1T0PB

Structural basis of icam recognition by integrin alpahlbeta2 revealed in the complex structure of binding domains of icam-3 and alphalbeta2 at 1.65 a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-L
publication title An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0pB00
1UH4A 4KGJA 4P4KD 1J1XH 4X6FA 5DYOB 4PTUB 4EOWH 1ITCA 4Y16A 4HSQA 4P23C 1N4XL 3B2UD 4ELKA 4ONGL 4G9FA 4OJFH 3LRSB 1V3LA 4JGUA 5FYKL 1MHCA 3DROB 4LKXB 4HGMA 4CMMB 4NKMB 4NPYA 3AXLA 3TFKD 3G6AB 3BZ4B 3KJ6H 4K8RC 4WEUD 4MS8C 3QFJB 4ZSOE 3MRDB 2BRQA 3DVNB 5HPMA 4YXLL 3MNWA 2ICCA 2R4SH 2MSPA 5E9DA 4QHNB 4NWTL 4AEHL 1EX0A 1RIUH 5F9WB 1EXUB 1P4BH 2Q7YB 5IROC 4NFDA 4WDIA 4BH8B 4U1SB 12E8H 2CGRH 4IJ3B 4HKBA 3HI5L 4GQ9H 1CR9L 4XVJL 5ALCL 3IAGC 1Z0NA 4LDOB 4WENB 1WGOA 4P0DA 3QFJE 4JG0L 3C6LA 4HKXA 4P5TA 3RPIB 3WJLC 3D9AL 4D8PA 4QXGL 4H8WC 3QIUD 4NZTL 1A21A 1IFHL 3UTQA 1J1PL 3GI9L 5EUOA 4JCLA 2EC9T 4TQEL 4ZD3L 3WL9A 3QO0A 1NCDH 4U1GC 1LILA 1PW3A 4KI5C 4XNQA 1QLFB 4M7ZC 4CNIB 4LARL 1T5XA 5EO0A 4YHLH 4PGEA 4E41D 5DJ0A 4NKOB 1QFWH 3MXWH 3GSUA 2FNBA 1F58H 2AXFA 4NO5B 2XTLA 15C8L 4PGBA 3GB7A 3H7BA 4B53A 2JELH 3R1GL 4Y5VB 5T3ZH 1K8IA 1UWXK 4Y8DC 5HHQA 2QV2A 1JPFB 3HA0A 3IS0X 4BH7B 1IEAB 3Q6GH 3QWRD 3MUJA 4LVEA 5FCSH 2I25N 2NY1B 2CRMA 4K7FA 3BP7B 3QDMD 3GMPA 3GJFK 4PJAF 1YPZA 3MLTB 4JRYD 3MMEA 4BKLB 2X1OA 2QSVA 1NGQL 4GXVL 3PIQB 1KPVB 4F15C 4M6AA 4FXLA 1OB1B 2EYRB 4UBDC 1NBQA 2C1OA 4PR5A 1DVFB 4RAUA 3QHZH 3MLZL 3KPSE 1NMBH 1K4CA 2J8OA 3SDDA 1CN4A 2F58L 3VFMB 2CMRH 3VXOB 3BP6A 4OCXL 3W81A 5DC0A 2AERT 5L2JB 1UC6A 2ITDA 3W11D 1A1OB 3WNLA 2AK4D 4C54A 1XCQB 3GKZA 5DRXB 4AEIH 4HLJA 1FBIH 5IW1B 4JGJA 4AL8L 6CGTA 5GS1C 2HN7B 4X4XB 2R8SL 1AQKL 5I73C 4X6FB 2JKXA 3NCFB 4FNLL 4ZUTA 3LKSA 4QXWA 3HAEG 4Y16B 2IBGA 2BJMH 1HNGA 2EDLA 4ELKB 1KULA 3VW3H 3MRCA 1QKZH 1G7MB 1MHCB 5KSAC 1C1EL 4NPYB 3CDYA 4YQXH 5GRZA 1EPFA 3RGVA 1DR9A 1E4KA 5HPMB 3VDBA 3O2WL 5JLZA 2R1WA 3MFFA 4MAUL 5E9DB 3L1OH 3D0LA 5TQ0H 3HNTL 1ES0A 4JDTL 3ZSTA 4RQQA 1A0QL 2MQCA 3U1SH 4WDIB 3NAAL 1TXKA 2HFEA 5H94A 3ILQC 3IGAA 3K7UA 5EUKB 2BZDA 4BQ6A 4HKBB 3HMWH 4U05A 5D2NC 3ARBD 3QG6A 3K4ZA 4WI8A 3KXFB 1M7DB 2KDGA 1R24B 4D8PB 4RMWA 1T03H 4M8QA 1T2QH 2VH5H 1E6JL 3TJEH 5CD5D 4JZJB 4OZGB 2BERA 1LO2H 4LSDA 4XNQB 2YSSA 1RZFL 1TTFA 4R3SB 1GAFH 2P1YA 1J86A 4ODVH 4UIKL 3JUYA 4QY8A 1XCTA 3V2AR 3L5HA 4KDTA 4YIQB 5DJ0B 3LKPA 3KXFE 1OTSC 4GO6B 5M95B 3GB7B 5ISZD 1ORQA 4WI9A 3R8QA 5SWZB 3NGBB 3NIGE 3T2PA 3VRLF 2LVEA 3ZMRA 1OM3L 4OZGE 3OJDA 4XHJD 2EDFA 3MV01 5DURD 4LCCC 1UB6B 3EKCA 5T1KD 3VD3A 3EIFA 1QLEL 2EDRA 2Z35B 3UP1A 3EFDL 4ODUA 4R4FL 1UCTA 3GMPB 1EO7A 4OLUL 4Y4HA 2Y5TA 1UENA 1CDCA 3ZDYF 2PTTB 4M1DL 2BMKA 1QRND 1MI5A 4J7RA 5E00B 2HT4D 3MJ7B 1ZKAA 1B2WH 2B0SH 2C1OB 4PR5B 1T2XA 4TVPD 1VFAA 3W0WA 1G1CA 4RAUB 5I15L 3ZHLA 5EOTB 4JN1H 1LO3H 2DJSA 1K4CB 2VR4A 3DX9A 2VABA 5EZIL 4YJZL 4P23A 1ZHLB 3F58H 4F9PC 3RWFB 1QOKA 4X9GA 3MUGB 1JUFB 2OI9C 3U9PH 3SGJC 2DRUA 3GI8L 2ITCB 4NRXA 3E6FA 3HG1E 4D3CH 4CVZA 3H8NA 1QBML 4PJDF 1CG9B 3IB4A 3HI6H 4POZD 3KDMB 2Z31B 4JO2L 1BJ8A 4YBHA 4XNUL 5IROA 4ZUTB 5JHDA 3LKSB 2R0WH 3QDJB 4CUCA 5HVFB 5CD3A 4MWFA 3IDYC 3MLXH 1OTTD 2X4SB 2CXGA 3ZTJG 3THMH 4X6CB 2VISB 5J1SC 4Y1AA 3MRCB 5DFTA 4Q6IB 5C0GA 1F3RB 2PTUA 4PYGA 3CJJA 4MZ3A 1U8NA 5JZ7C 3FRPA 4C4KO 1F11A 5FDWB 3WJLA 5KVGH 1FG2A 3D0LB 3O9WD 3DX7B 3NCYP 4MQ7A 1ES0B 4NO0A 4G8GA 5B39A 4FFZH 4LHUG 3LEVL 3QDJE 1EHXA 5C0ND 1RULH 3BUTA 3IGAB 1U58A 4X6CE 2DBLH 5HYIA 4L5FL 3TBWA 4IRSC 1H3WM 3INUL 3LB6C 3QI9C 4PD4K 4O2EB 4Z7UF 3GBLA 5IKCA 3DSNA 3HPJB 1Q1JL 1FDLH 3EOAA 3BKJH 3NA9H 3BI9X 4Z77A 4M8QB 3P0VH 4PV8A 2B1HL 3ME0A 4X9IA 4OAWA 1DUYA 2YSSB 4HH8A 4I5BB 1JNHA 2ICWA 5ID1A 1G9NL 2BNQA 1HHKA 3BKMH 2YRLA 3C60C 3SKNB 1H8SA 2HRLA 1QNZL 3RAJL 5B4MC 1S7UA 2W9DH 4DOHB 4PBWD 1YNLL 4HEPG 2GY7B 2DKUA 4CDHA 4ZUSB 4HH9A 1Y18A 3VGEA 4DW2L 1INDL 4KTDL 3N06B 4JO4L 1DBJH 2UZXB 4PJFB 3U4EA 5I1JL 1JPGA 5CKGA 2EDYA 4JEGB 2X89A 3RVXC 1FP5A 2OQJB 1A7BA 2Y5TB 5C0CB 3SO3C 3HUJF 5AWNL 3FB7B 5F7UA 1MI5B 4DOHE 5F93C 2LTQB 2GITB 2EEBA 5GS1A 3KWWA 5DQ9A 4NFCA 1QFOA 1DSFL 2VUYA 4KQ3L 3DX9B 2VABB 3KS0J 4P23B 2C3VA 1NCWH 4PJFE 4WI7A 2NMSA 3MRPB 1IE5A 1B88A 4NHUB 4GKNA 3HNVL 3OF6A 5KSAA 3IFPB 1I3RB 1HE7A 5C0CE 4PB0L 5DQJA 4DGIH 4WI3A 1OF2A 1DUZA 4XPGL 3ZLQC 3TT3H 4G6JH 4ZAKB 3ULUF 4M1GH 3BH8A 1PY9A 3UCRA 1Y6MR 3QUYC 1GGBL 4HMEA 3CUPA 3GNMH 2ZCLH 2MKWA 3DI3B 3QSKB 2C1PA 2VZOA 4MYWB 4IMLA 5CP3A 3L5JA 3O2DL 2CIIB 1L0YA 5D2NA 5FA4A 2DQFB 1P5VA 5FYJD 1S9VB 1NFDF 2P45B 1O5DT 4DKFH 4LHJB 5F88A 1HI6A 1IGIL 4ZYKA 1F11B 4L3CB 4HWBH 3VH8A 3RNQA 4BK4A 1FG2B 3T2NH 1UM4H 4MQ7B 4OD3L 1LEGA 4JPVL 5BS0E 4NO0B 4G8GB 4JG1H 4AM0A 4KHTH 2BCKB 3GMRA 1F6FB 4K8RL 4K94L 1HN1A 3K4DA 3LN5A 3BAEL 3WDJA 4OCYL 2YR3A 1G0DA 5C86A 5IBTH 1W0VA 4BSWB 2YD9A 4U33A 4R2GB 3CZJA 1GSMA 1PG7H 5TPWL 1LNUB 1VDGA 3BMWA 4DWHA 3EOAB 3TYGH 4A2MA 1EBPA 3CK0H 2DN7A 4LFHD 2NY4B 1IGMH 4RGMC 4EUPH 2IQ9H 3UYPA 4LCCA 3KG5A 5FXCH 5GGQL 1J11A 2QSQA 1I9IL 1VPOH 5ID1B 3EDFA 1C16A 2OSLB 2QQQA 5F72S 3KYKH 3VRJB 2ARJA 2Y4SA 