2RACA

Amicyanin reduced, ph 7.7, 1.3 angstroms
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PROTEIN (AMICYANIN)
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2racA00
2P80D 1RCYA 4GP5B 2EIJB 2PPEA 2TSAA 1SHXA 4N4YB 3IBOA 4YSUA 3T71A 3AY2A 2EINB 4E9XA 1A4CA 3ZBMA 3FPYA 2EIMB 1IKOP 6PCYA 2HX9A 4DPAX 1OV8A 3DKHA 1BQRA 1JZEA 1T5KA 2H47C 4DP6X 1OE3A 3UAEA 3CZUB 1AOZA 2UX6A 4ENZA 1AS8A 2J55A 4M3HA 1W8EA 2XYBA 2QT6A 3QJRB 2YXWA 3ZIYA 2PCFA 3FT0A 3FQYA 3FSVA 2GC7C 3AG2B 3T6VA 2JFCA 4DPCX 1WA0X 3T6WA 5PAZA 3UACA 5B7FA 2BP0B 1NDTA 2GI0A 3PPSA 2HRGA 1TU2A 3N55A 1V54B 1JXDA 1HFUA 2WO2B 1UATA 3OMNB 1M56B 1A8ZA 2ZONA 4E9WA 2QDWA 1AZCA 2HZHA 2GSMB 1KCBA 2Q9OA 1KBVA 2H5UA 4DPBX 4E9VA 4HALA 3X1BA 4AI7A 3L45A 1NIEA 5I6NA 2NRDA 5AZUA 9PCYA 1RKRA 1ZIAA 3WKQA 6PAZA 5B1KA 1FWXA 1ILUA 5B1AB 2WSDA 4AX3A 1XB8A 1WAEA 2J5WA 4GY4A 1PAZA 3NSFA 3FYIB 2OCCB 4HHWA 4YSDA 2PP7A 3FQ1A 1IC0A 1AIZA 2VW6A 3C75A 1I53A 1ZPUA 1GW0A 2IDSA 3NYKA 3OMIB 2UXFA 1KYAA 4FA7B 5I28A 2CBPA 4E9YA 4HCGA 3BVDB 5I6LA 1CYXA 1ZV2A 5B7MA 1ZDQA 1DYZA 1E5YA 1ETJA 2FJSA 3EF4A 2UXGA 2BWIA 2VMJA 1E5ZA 4GYBA 1JOIA 2W8CA 4G7SB 2VW4A 5TK2A 1J5DA 4YSPA 5I6KA 2YARA 4E9TA 1A4AA 1GY2A 2FT7A 3PCYA 1XB3A 4G70B 1JVLA 2P80A 1IBZA 2CALA 3V9EA 4M4RB 2JXMA 1NTDA 2YQBA 1OOWA 3TBCA 1KCWA 1AZNA 2PPAA 5I5JA 1CYWA 2AZAA 3FS9A 5FC9A 2IDFA 4BDVB 4N8UA 3X1FA 1YLBB 1L9TA 3QJQB 5B3SB 4NAJA 1SJMA 4Q8BA 2MTAA 4KOBA 5B1JA 2J56A 3SQRA 1EHKB 3NJKA 2BHFA 1AZRA 2DY2A 2LLNA 4YSRA 1JZIA 3X1GA 4QKTA 1GYCA 4YSSA 4HCIA 1NPJA 3FU7B 5I26A 1ILSA 2ZXWB 3ABMB 3NJFA 2UXTA 2HRHA 4A2DA 1PMYA 4UF7C 1L9RA 1SFHA 3S8GB 1BAWA 2XWZA 1ET5A 1J9RA 1AR1B 1TEGA 2HX7A 3WG7B 3OD3A 3S3CB 1XMEB 1TKWA 1F56A 3S3BB 4CSPA 1AG0A 1PLCA 4A2EA 4W9ZA 1OE2A 3CG8A 3IE9A 4KO9A 2R7EB 3QJTB 3FQ2A 2YAOA 1M57B 2DYRB 2DYSB 3CVBA 2EILB 4BWWA 2VSMB 3D12B 1AANA 1RZQA 4JKNA 2EIKB 3FSWA 2GC4C 5I5MA 1SFDA 3QJVB 1JZGA 2MRYA 4G7QB 1QHQA 2DV6A 2IWEA 2HXAA 1E67A 1SHWA 2YAEA 3ASOB 4E9QA 2HLEB 4TXVB 3ZDWA 1PF3A 2TSBA 2W88A 3ZX1A 1VLXA 2CUAA 3IN2A 2CAKA 2XX0A 1BQ5A 4X4KA 1JXGA 1KV7A 1PZAA 3ABLB 3HB3B 2XVBA 4FAAB 3SBRA 3MBWB 2OV0A 2IWFA 1MG2C 2I85A 2XU9A 4DP7X 2BZ7A 1W6WA 1V55B 4G71B 4HIPA 4BK5C 2B08A 1L9QA 4WTQA 4YSEA 5B1BB 4DP8X 1KDJA 1CUOA 1MZZA 1NIFA 2PP9A 3H4HA 2FTAA 3WNJA 4YSQA 4G72B 3NJJA 4KNSA 5IY5B 2XV0A 3NJNA 1OCOB 2XXGA 1NZRA 4F7KA 3TA4D 3SBQA 4NB7A 2IDQA 4YL4A 2Y69B 3EH4B 4YSTA 2YAQA 1AS7A 3T9WA 1BQKA 4KO6A 2ZOOA 1A65A 1BXVA 2CJ3A 3X1EA 4AKOA 3ABKB 1HAUA 1JZFA 2BZCA 3JT2A 4JHVA 4AKPA 2DWTA 3AZUA 3PAZA 2PPCA 2VM3A 1PNDA 2JKWA 2YAFA 1B3IA 3V9CA 2YAHA 3HEIB 5E9NA 4BDVA 4EF3A 8PAZA 2X88A 3FSZA 4A67A 4AZUA 2XV3A 3JTBA 2IWKA 4UANA 2PLTA 4QLWA 3X1NA 5AFAA 1KBWA 4YVNA 1JZHA 1L9OA 1NIDA 4KO5A 4P5SA 1ZDSA 5I5IA 1A4BA 3NJIA 1BEXA 1R1CA 1X9RA 2UX7A 2IAAC 1QLEB 5D4JA 2FNWA 1FA4A 1IBYA 3PAVA 1NWPA 4A66A 3CDZA 2FQGA 4BWTA 1AQ8A 1GY1A 3KW7A 2XLLA 1W6LA 1X9UA 1FFTB 3NP4A 4DP0X 3NJLA 3RYMA 3UADA 1MDAA 1JERA 4UAHA 4E9RA 3H4FA 2FT8A 1ZIBA 3CDZB 5ANHA 2QDVA 4Q89A 2BWDA 4KNTA 4NERA 2GB2A 2AZUA 2YAPA 2QPDB 4DP5X 5I6PA 2UXVA 1AZBA 4AKQA 2IH9A 7PAZA 2GHZA 2B3IA 2DWSA 1JXFA 3AG4B 3ASNB 1L9SA 5PCYA 5D4IA 1WS7A 3N2JA 4PCYA 1GS6X 3EH5B 3NJHA 2FWLB 2RACA 1N68A 1ET8A 1ASOA 3WNIA 4DP4X 1JVOA 2AANA 4A2FA 2PPFA 4CSZA 5TK4A 4HCFA 5I6OA 3QJUB 3OQRA 2X87A 4WKXA 4K9JA 3OM3B 2XX1A 2HX8A 2VSKB 2CCWA 1MZYA 4YSAA 2BW4A 2GBAA 1J9QA 1SNRA 1KGYE 1NWOA 3AG3B 7PCYA 2FT6A 1BYPA 1PZCA 4MFHA 3SBPA 4DP1X 3NT0A 4W1TA 1URIA 2XXFA 3DTUB 2WO3B 2BW5A 3AW5A 4ZK8A 4YVUA 4DP2X 3FU7A 2VM4A 1A3ZA 3FYEB 4GXFA 4PAZA 1NINA 1WA1X 3ABGA 3TASA 3FU8A 3GYRA 4YSCA 4BXSV 3DIVA 1AAJA 3NSCA 4A68A 1OE1A 5LDUA 3TU6A 1SDDB 4KNUA 1WA2X 1OF0A 3GDCA 4HHGA 2XV2A 2FQFA 3QJSB 1PNCA 3NP3A 4KOCA 4HZ1A 3FU9A 5B1JC 3QPKA 1J9TA 1SF5A 1BYOA 2BP8A 2GIMA 2BO0A 3KW8A 5B7EA 3U25A 4DP9X 1BXAA 3X2QB 2BP0A 3UABA 1GS7A 3BQVA 1KDIA 1SDDA 4RH4A 4L0PB 4HAKA 2VW7A 1RZPA 2Y1AA 4BWUA 5A7EA 3NJMA 3NJGA 1NPNA 1CURA 5AKRA 1AZUA 4E9SA 1MG3C 1BXUA 1ADWA 1E65A 1OCCB 1QNIA 1WS8A 5F7AA 1HAWA 2YAMA 3TBBA 3PXLA 1DZ0A 4A2HA 1SF3A 4GP8B 1ASPA 1IUZA 1OCRB 4KO7A 1V10A 2I7OA 3FPXA 3WKPA 3PAUA 1GR7A 1M9WA 3AG1B 1PY0A 4BXVA 1TEFA 3H56A 3NSDA 1PLAA 4YSOA 2Q5BA 3UGEA 2PP8A 1ID2A 4G7RB 1J5CA 2AFNA 2N0MA 3EHBB 3T6ZA 3WIAA 2VN3A 2J57A 4JHUA 3MX0B 4F2EA 2H3XC 3IN0A 1ET7A 5F7BA 1AS6A 1N70A 2ZWNA 3CVDA 3IEAA 4F2FA 2IDTA 1L9PA 1AG6A 3EH3B 3S8FB 2XUWA 2QPEB 3WI9A 1PCSA 1ASQA 4P5RA 3ERXA 1EZLA 1AACA 2R7EA 2YXVA 3S3DB 4GP4B 2PPDA 1PLBA 1PZBA 2OJ1A 5I6MA 1E30A 5EHFA 2I7SA 2FQEA 3OMAB 1NIAA 1NIBA 2A3TA 3NSYA 1GSKA 3PLYA 2AVFA 1OCZB 1XB6A 2IH8A 3FSAA 5D4HA 2BP8B 2E86A 2PCYA 1NICA 1GS8A 2IDUA 2FQDA 4A2GA 3GXUB 3UAAA 3G5WA 3T6XA 3CVCA 1JZJA 1CC3A 3QQXA 1J9SA
