1T0PB

Structural basis of icam recognition by integrin alpahlbeta2 revealed in the complex structure of binding domains of icam-3 and alphalbeta2 at 1.65 a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
b'QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-L
publication title An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0pB00
4MB3A 2X7LB 4N0FA 3TYGH 2NY4B 1BOGA 5TDNB 4Y4HA 1I75A 3O8XD 3BH9B 3S3JA 2ESVB 4OUUB 4DWHA 4E9LA 2GJ6D 4FQJL 1QSFE 4U1JB 1G0YR 4JQXC 2AK4A 4KDVA 2Q7NA 5T1DL 3MGTA 5IB2A 1J8HB 3VG9C 3BEWB 2W92A 1YEDA 5MENA 3MLSL 5CEZH 4M93B 3NH7L 4MAUL 5HHMB 5E5MB 3KYMA 2CGRH 3HMXH 4K3JH 5IVXE 4OLUH 1A1NA 3ZDYE 3MUGA 1NJ9B 1FLTX 4YHKH 3RJDA 3SDDB 1KEML 4M6ML 3M8OH 2YUXA 2VDML 3T0VA 4GG6E 3VGGA 2UWEF 1FGNL 4ZFOB 1F6AB 2C7UA 3IU3B 2WIIA 4NT6A 3D9AH 1H8NA 4HG4K 5ADOH 5C0NC 3VFWA 4FABH 1C7TA 1QBLL 1IAIL 2QBWA 2VZ1A 3QDGB 5GS0D 1I7ZA 5E99L 1FSKC 1TQBC 4OF5A 3IFPB 2DKUA 5F6HJ 1S7TA 2BNUA 1CLCA 2YUZA 1LE5A 2BSTA 1A1MA 2WP3O 4OZIE 3WHE0 3P4OB 4P4KB 2UUDK 1MCFA 3DGGB 3S5LB 2BFVH 4O2FA 5JOEA 4JQVC 2CLRB 4UINL 1A21A 1HKLL 1XZ0A 4BFBD 4WRLA 4X80H 1JHLH 4S1RH 3TBWB 4OT1L 3HUJB 3U7YL 5BZDA 4N0UE 2PTTB 2HJFB 2XZZA 5ISZB 5DEZA 1RK0A 4NC1E 5LBSH 4JFDE 5GJTL 4MQXC 3CPLA 4FQPA 4B7IA 3LKQA 3VCLA 5KVEH 3T1FB 1NFDA 5IHZA 4XX1G 5FHAH 3CVIH 2ZOLB 3EOBB 4Y5VC 3BGAA 4I9WE 2D0HA 4OCRH 3GI9L 4IIQC 4DOHE 1MRDH 1CGYA 5DD1L 4LOUD 4NBZB 4O2EB 3EIFA 1A7BA 4FN0A 1NMBH 1FRGL 4Y5XA 4BK4A 1ZS8B 4HFWA 4TNVK 4CGTA 3OBAA 1HE7A 3ZKXB 1RZ8A 5DMYA 1RV6X 3PE9A 4KRNA 1OW0A 2AK1H 2IH3A 4IMLA 4WENB 3ARDB 1ETZA 2EICA 3WUZA 1MCRA 5HI3C 4RNRA 1A6ZA 2MKWA 5EU6D 2CR6A 2ICCA 4DGIL 4YDIH 2XRAH 4XC3L 3V0WH 3DTXA 3SJVD 4JVUA 4AH2B 3MA9L 1U95A 1GC1C 3ZYIA 3EFFA 4FQLL 1AE6L 2P8MA 2VR4A 2V5YA 1LP9A 1UH4A 5T5FH 2NXYD 2BRRL 4KAQH 4FG6D 1JYVA 3RDTC 4OGYH 4UTBL 3GSUA 5GRZA 3KPQA 1VFBB 1L6ZA 2HJLA 3WHXA 4M1DH 1BD2D 2BNRA 3FQUA 5EC2A 1CCZA 4L4VA 3CFIC 1MH5B 4OZHB 3SE9L 3PWPB 4HWEL 2B4CC 4UB0H 4BQ9A 3FONB 4ZXBA 2R56L 5IGXH 2KPNA 2GY5A 3IGAA 2IPUG 4TULH 2BSSB 5DD6A 3V5KB 3IS0X 4OFIA 4HS6B 2ADFH 1CLYL 3RVUD 1G6RB 4E41E 5E4EC 4B41A 5DA0B 2H26B 3DVGA 1JFQL 4QXTA 3ZHDA 3H3KA 1KEGL 4JANA 4ENED 5EO1A 4D9QE 1UQSB 1F3DJ 5HPOA 3V5HB 3WS3B 4YWGL 1C5CL 3SOBL 5K9KB 4Z7QE 2JIXD 1PBYA 2GITB 4S1SH 2XI9A 1N6UA 4I8DA 1MF2H 4DN3L 4PRNB 4K7PY 3UMTA 3TYGL 3SE3C 1OY3B 4RAUA 1Q9LB 4KK5D 3Q3GB 4ZNEA 5F89A 1E27A 3IDJB 1NC4B 1HILA 5E9DD 4G6FD 5FUCE 4H5SB 2F54E 4V1DE 4L8SC 2ADIA 1U6AH 1A6AB 1S7SA 1NKOA 3NCFB 3IJHB 5L7XH 5CEZL 4P57A 5EH1A 3EOAB 4QRRA 5MEPA 1AH1A 1FFOA 2CGRL 4HWBH 2F8VA 2YPLE 2XQYG 1YPZB 4TNWK 4JO1L 4OLUL 3H9ZA 5I1HH 1XGUA 5CBEB 3WLBB 4N0CD 5GRXG 4HWZA 1KLGA 2H8PA 3QWOB 1KGCE 4OAWB 1D5BB 4RMUA 3D9AL 1RZIB 4QWWD 4ONOA 3UZQA 4ODUB 1CR9H 1JF5A 1WZ1L 3NVQA 4FABL 4RWYH 4K9EC 3NIFE 3RL2B 3P2TA 1WBXA 3AREB 4HDIA 4OCMC 4OF8A 4AY0A 1MFCH 5C09E 3BD5A 4D9RD 2VLKA 3QUXB 1HINH 2F5AH 4LSUH 4L8DB 4ODVL 1Z6JT 2W0PA 5T3XD 3HKFA 4DCQB 4NFBA 2ITCB 5C6TH 1NCDH 5HYQB 4KTYA 2AV7A 4X99B 5C0BD 4WFHD 2VAAA 1IT9H 4XP5L 1T2JA 3LS4H 4X80L 2FZ3A 5KOVC 4XNUL 1KJ3L 2WLYA 3VD5A 2OI9C 2R1WA 3C5ZB 3C9NB 3PHOA 4ISVA 5F8RC 4OFVA 2IJ0C 5LBSL 4P2QE 4LPUA 1K6QL 1I1YA 4MA7H 3FQNB 5KVEL 1AC6A 1KPVA 3VJ6B 5D5MB 2AEQH 5FHAL 3G6AA 3LOWA 1Z5LA 4HMDA 1CGUA 4J1UA 4KGJA 4OCRL 2W38A 5GS1B 3WE6A 3CC5B 2KZ1B 3T3ME 2P42B 1N59A 5EUOB 3CJJA 4MVBD 4BZYA 3D87B 4KMQA 9CGTA 5CP3H 1NMBL 5E8DH 2OL3B 1F4XH 4XPBL 3MNVA 4OBRA 4HKZB 1YYMH 2ZUWA 3PL6B 5KVFH 4PJ5D 3TPKA 4X9FA 5I6XB 4YK4C 2AK1L 3EJYD 2BMKB 4IMKC 4UDUB 1QBBA 5E8NA 4AIOA 2J2ZA 3L5XH 1BQLH 1CFNB 5KVGH 3B8SA 2C1PB 4J6RH 5ANME 4NKMB 3MPCA 2FX7H 2BHUA 3F7RA 4PJBE 5GSVA 5BRZE 3QJFB 5D8JH 5ESQB 4YDIL 5DJYA 3B5TA 4HIHB 2XRAL 5E2TH 5C07A 4ALAH 4PJGF 3FRUB 3KHOA 4HIXH 4PRAA 1J10A 3O6FC 2P8LA 4RMRA 2GSIB 4XVUC 3WCYA 4RQQA 1I1CA 2DI9A 2HJKB 4NQXB 3MRFA 5T5FL 5KSBF 5B38G 1V05A 4JM2D 3CH1B 1BF8A 5MHSE 3C5SB 2J4WL 4GXUN 3MLZH 5E8PB 5A16A 1U93B 2RHEA 2FH6A 4U49A 2R69L 5D7SH 5SX5K 3FOLB 3LD8C 1S9WB 2XTJE 2DLHA 3WV0A 1A7OH 4LSDA 1F4YH 2VH5L 4RAVB 3T0EE 2OZ4H 4GAGL 5I1IH 1I8LA 3TH4T 1MJ8H 4MCYB 2VDQH 3ZE1F 3DNKA 4XBPA 3B3IA 3QHFL 3SDXB 1NFIB 4FQXC 2FBJH 1XH3B 4TULL 5K9QG 3RI5K 3B6SA 3MRKB 3HRZA 2NXZD 3TPUB 1KFAH 1MAML 1H3UA 3K46A 3TVMB 3O3AA 2XV6B 3I50H 4TSCL 3FO1B 4NCC1 2V6HA 4L4JA 2BY2A 4NO0B 3BDYL 1R3LA 2P24B 1JMZA 3MLXL 1J0ZA 1NBZA 3O6KH 3RKPA 5L6YH 1F3RB 3TBSA 1BFSA 3B2UC 3RWGA 3LAFA 1Y0LB 4S1SL 1RK1B 3NFNB 1D5ZB 1NCBH 1FORL 1QSEE 2VWEE 4HXAL 4KI5E 2NY1D 3QCVL 3GSXB 4UBDC 3TF7C 3QUKB 3CSPA 1CF8H 1ZEAL 4WWKB 4L3EE 4HF5L 4M7LT 1KCUH 1QSFA 2BNQB 3PQYD 3EO0A 2BXYA 3O8XC 1JGEB 4CMMA 1XGTB 4PJAB 1GPOL 1ZHBB 3FT4A 5JW5A 3AUVA 2H9GB 2APFA 1T2QH 3DARA 5IVXA 3HI6H 1KYOK 5E56A 1RIHL 2LTQC 5BW7A 3FT2B 1BJ1H 4GG6A 1NFKA 1PX3A 3P9MA 1DE4A 2L0DA 3WUWB 3NPZB 5I1HL 2CXKA 1ZTXL 1F4WH 4H26B 1OP9A 4LIQE 3A67L 2F15A 1J5OH 1UVQB 5BVJA 1KTDB 4RFNB 4XVSH 3QUZD 5BCAA 1ZT4A 1FPTL 4FMFA 3OJDA 4AT6B 1CR9L 1PAMA 1JUFA 2V2WB 1A7PH 3TNMA 4NM4H 5ADPL 5ITBH 1G9EA 2W65B 4OZIA 1WVZA 5KTEH 3O6MH 3AAZB 3MLUH 