5HVGB 4QXTA 2H8PA 1KB5A 2DWDB 2YD5A 1I3GL 1WFTA 5HPMA 5JOEA 3QXDB 4LVOB 4PJGE 25C8L 4RFNC 3BP4B 4FQ2L 5LXGL 4GRWB 5D4QA 3VFNA 1DEDA 4MD4B 5ACMA 2VQ1B 3FO0H 4QHNB 4JFPA 5CEXA 2YK1H 4PPTA 4FN0A 4WEMB 4ODTH 3CDGA 4JRYE 2PR4L 2Y7QB 5I71B 2F5BH 4IMLB 4E0RA 3QI9B 2PTTA 4IIQB 1MCPH 3EO9H 1U3YA 5E95B 4XRCB 2UWEA 2A77H 1FYHB 4DZBB 1I8MB 2GCYA 3SE4C 1Z9SA 4NUGH 2A1WH 2I5YH 4PJAA 1MRCH 1VFBA 3K4ZA 2VE6A 1GGIL 4CU7A 3S8WA 4ENED 3A6CL 2I9TB 3TJHD 4PTUB 4LAQH 5EZOH 4N0CD 5HYJD 2PXYB 2BHUA 1BX2B 2XOTA 2BJML 2QKIB 4LCIL 1NMBL 5L0QB 1NBYB 1C16B 2PW1A 3DHMA 3PL6A 5JHLH 1OTUD 3P4OA 3ES6B 4Y19D 2YD6A 5EA0H 1G6VK 1TPXB 4JB9L 3HE7B 2OZ4L 5BVPL 3P4MB 4PJDE 3SEPA 5F88A 3MRQB 5ITBL 5D7SH 5HSFA 3ZSTA 5FECB 1V7ML 4WFED 5K9JH 2NY3D 1IFHL 2DQEH 1QQDA 3GIVA 4F2MA 1YEGL 3VGDA 1ZVHA 1CD0A 3JUZA 5H2BA 3EHBD 4LSTH 3QEQB 2E7HA 3CX5K 2AQ1A 1OP5H 1KIPB 4BK4A 3V7AE 1FV1B 1OTSC 1NFIA 4GG6B 5D8JH 2F74A 3QSKB 4KK9C 5T1KD 5IB1B 2HP4A 4Y2DC 3WHXB 2J8UB 4M61B 4ORZC 5C6PB 1QFWI 3BYTA 1N5AB 3BKCL 1YPZF 2EDDA 4CUCA 5GS0C 2FHBA 4AEHL 3K0WA 4XNUL 3VFRB 4H25A 3NIDE 5HHOE 4HKBA 1CK0L 3FB7A 4TYUA 3JV5A 4X99A 3ULUF 2VOTA 3BE1H 3RAJL 3EJZC 3UPAA 2DKSA 3MCKB 5CILH 5A2JH 3GHEL 3MRCB 4KROD 2AJUH 3RUGE 5HDLA 4S2SA 1F00I 2YD8A 1WFUA 3FQTB 5I8OH 4KPHL 5TF1H 4X9FA 1FIGL 4BFIB 2GK0A 4L3EA 1GHFH 5FKPB 2G9HB 4JGUA 1MCSA 1G6RL 3HE6A 4Y8AA 1PLGH 2WK2A 5EIIB 3C60A 5JW4R 2HG5A 4PRHE 1U8HA 4YR6B 4XBPB 1RHFA 5SX4H 3MRKB 5CBAB 3VD9A 3HAEG 5J13C 4LU5H 3IFNH 1TETL 3QFJE 4FZ8L 5C0JA 1X6NA 4JZJA 4OCRL 4HT1H 3LSOA 2QQKL 3LH2H 1KJ2A 3ARGC 3UAJC 1XGPA 4EN3A 4BZYA 3PUCA 1QFPA 3U7YH 4GMSH 3AUVA 4PTTA 4ZTPH 2C3WA 2OJZH 4YEFA 4YDJA 3MLXL 4FXGB 4HUNB 4Z7WA 1KULA 2AJXH 4GXVL 4OGAD 3TC9A 3RTQC 3ULSB 1T1YA 2Q1EA 1FC2D 5BO1L 3MOAL 4DN3H 5DQ9A 3I9GH 3TFKC 5E2WL 1YYML 3F7RA 3DX8B 1KB5H 2R1XA 2VLRB 3HC0A 4WV1B 3S98A 4M6OL 1W2KT 5LAXA 3U4EA 4EDWH 3DYOA 4RMRA 3CX5J 1HHJA 4FP8H 2NXZC 4ZSOE 1OAUL 4P2QB 4B53A 5JPNB 1A7RL 3IDUA 3GSWB 5E8EB 1UKQA 1R3IH 2DJ4A 3UTTB 4FQXD 1WAAA 2ICEA 1UACH 5JUEL 4DVRH 43C9B 5I0ZA 5IT2L 5IVXA 2QV2A 3QYCA 4CAGA 4IOIB 2G2RA 4LSUL 3OKLA 3Q5OA 3QPQC 3RGVB 2OCFD 3D5OF 4JFDD 2KUTA 2L0DA 5BCAA 1JFQL 4I0PC 4CJ0A 1QSED 2NMSA 4HIXL 4TNVF 2BZDA 3ZKSD 4J8RB 1U8NA 5DJDB 5F9WB 3RX7A 3WSQL 4C54A 1T1ZB 5IESH 5JPMB 4PJ5B 2HH0H 1KPRA 5IK3B 2R4RH 2BVTA 3D85B 2VXVH 