chains in the Genus database with same CATH superfamily
5E2WH 1S7UB 1MJJA 1T22B 4CBZA 5KJ7E 3TNNA 5HHVL 2OSLB 1IZJA 1YN6B 5HHME 5L4FA 4BD4A 1HSBA 4TNGA 2ZUTA 1IKOP 3WBDA 5TPWL 4LDLB 4LPTA 2NXYC 4NQEB 3FRPB 5GRJH 4LZKA 4CUCA 1YMMA 2XQYK 4IIQC 3WN5A 1CGXA 1YEKL 2AABL 1FVEA 1F1DA 1KN2L 4ENZA 1CCZA 2XACC 4JM2B 3VG9B 2R0ZH 2YWZA 3KDMB 4YZFF 4JY6A 5E2UL 5B39G 5FECA 2P5WA 3AG2B 3O4OC 2MTPA 4GRMA 1E90A 1E9OB 1D7DA 3DX6B 5I8EA 1URZA 5A2LH 5PAZA 1KJMB 4DAGH 1GMIA 3GMOA 2B5IB 2Q86A 1W72A 1UADC 5FYJD 2AJ3B 2WLYA 5KW9L 4JZJC 2D7TH 3EFOB 4DK5A 4YWGL 4MASA 4P4KC 3BAJA 4LPXA 4L8SA 3Q8EA 1CWVA 4XN2A 5DXWA 4EZMA 4PSRA 4UT7H 5ES4B 4DSYA 4U7KA 3MNWB 3IGLA 2DJ4A 2UY7B 3L45A 3LNFA 1BQSA 4S1SH 4DQOL 4JO1L 3UDWC 1WGOA 2VXQH 1NCBH 4P4KD 5T3ZE 4HJTA 3BGMA 5AZUA 4PMEA 3EUDA 3TC9A 3X3FL 4GO8A 4PJFB 4JRLA 3W56A 1FLTX 2JELL 1HXYB 4QOKE 4CADB 4AJYV 4R2GC 2EE6A 3UJJL 4AX3A 1BZ7A 4A04A 4D3CL 3KL5A 4YSDA 3QCVH 3KPNB 2BP3A 3LXBA 1T0PB 2B20A 3MSPA 3OMIB 4KKAD 3LH2L 3N41F 4PRPE 2CRIA 5CJ8A 5FCUL 3BQUC 4PW9A 3WIFA 4UT7L 1IO4C 2JB5H 5DLLA 1H3TA 4M43H 2Q10A 4N2GA 5EV7A 2JJWA 2UXGA 3QORB 2RCSH 1H6EA 4JQIH 3VD9A 3HG1A 5I1IL 1BFTA 2CR0A 5I6KA 1J5DA 4LAJH 1HSAA 2J4WL 2JE8A 4P4RA 3TESA 1XR8A 3KE0A 3OKLB 5BUPA 3BQUD 1IBZA 5HHPB 1AH1A 3AVEA 4XVJH 1G0YR 3D69B 3LV3B 3IDJB 4J7RA 1UM4L 1OOWA 1WAAF 3A22A 5I5JA 2EVGA 2UZXA 5DZVA 2C9UA 4KAQL 4ZTPH 1FCGA 5LKNA 1KJVB 4NO2A 2YMTA 2W0LA 4FNTA 4JBSA 4CVUA 5B1JA 3O6LH 2KZBA 3QK0A 2BHFA 4DKEH 1WQVT 1OM9A 3MAWA 4OCYH 4HWZB 4LCYB 3HG4A 2KQNA 3F83A 1K72A 1S9YA 5BXFB 3IDXL 4HCIA 1KOAA 3RIFK 3T4YA 4ZW8A 3WIIH 1GZPB 3TPKA 3MRJA 3DOIA 1SVBA 3MV8D 5I17B 1KEML 3PWPD 1HX0A 1LE5B 5LG6A 3I6KA 3MV7A 1FAKT 4L3AA 3HC0A 5GGUB 1JF6A 3FONB 1AE6L 2DTML 4PBVC 4PRPB 3H3PL 2IOIA 4PJGB 2R1WB 1EGJA 3DXAE 4FLRA 2NY0B 4PJHF 2YMXH 3D12B 4PHXA 2ZPKL 2ALAA 3SYCA 4BFKA 3QW9A 2A9NL 2DJUA 3DVGA 4PJGA 1FIGL 3NA4A 5F7EH 1ZVYA 3R1GH 4HWEL 5IBUB 4CILA 3VGFA 1RZKH 2EEDA 4ZFZB 3WO4B 5IFAH 1ZT4A 4UNTA 5FO8A 3QXAB 3ZDWA 4E5XG 3H6AA 1LO5B 3F84A 2G0LA 2P8PA 3IF1B 5ICXB 2DIAA 4XAWL 1HQ4A 2Q8AL 1F58L 4XHJC 4RRPA 4IBUA 1A6UH 5KYNA 3RAJH 3CUPB 4DNLA 4C8XA 4H8UA 2E7HA 3KYMA 1VEPA 4PJHE 5I2IA 3QDMB 4NDMA 1JBJA 4KPHL 4H26A 3EJCA 5CR8A 4AGNA 4J8RA 5EU7E 2HJFA 1SN0A 5CHNB 5FDWB 1MJ8L 3RKDC 1U6AH 1UA7A 5KVEH 1EXGA 5EU6B 5EUOA 2V4LA 4PTUA 3GSUA 1TT6A 2E75C 2VR4A 4J6RL 4KC3B 4NO2B 2FEJA 4H5SB 2F2HA 3K1KC 1FG2B 3QFJD 5DJCB 4LCWE 5D2LF 2NQ3A 3C5ZB 3V6BR 1S8DB 3P9WB 2BVEA 1CQYA 3ZKND 5JNYB 1J5OH 5JPNC 5I23A 2DKUA 1DL7L 5C0CE 2VDLB 5GSRB 2FIKA 4QRTA 2DMKA 1X5KA 5LHDA 3DETD 3MLWH 3OKDA 3KBEA 3IDNA 4KO6A 3B6SB 1IB5A 3K6FA 4ZNCD 5TFSL 15C8L 1G9EA 5IKCA 4K3DL 3GRGA 1I8LA 4WI3A 5KOMC 4Y9BA 1XF1A 3HZYB 1VKXB 2M2DA 4RAUA 3NDZE 4PWIA 4TLSA 4AZUA 2OTWA 2XV3A 3ARBD 2VKWA 2OKMA 4WFFE 5CEYB 4MS6A 4KTDH 5DD0L 1AP2B 2PCXA 1X7QA 4HIXH 1HHGA 4OZHB 4F93B 1A4BA 1BVNP 4I48B 3UTQA 5D8JL 5L88H 5E5RB 2BRRH 4ZFQA 3TJPA 4OLWH 1NWPA 1RZJC 1ORQB 2BRQA 3U7YL 5GSVA 3ESUF 4NRXB 3AFLA 1ODAA 2DDQH 4D9QE 5CJBA 1TYJA 3QYMA 4RAVB 4TUUA 5I18H 2D7NA 4AQEB 4PJ5E 3RYMA 3ESPA 4KK5C 5KVFE 4KFMA 1PPIA 3V4PA 5JIDA 2EEXA 1SJEB 4PJDA 1SM3H 2BZDA 5ANHA 2XPGA 2ATKB 1OXYA 4PHZA 4QTFA 4J3OG 1DE4B 1MAMH 1JYWA 2VRQA 2LU3A 4HQQL 1DVFB 4F9PC 4QJ4B 1G7LB 4GMSH 1NPUA 4XMTA 1IGYA 2W9DH 1KPRA 1EERB 5BZXA 3FO0L 1ITCA 6CGTA 3IFPA 1YA5A 3MACH 1O6SB 2KS0A 3NIFF 4PCYA 1E27B 1B88A 5KSVA 1E43A 1WAAA 5HHVH 3L81A 4R7NB 5BUGA 4CNIA 4JY6B 4ALAH 1QBMH 2A9DA 1AQDB 4ZYKA 3DOSA 1BJ1H 2EUWA 3O81A 3OKMA 3N40F 1D6EA 2ZXAA 4KTEL 3MNVA 4QTIH 5E8EA 1A6AA 3U1SL 4PRHA 1B4RA 1TVHB 2V17H 4NENB 5ADPL 5BV7L 2X87A 1J8HD 4YH6A 3X11A 3ULVH 1AYOA 1QLRA 1R9FA 5HVFB 3QUZD 4HAGA 5B4MC 2VDML 2W0KA 1H9DA 1G5AA 2VH5H 1EAJA 1D6EB 3UBFA 2V2WA 4PRHD 2YK1H 3FL7A 2RIKA 5C0JB 4BFIA 2WLIA 3NT0A 3FC8A 1KJ2B 3VYNA 5HTSA 5DFTA 1OIOA 4H8VA 1KIRA 2OXHB 1HINL 3F8UB 3MJ8A 1U8KB 3MUY1 3SHSA 1DSFH 4M7JL 2ZPKH 3C09B 1KF9B 3CN2A 2ARJB 3SDAB 4Z78B 4DP2X 1WFIA 3O8XA 4HIIA 3V4PL 4RCAA 4J3XA 2K78A 3EFFB 4JPKL 3S34H 2F18A 4KQ3H 4U7MA 2CLZB 2FDBP 2Z8SA 5DDHB 2IANE 4XXDB 3TVMB 5DD1L 1PD0A 1KNOB 5LBGA 5EUKA 1KTDB 2VAJA 5E0QA 5BW7C 3FFCB 3QUYB 4LCIH 5J89A 3HNSL 5LDUA 2X4NA 2ITCA 5JHBA 4ZW5A 2KL6A 3KCWA 1HE8A 3QFJA 4P2OA 5HI4C 2OFQA 3QJSB 3KLSA 4WKZB 4TUOB 3WFBL 2N1TE 1EEQA 3S4SB 2EIDA 2QQQA 4PWEA 5ENWB 2ZIDA 5C1MB 4K94C 3VCLA 1IEBB 4HJGB 4NC1C 1QFHA 4FI7A 4ZX6A 3KZ8A 1CI3M 3FUJA 4CL7A 1EUTA 1THAA 4Z7WA 3D9AH 3TO2A 3MLPA 2Y7MA 3P1VA 2WQVA 1A8JH 4JDZA 3CBKB 4ANKA 1CGSL 2WQ8A 3GKWL 3IDYC 3DV6A 1DJHA 1N4XL 1Y0LA 1JV2B 2IPTH 5EO9B 1DJWA 3P40A 4ONFH 2HRPL 1A1MA 1TCRB 2F54E 1OAQH 3EO0B 3DUUA 2LAAA 5I8OH 5HPOA 4E0RA 3HUJB 1H0DA 2I7OA 4HUWA 2KT6A 3PE9A 2X10A 