1MCHA 2GCYB 1FNLA 2F5AL 3BKJH 4LSUL 4ZUTA 2E27H 3RTQB 4UIMA 4BSJA 3LRSB 1V7NL 1RMFH 2EDNA 3AU1A 1NCDL 3GJFH 4DAGH 4G6KL 4PLOB 3VMNA 1EZVX 4N0UA 4JM2F 3LS4L 4KDWA 1QBML 3ZYOA 1KJ2H 3MJ9H 1U3JA 5F1NA 3IXAA 4JFDA 3CD4A 4NQDD 1H15B 2CH8A 5IK3A 3S37X 1KN4H 4IOFD 4PRHE 3OR6B 2DQHL 5LCVH 3DRQA 3O4LB 4PJEE 5DUBB 2FX8H 3NGBB 3MA7B 1A64A 5DWUH 3EGSB 1RZJC 3ZTNH 3E0GA 3HZMB 1A6TA 5HSFA 3LEXB 2OTUB 3ARWA 2FRGP 4LOUC 1B0WA 3QUYD 1T04B 3MRPB 3FB6A 4O51B 1ZLWK 3PWUA 2FJGA 1KCRH 1OTUD 1S7UA 4NN5C 5E8DL 1P1ZA 1JWSB 2EXYD 4FP8L 4OGXL 1YYML 4K71B 3LZFL 4GKZA 1QEWA 5KVFL 3HE7D 4NRXA 2BHZA 1A14H 4GFTB 4Y4FA 2AEIT 3L5XL 1BQLL 4NHUA 1U8IA 5D2LE 3QIBA 1IEHA 3MRMB 1PX4A 1Y6KR 1X5XA 1P7QA 1A0QH 1S9YB 1CDCA 1G7MB 1DTUA 4L8BB 5D8JL 3GKWL 5E2TL 2R29H 3OAUH 1KBGH 3VFNB 3IDYB 3MREA 1K3ZA 4RZCA 4C56B 1XGYH 1NMCC 1JRHI 4D2NA 2M2DA 2IMMA 5IT2H 1R3IL 3PG2A 4NM8L 2AW2A 2NXYC 4HIIB 3KXFE 4TYUA 1BIIA 5E00B 3WS6C 3MGOB 4LFHG 2E7MA 3V6ZB 3MLZL 1NBYA 4YHYC 4MNQE 4MDIB 4JREB 5D96B 5IVNA 3MACL 2XA8H 4GG8B 1GC1L 4JFYB 1PZUB 3H7LA 4G8FB 3MRGA 1ZHLA 3MSPA 3KWWA 2NTFB 5I1GH 1EIBA 5I1IL 4HPYH 5B3JE 1AXIB 2EIZB 2FR4B 1PG7W 4X7EC 2YUVA 4Y19E 4Z7UA 1ED3B 1OTTD 4HUKB 4P5TB 1AP2B 2FBJL 3VDAA 4M1GL 5AAWA 4PJ9A 3BD4A 2NX5E 2I5YH 4YFDB 4E41A 1KFAL 3L5WB 5CKGA 2EYSA 1MFEH 3QDJD 2PTVA 2FJHA 4O00A 4GXVH 4PP1D 2B4CL 3I50L 3RVUC 1CXHA 5E6ID 5DQJA 5J1AA 1YN6B 4YE4H 4W4NA 1HN1A 1JPTH 3X11A 5MI0C 5FB8B 3RIFF 5L6YL 1DLFL 4A6YH 4IJ3C 4JRXE 3V95A 3U0PB 2E6JA 2ZKHH 2HN7A 4BSVB 3FJTA 5CSBA 3BP5A 1J1XH 2X4NA 1CFTA 2J3SA 3PWVA 1FN4A 2LV4A 1CF8L 3MZTA 5JOFB 4LSVH 4JHZA 1KCUL 1MLCB 4PTUA 5IWLC 2F54A 4PJ8C 4V1DA 2I60H 1NQBA 4U4BA 2DRUA 2VOTA 2W9EL 4C83B 4YR6B 4LDOB 1YEKH 1IAOB 1MCSA 4WUUD 3L3GB 4MB4A 4MCZA 4QRTA 3KPSB 4QHMA 1F3JB 2YPLA 3UZVB 1T2QL 3ZE0F 2XG4A 2SEBA 5DRXB 4CRPA 5IF0A 4MD5B 4OF0A 5CJQL 1CD1A 4M43H 5HYSB 5TE7H 4LU5H 4XHQA 5IR1A 2NY3D 4XNMA 4WI2A 4LSQH 1J5OL 1DN0A 4C57C 1K4CB 3QFDA 2HFFA 5TH2B 2BC4A 5IVZA 4XVTH 1QNZH 2VSCA 1F6AA 4PR5B 3VMPA 4KRLB 3GMRB 3VXPA 5C08B 4ZPTA 4NM4L 3L95B 4HIJA 1Z3GH 1BX2B 5J9PB 3MV9E 1C08A 1JI1A 4I1NB 3SQBA 5L9DH 3LKOA 4P23B 1F5WA 3MCG1 4KK8D 1A1OA 2E27L 5LGJB 2Z31A 3ARGB 5HHQA 2GT9B 3KGRA 4WV1B 4PYHA 4O4YL 4LARL 5GRUL 4LHUG 3QEUB 3WFBH 1XGPA 2VSDA 3MJ9L 2J6EH 5B8CC 2DKSA 4ZUUB 4P2QA 5F9WB 3MOQA 3QPXH 1JPST 2NYYD 1S8DB 2Q20A 4XP6H 1KN4L 2ZUVA 4TUKH 5LCVL 2IPTH 3ETBF 5DYOA 1SYVA 4YHNA 3TIDB 2FX8L 4JFEE 3RFZC 5MEOB 3ZTNL 1D9KA 3UDWC 2VUOA 3E3QE 4KY1H 5I75B 3CXHK 5MEND 3VFMA 5DT1L 3VFGL 4KKCC 3PP4H 4R4FH 1IEAA 4OD2A 3T2NL 4EQ3A 1RZJH 4X8XA 5EU3B 1WWBX 4OCSH 4MXWH 3EO1B 4IHOB 2PYEB 4P3CH 1FHGA 3HB3D 4PJBA 3ECBA 2VITB 4F7CB 4LVHC 4I48A 5INCB 1U8OA 4WHYG 3BP6A 2HYMA 2EDDA 2R29L 1KBGL 5DSCB 4U1LB 4L9DA 1I85A 4PRDB 4AL8H 1JYWA 2ATPB 4LLDB 4ZD3H 3IKCB 3TBTA 5IT2L 4EDXB 1BAFL 2AKRA 4JM2C 2C3VA 1OT1A 4PG2A 3DUUA 4OCLC 4YHPA 4RGND 3G6DL 3GMNB 4J7RA 3FT3B 1B4RA 3MV01 4JGUA 1P4IL 1UCTA 3RVVC 3BQUA 4XP4H 2QADD 3Q6GH 4NJ9H 1U8QB 1XR9A 2EE9A 3KHQA 4EN3A 3KLSA 1FNEA 1L4IA 1U91B 3PHQB 3FOMA 4HPYL 1N2RA 4BUHA 4U0RB 1JF6A 2Y5TA 2X89A 2V5MA 3RNKA 3BAEH 3OMZA 3CFBA 3LKNA 2R8SH 5E8OA 2A9ML 1P4BL 4CNIB 2FD6H 2I5YL 2NXZC 2FEEL 5ERWA 3VG9B 3VGBA 3NABH 1U92B 1A2YA 5JZ7D 2MCG1 3MRRB 2IBGA 2X4SA 3GJFK 4WEBH 4UV4H 5ID0A 5GQBA 4EBQH 4OFYA 1RVFH 1EO7A 4YE4L 1TJIH 3GSVB 1MCEA 1QSEA 1JPTL 1W72H 1I1AD 1BFTA 3G04A 2W1NA 3GMMB 4AJ0A 5ICZA 1KB5A 1IVLA 2JJWA 1NDMA 5CGYD 2NY1C 1SJHA 4L3EA 5LQBL 3FTGB 4EUPG 3QNXB 3RA7L 4NQED 1T20A 4LLYA 4RMQA 1YEFL 1CE6B 4LSVL 2A83A 4M6OL 4XZUB 2C5DC 3MRJB 1NEUA 2I60L 5FFLA 4MA3A 4EI6A 2JJSC 5DC4B 2BX5A 1GGUA 2RFXA 4LNVA 5HJ3A 1UYWH 1QR1A 1YEKL 2XWBA 4NO3A 3Q48A 1JV5A 3UJJH 5FO8A 2WQ8A 4UQ3A 2Z0BA 4JKWA 4D0DA 2NLJB 4UTAL 4EQ2A 2BNRD 1WQVT 2R9HD 1YMME 1QRKA 1G9NC 1QBAA 1JPGB 2L7UA 3D25A 5IOPB 1YC7A 5I74C 2PW2B 3CFKA 1S9KC 1D6EA 5CJ8A 3RWFB 5TE7L 2E9BA 5KAQG 4MNGB 4JZOA 1YDPB 3HE6B 5GSRB 2DDQH 3MOAH 1CDIA 3V52L 1N3NB 4LSQL 2XQBH 3NA4A 3VGDA 4XVTL 1MLBA 3T2OA 1J86A 3D85B 4HWUA 4MQTB 3QH3B 4WIQA 2KDGA 1H3GA 2EDLA 2HFEA 2KQMA 1ADQA 1Z3GL 3G5VB 3ARFD 4NQCE 3H9YA 1T1YB 4AMKH 1FQ9C 5ICXB 1IL1A 2ZSVA 4ONGL 1AKJB 3O6LL 4Y4KA 3RY6A 1NUNB 4WHDA 4KTDH 2DL9A 2BDNH 3R8QA 2MPAL 1JIBA 2XACC 1LO4H 1X5JA 2YBRA 4WFEE 5CINH 4YHZH 4PRHA 3WN5A 3VFTB 4MHHI 1M6OA 4LDEB 3LHPH 1MHEB 3QPXL 3VXSD 2EE2A 4OI8A 4BELD 1ULVA 4PJEA 2AEWA 4XXCC 5T1LA 1HHIA 5T5NF 3QI9C 2IPTL 3IDNB 1IAII 2MCPL 3P30H 3RGVD 5B22A 4GMTH 3MOBH 1W0WB 3RWDA 1JGVH 1KTLB 3PGFH 2Q3AA 1YQVL 5D7JA 1T0MA 4KY1L 3OKOB 4NWUL 5C0AA 4W4OC 2OP4H 5JIHA 5FYLD 4OCWL 4X8JA 1U8NA 3PP4L 1MIEH 1RZ7H 5JPMA 2O61A 3GGWA 1V7ML 2WMPA 2WM0A 1U42A 2V2XB 3B4NA 4PY7B 3BOVA 1DANU 3EDJA 1RZJL 1P4LA 2A74A 4XMLH 1ZHNA 3ARTA 3WYRA 3I02A 2EXYC 3HN3A 2MHAA 5D2LA 3SDAA 1XF5A 4MXWL 3HE7C 5TE6L 2VLLB 1EGJA 5DUPL 5FO9A 2NMSA 3QP3A 4P3CL 1S78C 1RPQA 4FFVD 3ESVF 4OF3A 4K23H 2R0WH 3SGJA 1QO3B 3CDGA 1NGQH 3EZJB 3RVXD 4WTWA 3W39B 4AEFA 4IRSA 1OF2B 3JZ7A 4P4RA 4FNLH 4F80A 5MP6L 2XXMB 2NZ9D 3RWHB 4L3CA 1AO7B 3KXFA 2VYRE 3JVGA 5KANG 1GXEA 1MVFA 4URTB 