1T0PB

Structural basis of icam recognition by integrin alpahlbeta2 revealed in the complex structure of binding domains of icam-3 and alphalbeta2 at 1.65 a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Integrin alpha-L
publication title An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0pB00
4UNVA 4DAGH 1MCNA 3P30L 4RGNB 4KI5D 1QFHA 4F57L 4E41E 4Y5XC 4F33B 4KRNA 1QFUL 1R3IH 3QWOB 1MUJA 4Y4FC 4X6FA 3C08H 4U6HB 2YA1A 3CFIC 4HGWB 5HHPB 1JMZA 4Y5YA 2AVGA 4QRUA 1D5MA 3DROB 1KJVB 1F02I 4WY7H 4MB4A 1UM5H 1WVZA 4LMQE 5TF0A 3P9MA 4HS3B 1J1XL 35C8H 3RZCB 2CH8A 1WEJL 4PJCE 1MFAL 1SEQH 2HT2C 2FJFA 5JHDA 1R3KA 4MNQE 3TNMA 4PJ9D 3ZL4H 1T21A 1VEOA 5CWSB 2VWEC 2V9RA 4X6BA 1MI5B 3G5VB 3F7VA 3MV8B 1ZK9A 3QUKA 3BKMH 1MCJA 3CDFA 2HN7A 3PXHA 4YDJA 5I1LA 1WFNA 3MNVA 4XNQA 3WFCL 2P8PB 4PJIB 2JJSC 4LGSB 4NQDA 1J10A 3DV6B 1NC4B 3UBXG 3ULVD 5ESVB 1JZ2A 3O41B 2ERJB 1MPAL 4WUKH 2YA2A 4GKZB 1YNLH 2YWZA 2K1MA 1FH5H 3L3DA 5FCUH 5GRJH 3FONB 2APXA 2VZTA 5C7XH 2DOCA 3MLYL 1F6AA 3P9LB 2A83B 3GUTB 1DQDH 4KPHH 1WWBX 1VCAA 2FECI 4MAUH 1LEKA 3FT2A 5DO2C 5E8OA 1CDYA 1OAYH 3EFDH 2EICA 2FEDC 4HWEL 1F3RB 3C6SA 4YWGH 3PV7A 2ZPKH 2VLJE 3TN0C 1RK0A 3QDMD 3BIKB 1O0VA 1EHLL 3NIDF 5KSBB 1GOGA 2DQIH 2IALA 1JUFB 4POZC 4HKZA 5JORA 2J8UB 4PUBH 3KPOA 4OLYL 4TUJB 5CZXD 4NNYA 3DVIA 2I07A 1GC1L 3VFSA 3T65B 1H5BA 2HJKA 3QA3B 5C0DA 3VXMA 1ZS8B 4JGJA 1A3QA 3BXNB 3KLHD 1J9CT 2WMPA 5C6TH 4Q9QL 3IFPA 1HOCB 5BRZD 1MFCL 1JGDA 1NEZG 1TVHB 1U3HD 5D6DC 2CXKA 5EIQA 2R2BA 4YHYB 3GMNA 4NZTH 5IR1B 4E9LA 3BIAX 4KTEH 4XXDB 3EOBB 1V7MH 5D96B 3U0WH 2MHAB 3CVIH 3TVMA 3S97C 2BNRD 3T4AB 1SBSL 3G04A 4A6YA 1CK0H 2E27L 4N1EA 5ITFA 2XYCA 1D5XA 5K9JL 4G43A 4XXCA 4BUHA 2R2HA 3MOQA 3KPSB 1OPGL 5DQJB 4ELKB 1DQJA 2YZ8A 1A02N 4HCRA 2EDNA 3BPOC 5BVPH 5LXGL 4XP6L 4I77H 4X6CE 5IT2L 3VGEA 2FO4A 3W9EB 3LRSB 4KI5C 3ULVE 1HHIB 2UY6A 3BO8B 5E8NB 3UMTA 1G6RL 2IBZX 5IP4A 3VFMB 2RAMA 1I1AA 3IDXL 1CGXA 5IVZB 2A0LD 3RI5F 5FA4B 2BSTB 3RVXD 1P84K 3MRIB 3TFKD 4LKCA 1T03L 5CHNB 3T2QA 1EAPB 1JWSA 1DLHB 4Q9CA 4U3XA 3F5WA 5IMKB 1I8MA 2E8YA 4HAGA 3T3PF 4ZAKD 3QSKB 1MSPA 5GRWA 1ED3A 4CVZA 1U8QB 5I8KL 4CGTA 3BYTA 15C8H 4HK0A 4TUKH 3VFGH 4PJ9C 5EBWB 4WTWA 4XCNA 3MLXH 3QDME 3UTZB 3DO7B 3GI8L 1UM6H 5D70L 5EO1B 2A6DA 4YDVA 3DTXB 3MPCA 1QFWH 3UZQA 5FECB 3JUZA 2NXZB 5D7SL 5GGUA 1AO7D 4Q2ZA 4OIAA 3L3KA 2BNQA 5FK9B 3DYMA 1NBZB 3ULVC 1RZJL 4P2RD 3HZMA 4LSUL 4U6TA 1KG0B 3OZ9H 4Z7VF 4P9HC 3O2VH 3WDHA 2GT9B 5GRUH 4XWOD 3SO3B 1DP0A 2FBOJ 3DGGB 3U4EA 3VFUA 4KRMB 2JIXB 2CKBH 4OLVL 4YX2L 2R0KL 2Y4SA 4JN1H 4KXZI 3FT3A 4P5TB 3NOIA 3IAPA 4I4WB 1JF1B 3MRKB 1UA6L 4LSPL 1T1XB 5DEZA 4JB9L 5B21A 3MJ9L 2BNRE 3BP5B 4PJDB 2V7NA 5I8OL 4LLYB 1J0IA 2GYSA 3JVGC 2D2OA 1D5BA 1OAUL 3DLQR 3FB7B 1DBKL 4N9GA 2BVEA 6FABL 3LEXA 3O4OB 1XH3A 4NQUA 2JKXA 3ARDA 4I0PB 4IRSD 3RNKA 1L7IH 4NP4H 4TVPD 3H9HA 3WN5B 4PRIA 4KKBC 5DT1H 3ARPA 2BJMH 5CZXC 1AP2A 5FOBA 3SKOA 2AV1A 4FZEH 4ODTH 5JZ7D 1HKLH 4KJPD 3MUJA 3T4YA 4G7VL 2EE6A 3BN9D 4JANA 1JZ8A 4RFNB 2XQYK 1DQMH 2HWZL 2YEZB 2H26B 5C8JB 3KLHC 5HI4D 3L5WA 4GRWF 4KUZH 4M8QA 5IMOB 3C2SA 2BOCA 3QFJA 1U3HC 3UTSD 5EUOA 4M61A 4X6DB 3O3AA 1FDLL 5HXMA 4NO0A 4YQXL 4GJTB 2OCFD 4J8RA 4K23L 3B9KD 1U8KB 1ACYH 3WUWA 2A1WL 1RIHH 3QQ9D 3QWRD 3UYOD 3JBG7 4ZUUB 3G5YB 4NQVB 4AMKH 1KC5H 2RCSH 3KS0J 4OTXL 4PRNB 5GRYA 3OXRB 5DTFB 1T1WB 4TSCL 2WW8A 1P1ZB 4LF3A 4LNRB 4M00A 4GRLB 3V52L 3RDTA 1QPPA 1AO7E 3LHPH 4CMHB 3X3FL 5C9JA 5D7JA 3MUZ1 3PQYE 3ROLA 4AM0B 5C0AB 4UQ2B 2CJUL 4LARL 5T3ZD 1RJLB 3VI3F 1H15A 4LEOA 4XC3H 5F7HA 5DUML 2A0LC 3IS0X 3BDXA 4Y5VC 4UV7H 4EDWL 2H3NB 2OJZH 3RWJA 3GO1H 3RVXC 1D6EA 4ELMA 3TFKC 2Y5TA 3VW3H 2GY7B 2IG2L 4P2QD 5J89A 2YC1B 3BP6A 1XGYL 2VXUH 3CCHB 4ZAKC 4UQ3A 4R90L 5ID0A 1AJ7H 4Y88A 5EOQH 3A6OA 1AXTH 4OD1H 5EZOH 3T0VA 5IK3B 1A3LH 1HQ4B 4HIHA 2G75A 2AK1L 5HHQA 1DDHA 4WHYH 4ZS7L 3MOAH 2IADA 4QT5B 5IMLB 5J3HC 4L8SA 3C87A 4XTRD 2G60H 1L9NA 3I50H 2BHUA 4OCWL 1QQDA 5I8EB 32C2A 5TPWL 4L4VB 1FG9C 1FL6B 3AC0A 1U8MB 4FTVA 3AB0B 3UTTD 2CRIA 4J4PA 3UTSE 5BZWB 5HJ3A 1PZ5B 3QEQE 2DQJL 1JHTB 1RVFL 4R2GB 4LSDA 4JREB 1SJHA 3GSOB 4NKIH 4PJFB 5E8EB 2P8LA 5E00B 3ZDYE 1HSBA 2OSLA 5GGSY 3I02B 5I8CB 3THMH 2Q86B 3SE8H 5K9OA 1YEKL 3ARWA 4S1RL 4KAQL 4TVSa 1RZKC 1MHCA 4MWFB 3FHQA 3IGAA 3ALPA 4ZTPH 4YBQD 1BOYA 3DVFA 5C86A 4N0UE 2BCKA 2NY2C 3QZWA 5FGBC 5BOZG 1AHWC 3K3QA 1BQHA 5F1KC 4HZLB 2CKNA 4Y19D 2R56H 5GGVL 5T1MB 3RI5K 3HC3H 4RAHA 2J88H 2MTPA 5DK0B 1OSZB 3QIWD 5JZ7C 4KJPC 5T3ZE 3BN9C 2DMKA 1W0WB 1JE6A 4H26A 4HEPG 3TA3D 1IT9H 5HI4C 3EYVA 5EO9A 1UZ8A 1J8HE 2CDEA 1KB9K 1TVBA 3C09B 3EYFA 5L88H 2VSCA 3SE4C 4P2QE 3D69B 4E0RB 4OGZA 1F4AA 1AD0A 3B9KC 1C12B 1DCLA 3QQ9C 1NLDH 4Z7UE 4U1LB 5E4EC 5FUCC 3ARYA 1A5FL 1B0GB 3L6FB 5JXAL 1KJMA 1ZVHA 3Q5OA 2QSTA 4G8GD 4LHUA 3W2DL 5F71A 2F53D 2VL4A 2AJVL 3OGCB 4TQEH 3O9WB 4WHTB 4GKNB 4W4NA 4P4KD 1DZBA 3KYOA 1XIWB 3LMJH 2BVPA 4L3EA 5BV7H 1WZ1L 3S88L 4JFHD 5F9JB 3OBAA 5AG8A 1J12A 3BUYB 4K3DL 4MQXD 4TVPH 3DX9B 5FKPA 3S7GA 1UJTA 2HFFB 2K7QA 5C0CA 1T04B 4RMWA 4FXLA 1EHNA 1LP9E 4QRQB 3ALWA 4FQIL 