1T0PB

Structural basis of icam recognition by integrin alpahlbeta2 revealed in the complex structure of binding domains of icam-3 and alphalbeta2 at 1.65 a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
b'QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-L
molecule tags Immune system
source organism Homo sapiens
publication title An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2.
pubmed doi rcsb
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0pB00
3FFDB 2VIRB 4K23H 4Q0XL 4IRJC 2Q7YB 1YJDH 1MQKH 1SJEB 1UCBL 4ODTL 3PGCB 3UO1H 3MRMB 4L1HA 1J8KA 1KSRA 1GAFL 2AI0H 2VDPL 3DUSA 3IGAA 3WFBH 5HXMA 2BCKB 3K8LA 2ZUXA 4ZNEA 5JOEA 2NMSA 4YNYB 3FB5B 3QUML 1FNHA 5EU4A 1HSBA 3DMMC 1A3RH 4H0IA 1SQ2N 3G6JA 3MFGB 2P48B 1H3PL 1Z3GL 5DRWA 3O2VL 1D5BA 3KLHC 3FFCD 4Y5YC 3C08L 3V8OA 3HI6H 1MJ8L 3U46A 1N7MH 1UB6A 4JZOA 3QNXA 2VR5A 4LSDA 35C8H 2BOBA 4L5FH 3VXOB 3OZ9L 4HUWB 4MYWB 3KYMA 3GMNA 1MCCA 2H6PA 4G7VH 5IESL 4XBPA 4ZOAA 5IBLD 3MLWL 3LS5H 3MRKB 3THML 3LKNA 2YD8A 1QO3A 2MKWA 3UJIH 3QPXH 3P0YL 2HJKB 4NQDA 2GTZA 1A7BA 2DB8A 2JE8A 3QUXB 1KFAL 1KUMA 3OAUH 4Z18A 5FGCB 1EO5A 5HY9B 2K9UA 2AEIT 3TZVD 2ZCLL 1A1NA 4S1DC 5I2IB 2ITDA 4BSVB 1K4CB 4FQXC 3UTTE 3CLEL 1YNTA 4OZ4B 3DMMB 4GRWE 1V7NL 5IMOA 3HRZA 5ANMB 1H15B 4XX1G 4Z7VE 4K3JH 1Z2KA 1T5WB 4MJ5B 1BX2B 3BYTA 2VRAA 3UTTD 2VDLL 4UTBH 3T0EB 3L3OB 4QXGH 1J1PH 1CFTB 2AAVA 3MRJA 5E6IB 3O2DH 5HDOA 4PBXA 1YMMB 4HK3J 5EU3A 3SOBL 1CWVA 5C0IA 4MCZB 1NPUA 3QHFH 5IT2H 1LEIA 4PG2C 3K2MC 1QEWA 1A21A 4XP9L 1T21A 2H2PD 4K23L 3JV4B 1OCWL 3EO0A 2AK1L 1Q1JH 3GMQB 1OVZA 3V7AE 3GMMB 3MTRA 4PJDE 1UJ3A 3VD5A 5CBEA 3GSUA 4NO3A 3RWCB 3BDBA 3QWRA 5LGJB 2OR9L 2P5WD 1QSFD 3RKDC 1HOCB 4K3JL 1RZGA 2IH1B 5C08E 4I3RH 5GGSY 1U8HA 3QQ4B 5JW4R 1WC7B 1BFVH 1LD9A 3VW3H 2YXMA 4W6YB 5LCVL 3VXRA 5CMAA 3ULUH 2YEZB 4K7PX 5CHNB 1AXIB 4NNYA 5I16A 2VXTL 3OR6A 5C3LD 1MFNA 4KPHL 1XCTA 1J1XH 4HS8H 1Q72H 3BPOB 5IMLA 1RIVH 2MSPA 2X6MA 5ISZE 5J57B 1U6AL 3M1BA 5TE4L 2JJWA 5IOPB 3PNWB 5CP7B 4DGIH 3UJJH 4W6XB 4N8CH 3V4VL 2EKSA 3EHBD 4HWZB 5IROC 4OQTL 4OTXH 3QH3B 3IAGC 4WFED 1IKNA 3BHBA 3MUY1 1G7HB 4BH7B 1MFAL 3MUGB 4LLUA 3NCBB 1JGVH 2F5AH 2PTVA 3BZ4A 2FX7H 1JPSH 5FDWB 2WIIA 1CD1A 3RQ3A 4WWKB 1DDHB 3CSGA 1BJ8A 1BFSA 2CDGB 3ALWA 1D6VH 3P9WB 4H8WH 4MSWB 3FTGB 1JF6A 2XWTB 2X4SA 4LVEA 4UTBL 5K9QI 2MHAB 2BNUA 2B39A 3RDTC 4RQQB 1P7QB 3PXJA 3OKEB 4F15C 4F7TA 1D9KC 5F9OL 1BQUA 3KVQA 1S9XA 2EDFA 4I5BA 4E0RB 3IVKA 2LAAA 2R2BA 2BXZA 3O4OB 4XXDB 2FJFB 4PRBB 5SWZD 2A9MH 4AEHL 3X11A 2Z8RA 3GIVB 1BVLA 3S88L 1IBGL 1A3LL 3LEVH 4QF1B 5JZ7C 1A6ZB 4LPXA 4R7DB 3D39A 3OAUL 2I07A 2X4RA 5I6XB 1D5MA 3G9AB 1IMHC 4XHJD 1BQHA 1QRND 4JQXA 5DHVA 5SWZE 1XIWA 3MRQB 2BJMH 3K7UA 1NCAL 1VACB 2ESVE 4WUUD 4Z7WA 3THMH 4Z7WF 4X7FC 3B9KC 4LQFL 1GL4B 3V5HB 4MX7B 4WW2F 1EHNA 1NFDB 4L4VD 2DD8L 3T3PF 1QRNE 4TUOA 4Y1AD 1T2JA 4R4FH 5D2LA 4QYOA 3O3BA 1I7UB 1FO0H 1V3JA 1UVQA 1L7IL 1F58L 2XWJB 3QG6B 3NGBC 4S1RL 3GNML 4LLYB 4OD2B 4R96B 1J5OL 1A3QA 4HC1A 1ZLUH 2FIRT 2Q8AL 5DXWA 4NUJB 4GRLC 4KUZH 4LPCA 2EDXA 2A38A 4N0CC 3X14B 4UILL 2NY2C 4FQPA 4PY7B 3GO1H 1GGBH 3WLWC 2F19H 4LSVH 1CD0A 4X9IA 4NN7B 2VZ1A 4UDUB 3CSYA 4NRYA 2Q86A 1F4XH 3DUHA 3C6LB 5BO1L 5BZDA 5KSAA 1G1CA 3G6JF 1KEML 3BWAA 3B4NA 3VU2A 4TNVK 3PG2A 4HH9A 3OR6B 5EDXA 2C4FT 2VL5B 3EJJX 5DJZB 1KJMA 4NNYB 2J6EA 4TRPL 4I77H 1NGZB 4JRYA 1YEDA 5CMAB 1L7TH 2X4QA 5HYSA 3NPSB 1AGBB 3JV0A 2DS4A 2X2YA 1DZBA 2NXYB 3MV7D 2Y25A 2ZPKH 1U91B 1NC2D 3MA9L 3GI9L 3QNZA 4JFXA 3P4LA 3VFUA 4OIAA 3VFMB 2RBLA 4RA0C 4Y2DA 4GFTB 4V1DA 4CMMA 4YO0A 1T5XB 2CRYA 3CXHK 2Z31B 3G6DL 4WTWA 4DW2L 2YZ1A 2XWBA 1IGYA 4MD0B 2CDEB 3KWWB 5EU7C 3HZVB 4IRSD 2BXYA 4ZTPH 1QEWB 4G5ZL 3OB0H 4WU7B 1BHGA 1QFPA 3GSRA 4YFEA 5DVKA 4NWUH 1II4E 1LE9B 2NY0C 5T5NF 1L6XA 2HVJA 3ALPA 1S7UB 3VFPA 2HFGH 3C5SA 5C08A 1QLEL 2CKBH 4MXWL 4PJHF 5EU5A 4OB5L 5EU6E 2W1NA 2J6EL 1MJJA 4IDJL 4XGZA 3Q0HA 4LCWD 2HLAB 1FNSL 4G43B 4P2RE 4PTUB 3D0VB 1HK6A 4JO1L 3VXSE 5T1DH 4BSVA 3QXUA 4PJEA 3RX8A 3STZA 3SDDD 3DX8B 4P2RD 3ZT7A 3QCVH 3TLRA 3MLUL 4CVZA 3V6OC 1MWAB 4UT9H 4YZFE 2WQ8A 2A6IA 4O9HL 2JIXB 3HZYA 1MJ8H 4K9EC 4JRXE 2X9XA 3VH8B 1U2HA 1DUYB 4NQSA 1WCBA 4OD1H 3DX6B 4JKPL 5JPMB 1OTSC 1TXKA 4BFIB 4R97B 2YA1A 1JZ8A 3R1GL 1T04A 2OZ4L 4Y5VC 3DRQA 3VXQA 4MNGB 1AH1A 4JFHD 3P4MA 3DVFA 5JW5B 3BKYL 2CO6B 1M7DA 3TIEA 2FO4A 5IB1B 1KENL 1TDQA 3GI8H 2H1PH 2WLZA 4MMZC 1RZ7H 4PR5B 1JJUA 3FT4B 4PRIB 3G6JB 1EHLL 1MCIA 3BYYA 4EZMA 1J0HA 3T4AA 1NC4A 1ZLVH 4DGVL 5IFJB 3JTTB 1KIRA 3PIQA 4W70A 4IRZH 3WLWD 2CO7B 1NC2B 3K8MA 1SJEA 1TPXC 1TENA 2VQ1A 5B8CC 2HT2C 4ZXBA 1AJ7L 4OBSA 5EO0B 1I3UA 2W60A 3PQYB 4U3CA 4Z78A 3MXWH 3CU1A 3WFEH 4WWKC 2OZ4H 4ZOBA 4CU8A 4NDMA 4HCRH 4KKAC 5IVZB 5GGSA 2VDRH 1S7TA 1YEGL 3D0LA 1QUNA 4JFZL 5EBWB 5BV7C 4GW1A 3P11L 4RFEA 3ROOB 1B0RA 4WY7H 1NCUA 1OB1B 1S9WB 3E0GA 4X6FB 4XBEL 3SKNB 4QRUB 1E4WL 2XXCB 3S4SB 2PYFA 4Z7QF 1YNLL 5CEZD 4TUKL 2BHZA 1AO7E 1UH4A 1WITA 5FO9B 5EOTB 3BE1L 1NDGA 4S2SB 1FL5B 4O00A 4NUGL 4AEIH 1GRWA 5B3JE 2EE6A 3GSQB 4L8DA 4F57L 5DURD 2R0WL 4PREB 3GGWB 4U6XA 5KW9L 4MA3B 5I30L 