4LF3A 3EUUA 3HHRB 4J3SA 4LCWE 4Z7VE 3SKOA 4HK3J 3S37L 3KPRB 4PJIB 3MBXL 3D18B 3VXTA 2Y1VA 5E08L 3HG1B 3EYOA 4G43B 3VWKC 4UT7H 1ORQA 2ITDB 2NY6D 2X1WL 3Q6GL 4I5BA 4WHYH 1EAPB 3L3JB 3VRLE 2HWZL 4NFCA 5AZ2H 3V4UH 4TSAL 5TFSL 1URLA 4KKAD 3PGCB 4ODHL 4DQOL 2LU3A 5FGCB 4NRZA 1PSKH 3RPIB 1B2WH 3UYRH 1OTTC 4AQOA 1HXYA 2QR0B 3BAEL 4OZGE 2XY1A 1PYWA 3GHEL 1G7HA 3NABL 1NANH 5FYJH 3X14B 5HPMA 3PNWA 1I3VA 4WEBL 3AGVA 2Z93B 3VXME 4TUOA 3RUGB 1W2KT 1RVFL 2DTML 3IAPA 4U1MA 1TJIL 1RJZA 3FO1A 4N1HB 3L3IA 5SV3A 1W72L 3D3VD 2EDWA 1ITCA 3HC0A 4J3TA 4X9HA 4Y89A 1MI5D 2NZIA 5EFIA 3ULVD 1L0XA 1OSZA 1TVBA 4GRMA 5DQDH 3PHSA 3O81A 3OKDA 1MJJA 2Q8AL 1KV3A 4ZSOE 3GJFB 1WICA 5JPNA 2VLJD 3UTTE 5KG9B 3C60B 1KJ2B 3K1DA 1VACB 4F3FB 1ZGLM 4GRWF 1EEUA 4D94A 3QQ3A 3CH8A 3GSNH 1LD9B 2DQCH 1VKXA 3DX8B 1JK8A 1U3HB 2GQHA 4PFEA 1AGFB 4Y1AD 1I3RB 1XF3B 3O41B 3DROB 4EUPH 4FXKB 1JWUA 3WD5H 1EXUB 4YDJB 2O5YH 3ES6B 3V4PL 3FZUC 3T2PA 2WLZA 2NY3C 2FATL 2ZSWA 1QRNE 2DDQL 3MOAL 5DLML 2XQBL 5IW1B 4PJ7F 4JJHA 5IV2A 4ZFGL 3I85A 4U6XA 2XWJA 4L29A 3DETD 3MV9A 1KIPA 1U8MB 2J5LB 2A6JA 5JDSB 1FNSL 5D1QC 1JZ6A 3IDGA 3MV7E 5JW4M 1HSBA 3E6FA 4B7LA 1HQ4B 3PIQA 2A6DA 3RZCD 3QISA 2UWEB 4NPYB 4AMKL 3LSOB 4KK8C 4LCIH 1NGZB 1BEYL 1KCSL 1WITA 2X4TA 5C1MB 1RFDH 3ZTJG 4XBGB 5ANMB 1S5HB 1CBVL 5FA3B 2BDNL 1TLKA 4X4YA 5BRZB 1S7XB 4XX1E 2YRZA 2YEZA 5CINL 1FV1A 4ZOEA 3VXUD 1IC4L 3ALXA 3TT3H 3BGMB 1CZ8H 1JZ2A 5T3XL 3W2DH 4ZO9A 5D9SB 2K9UA 4HZAA 3S9DB 1BIHA 4JFEA 3MMEB 2X4RB 3MXWH 3IDXL 3O6FB 5EZOH 4KVCH 4NZTL 1CIDA 4GMTL 3OR6A 3MOBL 4H25B 1RZKH 4R8WL 4LKXA 4IM8A 2ZJSH 5HHNB 5D1ZA 2XTJB 3F5WB 3MNWB 4YBLB 4XPHL 1I9RL 4M7ZB 1MIEL 1RUMH 3IFNH 3T0EB 3BP7A 5B38B 4JFPA 2MOVA 4HV8B 4NKIH 3JSSA 3V5DA 4LCUB 4ELMF 1RUPH 1N8ZA 3BPOB 3P4NB 5CJBA 3WEXB 1JWSA 3TJEL 4PGBA 4K23L 2R0WL 2ZG1A 3BJLA 1S7WB 5I71B 2B0SH 2P46B 1HIMH 4PPTA 4K94C 3TH3T 3U46B 4A6YB 4IOIB 5F3HB 4HT1H 2CDFA 2R0LH 1U8LB 1FJ1A 3QEGL 4WVRA 1BZ9A 5EBLA 3GEWB 3LKRA 4GKOA 4KQ4H 3F12B 3OB0H 1N0LA 4EVNB 1Y6MR 1Q0YL 4LLUB 2Z91A 2XFXA 4GRLB 2DM2A 2P47B 5LGHH 4QTHB 2I9TB 2XKSA 3BPLC 3FQRB 1DBBH 4RGNC 3AROA 4HG4J 2A6KB 4PY8J 1FAIL 1DQDL 1AGBB 1P69B 5F1OB 2K3TA 1T7XA 3L3DB 4UT7L 4HKJA 1YN7A 1KIQA 2QADC 3N1FC 2Z92A 3QXTA 4AQ1B 5C0FB 2QKIB 5FDWB 3S36X 4HUNB 1B4JH 4RSVA 4YFLI 3BZ4B 2HG5B 1HSAA 3R8BB 1QLRA 4JG1H 2DOCA 3PGDB 1CICA 1Q72H 2GK0B 4CMHB 3K2MC 2CIKB 4YPGA 4LLMB 2XY2A 1CGSH 3QEHB 4HZLB 1IBGL 5FYJL 4Z95L 3FN3A 5C0JA 5BZWB 1T6VN 4M6NH 3MR9A 4GBXB 4L4TD 2VN4A 3T1WA 2ZG3A 2BXZA 1C8PA 3OHXA 5D7IA 2EC9T 3EYUH 1JNNL 3MODH 5D72L 2CRMA 5EBGA 3OKNA 5IEKB 5CSGA 4UNVA 1VENA 5HYJB 4PGCA 1FL3B 1I1AC 4NQTA 3SCMD 3SGEH 5D7LB 5EOQH 1MREL 5DQDL 1YNLH 4D3CL 5J8OA 4YIQA 3C8DA 2FO4A 5IMMA 1G0DA 4KPHH 5JHDB 2ZUQC 3MV11 4HJJL 2YS4A 5JNYB 1F3DH 5DQ9A 4EI5C 4PJHE 3DX9B 5JORA 4Z7WF 3GSNL 1LE9B 4RDQF 3D2UB 4HJGB 1YC8A 3LN4B 4ZUWB 5C3TA 1RHHB 1YMMA 3DSFL 3G9VA 1DEEA 3QIWA 4XAKD 2XN9E 5TQ2H 2OR8A 1IGTA 3VRJB 2R9HC 3ARXA 1OD7A 4Z78A 1SEBB 1G7IA 5CKAA 4JKKA 1ZVSA 3WD5L 3VXOA 2YD5A 2O5YL 3MJ7B 2BOCA 1FZOB 2X4UB 4P2OB 3BVNB 3O11A 1OP3K 3VE0A 4G9DB 2LABA 1P7KA 5IQ9B 1G9NL 1T7ZA 2HH0H 1TVDA 3Q1SH 3VWJA 4PD4K 3BZEA 4HKXA 4NQCA 4X6CF 2LVCA 3G9AB 4WJ5B 3HZYB 4N8VA 5CZKA 3W9DB 2GFBA 3ARFC 4NNYB 5IB5A 4YHML 4R3SB 4UQ2A 3MRDA 4L5FL 4LCIL 4Z76A 3GSRA 1D5MA 1F2QA 3G5XB 1RFDL 4E42A 5CBAA 3GK8H 1MRFL 5HYIA 4QRPE 3U7WL 1TCRA 3UO1L 1I9IH 3ILPB 3VD4A 3W81A 4X7SH 2EEAA 5D1XB 1A6PA 2FNBA 3N1PC 1NCNA 5FYJU 3C6LB 5EBMB 3TT3L 4F9LC 4OLWH 3P11L 4M7JH 3W2DL 4P3WA 4XVJH 3RAJH 3RGVC 4G9FE 2NY4D 5I8EB 5B39A 3HNVH 1FG2A 4TVSa 4L9LC 4MNQB 3ZTJH 3BD3A 2HRLA 5E2JA 5I1AB 2ESVD 5L8JB 3SE8L 1FNHA 2VAJA 2ADGA 1KELL 5HGAA 1J0JA 2J8UF 4X6DB 4HJ0D 2OJZL 1RUML 2K7QA 1PGRB 3IFNL 3PABB 3OXRA 4HMCA 1T1WA 4X9GA 3UTSE 1NAMB 4Y19B 1ZT1A 3DMMA 4GAFB 5C9JB 2GUOA 4C58B 3BDBA 2PYFB 4U6YB 3SN6N 1ZWIA 3QG7H 4FFVC 4YXLH 3QULB 3RVXC 1HEZA 2B0SL 2OSLA 1W72B 1FO0B 1ZLUH 4LSPL 3UP1A 3D39E 3G5YA 3MRBB 3BIKA 4HT1L 3QDGD 2NZ9C 1T83C 3QIUA 2R0LL 2P7TA 4M61A 4LCWA 4Z7VA 3MLPA 4JPWH 4JRXB 1JN6B 1EJ6A 2OMNA 2A1WH 4KQ4L 2V7NB 2M1KA 3VD9A 2AQ3A 2AXJA 3PDOB 4M3JA 5LGHL 5KSAB 1QTYT 4R0LA 1NL0L 4P4KD 1UXSA 1VPOL 5JW4N 2Y06L 4YFEA 4LVOC 3VXRA 4M7KH 5F9JB 2BVQB 3W0WB 2I07B 1U8KB 4G8EB 2NY6C 4HH8A 5JW4Q 1NSNH 3X12B 5DMIH 3S96B 4DK3A 1GOHA 4KKAC 1O5DT 1QHPA 5ISZD 3EOYG 2LAAA 1OAUH 4RA3A 4OZGA 3QRFM 4OV5A 1SMOA 4HCRH 4TTDD 1FFNB 2HVJB 1NBVH 2ZPKL 2WUCH 3LH2L 1K8DB 1Q72L 2AEPH 1I8KA 2M8XA 1CGSL 1ERNA 1Q8MA 2EDXA 3MRHA 1MPAH 3HLAA 4JQXA 4JN1L 1RI8A 4M6NL 4M7LH 1FZJB 2GJ6E 3ARRA 1OARL 2X1OA 2WBJB 4QNPF 3GJEA 1PY9A 1A6VH 3EYUL 1ACYH 3MODL 3SGKC 5E2UL 3SQOH 4QRSA 5HXMA 3LN5A 5I73C 3RL1B 4ZSOA 4Z6AT 4FZEL 4XBEH 1LO0L 1CFVH 3THMH 3UTTA 3ARDD 3JUYA 3U2SA 1I8MA 3T8XA 2GHWB 1C1EL 5FYKD 4AENB 3BISA 3DIFA 4KPHL 4JJ5A 3DO7B 2XWTA 3BKCH 5J1SC 3QEQA 1RURH 1AD9B 3U6RA 2QQNL 3ZSTA 4MZ3A 3NCEB 3S4SG 3S36H 1RJLB 5E94A 2QLVB 5TQ2L 5I16B 3P73B 1EUTA 5BQ7A 1UB6B 4K2UH 2BZDA 4JPKH 4JQVA 1QRNA 1CFBA 4NP4L 1DQLL 1P2CB 5EC1B 2IMNA 3LDBC 3IKKA 2N7AA 2X4OB 1UH3A 