4MNHB 5AB0A 4PJXB 2X2HA 4U1HA 1YC8A 1IAOA 4TLUA 1UB6A 1NBYA 4O02L 3ES6A 1TZOA 4ODUB 4UIKL 2EYTB 2SEBB 4NWUL 4WWNA 1AO7D 2J57A 2XRAL 3P0GB 4ZFOL 2KZ1B 4WEBH 3IDXH 1PW3A 5F7BA 4EDWL 5K9JH 1DZBA 1SMDA 1A2YB 1CDUA 2WTRB 2XQBH 3IJSB 4B50A 4GUOA 2NNXA 3SBWA 3B4NA 3MYJB 5TH2A 2B59A 3TZVA 1PY4A 3BP7A 5JHDE 4D8PB 1NCBL 4FG2A 1PKQB 3QUMB 4PJAF 4WDIA 1ZGLB 1C5DA 1FH2A 4Y16B 4DN3H 3PREA 5J12C 4J27A 2RBLA 1E6OH 1KACB 1NDMA 3GRBA 3O4OB 3OMAB 3V6OC 1G0XA 1NIBA 3TV8A 1RHFA 3VG9C 1EO8H 3KHQA 4OZGE 1VFOA 1KGCD 4JCMA 4GAGH 3WJLA 2Y4SA 1QNZL 1Y6NR 2NR6C 2AEQL 3HE7B 3MLSL 3UBXI 5C6TH 2X2UA 5I1DB 4NP4H 1G9NH 1U8PA 4X8CA 2F5BL 2APFA 2VDKL 2A6DA 3E8VA 1LO0L 2I69A 2VDRL 2Q6WA 2HFFA 3VSTA 3RB5A 2VDNH 4Q4EA 3QQXA 4FXGC 1C08A 3ZVVA 2XG4A 5IVXB 3GTTA 2GIXA 2AJUL 1XGRA 1E2VA 3MLZL 2R0ZL 2BDNL 1AC6A 5DD3L 3SEPA 2NZ9C 4LXFA 4GQQA 3QZBA 4G5ZL 3Q6GL 3WO3B 1YRKA 1LM8V 2E3VA 2R29A 3K4AA 3KJ4B 4H20H 3QHZH 4MBRA 1FVDA 3O2WL 3Q2NA 5AAMA 2F53E 3ARVA 2P5EA 3DKHA 4X9BA 4P23C 5KVGH 4NO0B 3V0FA 4WFHD 2YZ1A 3BZDA 4PJEA 3MR9B 3EFDH 5E5LA 2ZKWA 4QCIB 1OTSC 1QBBA 4HS6A 1B6DA 5HGAB 3U4BL 1PZUB 3RE0A 5IVNA 3FQRA 4YXHL 5I74B 2PCFA 5INCA 3V0HA 2OSYA 1UWYA 4OB5L 2WBKA 1GOFA 2YKLH 1WHPA 1RVFL 3OB0K 5BVJA 5C7XH 3ULVD 4I0PD 3S3PA 3T8XA 2MQ3A 5D72L 2XVLA 4E41B 4K9EL 3X11B 5AB2A 1XR8B 3SJVB 3KWWA 4X0KB 3FRUA 4WK0B 2B9BA 2E5EA 3QHZL 2JKLA 1E4WH 1AZCA 3T8XB 1DJZA 3UCQA 5J56B 2FWOA 2CR6A 4LPVA 4JG0L 4E9VA 2JJUA 4WI9A 1IM9B 2VMFA 5J8OA 3VD7A 3G9VA 2GTQA 3CLEH 4DJMA 4PV8A 1WFNA 4HVBA 1BD2E 4G5AA 3WXVL 3VB8A 2D4FA 3TVMD 4KZ0A 4YJZL 4TSCL 1C1EL 5D8JH 2P5EB 2LFEA 1QFUL 1XIWD 4M8RA 3BJLA 1Q90A 5D93C 1CXLA 4J4PD 4HHWA 1OWWA 4KTYA 4N2LA 3ULUL 1AI1H 4CADA 5C0EB 1NKGA 4HH9A 5DJXB 3WY2A 1LO4L 1GW0A 4Z7VE 3TBWB 4L4VE 1Z66A 4HJJH 5IFJA 2EQDA 1PAMA 5J06A 3GBNH 4UQDA 4J4PC 2XWCA 3OXSA 1C8PA 4CU7A 2QFRA 2WQSA 1KB5H 3KCPA 1EQWA 1MAML 3O4LA 3PV6B 4X5PA 1F5WA 4F91B 4DEUA 2IANA 2IBBA 3KJ4C 5F93C 4NM4H 4N2NA 1IAKA 3GIZH 5D1XE 5IMOA 2CU9A 3F7KA 2VDRB 3RAJL 5GS3A 4Z95H 1GAFL 2E47A 3JXAA 3QIBA 3E2HC 4F8TA 2WNKA 3LN4A 4PGZA 5JDSB 1N12A 5FC9A 5TDPA 2QMJA 4Z6AT 3LY6A 2C1OA 4YDKL 1UWXH 1U3ZA 4S11A 3QO1B 3MLTB 5BMFL 4Z7NF 1XDTT 5ABZA 3EJJX 4JFZL 2P8LB 2YHGA 3HPJA 4NSKA 1DLHB 4JCWA 5KS9E 4Z7QE 2ADGB 3IFNL 5EWIL 4RX4A 1NBVL 1JP5A 3L5IA 1WZKA 1QPKA 4H44C 4YN3A 5F9AC 5EEYA 1XTLA 5B38A 4HC1H 5IP4A 4JJ5A 3LPGA 1WE5A 2G5UA 2ZXBA 4DK3A 4UF7C 1FSKC 4OZIF 5FFGA 1I1FB 3KM2A 1JPFB 4B7IA 3NN8A 2OXGA 4XB7A 4EIUA 1AR1B 4Y19D 5FGCE 3VFPA 1UTDA 1QO3A 1UM6H 3MUHL 3VVVA 1F56A 4MD4A 1G6RL 4LRNH 5DD6B 1S6NA 5SWSA 4AYGA 2VTFA 1E4KA 4ZTPL 1IKNA 3GSUB 4Z7NE 1VEMA 5BO1H 1FCCA 1HL4A 4KO9A 5AALA 1MWAH 3FTSA 1UD4A 2KDGA 2YAOA 3N0PB 4UIMA 3MV8E 3STZA 3QG6B 5F7HA 3EO0A 4Z7OB 4BWWA 1U41A 1RZQA 2KH2B 3QI9A 5CEZD 3WJJC 4F7TA 4JRYA 3JWDC 4JKPL 3R19A 5EC1A 1KGJA 5FHBH 4ZZKA 1E67A 2XN9E 1U92A 2YAEA 2Z7YA 4L1SA 4X9FA 5D1ZD 4RGNB 4JRXD 4EE2A 1QLFB 2WINB 2RTTA 3E9UA 3SY6A 5AKSA 3HHMA 4JHWH 3C5ZC 3G08A 4JFEB 4Z7VF 1ACZA 1BLNB 3ZDYB 1B9KA 2AEOA 3W37A 1WIUA 2HB0A 1JWSB 3PHQB 3QFGA 4LVOC 3FO2B 4PP1D 2H1LM 5G55A 5LQBH 1VPOL 1TJGL 2GSGB 3GS4A 3HR5B 4IDJH 3U46B 4D0BA 4KKNA 3U1QA 1U95A 3C5ZD 4AUJA 4EI5D 1Z9SB 2BPBA 4IGBC 5JHDA 5DUMH 1CZ8L 1OLZA 1KLGB 2BY2A 3L7EA 3B9VA 3MRLA 4MVBD 4PP1C 4ONGL 4OLUH 2R0LL 5ADOL 2X41A 1IKFH 2IDQA 1DJIA 1AMYA 1UH3A 5CSGA 4IK7A 4L37A 4NEHB 5J1SC 1ZLVH 1BD2A 1N3NA 3CNKA 2NY1C 2N4IA 4XT1C 5EEVA 4QY8A 3T9WA 2B15A 1WWCA 3IFNH 2CXGA 3PQYA 3QDMD 5EWIH 5F89A 2P5PA 2ZOUA 4MVBC 3ILEA 1P5UB 3SQBA 1H15A 1HAUA 1KIPA 3QEQD 4FQJH 5HJGA 2VXQL 4JHVA 5K9QG 5A3IC 4HV8A 1AXSB 5T3ZD 4NI3A 1CFBA 1UACL 5KN5A 1HYRC 1XH0A 3HEIB 4TNFA 5E9NA 2YMOA 3PP3H 3FSZA 4JX0A 1IC5H 5C0BA 4F2MA 2ZKHH 5KG9A 4GG6B 1JGDA 1PQZA 2XN9B 4JLRB 3IJYA 4L18A 3UXFA 3M7FB 3RGHA 3SDAC 3X1NA 15C8H 3D85A 3FOLB 1NIDA 3MMEA 4KO5A 4UUJA 5K9KA 1F4AA 4OLYL 3EYVB 2NSMA 5JXEC 1NCGA 4Y19A 1HXMA 3S7GA 2IAAC 4WO4A 2J8UE 3G5XA 5I75B 4J1UA 4LARL 4N2EA 2VDOB 4O58L 4EUPG 2UZIH 1QWUA 2LTQC 2YEZB 3HC4L 4YR6B 2WZ6A 1R19A 5BS0B 2FNBA 2YPVH 1E27A 4OZ4A 2MIZA 3NJLA 3FT2A 5EF3A 4XN4A 2XWDA 3FNKA 1JCKA 3IFPB 1S9VA 4JZJA 1T2JA 4KY1H 1WF5A 3B7UX 3EZJB 1YY9C 4Q89A 5FEBA 3SD5A 4QD2E 5C6TL 2QPDB 1MW0A 3TBVA 4XP5L 1I9JH 3TONA 2WXGA 5ADPH 1XTMA 2XT1B 3WE1A 1C5BL 2UUDK 3EGSA 5SWQA 3VXRE 3MREB 3RL1A 5GQBA 1WS7A 5D70L 3N2JA 4JM4H 4N5EC 2AK1L 3MKKA 3OJDA 4QYOA 2J1KA 3DHJA 3F6JA 4ZXBA 3VU2A 3BP5B 4MHHI 5C7ZA 4A37A 2EDXA 2DQHL 2F19L 3MREA 3I2CL 4X6EA 2PPFA 4CSZA 2HUEA 5ESQA 3SDXF 1X5HA 1FL5B 4MJHA 1Q0XL 3KXFD 4WVRA 5IHLB 1WTLA 3U0PA 1NUFA 2I9LA 4U1LA 1PD6A 5J6GA 1RUKL 5EIVA 2AMUA 3GLAA 5T3XL 4AXWB 3MCG1 4KXAA 4NHUA 5CINH 3UPRA 1ANUA 3Q3GB 1U93B 4Z5RB 3WUWG 2GBAA 3TL5A 4X6DB 3VWJB 