5IEHA 1KXVC 5D72H 1MI5E 1FVCB 1AO7D 5HI4C 1YPZE 1R6VA 1ZXQA 3RY6C 1BWMA 2GK0B 2Z35A 2Q3ZA 1Q94A 3WS6A 2RB8A 3IETA 1JPGB 4IS6A 1AQKH 2XZCH 3I84A 4XNMB 1MFEH 1FCGA 1A7QL 4AENA 1UWEH 5SWQA 2B0SH 1MRDH 4TUJB 5ENWB 4XPAL 2GSGB 3SCMC 2ZSVA 3VFTA 2GFBA 2H32B 5HI5C 1F8TH 3WN5C 3B9VA 2PYEB 3QDMB 3K1DA 2P24A 4CNIB 1W72A 4NKDA 5T3XH 3ILPB 1CDCA 3CH8A 1O0VA 3LKOA 5ESQB 3P9MB 3RNKA 4PJHE 4OAWA 4TVPE 2FJGA 3EGSA 5DJCB 1AI1L 5J12B 5JHDB 1AFVL 4BH8A 3DOSA 1GZPA 4HQQH 2FIKA 3QEHA 1RVFH 5EIIA 3H9SA 3DBXA 4X8XA 2F58L 1KN2H 4L29B 2VR4A 1RUPH 3CFKB 3ZDYE 2DLFH 4I2XB 4WHYH 4OV6F 1PG7W 4ODWA 2XOTA 3MLYH 1G9NL 5IM7A 4RFNC 4GKSA 1GCFA 4PUBL 1VCAA 3GEWB 4DUWA 3PXHA 4I0PB 1CE1H 1FIGH 1FV1A 1NEZG 3X3GH 1VPOL 4L9LB 3FO1B 1CICC 1ETZB 3W9EA 2FJHA 3CXDH 1MEXH 3HMXL 1ACYL 3WFCH 2HJFB 1TJHH 4PJ9C 1FHGA 3KLDA 3WNLA 3QQ3B 1YJDL 2NY2D 3HLAA 5DRNA 4G5ZH 2CIIB 3L3KB 2P5WB 2OX5A 4BZ2H 3U36A 1VPOH 4H8WC 4O2EA 4U1MA 3VCLB 3CVIL 3IDUA 2DJUA 3O0RL 3O41A 3ET9F 1RZFH 5TGBA 1VDGA 4IEFB 5E8PA 1EAPA 4JQVA 3BP7B 2ATKA 1DR9A 4PJFF 3DHMA 4AJ0A 3HNVH 1A22B 1T6VN 3Q3GB 1KELL 1OAUH 3GHBH 4JLRA 4MA1B 3TIDA 2EEAA 5HHNB 4HBCH 2N4IA 4K3EL 4YUEL 4YEEA 1I1CA 4CN1A 2E9JA 4GSDL 1QLRB 1AGFA 5D7LA 4GUPA 1BP3B 1NFIA 3D69B 3ULVC 1QA9A 3K1KC 1CDYA 4YDLB 3ARPA 1JN6A 3BO8A 4I0CC 5JIPA 3G5YB 3T0BA 3VJ6B 1JNNL 4A6YB 4CAGA 1YNKL 3KPLB 5E2TL 3OQ3B 1CFVL 3BMVA 8FABB 4EUPG 5K59F 4NO2A 4FZ8H 1I8IA 4LLMB 1OQXA 2IPKA 2V2WA 5D8JH 1YMHB 4J1UA 4RAVA 4WDIA 1QPPA 2OYPA 1AKJD 1U3ZA 3RWIB 4FS0A 1X5KA 4NRXA 5F3BB 1SBSL 4P9HL 4E5XB 3QCUL 4BQ6A 3QQ9C 3IFPB 5F9JB 1EA9C 5KW9H 4Z7WE 3SCMD 4QOKB 4OI7A 2GT9B 2FX7L 3UTTB 3BIKB 3QUZC 4BFEA 4FMKA 1NAKH 4PJEE 3VGFA 1BOGA 1TVBA 2Y06L 4R0LB 1DQLL 2E7HA 3OKDA 5I73C 2YA2A 3NA9L 1YEIH 3QFJE 5MHSD 3WKNA 2ZJSL 4GMSH 5B38B 2YUVA 3W9DA 1P9MA 1JGEB 2VLRD 2X44D 1FO0L 2HLFD 5D70H 3M17B 3WLBA 3AB0C 1YEGH 4M7ZB 3U4EA 5FA3B 1BVKB 4L4TD 4PJ5D 2R1XB 3RX7A 1AO7B 2W9DL 4JO4H 1J11A 4Y4KD 1CK0H 2DQEH 2E6JA 4BJLA 3DROA 1MPAL 4P5KA 5GRYA 5K9JL 5HGDB 5TFSH 3K4DA 1Q9KB 4QWWC 4HHAB 3L1OH 1RIHH 4TNWK 1RPQA 4I77L 3F12B 1JRHL 4XCCL 4GW4B 2GJ6A 3EFDH 1VADA 3ZDYF 2IADA 3QI9A 4DQOL 4O2CA 3U4BH 4OUOA 1G7MA 3AM8A 4JY6A 5E2WH 2A9ML 1H3VA 5FGBA 4M7LH 1QKZH 3P30H 3CMGA 1RZKL 1QBBA 1SYSA 1SEQH 5F71A 4R90H 5K9QG 1UWGH 4NSKA 2BNRD 1A7NH 1CI5A 5F7NC 5DK3A 1FDLL 2WZPD 3FB8B 1N6QH 2OL3L 3QUZA 2DMBA 1I3GH 1ZA3B 5HHXL 1WT5A 2PTTA 5GZOC 3SE4A 3KYOB 3MBEA 1FNAA 2F5AL 2P8LB 4TQEH 1LP9E 3MJ9H 2Y23A 1CLYL 4P48A 4PP2A 4WI3A 3MV8B 3HHRB 4FQ2L 1CTOA 3TH4T 1ZHNA 4KQ3H 4X5WB 3VRLE 1WIOA 5SWSA 4DZBA 4DZ8B 2JJTC 1JHLL 1WWCA 2VDQL 1T1ZA 3T4YB 5GGUA 3JWDL 3T0XA 3MLTA 5F3HA 2EYRA 3D39D 4NNXA 4AMKL 5E8EA 2X89A 1QRKA 5DD5L 3VWJC 1TNNA 2UWEE 1N59B 1A8JH 5IW1B 3T2NH 3BW9B 2GK2A 3RUGA 3IRPX 8CGTA 4ODVL 4FQCH 5IB3A 3U9PH 3RVWD 4JFYB 4D0DB 4PJHA 1RI8A 1MWAH 1LP9F 1FL6A 4NJ9H 5BS0E 2DQGH 2RGSA 5BVPH 2H3NA 5IQ9A 2Q87A 2AV7B 5EORL 4KJYA 5C07D 2X9YA 3PWUB 5D7IF 1YC8A 3G5ZB 2VH5L 2DDQH 3QO1B 1CN4A 5HBBA 3IDJB 4NC2B 2DTSA 4P46A 5ID1B 5JR1H 1U8NA 5EZLA 2R8SL 3U9PL 1IGIH 1A9EB 4RGNE 3CFEB 1N0LA 3QZWA 4XPTL 1LEKA 2X4UA 4X4XB 1OT1A 1HHJA 1MHCA 3DV4A 2QHLA 4OF6A 4CVXB 1MFCL 2ZUQC 4QGYA 1T0PB 2LTQC 1JHLH 3O8XB 3GMLA 3CAFA 3OF6A 4Y16D 3B2UC 5GQBA 1I8KB 1HI6B 1M05B 3S8WA 1SJHA 1HH9B 3VFVB 4PIRF 1OAQL 5FXCH 4AIXA 1FZKB 1A1MB 2FBJL 2EYTA 4X9BA 2H9GB 5D72L 5ALCL 1I9RH 2EXWC 2GI7A 5E8NA 1MH5B 5HVHB 1U58B 1I3VA 1CLZL 1KJ2H 3ARFC 3HMXA 1VGEH 4JGUA 3FN0L 4CADA 3C60C 3P4OA 1J88A 5FDYA 5FYJE 4N1EA 3HNTH 2YPKA 5KJRH 1NUNB 5E24E 5CLWA 3FOLA 4X0KA 3ESUF 4YDIH 4JO1H 3D2UA 4Y4KC 4J4PD 2VQTA 4D9LH 3TNNB 1FNSH 2JTDA 3D2UB 1I4FA 3RTQD 2VAAA 4S0SD 1NANH 3HMWH 3MFFA 5MEPA 2ADJB 4PV8A 1D5XA 4Z7UE 5IF0B 4HWUA 1CICD 5BW7C 3D3VD 3QUXD 4Y2OA 1WWWX 1XF2B 1BM3H 4YBLC 2UYLB 4PJDB 5L7XL 4LSUH 5JUEL 4GW5A 1BREA 5E95B 1ZHKB 1INEL 3MRDA 3JWOC 5HI3D 3S36L 1RJZB 4PRPA 1V5JA 2X70A 4PJAB 1A3RL 3IF1B 4PB0L 1I8KA 4DAGH 1RK1A 2VLJA 2H1PL 4Z7UF 4M9PA 3ZYZA 2VN4A 3QR2A 2ENYA 4MZ3A 4TQEL 3TV3H 5I8CB 3MGTA 1IKNC 4NBYB 1FE8L 4NO0B 4PBVC 5HYQA 2DI8A 4JCLA 1N5AA 3B8YA 2JK5A 4FQLH 3RWHA 4HV8B 2GITA 1YPZF 1FSKC 2XKNA 1CFNB 4FRWA 2BVEA 5F7KC 2EE2A 2G9HA 2OSLA 2YPVH 2VXUH 3I75B 2WWMD 3V4UL 2AABL 4M48L 3U7YH 2AQ1A 2XZAL 3VWKB 4X7EC 3BMWA 1UXSB 5HHVL 4RBPK 1MLBA 3G5VB 1OGTA 2QSVA 3QIWC 4U6YB 4PJHB 5E94A 3NZHL 5D7JD 4NQED 1EGJL 5E2UH 5I71C 5LKNA 1M7IA 3CNKA 3O6FD 4HDIA 1JF1B 5E8EB 3V4PH 1T7YA 4UAOB 4EN3A 5KVGH 2GJ6D 3L95B 5SWZA 1D6VL 1N6UA 5F88A 4I0KA 4WHTA 3MOAL 1E4XL 4LNRA 2E9WA 4JFED 1RHHA 4PPTA 5H2BB 1NMBH 4HF5H 3TVMB 1KCSL 4GRLB 3VI4E 2XV6B 3CIQA 1QBMH 2Q3AA 3WD5H 3U6RA 5IIEB 4Y16C 2P8LA 2A73B 2R23A 4NQCE 4K2UH 1NGPL 2LTQB 1BD2E 5DDHA 3TFKD 5DVMA 3K4AA 1FZJB 4TYUA 4HS3A 1D6EB 5D1ZB 5JW4Q 1HWHB 1H3PH 2NY1C 2AJVL 2X1XR 4UBDD 1P69B 4I0PC 4WHDA 3ULUC 2CLRA 3OR7B 3WD5L 3BP5B 3B5TA 1MI5B 1U8IA 4MS8D 1NMAL 5HD8D 3HNSH 4BQ8A 4Z5RA 5FYJU 4LVOC 1FBIL 5D6DA 2GHWB 3PHSA 5EZJA 5EU6A 3KPOA 3ES6A 3L3IA 2RR3A 3PV6B 1F90H 1G0DA 1TZGL 5SWSE 2ADFL 2HT4C 3WIHA 2ADGB 3PWJB 2FECL 5CIPH 5E6ID 5AYUH 3GHEL 3BESR 4X80H 