4LHUB 5DJAB 2R0KH 1UKQA 2FIKA 4ESKA 1I8IB 2NCMA 3B9AA 1DVFB 2W60B 5SWQA 3BH8B 3PWPD 2Y6SC 4IRZL 4ZQKA 3ZYJA 2P5EB 5D93B 2A38A 2H1PL 4Q9RH 3K0WA 3DETC 1LNUA 5EZLB 3MV7A 1IGML 5HDLA 3CZFB 4OF7A 3BUTA 2IQ9H 3MJ8B 5EU4A 1E4XL 4MLIA 1ZLSL 3IRZA 4KKBD 4Y5VA 3NZ8B 2C3GA 3RZCC 2AJXH 1JP5A 4IIQA 2XNAA 32C2A 3LPWA 4LNRB 4KI5D 2D0FA 3GK8L 5DJ6A 4FQ2H 3STZB 1LDSA 1IAMA 3NAAL 3OXSA 5I8OL 1ZSDB 4E5XB 1KNOA 3KYOA 3KPLB 1TTUA 2X4QB 1BFVH 1OGAB 1OWRM 1C5BH 4RDQG 3SPVA 2G75A 3GHBH 5F97E 2DLIA 3AM8C 3IVKB 4OV6F 4X0KB 1EERB 1TENA 4OLWL 1A6UH 4XWGH 5IUSA 3RAJL 3BW9B 3EBAA 1OAYL 3SGDH 5F7DA 2DQDH 2JCCE 5LWYH 3HNVL 3HUJF 2ARJA 1XCQA 2HT3D 4KMLB 1M1SA 1N5YH 2E6QA 1NUFA 5C7XH 1MFAL 2YKLL 4TVPH 5EU6E 3QYCA 2XG5A 3A6CL 1JE6A 3S35X 3O9WB 2DWDB 3SJVE 3X13A 4JVPA 3CSBA 5M94B 4GQPH 4I2XB 3RDTA 1RIVH 4HGWB 3MUJA 4JY6A 4UOJA 5T3ZH 2XA3A 3K4DA 3MZGB 1UC6A 3OG4B 5H2BB 1LEIA 1RJYB 3MLWH 2GTZA 1B3JA 5I76B 1AY1H 3LMJH 4IRJB 4JDZA 5FKAB 5JO5B 2YRLA 3QG7L 4QHNB 5F96H 1IKNC 2WQRA 4HH9B 4YXLL 3P9WB 1BD2E 5T1MB 5ENWB 3ROLB 1KYOJ 3F7VB 1F58H 4Z0BH 4APQB 1ND0B 4Y5YC 2WV3A 4RBPH 4F37K 4FXGB 1QO3A 1S5IH 4QRUA 4DKEH 2ICWI 4I18B 4PUBH 2CLZA 3ARED 2AQ2A 1FBIL 1IGJA 1REIA 1JWMB 4JPWL 3K8LA 2DM7A 5DJ8B 3M45A 1LGVA 4LMQE 1XCTB 2Y72A 3QUXD 4M8QA 1KLUB 1T1ZB 4H1LA 4OB5L 4K94L 4D0CB 1J87A 2GIYA 5HGGS 1QG3A 4X5XA 4Y8DC 2DYPB 3GSNB 4K3HA 4XHJD 3F7YB 1T7VA 2NY7L 5INDB 3UTQA 4ZFFA 5DMIL 4WW1A 4BFIA 1KG0A 3C5ZD 5BVPH 3TA3A 1OAUL 4XT1C 4EUPB 1XT5A 3QJHA 4HMEA 4HCRL 3MGAA 1NBVL 3SE3A 4OZHF 2G5BA 5C0AD 4PJGE 4O9HH 3QHTC 5KN5A 4E0RA 5F7EH 4PJCB 5KSBE 5H35B 1WFOA 3V8OA 4L8SA 2DJ4A 2J8HA 3IYLW 3DVIA 4Y0GA 2JB5L 1HI6A 5TQ0H 5F6IC 4Z9KB 4F2MB 5E9DE 4Q6IB 5F7FA 1CE1H 4Z7OF 4XPTH 1CGWA 4G8GA 4MSWB 1UB5A 1MUJB 5BJTA 3HZKB 1ACYL 1X7QB 3SQOL 4ZG1A 1Q0XH 2N4IA 1BZ7A 1H8SA 2JKXA 3PL6D 3SCMC 1GGIH 3NA9L 3NFPB 1R5WB 3AMKA 2Y36H 3T0BA 2HRPL 3HAEA 4Q9BA 3ZE1E 2YK1H 4MX7B 1INQB 2VXQH 4BSWA 3RIAF 1YYLH 4PJFB 3NN8A 4F57H 4RGOH 2FEEI 2FDBP 2DM4A 4NN7C 1JF1B 4ZTOH 1RURL 1D3CA 4I3RH 3RNQB 4L8CA 5DO2C 2ATKB 1OSPH 2XN9A 4FQ1H 5F7YC 4TPRH 3MJ9A 3TIEA 2F19L 3CMGA 2ZUYA 4PREA 3S36L 4GW4B 2YA1A 3F7QA 3ULUF 4CW1B 3FFCB 3QUML 2YHGA 4D9RE 3CLFL 5HBBA 4JPKL 3UBXI 3SY0B 5T3XE 2WP3T 3WDHA 4K3DH 1XR8A 2R0KL 3QI9B 4FZ8H 2DQJH 1PZ5B 5C0BE 4WFHE 4KXZH 4K7PX 2EDBA 2BVPB 2ICWA 1YPZF 4U31A 1XF2B 4Q9RL 2NW3A 2ZCKH 3EYFA 1KCKA 3KLHD 1MHCB 3VA2C 2Z4QB 4UIKL 2IQ9L 1CLOH 3FB7A 4QGTA 1JPSH 3VFPA 1CDYA 4TUJB 1S9XB 1NAKH 3RKDC 4DFIA 5CLWA 4NGHH 4X6EB 5IB4B 4RCAA 2AJXL 3WKMH 3F62A 1A3LH 4RIRB 3B9KC 4FQ2L 5DC0A 4NO0D 2CDGB 4Q9CA 5JXED 5HI4D 4WY7H 2C3XA 1EFXB 3KYKL 4YHIA 1BFVL 3IF1A 1Q1JL 5E8EA 1RZGA 3GHBL 5I8KL 1WC7B 3QQ4A 5CIPA 4IMKA 4G9FA 3HC3H 5IM7B 3OKMA 2V7HA 1JHTA 2Y7QB 4PJ5E 2B2XH 4OCNC 3G6JE 2ID5A 4WWKD 4R26H 1LWRA 3LKPB 2DQDL 2NY4C 1K2DA 5FKPB 5LWYL 3QDAA 1J1OH 1N5YL 1ORSB 1MAKA 2NPLX 1PG7H 2X2YA 4JKMA 3V79C 3WIHH 5SX4I 3P0GB 1UM5L 1LEGA 4QHLB 2OTPA 2OR7A 4HJ0C 5D5MF 1G7QA 3QNZA 3ZHKA 5KVDH 4UT9H 2EH7L 4M93C 1RIVL 3OZ9L 2BSRB 2BSED 2FEDD 2X5PA 1HH6B 2HMID 4DVRL 3D6GA 4TQEH 3RJQB 1YEEH 3AXLA 3KLAB 5DK0B 4Q2ZA 2HLAB 3SDDC 4O02H 3V7AG 3LMJL 5EUOF 1Q94B 2NY0B 2X09A 2DQIH 5DI8B 1NMAL 5A43C 1QYGL 3D39A 2AJ3B 2HT4C 3JWNC 5HHPB 4JDTL 1GOFA 3C09B 3VXMB 5DZNA 5A3ID 3ABZA 5FYJE 3STLA 4Q58C 1MSPA 3ZDZF 1S5IL 4FQXA 5F7NC 3VGAB 2KQNA 4ELKB 4AK1A 3MBEB 4L1DA 3MRLB 5CILH 2DWEA 3WIIL 4F15B 3H9SB 1H0DA 5GRYA 3RGHA 3V0VB 5GGTH 3NZHL 2A6IA 3RTQD 2GSGB 1XF1A 4R2GB 4XPGH 1UZ6F 3CU1A 4P4KC 1T1XB 3UJIH 1UWGH 1UM4H 1IFHL 1OD9A 2R2CA 2HFTA 5I15H 5I66B 1M7DA 4YHOH 1RIUL 1U8HA 5BVPL 2CKBL 4WTZG 1GHFL 3HC4L 1Y6NR 4J8RA 3Q5YA 4CDHA 4D0BB 2ZUSA 3O4LD 4HFUH 1CVRA 4HHAA 4O9HL 5LAXB 3O8XA 1NGYB 5F7EL 2V2TA 1SBSH 5AUMA 2GJ6A 1M7IA 2DBLL 1KIRA 1NDGA 3PQYE 4YZFF 1UZ8B 4HS3B 1ZMYA 4GAYA 1A6WH 1EEZA 3QG6B 2AJYH 5MEQB 2AV1A 4F33A 1FL6B 1XGRA 1MCQA 3CVHB 2J8OA 5ICYB 5D71L 1Q0XL 3QDMB 1PFCA 5C70A 3ARQA 1WAAF 5GGSA 1UT9A 2W0FB 5DJZB 1M71A 1PQZB 3ZKXC 3U4EA 2Y36L 5C6PB 4XCNA 2ZOKB 3ARDC 4OIBA 2H45A 2YK1L 1IKFH 5F71A 1QFWL 3BYTA 1KTRL 3KPPA 2VXQL 4HC1A 1KPUA 2EYTA 2YOCA 1YYLL 2I26N 1KLFA 4WU7B 4F57L 4JHWH 4RGOL 5HDOA 3OGCA 4ZTOL 2R4RL 4I3RL 3UC0H 5DDHA 4UAOB 4C56D 2R0ZL 3D69A 1C12A 5CSZA 2K7PA 3OL2A 4GSDH 2BVOB 4FQ1L 3HRPA 3WIFB 1FVEB 4I4WB 2NR6C 3NFSH 4LMQI 3SKMA 4U7KA 1IQWL 1T7WA 2R2BA 4KRMB 2B1HH 4PJAF 2X1QA 2VDOH 4HJGA 5FHBL 1WTGT 5IB1B 4PJDB 2R4SH 3VI3F 3LV3A 3QAZC 3GMPB 2CIIB 5DHYA 1AGEB 3PV7A 2Y9RT 5E1AB 3OKEB 4OQTL 3I84A 3JWDC 1HOCA 4OZ4A 4PRBA 5CEZD 3V4VH 4LHJB 2P5WB 1CYGA 3GSQA 1CLZL 4PB0H 5DHVA 5IMOB 4NQDE 2ZCKL 4H8WC 4R7DB 4P5TD 1HHKB 1JL8A 3HI1B 3GSOA 1I1FA 5A2JH 4OKVB 5CEYB 3IDIB 1BM3H 1EFQA 5KSVA 2ICES 3GRWH 1QA9B 2BJMH 5IB3A 4NGHL 2LFGA 5I1LB 3QXUA 3U36B 5ACZA 3PWJB 3D48R 4WCYL 5F1IB 3ZE0E 6CGTA 1HDMA 5BOZG 5HY9B 5GRJL 2B39A 4RFOH 4G6JH 4I0KA 4TNWF 2CDEB 3PWLB 1PKQE 4WY7L 3G5XA 1NKRA 4ODWA 3BEVB 4HK0A 1F00I 4LP4A 4KMTL 4NYLB 3T0AA 3D0VB 1IM9B 4FQHA 2ZUUA 5DC9B 1IGIL 1MEXL 5TDOA 2HTKC 3B9EA 1CGXA 2JCCA 5CZVH 3V6OC 4XNXH 1YNKH 3DX7B 