5I8CA 1KJMA 1ZGLP 2H41A 3GJFA 3GSWA 4KUCD 2X05A 5SWSE 4Z0XB 1S7UB 5DFVD 1IAKA 4F15B 5FYKU 2UVEA 1KTRL 4OD1H 3RWDA 4I77H 3BOVA 3NCYS 3MGOA 3HNSL 4K3GA 1YEKH 3NN8A 3QCTH 4HH9B 5DJ8A 2P43B 2VMFA 1FVDA 4BK5A 2ICWJ 3RVUD 4F9PA 2JLLA 3U4EB 1JPGB 1NUDA 3CFEA 3EDEA 4CRPA 1QR1B 5BXFB 5IHUL 4JFZL 3V0AC 4X5XB 5GGRA 3ROLB 3SGJA 1S9WB 1U3JA 2RGSA 4KJYB 1W0YT 3BE1H 2NY0D 4ONOA 5CIPA 3U30C 1QYGL 4M43H 3KWWB 4K71B 4LCUA 1IAMA 2H3NA 1ZA3A 3W39B 1JGLL 2N7BA 1E6OL 1DFBL 2DQHL 4WHTA 3RL1A 2C3VB 2Z8SA 4OB5L 4ODHL 5DK0A 8FABA 4O2FB 1QSZA 5KSAB 4PJAA 3MA7A 4YDVA 5BVJA 4NO2A 4F3FB 1LD9A 5BRZA 1O0VA 4IRJD 1J0JA 1OF2B 4NT6B 3FCTA 1QR4A 1PDKA 3V6FB 2VWEE 4Q9QH 1IKFL 5DC4B 1OAYL 4Q6YA 4OCRL 3D85B 4X6DA 3AUVA 2VLRA 1A6VH 1JCKA 4U3HA 1UH3A 3SDAD 1F4WH 2VLJD 2C1PB 3DURA 4JO1L 4IMLB 3Q1SH 2DMCA 3KPTA 4UV4L 1F6AA 1JRHI 4AEFA 3DECA 5FGCB 1RJYA 1ZHBB 4IRSA 5F7EH 3QI9A 1BVLA 1P84J 5FA4B 5T5NG 4V1DD 2CUMA 3WLWC 1J12A 3R0NA 1HI6B 2V5MA 4PJBA 3T3MF 3VH8B 4HEME 4HJ0D 5C0EB 4NN7C 5FGRA 3RKDC 1LEGB 3UTOA 3H42L 3S5LA 4AM0B 5C0IA 3GMRB 4R26H 1YY9D 4G80B 4A6YH 1CE1L 1AI1L 3PV6A 3I75B 1FL6A 1U3HA 3M8OL 1W0VB 2EO9A 3A6OA 2FO1A 3C60A 4YHYB 4JR9H 2V7NB 1QEWB 4JLRA 2F19L 1MRFH 1PKQA 3KAAA 2V2TB 2ZUSA 4M7JL 3ZKMC 3TF7C 1CD0A 3BEVA 2VL5A 4M93C 5HYSB 4XMKL 1KNOA 2IPTH 4FZEH 3K2UH 5SWQA 4LCCB 1QSEA 5CJXC 32C2B 3AMKA 2VZ1A 3ZDZF 3FQUA 1F4YH 1A1NA 1DDHA 1Q72L 2ZOLA 5I8CB 3PL6C 1FORL 3GJFB 5SV3A 3LKRB 3GSWB 5CJQH 1GXEA 5CZXD 4DAGL 3BYYA 2W0FA 2X2YA 5ERWB 5B3NA 2O5XH 3LQZA 1FO0B 4U7SA 3ARDC 1MFCH 4QEGA 1S7QA 1UXWA 1VERA 2R9HC 2F8OA 3QUXC 3MGOB 2ZJSH 3NN8B 4N5ED 5HVHB 1RZJH 3ULVH 1R5IA 3TH2T 3ARSA 4OZFH 1TJHH 2FR4B 4RGNE 1SEBB 3NIFF 3FOMA 2DWEB 1DLFL 4WY7L 2OI9B 4PJHB 1J1OL 4MJ5A 2UWEB 5JW5A 3QXWA 3KLHC 1X6NA 2YKLH 2PN5A 1IC5L 4XCFL 3P9LA 5EH1A 5D1XB 5AZEL 3UAJC 2CK0L 4LCUB 2DYPA 2ZUXA 1ZA3B 3QUYA 1NCAH 5ACLA 1DEEB 3UTTE 1IQDA 5DK2B 4LASH 3NIDF 1B4RA 4WHTB 3RL1B 5FM4A 4LSSH 2D31B 5I18L 4LLYB 2V2WB 3D1MC 7FABH 4L9LC 3MA7B 4KHXH 4PJHE 1SM3H 3SGDI 1JYVA 4YDVB 3MCKA 4ZTOH 3N0PB 1LD9B 2UWEE 3MRGA 4OZHF 5CSZA 3WLBB 3FCTB 3D2UD 3MLSH 4GBXB 3F7PC 3W5MA 5I16A 3V6OE 5JR1H 5E6IB 1WLHA 5FV1L 4X80L 2VLRB 5EOQH 4PTTA 5EU5A 1NCCH 3T0EB 2H1PH 4N8VG 4ODTL 4MLSA 1AXSA 4XNZC 4L8CA 3MXVH 3I50L 1RJYB 5TDPA 1A47A 2NW2A 1A7PH 1JPTL 1KCLA 2FX7L 4ODWA 1NLDL 2R1XA 1GHFH 1LO0H 5FDYA 1LO4H 1CL7H 1T0MA 1TJIH 3U79A 4X98A 4TOYL 1DN0A 5C0IB 4EZMA 2AKRA 2H9GB 3GMOB 5L2KE 5HYJA 3T0EE 2HTKD 1AXTL 1F13A 1NC4D 1U3HB 4PRNB 5D8JL 3B5TA 5JPMA 1RMFH 4PGZA 3C60B 2AK1H 5T1DH 1VEPA 5IW3A 4P2CG 2HG5A 3KPOA 3LY6A 3C09B 5IQ7H 2W1NA 3BEVB 5FO7A 5L6YH 5SWQB 4PV9A 1P7HL 3KYMA 1AGBB 1QSEB 2GHWB 1OPGL 3FB5B 1A1NB 1DDHB 5C09B 1HHGA 5C71A 1J87A 2BVQA 5DA4A 2DICA 5MP6H 4WHYH 1G6VK 3DI2B 3VWJC 1RZ8B 3P4OB 4PJXA 3LQZB 1DTUA 1UXWB 4WFFD 4JKKA 2VDQH 1OLZA 3SKJL 4EI5B 4OUUB 4HKZA 2LU4A 1JWSA 4PJ5A 3BZFA 4HXBH 5C09E 1KELH 4BQCA 2CRYA 3FOMB 1KN2L 1UM5L 3WKNA 1TZHA 4DGYL 4MMZC 3UJJL 3OKYA 3IDUA 4G3YL 3JWNC 5DQDL 4I0PC 3QFJD 2AJUH 4ODSL 4L4TB 3VXMA 2DYPB 2DB8A 3M07A 3LKOA 3QUYB 2A77H 1N7ML 4JJHA 3HCVB 3VMOA 1P6FA 1G7QB 3EW3B 1QFHA 5ILTH 1QFUH 2PTVA 3REVB 1UVQB 3WNMA 5LCVH 1BFOB 1SJXA 2QTEA 1TQCC 3SKOB 2EICA 5HHOB 4MJ6A 3MV8A 3MLWL 5CSZB 5D2LE 1R3LA 4L4TE 5I16B 3ARUA 3GSNA 5JIHA 1B4JL 1G7LA 2C3WA 2HJFA 4I18C 3RWCB 5E0QA 1KJVA 5I1EH 4L29A 5EU5B 2VAJA 3C6SB 1HH9B 3MACL 4QRRA 4OJFL 4L8CB 3PJSA 1S7TA 1ZGLM 4XRCA 3RL2A 4WJ5B 5TDPB 4ODWB 1PGRB 4EQ2A 5HHOE 2R1XB 1AGFA 4Y5XC 5DUBA 3ULVF 4HKJA 1LK2B 3TPUA 2W65B 3MROA 1S7RA 3ARYA 2FH6A 5D4QA 2NY3C 2FDBP 3QUMH 4PGCA 3BP5B 3F6IA 5F9DC 4TNVK 4GW1A 5JPNA 5FOBA 5I0ZA 3BT2H 4HGWB 3I02A 3LRGA 2AABH 5F3HA 2NY1D 4FQJH 5ABDE 1UXSA 3PL6A 4HUKB 5TQ2L 2C4FU 2IBZY 4MVBC 1CD1A 3E2HB 4PJIA 1CFTA 4HCRH 2V6HA 4PGJA 3TBYA 4JM4H 2E27H 3ARDA 1KB9K 4KZEH 2UY7A 3QUXA 3WFHA 3QDAA 4GAGL 4CADB 1FRGH 2ARWA 4ORGA 2G2RB 3KYMB 2R0ZH 3EYVA 4LSRH 4XPAH 3FAWA 1HHGB 2CLRB 5F7LB 1YJDH 2EH7L 2HFFA 4WNQB 4I3RL 4IBLT 3MXWL 2A0LD 4OTXL 2XZAH 4HDIB 1YDPA 1ZLUH 3U0PA 4JFDB 3U30B 3DIFA 4PJXB 3STBA 1E0OB 4KXZI 1JF1A 5ECJE 5EO9A 3WMSA 5IHLB 1NCBL 3B8YA 3G08B 4HKZB 4Y16D 5SX4I 1S9KC 1UKSA 1KJ2H 1RHFA 1KACB 4YGVB 4ZFFB 4HWEL 3UPRB 3PWLA 3BSZH 1AQDA 4L9LA 5GRXG 4RIRB 1G7HB 3MRIB 4TULH 4H26B 3OKMA 5F1IB 3WS3B 5E9DD 1DQLL 4MA3A 4ZFZA 1XT5A 5I17B 2MJWA 2V2XB 1NMBL 4LNRA 2FATH 4CKVX 5DWUL 5MEPA 5DR5H 3ABZA 4N0UE 3ECBB 5C6PB 3L3JA 3MBEC 4XX1G 2VDML 4G6KH 3HE6C 1PYWB 1GGIL 2R0KH 2IFGA 3WDHA 3ZTNL 3KXFD 4EVNB 1V8HA 1FYTE 3GSNB 3MJ8A 4L3EB 4PBXA 1TVBA 2HJFB 3D25A 2NY6C 4N9GB 1CXKA 1KJVB 5DMGD 5CEZL 3EO0A 2HTLC 4WFHD 5GS0C 1RU9H 3N85L 3JV5A 5I1CH 3H2WA 4PREA 5I66A 4HFUH 5IJKC 4X5LA 3T0VA 4MMXC 4D9RD 2FL5A 1AGFB 3MO1B 3WSQH 4NRZA 2DIAA 3DMMC 4GG8A 3L1OL 4WW1B 3JWDL 4L3EE 5SWZD 1S7RB 5TE7H 1XF2B 4M93B 1SMAA 1CDYA 4NOFA 5JPNB 4P2OB 3MOBL 3WO3B 1CBVL 3QQ4A 2IMNA 2QQLH 2VRAA 3K4AA 5F3HB 1VHPA 3MGTB 2P8PA 4N0FA 3PL6B 1Q38A 1CCZA 1A6UH 2AJXL 3SE3C 3VWKB 2HRPL 4PJIB 4MA7L 5DJDA 3VWJA 3TBYB 3U0TA 1H3TA 1R3JB 3DV4A 3WFHB 2FB4L 2VDOH 3WFBH 3ES6A 