4FQHB 1QLRA 4TUOB 2W60B 3QULA 3UTTE 2D0HA 5DDHA 2APVA 1P4LA 1CD9B 2W65A 4Y4FA 4OFPA 1DEEB 2XN9A 2R0ZH 4U1NB 3U6RB 4M1GL 1AXSB 3KYKL 3PGCA 4OQ1A 4DOHB 5IMMA 1RZ8B 2VERN 4XNYL 2XZAH 3B5TA 4ODUA 5C0FA 3WEXA 3QDGB 1QSFD 1A9BB 2P5WD 3MYJB 4PRHB 4JFFB 4HSQA 5EU7C 4WO4C 1HCVA 4XTRC 2UZIL 2XQBH 5IB3A 5F7EH 4NN6B 3QG6B 5F70A 1NFDE 1U8LB 1LMKA 3ZZ1A 2JJSA 1UVQB 1RV6X 3LKSA 3O3UN 1LO3H 5JOFA 1U42A 1VACB 1WCBB 3FQNA 5IVXF 5GS0D 5BJTB 4NWTL 3FO1A 3L1OL 1QFPA 1YQVH 5HVWA 1JTTA 3LB6D 3M8OL 4OZ4A 1SJEA 1C5DA 5F3BA 3DIFB 3B2VL 4K2UH 2Y25A 5I1CL 4L5FH 4RDQG 3RBSA 1L6ZA 4OZIB 2KQMA 3QO1B 2C3VB 3JTTB 1GGYA 2P8MB 1R5WB 3HHRB 4G8GE 4WGWB 4YBQC 3O45A 3MA9H 3U1SL 2Z91B 4JPWH 3SOBL 3H9SD 2F53E 1H9VA 2F54B 4O58L 1K4CA 2D03H 3MJ8A 4G9DA 4F58L 4RFEB 3TN0A 4QY8A 3G08A 5D72H 2R0WH 4JY5H 1AKJB 2ITCA 1QSZA 3QIWC 4D8PB 2B1AL 3O4LA 4HH8A 1MCOL 3OB0K 5DJ8B 1T22B 3TA3C 3DOSA 4N5UA 2NLJA 4JJ5A 3ILPB 4MAYC 2YRPA 4JFYA 4Y0GA 3QCVH 3SKUD 4NQXA 4RMUA 2B1HL 3FQXA 3MRPB 4N90D 2HFGL 1BJ1H 1XR9A 3MRQA 1IAKB 4JY6B 4OM1H 5D6DA 5HHOD 3GMOA 2VXSH 1R3JA 3U2SB 1IGCH 2YUZA 5KBNC 5DD3L 2DMBA 2HJLA 1LDPH 4OZGB 5E6IC 4U7MA 5IHZB 5MEQA 4L8CB 1ZLUH 3ZSTA 3RIFF 3RVVD 2APBA 1ZT4A 3U0PA 3BWUC 2AK4B 1QSFE 3RWDB 1I8KA 2A9NH 1F3JA 3RY4A 2EE9A 2GTWA 3WJLC 3I2CH 3GRWL 5ALCH 2V17H 5FV1L 1RUML 2P24A 4HWZA 2Q87A 1CQKA 3BH9B 5I74C 1QR4A 4ZFGH 4BA8A 4MQXC 3LDBB 3CGTA 3EO1A 3UJTL 2J6EH 1YN6A 4WU5A 2CKBA 3IJYB 2RB8A 4NC0B 4QXTA 3TIEA 3MROB 4KJYA 3MRLA 1YJDL 3X3GH 3CSYA 4ODXA 5J0BA 4S10A 4AK1A 5EBLA 3MV9A 2X6MA 5GS2D 3PL6B 3LZFL 2IFFH 3IETB 1EIBA 5GRVL 3DETD 2R0LL 4FQCL 4LLDA 5FYLH 3TBVB 2VABB 4PJHE 3MC0A 5D5MA 4BUGA 5FO7A 4X9GA 4XRCB 3TBTB 4DKFL 2DLHA 5BVJB 3C6LB 3H9SE 5KANI 2PXYD 2J2ZA 5D7IE 2IPTL 2WIIB 4PJ9A 2ZG3A 1S7RB 3D2UA 4J3TA 3X12A 1FVCA 5CBEB 3O11B 3MRHA 4MCYB 3RWEA 5FO9A 4NO2B 1VFBA 5D1ZB 5DD1H 3HR5B 1WK0A 4IOFD 2EYRB 1MHPL 2Y07L 2BVYA 2ED7A 2YK1H 4FFYH 1DLFH 2JCCF 1U8OA 2JK5A 1YYML 1TXKA 2VIRB 1I3RA 1H8SA 4XVTL 3FTGA 5GS0C 1YEGH 1ZTXH 3FMGH 2R4SL 2ZNWA 4G6KL 2LQRA 4FFZL 1Q9OA 4HPYH 1NDGB 4N90E 1V3KA 3LB6C 4JQXC 1EAJA 1NGZB 1JWMB 4LOUD 3A6BH 2YS4A 1S5HA 3QIBB 4KMTL 1CTOA 4BSVA 1FO0B 2B0SL 3VH8G 1XGQA 4W4OC 1MRFL 5JIHA 1S7UA 5C2BL 3D39D 1FP5A 1TFHA 4LHJB 1I1YB 4Q6IC 3CX5J 1U6AH 1LO5A 3U83A 5L7XL 2BVOA 4QGTA 3VXUD 5GPRA 5JMOC 1IM9A 2B39A 3JVGA 3REWB 5F88A 1OF2A 5GGSA 5SX4H 1ZV5A 1YYLL 4PJXB 1NLBH 4GKOA 1D6VL 1N64H 4X7EC 5EOCL 1G0XA 4S2SB 4UAOB 2CR6A 3DSFL 2K3TA 2HH0L 1U95A 3U36B 1HH9A 5DWUL 1UQSB 5DRNA 4GMSL 3QUZD 3T0DA 4G6FB 4M7LT 2X09A 4OM0H 4TULH 3MLSL 4ZXBD 4HZAA 4NYLA 4XGZA 1UEMA 2JB6A 2Y23A 4RBPK 5BRZA 5C08D 2WQRA 5J1SC 3P4MB 3CZFA 3U4BL 1U3HA 5KJRH 2CUIA 1BEYH 4HMDA 3RU8L 1G1YA 1M6OB 5HI5D 5GS0H 3JTSA 2VLMD 3Q6GH 3SDXE 4GQ9L 2ZUVA 1R24A 1HN1A 3OR6B 5D8JH 2P44B 1S78D 3LKQA 2BNRA 3ECBB 4NGHH 1GRWA 4NZJA 2YWYA 1I85C 2ZUQB 1A3RL 1ZLVH 3RVVC 4X98A 4DFIA 5LWYH 2WBJC 3HZYB 3B9EA 4QHUA 3DX7A 5F1NB 4DAGL 5ID1A 1Z0MA 1U2HA 4LPTA 3T2NL 1NDMB 1TETH 4YHMH 5F93C 2X44D 1B6DA 4M7KH 1A6TB 5EBMB 1N3NA 3CFJB 2MFNA 5T1LD 1FORH 1MWAA 5HYJA 4P5KA 1V3MA 1BWWA 3K8MA 4DEPC 5DFWH 1ZA6B 2DJUA 3L95B 4TOYH 4UTBL 1OGAA 4YC2C 3OG6B 3DX6B 3GM0A 3EDJA 4JM2B 5HHXH 4Y5VA 2W9EL 5BO1L 4K7PY 5T1KA 4X7TB 4OGYH 3DETC 3D39E 2IAMD 1FYHB 4XPFH 1SY6L 1BQUA 2BHYA 1IKNC 4YR6B 2VXVH 4PJGA 4MNGE 4HG4K 4ZAKA 3MJ6A 4OLWH 2NNAB 2VAJA 5B38G 2AJSL 3VXUE 2FJHA 2D7TL 2UZXB 2P4AB 3NTCL 4M1DH 5DJCA 5EO0A 3VXSE 2XA3A 4ZUWA 3FT4A 3QXUA 3W5MA 4Y5YB 3E6FA 1MY7A 2X4QA 5D1XB 3UX9B 1CFVL 4NQTA 4I2XB 4S1SL 2PNDA 4IOFC 4EI5D 2ORBH 5EZJB 1CLYH 2VLLA 3MRDB 4XCCH 4BFIA 5JQ6L 5F1SA 3AREC 4M03A 2EKSA 3EYSL 3OV6A 1YPZE 4P2RA 1A7PH 2F19L 3CH1B 4HMEA 3WE6A 3O6MH 4YDIH 5IW6A 5HGHA 5C08E 2AW2A 4ZSOB 4YFLF 4XB7A 5TE7L 4MA7H 5DC0A 4RMQA 2NY1C 2Z8RA 4IOIB 1KJ3H 3IFNH 4TRPL 2V7HB 4HBQA 5GS2H 3WNKA 3M1BA 5I9QC 1T7XA 3W39A 1U8NB 4XPBH 1T6VN 4X7SL 5T3XL 4UTAH 2AJYL 3C9NA 2PYEA 3KLAB 5IB2A 2Z93A 4LMQI 2EDOA 4P3DA 1MAMH 5FGBA 1AHWA 3JXAA 4U6XA 4UIKL 1MRCH 4XVSH 5JW4R 4CVWA 1BD2B 3QUZC 4NNXB 4LEXH 2C7UA 3C6SB 4DQOL 3U0TA 4ZXBC 4HUVA 3UYPA 4WJ5A 1EH9A 3ARZA 2C9AA 3HE7D 5INDB 4OBSA 2YD1A 3WHE1 4HKZB 5JORB 5C6WH 2BZDA 3D0LA 1QNZL 5HI5C 4C4KO 1UYWH 4YBLB 5DJAB 3SE3C 3MNWB 1TENA 3SE4A 1S78C 1KNOA 4GG6A 4K7FB 3GMMA 2I07B 1KIRA 2DI9A 3KLDA 3VFSB 3B9KA 2EXWD 4NC2B 5E99L 3VXMB 4X4ZA 1KT2A 3QWRA 3G6JE 5GXBB 3GBMH 2VUYA 1IEAA 5D6CB 1WTLA 1GHFL 1CR9H 3WLWD 5K59F 2YKLH 3FFDA 3BQUD 2V5YA 3DX8B 3CFKA 3FFCB 3LVEA 5E2JA 3C5SA 3P40A 1DN0A 1XAUA 3BGAA 4JQVA 5ITFB 3JUYA 1OM3L 5MEND 1JBJA 1BZ9B 2XFXA 3FB5B 5FM5M 4I0KA 3BDBA 5IG7B 5SWSD 1ZLSL 5J11C 4O2EA 5KVDH 1AI1L 1M05A 5DJXA 4X4XB 5T33H 1LO4H 2HRPH 1DBMH 2IAMC 5DR5H 2FO4B 3WXWH 3V2AR 1N6UA 2XG4A 4JRYE 1X4XA 3TJEH 5JW4Q 1KN2L 3A0OA 1KTDB 5JDJA 3Q6FA 4TYUA 3L7FA 2ITDA 3FO0L 1U8HA 1Z9OA 4RWYH 4XNUL 4JFOB 1DE4B 4KVCH 2V9QA 2YUXA 4EI5C 1ITCA 4X80H 1ETZB 2P48B 2DB8A 4WO4A 1ULVA 5JDSA 4ZG1A 4JN1L 3LQAL 1JHKH 5B3NA 1BHGA 2EIZB 4OF3A 5DGRA 4HK0B 3WS6C 4OI8A 3V5DB 1FL3B 2QKIA 3I6KA 1ONQB 5F6HI 2YD7A 4ZO7A 5HGAA 2PTTA 