4CDHA 4MXQC 4MJ6B 4LMQI 2DQIL 4OUUB 1MREH 5FM8A 1G9NC 3WV0A 3QBTB 4BKLA 4GJTB 4HX1B 3QIUC 4M5YL 4PJFE 1TQCB 5DR5L 3GJEA 3AB0B 4GT7A 4TVPD 4PJ7E 3EOBB 1KBGH 1F02I 5AYQA 3C6LC 1TTUA 2V2XA 4JREC 4Y4FA 5DSCA 3RNQB 5MI0B 4XP6H 2D4FA 4ZD3L 4ZFFA 4ZG1A 3UDWC 2GJZB 4MA1C 3RVXC 3L5JA 4HUMB 4NKIH 5DD0H 4RGMB 3CFBA 3PGFH 2LABA 1ZWIB 5F93C 1IEAB 1R3KB 3MZTA 4JAMA 3NFPA 1SYVB 4JFFE 4H88L 3LKPB 3GUTB 3O8XD 4Q6IB 4AH2A 4TSBH 3UROR 1KF9B 1ZA6B 3ULSA 1IM9A 1E6OL 4ZFGH 3WFCL 3AU1B 4LMQE 3QSKB 1C5DB 3NIFE 3HG1D 4NIKB 4U1KA 4ENED 3QEQD 1BVZA 1X4YA 4WCYL 1EFXB 1NCBH 4JFQB 3LQZA 1F00I 2C1PA 4MNHA 2A6KA 3ORJA 3LAFA 2QJDA 1DBKH 5C1MB 4MHHI 3CXHJ 3PWPA 1FSKB 4B5EA 3TF7C 5ITBL 1T1WA 1HDMA 2MPAL 1QSFE 3GFUA 4YDIL 2D31A 5D1QC 5D7JC 5C70A 2OMNA 4MJID 5F6IC 3C60A 3ZE2E 2CDFA 4JG0L 5SX5K 4YHML 4LKXB 1FCCA 2XQYG 4GRWF 4Q2ZB 3FRPG 4GBXB 3L3DB 3C60B 3LKQB 2Z93A 4LCUB 1L9MA 2FEEL 4LCWA 1Z3GH 4KKLC 5L6YH 4G8EA 1MCLA 2Z31D 2OK0L 1MFBL 4H5SB 4MNHB 2R0KH 2LU7A 4JG1L 3TBTB 3L5XL 3GSVA 3SDCC 5GPRA 2P5EE 2QHRH 2X1WL 2Y4SA 4XWGH 5K9KA 5CWSA 2L7JA 5FF6B 1TVHA 1XGQB 4B0MM 5GS2D 3FQUB 3S96B 1YPZA 3ZHKA 3WDJA 4QTHB 3VG0H 2DTMH 3SOBH 2GAZA 2R4SH 2VXQL 4KC3B 1EO7A 2WWKT 1AIFA 1RMFL 4UU9B 4QRQA 5E56A 5L2JB 4KI5F 5JW3L 1G7QB 4P3CH 4J3OC 3ARDB 2HG5B 4OCYH 2DDQL 5C0DA 2D9QB 2QR0A 4L9LA 1FV1B 1OAYL 2FRGP 4ONHA 3BN9D 2CUIA 4ELMB 4LPYA 1KFAH 4L4TA 4PJ5A 3RI5K 5GS0D 4ODXB 4OFYA 3PWJA 2AJYH 1CGXA 4XTRC 2YKLH 1NSNH 1FORL 1WIPA 5L2KE 3PHOA 5J1AB 1CLOL 3KPOB 1MLCA 3LKRA 3HE7A 4DKAA 1FG9C 4C83A 4AL8L 4BKLB 4YBHA 3UYPA 1CE1L 5JHDA 1A9BA 5L2KD 3QIUD 3IS1X 1NCBL 4MJ6A 2PYED 1MCWM 3I3EA 3QDMD 1WVZA 3ZKMC 2ILLA 3BSZL 4WVRA 4NQEB 1OP3H 3TJEL 2Z91A 3O3DA 1FZJA 1F4WH 3MGOA 3OZ9H 1PDKA 4PGCB 2HKFH 4IRJB 4L4JA 5EU6B 1T66D 4WO4A 2H32A 2OJZH 4NQTA 1ND0B 1X6LA 2FLBT 3MXWL 3VFTB 2A77H 4WNQB 3BJLA 2JB5H 3NH7L 5D4QA 4GRLA 1EDQA 4M43H 4KHTH 5I71B 2O5XL 3HC0B 2QQLH 2IANA 4LSTH 2VNCA 3WN5B 4LNRB 4K71C 1KB9K 3KXFD 3T8XB 4XPFL 4M1CC 1W0VA 3NCYP 4DKDC 4KROD 5IR1B 4HS3B 4P4RB 4U0RB 4XPGL 3TVMC 4Z7OF 5DMGC 1LK3H 1CQYA 5T1KB 5D71H 3WSQL 3DARA 1N6QL 1I85C 12E8L 4X4ME 1DTUA 1FGVH 4MAYC 3ARWA 4G6JH 3FHQA 1BZ9A 2Q6WA 4ELKB 4WI9A 3A0OA 3CGTA 4MQTB 3QIWD 3A6CL 4OLUH 5E03A 4YHKL 3ZMRA 4YHLH 5DUMH 2ESVB 1RZJC 3F65A 4QHMA 3FQXA 2PTUA 5CIPA 1IM3B 1NH6A 5A2FA 2I9LB 5LBSH 1KBGL 4F7PA 1KEGL 2BRRH 3JSSA 2AK4D 1WBZB 1X4XA 2EZ0D 2DQGL 2VXVH 5AG8A 4DCQB 4R8WH 2N56A 4FFWD 1YQVH 2BNQD 3W2DH 3RZWA 5IW6B 3KPTA 3LQMA 1IFHL 1XGTA 4RGND 1I1FA 1INDL 1PD6A 4OZIA 1T22B 4JY5L 2IEPA 3O0RH 2G9HB 2OSLB 2X70B 4LP4A 4IIQA 3ARDD 2BNQE 3NN8B 5DJ8A 2Z4QB 3PIQB 5IJVA 4YHPA 2M8XA 4PJXB 1G9MC 4YPGA 2ZCHL 4UQ3A 3PDOB 1P2CA 1D5IH 4MD4A 5KBNC 2APVA 3B9KA 4GXUN 4P46D 1PG7L 3GM0A 2C3HA 5GJTH 1ZT1B 5A3IC 1RZKC 1T0MA 3OPZL 3PJSA 5EUOE 1H3XA 4PV8B 1AP2B 2CXKA 1KULA 4L9LC 3QA3B 4KK9C 3ZE0E 3UZQA 4GXVH 2B1AL 1M71A 3D2UD 4PRPD 1EBAA 3HZKB 3VFSB 2KPNA 5MP6H 3PWLA 1WCBB 2CGRL 4O5LH 4ZTOH 3HA0A 5CZKA 3OWEA 4PJAF 1KC5L 1NCTA 1NGYB 1UCTA 4LRNH 5I1LA 4R0LC 1WK0A 4RMVA 4NC1E 1MRCL 1QFUL 3B9DA 3H7BB 3VXRD 3LMJL 2ADIB 1NGYA 5DO2C 5GIRA 1MH5A 1YEHH 4CJ0A 2W0KA 2YPVL 3HKFA 1GOHA 1JMZA 3QCTH 3C5ZB 3CC5A 2ITCB 4TULL 1A6WL 1MF2H 2BY0A 2K3TA 1A4JB 1BGXL 4XRCB 4YHKH 5JA9A 1YMMD 3QEUB 3SKMA 4NN7C 4WI5A 3EYVA 4MNQE 4P23A 5HGAA 5KAQF 3UAJC 3WO4C 4PRHB 4BA8A 5E8DH 3VXUB 1VFAB 2L4OA 1OT2A 1KC5H 4YC2B 2HVJB 3R0NA 2XZAH 2CGRH 4O5LL 1A7QH 2FYYA 5E8NB 2HVKA 3PDGA 1ZVYA 1Q0YH 3TBYA 1IGJB 2WNGA 3MRIA 4G9FE 1TVDA 5IFHH 1CFBA 2CDEA 3OTTA 4HC1L 3NN8A 3B43A 4IDJH 4EDXA 3G5ZA 1U8LA 5ESVB 4LEXL 3FMGH 4I18C 1YZZA 2OP4L 2DAVA 4JFDE 1FLRH 3VE0B 3GRWH 1IVLA 4KJYB 5D7LE 1GIGL 3O8XA 4HXBH 4XMKH 1LO0H 2VOTA 4X6CF 3FOMB 1B4RA 3RIAK 3VGGA 5FYKD 1FP5A 2EE9A 4AM0B 4ZXBD 3AXLB 3O9WC 3ZDXF 1JP5A 3BDYH 2DM7A 1WBZA 3CFEA 4HSQA 1EXUB 4DGIL 2A83A 4YHPB 3SGJC 1P5UA 3INUH 3W11D 1WF5A 3SO3B 2VMFA 5L0QC 3AMKA 4BK5A 2A9NL 1G9NH 4XMLL 5E5UB 4JFZH 3H9ZA 2EZ0C 4M1GH 1ES0B 2ZOLB 5SWSB 1S8DB 2VR9A 4KVNH 5F1KC 4YQXH 2AEPH 4M7JL 3DGGB 5L8JB 3UBXA 3OMZA 3E6FB 5E2UL 3LCYA 4HJ0D 4HBCL 1RIUL 1JPTL 3KYAA 4UTAH 3CFCL 3BW9A 4FQXA 1X7QA 5LBSL 2PTTB 5F97E 3MMEA 5T5FH 3ZZ1A 3U0TB 4YHZH 4G80B 2VO5A 4POZC 1HH6B 1RUMH 2HMIC 4DZ8A 3ZKQD 5DMKB 4ZFZA 4MCYB 5BO1H 2IAMD 3N0PB 1JVKA 3CVIH 4HJGB 2IAMA 4KK8D 4LCIL 4OD2A 2V17L 3MV8A 4FQLL 5CJQL 1H8OA 1VADB 2XWJA 2B0SL 1UVQB 1QOKA 1NDMA 3KYOA 3MBEB 3TEUA 1MFEL 1QZ1A 4HPYH 4IRJA 4PGCA 1B2WH 4DVRL 4P9HC 5J89A 4U6VH 1D5IL 3U30B 2X09A 5D2NE 4QXGL 1R3HA 3K46A 1J18A 3KLHD 5ITFA 1NLDL 2R1XA 5DD6B 2IFGA 5FA3A 1Y0LA 3WN5A 4F7EA 3L6FA 5BCAA 4HFUH 2VXSH 5EIVA 2FDBP 1EGJA 5ICXA 2FB4L 4PRIE 4WNQA 3RHWK 4QF1A 3DSFL 2DQHH 4QNPF 3BP6B 4HWBL 1IGCH 1BM3L 1MHPH 2ZWLT 5E2VH 4KKBC 5IB2B 1ULVA 3KYKL 1ZEAH 2ZNWA 3QISA 4ODXA 4L4TB 4PJ5B 1T66C 2XTLA 4HFUL 4W6WB 3HRPA 3RGHA 1SY6A 5SX5H 5CINH 5CZXC 2FGWL 1A9BB 1S7VB 1T83A 5E5RB 3FZUD 3FJTA 5JZ7D 2VAJA 4C83B 3C9NB 5C0AE 5CUSL 2P42B 3OKDB 4YHIB 4L5FL 4QTHA 1DBJH 3QQNA 3B9KD 3W0WE 4MXVF 3ZKNC 2DBLH 1T1YB 4Y5VA 2AQ2A 1J05A 1VENA 4L8SB 1INQA 3V95A 1V05A 1KTDB 5C0DB 