1AO7A 1UYWH 2A74A 2B20A 3UC0H 3ULUL 1OAXH 1Q9KA 1JI2A 1VGEH 5DF0A 3CNKA 4HIEB 3IDMA 1SYSA 2J7LA 4L8SB 2IQAA 1Q9WB 1D5ZB 5C0AA 4YAQA 5A2JH 1HIMH 4GMSH 5GPRA 4GOSA 2B5IC 1OL0A 2Z31D 2H2SD 2GJ6E 4HJGA 3QDJD 4OM1H 3IFNL 4NJAH 2E7MA 1EFXA 5K9JL 2FEDC 3PWLB 5I75C 4U1IB 4KKBD 1WFTA 4XNXL 1AQDB 1CT8A 1V7ML 2YPLA 4OZ4A 4OLYH 4UT6H 1DJSA 4YE4L 3WUWA 2A9MH 4HV8A 2XACC 1ZXQA 4EN3B 4PBVC 4JM2F 5T3XE 2XKNA 3QEUB 4ALAL 3FO0L 5FYKE 3D39A 4TSCH 3UTPD 3HRZA 4KTEL 4ZFZB 3H9ZA 3RA7H 1MCDA 4LNRB 1MWAH 4I18A 5DJ2B 5MEPB 4HUWB 2ED9A 2XRAL 3FO1B 3HRPA 4JFFB 1AIFA 4XNZB 4Q58C 2AP2A 2FJGB 3U9PL 3BIKA 2OR8A 4MNHB 1EHLH 3QPQC 2LVCA 4P4RA 3OMZA 4Y5XA 3UBXA 4D3CL 5D1ZC 2BNRB 1NC2A 3ARPA 5DTFB 1LE9B 3QAZB 4MB5A 3RZWA 3RU8L 1A2YA 4NC1C 3D25B 4YFDB 3T77A 4KV5E 4JFFE 3EO0B 4H20L 4CL7A 3TP4A 4UDUB 3IFLL 2QL1A 2ZCHH 4XB7A 4JQIH 1U8QA 2CDFB 3SGKC 4TVSa 3AY4C 1KOAA 1ZT4A 4ZOEA 4GJTB 3SDCC 4PRHE 2BNRE 2Z8VC 4GG8B 4X4MA 2AEIT 2AAVA 4ZO9A 2HLFC 4FQCL 2WBJB 5C7XH 4Z7VB 4PYHA 2BSRA 2EYSA 2QBWA 2VDPL 3LCYA 2YA0A 1S3KL 3DRQA 4IHOA 5E1AA 2VAAA 3STLB 1I7UA 2CJUH 2A6KA 4M6OH 5FIEA 5C0CD 4F37F 3DBXA 3PNWA 3O11B 5DJDB 1GGYA 1BD2A 1MI5D 1S7WA 2GYSA 5BV7C 5E08L 4V2CB 1MHHA 3NA9L 4NJ9H 1XMWA 4Z7WB 4Z7VE 4NWUL 1QSFE 1EZVY 1KGCE 4KPHL 4W6WB 3S8WA 4L1HA 3MJGX 2W9LA 3HE7C 3HR5B 3M1BA 4IMKC 4P23D 5IVNA 1KT2A 3BUYB 1Q9KB 3PGFH 5I2IB 3IDMB 1SYSB 3VRIA 4U49A 4AYFA 3K8LA 4KDVA 5EZJA 3LQAH 2P5WE 3GM8A 1T21A 3V7MA 4Z7WE 5A43C 1VKXB 2EDXA 4ZAKD 3T08A 4ODXA 3P40A 1U93A 2F54E 4CW1A 4GUPB 4HJGB 5DD5H 1KBGL 5C0RL 1DBJL 4JHWL 5C0BA 1EFXB 1X5AA 5FHAH 3MBEA 1CT8B 4JKLA 1WITA 2BP3A 3ESVF 3EJYC 1TQCB 3HE6A 2GK2A 1BOGB 4XBGB 3L95A 43C9B 5I1HL 1D3CA 5J1AA 5I1DA 3UTSA 4WEBH 4F58H 2QSTA 5AD0A 5LGJB 3QB7C 1ERNA 1CFQA 3DVGB 3K1DA 4LMQI 1B0RB 3VD4A 1MQ8A 3VXPB 4NO0D 4G8GD 2VZUA 1RZ7L 3T0XA 2XIDA 1J8HA 3BPLC 4KK6D 5F97E 1YEDB 4KZDH 2ZUQC 1UJ3C 4CJ0A 1IAIL 4R2GD 1NANH 3TGXA 5J11C 5IJKA 1MRDH 3BXNB 4JRWA 1N5YH 1EMTL 1W8NA 1KB5H 4P4RB 1S9YB 4HUUA 4Y5XB 3UBXB 2NY5C 2C3GA 3DMMA 3HC3H 4RFNC 2NW3A 2LQRA 2WINB 1NBVH 5EBWA 1D5XA 3TT3L 2ZUTA 2R2HA 1A2YB 2NY4D 3RVWC 3T77B 1E4XL 1TIUA 1DLHB 1F02I 2ZCLL 2D9CA 2HJKB 4OIIH 4W6XB 1W2KT 2DTSA 3P2TA 4QXUH 2BNQD 3LMJL 4KQ4L 1LEIA 3OAZH 3RFZC 5IJVA 4AG4H 1OGTA 4HIIA 3Q2CA 4JM2C 3SE3A 1MCFA 1ZT4B 5DEFA 2BVPB 1FFPB 4UBDD 4YH6A 2AV7A 3HB3C 1UM4L 4AIOA 1KC5L 4KHTL 2YPKA 5ADOH 3DRQB 2A6IA 2VAAB 4YFLF 3VXSA 1I7UB 1T04A 3IU3A 1MJ8L 5IBTL 1CLCA 1IC7H 1MPAL 2A6KB 1V3KA 1K3ZA 2IALA 3VFNB 3PNWB 1V3MA 2UYLA 3ZTJH 2XTJC 4U1JB 4F7PB 2FCBA 3GZKA 3HZYB 3H9YA 3H3BC 2OTWB 3EO1A 4HC1L 4NGHL 4KK8D 3QUZC 1OP3H 3SY0A 3UYRH 3MNVA 4GXUN 1R5WA 2IQ9L 3V4VH 3IRPX 2GW5A 1A6ZA 2B4CC 3M1BB 3N1GC 1KT2B 2F9BT 5DJAA 3PABB 4NBXB 4ZFOB 2XY1A 4HS8H 5SX5H 3DRTA 5KSAD 3VRIB 2IAMC 5TE6H 4NQCA 5EZJB 2VLLB 3P77A 1DEDA 5IMLB 3OPZL 1INEH 4OD1L 2ADGA 3R4DA 5DRZA 2H2PC 1MIEH 3EJZC 3D85D 4HX1B 4KJPC 4ODXB 4CW1B 1U93B 3WKMH 1G7IB 3IXTA 1KEGL 4FTVA 5C0BB 3BMVA 3CFIC 3ILQD 3KPLA 5ETUB 1YPZE 3MBEB 3AS3A 3I2CH 5BW7C 4XCEA 1YEHH 3ZE1E 4KK9D 4QF1A 3ZO0A 4P5MB 4OLZH 2E6PA 4G6FB 2FJHA 4ZTPH 4O9HH 5A16A 1RZKL 5D1ZA 1EEUA 5AD0B 2HMID 1CFQB 2QR0A 4ORZC 1MNUH 4GG6E 2G5RA 3P11L 4JFEE 2LABA 4NN5B 4OGYL 2NY6B 5T1LA 3B9KC 4OSUH 3V4UH 1RUQL 2AJSL 1MCQA 1QO3A 3QRGL 2J8UE 3MRRA 5BCAA 3FRPG 4UB0H 1MCIA 2P48B 1BFVL 4DZBA 2GTZB 3SGKA 5F7HA 5E4IA 1FAIL 3AY4A 4W4OC 1OTSD 3U2SA 1HDMA 3C5JA 1MCWM 3PV7A 5B39G 3MLYL 3SDCA 3GKWH 5LGKA 4NUGH 4D9LL 3DMMB 3KYOA 4O00A 5B38A 2RHEA 5EBWB 1D5XB 3QG7H 4YHIB 3OKNB 2L4OA 4FQLL 3GSXA 3SE8L 3BYTA 2SEBB 1F4WL 3F12B 1TNNA 2DLHA 4FQPA 1HOCA 3T3PE 3Q1SL 3IU4L 3U7YH 1LEIB 5IBUB 5C0DB 1T7ZA 5IOPA 3H3PH 5IJVB 2KPNA 2XA8L 2C7UB 3RVVD 4YDLB 5DEFB 4WWID 1G7JA 5IEHB 1RUAL 4L4JA 2PXYC 1I7RB 1MCSA 1PQZA 3GIZH 2AV7B 3LSOA 1QTYT 1CD8A 1ZWIB 1XR8B 2ID5A 3WIFA 4R26L 1E28A 5IMOB 4A6YL 4Q9RH 1WIOA 2A6IB 5F1NA 3HE7A 4IMKA 5FM5M 1K2DB 1FFNA 1D5MA 1L7IL 1JN6B 1M7IA 4JR9L 4LSUH 2IALB 3GRWA 2YBRA 5EZLB 3VFUA 2UYLB 5KSBE 4Z0BL 3N1PC 4P46B 1NGWA 4NQTA 1JZ8A 3EYUH 5C6WH 4QT5A 2B5IB 4F2MA 1UT9A 1MCWW 1Z9LA 2IPTL 2ZKHL 4AY0A 5MI0B 1Z3GL 5FCUL 1DANU 3Q3GB 5TF1L 2O5ZH 3PQYB 4G9DA 4W70A 2BRRH 3FFCE 5CJQL 4QHLA 3VFPA 2YXFA 3LQMA 3IF1B 1UEYA 1JF5A 3S37H 4GBXD 4LAJH 5KVDL 1YUHA 5E6ID 2NLJA 4RRPA 5ANMA 4WV1C 3WFEL 2VLRD 4KUZH 3ULVL 4U1HA 3IXTB 1CWVA 3T0ED 2WIIB 3LEXB 4JANB 3PQYE 3LD8B 4HJJL 3RQ3A 1UJ3A 4F7CA 1P4IH 1SQ2N 4IRSD 3LB6D 4NCDA 4JHAH 5A16B 5JQ6L 1ZE3C 3TO2A 3V5HA 5D1ZB 1U8IA 1QG3A 5GS2H 3L9RA 1JTOA 2AXGA 1FCCA 1R6VA 3QIWC 4TUJA 2D7OA 5I76B 1HYRC 4AMKH 3T0AA 3M45A 2EEDA 1WCQA 1M71A 1U3HD 3S96A 5L7XH 3U4AA 4Z9KB 4DZBB 3VH8G 3C60D 4XBEH 4W4NA 4JM2A 2WWMD 3QWQB 5EU4A 3WIHA 3EOTL 3U2SB 5I1GH 4M3JA 5I71B 1UA6L 3SDCB 5FM8A 4PLKC 1SJHA 1MCRA 4X7DC 4DKAA 2PYEA 5EOQL 4PY8I 4Z95L 1I8LC 1NCCL 4JVUA 5GRYA 2I60H 1QSED 1AGCA 2PCPA 3MYJA 4IDJL 4KMLB 1T5WB 2N4IA 2Q1EA 5IG7A 2PUQT 1U95A 1NCTA 2YRPA 4JPWH 3RVXD 1OP9A 3N1QC 3BQUB 4X9BA 2HKFH 3VGAB 2VN4A 1BIIB 1PQZB 2CR6A 3BPNC 3MOQA 1A6WH 1TJIL 3QUZA 2EDEA 1TVHA 2OJZH 5IM7A 3CPLB 