1SNRA 5KJ4A 1WP6A 4RAUB 4ZUUA 4R96B 5JPMB 3JV6B 4G7VL 3O41A 4EOWL 3FB7A 2XXFA 4J3OC 1I82A 1S5HB 3ARBC 3JV4B 3DURA 3QA3A 2Y5EA 1JTTA 4HISA 4YEEA 4KV5E 2YA2A 4LHUA 4WO4B 4M62L 3VSUA 4AZ8B 1NAMH 5DHVA 1HZKA 4AT6A 1R6VA 4HGWB 4QXGL 2HFGH 3M1CA 1QPPA 1G7MB 4DCQA 2QELA 3SE9L 5ITBH 2OSLA 1U8IB 1QHPA 3AREB 4BXSV 4WO4C 1CF8L 4XP4H 3CGTA 2CDFA 4PUBL 5JA8B 5I73B 1CLOL 3MXWH 1P5UA 4KNUA 2H1PH 3NA9H 1OF0A 1SOKA 3QJHB 4HHGA 5F1NA 5T1KB 3JYBA 4RA0C 2R4RH 3FQ4A 3VXSD 4DF9A 1HKLH 2YOAA 2R2BB 1DBAL 4JO4L 4ONHA 3OSVA 1SF5A 3KW8A 2DTSA 3WTUA 4IU3B 4JPQA 3ATBA 5I5RA 3MZGB 4UYPA 3QWQB 4PJHA 3HNSH 4BFFA 3IF1A 4HBCH 1NC4A 3IFLL 5F7KC 3LH9A 4HAKA 2EEAA 2YN3A 5C9JB 5D6CB 2HTKD 4PIBA 4PJCB 2EACA 3OJ2C 2XG5A 3UBXA 5I19L 4K7FB 1PZSA 2H6PA 4KX7A 2AS5M 1A6ZB 3NGBC 2DEXX 1XGYL 1BSIA 3GT6A 3IK2A 2YAMA 5EEWA 3FT9A 4F8PA 4R5VA 2GPZA 1KTBA 4H1LG 3BVNB 4O51B 4AENB 5TD4A 3SE8L 4G8IB 3TGXA 2ORBH 1PDKA 5GISH 3ZKXB 2XQBL 2Y7OA 3O6FC 4KTGA 3RDTA 3U4EA 2NNFA 2CLVB 4BZ1A 3Q06A 1CGSH 1OD7A 2EYSB 2F15A 4HHAA 4QRUB 1A6VL 3BFWA 3GMMB 4JN2A 4WIQA 4J23A 5FYJL 3RG1C 5L7XL 1N6QH 4YLBA 2BNQE 3HC0B 4A6YH 3BIKA 2C26A 3L9RA 5E7BA 1FZJA 2AFNA 3N44B 1ZMYA 3O3BB 5CN1A 4QXTA 3BSHA 4WZ9A 1GPOH 4QHNA 5EOTA 1YPZF 2CJTA 2KYIA 3FO9B 3LCYA 3V0VA 4Z76A 1ET7A 3FH7A 3U0WH 4OZIA 3SDYL 4U31A 3ZYJA 3VM7A 3U1SH 1V05A 2A6IB 3H9SA 4OLXL 3N50A 1UQSA 4BGLA 1A9BB 3QDJE 3PWPA 4GP4B 4R6UA 4YHYB 2PPDA 3CLEL 4KH9A 2XTSA 4W9HC 1PZBA 2QSVA 1X7TA 5ICYA 2EYTA 4A7SA 5EULV 4IRSA 3CFEA 1UB5B 1SBSL 2J8HA 4O5LH 5HXMA 1OLLA 2VCOA 5DJDA 5FYKH 5IV2B 1JF5A 3VD3A 2L7UA 2CRYA 3OHXA 1A9BA 4CGTA 1PS3A 5ACMA 4KVCH 4PRAA 1UFUA 3U2IA 4TKWA 4UILH 3MV9B 4MCZB 3QUXA 5E2TH 4F2FA 2C1PA 3MBWA 4GW1A 1YEDB 4OJEH 5F1OB 1PX4A 1IIKA 3HJEA 2JK5A 4WHTA 4NSKB 4UDUA 4JY4B 4TPRH 5DJZA 1FNGA 1EFXA 1VADB 2MQCA 3IS1X 1CTMA 5FHAL 2WZPA 3VX1A 5MENE 4ELMF 1RCYA 3TA3A 2EIJB 4RIRA 4AVHA 2QPUA 2XKNB 4Z7UF 4MJ4A 2XICA 3U4KA 3LKSB 1M05B 2YIHA 4NKIH 5DD1H 4XP1L 1VCAA 3MLRH 5EOQH 2JH2A 5DJYA 3PWUB 1HE7A 1M71A 1P7QD 3DJZA 3HMXA 2OMTA 1G1YA 4DPAX 5C0RH 1R3JB 1JG9A 3MQIA 5CILL 1FNAA 1C12B 3V5KA 4IQHA 1L7IH 1T5KA 3FTUA 5C07B 4F37K 5DVKA 2X4UA 1U91B 3CZUB 1MFUA 1AS8A 1JI1A 3DHPA 3FFCE 5F97E 1TPXC 1W8EA 2QT6A 4U1GC 4AC2A 4ZFFB 3ZY7A 2GC7C 3PAYA 4L05A 4PV9B 4XP6L 1I9RH 3O3UN 3TVMA 4BFOA 4FF9A 5CMAA 4PJHB 2ADJA 3EO1A 2WJ7A 2MCPL 5SV4A 2BP0B 3QXUA 2GI0A 2BSRA 3D50A 2IG2L 4L4TB 1DN0B 1KCRH 1EZSA 5F3BB 4NAMA 1UD5A 1DVZA 4LSTL 3LEYH 5A16B 1QRNE 3T65A 5HPMA 3G5VA 7TAAA 2WZPD 1F90L 3GI8H 4UAOC 3ENEA 1BIIA 1JPSL 3K0WA 4G6KH 3H1ZA 5EU3A 5BOZG 4YO0B 1UACH 3DGGB 1HXKA 4EO5A 3NIDE 4Z3JA 1XSIA 2QTVA 4GRWB 2FWOB 2DLFL 1G1KA 1ZPLA 2GT9B 5ACZA 4JFUA 5B1KA 2YA1A 5HGGS 3NH7H 1A6WL 3UC0L 4YL9A 3DI3B 1RLBA 4PJ7A 4XZ4A 3RZCD 4AZ8A 1AR1C 4KTEH 5A2BA 4LPCA 3D7PA 5IVOA 3L3DB 3PHAA 3ARDC 3S37H 1YNLH 3X12A 3BD3A 4GKLA 2JLPA 4P59L 5GRUH 4OQTL 4XO3A 3BIAX 1XGYH 5I6LA 5ISZA 3EGXB 4LSVH 2BVYA 1ZDQA 4JZNA 5IB2B 4J39A 1GA2A 4TSBL 2NQCA 3C5SA 4HZLA 4U49A 3ZMRA 1AGDB 5DUPL 2IAMC 1ADQL 4Y2DB 3WJJA 3L1EA 3GD1C 2MCAA 5HPMB 1KUMA 5TGBB 2ZAIA 1G6RA 4YSPA 3HAEH 3ECBA 5GJTH 4EXKA 4E9TA 3RFRA 1KYFA 3HNVH 1XB3A 3ALPA 3M1BA 4HIJB 1UZ6F 4XOAA 4F15C 4FG6C 3R7RA 1M7IB 5JQ6H 1JZ5A 1JDCA 3BWUC 2IAMD 1GZHA 2IDFA 4X98A 2ICEC 1L9TA 5T1LB 1TPXB 2OZ4H 5DK2B 4AYID 5TE4H 4Q6IC 4KOBA 1TDQA 2FBOJ 4IRSC 2Y6TE 3D4CA 4Y9FA 2FCBA 4K3DH 2KZWA 4FX5A 4MAUL 4YSRA 2Z93A 4JFFB 5DC0A 5HVGB 1ZLSL 4C57C 3SDYH 1VZIA 4XO5A 4PRIB 3TEXA 4OFPA 3GMNA 3HG3A 3Q1EA 3KPQB 3MLUL 3QIWA 3GSNL 4N8PA 1M3JA 3QUYD 1NPJA 2X4PA 4MD0B 4F8QA 1IFHL 1J0JA 5EIIG 4XTRD 3AB0B 3EOBA 3AROA 1X5JA 2HT3D 3O0LA 4XMZA 1TKWA 5IJKA 1CI5A 1TTGA 4CSPA 1LGVA 1UVQB 4K0OA 1MUJB 4XX1E 5DRZA 3JTSA 5DU7A 4PJ8A 1EFXB 3IMSA 4JB9H 1N6VA 4OY9A 1HU8A 2JK5B 1WITA 3FQ2A 4WHTB 4XTRC 3R7QA 3VXRD 2J2ZA 4R4BA 1D7FA 2F54D 1XIWC 2AQ2A 4HG4J 3DJTA 3FTGA 3MNZA 1NBVH 2Z31A 4P46A 3UBGA 5I5MA 2F74A 4L3CA 3OHXB 5DTFA 3DBXA 3CFNA 1CQKA 5T1JA 2MKLC 4XCFH 1DVXA 2A73A 4D0CA 1U8OA 4OLZL 3HKZA 5E8OA 4C4BA 3ATEA 4UOW0 1KEGL 3IJEB 1N8ZA 4HXBH 1TCMA 4ZMTA 3VJ6B 4X4YA 3QNXB 3HG1E 4UM9A 4ERSL 4PR5A 4FN0A 4FAAB 1R5WA 5FO9A 2CNYA 5JHMA 2BSCA 2YD5A 4QTIL 1V55B 4NN5C 1MCOH 1CLCA 5IGXL 5F7LB 4BK8A 4HKBA 2NYYD 4N8VB 3H4HA 4B9ZA 1DVFD 1YSOA 2NR6A 2X3AA 1ORSB 2ZP9A 25C8L 5CGTA 2GG1A 3GC3A 4KUZH 3D06A 3WJMA 2Y3NA 3PRZA 3R0MA 2R69H 5AAWA 2Y69B 1S46A 3N85L 3T0EE 2AABH 1DDHB 4PREB 5DK0B 2NYYC 1X5IA 3UIZA 1DVFC 1SM3L 3IWUA 3P3RA 4XMPL 1HEHC 2YRBA 4TL4A 4HFWB 4JANA 2W60A 4DKEL 4NQSA 1BM3H 2PPCA 1QKZH 1BWWA 5I1LB 3VMOA 1B3IA 1KCKA 2OMYB 2DQTL 1N0LB 3IJHA 4YDKH 1XAKA 1QTPA 1LYQA 4PVMA 4WFED 4JFVA 4H2AA 3KVQA 4L4VA 5DHEA 4HIIB 1QSEA 1P7KB 4AJ0A 3QG6A 2ARJA 1QLEB 4WEMB 4KQ4H 