2PO6C 4E5XA 2H8PB 4R2GC 1T2QH 4QRQB 1SM3L 5DWUL 1T20A 5TDOB 4OD3H 4P4KD 3KPSB 5GRJH 3OG6B 4FQJL 4AK1A 1ED3B 1DQQA 4IM8A 4NUGH 4AEIL 4FG6C 4JANB 2YXFA 5KSAD 5DD3L 1V3MA 5B8CA 1HXYA 1YEJL 1PX3A 5EWIH 1DCLA 3TBTA 1FO0A 4NT6B 5IFAH 1YNLH 3HE6A 3DETD 3O6LL 3VXSB 1WC7A 5DQDH 3L5HA 3T65B 5CSBA 1BQSA 3AREC 1S7WB 2NZIA 4K7FB 4YH6A 1RUKH 3HE6B 3JZ7A 1B0WA 1RZGB 4NN6C 2YSSB 5D93B 1HEZA 3IFOA 5JHLL 4YHMH 2M1KA 2E6PA 1OARH 2G2RA 1O7VA 4C56D 4W4NA 2V7HA 5D6CA 1NAKL 1JBJA 3LN5B 4U6TA 2CSPA 4LP5A 4EIZC 1CFQB 1GZQA 1BFVL 2X05A 3P9LB 4LEXH 4U0QB 1R3KA 5FK9B 3CSPA 4DKEL 3BJ91 3HN3A 1NBZA 4QT5B 1ZTXH 5J3HD 4HKXB 2PN5A 3LQZB 4JPIA 3IXAB 4J3TA 1F4YL 1TETL 3MX0A 2F54D 2VSDA 5FKAA 4U1MB 1IAIH 1NGPH 1Z0NA 4L8SA 4MWFB 1N4XH 1A7PH 2GJZA 4MJ5A 4HXAL 1N3NA 2R4SL 2BP3A 4Q6YA 5D5MF 3BGMB 1FAKT 4H88H 1H15A 2D03L 5IMOB 1T20B 5TDOA 5GSRB 1MJ7H 3Q6GL 1OP5H 2OJEB 2XQBH 3UTSE 5FEBA 2H8PA 4QHNA 3O9WA 5KVGL 3ZDZF 4OUUA 4R26H 4KWUA 5D2NC 1IC4L 1QHPA 4NO5A 4RX4A 4OIBA 4X80L 3UTSD 1RHFA 5DURB 4NKDB 5DZNA 3MNWA 2D7TH 5H35B 2HTLC 4P2OD 4GAJL 3CFKA 3TJHD 2PYEE 3QDME 4L29A 5FO7B 1T6WA 2CQVA 5C86A 1LO4L 1MPAH 5ICXB 1QFWM 4Y2DC 2VISA 2KKQA 2CUHA 4Z8FL 1RZJH 4OLVH 4WENB 4K94C 1MVUB 3ZDZE 1XR9A 2O5ZH 3H8NA 3ARUA 3RNKB 3MLVL 4QLRA 1TJIH 2HFEA 4CNIA 5DDHB 4PRDA 3PQYD 3ZKND 4Z95L 2ZUSA 4HG4K 1Q9OA 4HUUB 1EX0A 5D96B 5D1ZD 5SV4A 4XT1C 1BBDL 3H3PH 3L7FA 4XPBH 1MCQA 4XNMA 5MI0C 4MCYA 1MUJB 5DD6A 5DMKA 4XC3L 5F7HA 1P1ZA 1R5IA 1PG7X 3DV6B 1IE5A 2FATL 5DUBB 4XXCC 3K2UL 1IRAY 1JF1A 3BPNC 3C5JA 4PJBF 4HDIB 4MAYB 3KXFE 1TQBC 1X7QB 1ZLSH 1VFBA 1BMGA 5L2KA 1ORSB 3U6RB 1A7OH 4ZUSA 4B50A 4LDLB 2BK8A 1Z9OA 3E6FA 3D3VB 1S3KL 1UXSA 2EO1A 1RHHB 3D18B 1CFVH 4R3SA 3S5LG 1AQDB 4ZFZB 1S8DA 3AY4A 2AK4E 3DXAD 5F9WC 1RSFA 3BIAX 5IB4A 5F88B 1CU4L 1PKQB 4MDIA 3RWFB 2W0LA 2UUDH 3V4UH 4MQ7A 4HPOH 1UZ8B 3RA7L 4U7SA 4POZD 1QSZA 5IFJA 5KSBA 4JJ5A 4FQXB 4TULH 4GW1B 3VD3A 5EZOH 2EXYC 1N5AB 5E94B 1CFSA 4P2RB 5FO8A 4AM0A 3FT4A 4XC1H 4IOIB 5ESAB 5I8CA 2QL1A 1NCWL 3QG7H 5LQBH 2W60B 3PQYA 5EU7E 1IM9D 1KJ2B 3UC0H 1PQZB 3SPVA 3VXQB 1NC2A 1OPGL 2IALA 4PRNB 2OLDA 3TO4D 3T08A 1NC4B 3JTSB 3Q6FB 5I1HL 3NH7H 5C0BB 4FFZL 4PRIA 1JGLL 4NQSB 5F8QC 5J11C 5J6GA 1X5XA 3QUYB 4QRRE 1BBJA 2UYLA 3GMOB 3ZE1F 1NCCH 4PRPE 5IGXL 4OQTH 4OTXL 3VXUA 1NQBA 1U95B 2DRUA 2XPGA 5F7YC 1BWWA 1XEDA 3BZFB 2E8ZA 1D5XB 4G7YH 1KTLB 4KUCD 5ESVA 4HGWB 2VAAB 3WIHL 4QRRD 2XY1A 3HE6C 5T3ZE 4KKBD 1F97A 1A4JA 5CEYA 2R0ZH 3QPXL 2NXYD 4K94L 3TPUB 3SJVE 4RFOH 1K2DB 5D7IE 4D9LL 2VLMD 5CZXD 4Y8AA 4DK3A 4N0FB 2VXTH 1BECA 1VFUA 3OAYK 2XY2A 5ABDE 4HWNA 2JIXA 1V7ML 4JPWL 5HHOE 2VSCA 5D7JA 4TOYH 4H20L 2D7QA 3B2VH 3BDXA 5DYOA 1CR9L 3TPUA 3MJ8A 4WI7A 3HZKA 4G8GD 5FUZL 1CD9B 5C92A 4FTVB 5HHOD 1A0QH 2CK0H 4HGWA 1AXTH 2N7AA 5DLMH 4WI4A 1S7QA 1IQWL 4MNGE 2FSEB 2UUDK 5CILL 3VD9A 4MZ2A 3QNZB 2XZZA 1ZHLB 1JTPA 1UCBH 4CADB 4F37K 1ONQA 2KDGA 3TV3L 4OZGF 2X4UB 1V3LA 4HJJL 3Q6FA 4Z7NF 2H2PC 4GS7C 1PSKL 1RZKH 1FZKA 3FB6A 4XZUB 4PJBA 2Z92A 5DJZA 3MV9D 1AP2A 1YY8B 1OSZA 4L8SC 5IK3B 4OGZA 1JTTA 1XGTB 4FABL 4B41A 1P5VA 3TT1L 4G6MH 5I66B 3IDGA 4XCFL 3E1F1 3VRIB 2G5BB 3QAZB 4RGOH 4J7RA 4D0DA 1MAJA 4TSCL 3J8F7 4DN4H 5D7LD 1HXMB 1VGKA 4YPGB 1YEDB 3EZJB 4NZJA 1KCRH 1UQSA 5F70A 4RWYL 3IFLL 4MQ7B 1X5ZA 3HMWL 2YD2A 4ESKA 5JPNA 2EH7H 4TVPH 3UJIL 1KB5L 5C0GA 3MBXL 1I1FB 1SY6H 1BLNA 1J86A 1MCSA 2H3NB 2ZCKH 4IHOB 5IQ9B 3QIWB 3ABZA 4LLYA 4ZAKD 5J3HC 4UQ2A 2L7UA 5IFAL 1BBDH 1AGDA 2NY6D 4DCQA 5IMMB 4O51A 4ZUSB 3B3IB 2VXQH 3EHBC 2R0LL 4XVSL 4Z0BL 2I9LA 3LOWA 4BFBD 3S35X 4GRWH 3WUWB 3MV8E 1S5HB 4NSKB 4Q0XH 3SDXE 1OD7A 1NANI 5IFHL 2XXMB 3MA9H 4QY8A 3SKOB 3L7FB 1ZMYA 1KYOJ 2CK0L 1D5MB 2XYCA 4ELKA 2ICWA 1IC5H 5C0AA 4ODSL 4RCAA 4GW4A 5J9PA 1IAKA 1KPUA 5FM4A 3F12A 1I7UA 3X11B 3O3BB 3DUUA 2DTML 5DS8A 1ZA3A 1E4XI 1MNUL 3JUYA 4HHAA 2V17H 4KRPD 2QQKH 4TTDC 3QO0A 5D6DC 1NLBL 2Z91B 3GMRB 4NQEA 2EDQA 1GHFL 3NABL 2NY1B 3IB4A 4M7LL 1AGCB 3MR9B 2ATPA 3T8XA 3OKEA 1MVUA 1IGML 1MCRA 1G7MB 5E6YA 3C2SA 1VESA 3G6AA 3HE7B 1HCVA 1DJSA 5DEGA 4ZFOA 1F13A 2BSED 2VDKL 3MGOB 4U1HB 3BKJL 3MLUH 3GIZL 3M8OH 4NO5B 4D8PA 1OQOA 1SJXA 1MCWW 4OZIE 4ELMA 5EUKA 2AEWA 5F9JA 3GB7B 2AJXL 2MHAA 4ERSH 4KRNA 1DBKL 4HUVA 3TGXA 2QSQA 4S1QL 4ZOCA 3D5OF 2MJWA 3F5WA 4NKIL 4IIQC 5DD0L 1G6RA 4WUUB 5E08H 1YMHA 4AYFA 4RAUA 2H45A 5DC0A 2J5LB 2ICEA 1CG9A 4YXLL 4HT1L 5K9KB 3WS6C 3FMGL 2JB6A 4OZIF 3IFPA 4GQ9H 4JZNB 4NQDD 1P4BL 2HG5A 4QRPE 5EPMB 2VERN 1XGYL 3LN9A 4QXTB 5DQJA 3QIUB 1EUUA 3I50L 3IJSA 3L3DA 5LGKA 4LVHB 1E4JA 5GS1C 2XN9A 5DD3H 3BN3B 3M45A 5C0JB 4S0TD 3RZCD 1F3RB 2BNQB 1MIMH 2DIAA 3QI9C 4PY8I 1T21B 5GGQH 4BZ1H 1S9VA 4MA7L 4NHCH 4M5YH 4U49A 3AREB 3RVWC 1MRFL 3T65A 1OSPL 1SMAA 5C0IB 1NUGA 4LCWB 2A6KB 5CAYB 1ZVHA 4KJWC 2ZSWA 5F6IB 5BV7B 5GRWA 5JXAH 3C8DA 4EBQL 2YRLA 3OB8A 5JO5A 3LKQA 4GBXA 1CFTA 5JOPD 3QDGA 1JWUB 4V2CB 2F53E 2F54B 1DQQB 2XRAH 4P0DA 5B22A 1SEBA 2D7MA 2YN3A 3P73A 4L8CA 5GISL 1MAML 1UH3A 4MLSA 1SYVA 3SE4C 3BP7A 2FJHB 3CDYA 2FEDC 3V0VB 5C9KA 1YMMA 3FO1A 2AXFB 1G84A 4CU6A 1JNHB 4PJGF 3SDXF 4U1KB 3GJFK 1WZLA 1ZT4B 3P40A 5DRNB 5D5MB 2VDOH 