1K6QH 3OAYK 4C56B 1AKJA 4MXVE 3HE7B 3OR7B 3RIAK 5HDQL 1ZHNB 4XWOD 2VOTA 5IVXA 4JN2A 1D5MB 2IEPA 3VI3E 1NAMB 5FF6A 2IAMA 2YBRB 1SMOA 5GGVL 1QBLH 5HTSA 2IF7A 1WICA 2F5AL 2Z4QB 4M61A 4PRBA 1NGWB 2BX5A 5KW9L 3AS1A 4F2MB 3B2UC 2DYPD 1TTGA 3QNXA 1MAMH 3QUYD 3S7GA 1FV1B 4P9HH 4C56E 1T7YA 1JJUA 3KHOA 5T33L 1QZ1A 1KTDA 2VIRA 3QQ9C 4KROB 5FUZH 4OM0H 3N9GH 3E8UL 3FB6B 1UM6H 5BW7A 2OL3A 3P3YA 2ATKB 1EGJA 4GMTL 1JL8A 5HHOD 5EWIL 1X5IA 1OAZH 1MQKL 2C4FT 2XWTB 1YUHB 5DJCA 3UTZB 4GRLC 3QEQA 5ANMB 4G7VH 4U1HB 3B9KA 1U3ZA 2FLBT 1I9RL 3X11A 5E2VH 5EIIA 1YMMA 3L3DA 1WFNA 1OQOA 3OXRA 5I1KH 4TUOB 2DTMH 2D7MA 3RUGF 2FBJL 2DL9A 3FQWA 4JJ5A 4W4OA 1ZEAL 4NNXA 3TO2B 1U8IB 1T20A 5KVFH 1SEQH 3L9RB 5HGBB 5JDSA 2YPVH 4PP2A 3HS0A 3ARFC 5C92A 3UXFA 4BQ9A 1CFSA 3ARXA 3O4LB 2MMXA 5ENWA 4FQ1L 4X5WA 1NUFA 1J05B 2NYYC 1QFUL 5ILTL 1M71B 5LCVL 1Y0LA 5I8EA 1FN4A 1SJEA 3X12A 1W0WB 3X3FH 1BX2B 4S1QL 3A0OA 4B7IA 1XF4A 3QPXH 4NKDB 3S5LG 4MXWL 2HKHH 4NYLB 3ZKND 1LP9E 2CUIA 2FIKB 2COQA 3DYPA 1EH9A 3QQNA 2PXYA 4L9DA 3NFPB 1SJHB 3VA6A 4EDXA 4J8RB 3BN3B 3O4LE 5EU7C 1J0KA 5JXEC 4WW2C 1AGCB 3DGGA 1PX4A 1A7RH 4P3DB 1DQML 2GSGB 3QJFA 5CMAA 3UJTH 2HWZL 1GOGA 1D6VH 3QJHA 3AU1B 3VFOA 5D1QB 1RSFA 1HHIA 2EECA 3VXQA 4JFDD 2XTJB 4UTBL 4P99A 5ID0B 1U8MA 4O51A 4WTZA 2EH8L 4ELMA 3QUZB 3QUML 2DQEH 2Y07L 3CU1A 5IM7B 1KV3A 4XCCH 1A14L 5CBAA 4YHOH 1EEZA 3W11C 2MHAA 2AABL 2AEWA 1TCMA 4JN2B 4YUEL 3QA3A 5M94B 1HEZB 5GQBA 5E8EA 3VJ6A 2IAMB 4OFYA 2AEQL 2XFXA 4NM8L 1JGVH 1YEEH 4M61B 3LDBC 2XWJB 1FHGA 4K3JH 4PRBB 4H1LH 1YNTB 5DJXA 2C3XA 2M2DA 1DL7H 2GJZA 4PJGB 5JXAH 3O81A 3T4YA 3O3DB 4K3DH 5GZOD 4WV1A 5EA0H 3OJVC 4XPAL 5ICZB 2AJ3A 4YPGA 4FG6D 3U36A 2VIRB 4I3GA 4DN4H 1MFDL 1YJDL 3DXAB 4G8FA 4EBQL 1MCCA 5CJOH 2D7QA 3U7WH 3QEGH 3WLWD 3MGAA 4WFGE 4DN3H 4X7CC 3I6GA 2VNCA 5KSUA 1IAOB 2YUZA 3VI4F 1LWRA 5I30H 5K33A 2O93L 3FTGB 4L3ED 3QIWA 1B0GA 3UBXI 2DQTL 5FA3B 3MRLA 1GPOL 2OMBA 2QQNH 1KJ2L 3CXHK 2G60H 3AM8C 1CFNB 3X11B 1Z2KA 2D4FA 5F9JB 1ZVHA 1BZ7A 3DXAE 1I3VA 1BQHA 2CDGA 1FE8H 3W9DB 3O2VH 3MPCA 4ZG1A 3CH1B 3S6CA 1AR2A 3ZKMD 1NAKL 5TFSH 2DLTA 4XCYB 1T20B 3K80A 3T0BA 4OFVA 3S88L 4PP2B 1DBAH 4Y5YC 3MRNA 5DR5L 4UDTA 4LSTH 1I8LA 4P2OD 5F7MC 4PJAE 2IPKA 1SJEB 1J0YA 1FH5H 5I19H 3PL6D 5D7LB 1OSPH 3QIBB 4IOIA 5EU3B 5T5NF 1A6AB 3VWKD 3BGMA 4P59L 4XHJC 2I9LB 35C8L 2PXYB 5E2JA 3RP1A 1CLOL 1XIWB 4EDXB 4E42A 1WSST 1MEXL 4WUKL 4S1DC 4G43A 3DGGB 3PHOA 2DM7A 5I1CL 5F9AC 2L0DA 1NEZB 3HPLA 4CBPA 2HT4C 5HDOA 1FGNL 5D7LE 2VLKA 4YHMH 1MCKA 5CMAB 5HHXL 3OKLB 3WUZA 1C12B 4F7TA 2FBOJ 5EN2A 1EO5A 1HHIB 1ZHKB 3VXQB 2XWBA 1OGAB 5T3XD 2NZ9C 4WU7A 4ELMB 1UQSB 4HS3A 2FO4B 5F3BB 4KKCD 1BFTA 2QQLL 5CBAB 1RZGA 3I6KA 4S2SB 4YO0A 1T1YB 3QA3B 3HR6A 3VFVA 1PKQE 4OZIA 4HWZA 2DJ4A 2GFBA 3VJ6B 2XZQL 3DLQR 4EN3D 1PSKL 3QO1A 1OGAE 1N59A 4J1UA 3LIZL 1T2JA 4U2ZA 5DJXB 1A7QH 4OQTA 1OTTC 5CZVL 1MH5A 5GGTH 4UAOB 3T4YB 4GRLA 5I1LB 3SOBL 1ZK9A 1FNEA 1UYWL 3QCUH 2EE3A 4YX2H 2AJ3B 2GCYA 4YPGB 4JFFD 3U36B 3G6JF 4ZS7L 4P9ML 4R4BA 2J6EH 4G7YH 1F3JB 4HIXH 4TTDC 4WI2A 4M4RA 1QFPA 4KY1L 4P57B 3O9WC 4RZCB 2ICEA 4FOMA 2IGFH 4XC3H 3TO4B 1TZGL 2FECI 1HIML 3MTRA 2BNRD 4C83B 1RJZA 3FN0H 3RHWF 3WXWH 3C8KA 5CWSA 3ARFA 4EI6B 3MNZB 1A7OL 3IETA 3C5ZB 3T4AA 2DQJL 2X4OA 4NDMA 1WAAF 3F5WB 5LXGL 1CDGA 3DTXA 1NDMA 3OKEA 1H9VA 5F9OL 4TNWF 4AENA 1BZ7B 1BQHB 4N1HB 1F42A 4UT6L 1F4XH 4QLRA 1D5IL 2XN9B 4YLQT 1UKTA 4YNYA 2JCCA 4PJ7A 1IC1A 1SY6A 3VRLE 2V9RA 2P4AB 2VITA 4LBEA 4WFEE 3STZA 1N4XH 4AIZB 4PJCF 5BZWA 4J6RL 1PZUB 1KGCD 4NOBA 5CHNA 5JXEA 4WW2A 3ILPB 1NBZA 2F53B 2IPUK 1OARH 3ZDYE 2IPKB 3TBTA 3QXDB 3BKYL 2XN9E 4YXLH 1EHLL 4ZUVA 4AEHH 2Y6SC 4J3OC 4PJDB 1U0QA 4Y19A 3VWJD 4KKLC 5B8CC 2JJVA 4KTYA 3BPNB 3JWOC 2QADC 4XP6H 4E42B 3L6FA 4M48H 4HFWA 3O3UN 3HI5H 4FQQB 4XVJH 5ALCH 1GZQB 4HZLA 2F53E 3JTSA 3P73A 3L3GA 2H32H 1AD0B 1T1WB 3ZYJA 2AK4A 3C9NA 3HPLB 4JG0H 3K74B 1MHEA 2ZCHL 1X7QB 4JQVC 4JQIL 5LWYL 1JBJA 2CPCA 4QXGH 4NZTH 4PJDE 4F7TB 4Z78A 1IFHH 5EN2B 1J1PH 3GI9H 4JREC 4TQEH 5D93B 2BVUA 4WU7B 1MLCA 5C7XL 5KANI 1MFAL 3V7AE 2DLGA 4RNRA 5D71L 4YWGL 1HINL 1AE6L 2CDEA 4YR6B 3BESR 1S5HA 1EFXD 1JNJA 4Z7UB 4FXKB 15C8H 3A67L 5CINL 1M05A 5CEXB 5IFHL 4MNQB 1N59B 4J1UB 1XGUA 4YBLC 1IEBB 3MRMA 3LKNB 5TH2B 1MH5B 3NACL 4GRLB 3OSKA 4QHKJ 4M4PA 5EZOL 1AC6A 2GCYB 3CLEL 3RWJB 1YN6A 3AM8A 2CXKA 1K9TA 1W72A 4R4BB 4Z7UE 4GXVH 3PGFL 5HHPA 4OT1L 1GH7A 1G7PB 2ICEB 3LQAL 5DD0L 4O02L 2Q86A 4MNQE 2QJDA 2VDLL 3MLZH 2VZSA 1RJZB 4Z5RA 4LKCB 4ENEC 3QULA 2F58H 4JE4B 2NY2C 4GKZA 5CWSB 4PJEA 4Y5YA 1X5KA 4LP4A 4OCXH 4UT9H 4NQDB 4C59B 5BQ7B 2MCPL 4F57L 4OKVB 3PWUB 3GHBH 5ISZA 4AL8H 1W8OA 2YD1A 4DKDC 4YNYB 1IAIM 4RMUA 5IEKB 2R8SH 3CFDA 1GOFA 4KGLA 1I9EA 1AQKH 3V52L 1YC8A 4WEBL 4FNLH 1JYWA 2VITB 3STZB 4DVRL 3JV6A 5T1KA 1MHPL 4GRWH 4XPBL 2IG2L 1FQ9C 4JFOB 3RI5K 5CHNB 4NQDE 4WW2B 1NBZB 1C1EH 1CQKA 1KYOK 1Y6KR 3HUJE 5DI8A 5DFVC 5HD8C 4QHMB 4OLEA 4ZUVB 3CCHA 1QLRA 3MRKA 1ZT7A 2X9XA 4MAUH 5BVPL 3ORJA 3HNTH 4JDTH 4Y19B 5ESVA 3SKMB 4OD2B 3RVUC 1NBVL 4LF3B 3NAAH 5FKPA 1G6RH 4LVHC 1SY6L 4I4WB 4R0LC 