3V95A 1FQ9C 2OMWA 4XP5H 3LB6C 2DF3A 1XWVA 2M83A 1Q9WB 4LSPH 3AREC 2UYLB 2WSPA 2YD1A 4Z7WE 5CBEA 4AQ1A 4GXUN 4BFIB 1J0ZA 2N7AA 3MJ7B 3AREA 4AQ1C 3ABZA 3ZL4L 2JKIS 1MFBL 4XNYL 4XE0A 4YXHH 1MDAA 2OXGB 5KJRL 1FGVH 5F70A 4NKMB 4YWGH 1NGYB 3PGDB 3VXMA 4Y8AA 2HN7B 1BYNA 3QFDA 3LRHA 5CEZE 1A14H 1B0GA 3HUJF 4IBLT 1J7VR 4UOJA 1REIA 1AZBA 4R9HA 4YS4A 5LCVA 2YPVL 4RQQB 2YD0A 2KHAA 4TQHA 3OKMB 4M6OH 3Q5YA 4UDTA 3DTXB 2A6JA 3Q1SH 3RWGB 4A7VA 1N68A 2CHXA 5I0WA 4D7PA 1ETZA 3OZ9H 3BWUF 1G0DA 3N43F 3F05A 1HQRB 4Z5RA 5F1IA 1M2VB 2FJHA 3CIAA 4O02H 3ZJAA 4CSTA 1MHCA 4U6XA 1ITBB 3A0OA 3DX9A 1P1ZA 2DQFB 4FRWA 3QUKA 3WAKA 1CO1A 1T0NA 3MC0A 4YQXL 1MRDH 4WNQB 5DQDH 1J87A 4ADJA 4ADGA 1KG0B 2ICCA 1W9XA 1KGYE 4RAVA 3AS3A 2R29L 2QSTA 4JB9L 3V55A 1G9MC 1BYPA 5DJ0B 4HMDA 1N6QL 1HZHH 2WXLA 5EZPA 2X38A 3FN9A 2WHVA 5J0BA 3BI9X 3MLWL 4C4KT 1CFQA 1WBXA 5D9SA 5KSBF 1YEJH 3TBVB 1IAMA 4C4KO 3GO1H 4WQOA 4BHUA 4GXFA 4OGYL 3AADB 1NA8A 2J8OA 5FO7A 3V0GA 5HYFA 3OXRA 1KMGA 3VSQA 2L7JA 1J1XL 3DI2B 3W81A 1BREA 1NCJA 2N7SA 3VACA 3S96B 3Q44A 4ZMLA 1U8QB 1T4KA 3IJ9A 3MU3A 5HDBE 3HR6A 2GVYA 1AAJA 4EI5B 1NOFA 5BMFH 2DWEA 3Q5TA 1TVBB 1OVZA 5I1JL 1FNEB 3VW3L 4KOCA 4ZAKB 3VAEA 4OT1H 4ETYA 4XMWA 2VDQH 4OF7A 2ZJSH 4RGNC 3APNA 1B0GB 4JFFE 4BV1A 1RFDH 3OQ3B 4GKNA 1BFVL 4ES8A 1RSFA 1JGDB 3FCBA 3OF6A 5DJCA 5IHZB 4B9CA 2WXIA 2AI0H 2GCYB 3B34A 3SE3C 2QHRH 2IH1A 4AQ1B 2IVFC 1C16B 3QQ4B 4GFXA 4B6ZA 4JPVL 1ADWA 3KPMA 4Y9EA 1LWRA 1MCRA 4R0LB 5DGRA 5E5UB 4XRCA 3T65B 1N7ML 1RPKA 3JWDL 1DZ0A 2HMIC 1U8HB 4F37F 3PP4L 3RX8A 4JRXA 5INDA 4OV5B 3GBML 2YGQA 5FKAA 5HDQL 4PJ6A 4WW1A 4KKLC 2CBTA 1ND0B 1A7OH 4P23A 5D7HA 1THCA 3KYNA 2ITDB 3AG1B 3QPXH 4B9PA 3WKNA 1CL7H 3KJ6L 3HZVA 2YC1B 4JDTL 1HNFA 3QXAA 4YHML 1EO5A 3VFOA 5D55A 3LPPA 1L3WA 4LMQI 2K7PA 4OW6A 3IFLH 5FO8B 1A3QA 4FFZH 3PHOB 3GINA 2ZCHH 5I8KL 1IRAY 2IIJA 2X7LB 3EYFB 1BBJA 3AWGA 3HB3C 3UDWA 1IAIL 4F5CE 1WEJL 1EK3A 1WSST 3I9IA 3ERXA 5E1HB 4KKQA 2XC8A 1EZLA 4NUPA 4ELMA 3M17A 4ODSH 2OCJA 3TBYA 4JR9L 1NDGB 5EHFA 5IQ9A 1BF8A 2VQ4A 3FH5A 4Q74A 2EXYC 1P9MA 3Q8CA 3TLRA 1AKJD 3SN6N 5AAWC 3G6DL 1OM3H 1T2QL 4DN4L 3P9MA 2J7LA 4FJ6A 4PLJD 5CGBA 3O3EB 4PPTA 4E5XB 5D1ZB 2VR9A 2NTFA 2XFGB 1AIFB 1J05A 4BSVA 5HYSG 5CILH 5E2VH 1E8YA 4WI7A 4Q4IA 2G5BB 5LN8A 4HUKB 4KMTH 1WGVA 3HVDA 4WWKD 2EXWD 1J9SA 1W0YT 4JDVA 3VNZA 2IH1B 4Z7NB 3KM1A 1QI4A 4AYMC 1BQHB 2X4SB 3X14B 1JPGA 4NBZB 4ZO8A 4P59H 4RSVA 1MQKH 1KN2H 2YFOA 3ARGC 4O2CB 4OCWL 3II1A 3FPYA 4ZUTA 4A39A 1RUKH 1A4KA 2DBJA 1OQOA 3WIHH 3BSZL 4KJWC 4HJEA 1B6UA 1E6JH 4WWKC 1JGLL 1XF5A 2EXWC 5HHPA 1I7RA 4J3UA 4HUUA 4OZFH 4P57B 3FF8A 4FG4A 1AXTH 3CFIC 3RWDB 4X5LA 3VFTB 3ZYOA 1OE3A 3ET9F 3EYUL 1TZHB 4UU9A 4G6JH 2ZNXA 3KYKL 3S2CA 1P4LA 3JTSB 4IMKA 2FJGB 1HZHL 3FT0A 5AZ2H 2NTSP 2B4CC 3T6VA 4OFIA 2XQYA 2P48B 1QFWM 5JIMA 4OTXL 2BVPA 5DZOA 1OCWL 3BZ4B 2W92A 4ATTA 1OAXH 2H9GA 3QYNA 3LXUX 1TU2A 1JXDA 4P0DA 5A2AA 1XF2A 1IAKB 5C0NC 5IK3B 3C2SA 1KGWA 1A64A 2GAZB 4KY1L 1WZ1L 2IXQB 5BV7C 3K6SA 2KPWA 3TCLA 2A0LC 1GL4B 3CSPA 2QPSA 1KCBA 1N59A 2ITCB 3BGMB 3BWZA 2ITFA 2GITA 3HFML 2AC0A 2YGNA 5F9WB 5LGJA 2XYCA 1QW9A 3RX7A 3HRZB 4KK9D 1NC4B 4OIBA 3L4TA 1T1ZB 3IDIA 5IQLA 1ZEAH 4JKLA 4F7MA 1U8CB 3WKQA 3OZKA 1MXDA 2CKBA 4IU3A 1CLYL 5G4NA 4TVSa 2XSKA 3ZKMD 2Z35A 1I7TA 5FKPB 4QR7A 1P1ZB 1GZQB 3RUGB 2CUHA 3OHXC 2I60H 2A77L 4FQQA 4HZLB 1EJ8A 3B9KB 4PGJA 1X5GA 4H8PA 5HHXH 4AC4A 1EO8L 3U83A 3BVDB 1CYXA 3MRGA 3WEOA 2A6JB 4IBYA 3AGWA 1BPLB 1F86A 3MN8A 4KMTL 4WHYG 4ZPTA 3NCBB 4F9LA 1ED3A 4P2RE 4UV4L 5CEXA 4G7SB 1LNUB 2J8UB 1B0RA 1DQQB 1O75A 4JFOA 1NLBH 4HGWA 4WRLA 2WVVB 3MRPA 1IM9D 2Y07L 4XPBH 3WN5B 2I07B 1AHWC 4G70B 4Q6IB 4FEIA 4EIBA 4NQEA 3ULAB 1A3LL 1A6AB 1ZLUH 3HHRB 1FN4B 5EORH 3J07A 4ORGA 1G9MH 2YR3A 3L7FB 3RVTD 4HF5L 5H94A 5T1LD 1AGBA 3OGCA 4HP5A 4GG6F 1QSFB 3DUSB 2ZUUA 3EYUH 1FFOA 4LT7A 3EYQC 5F7NC 4NHCL 1JYVA 1CF8H 1EIBA 1HWWA 1JZIA 3VG0L 4M4RA 3N3EA 3SOTA 4BSJA 5FGBC 2VNCA 2Q7NA 4BSWB 3GSWA 3DVNB 4C56D 2H8PA 2CGRH 2F58L 2JB6A 4FQLL 4MXWH 3HNVL 3MRDB 4M6MH 5GRVL 1P7QA 2QQLL 3CDGA 4MJ5B 4MAZA 4FC3E 1WWWX 4MQ7B 1LHZA 1NGZA 4HSAC 4JQXC 4RGMB 1BGXH 1DEEB 4OFQA 1R33A 32C2A 3S3CB 3OB0H 1LP9F 1SXNA 5JIKA 4ZFFA 4U6HB 3ZE0B 4CKVX 3U2SB 4JE4B 4GUQA 4M48H 2W9EL 4U1IB 4ELKA 2XV6B 3D3VE 1TYEB 1OAQL 3QEHB 2OYMA 5ESAA 1KB3A 1M57B 2VN6A 2DWYA 2E6JA 1KC5H 1F3JB 1AANA 1DDHA 4OZHA 1WC7A 4PGBA 2ISDA 3QHFH 1M71B 2ZUQC 1I8IA 3K8KA 2GC4C 2F53B 2W95A 3D25B 2F7OA 4NJAL 5JHLA 1QHQA 4I2XA 4W9FC 3SIKA 4Y16C 4Y1AE 5TF1L 4NOBA 1ZVNA 3GTNA 3TH4T 3ZX1A 4G9FE 4YE4H 2CAKA 3TH2T 4PEEA 4IBTA 4LBEA 1CD1A 2O5NA 3ULUH 1F4WH 4JO3L 4LLMB 2XVBA 4QYAA 4LLUA 1EWHA 2OR8A 3BWAA 3QJZA 4Y16D 3MMEB 4UUJB 1A2YA 3IJSA 3WS6C 2IOOA 1MAJA 3IXAB 1W6WA 1X9LA 4G71B 