1IM9B 3HC3L 4I2XA 1T7VA 2HJFA 3TBVA 2ZUWA 5JIIA 2OM5A 5IBTH 4A6YH 3LKPA 3DI2B 5E99H 1VKXB 1DP0A 4JN2A 2YC1A 1CIUA 4B7LA 3U7WH 1PX4A 2ITDB 3DTXA 3OKKA 2PW2A 1XF3A 5EO1B 4RSVA 5HY9A 2GCYB 3SDDA 2GW5A 2YD9A 3O6LH 4MD5A 3WJJC 4AL8H 4OGXH 1IC4H 1KCUL 2HJKA 4NQDB 1MVFA 3UBXG 1QO3B 4P2OA 1A1OA 4J4PC 4HWBA 4QWWD 4XNUL 3PV6A 4CN4A 4R4BB 2ZSVB 4JPKL 5LCVH 5DJ0A 2X40A 5ALCH 4HUWA 3PGCA 2O5YH 3HNVL 4H0HB 4E42A 3K3QA 1N5YL 5DJCA 4PFEA 4UB0L 3WNPA 4HXAH 2HRLA 4KI5E 1RZIB 4KJQC 3CUPA 3MLPA 4XPGH 2XZCL 1Q94B 1IZJA 3VFGH 3AS3A 3UCRA 3VA6A 3BKML 3H3KA 3VMPA 3F6LA 2J8UF 4YJZL 3L5WB 1Q9LA 1HQ4B 1P7QD 3ES6B 1N6VA 3P2TA 2R23B 4U6XB 1NDMB 3OGCA 4L8DB 1MI5A 1U8IB 4D0BB 4ODHH 3X17A 5HHPA 5FO9A 2XG5A 1VHPA 1QPXA 4KDTA 3HS0A 2VLRA 4OLYL 4QRUA 3F58L 4EI5D 3EYUH 1UM4L 3HE7C 5DA0B 3ROOA 1JTOA 4NP4H 4OJFL 3VWJA 1ZEAL 2A77L 4XAKD 1NGWA 3GGWA 1NL0H 4M62L 1ZS8A 2VN7A 4NZTL 1R5WA 4C4KT 1MLBB 3G5VA 4X6DB 1UH2A 4OV5A 5CZVH 4KU1A 4X6EB 1EVTC 3CFJB 4DEPB 2SEBB 3L3JA 4Q58C 3E2HB 3EZ8A 5IBUG 3TYFB 1F45A 3L95A 4D2NA 4XCFH 4X98B 5HDBE 5FECB 5GZND 2HRPH 4PTTA 4EI6B 4LPWA 3O3EB 3OKNA 5F1SA 5IBUB 4CKVX 5CJ8A 1G6VK 2ARWA 5HTSA 1X9QA 5CCKL 2J5LC 3S98A 5AAWA 1XGUA 3CZJA 3A6OA 2EH8H 4WFGE 5J8OA 5IB1A 2C9AA 3KPQA 1G7IA 2Y36L 2VLJB 3D85D 4ZSOB 4ZXBB 1ZVSA 5MERB 3HI6L 3VE0A 1RZ8B 3B2UD 1I1RA 4PJAA 5L88L 2RCSL 4GKZB 4WFFE 4YGVB 5J06A 5TPWL 4KTEH 3QXVA 1KIRB 4IOSD 2NTSP 4QRRA 5LJYH 5HI5D 1OTUC 4QHKJ 1OPGH 3MRDB 4GRWB 3RWHB 4O4YL 1MF2L 5C09A 3G08A 3IU3A 4EEEA 4NPYB 5DHYB 4M3KB 3IDMA 5ACZB 2R29H 2E7MA 2DM4A 1E4KA 1TFHA 1DFBL 4RISH 3SQBA 1KG0A 3DO3A 1NCDL 1ROWA 4YPJA 2ERJC 3IDIA 3ULUD 3QDHA 4WTXA 3B5HA 4WHYG 1Z0MA 4AQOA 1WZ1H 3EAKA 3KGRA 4P9ML 2WUCH 2XI9A 5T1DL 4MGXA 1QSFB 3L5IA 3B9EA 2J8UA 4G43A 4HD9A 3C5ZA 4LPUA 2JJSA 3SQOL 4HKBA 1DE4A 3RDTB 4YAQA 1I8MA 4GW5B 4K94H 4DGYH 1IQDA 3OSKA 4RGNB 5EU5B 2W07A 5DJAA 4U0RC 3U7WL 1IGTB 4G8GE 4JCMA 4Y19E 5EFIB 1OF2B 5KOMC 3AROA 1O7SA 4G7VL 5I0ZA 2APFA 1FJ1A 3SE9L 1J12A 2N1KA 4I9WE 3GSRB 4CJ1A 1DVFB 3CPLA 4KGLA 3TNNA 2ZG3A 3VXMD 3L9RA 2Y6SD 3V0AC 1HHGB 4KZEL 1H5BA 1B0GA 3JV6B 1A2YA 2Z31A 3FO2A 4F8QA 2A74B 1KIUA 5DGRA 3VFMA 2ERJB 1FL3B 4PJ9A 1G7JA 2QKIA 4YX2H 3MLSH 3QPQD 1YEEL 4KV5E 5FA4B 3SGDH 4CVXA 3GK8L 1QBML 4R8WL 4NFCA 3RHWF 3OXRA 1A9EA 1RJLB 3MOBH 1KPVA 1NGZA 5DJ8B 2EC8A 1T0NB 4J12A 5I1CL 5FYKE 3VI3E 3T2PA 1P4IH 1X5IA 4N8VA 2O5ZL 2WWMC 1PGRB 1T22A 4RMWA 3DIFB 3FO0H 1Q0XL 4XMLH 3O3AB 4OLWH 4XNXH 5D2NA 1JGUL 1U2CA 4RMSA 1MHCB 2VWEC 1AGBA 3CCHA 5E8OB 3EYQD 5HYSB 3HC4L 3NA9H 3U0WH 4OFDA 4D94A 4Y0GA 4TRPH 2JF1A 1U8NB 4DN3L 1FNEB 5DJYA 1GC1L 1V7MH 4LHUG 3KS0H 2CXGA 4LDEB 3TT3H 1D5ZB 3MLTB 2UV3A 1BFOA 5C0CB 2NY3D 3FQXB 4HZLA 2W9LA 1CICA 5IMKB 3GHEH 3BWAB 3E2HC 3UDWA 2AEQL 4G6KH 5IROA 4RX4D 3GBNH 4LAQH 3UXFA 4A2MA 5I17B 3WXVL 4R96A 5BOPA 3C6LA 2HTKD 1FL6B 4Q7DA 2NX5A 5AWNL 3RUGB 4M4PA 2R2EB 1L7IH 2DKMA 4UILH 5T1KA 43CAB 4NWUL 2R2CA 2D7PA 4PY7A 4QCIB 3ZYOA 4X5LA 2IH3B 4E9LA 4Z77B 2E9IA 1W0VB 4XX1E 1A6TB 4AIZA 3U48A 4U1LB 2JJUA 2X1QA 2XRAL 3O4LE 3TH2T 4LLWA 1XF4A 3UPRB 3S34L 3QJFB 5F7MC 1INDH 2IADB 1TZHB 2AV1B 4XCEA 5FM5M 3IFLH 3SCMB 3Q48A 1ZLWH 2VLKE 4ZO9A 1GVIA 1V3KA 2PCPA 2HH0L 5KG9B 4NN5C 5F6HI 4K3EH 3WO4B 2APXA 4J3WA 2P8MB 3V6FB 5HYJA 4M4RA 4G6ML 3HPLB 1P84J 2PCPB 3U4EB 3QUYD 4LLDB 5DJ6B 5ADOH 2EIDA 4P2QA 2VLKD 5C2BL 4O2CB 4F9PC 1FFOB 4YXHH 2X4OA 2VXUL 3RJQB 2MQCA 3VRJB 4JFEA 1FQ9C 3E8UL 3MROB 5C7XL 3OJDA 1Q1JL 4G9DB 4KTDL 1DDHA 4XXDA 5GS2H 4EKXA 2ENSA 5J11B 4ZDHB 3W81A 3BZ4B 4D0CB 3KXFB 5C0AD 2HH0H 1PEWA 3MJGX 4Z77A 3WFHA 1BVKA 2EYSA 1WTGT 4JRWA 1P7QA 4Y4HC 1O5DT 4AEEA 5B3JF 4YBQD 5TH2A 5HHMD 1FYHB 1HYRC 5INDA 1DLHB 1UT9A 4PB0H 4UU9A 1ZLWK 1AIFB 1RQ5A 4OQTA 1H3TA 4TSAL 2RCSH 5C0CD 3MV01 2G75B 1BOGB 1I8IB 4K71B 3EOAB 1TVHB 1XGQA 5ICZA 4OBRA 3I2CH 4NOBA 1D5ZA 3T0EC 4ONOA 5CHNA 1Y6NR 3QH3A 4KMTH 1J87A 5FYKH 5I1DA 4NRXB 1BF8A 4K07A 1PY4A 1J8HB 2ED9A 3MCKB 3MNZB 5CP7A 1VERA 1F3DJ 1WSST 1QA9B 3DWTA 2C3GA 2ICWI 2APWA 1LHZA 5CGMA 3VI3F 4PJGE 3V6OA 1EH9A 3TN0D 4W4OC 4PJFB 4XVTH 4C56A 5CD5D 4QRPD 2B5IC 4HIHA 4LKXA 3RVVD 5BRZD 1HHKA 3BUTA 4YDJA 1EV2E 4OLZL 1LO5B 1HYSD 3EUUA 2VWEE 1PVHA 3UTPE 2QEJA 1A6UL 1YY9D 2F5BL 1XGPB 1X5JA 1RJLA 32C2A 3I85A 1LEIB 4NQVB 4R2GB 4M93B 3BX7C 5TGBB 5F1OB 1OAKH 4P3CL 4JREB 2DLEA 1QVOB 4R26L 1PSKH 2R2HA 5D1XB 4LU5H 1JGDA 4X4ZA 5ALBL 3FO2B 5KZCD 3Q3GA 2EECA 5FYLH 1RUAL 1I9RL 1I3GL 1P4LB 3FRUB 5JOPE 4YR6A 3MCLL 1DVFA 3CPLB 2R4RL 3A67H 3OBAA 1EEYB 5AD0B 1ZWIA 4GXUM 3CFBB 2DLGA 3MRPB 1QFWH 3MPCA 3RAJL 3WIIH 1RAMA 1T7XA 4OGAC 1I8LA 5AZ2L 4NHUB 1MCBA 1T5WA 4HCRA 4POUB 2APBA 4QRSB 4U1GB 3DGCR 4G8GA 3I6LE 3HRZB 5KS9E 1WZKA 3GSXA 2XKSA 2OQJA 4LBEB 1EJ6A 4UOJA 5HYSG 1TQCC 3PWNA 1TNMA 2H6PB 4M6OL 4OZGA 3EO9H 5KSUA 4HK0A 2LFGA 3A6BH 2XTJE 3ZYIA 4LHUD 5GHWH 1XZ0B 3VW3L 5AUMA 1KG0B 3IDNA 1I3RB 4GAFB 4HS6A 4OCNC 3P9MA 4RIRB 3UTZB 3QNYA 4P99A 5DO2D 3QUXA 5ACZA 5BXFA 2IPTH 4PLKD 2VZUA 3LKNB 4PLJC 4Y1AA 2WUCL 3O45A 3SDYL 4KI5D 1WCQA 4OCLC 5IJKC 1EFQA 1FVEA 2P4AB 3CK0L 3IGAB 3LEXA 2LVEA 2NYYD 4GKZA 4XVUC 4BELD 3AC0A 4PBWD 3X13A 3WHE0 