4RWHA 4M5YH 4R26L 5EU6A 3VH8G 4IOSD 4J4PD 4P2RB 4GLRI 2HT3C 1NEZB 4K7FB 4CVZA 3SJVA 1YMMD 3BT2H 4KQ3H 2AS5M 5ESAB 5FO7A 3F58L 3VFVA 3DRTB 5I9QC 3FRPA 1FFQA 4G80A 3VFSB 4K7PH 3GMQB 4HLJA 1A3RL 1CL7I 4UT9L 4DGYL 2ORBH 1NGWA 2R1XA 4TQEL 2KZWA 2C4FT 1BD2A 5J13B 2UZIH 1BVZA 1SEQH 1TTFA 2BCKA 3R06A 3TFKD 1A9EB 3NPSC 4WDIB 3QFJB 4O58L 1WISA 1I3UA 2GAZA 4U1HB 1EEQA 3REVB 1CFQA 2PO6B 4JG0H 4NSKA 2HVKB 1LO3H 2AERT 4Z5RB 5C08D 5GGQL 3EYVA 3KAAA 1J0KA 3AREC 5IJVB 1OB1A 5CWSB 2XZQH 5CILL 3G08A 4DGVL 4P23D 3LS5H 3QUXC 5GGTL 4JFQA 2DQFA 2CD0A 3QDJE 5IW6A 1N0XH 1TZHA 2QV2A 1JGUL 3ARGD 3DBXB 3OAYH 1SJEA 5IFJB 1UWGL 5C0GA 4NKQB 5GRWA 4LRNH 3VXQB 2JIXA 4PJHB 3OPZH 4XHJC 5ETUA 3S88H 3DYOA 3LEVL 5I15L 5GZOD 2FJFB 3RWCA 1HWGB 1E28A 1GZPA 4U6TA 3H3PH 5EO0B 3C5ZC 2VQ1B 3S35L 2VC2H 4PJGA 3DV6B 1F11B 1I7UA 4TRPH 4JCMA 3ZE2F 5CD3B 5KSBA 5DS8A 4PJ8A 3OJ2C 5IWLA 3G5ZB 2DMBA 4GKNA 4O2CA 2EO9A 4LHQB 2P8PA 5E9DA 1SBSL 2E6PA 5DJCA 4ZAKC 3OQ3B 1DQTA 5GS1C 2EYRA 1A6WL 3MRCB 5GS2H 4WUUE 5I1CH 1ZV5A 5KS9E 5GGRA 4KUZH 3K80A 2QSQA 4LVNB 2I9LA 3DURB 4YPJA 1WIOA 3PL6C 3JTSA 4XCFH 5I6XC 1BLNA 2DLFL 3FB5A 1A9BB 3CSYB 3MO1A 2UYLA 4U7SA 3WXWL 1IZJA 1VFAA 3RI5F 1CFSA 4QRPB 5HGBA 1UACH 3LQAC 1T21A 3L5JA 2YMXL 5JIIA 4PV8B 1YEJH 1J9CT 1WCBB 3TT1L 4M9PA 3UPRA 3NFSL 2PCPB 3VXRD 4GOSA 2I25N 5FEBA 4FQQB 2B1HL 3H9HB 3VG0L 4FTVB 3FO2B 4KK6D 5C0BA 3UTOA 4U2ZA 3H0TB 1HH9A 5JMOC 3SKNA 3MRQA 4HUMB 5B8CA 3H7BB 3ME0A 3BWAB 1DLHB 1OGTB 2YR3A 1T5WA 1NCAH 3OKLB 3V4VL 1Q9KA 4MJ5A 5EU5A 4XH2B 2R2HB 5GGUA 4X4XB 4JPIA 3ARBB 5HHVH 3MCKA 3KLHC 2WW8A 3UTSB 4I0PB 5C0CA 3UDWA 3MCLL 2N7BA 4YAQB 3JWDH 2I27N 2A73A 4GW5B 2YD4A 3BSZH 3MUHL 5CP7B 3TVMC 1DBKH 1RAMA 1X6LA 4P46B 4G6MH 1FZMA 5GZNC 4F7MB 4H8WH 3HCVB 5MENE 3L3OA 4G6JL 1T22A 5J0BA 4PGDA 4CVWA 4S11A 2CPCA 4KU1A 4X7CC 5DD3H 1UJ3B 3OJMB 5K9OA 4WWID 1SJXA 4NBYB 1G7LA 4CN6A 4K8RH 4NKDB 5DRNB 4LBEB 5GHWL 4RISL 1G6RH 1BVKB 2JJVA 3G6JA 4E5XA 2Q7YA 4XCEA 4P9ML 1V5JA 3VA6A 1U8JA 1UKSA 3QEQD 2APBA 3QCTL 3ESUF 1VESA 4M5YL 3DX6B 4WWKC 3M17A 2XYCA 4HIEB 1YY8A 3UBXB 3L9RB 3BT2L 1SYSB 5BS0E 2WINA 3DLQR 5C0RH 1YNTB 5DK2B 2QQQA 3QCUH 2IGFL 3QQNA 3CCHB 1MFBL 3SDCB 3WUWG 4K7PL 4JM2A 4OCXH 4NKOB 3MRNA 2FEDC 2IH1A 3RWEA 3ULUH 2HMIC 3MNZA 4P5MA 4R7NA 3EDKA 1BREA 5DTFA 4MAYC 4RGNE 5E03A 5F6HI 2JE8A 2UZIL 3HE6D 4MJIB 3C5JB 2UZYB 2A77L 1SEQL 3BP4A 4LK4A 4KC3B 1NGPH 4MS8C 4ZYKA 2V9QA 3HNSH 4RFNC 4UZGA 5FGBC 4JG0L 3KPMB 1LO3L 5A3IC 3D85D 3LRGA 3S7GA 4W6XB 4D8PA 3O45B 1R24B 1WBYA 4ZFOL 3IU4H 3AS3A 1JTPA 1ZKAA 1KXTB 3M1BA 1EMTH 3KPNB 3IB4A 1JPFA 1AKJD 1J1PH 1BQHA 3RTQC 2VL5A 5FECA 3OKKA 2FSEA 4LEXH 2IFGA 4KK9C 4OD3H 5C6WH 1FC1A 2IANB 2X4PB 3OF6A 4LRNL 4CUCA 2BK8A 1MIMH 5HI3D 4XCYB 5CHNA 1TVHB 5ILTH 4QHKJ 2C3HA 3H3PL 1MVUB 1A4JA 4QRQB 2VC2L 5DGRA 2RJMA 2YSSA 5JLZA 1CN4A 4JFZH 3ROOB 4F7PA 1MNUH 4YDVA 4GMSH 4UILL 4G7VH 5E2WH 3NGBC 3CUPB 1IQDB 3PQYA 1MWAB 4AEHH 2JJSA 4NQEE 4QOKA 3BO8A 5AYUL 4QCIA 4BKLB 1F2XK 1LP9E 2D31B 4WFFD 2UY6A 5FM5O 5CJXC 5IVXF 3LVEA 3TESA 3LDBB 2C4XA 2I24N 1CT8A 2UUDH 4KUZL 3H2WA 4P59L 1U8PB 4GG6F 3HMWH 3FFDB 2QSCH 4K71C 2BNRE 1QACA 1AXSB 5EZIH 4KVNH 1KJVB 3GMLA 1G7JA 5GS3A 2HKHH 2BRQA 4EZMA 4G42B 2C1OB 1MQ8A 4XWOC 4LCYA 4EDWL 3CFCL 1AGDB 1IM3B 1UACL 2QHLA 4HBCH 3AMLA 3CFJB 3SBWC 3IDYC 1YEJL 1YJDH 1ONQB 1FIGH 1S7VA 4JR9H 1S7RA 2Z35B 2VLRB 4P3DB 3A0OA 4HUWA 1OAXL 3I2CL 1TZGH 8FABA 2Z8WC 1WK0A 3KPRD 1KENH 1II4E 3LQAH 5FK9B 1R3JA 3VW3H 3HG1D 4JREC 5D96C 4GO6B 2VL4A 1TXKA 3FO9B 3FQXB 3WXVH 4PB9H 4P0DA 4PGJA 4W70A 1AQKH 2MMXA 1JGDB 2EKSB 1JNLH 1VADA 3MROB 2OXGA 2OXHA 2H32A 1MCOL 5SWZB 1Z9LA 3SHSA 2A0LC 4G7YH 3L5HA 1BFOB 1J0HA 3U1SH 4DZ8A 1DBJH 1NCAL 4XXCA 1G9MH 3DOSA 3JUZA 1N7MH 3VXSE 3FQWB 3O2DH 4P5TC 2EE3A 1AHWB 1ZA6B 2A9NL 4GRWE 4CADB 2FWOA 4NO2B 5H94B 1WIPA 1LO2H 3VU2A 4G8GD 1AGCB 3JWDL 4NRYB 3WL9B 4W4OA 5IBTL 2PTUA 1AR2A 3WFEH 1PKQA 4WHTA 4G6ML 4H8WL 3BZFA 3PWNA 1BBJA 3ZDXF 3QUYA 2X6MA 4U1IB 4CVXB 4NQVB 1K4DA 2JK5B 4KROB 5DD3L 3V6BR 3RU8H 5EUKB 4XGZA 3W11D 1P6AB 3HE7A 4LPCA 5JHLH 1QFOA 4HUUA 2H2SD 5DJDB 1G6RL 3D0LB 2YA2A 4PJ7E 3I75B 4BH8B 3MV8B 3RWIA 5C0EA 1R5VB 2FGWL 5CFHA 15C8L 4MQ7B 4DFHA 3FCTB 2W91A 5CJOH 1E4XI 2E7CA 4J4PC 3C60D 4S1QH 3TO2A 3B2VL 2VXTH 3FN0H 3IETB 1GGCL 5DRZB 3DUSB 3O3DB 4U1SB 3QCUL 5EPMB 5TF1H 3F8UB 1U3HD 1UCBH 4OCXL 5SWSB 2E9WA 1CXFA 3QZWA 4KKLC 4OBSA 3TO4B 3T77A 3U4BL 3ULUL 4JFFE 5ALBH 5A2LH 4HX1A 3K8MA 3VWKA 1D5XB 1YMHA 1AR1C 4FRWA 1CG9B 4ORZC 3RVWD 1YEIH 1R5IB 3TFKC 2AI0H 2Q6WB 4XRCB 4KUCD 5KSUA 3SE4C 2X9XA 1WFTA 5HHOB 2CK0H 4POYA 4XAWH 5MERA 3ZKMD 5E5UB 5KZCB 3IU4L 3QDJA 1EVUA 1EMTL 1JZ3A 3DVNB 4ZUSB 1FVDB 1Z9SA 2F53A 5EN2A 5E6IA 4B5EA 3JV6B 5GGSY 3TWCL 3TYFA 3ZZ1A 1KT2B 4PTTA 3DXAB 4PD4J 3Q2CA 1DR9A 1HXMB 3ARGC 3RIFK 3LQZB 4WV1C 4LEXL 4U1NA 4ELME 3R1GL 2VZOA 2GSGA 5BXFB 4JDVB 5IJKC 1WEJH 2DD8H 4PJIF 3HPJA 3F6LA 4F7EB 5F9WC 2H3NB 4PS4H 4QT5B 3D3VE 3OSKA 1DFBL 1MI5E 5IHBA 4JFZL 3N06B 3ULVE 1MNUL 3O6FD 1E4KC 1CDGA 1LK2A 2IG2H 1T3FA 4G7VL 5E2WL 2E9JA 5IESH 2GTWB 4AEHL 3MRIB 1BVLB 2VLJE 4JAMA 4Y16B 5I75C 2APTA 