4J1UA 5TQ2H 2FATH 1J1OH 3FN9A 3RRQA 3CLEH 4JHAL 2A6DB 2C1OB 3DRQA 3SJVB 4KHTH 2FX7H 1FG2B 2DL2A 1QBAA 3SO5A 1UXWB 4QHLA 3UTTA 3BZFA 2E8ZA 3Q1SL 5DFVC 3ESVF 3V5HB 3D85B 1VGEL 5C09B 4QNPF 5HSFA 5HHVL 1YUHB 1MCQA 1KCVH 4YE4L 1MFDL 1CXFA 2PTVA 2IANE 3O2DL 5DVLA 4MD4B 3SQOH 4ZNEA 1VADA 2V5MA 4L9LC 4HV8A 5DRZB 5CMAA 3U4EB 4NUGL 5KG9B 2FB4H 4PRBA 3P0YL 3FT3B 1A7QH 2XPGB 3QFDA 3TESA 3AVEA 2IGFH 2NXYB 4QTHB 4LDEB 4PTTB 2J6EA 5EU5B 4KC3B 1UENA 1DL7H 3BPCA 1EUTA 1H3VA 4JFXB 4Y19A 3IU4H 4GQPH 5ISZA 5MENE 3UO1L 5CJQL 4HIIA 3QIWA 2YXMA 2O5ZH 4P46C 3WFEL 3LEXB 1QR1B 4QHMA 2YBRA 4DUWA 1BBDL 2BDNH 3RNKB 4EQ2A 3TA3A 5SWSE 3HE7C 2R29L 2NTFB 4MAYA 4R4FL 3MO1A 5EU4A 5A1AA 1XCQB 4PJIF 5EORL 1FV1A 4W81A 1FVEB 3PP4H 1AP2B 2AXJA 4AG4L 3ARVA 2QR0A 1MNUH 4HW6A 3H2WA 1OQXA 4OD3H 2EXWC 4ONHA 1IAOB 4P3CH 1ZHKA 3VE0A 5JOPD 1KBGH 3HI6L 5DA0B 3JV0A 3X17A 1ZHNA 4E42B 1PDKA 4I18C 2FSEA 5BMFL 1KEGL 5E6IA 2YD3A 3WLWC 4ORGA 4IJ3B 4DKEH 3ZE1F 3BQUC 3LN5A 4V2CB 3EHBD 4F7EA 4NKDB 2NTSP 4J8RB 3WJLA 4JG1H 1F97A 1X5KA 4WCYH 3WUWB 4HD9A 5GQBA 1DVFD 2DQFB 3BKJL 4JHZA 5D2LE 3QCTH 1DBBH 2FZ3A 3MRFB 3R4DA 3V7MA 4M9PA 3ULUD 4U3CA 2CIIA 4MHHI 4WW2C 3VWJB 4QYOA 4BQ9A 2J8UF 2EZ0D 4POUB 1S5IL 2HLAA 1ACZA 2DTML 4IIQB 4GW1B 3K4AA 3F12B 3X14A 1HILA 3BGMA 2GFBA 1RU9H 3GSRA 2CXGA 1EEUA 5JHLH 2VB5A 3KJ4C 4MCZA 5C0JA 1CZ8L 4PBXA 3F7QA 1JRHI 4F3FA 3PWVA 4L4TD 3K2UL 5E24E 2W0KA 3ROOA 4LVHC 1R3LB 3PABA 3SHSA 5I16A 1MCKA 2YPVH 8FABB 4FNLL 1R5IB 1D6EB 3EZ8A 4QEGA 2DLFL 2FECL 2P5WA 3VFNB 1T1ZA 1WIUA 3VA6A 3HE6B 2X4RB 4Z7OE 1JK8B 4JFED 4BQ8A 5KS9B 4LAQL 3C5ZD 1GZQB 4FQXC 4JO4L 4KY1H 3FRPA 3BE1H 3QPXH 4NKIL 4N68A 4RZCB 4V2BA 3SGJC 3G5XB 1IBGH 4HIHB 2G75B 5DJDB 2DS4A 3O3BA 3WIIH 2PF6A 4LCWD 1G9NL 2GSIA 4JPKH 3V0VA 2ADJA 4K3EL 5LAXB 1E28B 2EE2A 4OD2A 1RIVH 4XNXL 1NCCH 4CU7A 1KENH 4JQXA 2ZUUA 3TZVB 2I26N 2DBLH 3CFDA 4KMLB 3WXVL 2VH5H 1QQDB 5JOPE 4W4OA 1A7BA 4FQJL 4RA0C 4YDLB 1OP5H 1M71A 4Q6IA 1KGCD 4PJHA 4YPGA 7FABL 5HJ3B 3VMNA 5ACZB 4JLRA 1FNGA 1EX0A 3V0WH 4OAWA 3VFVA 5CILL 2D31B 3H9SA 4OZFH 4CW1A 5DVKA 2VZVA 2XWTA 5D7IA 5IOPA 5HYQA 4N0FA 5B3JE 1ERNA 2PYFA 4K8RL 4H1LB 5ETUA 2VLRD 2X4TA 2VN4A 4OKVA 1CICD 3SDDC 2XWBA 3IGAB 3FQWB 4LDLB 4PG9A 2MNUA 3ULUE 4G8IA 2CDGA 2FL5B 4Y2DD 3BRFA 4HS8H 4KTDL 5HYSB 1DR9A 4HH9A 1Z5LA 1YY8A 4D3CL 4LPCA 2NW2A 1YN7B 4YGVB 2V2TB 4JZJB 4L29A 1IEBA 3UPRB 4EJ1C 3CFBA 4LSTL 2D9QB 3TYGH 3MJ7B 4OGXH 4ZQKA 2Z4QA 4PRAA 5I18H 2UWEA 5HHOA 4R26H 3ZE0E 3EO9H 4L4TE 2OK0H 3NBNA 2XXCB 4I13B 5E6ZA 2QV2A 3P4OA 5DUPH 5HGDA 5J7CC 4WTZG 4DK3A 1TVBB 3OJVC 5L2JA 1I85A 2XY1A 3EYFB 1SM3H 4U7SA 2X5PA 2WBJA 3MFFB 4B41A 4KZDL 5KVFL 2DQUH 5EU3B 2EIDA 3MGTA 4MGXA 4OCSH 1SEBA 2A77H 1DVFC 5JO5A 3NPZB 5GHWH 1KJ2B 5D7LB 1F3DJ 1KJMB 5HPMB 1OAXH 5E4IA 2P5EA 4LRNH 1TTFA 3LS5H 3ULUC 3RWFA 1I3UA 4BKLA 3U7YH 1AC0A 1G7QA 2EZ0C 4Y8AA 3TH2T 1BX2B 5EC2B 5C0BD 5EC1A 1QHPA 1WFUA 1CYGA 5IHUL 3LEVL 1T1YA 1KACB 3QXDB 5I1GL 5EOTA 2GJ6D 5LJYH 1LDSA 2A74A 3HNTL 3W0WB 1D3CA 2XZAL 3BVNB 2YMXH 1CGSH 4QTIH 3RPKA 1A6ZB 3HTLX 4ZOCA 3SDXA 1XGTA 5I1AB 1FO0L 1UWXH 2ZUYA 4OQTL 1H8OA 4GAYA 1V7NL 1IKNA 4OB5H 1NL0H 1KGCE 4BZ2H 2I9TA 1NCWH 4Y5XB 4F9LC 3OKDA 2VDPH 4MQ7B 5KVGH 2FWOA 2VL5A 3GMPA 4G3YH 4U2ZA 5IFJA 2PR4H 4MSWB 3S3SA 2XN9B 3QDJA 1Q9LB 3MACL 4UB0L 1JFQH 1CDGA 4G6JH 3C5ZC 3INUH 2P7TB 1MF2H 1H3UA 3PGCB 4JFDD 4YHNA 3M17A 3GBNL 2Q76B 1MVUB 2ENSA 1AE6H 2H2SD 2WQ8A 1U8IA 2ZSWB 3AREA 3VMOA 1MFNA 3D1MC 4NZRH 2G2RA 1D9KD 4X9FA 5ESAB 3MCKA 4XNMA 3D25A 3O81A 4PYHA 4O2FB 1LNUA 2AJXH 3GGWA 2E9WA 4H8WC 4XVJH 4NFDA 1URLA 2D7PA 5MHSE 2IFGA 5LBSL 1I9JL 3MNZA 4DZ8B 3LKSB 2EDDA 5KVEH 4JM4L 1KLGB 3HZKA 1FJ1B 5CIPB 3DMMB 3VI4E 2OMNA 2R0WL 3I6GA 2O5YL 3V4PL 4IOSD 2FLRT 4E41B 5JMRA 2HLFD 3UCRA 1G0YR 1U3YA 4DTGH 2YXFA 2B4CC 4G42B 1C5DB 1U8JA 5F3BB 1CLOH 4F2MA 3VXOB 1GAFH 2MKWA 3P11H 1YY9D 4PIRF 5IUSA 4JHWH 4YHOL 1F58H 4HIJB 4U3HA 5IEHB 4DN4H 2W0FA 2ICES 5D7KD 1JN6A 4PJCB 3IXAB 3QWQB 4Y2DC 1WZMA 2XZCL 3QUZA 3QHFL 5EIVA 4E5XB 4JCMA 5DMIH 4MNQB 4RX4D 1OAZL 5IBTH 5C0BE 2UV3A 3TN0B 3ULSA 4ZXBA 1BVKA 1K3ZA 4GLRH 5IEKA 2C4FU 1CU4L 4RAUB 2GJ6E 4GOSA 4LLUA 3NAAL 5C08A 2VDNL 1WWWX 4GAGL 1F00I 4UNUA 2NR6D 3IDNA 3RGVD 1ZA3A 5DS8B 2NX5A 5I1KL 4Z8FH 3SE3A 1OAQL 5SWQA 4H88H 1NC2B 4NQXB 2MSPA 4ZFOB 4F7PA 3MMEB 3N1GC 3HCVA 3NFNA 2R2EB 2Y6SD 4NQCA 3MRQB 3ZTJG 3W11D 5HY9A 5DHYA 3TO4D 2OTPA 2WWMD 3NIDE 2Z31C 2IQAA 5AYUL 1R3JB 5DRXB 4O4YL 4WI9A 3WFDH 3NPSB 1J8KA 1RZGA 2VQUA 2HJLB 2B4CH 1TQBC 1F6LL 1E4WL 4JFDE 1WAAF 5T1LA 1MIEH 4PJBE 4OV5B 2WINA 3GB7B 3U0PB 4L3AA 3SKNB 4XMKL 5B8CB 2GTWB 1QSEE 1FN4A 2VLJB 4K07A 4ONGH 3CK0H 3LS4H 4BH8B 3CUPA 3MBXL 4XPHH 4DW2L 4X5XB 5HVHC 2V5RA 3IFLH 1DQLL 1FLRH 1J5OH 2YRLA 1OWWA 1J05B 2OR8A 5A3IC 4R96A 4KK8D 3GIVB 4WENB 1RMFH 1OQOA 2IAMA 1FFOA 2H9GA 1ZEAL 3MRLB 4O9HL 4DJMA 4LPUA 4JY4B 5C3TA 3LKPA 2E7LC 5EBLB 4K94C 1HQRB 3DBXB 3U46A 4CJ1A 4X8JA 1DLFL 4U05A 4HKJA 2IMNA 1FBIL 4Q7DA 5EG6C 1PG7L 1YEGL 3QUXB 5DA4A 3R1GL 1INDL 1RJYB 3Q48A 1IEHA 5LGJB 4HBCH 1TLKA 3A6BL 2H2SC 1MHEB 2EIEA 3SQBA 2CUHA 1U92B 4UT7L 5IB1B 