3PDOA 1G0XA 3P73B 3B43A 1ZA6A 3ZE0F 2NY0C 4WTXA 1MHEB 4QRUA 1NFDB 1IL1A 3CXDL 4PRPA 4QWWC 4X9FA 1IBGL 2DWDB 1DQQA 4Z78B 2EXWD 2QQKL 3ULUE 2RR3A 3WFDL 3LDBB 1UWGL 2VYRE 1E6JH 4NQEB 4X7SL 1IZJA 1WIPA 4X4ZA 2L7UA 3CX5K 3UJIH 1RZFH 5FV2A 4OF7A 4RNRB 4GSDL 5IHBA 1IGJA 2F5BL 5CGTA 4UIKH 3IVKB 2YEZA 5C0BD 3RWGA 3MBED 4NNPH 1NFDE 4O2CA 1RZJC 3JV4B 3O9WA 3DUSA 2NY7L 3TVMC 4G6FD 4NQEE 3UTSD 4UOJA 3MRMB 3E1F1 2X4RA 2E8YA 4LL9A 3SDAC 4YHPA 5INCA 2AI0L 4TTGA 3BH9A 1QLEH 3IDXL 5C08A 2NY6D 3FONA 4R4FH 1E27A 3WUWG 2HTLD 5GS0D 4M8VA 1A9EB 1AFVL 4M1DH 5C8JB 1GIGH 1EEYA 4X9HA 2X41A 4HJ0C 3F7VA 5I15H 5DD1L 5GISL 7CGTA 1NMCC 4MB4A 1H15A 1YEGL 3DMMD 1R0AL 3SDXA 4LLVA 3IXAA 4Z5RB 5EZIH 3QULB 5DJ6A 1LDSA 1CGSL 4PJEB 4NKQB 4Y5YB 4HWBA 1RJLA 1OD9A 3B2VL 5EO1B 5FKAB 1RIHL 2HA1A 3UBXG 3CMGA 3GGWA 1S7SB 4OLZL 4QRPE 1QBMH 5CGYD 1KUMA 1DANT 4XMPH 4LOUD 2APFA 1W72L 1OQXA 4JO2H 5DEGB 4XNUH 1MVUB 3V0WL 5IB1B 2ZUYA 3S98A 3D69A 4NZUL 4MQTB 1K4DA 2P8MA 3EYFA 3SE9H 4OLVL 3WDIA 4U7MA 5DHYB 3AB0B 3VFWA 4NP4L 5CZXC 4ZOCA 5IB4A 2BC4A 5DI8B 4DZ8A 2I07A 4EUPA 4JQVA 3MRKB 5MENE 5J6HB 4JDVA 5KS9F 4N5EC 4NUGL 4RX4D 4P46D 5GRUL 3LEVH 1JWUA 1HHJA 4WWKB 5FKPB 3BEWA 1MOEA 2YZ1A 3EYSH 4L5FH 5E56A 3INUH 3PDOB 1M1SA 2CKBA 1ZA6B 3MA9L 3D87B 4PRDB 4GAYB 3PQYD 1YMHB 4QRUB 3PHSA 1IL1B 5D7KD 3A6CH 4PRPB 5BZDA 1Q1JH 5C1MB 2JF1A 1DQQB 1MELA 3DARA 2BSSA 3D0VA 2B1HH 4LLQB 1NDGA 5D5MA 4G8EB 4S0SD 4TVPL 5JTWA 1BVKA 1G9NH 1ZLUK 5IIEA 1FNFA 4I48B 2P46B 2YEZB 3WHXA 3AAZB 1FZOA 1B3JA 3WBDA 3RAJH 4KU1A 4LSUL 3T3ME 1L0QA 4GRWF 4XXCC 4XP9L 5D7SL 2ZSVA 1WC7B 5D1ZD 4DW2H 2VQ1A 1NL0H 2X4RB 4YHPB 4KTDH 3OKDB 5FECB 1AO7E 2XI9A 4HK3N 1BQUA 1U8OA 1A1MB 2OBGA 5C08B 2OZ4A 1VEOA 3H6JA 5D9SA 3FONB 1FIGL 5LJYH 3S4SA 3H9SB 5AWNH 4X6EA 2HLAA 3KPMB 4BFEA 3JV0A 4Q0XL 4OFKA 4LLUA 3VXUE 4PRAB 1DSFH 3SDCD 5J57B 1H15B 2AJZB 4KQ3H 4LLVB 2HTKC 3T1FB 4R6UA 2HLFD 2KUTA 2G9HB 3A6BL 5DJ6B 3ZKQD 4NO3A 5MHSD 3ZDZE 3CXHJ 4KUZL 3HNVH 1RJLB 3H9SE 4PB0H 3TIEB 1R3KA 2XQBL 2YA1A 3KS0H 1ZANL 3HLAA 1OAQL 3QFDB 4Y8AA 3BQUD 4XPGH 3G5YA 3OB0H 4JHAL 3QCVL 1GGBH 4L4VB 1C08A 3LZFH 2AVGA 1NUGA 2KQNA 3EYFB 4BELD 4P2RB 3NIFE 4R0LA 4LGSB 3HE7D 3DX6A 3VFWB 4ZNEA 3CFJA 1ND0B 5BJTA 3BGFB 3KLDA 3QR2A 1IGIH 4LGPB 4F33A 4EUPB 4XBEL 5H37H 4M9PA 1P5UA 4KXZH 3ZKXB 5ICXA 1NGYB 4OD3H 4JPVH 4JREB 5EUOF 2YZ8A 4K8RH 3VXRA 5IWLC 1JWUB 3BAEH 4OCYH 2HT2C 2D7NA 3NIDE 4XVSH 5SX4H 5D70L 3T65A 4P2RE 5EIQA 3OKKB 4JFPA 3NABL 3QT2A 3JWOL 5DVNA 3X3GL 4KROD 5IBLD 3TV3L 4OZHE 2X1QA 1HCFX 3HC0B 3EJYD 2HJLB 3DX8B 3IJHB 5F9WC 3TVMA 4F7MB 4ZXBB 3PWVB 4B0MM 4Q9BA 1BLNA 3MRJA 1NDGB 4IRZL 3SDAA 2JK5A 3QDGB 4WTWA 2H6PA 2VLJA 5EOCJ 5GGQH 4IJ3C 4MD4A 3B4NA 4X4YB 4X7TA 2QHRH 3QZWB 1FNAA 5IIEB 3WNOA 1A22B 3U6RA 4V1DA 5BOZG 2W0PA 1FZOB 1JIBA 5DD6A 5DS8A 1P9MC 2YD6A 2ILLA 1KTKE 2E7BA 2YN5A 1T1XA 2EDOA 1UCBL 2MOVA 2E9JA 1EVTC 2CKBL 1HKLL 2FX9H 2DM3A 2ZSVB 4X0KB 1JV5B 2DQUL 1CF8L 3QDGE 2ZUVA 4XVUC 1AHWA 4FQHA 2NY2B 4WGWB 1U8OB 2CSPA 4OLXL 1FC1A 1MAML 5AYUL 3O4LD 2FGWH 5D9SB 5EBMB 5IHUH 4JFZH 1SBSL 2Y36L 4Y4FA 5FUZL 1P4LA 4OLWL 4X6EB 1MSPA 1AXIB 5E1HB 3U4BL 1QYGH 4MA8L 5ICYA 4Y5VC 5FYJL 3L3OB 3P9MA 1KLUA 4AT6A 1JGLH 4OFPA 2A73B 1R3IL 1E6OH 1DFBH 2DQHH 1YEFL 4OB5H 4ODHH 2Q20A 4HUXA 4QCIA 1YYML 4LPXA 1EAJA 1XAUA 1TNMA 2PF6A 1EJ6A 1ACYL 3D3VE 1QBBA 1DBBL 1OT1A 3O6FB 1QFWI 5FUOL 4IS6A 2V9TA 1ED3A 1WZLA 4PIRF 1TFHA 4BUGA 4N0YL 5B38G 3NFNA 4A6YB 1DVFC 3G5YB 5D1QD 1IKFH 1U2HA 2XTJD 1WJ3A 4R90L 3CVHA 5IGXL 4PG9B 4UOW0 3QUZD 1QHOA 4JO1H 4LVHB 4IOFD 1B6UA 4UV4H 3G5VA 3VXTA 4R0LB 5K9QI 1AKJD 3CFJB 4X83A 2BOCA 5BJTB 3K8MA 5GGSB 4F33B 1NGXA 2C3HA 4HHAB 5JORA 4QHKI 3KYNA 3VFGL 2IAMD 3FO2B 4R7NA 4DTGL 2UY6A 4U1MB 1D7FA 5DJYA 3GMMA 3H42H 1M6OA 3VG0L 3VGGA 5EPMA 4HK3J 1QP1A 1CE1H 5FK9A 1BFSA 2H45A 3BZDA 3KJ4B 3EJZD 3T65B 4KJPD 3MREA 3PWJA 2EYTA 4X6BB 4JFPB 4ZPTB 5KOVC 3GMQA 3E3QE 2F19H 4M7JH 3DXAD 3D2UA 5D7IA 4BQ8A 4XXCA 4KRLB 1ZLWH 3TVMB 4OZFB 3SQBA 1XF3A 1RZIB 5C07B 4XMKH 1F5WA 3MRJB 1J9CT 4WHCA 1WTLA 3JTTB 2JK5B 1TQBB 4M62L 2H6PB 2DIBA 3BRDA 4MD4B 3QEQD 3OZ9L 3B9KD 5ITBL 1BECA 4KFZC 1FORH 4PJ9C 4OCNC 1YMMD 4DAGH 1LO5A 5TE4L 1D5BA 1G84A 1JZ6A 4ZO7A 3IKCA 3ULVE 1T1XB 4POYA 4PY7A 5JMOC 2GJJA 4RRPG 5C07E 4JZJC 4U6VH 3TA3B 3FAXA 1IGTA 1AHWB 1DL7L 4K3DL 3PHQA 5EA0L 3VGDA 4C57C 1F90L 3FQNA 1DLFH 1N2RA 4WY7H 3RIFF 4DN4L 1J1OH 3BDXA 4Y4FB 3U0WL 1SYVA 5IW6A 1U9KA 4FQXB 1ZMYA 4CGTA 4JZNA 5D7LD 1IC5H 5F70A 4XCFH 3L5XL 3NGBC 1MLBB 3U7WL 1MFEL 2YOCA 3QEGL 5AZEH 2W0KA 2CK0H 4DN3L 3MLPA 4Q74A 2DKSA 5GRVK 3GMLB 3KPRB 4AT6B 2PXYD 2GY5A 2XNAA 5I18H 4QCIB 3HI1A 1MCJA 5HY9B 2QQNL 3R06B 5LBSL 2G60L 3OGCB 4MAYC 1FE8L 2J4WH 4HGKC 4ZSOA 3FQXB 3O2VL 4OGAD 4ZOAA 3NFNB 3O3BA 2HH0L 2R69L 4ZFGH 1CGXA 4XAKE 5TFSL 3KPRE 1OGAD 4U2YA 4PTUA 4X80H 5CIPH 1YC7A 5IWLA 4KI5F 4LPCA 4PGDA 3LRSA 3I50H 1YECL 2RB8A 3DROA 1KYOJ 4LKXA 4P2QE 2VLME 4CMMA 4NKMA 2Z0BA 1JPTH 5E94B 2BOCB 3BZ4A 3JZ7A 3MYZA 1NLDH 4BZ1H 3QFJA 3MRDA 5I1AB 3KYNB 1ADQA 3KGRA 3F62A 2V5RA 1EXUA 2Z31C 1S7VB 2H2SC 5IFAL 1M6OB 2Q7YA 5EBLA 5IB3B 4TOYH 