3D39E 1NCCH 3ZE1E 2DL9A 4JREB 5ADOL 1FZMB 4ODXA 4ZS6C 1KCRL 3TZVB 1F6AB 4HX1B 5FO9B 5I8EB 5D5MB 2YRPA 4AENB 4CN4A 2DQIH 3QP3A 2HRPL 3QO0B 1ZLVH 2CUHA 2VAAA 2W9EL 1J86A 5ACLA 5C0FB 4F7CA 4MMXC 4Y4FB 5CHNB 4QNPF 1MJUL 1S7QB 2VN4A 3DO7B 4OZIB 1OARH 4WUUE 3MROA 1TTUA 4PS4L 4GH7B 4FQLH 2BY3A 3GEWB 1IQDA 5C6TL 3OB8A 4JFEA 3NABL 3LDBB 1LE5A 2JJSC 4P59L 3FRUB 1JGEA 4NKMA 3OR6A 1T03L 2ZOKA 5H8DA 5GS0L 4XCFH 3FOLB 4NFCA 5GRZA 4BYHA 5DMIH 4PP1D 2EDJA 4Z78B 4Q6IA 2Y07H 4XPHH 4XVSH 4EI5A 3K8MA 2R2EB 1K6QL 1IAKB 1FVCB 3BDYH 4PJ9C 1SEQH 1V7NL 1R5WB 5FA3B 2EIZA 5JTWA 1JI2A 3CH1A 5MEPA 4XWGH 1UWGH 5A40E 3BH8A 3T0AA 3L5XL 3THML 4DW2H 2H2SC 3BIBX 1KJ3L 5FYLD 3H0TA 2AEPH 3SO3B 4WWKC 3C6SA 3GRWA 2LTQB 3FKUS 4M03A 2ZP0T 3CNKA 3U82B 1NL0L 2V9RA 3QUZA 1HK6A 3PNWA 4KFZC 1N6QL 1ZKAA 1GGCL 3GSRA 4G8FA 4OKDA 2HN7B 3ORJA 5DFVC 4AYFA 5E4EC 1WISA 2XRAL 2ZNXA 3BT2L 3SCMD 5F3HA 4QOKE 4HJ0D 1G7MB 4IRSB 4YDIH 1KJ2H 3DUUA 2DLGA 4O2EB 3HNTH 1DE4B 1XEDA 1NC2B 1TJHL 4M9OA 1MJJB 4CDGC 1ZMYA 1FZKA 2BVOA 1IRAY 2A6KB 4MAYB 4ZYKB 4ODUA 2C4XA 3T3PF 1Z9OA 5HJ3B 1FPTL 3FT2B 5DFTA 3CZJA 4GAYB 5F71A 4HUVA 3VA2C 1KPUA 4GO6B 2JKXA 5ACZA 3ROOA 1JN6A 1INQB 1HH6A 5BOPA 2HKFL 3VFGH 1PY4A 3TNNB 1G7QA 4PJ7F 3UROR 5FEBA 2XG5A 4S0TD 1U2CA 3HCVA 2I07A 1HH9A 2ZG3A 5GRYA 3QG6A 1UT9A 2VZUA 1AQDB 4PD4K 4QRRB 4L4VE 3JXAA 3QNZA 3RWCB 5DJXB 3O6LL 1R3LB 1EJOH 3LCYA 3VGHA 4E41E 4JFXA 1YYLH 3ARVA 4OM0H 5L9DL 4CNIA 5KANG 1CICB 2Q3AA 3GSNB 5KANI 4Z0XA 1FGNH 3AAZA 4EQ2A 5C09D 1M05A 1U42A 1YEFL 5EBMB 5CD5D 4M1DL 3U6RB 5DJ6B 3TBVA 1N0XH 1SJHB 1UJ3B 3FB8A 1ITCA 3TWCH 1ZT7A 2NX5E 5DEFA 5B38G 5DMGC 4R26H 3P3YA 4R2GD 5IB2B 3QUYA 3SDCA 3SN6N 2ESVE 4MNGE 2YK1L 5D2NE 2JB5L 3BN9D 4U1NA 3O2DA 4R7DB 3VXPA 2F5BL 2P7TA 2D0HA 1MCPL 3EO9L 4TNVK 1YJDH 2ZNWA 3AB0C 1ZA3B 1EXUB 1CI5A 4FZEH 4U7MA 1CL7H 4RFEB 5GXBB 3BD3A 1MRCL 4O2FB 2X7LB 1XH3A 2D0GA 4QRTB 2P5EA 5F7WC 2YXFA 2EXYD 4P46A 3ILQC 3V0VB 4LAQL 4IDLA 3O8XD 3HMWH 5EZOL 5D70H 1D5XA 1LE9A 1XF5B 1WC7A 2APTA 4JLRB 3O4OB 2VXQH 1JV5A 5IROA 4J3UA 5DEGB 4G8IB 1G7PB 4RX4D 4U0RC 2YWZA 5DUBB 2FBOJ 3PL6C 3IJSB 5EOQH 5ITFA 3D3VA 3LB6C 5D7SL 4XCYA 4P9HH 3IDJB 4G8EA 3Q0HA 2HT3C 5CGYC 4I4WB 1T20B 2DQEL 1U0QA 5E24E 3S4SG 4KJQC 4XNMB 4G6AC 4XAWH 4DFIA 1MHPH 3GGWA 5C0IA 4PD4J 3BP5B 1I3RA 1BZ9B 4OZHF 5IW1B 2IPTH 4LP4A 3L5WA 1NGWB 1DQJA 