5IV2A 3QRGL 1T3FA 2AJUH 4GG8B 5ADOH 4MJ4A 5FOJA 2X4PA 4XP4L 2ATKB 4HKBA 2BSRB 4U2YA 2NW3B 4NSKA 4X6CB 1TPXC 5IROC 5AAWA 5E94A 5F7MC 1I7RB 3LQMA 5GS3A 5I76A 5IB4B 4F15B 5E8DH 4MNHA 1I3RB 4HEME 4XP5H 4YK4C 3VXQA 3MRNA 1L7TH 4PV9B 4QXUL 2OTWB 5TQ0H 5KW9H 5KTEL 2HLFC 2VR9A 4AEIL 3ARQA 2XT1B 4NUJA 4L9LA 2ADGA 4PJEA 43CAA 1IVLA 1S5HB 1XGQB 3VFTB 3S3JA 1AGDA 1EO8H 1S7SA 1VEMA 2BC4A 1JHLL 1G7MA 3H0TA 1Q0XH 5FYJD 1CE1L 3QHZL 4JRWA 4Z7VE 4XCYA 2VISB 3AS0A 3MRBB 4HGKC 5E7FA 3RL1A 1KYOJ 3MR9B 5HVGB 3L5JA 4P46A 4NRXB 1TZIA 1INEL 4ZPTB 1MCDA 5TF1H 4I1NB 1FE8H 5EU6A 3QDMB 4HFWA 4JG0H 4JRXE 3HAEA 1IC4H 3HE7A 3VGBA 3BHBA 5AWNL 2NR6C 3MLRH 3RGVC 4R9HA 1WGOA 3QDHA 1JI1A 5DRNB 4XPTL 1ADQL 4LLVB 4L4JA 4YHML 4V1DA 2DQDH 2DYPD 1A7OH 1RPQA 3PIQA 4RGOH 1ZHLA 4M7KL 1NQBA 3V79C 2JB6B 2Y6SC 3W11C 3CSPA 4JR9L 1PLGH 5F7DB 5CSZB 4HIXH 5IM7A 1R0AL 3CZFB 2WWMC 4I18A 4EOWH 3CLFL 3O0RL 4PV8A 4QLRA 1F8TH 4TSAH 1R24B 3FN0L 3BQUA 2FYYA 4OI9A 4YIQB 1WITA 3U4AA 3LKQB 5TJWK 1K5NB 2BNRB 1IGTA 3P73A 3OX8A 3GHBH 1RZIA 3IB4A 4EBQL 3S36H 4X98B 1Z2KA 2BX5A 1K6QL 4G7YH 2OR9L 2VKWA 4HXAH 3DX7B 3VXNA 1LK3L 2NY7L 1XF5A 4QHKI 3DVGB 3PWPD 4D0CB 5BS0D 5SWSA 2FJGB 3L7EB 4WW2A 5E8PA 3E8UH 1LEGB 3S37X 1KCRL 4XMLL 4KK8C 1MWAB 5IESL 3HUJA 2AXGA 5ALBH 5ENWB 4YO0A 3NFSH 3DURA 2H45A 3NCYP 1JGLL 4EI6B 4OZFA 5D2NE 1A1OB 2IPUG 1FZKA 4NCC2 4QXGL 1A4KB 3QQNA 5DSCA 4KRPD 4ZMAT 3TO2B 1A7NH 1CLZL 5EB9A 4KJQD 4LU5L 3MODL 4AEFA 1IRAY 3ARFD 1N59B 5H94A 2PO6D 1A4JB 4H5SA 3HRZA 3X13B 2DQCL 2QADB 1JGEB 1I1RA 1F4XH 5FYJE 2Q6WA 4ZAKB 3UJJH 1QBLH 3I9GL 2X4NB 5EZLA 3VI3E 3BRDA 4FQXA 5DJCB 4BK4A 1BLNB 5D2LA 4OT1L 4MA8H 3HLAB 1JPGB 4CN6A 1M1SA 1CD1A 3GSQB 3KVQA 4ZODA 4CNIA 4LCYA 5FYKH 1JF5A 3HC4H 1KFAH 3V6FA 1AO7B 3TEUA 4XT1C 4WUUD 4BSJA 2HKFL 3PQYB 4F7TA 3MUY1 1EJOL 5DQDH 4GXVH 2EKSB 3CSGA 4LVEA 1WUNT 3HZVB 5D2NC 1FNEA 1KXTB 3QNZB 2H2PD 4YUEL 4UINL 2AJZB 2VITA 1V3JA 4OUUA 5IW6B 1AGFA 3VXPB 4LCCC 2ZNXA 4TN9A 5CP3A 5DZNA 3T0EE 5C07A 1OB1B 5BZDA 2B2XH 2XIDA 4I48A 2BY1A 2N56A 3QEHA 5F7UA 3GK8L 3SDDA 1SMOA 4NOFA 3BZEA 1S9XB 3NCMA 4IRSB 1C1EL 5IB2B 1CXIA 2H6PB 1HHJA 5ICXB 2R15A 2Z93B 4HQQL 1NGPL 4P3DB 3P4NA 5J1TC 5I1HH 4R8WH 1MLBB 1XF2A 5GGTH 4MJID 1IGMH 4PRDB 4GRWH 3HPJA 2VAAB 3BPLB 1FPTL 2VQ1A 3HMWH 3TBWA 3U0TB 3GSWB 4HF5L 3VRJB 4WJ5B 3FB8B 4CBPA 5EWIL 3FQRB 4KZEH 4LIQH 4GBXD 4LSSL 3JWNC 4BK5A 3MRCB 5J56B 3UTSB 2FDBP 2X41A 2YSSB 2Z35A 3QEQB 5E2WH 1W2KT 4FQ1H 4U1SB 2F5AL 4MJ5A 5GJTL 3GMMB 1BF8A 1TZHA 4LL9A 3TM6A 1KT2B 3CPLA 4Y16D 4NC1E 1DVFA 5T33L 1QKZH 3LSOA 1S7VA 5DMKB 1AFVH 4FQLL 2IH1B 1A22B 3W81A 3Q3GB 4N0UB 3GIZL 5ESQA 3KGRA 3TBYB 3CFKB 3D3VD 1SBBA 1S9WA 1UZ6F 4ODSH 5TDPB 1BZ7B 1DN0B 4LSRH 4WUUE 2ICEA 3MV7D 3E2HC 3V0AC 4Z7QF 2FHCA 3VGGA 3ZT6A 2QHRL 2FBJL 5J8OA 1UB5B 3IJHA 3D9AH 4M5ZL 1LO2L 4O2EB 4PY8I 5CFHA 4KRPC 2D4FA 1J8HB 3KPTA 4JDTL 4N8CH 1B9ZA 4QWWD 5DJXB 4M5YH 3GSXA 3QI9A 1JYVA 2EC8A 4F9LA 3ZYJA 1D5IH 2ESVD 3JV5A 4P2QB 1MRDL 1KIPB 1J1OL 2A6JA 3KPNB 1RFDH 5AEAA 4Z7UB 4JFEA 4NC1C 1S3KH 1YNTA 3GKWH 3HRPA 2ITDB 3OPZH 3ZSSA 5DMJB 4DVRH 2EH8H 1JYWA 1YEHL 5TE4L 2D7QA 5DEGA 2BVQA 1AQKL 4WV1B 4R0LC 4LCWA 2UVEA 4NKOB 2HJFA 4ONFL 1G7JB 2R1WB 3FCTB 4MJIE 3NCJH 2Q1EA 5F6IB 1SJVA 2CK0L 3ARXA 4JGMA 3T77A 3GSNA 4XPGL 2IPKA 1OW0C 1RUPL 4M48L 2H2PC 2O26U 4J1UB 1DJSA 2CRZA 4G9FD 2VOTA 5HHMD 5IJVA 1LP9B 4LLMB 3AAZA 3UTTB 1P9MC 1EXUA 3O8XC 3AFLA 2PW1A 1Q72H 2XXMB 4LASH 2SEBB 3FO2A 4UOJA 3KXFD 5CEZH 1IC7H 3HG1A 1QEWB 1UJ3C 4HJJL 1BWMA 2Q7YA 2VLRA 4HDIA 1HHGB 2F74B 5GIRA 1R3HB 5JUEL 2D9CA 1P4BH 4R4BB 2E6JA 1KJ2L 3QFDB 1XMWA 3C8KA 3OJ2C 2RJMA 4R7NA 5D9SB 4P4RA 3ILQD 2ZOKA 5IVXE 3HNVH 3V95A 3BKCL 3D3VE 3BPCB 2GK2A 5E03A 3RX8A 3MV7E 3P30H 4EXKA 2CGRL 4F57H 4QRPD 1NFDB 4PGJA 4QHMB 3GBLA 3RWIA 3L3OB 1QFUH 4XH2B 1EUUA 2XV6B 4GBXC 3N1PC 1U36A 4JDVA 3VXRD 1LE9B 2Z8SA 4MJ6B 1F4YL 3P4LA 4PJ5E 3QAZC 3MUHL 4NRZB 1MFBL 3IJSA 2ESVE 5MERB 1J1XH 3NCYS 1BFOA 4YFEA 1KTKE 1WEJH 2Z31A 4Y16C 5TDOB 4MD0A 4NNPL 5JW5B 4Y4HD 5E1AB 4ZUVA 1DBAL 3KPPB 1A2YA 12E8L 1WSST 4G8GB 4W70A 3EO0B 4ORGB 1B4RA 1GC1C 4N0YL 1X5XA 2F53B 4F7EB 2FH8A 2CO7B 3FZUD 5C0BA 3M45A 4TPRL 4JVUA 4P4KB 5I74B 1WZKA 2AABL 4HHAA 4AIXA 4GKSA 1P7QD 1MPAH 1ORSB 3R0NA 5HHME 4JZOA 3CU1A 4R97C 3VFRA 3O3DA 4QWWC 3LKOB 5EFIA 3SPVA 3MLYH 3G6DL 4BM7A 3LIZL 4X5WA 3GSRB 4NHUA 3X11A 5HGBA 3H7LA 1MH5A 4WEBL 2E7LA 1W72B 3OKOA 1P5UA 3WUWG 1VHPA 4OZHE 3ZT5A 1HYSD 1N0LA 1H3TA 2RFXB 3V4VL 4DCQA 1EFXD 4AH2A 4F3FB 4HWEH 3ROOB 1XCTA 3PWLB 4A2LA 5I16B 3O6FD 3D6GA 4F9PC 1KENL 4D0DB 4JFDA 4NBXB 5IFAL 1EHLH 4AQOA 2QQKL 4QCIA 5INCB 1QSFB 1EBAA 4NQEE 3NIGF 1T1ZB 1ZWIA 5C0RL 1N6QL 1A1NA 2ZG1A 3QP3A 3SDAB 1P5VA 1HXMB 3FQUB 1K4DA 4OLYH 1H0DA 4ONOA 2ZZUT 1Q94B 3ARGD 3WNLA 1MCBA 4UDTA 1GC1H 1BOGB 4QRPE 3BEWA 5EN2A 4XP9L 5IROA 2J12B 4Q9QH 4PGBA 1JZ3A 1F90L 1MFCH 4PBVC 2CLRA 3O3BB 3A67L 4D2NA 4OLEA 4KJWD 2GSIB 2ADJB 3JWOL 5IB5B 3KYNA 5KANG 4HUUB 1IZKA 4N0CD 1A7RL 5C70A 1WFOA 2VDOL 4ZFOL 1SBSH 4FS0A 3CFDB 5FO8B 3DHMA 2E27H 5A2KH 1YMHA 3MA7B 1NBQA 5K9JH 3PV6A 3CFEB 4Q6IB 4PJHB 1OPGH 2JCCE 