2YZ8A 5BJTA 2MMXA 4P2CG 2FD6H 1I1AA 3QNXB 4GAYA 5FGBC 4X6CB 4OAWB 2EEBA 3ZTJG 2R1YB 4L4VB 3QDJD 3WL9B 1AC6A 1D6EA 5LVEA 3ILPA 2Z35B 1CCZA 3MRLA 3U7AA 1IQWH 2R9HD 4X83A 5EU4B 3P30L 3L7EA 3HAEH 3LKSB 3OKNB 3HFML 3WNOA 5IEHB 2A73A 1NFDE 1GJIA 1FLTX 3G5XB 5FHBH 2Y5TA 2HT3C 1BAFH 4ZS6D 4RDQG 5SWQB 3TVMA 4XC1L 5H2BA 2RJMA 3BWUC 4XNQB 4XWOC 3CVHL 2J4WH 5GRZA 2JJTA 3IETB 3S4SA 3GSNL 5IVNA 1DQDL 1S9WA 3MA7A 4MQXD 2GK0A 1IAII 3MSPA 5JIKA 3G5XA 4JKPH 5ERWA 5JORA 3O6FC 3V2AR 1MRFH 4JRYE 1JF5A 2WANA 1QFHA 4ONGL 2XIDA 2E6QA 1GGCH 2NNAA 2P43B 1WAAA 3QWOA 2ZUUA 4OB5H 4TNVF 3RPIA 1FL5A 1FPTL 4PG9A 3HR5B 2GQHA 4N1HB 3MBED 3ZTNH 4PP1D 2HTKC 5I75B 3MO1A 2AKRA 1EERB 1I1AB 2IFFL 3K2UH 2WINB 1MY5A 1HKFA 3V5DB 2WSKA 2QQQA 3TO4A 5GS0L 3LHPH 2YPLE 3FFCE 1BFTA 4Y5XA 2LV4A 4GXVL 3T4AB 5FGSA 4LGPB 5EBWA 1Q9LB 1ZHBB 3QCUH 2ZP0T 4PS4H 4E41A 4KZEH 2AJUH 4NDMB 1ZT7A 2EDJA 3MGTB 2YPLD 5TDNB 3MODL 4GOSA 3TIEB 4M7KH 4HWEL 5DI8B 4ZD3H 3V52L 1OWWA 3Q1SH 1AKJB 1FNGA 3EJYC 3GRWA 4OI8A 5DQ9A 3FCTA 3BT2L 3MNVA 1CGYA 1QQDB 3LH2H 4MNGA 4MS8C 4AEFA 2J8HA 4Y4KB 1W0WB 1IC7L 1LK2A 4OZGB 4WIQA 2LQRA 2J88H 5T1LB 3ETBF 4JPVH 4HC1H 4ONGH 3KYNB 2NZ9C 1G0YR 4XNYL 1ZHKA 4G8GB 4PUBH 2EE3A 4JFPB 4XH2A 2UWEA 2DQIH 1F4HA 1XH3B 2EEDA 4PJDA 3T77B 4QXUH 3HR6A 2MCG1 5AYUL 3DYPA 4OZHE 1UGNA 3FT2A 5IF0A 1R0AH 1K5NB 3TWCH 3OAZH 4KH2A 4PJEB 5I1CH 4CBPA 1RIHL 3DRQB 3V0WH 4HK0B 5FKPB 3RGVB 2XKUA 1EO8L 2CIKA 1DFBH 5K9JH 2DQFB 5EUOF 1Q0XH 4QRPB 1TQBB 5DWUH 1DUYA 3NIDE 1F6FB 3KLAA 4G8IA 4S1SL 3VXME 4WWID 4HUXA 3MRPA 3P4OB 1AD0A 4Y4FC 5L88H 4J23A 1F4XL 2QTEA 3NTCL 3TA3C 3ARGB 3ZE1E 4IRSA 1W72L 3ARZA 1JUFB 3HZVA 4XPTH 3GO1L 4KZDH 1PG7H 2VYRE 2FEEI 5CCKH 4ZYKB 3VFVA 1T5XA 1EJOL 1U36A 1DEEB 5I8KH 1NBVL 1BEYL 4F7CB 3AFLA 4ENEC 1WFOA 5GS3A 5GRVL 5BZWB 3MV7B 1ZGLP 4NQUA 4TVSa 1WZMA 3F7VA 1GYAA 3LHPL 3MRGB 4NJ9L 4X4XA 4NQVA 4YWGH 1LEKB 1J8HA 3MCKA 3GBML 3AREA 3MNZA 4DOHB 4FQCL 1C1EH 5ISZB 5CEZL 2X4NB 3GSNB 4Q74A 2VLJD 4FTVE 5ISZD 1R3IL 2BNQA 2VL5A 2VDKH 1WIUA 1JNNH 4LGRB 1BIHA 43C9B 4HIHB 3F7PC 4JFXB 2IQ9L 5DK0B 1CGTA 3RIFK 1FYTE 1Y18A 3FO0L 1FFRA 3QIUA 3BQUA 3MLXH 1S7SB 2Z31C 1NKOA 1MCDA 2W9EL 4IMKC 4YIQB 1GOFA 2BRRL 2EYRB 4WW2C 3LPGA 4ZUTB 3KG5A 5TQ2L 3NOIA 5JHDE 4M00A 5GGUB 4XCYB 4ZDHA 2Y36H 1EUTA 2OTWA 4EOWH 1SEQL 4RAUB 2NY1D 3W5MA 4Y5YB 2EH8L 3WBDA 5IHZA 2MCPH 4WFEE 3OJDB 5EC1B 3F5WB 4KAQL 5ID0A 2ID5A 4NQXB 4EI5A 3N85L 2XA8H 4BK4A 3EJYD 4G6JL 3KR3L 4QYOB 3RTQA 2LE9A 1CGUA 1A6UH 1DLFH 1YYML 5GJSH 3L1OL 3QFJD 1RIUH 1RD6A 3KXFA 3V6FA 1F6AB 2I5YL 5GS1A 4Q9QH 3DRTA 4LL9A 2YMXH 4N5EC 1MEXL 2DWEB 2OTUB 3NAAL 1XIWB 3MRBB 5EO9A 1BZQK 2AJSL 2FGWH 2I07B 2X4RB 2NY7L 4R7DA 2GJ6B 3P0YH 1VA9A 1OGAA 4DGYL 4MB5A 2RFXB 4NCC2 4J3SA 1IT9L 2OR9H 4LLWB 1A7RL 1MWAL 5CP3H 3ZKMD 1P7HL 3C6LD 1KPRA 3ARRA 1K4DA 5BOZG 25C8L 4P3WA 3H7LA 1KPRB 1VACA 1B6DA 3V5KA 4BQCA 4B53A 1BQHB 4RFOL 5EZIL 2CRZA 4ODBD 3O4LB 5B38A 3VFOB 1A14L 4PRAB 2WWKO 1HSAA 3WS3A 1JNLL 4OQ1A 4R6UA 1TZIB 1CLYH 4PJCA 2KBGA 2R2BB 2B1HL 1WAAF 1W2KT 1W8OA 2BNRB 5FDWA 1BD2A 4CN6A 4W81A 3ARGC 4HZLB 4RA3A 4F7TB 1TPXB 2GYSA 3BHBB 3VI4F 1ZGLA 1KJVA 5E8DL 5K33A 1NMCC 2JELL 4OM1L 1HCFX 5TDPB 2VJXA 3RWIA 4PGDA 1X44A 4ZS7L 2NX5B 5E2WL 1QR4A 3T2OA 3R1GH 4UQ2B 3QULA 2ZCLH 5AAMA 1QFOA 3MYJB 2DQJH 4OZHA 1YN6B 2FWOA 3CDGB 1KENH 4Y5YA 4WWKA 2QV2A 2WIIB 4I3GA 2VLKA 5T5FL 2UZIH 3QG7L 4OM0H 4N8VB 2BC4B 4FG6D 3LMJH 1G7HA 4NZRL 4BH7A 5BS0D 3IKCB 5MEOB 3H2WA 1A64A 5BW7A 1CXEA 5HHOB 4HWZA 3S7GA 1VGKB 1RY7B 5CEXB 1FZOB 5J1TC 1SMOA 1KGCD 4YHYB 3VG9C 3PNWA 3MYZA 3NVQA 3V79C 1G9ML 4GBXD 4GUPB 4LEOB 5C2BH 3I9GL 3UTSB 5DK0A 5BZWA 4HAFA 3RWCA 4TN9A 3TP4A 5DVNA 4ZUUB 1XIWD 2NLJB 2VKWA 5DA4A 4D3CH 3AUVA 4GQ9L 4OCSH 3DX9B 4GRMB 3CU7A 3ZT6A 1H5BB 3T0WA 3CH1B 4L3EE 2X4NA 3GSNA 1R3JA 2B4CC 3VXRB 5ADPH 1C16A 2P5EA 1ZLSL 4DK6A 2ATKB 1MSPA 2E27H 4F33B 5EU6D 1XCQA 3MUZ1 3MRGA 4P46C 1ONQB 3R4DA 4K8RL 5B3NA 3QRFM 1OL0A 4M6MH 5A43C 4CGTA 5E6IA 4F7CA 1ADQL 2P5WA 4G9FB 3BAEH 5IQ7L 3U4BL 1P7KA 1T4KB 2J8UB 3MJ9A 3VXUD 4OLXH 5EUOB 1TITA 5F7WC 3WFBL 3Q5TA 1JUFA 3IS0X 1MFDH 4H1LB 1ETZA 3W9EB 1Q9WA 3FO9B 3F6IA 3G6DH 4QGTA 5EU3B 4LCWE 3U2SA 4LHQB 3PP4L 1RULL 2DQDH 1OF2A 5I6XC 3LV3B 4LHUA 3H42H 3MRJB 5FCUL 1YN7A 5HHQB 5DJAB 4RFNB 3RDTD 3VFRA 1HINH 5IBLC 2XTJD 3V6BR 3WKMH 3HE6D 3IU3B 1YEHL 4BZ1L 3O11A 2X4PB 3NIGE 5DFTA 3W0WA 2DQFA 4LVOB 2Y1VA 1AHWB 4PJCF 4YGVA 3PF2A 1L6ZA 4Y4KA 1HE7A 4XPAH 1FGNL 2D0FA 4WU5A 1UKTA 2ZUTA 2FX8L 4BH8B 1ZVSB 5MERA 4OLXL 1I1YB 3IDIB 4ZSOA 1J0KA 1KCVL 2XPGB 3U46B 3LQAH 5TF1H 3RY5A 3MXVL 4LSPH 5TQ0H 4LPTA 5I1IH 2NW3B 2GTZB 4ISVA 4M02A 5JQHC 3NACH 4JFPA 2PO6B 3HUJF 3CX5K 1UB5B 2VLLB 3G08B 2FATH 4G6AD 1J5OH 4L3EB 3MUJA 2BCKA 3O3EA 1G7PB 4M6NH 3KYMB 2A0LC 3SPVB 2NY5H 1F2XK 4ZFGL 3MO1B 1E4KC 5DI8A 2VIRA 4XNZB 2FX8H 3KPQB 4HEME 2XACC 4Z6AT 2IC2A 1E27A 4JM2A 2FZ3B 4IOIA 1GXEA 4BQ9A 3K4ZA 3K74B 4GH7B 3ESVF 1ZS8B 4X4MA 4GRLD 2COQA 4M03A 3MOAH 4EBQH 4Y5XB 2ZKHL 2EIBA 4N1CA 5IVXF 3GBNL 4LAQL 5C07B 1DBAL 3O6FA 5FECA 4L3CA 1H8NA 5ACLA 2W65B 4KK6D 1QYGL 3LQAL 4LLQB 1JIBA 2CMRL 2Y5EA 4LLQA 5I0DA 4X7SL 