3OGCA 4UIMB 3T0DA 4CW1A 2P5WB 3DXAE 2Q6WB 3INUL 3WO3B 1EEYB 1ETZA 1T7WA 5AZEH 1PBYA 3B6SB 4XXDB 4HUUA 2YC1A 1DCLA 3BIKB 3RVWD 1GZPA 1IKNA 2JF1A 5C2BH 1JPFB 1PZ5A 1LK2A 5CD3A 3G08B 3KG5A 3G6JA 2R39A 3CFBA 4PJEE 1UKSA 4C4KO 4WFHE 1OTTD 2BNQB 5C08A 3WDJA 3O2VH 3QJHA 3STBA 2J8HA 1OY3B 5CEZH 1FNSH 4PJXB 2HJFB 4CU8A 2AJUL 4NM8H 3X12A 2XY1A 1U6AH 1GHFL 4MWFB 4ZFOB 5IMLB 1U8PA 1CXEA 3U2SB 2F54D 2EH8H 1ZSDB 1PLGL 4KJWD 2Z35A 2D0FA 1A7NH 5GRJL 4NNXB 3AC0A 2FATH 5L2KA 4LFHD 5D96C 3EAKA 3HE6C 1KCLA 1QHOA 3C60C 5AYUH 2XNAB 4HT1L 3KXFE 3LH2L 3PGFH 4PGEB 1HQRA 1ERNA 2CLVA 2D31A 4JZJC 1CD1A 4GMSL 1KTDA 5HD8C 2RCSL 2VDKL 3CFEA 3KYKH 5TF0A 3ZYJA 4EN3C 2B8OT 3WFBH 2FJGB 4D9QD 4NUJA 1UFUA 1JYVA 5D7KE 2Y4SA 5I1HH 5EPMA 3B5HA 3RNQA 4HKXB 4DN3L 5SWSB 2FRGP 3I9GL 3JWDH 3SGDI 1F4HA 1KB5L 2HFEA 3QDJE 4XMLH 4DKDC 5IHZA 1A3LH 5D1XD 1J8HA 3QEUA 5HGGS 1MHCB 5EUOB 5ESQA 1HWGB 1OSPH 4X6DF 4FP8L 4OF5A 3TPKA 2CRZA 3UZVB 3WXWH 3EDFA 2DMCA 3O2DH 2YWYA 1BBDL 4MB3A 4JO4H 4YE4H 1WZKA 3KPQB 1UACL 4DVRL 4ZFFB 1BVZA 1MUJB 1QSFB 1ZA6A 2P1YA 1CGYA 1GVIA 5AG8A 4M43H 4TSCH 2ZCKL 4G6KH 4NC1C 4PIRF 3RBGA 3TA3D 5MI0B 2FD6H 2Z31B 3BESR 2Z92B 3VH8B 4OZGA 4QF1B 1N0LA 3DETD 1IM9B 3D25A 1NMCB 4JRYD 3STZA 1FYTE 3GSOA 3GMQA 3X13A 3WDHA 4HLZH 5JA9A 2HH0L 3PWLA 3VW3H 5I17B 2C4FT 1RZKC 3B2VL 1E28B 2VAJA 4HIHB 4XP4H 3EFDH 3BH9B 4G8GE 2JJUA 4MNQA 4PJBA 2FX9H 2DQIL 1K2DB 1YJDC 1T66C 4D0DA 3RZWA 1MFEL 3BRGC 3G6AA 2OP4L 2X9XA 1IGIH 4KU1A 4PBWD 3SDAB 1KSRA 3K4AA 3HUJE 4MXWH 4NQCE 4CN1A 5I2IB 2HA1A 1OARL 1S7SA 1HQ4A 2A6DB 3NZ8B 3QIBA 3SJVE 4U1GC 3VFUA 4O00A 2CGRH 4ZO9A 4FQLL 4L4TA 3LY6A 4PGJA 1CLYH 2DTSA 4ZMAT 5BRZE 4L8CB 9CGTA 3V5HB 3BQUC 5FO7A 4Z0BH 3AGVA 3KJ4C 2ED8A 4IMKA 4BELD 1VFOA 5HYIA 3VCLB 3UPRB 1F5WA 2VL5A 3HG1B 2P49B 2ENYA 3KLHD 3TBSB 4N0UE 1FLRL 1K4DB 5HHPA 3QPXL 2Y07L 4A2LA 1YEJH 2QQLH 2AXGB 1A6AA 1OAZH 5C0NC 1BD2D 4YLQT 1FO0B 1JGUH 3QJFA 4Q6IC 5HBBA 4MAYD 3BDYL 3T08A 4EI5C 4PJCB 4R0LA 1SEQL 3QUXC 2PTVA 5IVZA 1N59B 2NNAB 4KKCD 3VDBA 3VU2A 2XN9E 3MJ9H 1EBPA 1S8DB 2DQTH 3O6FB 4ESKA 4HIJA 1BEYH 2F58H 1ES0B 3CMGA 1ACYH 4JJ5B 4IJ3C 3U48A 3X14B 5M95B 1LO3H 2EYRA 3QIUD 1ORQB 1FL3A 5HHOD 5DO2C 2JB6B 2R9HC 2E9IA 1F42A 5J4MA 1QKZH 4Z7NF 2D3VA 3QDMB 4Q2ZB 4ZUWA 5D7JB 1INDH 1KJ2L 5JIPA 3DX7B 1Z9LA 2ZUYA 2E6QA 3MA9H 4JHWL 3X3GL 2HLAB 3DWTA 3HNTL 