3OKMB 2XKNA 3WFHA 5EUKA 3OHXA 1RZJC 3ILQC 2I60L 3H9SB 4EVNA 4XAKD 5D7IB 3T0AA 3GSVB 5LXGH 4RX4A 4J23A 4XP6H 4N0FB 5IT2H 5KVMC 3L9RB 4OKVB 3K7UA 1SHMA 3PDGA 5AD0A 1PKQE 3RGVA 1G6RH 3L3HA 4LVNC 4PG9B 4QRSB 1BJMA 1QO3A 4G8IB 2CDGB 3IDXH 1NMCC 4FQQA 2F15A 4FMKA 2DLTA 2I5YL 1YEDA 4MA1B 2XNAA 4WNQB 5DURB 1T03H 4CN1A 4AL8L 2FIKB 2C1PA 2W38A 3CFBB 4LLWA 3P3YA 5T1DL 4S0TD 1XZ0A 4R3SA 4H1LG 3WL9A 2VLKB 4C83B 1JPTL 4FN0A 2GI7A 5FDYA 5I8KH 2QTEA 4FFVD 2EDXA 5C92A 4Y4HC 2G5BA 1Q1JL 2N7BA 4NFBA 1EHAA 3KYMB 5LGKA 5HYSG 1ZLUK 3GI8H 5D70H 1IQDB 4ZUSA 5I0ZA 5DZOA 4YHKL 1IGYA 3MYZA 3JSSA 3FZUC 5AUMA 3STZB 3VCLB 5KN5B 5DJ2A 4CN4A 5D7SH 3MGTB 5F72S 2G9HB 5FHAL 2JJWA 2W9DL 5KOMC 5JO5B 1ZVYA 3QJFB 4HXBL 1RZJH 4LSUH 5KSAD 5KVGL 3TJHD 2X1XR 2XY2A 4G3YL 1UT9A 1W8NA 2L7UA 4OUOA 3I75A 3RWFB 1S8DA 4LQ1A 2J7LA 1BQLL 4OLVH 4Z7WA 5CLTA 2R0KH 4DEPB 4YX2H 4RISL 4FZ8L 2YPLD 2HVKA 3TBSA 1ORQB 4TNWF 5EC1B 4JAMA 3H7BB 5TDNA 4XBGB 1I7UA 1JV5B 3ULVL 1UA6H 3LH2L 4LSPH 5EOTB 4P9HL 2A74B 4JB9H 3MJ9H 1HYSC 5I8OH 2PW2B 4N1HB 4YFDB 3SDXB 3VDAA 1GL4B 4PLJD 1DBKH 3O6FC 6FABH 4IS6B 4OBRA 2HVJA 3BH8A 4GH7B 4KK5D 1TJHL 2X4OA 3MZGB 2V2XB 3HNSH 3F8UB 3KDMB 3GNML 4NDMA 2PXYB 4XCEB 4YHIB 4POYA 5GGTA 4FQ2L 3OJMB 1HXYA 2OL3B 1EGJL 4UBDD 5DJYA 4H25B 2Q7NA 4HIEB 3VD5A 1XF4A 2C4XA 3OKYA 4G7VH 2CMRH 1P2CB 2HWZH 2X4SA 1ZGLP 1RUAL 2GUOA 5MEOB 2KH2B 1YMMD 3RZWA 4M7LL 1CD8A 4M62H 4OCXL 1GGBL 1U41A 2A6KB 2LTQB 4KJWC 4MS8D 1UKQA 5D1QB 4GUPB 1FDLH 5D4QA 1LE5B 1YDPA 3IDIB 5DD6A 5D2NA 1NEZA 4YQXH 1MIML 5I71B 3IRZA 1NSNL 3ZKXB 4K23H 3RA7L 4LCCA 1OL0A 2A1WH 3QNXA 5L2KD 5K9KA 3D39B 2NZ9D 4OTXH 3MBED 1I7ZA 5GRZA 4NQDE 3I6GB 1IAMA 4MNGB 2K7PA 5BXFB 4TSCH 3S37L 4K55A 3VXUB 2JELH 4U1GC 1LHZA 4PRPA 5CSGA 3VXSB 4Y4KC 3HN3A 3KPMA 3V52H 4ZUTA 1C7TA 3QUYA 3X3FH 4PLNC 2CJUH 4XHQA 4LARH 1L9MA 3ZE2F 4ETQA 2IQ9L 2R23B 5C0IA 3GSUA 5DUMH 3C2AL 4LFHD 4M3KB 1MWAL 1C08A 2ICWA 4EDWH 1YPZB 4QXWA 3SDCD 1FFPB 1B3JA 1OTSD 4X8XA 3T0WA 2VSDA 1SYVB 1NAMB 3EJZD 3SGDI 5HDQL 2IG2H 1MQKL 4GW4A 3RJDA 4LLUB 1XGYH 5C08B 1RK1A 2ADFL 1JRHL 1RD6A 4M7JH 4R90H 3RKDD 4FFVC 4ALAL 3IS1X 1OD7A 2CIKA 5SWQB 5E7BA 5EZIL 2BNQD 1GIGL 1K8IB 1NBVL 3UC0L 1U58A 2FD6L 2DQTL 1EEYA 4JO3L 1ZLVK 3HS0A 2DJSA 5DHYB 4ZS7H 1XGRA 3OKKB 3PWPA 4ODHL 3GJFB 5BS0A 1DSFL 1S7XA 3DUUA 4TSBL 2FIRT 5KSAC 4P2OB 4OCWH 1YC7A 2X7LA 3TF7C 1GGTA 1X6LA 2D4DA 1FCGA 3ARRA 2BRQA 5TPWH 2HTKD 3BAEL 5FF6A 1YMME 4NRYB 2ZCLL 1OSPL 2DQJH 1RVFH 2KUTA 2ATPA 1G9EA 3ARDD 5J11B 1J86A 2LVEA 5KSUA 3JV6B 1OARL 4BYHA 1JZ7A 1FYTA 4JZNA 3L3GB 4QO1A 1YEKH 3PF2A 2IAMB 4PLJC 1DUZB 1VEPA 4KAQH 1E0OB 4S1RH 1CT8B 1QVOA 4KK5C 4PPTA 1CIDA 1XGUA 2GJJA 3S35L 3KNBA 1MREL 2X1PA 1EHXA 3G6JB 3IT8D 1ZLWH 5K9QI 1TQCC 1KPRB 3QFJD 5CP7B 2GCYB 2X70B 5F3HB 5GGVH 1RZKL 4AY0A 5E6YA 4UBDC 2XG5A 4LBEA 1RAMA 4EI5B 1XF3A 4R0LA 1Y0LA 3U48A 4U0RC 1YEIL 4WUUA 2WAHA 4F7MA 4MS8C 2CQVA 1OW0A 5I75B 4K9EC 1KSRA 2X4PB 3HR6A 4MXQD 4PJEF 1VFMA 2P43B 3STLA 2Y7QB 1P9MA 2OI9B 3WS3B 3O8XA 2NZ9C 1A5FH 3MBEC 3RDTD 5JXAH 2YD6A 4ZOEA 3MRNB 3BSZL 5D7JD 3F7YB 1TVDA 2BNQE 4F8QA 5CZKA 4PP2A 5DXWA 1CL7I 4JRYB 3W2DH 3FOLB 3IVKA 3KR3L 5DMYA 1UJ3A 4XNZB 3TNNA 2W0PA 3I3DA 2VNCA 1HHHA 4KV5F 2AJVH 3EOYG 4RGMB 2J4WL 3FHAA 3S88H 1AGDB 1WZ1H 3RGHA 1S7SB 4K3DH 5CJBA 4TNWK 3H0TB 4RNRB 4QNPE 1FSKB 1KIUA 1MCEA 1PLGL 1T5WB 3B3IA 5FA3A 3IAGC 4MJIA 4GRMA 4U1JB 3HPLA 4FQIH 1JPFA 2A73B 3P0VL 4ODWA 2V2WA 3SDCC 4CVXA 1UWGL 4BJLA 1MCWM 1Q0YL 3GEWB 43C9B 3EJZC 3HAEB 5T3ZL 3HE7B 3BOVA 4GBXA 5FHBL 3WIFA 1A6AA 3RNQA 5EH1A 5GGVY 4PRIE 1EJ6A 3RKDC 5FV2A 1J0KA 3F58L 4M1GH 5IKCB 4PJAA 3KYKH 3OAUL 2IANB 3PJSB 5B39B 3IFOA 4XNYH 1EV2E 3IDJB 1T83C 4K71C 1E27B 4Y16A 5IIEA 2HMID 3WHXA 1I9EA 4DVBA 2NY4B 1BM3L 1CFQA 2EECA 3QFJE 3NFSL 4FTVD 4YGAB 5EUOE 4WW2F 3GMLB 5IVXA 2UZIH 1LK2A 4RGNC 3PWJA 4PJCF 2IWGA 1MLCB 3DARA 4Y8DC 3QH3A 1IM3A 3HUJF 1G7HA 1Y6KR 4KQ4H 2HTKC 1Z3GL 5MENB 1PQZB 4LLQB 3TT3L 1CXHA 5HDBF 1Z6JT 1XF5B 4NWTH 2BNUA 3MLVL 3L1OH 2Z92B 4HK3N 3B6SB 3FQTA 5SWSB 2XICA 3ARDC 3M8OH 3VGAC 1ND0A 4MB5A 4PJ7A 3B2VH 3ZE1E 3V6ZA 2BK8A 3NGBC 5I1CH 3RZCC 3FAXA 2HYMA 3PHSA 5HYEA 5LKNA 3U1SH 3HKFA 3SOBH 1FZKB 2MJWA 4O58H 4LVHB 3BZ4B 4F58H 2ICWJ 4F9PA 2NXZD 4OLUL 4X83A 4M4PA 4MHHG 1LQSR 1CVSC 3LD8B 4ELME 3BP4A 2WZPD 1NGWA 2B1AH 3REVA 4GXUN 1G6RA 1MCOH 3BD4A 2EYSA 1F4HA 2VDKH 1MFEL 2JIXD 3T0BA 2B1HH 3EYUL 1D5ZA 2HFGH 5CEXA 1OCWL 4G9FA 1ZSDA 4MXQC 3FRUA 4CNIB 5F9WB 4LCYB 2CLZA 5GJSL 1P53A 4M6NL 3V6FB 4OGAD 2DAVA 1NUGA 3BRGC 4F7TB 3OKNA 3IKCA 3KWWA 5DD3H 5D7JC 4L3ED 3KXFA 5KSVA 4Z5RA 5DHXB 4HMCA 1FNEB 3R06A 1MCPL 5FUOL 4PR5A 4AENB 5C0CD 1IGML 2H32B 3GRWH 3T1WA 1VKXB 1RUMH 4FTVE 5BZDB 2VR4A 3QEUA 4NN7C 3SGDH 2EDLA 1PEWA 4I48B 3UJTH 3FB6B 4Q74A 2ZG2A 3QEHB 5F1OB 4XMPL 1NBYB 3S96A 4WWID 4RSVA 4KMQA 3BZEB 1YJDH 4YHYC 1OWRM 2BY0A 4A2MA 4AQ1B 4HC1L 5D96C 4M9OA 5LG1A 3VXRA 4ERSL 1DQQB 1KCKA 3LZFH 4I5BA 4JFQA 4Q58C 2R0LH 1I7TA 2AKRA 4UI2A 3UPCA 4WEMB 3LOWA 1KIQB 3RWGB 1W72L 1HEZA 4DKFH 5FGRA 1S9YA 1X4YA 2EEDA 2IPTH 3B9AA 4Y4HA 4G80A 5TH2A 3MRJA 4F80A 3V6OC 3WO4C 5T5NF 