1BAFL 4R8WH 3QYCA 4BH8A 2DBJA 3I9GL 1HSBB 1AXTH 4QO1A 3LKQB 5D8JH 4LLMB 1JPSL 4Q6IC 3PWJB 4Z7OF 1P7KB 3CVHL 5ELIA 3GMQB 1EA9C 1KLGB 2CRIA 2GIYA 3I85A 1P9MA 1OP3K 5ACZA 4NIKB 3RPIA 25C8L 5C9KA 4PLNC 5D7IB 1Y6NR 4LCWE 2UUDH 1JVKA 1XF3B 3TO4D 4NM4L 4CU6A 4HF5L 2ESVB 3GDBA 5CILL 1WCBA 5SX5K 4PRIB 1H3PH 4CNIA 1OPGH 1N8ZB 1HNFA 3C5ZD 5EU6B 1TETL 4NKOA 4NO5A 1MCNA 4U6TA 1D5BB 2EIBA 3O45B 5DLML 2XN9D 4PY7B 4Y5VA 3TNMB 4DK6A 3ZE2F 1JPFA 2AV1A 4JFYB 2ESVE 3PXJA 3SKJH 1S8DB 2Y23A 3KPSA 4BH7A 1IEAA 5GGTL 4YEEA 5HPOA 4XAWL 5F1KC 1KN2H 1UM5H 5A40E 5EU6E 3BP7A 4K9EL 4DGYH 3V5KA 3MLTA 4BKLA 5JHLL 1WEJL 2F53D 5J12B 3UJJH 1SYVB 1MAJA 3PIQA 4G3YH 1KPVA 1OB1A 5M7QA 4ODSH 4XC3L 1DVFA 3RTQC 1IMHC 2YK1L 3C2SA 4ONHB 5HGDB 1N7MH 2NQCA 3VFMA 3HI1B 1AY1L 4NZRL 1EK3A 2AQ1A 4FFYL 1KPRA 1WK0A 4BFBD 5T3ZD 1ONQA 5DRXA 3MLWH 4ZSOB 1F4XL 3QUMB 3BW9B 1AR1C 1CTNA 2AGJL 2HN7A 4X4XA 4HLZG 1B4JH 2UZIL 2DMKA 1MIML 4HT1L 1JZ7A 3RKPA 4P3CH 3MACH 4PGDB 2VR5A 1G7MA 4GLRI 5C2BL 3ARVA 3TCLA 2I24N 1OARL 3MLRL 3QQ9D 4N0CC 3P4LA 4MCYA 2XQYK 4KRPB 1LGVA 1PVHA 4FHBD 1FPTL 4WTZG 4ZAKC 3IDJA 5EBLB 1U8KB 4MNQD 5D7JB 5MERA 2BOBB 2OP4L 4LSQL 4XP6L 5EUKA 4M48L 1LE5A 1JMZA 1FLRL 4GRLD 3FQTB 5I9QB 4WI5A 4PJ9A 5TQ2H 1HYSD 3KXFA 1M7DA 1TMCB 5ACZB 3QEHA 1R24A 4XPFL 2J5LB 2NCMA 1KJ2B 2ZSWB 4GAGH 2A1WL 4LEXL 4JZJA 2IH3A 3FT2B 4KK6C 4OZGA 4UU9A 1HXYB 2XKSA 1ADQL 1WCBB 3ARFD 1S78C 1WBYA 4R3SA 4XP5L 3VGHA 1L7TL 4R2GC 2G75B 2EH7H 4LQFL 4NQDD 5TDNB 2NYYD 1TCRA 4YIQA 2APWA 3FO9B 4I3RH 4FMKA 1BZ9A 4OTXH 1HHHB 4KKNA 5KOMC 2ZCKL 3HC4L 2NXZC 1J0IA 1BM3L 2WSKA 3D5OF 5SWZA 4UTAL 1FNGB 3L5WB 2ORBL 2NY4C 1CDJA 1ITBB 1NCBH 2AV1B 4MCZA 2D9QB 3HN3A 4NZDA 4JRXE 3KPSB 1U41A 4KKAD 3MZGB 5ITFB 2WUBL 3SE4C 3PE9A 3VCLA 1UB6A 2OJEB 1P7QB 4HWEH 1MCHA 3MX0A 3TNNB 2Z35A 1BQHG 3ZZ1A 5JXED 1JRHL 3V5KB 1BIHA 2PTTA 3CFBB 4HIJA 4MAYA 5DMIL 4GW5B 1ZS8A 1UH2A 5E00A 5KG9B 3MJ7A 1X44A 3HG1A 2H8PA 3KPPB 1DQLH 3TN0B 4C4KT 5EOTA 4X6DF 4Y19D 4Q2ZB 5DWUH 2EDQA 1ZHLA 1AJ7H 3RWFA 5FO8B 1RHHB 3MUGA 4NHCH 1JUFA 2VDMH 1FZJB 4UT9L 1J5OH 2VXUL 3DVFA 5J3HD 3VDCA 1KPRB 1GGIH 2ITCA 1ONQB 3ZTNH 4PS4H 2AEPL 3GHBL 4PJ8C 5IR1A 4PJBF 3GK8H 3NFSH 4KK8C 1CG9A 2VWEC 4K71C 3MCLL 4YXKH 2IBBA 3KDMA 1VADB 2Z31A 3NCJL 2NZIA 4NQED 4P3WA 5LGHL 3QDJA 5CLWA 5CEZH 3CZFA 1BEYH 4U6YA 2X4SA 3N85H 3QH3B 4X6CA 2VISA 3VFTB 4Q6IA 3MLUL 3CC5B 3U9UB 1Z0MA 3TCLB 4LVOC 4X99B 3HZVA 4MCYB 5FDWA 4XP4L 3DX7A 3JWDH 2A6JB 3IDJB 5K9QG 1JFQL 1MCPL 5MERB 4AQ1B 2DKMA 4F80A 1CBVH 3MOBH 5L8KB 5L88L 3FT3B 5FYJU 1G6RL 5I6XB 3PXHA 1LE5B 2VXQL 4HZAA 4KK9C 4O2EA 3KPQA 4PJ9B 4R7DB 2AJXH 1PG7X 1S9XA 4NNYB 5CFHA 2HRPH 4MA7H 3QEHB 3HPJA 2HMIC 3ZT7A 1CI5A 1F8TL 1I1AB 2FB4H 3K81A 3CSYB 2IH3B 2KH2B 4UU9B 5JOFB 3UJIL 3KNBB 3ULUH 4I5BA 4QNPF 1WBYB 5GIRB 5F7KC 3WFZA 5E99H 4U6XB 1IT9H 3SKNA 4YHYC 3LN4B 1TCRB 1JHKL 5F7YC 1X3DA 3RDTB 2YD7A 2EC8A 1BZ9B 4MGXA 4NNPL 5GGSY 3U46A 4KAQH 1AP2B 5J4MA 1MWAB 5TDOB 5HVWA 3RTQA 3DUUB 4KK5C 4MCZB 4ZUSA 3QQ3A 4E9LA 4DCQA 3IFNH 1NKOA 2ZWLT 3WHE0 3VCLB 2ZUWA 3EZ8A 4PJFA 1VACB 3ARGC 4RGNC 4M9OA 2OR9L 2Z8RA 5HDBF 5K9JH 1KB5A 4WI6A 4XNXH 1V7MH 4S1DD 2OQJA 4YE4H 3MRHA 5C0CA 4MAYB 3RVVC 4HIJB 2E3VA 1GIGL 1X5FA 1ZS8B 3FB7A 2E9BA 3O8XB 1JMXA 4ALAH 3HG1B 2GITA 2H8PB 3FO0H 3BP4B 1KPUB 4MDJB 1RV6X 4KTEH 5HGAB 5HVHC 2DS4A 3EFFB 1CDIA 1BGXL 2NZ9D 2XRAH 4WWKD 3H9HB 1QVOA 4APQB 4DGVH 3MRPA 4NHUA 5TGBB 4N90E 3D18B 3PG2A 3B9AA 3IFPA 3G5XB 1I3RA 4J4PC 5F7WC 3S3PA 4KVNH 5IR1B 4PRPD 1N26A 2P5EB 5D1XC 4ZAKA 4XMPL 2EDTA 3RU8H 1HXMB 1N0LA 3QNZB 4UT7L 3VXNB 3UEZA 3AC0A 3CZFB 1FFRA 4U6YB 4H20H 3SCMB 3SE9L 3IFLH 2CIIA 1XZ0A 4BZ2H 2DQFA 1XR9A 1S9VA 2XZZA 2YD8A 1BBDH 5KAQG 3HZVB 4I2XB 1T1ZB 4NUJB 4L3CA 2EDJA 4TTDD 4GBXC 4ZDHA 2P5EE 4M5ZL 3FQRB 5E6IC 4FQCH 4DFIA 3KYAA 1BMGA 3EZJB 2BCKA 4OFIA 2ED8A 2VDPH 1S3KH 3T0EC 4UUJB 1MJJA 4OI8A 2ARJQ 3EYSL 5C08D 4BSWA 3KPQB 1S9XB 4WEMB 4KDWA 1LNUA 4I2XE 3H9SD 5SWSA 5IHZA 3A6CL 2HFGL 2WLYA 4PJXF 5JUEL 4P9HC 5E08H 1H5BB 5DSCB 3AS2A 4NWUH 1FJ1B 1TZIA 1OWRM 2HVKB 4KPHH 5E8PB 3U48A 3SE4A 4JFQB 1U3HC 2R39A 3SGEI 2RFXB 5CJ5A 2OSLA 3VRJA 3NOIA 1UACL 2WWMC 1F45A 3W82A 3U46B 4Z0XA 5B21A 4NQSA 3C09C 4X8JA 1CL7I 3DVIA 2Y6SD 3RTQB 3NCEB 3QQ3B 4S1SL 4KKLD 4DCQB 2R1YB 1NL0L 4L4VD 1J10A 1KBGH 2X4PA 5C0RH 4JHWH 2QADD 2WQ8A 3QHFL 2I9TA 3O3AB 5I1IL 3LPFA 1CGTA 3MJ9A 1QR1A 4E41B 1KB5B 3LS4L 4P2RD 5BXFA 5JMRA 3ULSB 4X5XA 3ROLA 2WWKT 3MRHB 1N5AB 1S9WA 4RDQG 5EG6C 1QPPA 4KJYA 1HILA 4JY6B 5I1HH 5GSVB 3P4MB 4PJ8A 2GSIB 4EI5C 1MUJB 1RZ7H 3W39A 3EHBC 4WVRA 1QVOB 4XWOC 4O2FA 2DQDL 4E41E 2Y25A 4JRYB 3UO1L 4FQ2H 3VGBA 1IAIH 1BQLL 5FYLH 5D6CA 4F3FA 1F2QA 1BQSA 1EMTH 3DWTA 2UV3A 4LAQL 1II4E 4M3KB 4NT6A 4NFBA 3TT1L 3V6FA 4DQOL 4X8XA 1FFOA 1X5JA 4ZXBD 3D85A 5BS0B 4LSPL 4I13B 1V3JA 3ZDXF 1C5CH 1O7VA 3QWOA 1E4XH 4K55A 2RBLA 3LV3B 2E5EA 3LZFL 5D96B 1A3QA 4M00A 3QDGD 1IJ9A 4MHHG 3QDME 2DLFL 2ZPKL 1HWGB 2X4QB 4WO4B 4JRYE 4GFTB 4BUHA 3LMJH 4KQ4H 5DHXB 1ZHBA 4N5UA 1XZ0B 1I75A 1XR9B 5C3LD 5HHNA 4PJIF 4QTHA 2WV3A 3GBML 3LH2L 2JB6B 4ZDHB 1UWEL 5C0EA 1KC5H 4G80A 4S1RL 