3P0YL 2GSIB 1V3LA 1P7QB 2NW2B 3DVNB 4ZAKB 4RAUB 4PRHD 2NY1B 5KJRH 1S3KL 3IB4A 2EKSB 3IRZA 3MV8E 3VFSB 5MEOB 3QFJD 4AIOA 1IE5A 1I1RA 2BXYA 1Q9WB 4FQQB 1J0KA 2PN5A 4OBSA 1A22B 3VFGL 2OJEB 2J5LC 4NO0A 5KSUA 3LKSB 1K3IA 1RVFH 3IU3A 1A7QH 3BGAA 4WNQA 5GJSL 5TJWK 5F96H 3J8F7 5I73C 4XWOC 3NVQA 4YXLL 1L7IH 1ORSB 5IFHH 3NIFE 3LD8C 1EJOL 1AGEA 4HS6B 1YYLL 5CUSH 3VRJB 2XWJA 3SKNB 1RURH 3H9SA 3I84A 5GIRA 1JRHL 2JJWA 3AFLA 2CIIB 5KSBB 3B3IA 3V79C 3KPSA 3JWDC 4BUHA 1VKXA 4R4NC 4MQ7A 1ITBB 3T0EB 1GZQA 2VN7A 4LLQB 5I1KH 1RHHB 3D69A 4KC3B 4JKLA 1RZKL 5F6HI 3MCLL 3U9UB 3QUYC 3SDCC 4U4BA 4R4FH 3OHXA 4DTGL 3DX9A 3HNSH 4LDEB 2BFVL 3C87A 3OXRB 2I25N 2V2TB 2CDFA 2OQJB 1YJDL 1LQSR 3VGFA 4YIQB 4NPYA 5IKCA 4FZEL 4HS8L 1H3XA 5E2VH 2DMKA 2D7MA 3EO1B 4UMGA 2GJZA 1CL7L 3MOBH 4HGWB 3ZE2F 5F9AC 5JIKA 1D9KB 3BGFC 3VJ6A 2IANE 2ZCHL 4NQSA 1RZ8B 2XTJC 3W2DH 4KDVA 3S88H 3CSYB 3HMWL 3VE0A 2YPLE 4P46C 4ELMF 5DRNA 3HAEB 2QSTA 1CLOL 2ZJSH 4QRSB 1RY7B 4H26B 2JJTA 4WRLA 1EMTL 4QEGA 3MREA 3S35H 3NBNA 4WHYG 5T3ZH 1P2CA 5IROC 5EOQL 4NBYB 3MYJA 1FL6A 1VFMA 4HFWB 4HIIB 2CKBA 1LP9F 1F97A 2DAVA 4PJHB 4PJFB 3TVMB 2V7HA 3D2UA 1OD9A 3LKQB 3PV7A 4Y1AA 2VSDA 4G43B 2ADGB 5DGQA 5IM7B 4ZXBA 5F6IC 1OPGH 5L8LB 2X4RA 4JAMB 3I3BA 3NFPB 3C5ZA 4PRNB 3EGSB 1A4JB 1N6UA 3K46A 4FQCH 2X1OA 4OT1L 2DQDH 3NA9L 1F3RB 3LMJH 1XMWA 2JIXD 5J06A 5E99H 4KWUA 1MJ7H 5AZEL 3P73A 5TPWH 1O5DT 3GRWL 1NFKA 1DTUA 4RMUA 1CIDA 4JFFD 4MYWB 2F5AL 3N9GH 2YN5A 3L3JB 4MSWB 2VNCA 3UBXA 3MLUH 4R97B 5LQBH 4FQIL 4U0QB 5BZDA 1W0YT 3GBMH 3KPMB 2Y9RT 3ZKMC 3GI9H 1P7KA 1IKNC 1XGYH 3O2VL 2V2XB 1IGJB 1P69B 5J0BA 1NDGB 3CVHA 4QT5A 3GBNH 2J88L 5GGTA 3IDGA 4YHKH 5T1MA 1U6AL 3TNMA 4X7FC 5J8OA 5BQ7A 1OGAA 2EH8L 3E2HB 3OKOA 1PEZA 4WU5B 3B9KD 5GS1A 1MHHA 3M17B 4DEPC 1T5XB 2FATL 5DSCA 3MLTA 3LEVH 2MMXA 1N8ZA 4QOKD 3UX9B 5AYUL 4U1IB 5C7XH 4TULH 2Q7YB 1RK1B 4S1SH 4QTIH 2P44B 1A1MA 1GIGL 4M5YH 4G80A 1EZVX 5EO9A 1T22A 3KYKL 1Z3GL 4RDQF 4DWHA 4PJIB 4ZUTB 5I1HL 2QR0B 4HK3J 3DYMA 3JWDL 4ZUSA 1IM9D 2X5PA 5ICZA 1BBJB 1LEIB 1CDBA 1N4XL 4XMLL 5I9QC 3LEXA 4AEEA 2BVPB 3E6FB 5CSGA 2AV7A 3H3KA 4LSVH 4LNRB 1RD6A 3FB6A 1OF2A 2GKIA 2I24N 2DN7A 2VSCA 5TQ2L 2X10A 3CVIH 1X4XA 2YPVH 2WQRA 2R8SH 4L4VD 4X5XB 4YPGB 1LD9A 3O2DL 5DDHA 4E41D 1UENA 3LKNB 5DRZA 4OUUA 1IILE 1I1AA 3GUTA 1KTLB 1ZGLB 3IDMA 3BI9X 1CQKA 4GAGL 