5TDPB 5EIIB 2CRIA 4WUUA 5IMKA 5KS9A 5D6CA 5DJ0B 2DF3A 1W0VB 2VLMD 3P9LB 2XPGB 1F6LL 5EO9B 4HQQH 1ES0B 3KDMA 3HMWL 3TCLB 1VEOA 3O3EA 4Y1AE 4EIGB 3P77B 1WZLA 3UJTH 3WFDL 3MLTB 4B53A 1YECH 1S3KH 4JZJB 4F9PC 5ITFA 1T03H 43CAB 4KVNL 2O5XL 1F45A 3QRGH 3ELAT 2YRPA 2OL3L 4M3KB 3MX0A 1L7TL 5D1QA 1AFVH 1P53A 1I7TB 4H20H 1MELA 3QO1A 1FIGL 1K85A 1FAKT 3BE1L 4TOYL 4OJFH 4DZBA 3K1KC 5T33H 4KZEH 4AG4H 4OLVH 4PJ5B 1KENL 4I4WA 4JZNA 2RCSH 3B2UD 3LQAL 5D2NB 4JM4L 1EZVY 4KK6C 1E6OL 1YUHA 3WXVL 1C16A 3IFOA 1NGXA 2D7MA 1AQKL 5JMRA 1X3DA 4UBDD 2UVFA 1OPGL 2AJZB 1XF4B 4PP2A 3VXNA 2H41A 3PDGA 4I0CC 1FFPB 1DBJL 3PV6B 5F3BA 2VZVA 2Q86B 3VXUE 5JIPA 4U0RC 1P9MC 1N7ML 2DQTH 4ETQA 4MNHA 1B0RA 3GSWA 4Z7WE 1BP3B 4KUCF 3SO3B 4NZRL 1LO2L 1N5AA 4R7DA 5AZEH 3WFEL 5DK3A 2EC9U 3C2AH 3DV4A 4GBXD 2FECI 1ZGLB 1FGVH 1AD0A 1X4YA 4K3EH 3E6HA 3VRIA 3QNYA 1WFNA 2IBZY 4HKBA 3JWOC 5IEHB 2Q1EA 2ZCHH 5HYJD 1L0QA 5SX5H 1ZANH 3VFRB 2IAMB 4N5ED 2FHCA 5JHLL 2OK0L 2EO1A 4BZ2L 5D7LD 1LK3H 1FL5A 2PXYB 5HI5D 4C59B 3I6KB 4IS6A 1HHGA 5AEAA 3T4AB 5ESVA 4OI7A 5TF0A 5BS0A 5JHDD 1V3KA 4GXUM 2KBGA 4X6CE 4BH7B 1CU4L 2DMCA 5HGHB 1DJSA 5HGDB 1S7QB 2VXTL 3FN0L 1JBJA 2YD3A 4LCCB 2ADJA 3BESR 3QWRD 5JOPD 3KPOA 1N4XL 3ZT5A 1I7RB 5TF1L 4ZDHB 5T1KB 3WSQH 3PP3K 1IAKB 2OR9H 2Y23A 3GIVB 3L7EB 4QYOA 1T5XA 5J6HA 1HHJB 1N64H 1ZT7A 1KPRA 4HCRA 4LLWA 4WNQB 1XIWB 1UXWA 4ODTL 4X7TA 1GCFA 1AIFA 3HE6C 3JTTA 1VGKB 1YEIL 4LSSL 3BRDA 3WFHB 4P2OD 4UT6H 2LU4A 5FF6A 3GZKA 2VQTA 3P4MA 3T65B 4JFHD 1MHPH 4LAJH 5KW9L 4S2SB 2OTWB 3IJSB 2C3WA 2N1KA 4N1EA 4XAWL 2XTLA 4LLQA 2XOTA 4P49A 2J8UE 5TGBA 3N9GH 2W0KA 1GH7A 1UFUA 1SM3L 1SJVA 4WW2B 5DEFA 4L4TE 3EJZD 1R3HA 1I1AA 3QUZB 1WEJL 2DD8L 3C6LD 4F8QA 5L88H 5DRWB 1R0AL 4PS4L 2H6PB 5CMAB 1KJMB 1KIUA 4NZJA 2P44B 5KJRH 2DL2A 2PW1B 3UTZA 5J6GA 4NQEA 5I1EL 5I8CA 3D5OF 2IG2L 5BMFH 2ICEA 3QUMA 4EI5A 4NZDA 3I6GB 2W0LA 5ID1A 5DJXB 3VFOB 2B5IB 2UV3A 4FQCH 1T4KB 4HULB 1DQQB 2YC1A 4KJYB 3W5NA 1CTNA 4MD0B 4GQ9H 2ERJB 4Z0XA 2EDRA 3QAZB 2WUBH 1J8KA 4NO5B 1MCBA 4LFHD 2FLRT 3MYJB 3KNBB 3SKJL 7FABL 3MRCA 1RUKL 4P5KB 4XAKE 3NTCL 4UUJB 3PDDA 4R96A 4R4ND 3JV4B 2R23A 3CFEA 1EEYA 5C0IA 4PJXE 5HYFA 5F88B 3ZKND 3QRGL 4LRIC 3TBYB 1J05B 4Z7UE 2OJEB 4XTRD 3RWJA 4WI9A 1FNGB 1AQDA 5FOBA 1IGCH 1AFVL 4U1KA 3TZVB 4JLRB 4ONHB 4NUJB 5IG7A 3R0MA 3UROR 5I30H 3ARFA 4KWUA 1X5HA 3QA3A 2QL1A 3T09A 4F7TB 5C0DB 4OJFL 5T33L 4UMGA 5CJ5A 5KSAD 3V9FA 4OLVL 3W9EB 1OAZH 3MXVH 4QY8A 1ZLWH 4XNQB 3HZVB 2HKFH 2Y07H 3MLYL 2JB6A 4JN2B 1LEKA 4PRIB 2VABA 3W0WD 5E5RB 5K33A 2Q76A 1QFWI 4YDLB 3EO9H 3FQTB 1H5BB 4LKCA 3KYNA 3VXSA 1JNHA 4F9LA 4WO4B 4PJ8D 4Y8AA 1QSZA 3RGVA 1HQRA 4GW1A 5LXGH 3VDCA 1C5DB 3S3PA 4L9LA 4MXQC 3VH8B 5I9QB 2FH8A 3LY6A 3U79A 2AXGA 3TN0B 1DQJA 2NNAB 3BPCA 3S34H 3C2AL 2ESVE 3GB7B 3HMXL 4K3JL 2NTSP 2WBJD 2VIRB 4WU5A 4DKDC 4YHKL 1GGBH 1ZA3B 4N9GB 1U58A 3M8OL 4XP9H 1K5NA 3NPSB 1G7PB 5EBWB 4PJ7A 1R3KA 2YPVH 1ZANL 4ZUVB 3W11C 1WWWX 1OM3H 2R1YB 3TV3H 4Z77A 3LKSB 2H2SC 2IALB 3NIDE 4ORGB 1N6QH 5CUSH 5ADOL 3IXTA 3QPQD 4YUEH 1GYAA 5TE4H 1Y18B 2G5RA 3JWOH 1BQSA 1A5FH 1B0GB 3C60C 3CFDA 1T83A 3VGEA 2AGJH 3FB8B 1YY9D 2V17H 3QDGE 3T4YA 1U3HC 2BFVL 3WSQL 4ODXA 4M5ZH 4NN6B 1FVCB 4JFFA 2BVYA 3L6FB 4ZFZB 3GUTB 4HUVA 2YD8A 1JZ8A 2IF7A 2CKBA 4QHUB 5I18H 3QXDA 1H3TA 1JHLL 4S1RL 3JV5A 5K59F 3K4AA 3OR7B 4X6DF 1CTOA 4NOFA 2EZ0C 1ZHKB 1X5ZA 2XKNB 4LHUD 1VDGA 3RVWC 5B3JF 2IPKB 3U9UA 5DJ2A 1FYTA 2KUTA 1R6VA 4AEIH 2OMBA 2P5ED 3O3BA 5C0CD 2AXFB 3HUJE 1I4FB 1IEBB 1DUYA 3CVIL 5ISZE 3NCCB 2J5LC 2QSVA 3OX8B 4JB9H 4KKCD 3RY5A 5FUOH 4ZAKB 3ZKMC 2EDHA 4X98A 1MCKA 3AB0B 5FA4B 5I1DB 3HTLX 1MRDL 5L2KB 4U3CA 4NNPH 1Q9OA 4YO0A 3N9GL 4HGMA 2MFNA 4ELMA 4WTXA 4JQIH 1WBZB 4I77H 4U33A 3ZMRA 1PVHA 3V7MA 1S9VA 3WBDA 2VDRH 3IDMA 4LL9A 1Q9WA 5AD0B 1ZGLP 1LO5A 5GIRB 3HPLA 1OGAD 3PXJA 4KI1A 3D3VA 4LEOB 3UPAA 5AWNH 1DSFH 2VE6B 2IADA 1MI5A 2G2RA 5L88L 2FX9H 3N1QC 4AM0A 5CEXB 3EDEA 1CI5A 4Y2DB 1TIUA 1T66D 3V0WL 1H3PH 2XXCB 5KJRL 4X5WA 3I3DA 3N0PB 2VLJA 3WO3B 2E7BA 5FYKE 5HD8C 4GUPB 4A2MA 5IBLD 5DMJB 3U0TA 1UEYA 4KAQL 4PG9A 1PY4A 4MD4A 4R97B 1AI1H 3O9WD 2XTJC 4OGYL 4YBLC 4M7ZC 4OQTA 5I2IA 3T0EC 3RVVD 2WUBL 3OAZK 4M1DL 1T0NA 4Y1AA 4N0FB 2XICA 1BOGB 1T89C 3S4SA 4Y4HB 5FYJD 5K9JH 3F7PC 5IROC 2PR4H 2IQAA 2LAGB 3BPOC 4IRJD 4UB0L 1M05A 1TETH 2VISA 3MFFA 3VI4F 2RIKA 5IGXL 2AK4B 5DMKA 4LLVA 3MGTB 5I71C 5IB2B 4OZHE 5EWIH 1YEDB 3U83A 1H3XA 4OFPA 5MENB 3PWPE 3KYMB 2ADFL 3V6FA 4MXVF 3WO4B 1A1NB 4YGVA 5EZJA 3MUGB 1OHQA 2GEEA 3RZCA 3RX7A 4QF1A 5J12B 2C7UB 4GRLC 5FCUH 2WIIB 3OF6D 4NT6B 1OAZL 1OLZA 3MXVL 4MWFA 4HAGA 2DYPD 3VFWB 1IC1A 3BUYA 3Q6FA 4WGWB 1MF2L 3VXUA 1I7ZB 3IRPX 3AM8A 5AAMA 4YNYA 1WUNT 4Q97A 3EOTH 1XEDA 4MDJA 1S7TB 2BNUB 3C6SA 1LE5B 2BSTB 4Z7WA 5IMLA 1EJOH 1A1MB 1H9VA 3PJSA 4QOKD 1KTKE 1MOEA 3EZ8A 4X6FA 3V6OE 4X4ME 2D9QB 4CMHC 1U6AL 2HLFC 1XZ0B 4UU9A 5L7XL 3NACH 4HD9A 5BZDB 4HWBL 4GBXC 5E7BA 1RK0B 4MAYB 3RHWF 2ICWJ 4P99A 3CPLB 4XP9L 4HUXA 4M00A 3EDFA 1QVOA 3LKQB 3VCLB 3MYZA 4NQUA 1NFDB 2YPVL 4CN1A 5IHZB 5BO1H 1KC5H 4N5EC 5FGRA 3OJVC 3TNNA 3TBVA 1RD6A 1YEGH 