4G5ZL 2X4TB 3I75A 1CS6A 4LHUB 4ENED 3DYOA 4XVSL 1MJJB 1MJ8H 2NY2D 5IB5B 5HI3C 1MPAH 4D2NA 5HYFA 2V7NA 1QEWA 1O7SA 3OR6B 4BA8A 5SWSB 2V2TA 5IHZB 3LHPL 4AJ0A 2DMBA 4QGTA 2NXZB 3QXTA 4HC1H 4NGHH 2V17L 2FEEI 5HYSA 4DUVA 3ELAT 1KIUA 3TIDB 5CBEB 1TZIB 4WI4A 1CYGA 5JDJA 1CGYA 4M5YL 3X13A 4AEEA 4H8WL 32C2A 1CU4H 3ARGA 2QHRL 4PB9L 4ONFL 2X4UA 1QHPA 4TSBL 3LKRA 3O6FD 3OG4B 3E2HC 3ZKNC 3REWA 1OVZA 3OPZH 5HD8D 3V4PL 5ERWA 4NQSB 1FO0A 1X5ZA 4LLAA 4X8JB 2LE9A 4RFOL 2FX9L 4I3SL 2O5YH 1FL5A 4UI2A 4UIMB 4FABL 3UTTA 2IADA 2X4PB 2YWZA 3CLFL 3S9DB 1KEGH 2FR4A 4U4BA 2I9TB 1SEBA 3IJSB 1VEMA 4JPIB 2NTFB 2FGWL 2AXJA 2VKWA 2DWEA 1H0DB 4MNGE 1KTLB 2K3TA 5DVKA 4J4PA 4PJHA 1CK0H 2IANB 5HI5C 1HILB 5GSRA 4K7PL 1I9JL 2UWEA 4L8DB 1PD6A 1RZKH 4HAGA 4PJ8B 2VXVL 5HHMD 4QWWD 5D1XA 2AJVL 2H26B 2YWYA 4MDIA 2X4NB 3P11H 5A2LH 1IM9B 2D0HA 4ZUWA 4OGYH 3HFML 3VXRD 1DEEA 4UINL 4RMTA 5DK2A 1T7VA 1RUQH 2GQHA 2D31A 2AJSH 4XPTL 4LLYA 1EO8L 4D0BB 2V2WA 3QRGH 2VDRH 5E8NA 5C0FB 3S35L 4EUPG 5I74B 1RK1A 1BFVH 2IANE 3MBXL 5D6CB 2FX8L 4LVOB 1WZ1H 1BJ1J 1FAIH 3RUGB 3MLYH 3WLBA 3MJ9L 4AIXA 4D9LH 4GBXA 5ACMA 5CEYB 3ULVD 5E6IA 1FFOB 3TVMD 3IAPA 3S36L 4LU5H 5GZOC 4WUUB 5C07D 3QP3A 4FQLH 2CUHA 3QWOB 1CLYL 3SE8H 4JZOA 5L2KA 4ZOBA 2MCG1 4FG6C 3T0EA 1I7TB 5LG1A 3IU4H 3PWPB 1NGPH 4E0RB 1QRNE 1HH6A 2IJ0C 4HXAL 2NXYB 3VG9B 2XA8H 5HHNB 5K59F 5GS0H 4Y88A 3RUGE 4TVPE 3S3SA 1IGFH 2Z8WC 3RNKB 4QTHB 1RUAH 3PP3K 4OCMC 1HZHL 4WUUE 1FGVL 4ZNCD 3DO7B 2H9GA 3GMOA 1OSZB 3TA3D 5F8QC 3T0WA 1NPUA 3GUTB 1U6AL 1JZ3A 1BBJA 4PRNA 3PWPE 4WU5A 5IMMB 4BSVB 1L7IH 2F74A 2QSCL 3ARTA 4Y4FD 2AJYL 4Z0BH 4N1EA 1WF5A 1JHLL 4FQXD 4XXDA 3I6LE 1CVRA 4QRQA 4EKXA 1RK0B 3S34H 3KPRD 4P2OC 2ZKHH 3X13B 1AGBA 1Z3GH 3M17B 5FCUH 3FB5A 3S4SG 3ARGB 4RGNB 5TF1H 2W38A 5C09A 2KZWA 2X4UB 4JFXA 3V79C 1JNLL 4U0RB 2VLMD 5KSVB 3VWKC 4LFHG 1C5BL 3REWB 4MJIB 1RZ8A 3P4OA 1A4JB 5KVDH 4XBPB 5IT2L 3B6SA 4G42A 3ZYOA 1A8JH 1OOAA 1FL5B 4EI5A 4U6VL 3WFEH 4OUUA 3UTTB 2IADB 1KN4L 2NPLX 2R23A 1T4KA 4JVPA 4HJJH 1GL4B 4XNYL 4L8SC 5GSRB 1ZLVH 4MJIE 3PWNA 2ZG2A 3TYFB 5JQ6H 1X5LA 2JJWA 5D2LA 5TJWK 1CDUA 4L4TA 5C2UB 1YY8A 4MDIB 2J88L 5CJ8A 4ZUWB 4KKCC 1XF5B 2BVOB 1BOYA 2ZP0T 3HCVA 1G7QA 2BFVH 2GT9B 3REVA 1UVQA 1BFOA 1EJOL 5E8NB 1RK1B 3SKOA 4EN3C 1E4WL 3OB8A 4N68A 1ZTXH 5HHOA 3EOTH 2R4RL 2J4WL 1UA6H 4MX7B 5ADPL 4I9WD 5ESQB 2YMXL 4ZFGL 3VI4E 4EXKA 5MEOA 3RWCA 5F21B 4Z95H 2YN3A 2ESVD 3MR9B 4JZOB 5L2KB 4PRID 4IDJH 3C6SA 1HH9A 3MOAL 3G5ZA 3TC9A 2OK0L 4WJ5A 1KSRA 1HH6B 4H1LA 2AS5M 2WLZA 4H88H 3LPGA 2BHYA 4BZ1L 3BWUC 3GO1L 4OV6F 4XPHH 1P1ZB 1MCOL 4Z7NF 1CDHA 1LK2A 3QAZC 2W65A 1ACZA 4NKIL 1KCUL 3AREB 3L3KA 3BP5A 4R8WL 4LVNB 1DQDL 2BHZA 3V0VB 2EDNA 4HGWA 3SPVA 3W9EB 5HDQH 2KKQA 1BBJB 4WU5B 3BPCA 4BFIB 2F74B 2J3SA 1VGKA 3F7YB 4YDIL 5CCKL 5GGVH 4D0DB 3BX7C 1LK3L 2F5AH 3O3EB 5H35B 4XXDB 3AFLA 4QRQB 5DT1H 1WFOA 5KW9H 1CD9B 2WBJC 2Q6WB 3C08H 1Z5LB 1MFBL 2LAAA 4CADA 5FHBH 3UROR 4XTRC 2G2RA 4XC1H 1R3HB 1RUPL 5T33H 1H3PL 4JO3L 1GJIA 2CLRA 3E8UH 4JFXB 4WNQA 5TF0A 4L3AA 1XGRB 4GMTH 1M7XA 4HDIA 3S97C 3ESUF 5LAXA 4JFDA 5L0QB 3RBGA 5EWIH 3DGCR 3HTLX 5CSBA 3P4NB 3JVGC 1MQKH 3B6SB 4G42B 5KN5B 3MV7B 3G08A 3VA2C 2EE2A 4XP1H 3Q5TA 2R23B 2HT2D 4ZFFA 4YGVA 1T4KB 3UPRA 1I9RH 5CZKA 3G6JB 5MEQA 4DVBB 4RIRA 2GUOA 5DVLA 1G7HA 2FBJH 3PWNB 3MRIA 3V5DB 4H26A 3RY5A 1ZEAH 5D2LB 5F1IA 4KRPD 3WS3A 1JWMA 1FYTA 2CLZA 1YY8B 3HMXA 3MV7E 5I17A 2B1AL 2V2XA 5IK3A 5D7JD 4DEPB 4TNVF 1RURL 4FQ1H 2R0LL 4JHZA 1NSNL 4PUBL 3FL7A 3ECBA 3G6JE 4HK0A 4KJQD 1N6UA 5DEZA 2CLVB 4S1QH 5JW4M 1ODAA 5CP7A 1PYWA 4MXWH 3CDGB 4EVNA 1NMAL 2V5SA 1KFAL 4L3EA 4HUVB 1FNLA 5MEOB 4PJCB 4N9GA 2RQ8A 3F8UB 4XVUD 1WAAE 4P3CL 2ATPA 2P7TA 5KJRL 1DQMH 3G5ZB 3SJVB 3RPKA 5D72L 2WUCL 2FYYB 2C9AA 4H1LB 4IRJB 2HWZH 1ETZA 3MO1A 4UTBH 4RA3A 1N3NB 4WW1A 2EH8H 1XF2A 5EIVA 4PJCE 3L3KB 3O41B 4MB3A 2Y07H 3OJMB 5KVEL 3KPSD 2N56A 4P2OA 2BDNL 1A14H 2R29L 3LPWA 2NX5B 4PD4J 3SPVB 1P7QD 3FOLA 4GS7C 3SJVE 1U8PB 3MGTA 5E5UB 3BPCB 4YUEH 1NANI 1VGKB 3AMLA 2AEQH 3VWKA 2Q76B 3WNNA 4NM8H 1BZQK 1SBBA 4PG2C 3RWEA 2FGZA 3TZVC 1T89C 1DVFD 1R3JA 3TN0D 2GJ6A 1IZKA 3D6GA 3RJDA 2XPGA 2NX5E 1MREL 3W2DL 3NPSC 4V1DE 4HIEA 5K9OA 1MFDH 2R56H 5HVGB 4L8SA 1CXEA 4EBQH 1Q9WA 4TSAL 5LAXB 1D5ZA 1T6VN 3B8SA 3CX2A 4GAJL 2YUWA 2DQTH 1GPOH 3EDDA 5D6DC 1WBXB 2M1KA 5ALBH 4N0UB 3MV9B 4NN6C 4X7FC 5L9DL 4U1IA 5MEQB 1CXLA 1K8DA 4YDJA 4EN3A 2EXWC 2GUOB 5F44A 3QEUA 4F7EB 1NAKH 2OL3H 1JWMB 5IVZA 5HGGS 1FYTB 2CLZB 2IC2A 3S88H 5IV2B 2H32A 2PO6C 5DJ2A 5IK3B 2WZPD 4HUWA 1U3YA 1INQA 2Y72A 4Y4KC 1AJ7L 1I1CA 3FO1A 4JFFA 3MV9E 5HJ3B 4HK0B 3RIFK 4NHCL 1XGTA 2FJGA 1J5OL 2VZTA 4PJ9D 5CP7B 1T22A 4MNHA 4EEEA 3VFRB 4RMRA 1P2CB 2Y7QB 4PS4L 4PRHA 4P59H 2BNRA 3GK8L 3NFSL 35C8H 5DTFA 1LE9A 4DK3A 4YXKL 1CLOH 2VR9A 3P0GB 4NN5C 1I1AD 1HSAA 2DF3A 4XCNB 1MEXH 1BEYL 4WUKH 2ATPB 2P7TB 4UDUA 1FGNH 2P8LA 5HHXH 2CDFA 4ERSH 4D94A 1YNKL 3RDTD 1ETZB 3N50A 4CN4A 1G9NC 1C7SA 2IBZX 3NVQA 4JFHE 4OGZA 3O6ML 2WBJA 4UZGA 4Z7VA 3CDFA 4Y2DC 3F7RA 1IEHA 5DUML 3STLA 1J8KA 3GSQB 3GSNL 3FOLB 1NGZB 2D2OA 1JYXA 