2G75A 2P8MB 2NX5D 2YBRB 4M43L 4R96B 4TSCL 5ALBL 3ZLQC 4G6KL 3BVNA 5D7IA 5TH2B 2FD6L 2ESVD 4BH8B 3IDNA 5JORB 5GS2D 2WBJA 4WW2A 2BOBA 1OP5K 4U1KA 4BSWA 4X6CA 5SWZB 3O41A 3O9WA 3I3EA 2FGWL 5L6YH 1L0YA 1A1OB 5CJ8A 2VZOA 4PYHA 4JDVB 2VLLB 1S7TB 3ZKNC 5I18L 2KQNA 3SQOH 1EEZA 3AM8A 2FX9L 5DJ8A 3O2WL 4AEFA 3UTQA 2FX7H 1D6EB 4AM0B 1UCBH 2L7UA 4HUWA 1KIRA 1RIVH 2M2DA 4FFWD 2CKBH 4XI5D 3FT4A 1RUKL 3QH3B 1IGIL 2XPGA 1A4KB 2XFXA 4MXWL 2GEEA 1ZLWH 5IQ9B 5JW4N 2OTUB 2ILLA 1CLYL 2E6PA 3C6LB 3QIBC 5EC1A 2FL5B 2H1PH 2R69H 2W0KA 4AQOA 1NCTA 5EDXA 1MQKL 4GG8A 2NLJB 1M71A 2PYFB 4D3CH 2R1WB 1M4KA 1KPVB 4UB0L 3ZE0F 4NZJA 1QA9B 4HIEA 1B2WH 3WXVH 2RAMA 2NTFB 3STLB 1PAMA 2QQLL 5HGAB 1OAZL 4ZDHB 2AEWA 1W0WB 1HCFX 1DN0B 1EHNA 2NY2C 4PY7B 1JGUL 3PJSA 1JZ4A 1S7WB 2MHAB 4H0GA 1J1OH 5CWSB 1BMGA 1JI1A 3I75B 2XYCA 3DXAD 1MCLA 2DF3A 1EIBA 4XVJL 3CVHH 1JHTB 4R0LC 5I1IL 5F89B 4UI2A 5B38B 3FQUB 1LDPH 1REIA 1LWRA 3ROLA 1BEYL 2F58L 4LSPH 1Q9KB 5GGTH 2E8ZA 3UXFA 4XHJC 1LO3L 2DIJA 3WIFB 1I9IL 2R29H 3X11B 3PP3H 4M48H 3FFCB 4Y4KB 4MA3B 4PGDB 4WFHD 4D0CB 1YMMB 2B20A 4KUCD 4D2NA 1BVLB 1CU4L 2E7MA 4IS6B 4NRZB 5DJAA 1RZJH 1IZKA 3HPLB 3FZUC 1MH5B 3TIDB 4NCDA 3MA9L 3TO4A 2F8OA 1UEYA 4F3FB 2LVCA 5E9DB 5KSVB 3QHTC 1CXFA 2DWDA 4ZQKB 4JPKH 4LOUD 2UY6A 5KJRL 4E5XB 2DQUH 3QXDA 1MCWW 3BP4A 4O5LH 3S5LG 5C1MB 1NC4D 2FX8H 2NY7H 3TJEL 5DD5L 5C3LD 4MD4A 3TBYB 2VQ1A 4QHNA 5KAQF 4FNLL 3KNBB 2Y7QA 4IMLA 2XI9A 3QI9A 3WDIA 4NBZB 2APXA 1LO0H 4IIQA 1A7QL 4XRCA 4DZBA 5F96L 4P3DB 3C8HA 1I8MA 4X7SH 5D7KD 5HY9B 3L6FB 3ARRA 4PJ8B 3VXRE 1L7IL 3S4SB 4KGLA 4KHTH 1FZJB 3QDJD 5CUSL 1RURL 2I9TA 4L1HA 4PTUA 1L9MA 1PKQB 5CSZB 4OI8A 4Q7DA 2PXYA 3GJFK 1BX2A 3FQRB 2QKIA 1VEPA 5F7UA 1NBYA 3H3BC 1WJ3A 1HXMB 4Y4HB 5DRXB 4JGMA 2JE8A 3WFCL 4DKEL 4XC1H 1C16A 1NAKL 1UH3A 2RGSA 3ES6A 2A9NL 3RIFF 4R4FL 3MBEB 3OQ3B 2NY4C 3DMMB 3HNSL 4FFVD 3HE7A 1U3HD 5D93C 1ONQB 2CQVA 3P4MA 5H35B 1T3FB 3GSXB 3MRQA 5HYQB 5E2VL 4ZFGL 3OKDB 5FECA 1OCWH 1FGVL 1R3KB 2IQAB 1FYTD 4LASL 3W2DL 3QEQA 4KXZH 1KIPA 1FV1A 3PIQB 4GG6A 3HI1B 3PWVB 2NZ9C 5CP7B 1UYWL 2BY0A 3LRHA 3QULB 5IB1A 3KS0J 1FDLH 3WHXA 3RY6A 2J8UA 4M61A 4JDTL 3EO0B 1H5BB 1U9KA 1GGYA 1N5AA 5C07B 5D7LB 3GHBH 5T3ZL 3VFRA 1FAIH 2JJTC 1C5CL 4KRPC 2APFA 2BXZA 3ZL4L 1HEZB 4NQCD 2EDTA 5FYKU 1JK8B 1T89A 3SJVD 5C0BE 1LGVA 3HZYB 5FHBL 5L88H 1JGLL 1F3JB 