25C8L 5KZCD 1X5JA 1PD6A 4K7PL 3MUGB 3SKMB 4NT6B 3MV01 4MJ5B 2DQGL 4WU7A 2Y07H 1MHPH 4IHOB 5JNYA 4N8CL 4M43L 1NANH 3CVHB 1YYMH 4LKXA 5SWZA 5DVOA 3WKML 2AV7A 4XVTH 5GZND 2R4SH 4FHBD 4G6KH 4FFZH 4S0SD 3KPRA 1FFRA 5DO2D 4YXHL 3VFWA 4WW1A 4KMTH 5SX5H 4WGVB 4MDJB 1X5AA 2B0SH 3MLTB 1MRFH 4WI3A 5C2BH 1FNSL 3OPZL 3ES6B 1XF1A 2YRZA 1WWAX 1L0XA 2EH8L 4L3EE 2FGWL 5L7XH 3O4LD 3IF1A 4POZD 3RWCB 5A43C 4L4TB 2Z8VC 4NO3A 4PTUA 5C0CE 3O6FA 3GKZA 1YYLH 4NJ9L 4NM8L 2NXZC 1I1FB 3MJGX 3I6LD 3T1FA 1D6VH 5H2BA 1TIUA 3DV4B 2R4RL 5EOCH 3PE9A 4ISVA 4KU1A 3DSFH 2HH0H 2ZCHL 1BGXL 3K4ZA 4NCDA 2IBGA 3DHJA 5DWUH 4BSWA 4GMSH 3SO3C 4J3UA 3SE9L 2EDYA 3C5ZB 3I3EA 4MD5B 1IGIL 2C3GA 4ODBD 3MLSH 3KPLB 2EH7L 1JNLL 1U8PA 3NZ8B 3U4BH 1QLEL 5J6HB 5EBGA 4FXKA 3RU8H 4OGAC 2BMKB 4RQQB 1NCBL 4GQ9H 3BIBX 5FYJU 1I4FA 1FRGL 2VWEE 4LCUA 3IYLW 5JPNA 2DD8L 3GSNB 4CADA 2MOVA 4ZPVA 1A3RH 1H3XA 1HHKA 4P3WA 2EXYC 3QHTC 4KVNL 3MRMA 4HJGA 1JL8A 3QXVA 2B7DT 4XAWL 1F11A 1OP5K 1MJJA 3JV4A 1Q8MA 4L8BB 3T2NH 4KH2A 1AY1L 1EEZA 4PLKD 1BIIA 1PYWB 4IDLA 4Y4KA 5FB8B 2O5XL 2B5IB 3MV9D 3PWUA 4HX1B 4PS4L 4RFNC 1CDHA 4N8PA 3SCMD 1CICB 3T8XB 5GIRB 3AXLA 5CBAA 4UTBH 2XOTA 3C8KB 3GJEB 2VZ3A 3G5ZB 3Q5TA 1LD9A 3RL2B 4P4RB 5JR1L 3LEYL 2WBWB 4Y2DB 2W9EH 4DN3L 5BO1H 4KQ3L 4IMLB 4G8EA 3D2UD 1SY6H 2IBZY 2MKLC 4UIMA 5MEPA 5CLWA 4JDZA 4IDJL 4WI8A 3O4LE 1NFIA 2AJSH 3PDOB 2D7TH 2A6IA 1JGUL 3NTCH 2H8PB 1BBJA 5J1AB 4GRLC 3O9WD 4ZFFB 1JNHB 4X4YA 3OAYH 3VG0L 4CMHC 3IJSB 1CFVH 4S1SH 3BP7B 5JQ6H 1NMBL 2FHBA 3WNOA 3EYSH 5DQ9A 2Q3AA 5KSAA 2DKMA 4WI7A 5GZNC 2OL3L 3O3EA 2F19H 4XBPA 1CIUA 3BJ91 2ZOLA 1I8IB 4PG2C 1B2WH 4PY8J 4X7CC 1Q9KB 3U30B 2BSSA 2YPLA 1IM9D 3ZKSD 1QHOA 5C0BB 2Y06L 4ETYA 5I73B 1QRNA 5TE7H 2VDQL 5DHVB 5HVHB 3IU3A 2GJ6B 2NY6D 4TRPH 2HRLA 3QG7L 3BEVB 4KKBD 3QPQD 2R69L 1AGCA 3MGOA 2LE9A 1WAAE 4JKKA 4HLJA 1UWXK 2UYLA 4LPWA 4PRHD 4X7SH 1UH3A 5T3XH 2AJYH 2GAZB 1BFSA 1UM4L 5HBBA 2NYYD 4KI5E 2IH3A 4NHUB 4XZUB 4Z7NF 1EK3A 4UIKH 3MV9E 1EFQA 1OT1A 3IDUA 3K8KA 1M7IA 4DQOH 3NVQA 1CFNB 2EKJA 2VMFA 3AB0C 3LQZB 1QA9A 4JFDB 3VG9B 2FCBA 4UNTA 2FR4B 5CJXC 4PY7A 4PJBB 4R2GC 3O6KL 3LCYA 4P57A 1CG9A 3CDCA 4JREC 5D5ME 1YMMA 2YD8A 1QSEB 3RUGA 1U93B 1D9KB 1QNZH 1RJZA 4PBWD 3OG4B 4TNVF 3VXTB 5BQ7B 4YHZL 5JPMA 1KTLA 2K9UA 1FFNB 2VRAA 1NAML 4YHPA 5E99H 2JB5L 1P4IL 2EDKA 5L2KA 4NBYB 4PGBB 5HYJD 3MBEA 4G8FB 2R1YB 2F54D 4GFTB 4OFVA 3LQAC 1GHFH 1REIA 5TGBA 1VPOL 5JOEA 1ZGLA 4PLKC 1OGAD 4M6ML 5L0QB 5GS1B 4DGIL 5L6YL 2R8SL 2OTUB 1OM3H 5T1KD 1KXQE 4ZYKA 3SCMC 4JN2B 2MQ3A 1HNFA 2DWEB 3WFHB 3CDGA 5EUKB 4ZTOL 1JWUA 2V9TA 3ZDXE 3C09C 1ZLSH 5E5MA 4PREB 4UUJA 3BW9B 1AI1H 4OJFL 3GFUA 1GZPB 2YD2A 4AT6A 3SDCA 1ZT7B 2EYTA 5CJ8A 1TJGL 4X0KA 5ILTL 5J6GB 1VSCA 2FRGP 4Z77A 4PB0L 5AD0B 3OQ3B 3E6HA 3UZEA 3RGVB 4JFZL 1LP9F 4PP1D 1KN2H 2AK4D 4HLZG 5ERWB 3FO0H 1WC7A 5J3HD 3C8DA 2ARWA 5B38A 1QZ1A 3O9WC 1OHQA 2V6HA 4XNUH 1T83A 3C60D 3LKNB 1B4JL 3F62A 4YNYB 3TO4B 4KKAD 3DVNA 3UPAA 2H1PL 5FUZL 5I1DA 5BRZE 3C5JA 4QHNB 4EEEA 1CFSB 2GJZB 3LQAH 1IC1A 5IW3A 1CBVL 3ETBF 1V5JA 3QIUD 1P7HL 2W1NA 1TZGL 4NCC1 2W9LA 3MLUL 4F33A 4Z7VB 3QWOA 4JHAH 4Z7WF 1IGYB 4ZD3L 1A9EB 4U6HA 3Q1SH 3OB8A 4URTB 3U9PL 1WT5C 4HGWA 3GMQB 5HHPA 1VGEH 2Y5EA 4JRXB 2E7MA 5HHVH 1NFDF 2PYED 2NY6C 4YE4H 3BESR 1BAFL 1MFDH 4HUXB 2X10A 4XBEL 3O2DH 3HNSL 3BPNB 4HS3A 2NY2D 4MJ2A 2DLEA 3QPQC 3RZCA 3WLBB 4NUGH 5HYJE 3BWAB 3GRWA 1BECA 3P0YH 1NUFA 5I66B 4NN5B 2NYYC 1C5BL 1I7UB 4R4ND 5CWSA 3QUMB 2CMRL 1QACA 4O02H 4YEEA 1OGAE 1MI5A 3G5VA 3MV8A 4NN6C 4Z0XA 1NMAL 1UCTA 4M62L 2P8PA 1FNHA 4PJIA 3QNYB 3UO1H 5CJQH 3DV6A 1W0VB 3WFEH 1ROWA 1BBDH 3O41A 4PJGE 2R29H 4GKZA 4R4FH 1T0MA 4OFYD 1RHHB 3FONA 1GGIL 5EORH 5C3LD 4RAVA 3NCEB 2PN5A 3GUTA 3P9LA 2A83A 1HXYB 4AG4H 5DJYB 1FAKT 5AZEL 2DBJA 1BFTA 2JELL 2M8XA 3MOBL 4HUNB 5JW4M 3HI6H 2X4SB 5C0EA 3EYQC 3D18B 5IF0B 3ZYOA 4GS7B 4HUWA 5J06A 5BMFH 4EUPB 1KEGH 3NZHL 3P77B 4P2RE 5D2NB 3BIKA 3FOMB 4Z78B 1XT5A 5IGXL 2MCPL 3FKUS 1C8PA 5ICYB 1QOKA 2J8UA 1NGQL 1PY4A 3QNXB 4JE4B 4TUJA 3BKJH 3QBTB 3U9UA 1VESA 1RSFA 5SV3A 4G6FD 1GOHA 3T65A 1UH4A 2OLDA 3QA3A 2D0FA 5I0DA 1TTUA 3BXNA 4M7JL 4YAQB 1S5IH 3R8BB 1HOCA 1T4KB 2DTMH 4J3XA 4BH7B 1TVHA 4ZS6C 4ZUTB 3ZKND 1QYGL 2ADIB 5IR1A 5IVNA 1O5DT 4XXDA 2PYEE 3EOBA 2PUQT 4FRWA 1RIUL 4TVPE 4M4RA 5IQ7L 1CZ8H 3LN4B 4IBLT 4PP1C 3K2UH 1HIML 5C0IB 1YECL 4X7FC 2BERA 4WO4D 4Y2OA 5FKAA 5I17B 3GMRB 4K8RC 4FNLH 2DYPB 3KPSA 3QQ4B 2DLFH 3C60C 5DQJA 4ELKA 1A1MB 1CDIA 3KHQA 4GW4B 4KKAC 3LDBC 3AS1A 4PGCB 3V6OA 3T0EB 1ZVSB 3NCCB 4LAQH 4JO4H 3QIUC 4LVOC 3ZTJH 5CZVL 4PGDB 3EJYD 3TV3L 4I3GA 4U6YB 2PCPB 3LRSA 1NGYB 3TYFA 1FNFA 1HHIA 3T09A 1U58B 5E8NA 4GG6E 5DJZB 4XWGL 1LEIB 3A6CL 3VFMA 4HWBA 4U6VL 5IVZA 1G9NH 5FUCE 4K3EH 4XNXH 4M7ZB 2GK0A 3PL6C 4EN3B 1IARB 2BSTA 2VDML 3MRIA 4YFLI 2HAZA 5BV7C 1EAPA 4D9QD 1VFAB 1DLHA 5KAQG 1KELL 4Q97A 2I9LB 3WXVH 4Z18A 4FQJH 2D7MA 1U8QA 3C6LC 4JQIL 3E2HB 5JA9A 7FABH 5ISZD 1PZUB 2NY3D 3IDYB 5EBWA 1FQ9C 1OLZA 2ATPB 4R4NC 5CILH 3SDYL 1YEEL 5I19L 4N5ED 1FZMB 5D1XD 2X1QA 3UTZA 1N7ML 1E6OL 3DTXA 4KKNA 5CS7A 1ODAA 3AM8C 