4FG6D 4W9CC 4Y1TA 1L9NA 4LU5H 3DX7B 4YBLC 4ZOBA 1U8OB 5E8OB 4MB1A 2DLEA 3VXUE 5HY9A 5DJDB 1HL8A 4DP8X 3FCGA 2MCPH 1BQHA 2HKHL 2X4SA 5H35B 3CFEB 3SGEI 2EDTA 2R9HD 4ZTEA 2FUQA 3GSRB 3WNJA 3RQ3A 1CFSA 1KIPB 3AXIA 3LS4H 5C07D 3GIZL 4N8CL 1ZT1B 3BEWB 3QJFA 1QSED 1HN1A 2KDYA 4YL4A 4ZNEE 1SEBB 3LX9A 3LEXB 1AIFA 2VDMH 1AS7A 3O3EA 4BZYA 4ANVA 1DEDA 3HRZC 4AEFA 4QRRE 2EVIA 4WW2C 5EOTB 3OJMB 3X1EA 3EAKA 4IJTA 1DSYA 2YKLL 4NM8L 4X2UA 2HT3C 2VXVH 2YAFA 4XNBA 5LGYA 3TOPA 4F7EB 5TF0A 2C3WA 2ZG3A 8PAZA 3MRQB 1UOLA 4AJWA 4XBGA 3TFKC 4A67A 4NN7C 1CGUA 2ENQA 3V4VL 2Z65C 4HEPG 2PLTA 4OFDA 2MSPA 5DQJA 3VCLB 5CCKL 4DGWC 4HLZG 4MB4A 4M5SA 4QXUH 3PHQA 3V4PH 3MV9D 3FHAA 1E4XI 2AJZA 5C0RL 4C83B 4N6RB 3DO7A 1MDTA 2WYHA 2GBTA 5LJYH 4G6FD 3FTWA 2VC2B 3FT4A 4HK0B 1AQ8A 5TE7L 4FJYA 3Q2CA 4OCSL 1KBBA 4K15A 2BIHA 4TSBH 5KSBA 3CCHB 4TNWF 3L6FA 3O6FA 3O0RL 1U92B 3RDTC 3BVUA 1WT5A 3I6KB 5FCUH 2W9DL 4BRVA 2EDEA 5I17A 2NDGA 3SOBH 3IBEA 5LVEA 1GZPA 1MFAH 1EO7A 3ZHDA 1DVSA 1VSCA 4F27A 3BX7C 5LWYH 4UMSA 3JV0A 5E99H 1O5DT 2Y9RT 3FB5B 1FPTH 3ZR6A 3IFOA 3STZB 4YIQA 5T5FL 5BV7B 2OJZH 4G80A 1G9HA 3T1FB 3K71B 3MX0A 4TV3A 5LB1A 3LSOB 4MQXC 1MW2A 1TZIB 3BUPA 1GMEA 5TE7H 2GFBA 4PD4K 3VRJA 2QADB 2X3BA 4LSPL 2WMPB 3GUFA 3O4LD 2P1YA 2VABA 4G6KL 3U0TA 2E4TA 2V2WB 4ZUSB 5JORA 4HD5A 4A2LA 4ZNEA 1CXFA 4FQCH 3T3PF 2MPAH 5MERB 2DS4A 4D9RE 3C5XA 4IS6B 3SPVA 2XX1A 4ZAKA 4KXZH 1OAKH 4P5TC 4Y7OC 1IBBA 4JO2L 2AXGA 2A7BA 3LDBC 4J3WA 4WWKB 2D31A 2BW4A 3LXCA 4ONGH 3NPSB 1NWOA 3TCTA 3AG3B 3W9EB 1KIQA 2W9EH 3WIFB 1DQDL 2B1AL 3HMXL 1U8QA 1KXVC 2NY4B 1IGJB 4AQZA 2DTMH 2BVQB 3UPRB 4P5TD 4OCXH 3M1OA 2F6AA 4IKNA 4RGNE 5DZPA 6TAAA 3LOWA 3HN5A 4MXQD 3MJ9A 5CR1A 2WN2A 4TL5A 5I73C 3CVIL 1RULH 5D1QD 4FQIL 2R69L 2X89A 1EV2E 4FXKA 1H3GA 1FGNL 4JQXA 4F1SA 3VXSB 5AW9B 1A7PH 1DBMH 2DYPA 5T1KD 3ARED 3CAFA 1YNTB 4TS6A 1LQBC 2VXUL 5D1QC 2HA1A 2CRZA 4OD2A 5I66B 1BHGA 2X4UB 4PJAA 3WLWD 3CPLB 1QFWI 3V5KB 5HHNB 4JL2A 4AYDC 3A6CL 3P3YA 2R59A 3JSSA 1SY6H 2FBJL 3GSOB 4DIXA 4BCYA 4O4YL 4MWFA 3WFEL 1WFOA 4HT1H 3WENA 4M7ZB 2OPCA 4XXWA 4RX4D 5FYJH 1A7QH 3DTXA 1LVEA 3SYQA 12E8L 4X9HA 1E8ZA 1FO0L 1EA9C 1M7XA 3JT0A 4FGMA 1KCSH 4KV5F 4MA3B 3VI3A 2QBWA 2E7LA 1DBJH 3MRKB 4HUUB 5AVYB 1BF5A 3Q8BA 2BNRA 1YMMB 4NKQB 4QGYA 3MV9A 2BIOA 2H32H 4G1MA 1FYTA 3A6CH 2LT9A 4N2AA 4R7LA 4V33A 5I1AA 1Z0MA 5E8PA 2NUTB 2DI8A 3FQTA 3WMPA 1N26A 4DPRA 2Z92A 3G9AB 4GRWF 5C0GB 4HT1L 3Q48A 3UGEA 3TV3H 4NQEE 1KFAL 4J5VA 3MBED 5C0AB 4RA3A 2D73A 3LD8C 5KVMC 3D39A 1RURL 3TS8A 2AXFA 4J3SA 3WLBA 4URTB 3E7JA 3MBEB 1INDH 3QNZA 4M93B 1NCWH 2D3JA 4CN1A 4TMPA 3VX0A 2IQAA 5C2BH 1UWFA 4UZSA 2CM5A 1U3HB 1D5MA 3ESMA 3NIFE 2GW5A 4ZS7L 4LCWB 1F6LL 1QYGH 1NSNH 2Z4TA 3FJTA 3G6JF 4N2HA 3VXTA 5BOJA 4PJ9A 2A6KB 3SKMA 4KXZI 1JFQH 1R46A 2MCG1 2IH3A 3UEQA 4LSQH 3LD8B 4PFEA 2A3TA 1JZDC 4FQXA 4LLAA 1CR9L 1AFVL 3MUZ1 2AVFA 4LIQE 1YMMD 5J6HB 4F3FA 4BFEA 4RGND 2O5ZL 2W07A 4G8IA 3UBHA 2FQDA 1M1XB 3D51A 3KH4A 4NKDA 3JTTA 2FSDA 4GXUM 4P8QA 5GGSB 4Z0XB 2V7HB 2YPLD 3OC8A 4G3YL 4MNQA 4NKOB 4WK4B 2B1HH 3J27A 1WUZA 4OVUA 3VFOB 4N4YB 2PYEA 1E9QA 1P69B 4IU2B 3SKNA 5HHOB 2ODHA 3DSNB 1VF5C 3HE6B 3S8WA 3G5YA 3TN0A 4E9XA 2BSTB 3RZWA 1KT2B 4D9RD 4S1DC 1L7IL 1F11A 1QUNA 4W4OA 3WMSA 4OV6F 1CICB 4UB0H 1KSRA 2V17L 3WLBB 1SEBA 2EIBA 1ZLSH 1FZMB 2ADIA 2LAGB 5KYYB 1UA3A 4JHBA 3QJHA 1J8RA 4FFVC 4P2QE 4ODHL 4D0CB 4JPWH 4PJ7E 4S1DD 2CM6A 3FQYA 3H55A 2NYZA 5FFLA 1OSYA 2Z92B 1QLEL 4YGAB 1O9WA 2AAVA 1B90A 3K80A 1BZQK 1QBAA 2FK9A 3VFRA 2JJVA 3F7PC 1HEZB 5C0AD 2HLAA 1L4IA 3OBAA 1TZ8A 1MVYA 1ZA3B 2ZOKA 4GAJH 3MNZB 4G6JL 1TMQA 4XXWC 4FLOA 1HINH 1TJHL 3CQPA 1FJ1B 1HSAB 2IBZX 5E6UB 5GS1B 4JFXB 2XTJB 3FFDB 3ZUCA 3VI3B 4KKBC 4D0DB 2Q9OA 1S5HA 2Y06H 3JV4A 5D7JA 2YUZA 5J6SA 4HEMA 4PJDF 4XO9A 3VXME 2NY4D 3G04A 2CNZA 5L4IA 3MLTA 4X9GA 1ZA6A 1JWUB 5DC4B 3UZQA 4A7QA 3H2PA 3TO2B 2D7PA 4G6AD 4QHKJ 3V0WL 1NFDA 5SWSE 1VGEL 4RLDA 1RUML 1DQJA 4I8DA 4QT5B 4B5EA 1FWXA 3AAZB 4ANXA 3SDXE 2BJMH 2CKBL 1K6QH 4TRPH 1F2QA 2P3YA 3NCXA 2HJKA 3D18B 3NFSH 4KTDL 4YLQT 4PJEE 1KLFA 4Y5VC 5HHMB 4DKFH 3FQ1A 5IM7B 3WYRA 1CDCA 1IC0A 2XA8L 2WZ5A 3N42F 4PRIA 1FNSH 3B7TA 3LRGA 3H3BC 4Z7AA 5BRZB 5AVQB 1OP9A 2JWYA 1XCXA 3WGUB 4E9YA 5DJ0A 3DGCR 4ETQA 2DB8A 4YE0A 5ILTH 2Y06L 3ARFA 3Q9QA 4XI5D 3KLHD 4Y5XA 3WDHA 4C4UA 4QXWA 3EXJA 2WN3A 4FEMA 2VMJA 2JV6A 1E3ZA 5CBAA 2VB5A 5LGKA 3APFA 3ESNA 43C9B 1SXZA 1OO2A 3S97C 3IAPA 3O8XB 3ZZLA 1VPOH 2XWRA 5CZKA 3DX9B 5IHBA 2B5IC 5TPWH 3KLHC 2EE0A 2OI9C 1ZK9A 4Y2DA 1ZLDA 2CGYA 2GUYA 3L9BA 5FW7A 3UPAA 2FEEI 1I1AD 4LSUL 4U4BA 5JW4N 4ODWB 2Z8WC 3QJQB 4LU5L 4GAYB 1BGXL 4H8WH 1XD1A 5CUSH 3O6ML 3VYPA 1I3RA 2AHIA 3W2DL 3N1FC 1QFPA 3O11B 3WD5H 3ZHNA 1L6PA 2HKFL 3DDFA 4NZDA 3KWWB 1HL9A 2IMNA 