3ARDD 2CD0A 3MCKA 5BRZD 3MRCA 1CGVA 1OPGL 1GXEA 3FQTA 4KK5C 4UT7H 1HIMH 4OSUH 4X9HA 4BFIA 4ZXBC 5FKPA 4FQCL 2IBZY 2UZIL 4NO3B 5FGBA 1F4XL 5EIIA 1OWRM 3C5ZC 1MJ7L 4D0BB 4YR6A 4XBPA 5TPWL 3RDTD 5CBAA 3MRKA 2B5IC 5TDNB 3HC3H 5AAWA 2DKMA 2DM3A 2FH6A 1KLGB 1MAMH 4P9ML 4RGMB 3WIIH 4X7CC 3F6IA 3KYAA 1W8OA 1PX4A 3PGCB 3MLUL 4J3VA 3UYPA 2NY0B 1G9MH 4XPFH 4NWTH 3GI9L 4FXGA 1XGYL 1KN4H 2YA1A 4UQ3B 3ULSA 2XN9D 5IUSA 4MS8C 4Z7VB 5E2JA 2CK0H 4Y88A 2QSCH 3DX8A 1XFPA 3RP1A 2VLRA 4WV1A 4RRPG 2BY2A 2IPKB 2EYSB 3EOAB 3B5TA 4K9EH 5EFIB 5F97E 3MRNB 3OB0H 4GRWH 1OM3H 5T1LB 3LEVL 5ILTH 5GZOD 4OZ4B 3RVXC 1UZ8B 4H8WC 4P2QA 5GS1C 5EU6B 1E4WH 1ZK9A 1MLBB 3GSWA 4TULL 5E8EA 4S1SL 3UTTA 2GJ6E 4BUGA 4N1CA 4M5YL 5MHSE 43C9A 2DDQH 4IOIA 5GSVB 3RGVA 2DQJL 2IQ9L 3FQWA 3JV0A 3RI5F 4RGOH 2A73B 1Y18B 5I16B 3F12B 5DVOA 2FEEL 3TM6A 4QRPB 4YBQC 4J8RA 1MPAL 5DJDA 4CMHB 3UJTH 1L7TH 4G9FB 1T1ZA 4P5TB 2JK5B 2EE6A 1U91B 3GSQB 5JPMA 4PJ5A 1E4XI 5IK3A 4J3SA 4LSVL 3D85A 1RIUH 5E6IB 1OAXH 1FZMA 1UG9A 2CRYA 4W4NA 1NEZG 3CVIL 2ID5A 3TZVA 4Z76B 2YKLH 4CVZB 1F6AA 4HX1A 5FO9A 5IFJB 5D5MA 1DUYB 2XWTB 2UWEE 4I3SH 3L95B 5J3HD 3QO0A 1BGXH 2EDHA 3L3OB 1PGRB 3WIHA 4PJAE 1YEIH 1GAFL 2DB8A 4RWHA 5C0FA 4JG0H 3RVVC 4Y4FA 5CHNA 1S7QA 3HB3D 3DO7A 4OZIA 1I7RB 1I1AC 2A9ML 2ERJB 2DBJA 2GJJA 3RIFK 2E7LA 2J1KA 2NXZB 1WQVT 5A2FA 1DQDH 2GTWB 1UH2A 2JCCF 3FRUA 5L6YL 2WBJC 4WW2C 1RAMA 3WO4C 3DGGB 3BXNB 3VFWB 3FOLA 3O9WC 4R6UA 1SYVB 1JTTA 4MJ4A 1NCNA 4WVRA 2VZTA 4OFYD 4Z78A 4I77L 1QRKA 1SJXA 1BAFL 2R2EA 3O11B 2CKBL 4GSDH 3AM8C 4C59B 1IAKA 4TPRH 1FVCA 4LLDB 4JM2B 2IG2H 1HHHB 4WI7A 2ATPB 4LGSB 1R5WA 4RAVB 5FA3A 1BHGA 5KVEH 2YPLD 1HYSC 3E8UH 2ARJQ 3VWJD 4U1HB 3W0WB 2DRUA 1I8KB 5D6CB 5C0CB 4K2UL 1JF6A 3W39B 2R69L 2IALB 1AXSB 3RBSA 3U4AA 3ULVC 2GT9B 3SDXB 4J3XA 2CRMA 4LEXH 2Y6SD 4Y4KD 5T5FL 2APBA 4WFGE 4D3CL 3QDGB 2HN7A 2P45B 1KGCE 3CDFA 1CXHA 3IFLH 1G7MA 4IRSA 3WXVL 2CJUH 4Q74A 2WLYA 1ZT1B 5C6WH 4HC1H 3QXWA 3VD4A 3OF6D 4O2EA 4EOWL 1DE4A 2N7BA 1NC2A 1FLTX 1BD2A 1MJJA 2A6KA 4MAYA 4YHZH 3MACL 4ZYKA 3T77B 5HJ3A 3FT2A 4RGNE 4GAYA 4L3EE 3DVGB 3BX7C 1LDPL 3QQ9C 1U95B 3MGTB 4LSPL 2UZYB 1INQA 4POZD 5GGTL 5JHDB 1C08B 4CMMB 3V52H 3BPNB 2DBLH 2VO5A 3MRJB 4H8WL 2MPAL 3VMNA 4M48L 4UAOC 3TNNA 5DMKB 3QFDB 5CGMA 3CLFH 2QJDA 5SX5H 4UNTA 5KVGH 1AQDA 3MLZL 4I18C 5CGTA 3FTGB 4QRRA 