4N90D 5CGYC 2VQUA 1Z9MA 2PYFB 2XZQH 4LQ1A 3BWAA 4MAYD 4LOUC 1PSKH 4YDLC 3O11A 3RWEB 2P5WA 2PW2B 3BVNB 3OTTA 3LIZH 3HG1D 2MPAL 4Z7WA 3JVGA 5CZVH 4B7LA 2GJ6B 3SOBH 2F54A 3ARQA 2XPGB 3HR5A 3BUYA 1X4YA 4FQIL 4APQD 4ZS7H 4P9MH 3ZE0E 4YHZL 5K9OB 5I0DA 5E99L 5I2IA 3RWIA 1IT9L 4KY1H 5DMKB 4TRPH 1RUML 4PY8J 1TJGL 4KAQL 4P46C 1TZGH 1IC4L 5IFJB 5KTEL 2EDKA 4NC0B 1FL3A 1L6XA 1VKXA 4U1LA 3FFDB 1ORSB 4GUPA 1A7OH 1NBYA 2DQJH 2OX5A 5MI0C 4KWUA 5LXGH 2Z91A 3SCMD 5F9OH 4WCYL 1K8DB 4YDJB 1D5IH 4K7PX 1ZVSB 3MLVL 1BOGA 4XBGA 43C9A 1OW0C 1ZGLB 2DI7A 1RFDL 5EDXA 5LGJA 3QBTB 3DVGA 5IVZB 1EAPA 1B0RA 1WV7T 4E5XB 3VXPA 3WFCL 2H32B 4J6RH 1G0YR 4NSKB 5E03A 5T3XL 1FVCB 1INQB 2IFFL 1YEDA 4OCSL 4DGVL 3LD8C 3ZT5A 3S35X 1A9BB 4Q97A 3QHTC 1XGTB 4G6ML 3BKYH 4HS6A 1T22B 1P84K 3BXNA 4K94C 1Q94B 1CICB 1U8HA 3TBSA 1LMKA 4KVNL 4WFFE 1S9YA 3PP4L 4PRHB 3WXVL 1XGYL 2WINA 3LN9A 3S36X 4U0QB 3AROA 1MY5A 3CH8A 4LSVL 1HSAB 1JPST 3WD5H 1DLHA 2HJKA 5DRNA 3ET9F 3T04D 1WT5C 5IVXF 1ZLWK 4XX1E 4BZ2L 1H8NA 2P8LB 1MRCH 2HVJB 1CVSC 1BREA 2EIZB 5LVEA 5LWYH 5GXBB 3LEYL 1B9ZA 1A3RH 1CFVH 2W91A 1BBDL 1FFQA 5I71C 4PG2A 2BVPA 5F71A 2CR3A 4HD9A 5KS9B 3WYRA 1FFPA 3TZVA 1FZKA 1T89A 3O6KL 3RTQD 1MFAH 1PFCA 4PJGF 1QSFB 1IKNC 5HHVH 5D71H 4YWGH 1HINH 1AE6H 4QOKB 2UVFA 2VSCA 5E95B 2BVEA 3Q5YA 1EHAA 4QYOA 3A67H 5CINH 3BQUC 5E8OB 3HAEH 3VFNA 3BWAB 4LP5A 5IVOA 3VGAC 4FXGA 4U1JA 1XH3B 4F7PA 2P5WB 5IFHH 3BD4A 2PR4L 5KS9E 3HZYA 1AR1D 2OTWA 2Q8AL 1X9QA 3NACH 4JGMA 3E6HA 1GGUA 1MY7A 4QOKE 2F54B 3RZCC 1GC1C 5EZOH 3KR3L 5D6DA 3CLEH 3NCMA 3PABA 5A3IC 3WE6B 4ZFOA 5DHVH 3RWIB 1CQYA 3KHQA 2VE6B 4OT1H 2VLLA 5DD0H 4N0CD 4O02H 5IMLA 4GRWB 2VDLH 3S37X 4H5SA 1FL3B 5J7CC 4J3UA 4U1LB 4MD5B 3B9EA 5F7DA 5BS0D 1TITA 4HX1A 4GG6A 2PO6A 2ADIB 4JFEA 1YYLL 3DSFL 1G7IA 1NBYB 3C5SA 2D0GA 1FLTX 4Y4KA 4OUOA 4KROC 3UPAA 2Z91B 4OQTH 4WO4D 5ETUA 5IBLC 1DQJB 1VB9A 2J8UA 2MCPH 4KVCL 4F57H 3JBG7 4P5MA 1ZLSL 4UQ3B 1WBZA 4GRWE 2E7LC 1G9EA 1GGCL 1G6RB 3V52H 1I8KA 4LNVA 4LCYA 1CZ8L 4DVRH 1EAPB 1MHPH 2DD8L 4XPBH 2IG2H 1EIBA 5F1SA 2EKJA 4I8DA 4G9FB 4LHUD 4XHQA 3AXLB 1S78D 4FQ2L 4YXHL 1OCWH 3EDKA 5FYLL 2GTZA 4HS6B 1CTOA 4CU7A 4EXPX 1U8HB 4RAVA 3TBSB 5BVPH 5SWSD 3MNWB 2ED7A 3UDWC 2XZCL 2NXZD 2B2XL 4YHIA 4O4YH 3OKNA 4ELMF 1C5CL 4Y2DA 1SY6H 2D0FA 2SEBA 4G9FE 1U8JA 3NA4A 3F12A 5DRNB 1T80A 4GS7B 2UUDK 4RWYH 5C0DA 3BRFA 3CXDH 3C6LB 4HKXB 4P5TB 1IBGH 3PDGA 5DMJB 2C7UA 3CMOL 1N64H 2QQKH 5E9DE 3WFDH 5IEHA 1UWGH 5KSBA 2CO6B 3UTQB 2WNGA 1I7RA 3I3BA 3TZVB 5EUOB 1FZKB 4X7SH 3WL9B 3QO0B 1ZWIA 2VDKL 1XR8A 5IMOA 4GSDH 2F5BH 4H0HB 1H3UA 5JW3L 1K2DA 1T5XB 1EZVX 5EO0B 3NPSB 3RVTD 4PGEB 1G9MC 4QYOB 1JN6A 4FFVC 4R4NC 3GSUB 3OAYH 2AXFB 4JCMA 2IAND 4PGBB 5EZLA 5D1QC 2VZ3A 3FFCA 2NY7H 3MV11 4FXGB 3H7BB 4P46A 4RX4A 1A5FL 2ERJB 1K8IB 5EUOE 4PJ8D 5HHQB 3G6DL 1YQVL 3SQOL 4PLOB 2AI0H 4WFHE 3E6HB 3FMGL 4IOFC 1IM9D 3IDXH 3SDYL 4FN0A 4M7LL 1CU4L 1N0XL 4PP1D 3Q3GA 4K7FB 1JI1A 1AFVH 4HQQH 3PQYA 4NN6B 4D9RE 1YPZB 4A2LA 3MMEB 4LCIL 3IF1A 5IP4A 3UZEA 2CD0A 5SWZE 4UV7H 5DD1H 5GISH 1OW0A 1YEGH 4H5SB 1F3DJ 1R0AH 4W81A 3O2DA 4R96A 2QEJA 5F7DB 2O5YL 3SDDB 1CGSH 5HSFA 4WUUD 4GG6B 2PO6B 4JFEB 4IDLA 4DKEH 3C5SB 3H7LA 4Y4KB 3BP6B 5JIPA 3LEXA 2WIIA 3L7EA 4JANA 3B9DA 3B2VH 1A6PA 2J8UB 3PWPD 1RIHH 2ITDB 1CK0L 2NXYD 1OAKL 1WBZB 2VL4A 4ZFOL 1W72H 4YZFF 4N8CL 3V0WH 1I8KB 4LCYB 4JY5H 3I6LD 4NZUH 4C55A 1RIVL 1QUNA 1T3FA 3IJYA 5I76A 2FD6H 1HQ4A 4OLVH 2B8OT 5E4EB 1MJ7L 1S5IL 4NP4H 2VDRL 1WT5A 1U91A 4M7KL 4N1CA 3RGVB 4HUNB 4RAVB 1WZ1L 3GSRA 5JLZB 2R1WB 3MFFB 3TLRA 5GRUH 3TEUA 2GI7A 3WCYA 4RQQB 1FVEA 2OS7A 4ACPA 4LU5L 4RMSA 5C9JA 5DA0B 4KK5D 2HFEB 4Y2DB 5H94B 1IKNA 2UZYB 5E2TH 2VDNL 1LQSR 2VSDA 1U8JB 4YGAB 1WWWX 4LIQL 4YDKL 1T5WA 3ARGD 3MA9H 4RGND 4CMHB 1NGPL 4JKMA 5E5MA 3QG6B 4OZIF 1DBML 3QIBC 4UNUA 2RAMA 3BQUA 5GS0L 5GS2D 1IGFL 4MJID 5KSBB 1BIIA 3UTPE 2NR6C 2FECL 1XIWC 1CXIA 1DN2A 4TVPH 1WTGT 3CPLA 3RZCA 3UTTD 4C56A 3OR7A 3VGFA 3F7QA 2DQIL 4QY8B 1ZHNA 1MCLA 2R2EA 5IESL 1XCTB 3FN9A 4GKSA 1NAMA 3LKPB 4OGAC 4OCWL 4J4PD 3FFCB 4XP9H 2WANA 2Z4QA 1KB9J 3BRGC 1ORQB 5EC1A 5D7SH 4J23A 5FGBC 3OJDB 4YK4B 5D1XD 1UFUA 3S34L 5LQBH 2EDWA 2VO5A 1FV1A 4HBCL 4GLRH 1FIGH 4ODUB 5GZND 4Y4HB 3FB6A 3GHEL 2N1KA 3ISWA 3AS0A 2ATKA 2BMKB 1KJ3H 4EDWL 3IDIA 4Q0XH 3HHRB 1AGEA 5F6HJ 2JCCF 4PJ7F 4XNMA 2E7LA 2I27N 2Q8BL 3W0WB 1VFAB 5J13C 2XWTA 3BN9C 5JO5A 4R96B 3A6BH 4UAOC 3UTZA 4QKXB 2YD4A 5CSGA 5L2KD 1JHTA 4WW2F 3L7EB 1MCBA 2XQBH 2YS4A 3TJHC 2XQYG 2AQ3A 1ZANH 3ARRA 1OAQH 1MI5E 4NRXB 3E6FB 4TUOA 1BWMA 1JZ2A 3UX9B 3TO4C 4CVZB 1WWAX 3W0WE 3QCVH 1LP9A 1GRWA 1R5VA 3UDWA 5HGBA 5JHDB 2R2CA 1JNNL 3ARED 1T3FB 3IJYB 5CD3B 4MWFB 3D48R 3O4LA 3C5ZC 1LEKA 1HQ4B 5DUPH 1J05A 2BFVL 3RIAF 4Y1AB 5C0GB 1U91B 1W0WA 4Z8FL 1BX2A 1IM3A 1U8NB 1ZTXL 4QTIL 2DM2A 4FFWC 4K3EL 3GSRB 4NKDA 4NYLA 2FIKA 5KAQF 1EBAA 5DZOA 4OF3A 4OGXL 5GHWL 5B39B 3NFPA 5JHDE 4NQXA 1FVEB 4U1GB 5C9JB 4J8RA 5LKNA 5D70H 5DD3L 1U58B 4TN9A 4M7ZB 4PLJC 4Y1AE 1IGYA 3NABH 3TBWB 3JWOH 3X3GH 4P3DA 1QSVA 5C09D 2GSGA 5DJZA 3WIIL 4U6HA 1RUKL 5E5MB 3TV3H 5IKCB 4H88L 3