1N6QL 4X6CA 5CUSL 1IKNA 3BIBX 5HI5C 5FV1L 4OLYH 4RWYL 5TE4L 2CLVA 5FCSH 2R2EA 4POUB 1QFHA 5GGTA 3JWOL 5DHXB 4Y5YA 2G9HA 35C8H 5HVGB 1MFCL 4U6HA 4Y5XB 1JRHH 1HINL 4HFWB 4Y4KC 2OQJA 1RZ8B 5SV4A 1IGYA 1FZKA 1JMXA 2IH3B 2EDQA 4IMLB 5C6TL 1QLFA 1TZIA 1WT5C 3INUH 2GJZA 3FFCD 1ETZB 1IT9L 4HXBH 2NW2A 5I18L 2G60H 5EOCJ 4RNRB 1A6ZB 2MNUA 1DDHA 2DIBA 3HA0A 3QO0A 4AIZA 5CAYB 3DTXB 2DQEH 1V3JA 3QI9D 1F42A 1U95B 3REWA 3CMOH 4PGEA 2VZSA 4P2OC 3EFFB 2EECA 4MA7L 2P8MB 5C8JA 1LP9B 4ZS6D 3MUY1 1D5XA 4AEIL 4S1DD 1EHAA 3O4OB 2AEQL 1DUZA 2J8UA 3GSUB 3KPQB 4P2YA 4FFZH 2HJLB 1NC2A 3WHXB 1K8IA 4BUGA 5C0AE 2BNRB 3FQUB 5EC2B 4L4VB 1HHHA 1TQCB 5EOTA 4XMPH 1AJ7H 5D5ME 4OM0H 1F4XL 3F6IA 4L4TA 3SDAC 43C9A 5IKCA 3HR6A 4JQIL 3VFUA 1UH2A 1TJHH 1B9ZA 4ZPVA 3L3KA 3EJZC 4NNXA 4ZXBB 1NLDH 2D2OA 1S78D 1EFXD 5F72S 3IGAB 5D1XC 5EUOE 1KULA 2XIDA 5KVGL 3U30B 3SCMA 2FL5A 1DSFL 2F74A 2GJJA 2X70A 4J6RL 5D6DC 5DD6B 3C6LC 2FX9L 3RVTD 4BQ8A 2FX7L 4FMKA 4OZFA 3C08H 4EXPX 5C86A 2WK2A 3HS0A 4YC2B 4ALAL 4HIXL 3DVGB 4PRPA 4QXTB 3ZDZE 4Z7NF 4D9LH 3GIZH 4JANB 4N5UA 5EO1B 4MA1B 4EJ1C 5DEGA 5L2JA 5F21B 4JFXA 2E7LC 3H6JA 3V0AC 1NBQA 3BHBA 3C8KA 4LSTH 2GY7B 1UZ6E 3HR5A 5D7SL 3VWKD 3BXNA 4JEGB 4DVBA 4PJCF 3X17A 4PJXA 1A7OL 4RAUB 1F4YL 1VCAA 2FYYA 4L3AA 1MHHA 2OZ4L 5F89B 1E27B 4PLJD 1FDLH 4R4NC 2NY0D 1MJ8L 1HILB 2VDQL 3GMOA 4CL7A 2XZCH 1TETL 4JY4B 3IJYA 3NOIA 5F70A 5I17A 2ADIB 4UOW0 3ZKNC 4RFEA 5L0QC 1T2XA 5JTWA 1XGQA 4MHHG 5IIEA 5KAQF 4XTRC 3GDBA 4P57B 4QRRB 5MEPB 4MA8H 1NPUA 1FFOB 5IQ7H 1L7IH 4AYFA 4IDLA 2F53D 4YZFE 1XGUB 4WGVB 5EB9A 3SDXE 4PJFF 3H9SD 4NDMA 3X3GH 4A2LA 4HWZB 2VB5A 1KLGB 2H8PB 5FCUL 3O6KL 5KSAC 4R4BA 4QGYA 4JRYA 3B9KA 3AFLA 4R2GD 4XPAH 2WNGA 1NCBL 1RZFH 1RULH 2E7HA 4YFLF 1QHOA 3KJ6H 4BJLA 1GSMA 4PV9A 3L3HA 4XC1H 1WBXB 4HDIB 4XNYH 1GAFH 2BP3A 4GKSA 3CGTA 3EOTL 3CXDH 4DTGH 2ILLA 2VLKB 1F8TH 2X7LA 1T0PB 3FL7A 4KTEH 5TDNA 2AV7B 2RR3A 3BN9C 2VAAB 3BH9A 3A6OA 2ESVA 4OUUA 4WFGD 3HI6L 2FZ3B 4QTIH 3UX9B 4U1JA 1A3QA 2R1WB 4PJAE 1J8HA 5HVFB 3BEWA 3U0WH 3PHOB 4ISVB 2WBJC 1OQXA 3FZUD 1IRAY 2EDYA 5E5MA 1F4WL 3GI8H 5LGKA 4YBHA 1I1YB 3QDMD 1VGEH 4AEEA 1BPVA 1KPVB 1NJ9A 4R90H 3SDDA 1KC5L 3ZHLA 4XVSL 4LIQH 3G6AB 1Z5LB 4J1UB 1YEGL 4ZFOA 1DBAH 2IFFH 3IU3A 1A7PL 3QPQC 3WE6B 5ITBL 5D1QD 4OFKA 1WWCA 3RP1A 1N59B 5KTEL 3O6ML 4GS7B 3MLUL 3QDGA 2VXSH 3MNVB 1JRHL 3BKJL 1VFMA 1YY9C 4JO3H 1ZK9A 3IFPA 4FFWC 3UEZA 5GISH 1RMFL 4DAGL 5E8NB 3PF2A 3INUL 3U9PH 2DIAA 3P4OA 4P4KA 3DGGA 3S5LA 1KJ2L 3VRLF 5GXBB 5T1KA 5GSVB 5EULV 2CLRA 3QT2A 5DJYB 3EDDA 5C07B 3GBLA 2DQEL 3P0VH 4PRAB 2D9CA 3TBWA 4NC2B 1DVFC 3HUJA 3CMOL 2PTTA 2HJFA 1O7VA 4RQQB 5ISZA 3MRFB 2P5WD 5D93C 5DWUL 2LE9A 4N8CH 2CJUH 4X7DC 5A16B 3T1FA 1GGYA 3MC0A 4FFZL 3O4LE 2ZOLA 3EOBA 4N8PA 3EYSH 1KCRL 4OM0L 3AVEA 2V9TA 1JZ7A 1F02I 1NCCH 4O2EA 4ZOAA 1TJHL 2VTFA 4BK5A 2CK2A 2WWMD 5EA0H 4XBPB 3B3IB 1A14L 1ZS8A 2EH8H 1CIUA 2PF6A 3B6SB 3T2QA 3HRZB 4WUKH 1A0QL 5BS0D 1IM9D 4LGPB 2EXWC 3C08L 3ARDA 3BJ91 3EYQC 3O3AB 1T66C 3OAUL 1XGYL 5ABDE 4P2RD 1R3LB 1NBZB 5IBLC 4AH2A 1UADC 2NY2B 3TBSB 4RX4A 4WI7A 3RWGB 5H37G 3O9WC 4CU7A 4LSTL 4C56E 1GIGH 4JY5H 2XA8L 2YXFA 2DI8A 5KVMC 3UZEA 1VFBA 5BV7C 1QSFB 5I1GL 3FAWA 3EO0B 4IRJC 1FDLL 1A8JH 1MH5A 2XZCL 4OZHA 3FT4B 4V2BA 5JW5B 4OLEA 3QFJD 4JRWA 3PWPA 4PY8I 4XB7A 3CK0H 1NAMH 5CS7A 3ZE2E 4APQC 5IVXB 5CEZE 3FONA 1MFEL 1J12A 4GG6B 4GXVL 4I18C 1J05A 2BSSA 3P9MB 1DE4B 1EV2E 3V5KA 3MLSH 3NH7H 4HGKC 4MAUH 3AS2A 4HS6A 3X3GL 1G6RA 5BVJB 1F4HA 1FO0H 1KEMH 2H26A 4A6YL 5D7IE 2VDMH 4HLZG 1ZT4B 3WDJA 5C9KA 1FGNH 1UQSA 2ZKHL 3OJDB 5E6YA 3V5HA 5AG9A 4W6WB 3WS3A 1JUFB 2OBGA 5FOJA 1RZFL 1RULL 5K9KA 3TNMB 3KJ6L 3W9EA 1J1XL 2GITA 1AXTH 1OAQH 1KCVH 4OZIB 1GAFL 2CXGA 4PJDF 1QBLH 3CXDL 1IAIH 4EI5D 3V6OA 4X4MA 5E99H 4ZUTB 4PRNA 4UIMB 4KGLA 1Q9LA 3AU1B 3Q3GA 3EJJX 3IDJA 1HCFX 1NC4A 5J11B 2HAZA 3WJJC 4N0UB 2BY1A 1WZMA 4H5SA 4QTIL 1SHMA 5F1NB 3IXAB 4FA8A 4JFDB 5TPWH 1A6AA 4LPTA 3IJHA 4Q6IC 4WI4A 5IK3B 3ARPA 3ILQD 3U0WL 3GNMH 4M43L 3DRQB 3WNOA 3EOAA 4OT1H 4L1HA 4LU5L 3IAQA 3KPSE 3UTPD 1YPZA 4XP1H 4N8VG 5CBEA 4R90L 3WLBA 5GJTH 4Y7MA 1M4KA 4DOHB 3VWJC 1QNZL 2IFFL 3QWOA 1E4WH 3NIGF 4OAWA 4YXHH 1A6TB 1ZE3C 3R4DA 1D5BA 4U2YA 2ZUXA 1RZIA 4ODUA 3MQIA 2ARWA 5HDBE 3FB6B 5DGQA 1A02N 3PWUB 5L9DL 2FJGB 1X5IA 1S7UB 3RL2A 1P1ZB 5DD1H 3AREA 1SVCP 4GKZB 1QEWB 5C08E 3ARYA 1FG9C 4M8VA 4NRXB 1FRGH 4Y4FB 3QUXA 3VD7A 4NHUB 1U8IB 4L8DA 3QIBB 1TCMA 4DCQA 3C8HA 3WFBL 1HWHB 1P7QB 4LAQH 2ITCA 5B39G 1Z2KA 2J6EL 5HYQA 4X99A 1RZKC 1HKFA 4TVPD 1BMGA 3MREB 4XP6L 3BRGC 4TUKL 4RZCB 1CVSC 4XC3H 3C5ZA 3C9NA 2WBWB 4ZS6C 1IMHC 4J3VA 5T3ZD 4S1DC 3MA9H 1BIIB 3H3BC 2CJUL 1AE6H 1NBYB 3FQNA 4Q0XH 3VJ6A 2RB8A 4OF6A 5D5MA 4R4FL 3N1GC 1K9TA 3MRGB 1DEDA 1ZHLB 2V9RA 3QSKB 3KWWB 4P46D 5GS1A 3CC5A 5EUOA 4OCSL 3MJ6A 4Z7UB 3SE9H 2OL3A 4HWEH 2EH8L 4HKZA 3PL6A 4PJ9B 1SQ2N 4E41B 4WUKL 2EYSB 2BMKA 3RVTC 4UDUA 1OP5K 2FJHB 1OP3H 1CFNA 2C1PA 4PJHF 5F1SA 4RRPA 4NKMA 4AL8L 5DQJB 5J1AB 3QJFA 5ESQA 4ZD3L 1CLYH 4HIHA 3X11B 3FRUA 1JFQH 4JFFD 1RUQH 2GSIA 5JDJA 2HN7B 2HJKA 4NQXA 1C5CH 1MCJA 3SOBH 