5HDBE 4Z7WE 3RWCA 5DJXA 1R3LA 2N56A 1XGTB 2VTFA 4UZGA 4HK0B 1EERB 1CICA 4MJ2A 3GSNA 3I85A 3TO4C 1LO5B 1MVUB 2YD3A 3QQ4B 4JPKL 2Y23A 3DROB 5EBMA 3L7FB 3U6RA 2X4SB 5DJ6A 1SJHA 1UJ3A 2C9AA 4O5LL 5B3NA 2Z0BA 5IB2A 2KKQA 4OAWB 2FX8L 4YO0B 3Q5YA 5JMRA 4TN9A 4LVOC 2AABH 2UVFA 4K9EC 4PGBB 1CGTA 4G9DB 2QHRL 4R7DA 4M1CD 1YY9C 3RI5K 3MLYL 4ZO7A 1LO0L 3UEZA 4HXBH 1ZA3A 5I71C 1EXUA 1WAAE 4M7ZB 2DLIA 3QI9C 4X7SL 1LVEA 5IVXE 4IIQC 2X4NB 5JNYB 3TCLB 2QADB 4YZFF 4RFEA 4P2YA 1HDMB 4NC1E 1WSST 4O2FA 4RISH 1AKJD 1ZANL 3LZFH 2X7LA 4KHTL 5F44A 4N0RA 5GRWA 4GKNB 5CFHA 5ECJE 1I1YB 4QRTA 3ARFB 1IGCL 3QRGH 3V0VA 5FYJU 3DRTB 3HZKB 4RWYH 5E1AB 3I6GA 1ZGLP 4Q9QL 1XF5A 4JLRA 3T2NH 2PXYC 4XC1L 2IEPA 4QHLB 3WNLA 2C3VB 3C08H 1JF1B 1CGSH 1Q1JH 5DEGA 1DP0A 4G8IA 1G7PA 3RX8A 4QRUB 5C8JB 5L0QC 4YHLH 1T7YA 5DUBA 1X6LA 4PR5B 1J1PL 1NCWH 3S9DB 3IJSA 5DQJB 1MJ8H 5DFWH 1CFVH 4KTEH 1TPXC 3VRLE 3N1GC 3IDJA 1M7XA 3HE7C 1S7XB 4O2CB 1OCWL 4I4WA 1T20A 3AXLB 4HPOL 4Z7UF 3B8SA 1OLZA 3KR3H 3QUKB 4XNMA 1DBML 3ZT5A 3FN0H 5K59F 3BP5A 1BZ9A 5IW1A 4UIMA 1CTOA 1NGWA 4JFEE 1S9XB 3WFEL 2P5WA 2Q6WA 4P3CH 2NY5H 1EEYA 5J57B 1RJLB 1KENH 2D03L 3QWOB 3EYOB 3ULVL 3B6SA 2K1MA 5GRVK 4XXDA 1RI8A 4JR9L 3MO1B 3V4UH 2MCPH 1W0VB 1T7XA 4K23H 3RY6C 4P0DA 3BIKA 3DUSB 3GHBL 3DGCR 5DJYB 3EDEA 1P5UA 5HHME 1JPFA 1FCCA 1G1CA 3BSZL 3G08A 4ZOAA 3HC4H 5IBUG 2O26U 3PHSA 1BF2A 1OTSD 5LVEA 2BNQA 1AHWB 4ODSL 4KK9D 4G6FB 5L88L 4Y2DD 4OB5L 4PJXA 2HJFA 3T0WA 5ISZE 1WT5A 1MCEA 1SQ2N 4Y0GA 1QVOB 5GS0D 4B41A 4AIZB 2RIKA 3QAZC 4NNPL 5TDOB 4G5ZH 4MWFA 4XP6H 4ZFOA 5I19H 5IMLA 5C0AB 4X98B 1ZSDA 3SKMB 2ORBL 4FQJL 5IB5B 3QNXB 4NNXA 4MB5A 4HJJH 5FGBC 3EJZD 2XNAA 4GRLB 5CMAB 1I7UB 2CSPA 4JFFA 5DD1L 5FUOL 3HMXA 4PGEA 4U1SB 2AW2A 3VXMB 1RSFA 1NLBH 4NWTL 4UV4H 3CFIC 5HI5C 1KN4L 1T0PB 4WUKH 4PV8B 2FJGA 4XC3H 2RHEA 3Q1SL 4H88H 4WI5A 4HKXA 1AXTH 5SWSA 2CK0L 2KZ1B 3GSNH 4YGVB 4OLXH 5L7XL 2GW5A 3ARGD 3UAJD 1WF5A 4LCWB 1KC5H 2ADFH 4PBVC 3GI8H 4K9EL 1MHCA 5EUOA 4WV1C 4OF0A 4F57H 4HD9A 4JZOB 3TV3H 1WWWX 2BVYA 5ILTL 3RTQD 2D9QB 2Y25A 1E4WL 4JPWH 4ONGH 3G5XB 5IVOA 3TFKD 1T4KB 4ZNCD 3NACH 3KPQA 4M6NH 3L3GB 4ZFFA 1XZ0B 4HFUH 4JY6B 1MUJA 1QSFA 4TSBH 2C26A 3WMSA 4HGKC 2C7UB 5D2NB 2NXZD 2Z31A 2Z92A 3VH8A 2D7QA 4QF1A 4KZDH 4M00A 1IM9A 3CFKB 2W65B 2WWKO 3RJDA 5F9WC 3HS0B 1TCRB 4OLYH 4KRLB 5I17A 3QPQD 