4MAYD 5FECA 3T0XA 4JZNB 4K8RH 1KB5B 3RTQD 4H0IA 3ARFB 3LPWA 4LSVL 4W68A 2PO6B 2APTA 5FK9A 5FYLD 5CJOL 1NBZA 1KG0A 3KNBB 1RURL 4BQ6A 4Z7QE 4G6ML 4WDIB 1JPSL 4KTDH 3DGGA 2JIXA 4P2YA 3WDIA 4D3CH 1JP5A 1SY6A 4OSUL 1U0QA 4I4WA 5E6ID 5J12C 1CD0A 1JF1A 3MRKA 3MTRA 4LSTH 2AEIT 2Q20A 1K8DB 1E4JA 4R0LB 4PJDA 3EOAA 4LLYA 4WUUB 5EU7E 4JQVC 2EDQA 2R9HD 3PGDB 2Y1VA 4PB9L 4I3RL 5IW1B 4L9DA 3MCLL 4I0PA 5F44A 4KZDH 5KVFH 3WN5A 1UB6B 1BIHA 5EA0L 3PP3H 3W9DB 2ED8A 4KUCF 3LV3B 2GTZB 2RR3A 4D94A 1N5AB 3UJIL 4HKXA 2FO1A 1R5VB 4PP2B 2DIBA 3RBGA 4UT6L 5F9DC 3TNNB 5I2IA 5C8JA 2YEZA 2H26A 4UDUB 4ZNEE 2PKDA 1GOFA 1NPUA 3H3PL 1AGBB 3CVHL 4JO1H 5L9DL 3D48R 5IHUH 3ZKNC 3LEVH 5JLZB 5I1GH 3BZDA 3HNTH 1YEJL 5F1IB 5FCSH 3SGKC 3T04D 4D9QE 1F2XK 3L3JB 3ULUL 1T0NB 3S5LB 1AD9A 5GSRB 1HCFX 5DRWB 4RMTA 4NQSB 4MJIB 4UT9L 2OR7A 4PJAF 1FO0H 4KXZH 4ZUUA 3G5YA 4NQVA 4OQTH 3MREA 1V7NH 3WDJA 4Y19E 5ISZE 4PRNA 4IRJB 2AGJL 2DM2A 5DEFB 3OXRA 5DTFA 4J12A 5J9PB 1T1WA 4KQ4L 3EUUA 3MACH 2X40A 4UB0H 4LNRA 4J3VA 3QAZB 4GRLA 4EDXB 1XR8A 4HPOL 1UWEL 4M1CD 3EJYC 4OCYL 2W59A 2CLVB 2JLLA 2DM3A 3NN8A 5FYLE 3GDBA 4P99A 4AM0A 5I15L 4J6RL 1RJLA 3QCUL 3GBNH 4X5LA 3VJ6B 5DYOB 3ZDZF 3SGEI 1T2XA 4Z76B 4XC1L 3STBA 5D71L 3HAEG 4TTDC 1FVDA 2H3NA 3DUSB 4PG2A 3G9VA 3HMXL 3VGHA 1T89C 5F8QC 4PJ7F 2YC1A 3D3VB 3VRIB 2VO5A 5C71A 4MLSA 5LBSH 1I9JH 1ZANH 1MEXL 3CCHA 4S1DD 4JM4H 1YPZF 3MV7B 4LQFL 5B39G 2DKUA 3O6LL 2O5YH 3V4PH 2NY3C 4JFHE 3EGSB 4PGEB 4H8WL 2VE6B 5IK3A 4N5EC 3GSNL 5D1XC 1HQ4A 1AR1D 2VDKL 4PJ5B 1Y18B 1FL5B 2IBBA 2WIMA 3RTQC 4QT5A 1MJ8L 5IMLA 1Y6NR 3MSPA 3BX7C 2N1KA 3K80A 4O51B 2ESVB 3VFPB 4YHOH 4H0HB 1Z9SA 5F9OL 3PNWB 2BFVL 2XZCH 3QHFH 5I8EA 1OAZH 3SJVD 4L4VA 4N1CA 1FL6A 1U8MA 1F3DH 4NZUL 3H42L 5BZWA 1PZ5A 5CJXA 1CU4H 3D85D 3NAAH 3GSOA 2VDNH 4CU8A 3FO9B 4GAGH 4PJFA 5E8EA 5EOCJ 1IQWL 1X5ZA 3U82B 5E00A 5ITBL 2P5WE 2WBJD 1KCUL 4KWUA 3I02A 5I1KH 5I8CA 3PWNB 1OAQH 3FAWA 1A6UL 2Q86A 2E6PA 1UCBL 2R9HC 6CGTA 4EZMA 4Q9RL 1A6WL 1C16B 4MWFA 3MXWL 1D5ZB 1MJ7L 3TPKA 2P5ED 3CNKA 5HHMB 3L5IA 1WAAA 4WTZA 3NFPB 5H37G 2NXYD 2FLBT 3RPIA 1JVKA 2NMSA 1EO5A 4GT7A 2P1YA 4BFEA 2KDGA 3NIGE 5AYUH 4O4YH 5IFHL 4P5MB 5T1MA 3KWWB 2BY2A 3QO0B 4OZHB 1N2RB 5DK0A 1OSZA 1E4WH 4Z5RB 1W0WA 4OCLC 3OR7B 4XMKH 3BUTA 3SCMA 1A6VL 4CMMB 4C58B 3MBXH 4DW2H 3RWHB 4C57C 1EBPA 4YBLC 2O61B 1HI6B 1DQLH 4NQEB 2ICCA 1G7LB 4NKMA 3D69A 2OS7A 1WBYB 1IGFL 1U91B 3OJDA 3QDJD 2APWA 2VZUA 4U1LA 4HS6B 4NFCA 1FGNL 1B0GA 3L6FA 4QRPB 1ZEAH 4O9HH 3ZYZA 4LVNB 3L3IB 3HI5L 1NKRA 1X4ZA 4X99B 1CFBA 3OGCA 1FBIH 2CDFB 3ARED 3O9WA 4GKNA 4WHTA 1PG7H 4M1CC 3R1GH 4QRRD 1INDH 2AKRB 1GJIA 1QLFB 3BUYA 4X7DC 5F89A 4LP4A 3DX9A 1YZZA 2F9BT 4X6EB 2HFFA 1S7TA 5M95B 1S9YB 1IFHL 2R1XB 2UWEE 5DJ0B 5HHOE 4Y4HB 2KL6A 4UT7H 4QRQA 5C0GA 3QRGH 4FQHA 2JCCB 2W60A 3NH7L 4XB8A 4WHCA 5JW3L 2NY1D 4XP4H 4UU9B 4EIGB 1J7VR 5D93B 4PJ8B 2E6QA 2XZQL 4U1KA 3G6AB 1DEEA 2BY3A 3DSNA 2EEBA 4S1DC 1WT5A 1RULL 2IC2A 2F5BL 5AYQA 3U6RA 4D9RD 1KLUB 5CGYD 1AXSA 4RDQF 4QXUH 3HC0B 1P7QB 3TLRA 4JVWA 5KTEH 1B0RB 1PKQB 4AEIH 1XGPA 2P5EE 2Z9TA 3OAZH 3VFWB 4YXLL 1L4IA 1A9BA 4DGYL 1AR1C 4PRHA 4JFFA 5GISL 1YNKL 3HE6D 3VWKD 1CFTB 2F58L 2BOBB 4N8VB 2KZ1B 1JHLH 1CL7L 2XWJB 1CE1H 3QHZH 3QG6A 1G7IA 1VDGA 3EYOB 1EFXB 1U8LA 3OKEB 4A6YH 1K2DB 1RJCA 3E3QC 1UVQA 4NO3B 2NX5D 2X4UB 1BVLB 4JFPA 3O6FB 1INEH 3ARBB 1VACA 1WCBA 4L3CB 2ZCKL 5BJTA 1ZAGA 4M8VA 2HFEB 5AWNH 1M4KA 1JNNL 1WISA 1CE6A 4ISVB 3TZVD 4NQCD 2LFGA 2ARJA 3DIFA 5EPMB 3QDJE 1U3ZA 4XPTH 1ADQH 4F7CB 3ARGB 4OZIA 2YPKB 3QO1A 2C3VA 5TE6L 1T7VA 3JTTA 5FXCH 2P8MA 1R5WA 1WBXA 4YHLL 5AZ2L 2Z91A 2J5LB 4JR9H 5GSVB 4F37F 2NXYC 4DUXA 1R0AH 1AIFA 2F54A 5LVEA 1MHHB 3CLFH 3O0RH 4OFIA 4RFEA 1EMTL 3FN0H 4QRRE 1F2QA 3N1FC 1AKJA 2VUOA 2LU3A 3IRPX 4LCUB 5H35B 3D0VA 4EBQH 3WMSA 5DJ8A 1K6QH 2OR9H 4Z0BL 1HHKB 1QFWM 1T22A 5CD3B 4HJGB 1LK3H 1I3GL 2NY7H 2XA8L 3MRPA 1DEDA 3VDCA 1KCRH 3L5HA 4XMLH 1IAKA 4JY6A 1MUJB 2M26A 2IJ0C 4X6FB 2QQLL 5IESH 2WP3T 5DMGD 3U2SA 4QRUB 1D5MB 3AXLB 5CBAB 1JGLH 4OZGA 5ELIA 4L8CA 5IHZA 4QXGH 3P9MB 4KGLA 4IJ3C 2AK4A 3WSQL 5E08L 1CLZH 3RWDA 4XPAL 4LU5H 2FJFB 3SGEH 5JHDB 3MODH 5GGRY 3TCXA 1R3KB 3TNMB 1IKFL 3C60A 1T21B 4X6BB 2DQCH 1IL1A 3F7VB 3QUKB 3QUML 1B2WL 3AGVA 2HN7B 3RIFK 1NFIB 4YDJB 3V8OA 5I1LB 3MNVB 3S4SA 3I9GH 4XNQB 3U7WL 5DFVD 3VWJC 3QIUA 4YH6A 2NX5E 3IJYA 3ZE2E 4NQDB 2VLME 4OT1H 4IIQC 3JWDL 3MCG1 4H20H 5HDLA 1FIEA 2AEWA 4NWUL 3W0WD 3WYRA 3L3DB 4NQCE 2E9BA 4MA3A 4GW5A 3PL6A 2WM0A 3IETA 2HKFH 1F6AB 1EJOH 5CGYC 5DJ6A 2XQYG 5GGQL 4UV4L 2HTLC 4MMZC 4YUEH 2F8VA 1LEKB 3FT2B 4UINH 4XRCA 5E8OB 3TBTA 2AI0L 3AMKA 3C6LA 3ZTNL 2VZSA 2WIIA 2NY0B 3HE6C 1PG7X 1S7RA 3VWKC 4P46D 5CBEA 1UG9A 3O11A 2ZKHL 1RK0B 5EU6D 3U79A 2IALB 3AM8A 3HR5A 4OF6A 3H3BC 1GPOL 4JO2L 2EYRA 3MGOB 1T2JA 3KPOB 3GK8H 4QOKD 5DUBA 2VIRA 4LLAA 2UYLB 2XRAL 4NNYB 1S7WA 2HP4A 3LPFA 4V1DD 3LKRA 1C1EH 1N5YL 1H5BB 2HJKB 3B5HA 5C0DB 1NDGA 4HQQH 5FYJL 4OFYA 1NGPH 5IJKC 3RUGF 5MI0C 3TZVC 1NGZA 1JWMA 3IFPB 1JGDB 3BFOA 1FO0A 2C4FT 4WFED 4OQTA 1FPTH 2R2BB 1MAJA 3GMNB 2C3WA 1YEFL 4HF5H 1I1YA 