3NCEB 1AFVH 2Q76B 1UA6L 3BKCH 3TWCL 3U83A 1BJ1J 1B0RB 3O6FB 4JDVA 4U7KA 5DVLA 1XIWC 1M1SA 2C3VA 1VFBB 1LNUB 5INCA 3LKSA 3IXTB 1QSED 5DUML 3L5WA 4JDVB 1C5BL 1S7TB 3BD4A 3DXAB 4MAUL 5IVZA 4JQIL 3FFCB 4H26B 3WJJA 3MRLB 1VSCA 4KKCD 2XT1B 3PWVB 1UC6A 5I19H 4JRYD 4R4ND 5A3ID 3HPJB 2XTJB 1F90L 5FHAH 5J13B 4PGBB 5HHPB 4PGEA 1LK3L 3EDJA 4K3GA 1G7PA 3HFMH 5DJ0B 2R0LH 4M8VA 4R4BA 2V9RA 4HFWA 3L7EB 3G6JE 1A1OB 5BQ7B 5EB9A 3UTQB 1RJYA 2X10A 1TETH 2HFEB 2YOCA 5B39A 2V5TA 1DN0B 3IJHB 3KPNA 4MA8H 4XC3H 1KCLA 4MD5B 3ZL4H 2FO4B 3CUPB 2ARJA 3MBXH 4N9OB 4X6CA 4Y7MA 5T33H 1REIA 1MOEA 3FQTA 4OCWH 5DUPH 4E42B 4UT6L 4WU5B 2FHBA 4KRLB 1NBQA 5I1EH 4JZJA 3SE9H 3WE6A 1S5IL 2YC1B 2A6JA 4DFHA 2WK2A 2VXVL 1D9KD 1EAJA 1NL0L 2AJ3A 3PGDB 3S36H 1FORH 3K8KA 5H35A 4LCCC 4TTDD 3ULUL 2NXYC 1I7TB 3RWDB 2H26A 5BRZB 2YUZA 3QP3A 3V6OE 1P53A 3ULVF 2AW2A 3JWOH 4YFDB 3UTZA 2NXZB 3LS5L 5JTWA 3P4NB 3SDDC 2FHCA 1QFWI 4W4OA 4LIQH 3QEQB 3N9GL 2EICA 2PUQT 1NAMB 4LSRL 1EMTL 5A2JH 2KQMA 2OQJB 5A2KH 4JKLA 4HJJH 3VG0L 1RFDH 3P73B 3SE3C 3JWDH 1HHIB 3OX8B 5BVJB 1N3NB 5HHQA 2MFNA 2XZQH 3QDGB 2WBWB 4HLJA 3DO7A 4LAJH 4RZCB 1AGEA 4OLYH 3BPNB 4N9GB 1QVOA 5F8RC 2AXFA 4NBXB 5FM5O 1J1PL 3U2SB 3LY6A 2GUOA 1NBZB 4QT5A 3TO2A 4BUGA 1GAFH 2AI0L 5IJKA 2R1WA 4XP9H 1NCWH 1YDPB 5J6HB 1C16B 3HG1E 4JPKH 1JPSL 3P9LA 4Q9CA 1GZQB 2P5WE 1P7KB 1T4KA 4XNUH 4P4KA 4TOYL 2YPLB 5C0EA 3BEVA 3WHE1 5DC4B 5JW4M 1S9KC 4NRZA 2XN9B 2E7LC 5L6YL 4JO3L 4U2YA 3VGAB 3BZDA 1U91A 2YD6A 3NFNA 1NUFA 4UB0H 1VEPA 2ZSWB 2VUYA 1UXWA 3SDAD 1I7RA 4HMDA 4O9HH 1XCQB 4F33A 2NY7H 1FZOA 5FIEA 4FHBD 4X4YB 1Q72L 5TF0A 1XGPA 3CH1A 3LPWA 1BQHG 4C59B 4KKAD 2ZOKA 1LO5A 2ZUQB 4OZGE 4G7YL 4JANA 3RZCC 4KVNL 5A2LH 4OKVB 2NLJA 1FAIH 2G75A 4K7PH 2C4XA 1MAKA 1JFQH 3MLRH 1YN6A 3RY6A 4KKCC 1JHTB 2P5ED 4OJFH 5F96H 3FQWB 1LMKA 1QNZL 4NRYB 3EYSH 4QXTA 5GGTL 2IBBA 3O2VH 4OCYL 1Z6JT 2WBJD 3QUMH 5B4MC 4KV5F 5KJRL 2EYSB 3WUZA 1S7XA 3X3FL 2EC9U 4U1NB 2BC4A 3QFJA 1LO0L 2Z9TA 4D8PB 4CW1B 2ICEB 3H9HB 3SJVA 2FWOB 4PJCB 4MJ2A 1TZIA 5M94B 4RMUA 1T2QL 5DLML 2B4CH 4PGDB 4I3SH 5INDB 1OSPH 1IKFH 2ED8A 5IHBA 1DBBL 5FUZH 3UYRH 3V0WL 3V5HA 1FDLH 3MR9A 3I02A 4H0GA 4K9EL 2ORBH 3FAXA 2EDWA 4DFIA 5KG9A 3O81A 1CZ8H 5DHVB 4QXUL 4JQIH 1JPST 2AABH 2BSTB 4M48H 5ELIA 4JFEB 1A6ZA 2B2XL 1OGAB 2ARJQ 4NWTH 3LVEA 4F9PA 1CU4H 5H37G 3JWOL 4FP8L 3QJFA 5ADOL 1KXQE 4QY8B 1YECH 5IWLA 1RULH 3HPLA 2FBOJ 4U1LA 5EBLA 5I1AB 4FNLH 1S5HA 1OTSD 1U8QA 3QRGL 4RQQA 3I2CL 5E9DD 2BNUB 2A0LD 2YR3A 1E28B 1UM5L 4WUUE 3SCMA 3LN4B 2NCMA 4WGWB 3R8BB 3B3IA 4ZTPL 1EBPA 2AQ3A 4EI5B 1XGYH 3B8SA 4M7ZC 4BM7A 5IHUH 3KPRD 3P77A 4WEUD 4KXZH 1FAIL 4K7PL 3IFNL 2OI9B 5I1IL 3ULVL 3BP4A 3UC0L 4Q9RL 4YIQA 1MAMH 3KPRE 2R2EA 1S7SA 1DANU 3PHQB 3GJFH 3ZDXE 1G6RL 4J8RB 4KTDH 1FVDA 4Z7NE 1L0QA 2AEQH 1WEJL 1TLKA 2KZ1B 5I66A 3O3AA 1IAMA 1IGFL 4HK3N 1CT8A 3MRHB 2BSRA 4Y89A 1F3JB 3AGVA 4OCXL 1XCTB 5HYFA 4XCYA 1Z5LA 2GTWB 3WFDL 3GSWB 1PLGH 2ZOKB 1WFNA 4PJBB 4ZUTA 3FB6B 1X5LA 2H2SC 1KT2A 2FL5A 2HWZL 5I9QB 3IAPA 3UYRL 3OJMB 1KOAA 3EDFA 5B39G 4LKCA 1YJDC 1MFDL 4JFDB 1TTFA 1VEOA 3F7VB 4N0UB 4WJ5B 5JA8B 4KJWD 2MTPA 2HP4A 5IK3A 43C9A 2BOCA 1QLFB 3WNMA 1GHFH 2YPLA 4XZUA 1KB9J 3HG1B 2MQ0A 3JV4A 3BQUD 4BZ2L 3BUYB 2F8XC 4K8RH 4D9RD 2V7NB 5DYOB 3U1SH 3TO2B 1IAIL 4UOW1 4X9HA 2R8SH 5T1LD 1ZHLA 2LU4A 1NMBL 4HF5L 4PJ9B 2W0FA 3NIFF 1FLRL 5E4EC 3DO7B 5HYEA 1E4XH 4MJIB 1CE6B 3EYVB 4P23B 2A74A 3RDTA 2PW1B 1MCEA 4WV1A 1U3HA 2W92A 3NACL 4QRPA 4ALAH 2AGJL 1QSFA 4ONFL 1NUDA 2BFVL 3MJ8B 1LEGA 2ZG1A 1ZLVK 1K4CA 3RGVA 3S36X 3RBGA 4IRSB 5DMIH 1XF5B 4QNPE 2VUOA 3BPOC 4G3YH 4HEPG 3HNTL 1YQVL 2OMBA 4HUXB 3B5GA 4J4PA 1VGEL 1IGTA 3T77A 4OLEA 3QUYA 4WY7L 2UVEA 5C6TH 4XH2B 3RJDA 4R7NA 1DE4B 3MRCB 4MA8L 4YAQB 5DJ2A 2H26B 1I8MB 5C0BA 1K2DA 2DL2A 1NGQH 3LRSA 5M95B 2NXZD 3MRKA 4OZFH 2YS4A 1EFXD 3TPKA 3QA3A 4JZJB 4YDLC 5D1ZC 1EHAA 1I9IL 3FCTB 4JZOB 1OM3L 4IMLB 3DX7B 1G7IB 1RURL 2V5SA 3MV9A 4PGZA 4K3DL 4P23C 4LF3A 2F74B 4IRZL 4ZTOL 3EDDA 5F21B 4IDLA 1IC5L 3REVA 4YNYA 4IJ3C 4NKOA 5IEKA 3S3PA 4X8JA 5C9JA 5DGQA 3QDJE 3FT3B 1RZ7L 3TO4B 2IALB 4IIQB 4NYLB 1QQDA 2Q7YA 4MDIB 3RWFA 4NQEE 1QR1B 1FRGL 1IAOA 5DTFA 3SDAC 4HULB 4E41E 5L7XH 3GKWL 5EBMA 3RL2A 2IMMA 3A6BL 1XR8A 5E2VL 1HQRB 3CVHB 1XGUB 2HKFL 2R0KL 1MFBH 1MCNA 2IGFL 1ORSA 2VDNL 5KVFL 3EYFA 5HDQH 3IXTA 5CEZE 5DRZA 2J2ZA 4KI1A 4F3FB 1JWMA 4UUJB 4X99B 3UJTL 1NEUA 1HHHA 3TYGL 2DYPA 3AAZB 1LDSA 3H9SE 5T5NG 1K3IA 4GAGL 1TCRB 3JXAA 1P6AB 5MEND 5KVDH 3BI9X 3FRPA 4S10A 4F9LA 1YYLL 4ZPTA 5HJ3B 3T0DA 1PW3A 3HS0B 3W39B 2Z0BA 1R5VB 5HPOA 3BGFC 1BD2D 3HR5A 4RDQF 3C2AH 4NZDA 1DUZB 35C8L 3VDBA 2NY6C 5T33L 4XBEH 3D25B 4U1SB 3ZTJH 5ITBH 3TA3A 2Y5TB 1Q9OB 2AGJH 4ONFH 4KROB 4YK4C 4U1GC 1DQJA 1EHXA 3VXPA 3TO4C 3S5LA 3C5JB 5IVXA 3VRLF 3OKLB 5HDQL 2UZYB 1T80A 5D7KD 1R5IB 1QBLL 2H32H 4Z7OE 1RZIA 3VFGL 4PJXF 4Q9QL 2R39A 3J7HA 4PV9B 2P45B 2CKBB 3L3HB 4XNQA 3N1MC 4I4WA 2QBWA 4HIJA 3EDEA 2X4TB 5IB5B 4N8PA 2EDTA 3ZT5A 3FQNB 3QUZD 5GGVH 2ZZUT 3HZMB 2BVOA 2J7LA 4LU5L 4X7DC 5HGBB 3QNYB 3F8UB 5E70A 5FYJH 1FC1A 3MRRB 4M1GL 4NKQB 1FN4A 5AG9A 3U9UA 5SWSD 