4PJFE 4Z95L 4AITA 1F0LA 1IEAA 2IBGA 2ZXWB 2ADFH 4Z8FH 1JJUA 2FYVA 1JS4A 5IBTH 2DQCL 4HPOH 1RUPL 3AM8C 2WKGA 4K8RH 2XWZA 3HJ0A 3HHSA 4HJSA 4WI0A 2ZICA 2HX7A 2XHNA 2VDPB 1GHFL 3IAGC 3VXRB 3SGEH 2GY7B 2GTWB 4KAQH 4MMZB 4NNPL 4KK9C 3R1GL 1EFXD 4HWEH 4RMQA 3S98A 3PU7A 1RZ8A 3MR9A 5F0JB 1KPRB 1OTTC 1U3JA 2LLGA 2BSED 2QADD 1RULL 1EEUA 4HJ0D 1QSEB 2VSMB 2WOBA 1N3NB 1H19A 4FP8H 5EUOF 3ZIMA 2Q8BL 2EIKB 1JD7A 5IQNA 4JFDE 5DRXB 4E36A 1MLCB 1EBPA 5HGDA 4OJFH 4JHWL 3QJVB 3V4LA 1K6QL 5T5NG 5AYUH 2BSTA 1UM6L 3K8LA 2YFNA 4AQEA 3MA7B 1XSOA 3CHRA 3CVHB 3N43B 4ZT1A 2HXAA 1OAUH 1O7VA 1R75A 3EDKA 3O6MH 3HE7D 3OAWA 4HJ0C 4TNEA 4TXVB 5E8DH 1KEMH 2FB4L 2HVJA 4YPGA 3KJ6H 3CXHJ 2L7EA 5I76B 4LLDB 5K59F 3EHBD 1D9KA 2ZAGA 1GIGH 2BSDA 4FXGB 5AYQA 3Q1SL 4Z0XA 4NJ9L 3DPDA 1KV7A 3ROOB 2QVKA 2RFXB 3ABLB 4JFFD 4BELD 5FOBB 4HWBH 4AUUA 1RZIB 3HW7A 1IT9H 4AG4L 2FLMA 3TIEB 1B0WA 1YECH 4Z23A 1LE9A 3EYSL 3HE7C 1AP2A 3SJVD 1CE1H 2KI6A 3LKRB 5EEUA 3F7YB 3GMRA 3KPLA 1KBKA 1UD8A 1FIGH 3GFUA 1CLZH 3P77B 4A7TA 3DHMA 3EYQD 4AIZA 4H25B 3L3GB 1NZRA 4H8QA 3VE0B 3P4LA 1INQB 2R56L 4GW1B 4KRMB 3RGVA 5C08B 3WTXA 1ZANH 4YK4B 5T3XH 4BFNA 3WD5L 3QJFB 4LNRA 2ZOOA 1HNYA 4V1DB 1BXVA 3SO5A 4FI8A 3VU1A 4N1HB 3PF2A 2NW3A 4DO6A 2BZCA 3ILDA 5JW5A 2VZOA 4DZ8B 3GMLA 2X70A 3NOIA 1VGEH 3VFPB 4BDVA 4PJXA 2CUIA 1AD0A 4FQ1L 4LDEB 2HLFD 3I6GA 3OLDA 3KNBA 5FDWA 1YEGH 3U79A 4NCC1 4UTBA 3AWFA 1QD0A 2B7DT 1B4LA 4PBXA 4QHUA 5JIHA 1QBLL 1CGVA 1R1CA 4N8VG 1TO4A 3EJPA 4OM0H 5GS2H 3T3ME 4A63A 5D2LA 3MXVL 4R4BB 3WTVA 2YO3A 3VTAA 1Z3RA 2QSCL 4HDIA 2WWOA 3P9MB 2I32A 2P8LA 2Z0UA 1Y0LB 3KW7A 4AIZB 4HPYL 4UZUA 5FGSA 4RBPH 4XCEA 1QSFD 4I2XB 5D71L 2BP5M 3MACL 5DS8B 4Z77A 4HYTB 4YDJA 3HBGA 2BWDA 4KNTA 6FABL 4JHZA 4NZUH 2AZUA 2YAPA 1T03L 3PWNA 4NRZA 3E80A 5CN2A 2BOLA 5DS1A 3AABA 4IMKC 4OCRL 1HOCA 4HIXL 3NCCB 2JCWA 1ZHKA 2F53D 2UVFA 4JFYA 2FH8A 4ELKB 3SOBL 1DN2A 3GUTB 4Q58C 4TUKL 5AOMA 2FWLB 2RACA 5I1EH 3IXTB 1ASOA 5D6CA 3CVHA 1NGZB 5CU9A 5DDHA 2GBVA 1JHLH 1N2RA 2OA9A 1P7QB 4MJ5A 1TJIH 1ZT7A 3VRIA 4Y5VA 3TNMA 3WEBA 4M7LL 5F72S 3LTVA 5C08D 4GH7B 2YD4A 4LSDA 5F7EL 4AYFA 4X4MA 3W38A 1BMWA 4B53A 2V8MA 5DO2C 1GGIH 3BVVA 3VTTA 2X6AA 1J8SA 1D5BB 5IVZB 5D7KD 3K6NA 1KXTB 5ICUA 4GBXC 4FDWA 1MZYA 1OL0A 4KWUA 4K3EH 3VXUA 3G3LA 1ZXQA 3HBQA 1GJWA 5T3XE 7PCYA 1YAZA 4CVWA 3RZCA 1N4XH 5DO2D 4PTTB 4I18B 3GJFA 4GIOA 5IFHH 2D31B 4GMTL 4DW2H 3OR7B 1GYVA 3AW5A 4F9LC 5H37G 3JV5A 4XODA 5C2BL 4G83A 1KTJA 1FBIH 1MVUB 3FYEB 4GW4B 3NEOA 3OSKA 4BFJA 4JFTA 3ETBF 4NO3B 2BNQA 4ENED 1XF4B 1P5VA 4TTGA 3DOSB 2PTUA 5JXEA 3O41B 4TNVF 1FL3B 1AO7E 4GAYA 4ZMAT 2AI0L 5KVDE 4KZEL 8CGTA 2CHWA 5KAQG 4ZRGA 1A47A 1PLGH 1B2WH 2PXYA 4GSDL 2DI7A 3CZEA 3MRHB 5E95B 4ENEC 5GZNC 4QRBA 3OXRB 3PFQA 2ZKYA 1G7LA 1A7PL 4RGOL 5J6GB 3QDJA 4EUPB 1BG9A 1G7JA 1J9TA 2ZXDA 3NGBB 4U2ZA 1WIPA 4CRPA 1BV8A 2BP0A 4L4TA 4OIIH 4UTAA 4YC2C 1SDDA 1T3FA 1KCVL 2OX5B 5IUSA 3QPXL 4QYOB 4C56A 3I50L 3CCHA 3NJGA 4F9PA 4MNGE 1MOEA 2MCMA 1MG3C 3QG7L 4R26L 5GSVB 3CSFA 5T1MA 3TBBA 3NJVA 3ZL2A 3SE3A 4PWJA 3A6OA 4F33B 4ODXB 1TTBA 2Y24A 1WD9A 1AKJB 4PS8A 1QABA 2FGZA 3PAUA 4YDJB 1AGFB 1E9OA 3DX6A 4FNLL 1ZA6B 4Y8DC 1XVSA 4HCRH 3OJVC 1LEKA 2JJSA 2KPNA 4TOYH 1MNUL 2VERA 4UDTB 4G2AA 3UYRH 5IHWA 1X4ZA 4W81A 3P73B 2VLKE 1IAIH 2OQJA 1WD8A 4FKEA 1SVZA 3O8XD 1EHAA 3NTCL 1U8JB 4HWBA 4IRJC 1I7RB 5EBMA 2BMKB 5GS1C 4MA8L 3N1GC 4KMLB 1F1AA 2VISA 4LL4A 1MCJA 5LN4A 1HYSC 1IC4L 3VGDA 5ALBL 5IR1A 1IC1A 3UAJC 2O61A 1Q1JH 1GGCL 4JDEB 2K8MA 3VWJC 4DEWA 2B3RA 1KJ3H 1DFBL 1FAIL 3S48A 5FS5A 1Y18A 1NIAA 5BRQA 4M1CD 5T3XD 4XOCA 1K8DA 3RU8L 5E24E 4RFOH 4Z7WF 4KKZA 5EEZA 3BP4A 1YY8A 2E86A 5HHOD 5C08A 3OB8A 4LLUB 3VWJD 4PB0L 3W0WA 3QPQC 1IQWH 4JFWA 3UAAA 3IGAA 4EIGB 5HVHB 4LBEB 3VH8A 2YPLB 4M1CC 5CEZH 1UZ8B 5GGQL 1WDAA 4X6CA 3KXFB 3GLZA 4M1DH 4PYHA 5AEAA 4YLCA 5I1LA 5KSAA 3QE5A 3QIUC 4NQSB 3F6LA 4FLQA 4MXVF 5BRPA 1T7YA 4JM4L 3U4BH 5GGTL 2NY0D 2OL3B 3N1PC 1RFDL 2FJFA 3WO4C 1TETH 5GGSA 3DIFA 1AXTL 3ME0A 3NCMA 3HZKA 4LLQB 4XPFH 4JJHA 5JW3H 2A9BA 3L48A 5IEHA 1UYWH 2V7NA 4KVNH 4NIKB 3F58H 4TUOA 4JUTA 2F8XC 2VR6A 3QFJB 4ZAKD 4PCSA 3PABA 3STBA 4K9EH 1AOZA 4JMNA 5HVWA 4YC2B 3QJRB 1J48A 4OM1L 3RWFA 3ULVE 3NQKA 5DGQA 3BUYB 4IOFC 3MFFB 5F9OL 1NKOA 5C9JA 2FATL 5MEOB 4YUEL 5I1CL 5FW6A 3UACA 4IHBA 3MTRA 1N6UA 1UH4A 4HS8L 2HFEB 3K46A 1MLCA 3N55A 5EU6D 3UO1H 1H9VA 4NP4L 1ZANL 2LR4A 5C0IA 4FHBD 3GSWB 3BH8B 1ODUA 2AXFB 2G75B 2OTPA 2C5DC 3EDFA 3MUGA 3B2DC 2HZHA 1CT8A 1NBZB 3JWNH 3EF7A 4IEFB 2A73B 4JZOB 4ZXBC 3TIDB 1BXXA 2WLHA 3VWKB 1LTXA 5DD6A 4LEBA 4ODHH 4POUB 5I6NA 5AVRB 5KBKA 4NC0B 3IGKA 4XWOC 1H8OA 2C4FT 4FMVA 4JDEA 1BZDA 3L7FA 3IMBA 4LCUA 3BCFA 4Y4KA 5E00B 5CFAA 3MV7E 3DJRA 1K9TA 5CP3A 5B38B 2WQAA 4GIPD 