4EKXA 4OKDA 2R2CA 1HZHL 5EWIH 3TVMB 4A6YB 1A0QL 3G04B 4LSSH 1YMMB 1FIGL 1QFWI 4P49A 4WHDA 3REWA 4GSDH 4FABL 1D5XB 1W0YT 5F21B 4ESKA 1RJZB 4G43B 2R2HB 3ZMRA 4AEHL 4PJXA 5K9QG 1X7QA 2F5AH 4HK3J 5GJTH 1DQJB 1H3PL 1EZVX 4YHPB 2DRUA 4S2SA 3U36A 2GY5A 4Q0XL 4OIIL 1UQSA 1C5CL 1RZ7L 4UZGA 4DGVL 3QJHA 1TJIL 2J3SA 4FQLH 4OF8A 5TFSL 4XX1E 4JZJC 4BQCA 3GIZH 3OGOE 1WIPA 3P4MA 1I1AB 4PJEE 5E2UL 1M6OA 5DMGC 1M7XA 3TPUA 3OR6A 4LKCB 4MXVF 3UDWC 3SGKA 1JWSB 1OD9A 1HK6A 2QHRH 2FBJH 4KK9D 3F5WB 1NC2D 3ECBA 1N26A 1KTRL 4MQSB 1I8MB 4M5ZH 1LO2H 4LRIC 4JDTH 3HZYA 1ED3B 4ODVL 3PXJA 4CVZB 4C56D 5F1NA 5JXEA 4ZO9A 4FQXD 1ZKAA 2BVUA 2DTSA 2CUMA 1NDMA 4XCNB 5JTWA 1MRDH 5EU6E 5LCVL 1JYNA 4YDVB 1A6TA 4ZFZA 3MRGA 2BXZA 2DI7A 3CFJA 5EBMA 3E0GA 3O2WL 1FNLA 5GGUB 2Y36H 4Q2ZB 4QOKE 3BYYA 2NCMA 4H1LH 1KB5L 1WC7B 3L3KB 2BNQB 3WJJC 3L95A 1YEHH 3GI9L 3HZMB 4V1DE 5TE4H 2Q8AL 1X5FA 3DX6A 1AQKH 4JM2A 4G5ZL 3VFUB 4TTGA 2VDRL 3DYPA 4ONFH 4WFEE 2A2QT 4X7TA 3NACH 4RIRA 2CK0H 4OLZL 5C07D 1T89A 4JGUA 1CQYA 4XPGH 1P6FA 1RUPH 2DDQL 4YR6A 4O02L 3P0GB 4M48H 2JJTC 2NNAA 3BDYL 2V7NB 2KZWA 1D5BB 3SDDD 2DM4A 4N9GB 5E56A 2CR3A 1XH3B 4FXGA 3MLWL 1UKSA 3QUXD 4PGZA 3ARDB 5D1XA 5DD0L 4I2XA 3VGAB 3H9HB 4HG4J 3NGBB 4HJJH 5EZJA 3V4UL 4PRIB 3RTQA 3VI4F 3MRDA 1AH1A 4WI6A 5C0ND 3HUJE 3OWEA 5JUEH 5FOBB 1KJ2H 3SKOB 2AV1B 5HDBE 3T4YB 1XFPA 3H3KA 3CH1A 4JANB 3BKCH 2AQ2A 3L5WB 4Z0XB 1ZLWK 1GCFA 4M8QB 2BOCB 2DIJA 2NZIA 3BN3B 3QFJB 4ZSOA 5EUOB 4KDVA 4M61B 3D5OF 3O3AB 2CGRH 3DMMC 4NO0B 4Z9KB 4F8TA 4IOIA 2V7HA 2J8HA 1T0MB 1N4XL 1J87A 2W07A 1F4YH 1U8NA 4C56E 4RAVB 5CCKL 1MFBH 3PDDA 1DBJL 1M7DA 3KLAA 5E2VL 5KSBF 1FGVL 3WO3B 3CXDL 4KTYA 1FAIL 2AEPL 4BFBD 1S7QA 3VD7A 5C0EB 4LF3B 4NNPH 2DJ4A 3RDTB 1DBAH 1BD2A 4YEFA 4HUWB 4NNXA 12E8H 5C9JB 5D7JB 3ROLB 3T3ME 4LAJH 4N0YH 1H15B 5F7NC 4LEOB 5INDA 4LSQL 3MRRA 4TPRH 4WI5A 4M6AA 3K1KC 2FX9L 2E7CA 2AABH 5DJAA 3QI9D 3RWJB 4ELMB 5BW7C 5C07E 2Y5TB 3MNWA 3OF6D 3U9UB 3JWOC 4NN7B 4KK9C 3ET9F 4PJBF 4K7FA 3ELAT 3BP6B 5CINL 1HDMA 4EUPG 1R6VA 1WICA 4UQ3B 2D7NA 4N0RA 5ID0B 1QD0A 3G6DH 4NPYA 5D6CA 5CIPH 4IEFB 3FL7A 3LIZH 3AMLA 5FGCE 5FIEA 1SVCP 1RI8A 1AR2A 4WEBH 1SMAA 4GAJL 3NPSC 3DX8A 2ID5A 3V4VH 5HHQB 1DDHB 3FFCA 2NY5L 2IADB 1OVZA 2FEEI 1G6VK 5FKAB 4GMTL 4L8SB 5B8CC 1BZ9A 5GGRA 3FB5A 1P6AB 5IFAH 3F6IA 2QQKH 5CSBA 1WIOA 3MXVL 5IG7A 2DQHL 3T2PA 5C0RH 1N6QH 32C2B 1ADQA 4X4XA 1PSKL 3WO4B 2VXTL 4FTVB 4JKWA 2HG5A 4OCRL 5LGHL 1CDBA 5CD5D 3OSKA 1SJHB 4YDKL 3DGCR 4XP9H 3TYFB 5LQBL 2P8LB 2OJEA 1HSBB 1HWGB 3HG1D 2OSLB 1F90H 1FC2D 3A67H 1KTDA 3CMOH 5K9OB 3JWOH 2GK0B 1GXEA 1MHCB 4D9LL 3QUXC 3DNKA 1A7RH 1RHFA 1WCQA 4MB3A 4JFOA 2VDOH 1DE4A 2AP2A 2BCKB 5E1HB 2QADD 5MP6L 3QZWB 1ETZA 2P42B 5EDXA 5C0NC 1BQHB 2IF7A 1A14L 1IC5L 2EIZA 5J13B 2XZZA 3BD5A 3V5DA 1FL3A 1ONQA 2I60H 2EIBA 4H26B 4RRPA 3TGXA 2C1OA 3WFBL 3EYVB 3SJVA 1SVZA 5EO9B 1FG2A 1UZ8B 2M2DA 1UXWA 2CDEB 1CGTA 2YD9A 3V5HA 3D85A 5C09A 4F15C 4FOMA 1T2QH 3PQYD 1YUHA 1KEML 4PJDF 1MCCA 2OZ4L 1AD0B 3PGFL 4MD4A 2Z31D 4S1QL 5DRZA 4JFEE 3HB3D 2I5YH 5KG9A 4LPYA 3N9GL 4J7RA 2VN7A 4AL8H 3H9ZA 2XPGA 4LHUB 4RFOL 2D0GA 5E2TL 5T1DH 4QTHA 1MCWW 1JPTH 4PTTA 1WF5A 5EU5A 1IE5A 2VXQL 3R0MA 2RIKA 1BP3B 1VERA 3EOAB 4JFXA 1RUQL 4LCWE 4JO1L 4HULB 3B9VA 1H3GA 3KYOB 1Q1JH 3RJQB 2BVPB 4L3EB 3PHOA 1QR1A 5FKPB 5A3ID 2ZP0T 2YUVA 5GZOD 4YHKH 5I1JL 5C0CB 2NTFA 1XCQA 2FX8L 4HWNA 1QLRB 4RMSA 4X6DF 5FHAH 2W9DH 1PJ9A 3QULB 5DDHB 2DQEL 3QI9C 1FVEA 2ZJSL 4HXBH 4HKXB 3IDGA 1VGKA 1P4LB 3TT1L 2W65B 4Y4FB 1IAOA 3HG1E 5I2IB 1BQLH 1NKOA 2XACC 1OTTD 4RISH 4FZ8H 3BMWA 4EIZC 4E42A 2VLRE 2QBWA 3ULVH 3LH2H 3QEQD 1XEDA 5IMMB 3Q2CA 4P9HH 1I9IL 4ODUB 5C0FB 3WEXB 1CGYA 4NKDA 1FCCA 3VDBA 5I30L 1AD9B 4NJAL 2MMXA 4QRRA 5GRVK 1KF9B 1F5WA 2DQFA 2HKHL 3MREB 3V8CA 3OKLA 1TJHH 4Z95L 2OYPA 5IB3B 4JKPL 3MRFA 3GNMH 1E6JL 3VMPA 1TMCB 3VWJA 1ZANL 2A9ML 4FQ2H 5JOFB 4IIQA 4GW1A 3F12A 1XR8B 3FQNB 5KZCB 1EGJH 1QBML 3S5LG 3SBWC 3WIHL 1K85A 5CD5C 3FO1B 3NN8B 3N85L 4OZ4B 1SJEB 2A38A 1RUAH 4OLXL 4PD4J 2D3VA 4M7LH 4OCXH 1GGBH 1R3LA 1J8HD 1MY5A 8FABA 5BOPA 3MQIA 1FVDB 1R5IA 1MIMH 2DI8A 4L8DA 1NSNH 3O45B 3RA7H 3VFNA 1T80A 3QQ3A 2QADC 5SX5K 1K4CB 3HE6A 2X4RA 3MJ8B 4G9DB 3VWKA 1JK8A 3BKYL 4QY8B 3G08B 5KS9A 1GZQA 2ITCB 2WUCL 4RZCA 3O4LB 2C3XA 3S37H 3HFML 1BFVL 3Q0HA 2AEQL 3G5XA 5DJDA 3RAJL 2NLJB 4JJ5B 4JFYB 5I6XC 5LAXA 1E28A 2B20A 1RUKL 3FQXB 4PJFF 5DLML 5IJKA 2X9XA 3TZVA 3G9AB 4JPIA 1XR9B 3GZKA 3V7AE 4KFZC 2IQ9H 1I75A 1A8JH 4XWOC 3C2AH 1MWAH 3K8LA 3HB3C 1G9ML 3GMOB 5I1IL 4RA3A 2OP4L 5ACZA 5MEQB 5HDQH 3S34L 5ICZA 1MQKH 2E3VA 2D31A 2ADFH 1ZT4B 2GW5A 1JRHH 5FYKD 4OI7A 1I8KB 1F3JB 2LAGB 4ALAH 4Z7NE 3EW3B 1NGXA 4H1LA 2P24B 4HWZB 5EZIH 1GIGH 1MCIA 3UC0H 1NBVH 1KCSL 2FD6H 2DQTH 1UACL 3BPOB 4JO3H 4XP1L 3FQWA 2I25N 4IRSC 3EO1B 5GZOC 3NABL 1YN6B 4WU5B 2FL5A 4X4MA 2CKBB 3RPIB 5HYSA 3H6JA 2X42A 4QXTB 2L7JA 4ODHH 3TIEB 2KBGA 1DSFH 4YGVA 1FZJA 1YN7A 2V2TA 2XTJD 4JZJA 4KJYB 4TSBH 3BPLC 3VFOA 3UPRA 3CSYB 4ODXB 3MJ7A 3MV9B 3TWCL 2JJVA 3BAEH 1OTTC 2ZCLH 3SCMB 5SX4I 3UDWA 1DFBL 1OSPH 1NCAL 4LLDB 1DANT 3SN6N