3CH1A 4JY5L 3BP5B 2X4NB 1CFTB 2X41A 3PWVB 3C5SA 4XP4L 5E8PA 1FN4B 2EDJA 1U93A 3BMWA 4NJ9L 2OYPA 3VXRE 4PTUB 2F54B 4V1DB 1FYTD 2WBKA 2OLDA 3S98A 4DN3H 5GGVY 3MLVH 3FOLA 4MJID 4PLJC 2Q8BH 3FHQA 2NY0C 1S9WA 4RAVA 2AJSH 4MCZB 4QRTB 3CK0L 1NAML 4MCYA 4QHMB 5H37H 2YPLB 2R8SL 3C09C 2FD6L 5BV7H 2SEBB 3SDXA 1NFIA 5IF0B 1XH3A 3EHBD 3BGFB 2DBJA 4KKNA 1OT2A 3MRKA 1CD1B 1U2HA 4UV4L 1PLGH 3VGAC 4EBQL 3TPUA 5HVHB 3MBEC 3KLDA 5IR1B 1CXLA 4F15C 3TVMA 4XNMB 4JO1H 1DN0B 1WAAA 3ZT6A 1FO0L 3QFDB 2HFFB 2YD7A 4R2GC 2BC4B 5IVZB 2COQA 4NO0A 2P24A 5JXEA 1UWXK 2EDTA 3VXPB 2IAND 4ZPTB 2KH2B 5I0ZA 5C09B 2CMRH 1Y0LA 4CVUA 4HIJB 1RK1A 3NFNA 1AXTL 1OAQL 1D5ZA 1KCVL 2AABH 4LSRH 1WZ1H 1C08B 2D7TH 1Q38A 3LKOB 4WHCA 3GSXA 5F9DC 1A1OB 2AAVA 3QUKA 4WWKA 1UYWL 2Z31B 5HHQB 1FE8H 2BNQA 3QEQE 3UJJL 4ODVH 1JGEA 4HLZH 2DQGH 1XGTA 4NBXB 4PJAA 1ZHBA 1XGPB 4XNZB 2H9GA 2CUIA 3GBMH 5TPWL 4P2QB 3U48A 2X9WA 4XP5H 4RA0C 3GNML 4XNUH 1KJ3H 5DVKA 3FT2A 3DGCR 5DYOB 1SYVB 4XP1L 4YHNB 3WUWA 1MFDH 4MAYA 2Y6SD 3DHMA 1D9KB 4H26A 1K6QH 4ZS7H 3VFMB 1E4WL 1UVQA 1KTDA 4UDTB 4MNGE 4YXHL 2AJVH 2VXUH 5FGBA 2OCFD 1EVTC 4PIRF 1IEAB 2BERA 4AT6A 4OD2B 2V2WA 1X4ZA 2VDKH 4UAOC 5E6ZA 2W65A 2D7PA 3AAZA 4KTDL 2VLRD 1JNJA 4XPBH 2GCYA 3TLRA 3ZDXE 4KRPB 4PJBB 1ODAA 3ECBB 3RTQA 1LO4L 3LRSA 4I48B 4YHZL 4LAQL 1SBBA 2IEPA 3JBG7 1U8OB 4R9HA 3BP6B 3LHPL 1F6FB 4ZODA 1OOAA 4N0RA 4PLKD 4KJPD 3P30L 5SWZD 1RSFA 1H15A 4PLNC 3TBTB 1L6XA 1CD0A 4FFYH 4ACPA 2AKRB 5KOMC 4GAJH 2C3VB 4S10A 1JGVL 3PGFL 3DUUB 4TSBH 1TJGH 4YHPB 3O4LA 2E8ZA 5DUBA 4Q0XL 1DCLA 2OP4L 3MA7A 4F8TA 3EGSA 1RZ7L 3BQUB 2CR3A 5LG1A 2QJDA 2J4WH 1XR9B 3HZMA 4EN3B 1X5KA 1FNEB 2R69H 4XMLL 3LEXA 2OTUA 3FOMB 5CJXA 2NY5C 2BVUA 2X42A 1T04A 2N56A 1N2RB 3MRPA 4O51A 2ZUTA 4WFFE 2Y5TB 2WWMC 3ZYZA 2VH5H 4KROD 5E1HB 2RQ8A 2H2PC 4GAGH 3RNKB 2GKIA 4EKXA 1L9MA 3CFBB 3LKNB 5E8OB 1NGQL 3MFGB 2VKXA 1A7NH 5ERWB 4OGAD 4FOMA 2CKNA 3QHFH 3RRQA 3N50A 3MV8D 1A2YB 4FNLL 4HS8H 1NEZG 2FIRT 2X4SB 3MRMA 4H1LG 5ID0B 2VMFA 1S9YA 1G7MA 1MAMH 4L8BA 4CU6A 4TSCH 4UNUA 3SBWA 5JQ6H 3VFNA 1QSEB 4C56A 2GK2A 4TN9A 1RUQL 3G04B 4OM1H 3ET9F 5ICZB 1KB5B 3BDYH 5GJSH 4XCCH 3MLXH 1NDMB 1JZ5A 4B0MM 4MJ2A 4HIIA 1AO7E 1SJHB 4L3EB 5E00A 5SWSD 4HEPG 3MGOA 1JJUA 3ULSB 3DECA 3BFOA 3V6ZA 1FORH 4HXAH 1T20B 4LLYB 2W07A 3TO4D 4MDIA 4C4KT 4KH2A 5AZ2L 3QCVH 4S0TD 2A83B 3V4UL 3WKNA 3TA3C 4GG8A 4JFYA 1MAJA 3KPRE 4G8FA 2HFGH 3MLVL 4MA3B 4PJIE 4EI6B 2Q8BL 5J13C 1PSKL 1ZEAH 2RFXB 5HJ3B 3HG1E 1QR1B 4HF5H 4UV7H 2XWBB 2WWKO 1B2WL 3UYRL 4NO3B 2AJSL 2NTFA 1JV5B 4YEFA 5FO8B 4UQ3B 2PO6C 1GPOH 2EIZA 2FR4A 4D0DB 5J1TC 5HHOD 1ED3A 3HMXA 4JY4A 1NC2D 5BV7L 4H88H 4P5TA 1AP2A 5FGCE 3D25B 2F8OA 2OX5A 3CFKB 5KZCD 3I6LD 1PLGL 1D6EB 3L5WA 1RIHH 4JZOB 3HAEG 5D4QA 4NZUH 4EEEA 4G8GE 1ZTXH 1RU9H 2J12B 3DXAD 1YN6A 3A67H 1MLBB 2HT2D 1GOGA 1WTLA 1EBAA 3RUGE 5FB8A 2Z9TA 2HFEB 1ZLVK 1FPTH 2CMRL 3U0PA 2C26A 4BSVA 1NCUA 2AABL 4LSRL 4PRPD 2D7TL 4HSQA 5ADPH 2X9YA 2JCCF 2FHBA 1IL1B 1QQDB 2ZSVB 4Y4KB 5DO2D 5JOFA 1LDPH 4J4PA 1MLCA 2DQCL 2GYSA 1FE8L 4OQ1A 4KHTH 5DFWH 2VO5A 2DQGL 2YBRB 4C83A 2P45B 4Y16D 4WEMB 4YR6A 1IAOA 1V7NH 3BDXA 4DEPB 4PRHB 3WN5B 3L3GA 3GBML 1GZQB 1FYHB 4G6KH 4PBVC 1MCPH 1M6OB 5CLTA 2O26U 3KPSA 1F3JA 3ILQC 4PJEB 1QBMH 5T1LB 1HHIB 3CDYA 3J8F7 5DRXA 4MD5A 4LVNC 3E8UH 4IEFB 1MFDL 5HYSA 2DQHH 3RWDB 5DVOA 5D7JB 1IC5H 1T0MB 4Z18A 5C0AB 4ZS7L 3AY4C 5LKNA 3N1MC 3KJ4B 4X8JB 1K4CA 4EXKA 1U8NB 2AJVL 4KDTC 5TH2A 3SE4A 5JPMB 2VXUL 2O61B 3GGWB 3ZKQD 3CVHH 1CDJA 3KYAA 2DM3A 3DI2B 4PR5A 3RKDD 3GMRA 5C08A 5HTSA 4YXKH 2VDKL 1P4LB 2A74B 3L95A 3WNNA 1ZHNB 4YX2H 3I02B 2WZPD 5I1KH 4N0YH 2MHAB 5D2LB 3SDAB 1BX2A 1XF5B 5J9PA 3HFMH 3DYMA 4JRYD 3B9KD 5B4MD 5FO9B 4P23A 5E2VH 4FP8H 4OGXH 3LZFH 3CDGB 5LGJA 2UWEE 4IRSB 3ARGA 2GT9A 4P4RB 4WV1A 1Z9MA 1CZ8L 3QEUA 5IJKA 3IT8D 1IARB 4L3CB 4RGMB 3KXFB 3MXWL 4ZUUA 2MTPA 1P84K 5ECJE 3GKWH 4XI5C 5EZOL 5EIQA 4KVCL 1S8DA 4FFYL 4LF3B 4GAJL 2EDFA 2Q87A 3SKOB 4BFEA 1RZKL 3ARBC 4TSBL 1TJGL 1E4KA 1R3IH 4NM8H 1A7RH 1RJCA 2ZJSL 3TIDA 4JHAH 3VXTB 4I0PC 5MEOA 3EYOB 1J8HD 5DR5H 1ORQB 4I5BB 5J57B 3CX5K 5HHMD 3MACH 4NKIL 4P46C 1GC1H 3TEUA 1OL0A 2DIJA 4NRZB 3SDDD 1RUPL 2NX5B 5AG8A 3GO1H 1HXYB 1UJ3C 2VLME 5EU3A 1MCWW 2IAMD 2UY7A 1PYWB 4M4PA 3EO1A 4F9PA 5L0QB 2HT4D 4IHOA 5D7KD 1A7NL 1HIML 2PYEA 1G7HB 5HPMB 2PXYD 4HS8L 2NY5H 3UBXG 2VITA 3PNWB 4F7CA 4M1GH 1F13A 5JIKA 5INCA 4TUOB 2HTLC 2B4CH 3CSGA 4U1MB 4ERSH 5JQ6L 1RJZB 3L3IB 5DSCA 4U1LA 3QHZH 4PRDA 4OM1L 2ATPA 4LLDA 1DBBL 3HC0B 3IKCA 5GJSL 4XCCL 3C87A 4EDXA 5T1KD 5EFIB 1OSZB 1TVBB 2ZNXA 4GRMB 4X9BA 3SDCC 4POZD 3FN9A 1DLFH 3OKDB 1MJJB 2B20A 1LILA 3GMNA 3FT3A 5JPNB 4H1LH 7CGTA 3FHAA 1B4JL 1XIWD 2HFGL 1U8QA 3QQ3B 4UV7L 1U91A 1VKXB 4EIZC 1JK8B 3PHQA 2CUHA 4GT7A 5GS2D 4JG1L 1BQUA 2W9EH 4HWBA 4Y88A 1P9MA 2ZNWA 4H88L 2DAVA 1JWUB 1TFHA 3LIZH 3EHBC 1GL4B 4G5ZH 5DURB 4ZTPH 4CNIA 5FM5M 1U92A 5IHUH 3MRRA 2ZSWB 5CJQH 4NZUL 4S0SD 3QQ9D 1RU9L 5IV2B 4U6XB 2XWJB 4DUXA 4L29B 1KN2H 1BOYA 3GSVA 4M03A 3MV9B 1KIPB 1KSRA 2VNCA 5EOQL 2A6JB 4J3WA 1YNLL 4LQFH 3GMMA 3IDGB 4QEGA 3QBTB 1HSBB 3E6FB