3O9WB 3U79A 2HLFC 4F9LC 3EYOA 3DTXB 2VDML 3I6GB 3QIBD 5AZEH 1F11A 4P2QE 3GHBL 5FGCE 1UG9A 1X6NA 2ZJSH 5KSUB 1FVEB 3MLXL 3TZVA 5KS9B 3QHZH 4PJGB 3BZEA 4WO4C 1TJGH 4YEFA 3NZ8B 3BH9B 3VFNA 1T3FA 4GG6A 4XAWL 3D6GA 4HXBL 1LQSR 3SDDB 4ONHB 4LHUB 4UZGA 3RWJB 2ADFH 4JPIB 2AJZB 3O6ML 1G7QA 7FABH 5AEAA 1EEYA 2OJEA 5AD0A 4P23D 4YXLH 1VKXA 3QUMA 4XPHL 2V5MA 4APQA 4HPYL 5I1JH 1CXKA 1SEBB 1YPZB 1YYMH 5GJSL 3MZGB 1W72H 3QXWA 2KQNA 5D1XA 4MNQA 2FGZA 3OJ2C 4RNRA 3RX5A 3HI5H 1JNHA 5JO5B 3ZE0F 3QPQC 4P5TD 5ANME 5FUOL 4Z7QE 4HGKC 5CGYC 1QTYT 32C2B 2DLFL 1FO0B 1CFQA 1HXYB 2D7TL 5JOFB 4GRMA 3C8KA 3DX9A 4Q2ZA 2V7HB 2BJML 2EDRA 3VGEA 1KELH 4LRIC 4LSQL 5EN2B 2CDFB 3UTSA 1R0AL 1HEZB 1J9CT 4FTVD 1HN1A 3KPSA 1PFCA 4NNPL 3RA7H 4ZAKC 3LPFA 3QAZC 4NFBA 2JCCF 5GGQL 2IPUG 4YUEH 1G1YA 5CEXA 5JDSA 4Y8DC 2F53A 4QHUB 3IU4L 5HHOA 3TN0C 3T3ME 3B6SA 4UT7H 1MHHB 2JB6B 2K1MA 1ORQB 4FQIL 1FGVL 1MRDL 1KYOK 3SO3C 4DTGL 6FABL 1ED3A 3AU1A 2VLKB 4OCXH 4G8FB 5F1IA 3IJSB 5E4IA 2NY5L 3O2DA 4PG2A 1J1OL 5DQJB 2HKHL 1KLGB 4I1NB 3NFPB 4KUZL 4OF0A 5DFVC 2J88L 3NCYS 2OS7A 3JVGC 2XNAA 1KTDA 2K7QA 1ZV5A 5EUKB 5MHSE 3T3MF 3BRGC 3V6ZA 4WI2A 2L0DA 4NM4L 4D0CA 1T1YA 4Y5VB 3CZFA 4EQ2A 4KY1L 1JV5A 5DSCB 1CL7I 2UY6A 2XICA 4U1HA 4NCDA 1EPFA 4G9DA 2YRPA 1FNLA 3QRGH 1JZ6A 5IHUL 3ULUF 3ZTNL 1HSAB 4J3XA 3WS3B 1LE5A 4PRAA 1K8DB 5F7DB 1PYWA 4GS7B 2IBGA 1X3DA 2X4OB 2PNDA 3EFFB 1F58H 1BQLH 5T1MA 2EIZB 3ILQD 2C7UB 1MELA 4UDTB 4P2QB 2YD4A 4JKWA 1WGOA 4KPHH 2AVGA 1U8KB 1IBGH 3LEVL 3SGKC 2DD8H 5HYJB 1R3HB 4YHLL 3S35H 1DL7L 4DN4L 5GGRA 3UZEA 5JNYB 2VLRE 3SGEH 3FHAA 5DMYA 4LARH 1C12B 4L3AA 2DLTA 1NLBH 1AJ7H 4FQJH 5DEGB 3DUUB 3SDXA 1AXSB 4XCEB 5D71L 2NQCA 1AD9B 1CXIA 1JK8A 2NW2B 3WEXA 4C57C 3QHTC 1YQ2A 3BP5A 2IWGA 4KRMB 5FHBL 4ODUB 1KIQA 4Y1AE 4OLWL 4PJ8C 1H8SA 3NMEA 4HJGA 4NJAL 3L6FB 1J7VR 1MJUL 4V2BA 3QXAB 1HH6A 2P8MA 3KNBA 1A6AB 1ODAA 1WJ3A 2J4WL 2P7TA 4UNVA 1FFPA 3RVTD 1GGTA 1TZGH 5KVEL 4CU7A 3U0TA 4Y4HD 1DBML 1E6JH 5F7EH 4MDJB 3ARBC 1GGBL 4Y19A 2ICWB 3BE1H 5C0AB 3T1FA 4JG1H 5ICYB 3LSOB 7FABL 4WWKD 2VE6A 4OFYD 1XF4B 4OIIL 3UPRA 4ZUVB 3C09B 1OGAE 4LCCB 2O5XH 3BSZH 1A6TA 3O8XC 2JB5L 1C5CH 3WXWL 4OZFB 5JPNB 5SWZB 3MRFB 4QEGA 5H8DA 5EG6C 1I7ZB 2CR3A 5E00A 43CAA 4OKDA 3ELAT 2D3VA 4XBGA 2WW8A 2DYPD 3ARFA 3DXAE 3SDYH 3CCHB 5E8OA 5MENA 4G6FD 1AGDB 4N8VG 3TBSB 3BEWA 3VRIA 5H94B 3UBXB 4XWOD 5C0RL 2JCCA 3OKMB 3SY0B 1KB5H 2R69H 1FRGH 1BLNB 3IKKA 4XP1H 1HWGB 1CICB 1AR1D 5IMKA 4CDGC 4MXWH 2JLLA 5E5MB 5HI4D 2WIMA 3LS4L 2MWCA 2GITB 3MC0A 4JQXC 1CTNA 5C07E 4BSWA 5I76A 2BHUA 1BJMA 1CF8L 3TBYB 3JVGA 3IDXL 4KQ4H 2WBKA 3ROLB 4M8QB 4MXVE 2G60H 5FCSH 3EBAA 3MBEC 3EO1B 4UIMB 4FFZH 4KKLD 5DFVD 2VXSL 5HVWA 2EDDA 4BZYA 4JEGB 2PXYB 5SX4H 5MEQB 4ODSH 5FOBA 3WIIL 4N0YH 5HGAB 1OSZB 5TE7L 2FBJH 3N1QC 1NC4D 1T0NA 3MV7E 3QEUA 3JV6A 3SKMB 2VZ3A 1MHEA 1HHGA 1EEUA 3MJ9L 1NGQL 5TPWH 5TQ2H 2YBRA 4OSUH 1HIML 3ALXA 3ARGA 4UBDC 1JPTH 5KN5B 5D7JB 2QHRL 5J0BA 2QKIB 2DLHA 1EMTH 3QIBC 3WJLC 2EDEA 4G8IB 1CF8H 3CLFH 4PRHA 4LDOB 1A6PA 4UI2A 1I9EA 1WV7T 3BGAA 4OGAD 3TM6A 2C26A 3RRQA 2BY2A 3MFFB 5MEPB 1ZE3C 3RUGF 1A2YB 2IPUK 1B0GB 1D3CA 3PWLB 3S4SG 1SY6L 4FTVA 1PJ9A 4FZEL 1JRHH 4Z76B 3KPMB 1M71B 2ITCA 3MLRL 3VXRE 4JRXD 5H37H 3ECBA 4DUVA 4MXQD 4PJIB 4LSUL 5JUEH 4X0KB 4K55A 2DQUL 4RWYH 5BS0B 4BYHA 2ADIA 3C6SA 1FBIH 5EFIA 3H7BA 4YWGL 4PGJA 5CZVL 4NC0B 2BFVH 3KPSD 2C5DC 1UADC 4HWEH 5F7FA 1PZ5B 1S7RB 4EQ3A 3FQRA 2A1WL 5CJBA 5DD1H 5DHYA 4AG4L 3MCG1 3SN6N 4NPYA 1S78C 2J6EH 4JM4L 2YBRB 4PLKC 5C09B 4DJMA 3JTSA 3QJHA 3D3VE 5CEYB 2FCBA 5T1LA 3AM8C 5I1HH 5IESH 5IJVB 5FYKL 3H6JA 3F58H 4FQHB 1IC1A 1KTLA 2OL3B 5GZOD 3LIZH 2O26U 5GISH 1RUQH 3MLZL 3FONB 4TPRL 4BFGA 1ZT1A 4UIMA 5FYLL 4QHKI 1UJTA 5FO8B 3DV4B 3ME0A 1NCAH 4JFDD 2R9HC 3ARBB 4JDZB 4JJ5B 5EZOL 5B38G 4FP8H 4PTTB 2Z4QA 4EI6A 1P9MC 5DMGD 3BIBX 1RUML 1XGRB 1GGYA 4UIKH 1J8HD 3VWJD 1U3HD 3WHXB 1K85A 1RZ8A 4KKNA 3NIGF 3TYFA 3R06B 1EGJH 3SE8L 3DLQR 5K9OB 1KLUB 2KZWA 3ISWA 1WBXB 5IVOA 4LOUD 3H9SD 4TTGA 4BQBA 2F9BT 2GJ6E 2PF6A 1LO2L 4WRLA 5DC9B 1BIIB 1D9KA 5CEZH 3PV7A 1JGUH 1NCNA 3Q5YA 4MAUH 2UZXB 5IV2A 4FQ1H 4RWHA 5FUCE 4WW2B 3TCLA 1PY9A 1CK0L 2DQEL 1L0YA 4NOFA 4UIKL 4F7PB 1I7ZA 3HB3D 2F8OA 3EJZD 2ED7A 4XNYH 3MQIA 3DV6A 2A6DB 2ESVA 5TE6L 2XFXB 3AMLA 3MREB 4L8BA 5KSVA 3D9AL 1MJ7L 1FE8H 1MI5D 4O58H 3MLWH 2QADD 4EN3D 4OV5B 3T3PE 4H25A 4Q9RH 3U82B 1M6OA 2ICCA 3BDYL 2HFTA 4PP2B 3OKOA 4LHJB 3RP1A 4PLNC 1ND0A 3ZO0A 3IFNH 4DAGL 5F1NA 4LCYA 4MAYA 2AJVH 2LU3A 2VB5A 4JM2D 3ARDC 1KCSH 3IJYB 5DUBA 3FB8A 3AS0A 5FB8B 1QNZH 2I24N 4PRID 2P7TB 5EA0L 4S1SH 4HUKB 4NQCD 4BSJA 4Z7VA 5I15H 3HC0A 3GI9H 3MGAA 5I8EA 2E27L 3X13B 5I1JL 5A40E 1NGXB 2BMKA 1J10A 2BERA 1I85A 1RZJL 2DM2A 4NHCL 4OLVL 1K8IB 3OGCB 4FQ1L 2DWDA 3CXDL 3O45B 1OTTD 3D9AH 4O58L 5I18L 3DYMA 1F4AA 4IOFC 4LK4A 4XTRD 4FXKA 5I19L 5HGDA 2PR4L 4QHLB 3N1GC 3QZWG 4X5XA 3QUYC 4P5TA 5AUMB 2Y7QA 5JXAL 1C5BH 3VGBA 4UDTA 3RAJH 1KCVH 4P9MH 2VISB 3CLFL 4EUPB 1U8OA 3W0WD 3QHZL 3F7QA 5L2JA 3T04D 4JN2B 3HI1A 1MNUH 2I9TA 4LBEA 2XQBL 3HCVB 2J8OA 3LEYL 2YK1L 5KS9F 1BAFL 3VD7A 4TNWF 5EC2A 4O02H