3TBWB 3OKYA 1E28A 4HIHA 3FMGH 3BH9A 3DUHA 3LAFA 2EEBA 4I0PD 4JKPL 4X4XB 4XBEH 5FV2A 4JREC 4I3SL 1BGXL 3TZVC 1K2DA 2GTZB 5D1ZC 5JW5B 1NAMH 2QTEA 5J1TC 1T1XB 2FJHB 1N7MH 3DECA 1YEIL 1MI5B 2XTJE 2XQYK 3SDAA 1BJ1J 1JYNA 2EE2A 2VDOH 15C8L 5I2IA 1NANH 2A6DA 3NZ8A 2P5EE 3RL1B 4ZS6D 4Y4FC 2VLKB 2L4OA 4S1QH 1DQDL 4L8CA 1LK3H 2AXFB 3O3EB 3V5HA 2E7LC 4CU6A 1YECH 2PW2B 3DVFA 5J56B 3BRFA 3QWRD 2F9BT 1G0XA 3VCLA 3BGMB 3FO9B 3UPRA 3LDBC 4N0FB 3MXWH 4HUMB 3HG1A 1H3PH 1NFDF 4PP2B 2Q8AH 3VXUB 3AS1A 1B9ZA 1FH5H 3TBSA 5CLTA 1WWAX 1GGTA 1K4DA 2AAVA 3D3VE 1JZ8A 2AXGA 3MRRB 3VFMB 1FO0A 4F58H 4GW1B 2V5SA 5DD3H 4TPRL 1MY7A 1RUMH 4PJCA 4UNVA 1N59A 2NNAA 1CXIA 1W8NA 3S3PA 2YUWA 1TZGL 3S5LB 3WFHB 2PO6B 1S8DA 3O6FA 4UV7L 2QQNH 1ES0A 3VI4E 3CK0H 4JJ5A 3X14A 3V0WL 4ZNEA 1ORQA 2JB6A 3SO3C 3BKML 3F65A 4FXKB 4LEXL 2VYRE 4PJ9D 4N8VG 4WI9A 2LTQC 1WTLA 4BA8A 4EUPG 2MQ0A 5KS9F 5C0BD 3QDMA 4KQ4L 5IR1B 4Q2ZA 2JCCE 3IS0X 5D7JA 2OMNA 1EGJA 3G6JE 2CJUL 3HMXH 4NQEB 5DJ2B 2H2SD 3DX7A 4BFBD 1FZOB 1DVFB 5C08E 4WWKD 2HLAA 1JMZA 3RWGA 4HQQL 3MOQA 4IRSC 3P4NB 3BQUB 4CADB 1AQKH 2GSIA 1P7QA 4YHZL 4KKLC 2NW2A 3DVNA 4ZAKA 4RAUA 2FO4B 5DFVD 5DD6B 2YD2A 2EKSA 3KXFB 4EI6B 2P47B 3VFSA 5MEOA 4IEFB 4OZFH 1A3RL 4UOW0 4JFZH 1Q9WA 4FQQA 2GAZB 2OJEA 4TRPH 4LHQB 3D9AH 1YPZB 4MJ6B 3LKSA 4F9PA 5LGHH 3QUXB 5HPOA 4OD2B 1UEMA 1Z9MA 3PP4L 1NQBA 4YDVB 1ORSA 1MAJA 1U93B 3IVKB 4KY1L 4UUJB 3HI5H 3VRJA 4E9LA 3SKNA 2VABB 5HDQH 4Y2OA 1WBZB 2CIIA 5KSBA 1DBJL 1KNOB 1CICC 1YNKH 2GHWB 3T0EA 1JWMB 1X5HA 3NH7H 4LLQA 5E56A 3BP6B 2OXHA 3OKNB 1J8HE 3BEVB 4F7EB 2XG4A 2FZ3B 2W9DH 1UJ3C 2AABL 3FHQA 3U9UA 4D94A 4NHUB 1J7VR 5MHSD 4HF5H 4YWGL 3F58H 4A6YH 2EDRA 3OXRA 2V2TA 2OQJA 4HXBL 1RJYB 4P48A 4YIQA 5F7YC 3DHJA 3EO1A 4HGWA 5DMGD 3WIHL 1D9KA 4RISL 2I60L 3LZFL 3SDDC 3SGEI 1MCWM 5CSBA 3O4LB 1PYWB 5SX4I 4WU7B 1RZ8A 3WBDA 1ZLWK 4DK3A 1WEJL 2VR4A 3QRGL 3F62A 3CSYA 4OZGE 4G8GB 1RZIB 5I30H 3O0RL 3V8CA 2OI9B 4OFDA 3HAEA 3HA0A 3UTZB 5GS2H 1YY8B 4LVEA 5I73B 4X9GA 3T2NL 4QRSA 4C83A 2FR4B 1CVSC 2WUCH 1CE1H 1FVDB 3C08L 4H26A 4QRQB 4YHML 1RULH 1CGSL 1Q1JL 3O4OC 1S9YB 3K74B 4JN1H 1YC7A 2YMXL 4MNQE 5J12B 1MJ8L 4HFWA 4HIIA 4HUXB 3EJYC 3ILQD 4UT6H 4PJHA 3DI2B 4PJFA 3TVMA 1TENA 1MWAB 1T2XA 2PCPB 5GGSB 4L1DA 3LKQA 5I1CH 2D7TH 4G43A 2ADGA 5IM7A 2WMPA 3KR3L 4LLVB 4JAMA 1JYXA 4Y5VB 3MRPB 7CGTA