1SN5A 4G8GE 4H4NA 2LOEA 5I30H 1RURH 1ZHNA 1TEYA 2ADGA 2WB7A 3ISWA 3L4CA 1Y6KR 4XWOD 3UGXA 1TTCA 3N1QC 3GXMA 3RIFF 3QEQB 5I28A 2WC7A 4LCWD 4YUEH 3PWPE 3DMMA 1Q9KA 3QG7H 1NCAH 4PRPD 4ZUUB 3A4AA 2BX5A 4R84A 5F8RC 2WNWA 2JKXA 4IW4C 1ZVSB 4MWFB 4OLWL 3KPNA 4BH7A 2LE9A 3TYGH 4HU2A 1H3VA 1BAGA 3ARFC 5CJQH 3CMOL 1KXHA 2D9CA 3RVWC 4AGLA 2JXMA 3LZFL 2PPAA 4OFKA 2XDHA 1JGVL 1NLDL 4Y5XB 5AAMC 5IOPA 1IKNC 3VG0H 3BPCB 4BK4A 4LMQE 3C08L 5GS0C 4LO9A 4X9YA 2XNAA 4W4OC 2FAUA 9CGTA 2LLNA 4LRIC 4KJPC 1TJXA 5DI8A 3MLXH 5CD5D 2VN5A 3ELQA 3L5JA 1XCWA 1GYCA 4HIEA 5TQ2H 2EUXA 2HJKB 3BPLC 1KLUA 5D7IB 5I26A 4ODTL 3CHXA 2CBQA 1PMYA 3WXWH 5F1IB 1I8KA 1NCHA 4JZJB 4XNQB 2A74C 3S37X 1NOLA 1ZSDA 5C0DA 4DGIH 3P2DA 4F7CA 1TEGA 3VD2A 3WG7B 1RZJH 2ZXCA 3WDJA 4DZBB 1F1GA 4WHYH 2B77A 4W9ZA 2OSXA 4JKPH 1OE2A 1HCFX 4UU9B 5FOJA 1A7QL 4HULB 1LD9A 4JKMA 2OMXA 4HPOL 3AGVA 3MBXL 5CJQL 5HYJB 2DOCA 4L29B 5GSRA 1QSVA 2W0FA 4PJ7B 4OFYA 4E41A 1A66A 1H3WM 2CDEA 1A4KB 4LGPB 3HS0C 4ZUTB 3GKWH 2X9ZA 2WMPA 2GTZB 3JWOH 4PJDE 3C8KA 1T83C 4FQ2H 4FXTA 3DRTB 5EG6C 4XI5C 1MH5A 1WBYA 2WYIA 1S78D 5DVNA 2Y2TA 1H6FA 1BQ5A 2EH8L 3ZDXE 2HJFB 3KYAA 4YIQB 1SXBA 3KAAA 5EOCH 5LNEA 3OGOE 3S34L 3VXSE 4U0RB 2EYRA 2LGNA 3BKML 3P4MB 3JUYA 3GIVA 3B1TA 3CX2A 3VFSA 5BS0E 4GG8B 4JM2C 1S78C 3TYGL 3WKML 4HIPA 4Y4KC 4M48L 1JDDA 2X53A 3RVXD 3VFWA 3BC9A 1L9QA 1I1AC 3KYOA 4WTQA 5I6XB 1IGFH 3S3SA 4BKTC 5JHLL 3V7MA 1XGRB 2NY2C 1X5YA 5AYUL 2DAVA 3DPBB 3KWUA 3VFUB 5B38G 4QMEA 5JXAH 4CMMB 1YDPA 1T6BX 1JK9A 3QT2A 3WSQH 1RD6A 4B3EA 1OGAA 4IJ3B 5CAYB 4XC1L 4JM2D 4Y4KD 2G2RB 1M1XA 1ACYH 3RVXC 2BHZA 5DZ9A 3FO1B 2CHDA 4JQIL 4S2SA 2DYPD 4OZGB 1AOHA 1KENL 4Q9BA 2WIIA 2W5PA 4OM0L 4L0YA 3LDBB 2FHBA 2AMGA 2Q20A 4FOMA 4NQED 3GS7A 3QZNA 3WNMA 4S0SD 2W1NA 3ABKB 5CLWA 1WK0A 5F7FA 1MFBH 1TQSA 1XIWB 3LKSA 4AKPA 2EKSA 3ILQD 2VR8A 3VXTB 1EUUA 4RIRB 4B3VA 3NRPA 3NZHL 4X80H 1U3HA 1JZ7A 4U3HA 4QTHA 2IWKA 4PRBB 5LXGH 3ALXA 5HHQB 4ZFOA 5DMYA 1YEFL 5JOEA 2QADC 3UC0H 5AOKA 5I5IA 2W65B 3LIZH 1Z3GH 3QBTB 2C1PB 3B2UC 5DD5H 4MDIA 2VERN 3ILQC 1T03H 1NGWB 4G8EA 1ZAGA 3I84A 4X8XA 1FA4A 5DD0H 3VXOA 4H0IA 4K71B 2QVIA 3CDZA 4R0LA 3LPWA 1F42A 4HFUL 1O9ZA 4D9LH 2XLLA 1KCUL 4G7VH 2WTPA 4L4TE 5BZZA 4DP0X 4KQ3L 4K9EC 4X4ZA 2IALA 4OR1A 5BUAA 1MPAH 1J8HA 1BP3B 3LNIA 1URLA 1HHIA 2ZWSA 1USZA 3EHBC 3NN8B 1AMXA 4MNHA 4U1SA 3VFVB 2DDQL 5IR1B 3HG5A 4UQ2A 3HN3A 3VXOB 5HYIA 1TJMA 4PB0H 3DUUB 3RGVB 3QEUB 3O9WC 3GB7A 1ZHLA 3H42H 1MCPH 3HRPA 5F0PB 1D5ZB 3CX5K 1T1XA 3FQWA 3I9GH 2OQJB 3CFQA 4OLYH 4W9DC 2DMHA 3LS5H 4YBHA 1UM5L 1ZLWH 1KJ2H 4GRWE 3O2VH 3DHUA 1EAQA 3CFTA 1A9EA 1LL1A 3CSBA 4PJBE 1RZKC 3MA9L 2AANA 4OKDA 1R24B 3BN3B 1MWOA 3H7BB 3BE1L 1YYLL 2EZ0C 3K2UL 3KD4A 2ZXGA 3IPFA 3BKCL 4GUPA 2E8YA 1XH2A 1K5NA 1KXQE 4QI3A 2ZD0A 1A6UL 4LLYA 5FYJU 4PJAB 2P28B 2VKXA 3CHOA 5G2NA 5ABAA 4WW2B 3UYRL 3L4VA 1QOKA 3F85A 2GEEA 2X1PA 1P7HL 2FATH 2UY7A 3LS5L 2FL5A 4C56B 1PZCA 2EC8A 2XCMC 1I9IH 2FJUB 3QEQE 4W1TA 5J5EA 5IFJB 1M3IA 5E03A 3RY5A 3BAKA 4B97A 2Y1YA 2HLFC 3MRDA 3KEDA 5DRXA 3GMQA 1TVDA 3OG6B 3HMWH 5GISL 2VM4A 4GKOA 1A3ZA 2EDMA 1KULA 1S7RB 5IMMA 2XIBA 2AJ3A 3MRHA 1A7RL 3PIQA 2GSIB 2L0DA 2LU4A 5EBWA 1CXKA 4PBDA 4Y5YA 3TASA 1JUFA 4RMUA 1GXEA 2NY5L 1NM9A 2ED7A 2WVSA 4YHIB 3WNNA 2K9FB 4RFEB 2CCLA 1DUZB 4DCQB 3ZE1E 1BFSA 3BPOC 4N22A 1A1OB 2XTJE 4DUVA 5FUCC 1WICA 4GXVH 5D2NB 4P3CL 2OBGA 3QPKA 2WVVA 1UCTA 4RDQG 4HXBL 2AV1A 3BAXA 4ZPVB 5EZOL 2F8VA 2AQNA 4I88A 4FYTA 1A3RH 4RH4A 1FO0H 3GJFB 3IU3A 4DESA 4PJ8C 4N28A 2A9AA 4CNIB 1MJJB 3RZCB 3L95A 4QOKB 1CURA 4LBAA 2HPTA 2UUDH 5ITBL 4QHMA 3OPZL 4Y1SA 5EU5B 1WS8A 4AOFA 3CVHH 3FUKA 4WUUA 3MLYH 2WCGA 2VMDA 1BPVA 2ZOTA 3M88A 5E2TL 5H4ZA 1IBFA 2Z31C 3C5JB 1S7RA 5DFWH 3RURA 5JLZA 1VERA 1AY1H 2EDOA 2I9LB 4U1LB 1DE4A 2H6UA 1V10A 2CMRL 1QA9B 2ATKA 1PKOA 5HYJE 3OAYK 2R0WL 1G6RH 2FD6H 2CIKA 4V2CB 4WNJA 2ITEA 1GKOA 1PLAA 2PWGA 2APBA 4DEPB 2PP8A 1MI5D 3MGTB 4EN3C 1WRFA 3J2PA 4BH8B 3ULUD 4NRXA 3EHBB 2R0KH 3CK0H 4BCZA 3FFCD 4JFYB 3WFEH 4JVUA 3LHPL 1N70A 5IM7A 2ZWNA 1H5BB 3TO4B 1GAFH 4LP8A 1KYUA 4X7TB 2X40A 3ZE1B 1IJ9A 4JFEE 2AW2A 4ABVA 2R7EA 1ZVSA 1SDAB 7FABL 1D3CA 2OTWB 2DQ6A 1EPFA 4LVHC 4WI8A 3MRQA 3IAQA 5EFIA 3KGUA 2APWA 5CNHA 1MW3A 3ZZ1A 5I6MA 1AHWB 5E5MB 2RCSL 5JOPE 3S35X 2B1OA 2NY3C 5IWLA 2YBRB 1L9MA 1S7QA 1Z9OA 2Q3XA 4JFQA 4AYEC 2QHLA 1PYWB 2EVFA 4NUJA 1HL5A 5E08L 3FQWB 1XB6A 3I75B 5J3HC 1G9NC 1I4FB 3LQAC 4OCRH 3FHEA 4PN6A 2MQGA 2B59B 3HC3L 4AV4A 4CDHA 2AJYH 3EYVA 3CC1A 4DQAA 4DW2L 2BIMA 2WWMC 4A2GA 4ATWA 5IBLD 5J1AB 4AMKH 2E7DA 1A4JA 1W15A 5BZDB 3VFVA 3BZFA 3L1OL 3TBTA 5BQ7B 4DVRH 2VLRA 2FYYB 4GP5B 4YDVA 1HC1A 1VAHA 1G94A 3LH2H 4FZEL 3OZ9L 3B3IB 3TXAA 3ZBMA 1IAII 1SY6L 5AG8A 1CDIA 1V27A 5KUMA 3C6LA 3CSYB 2F7IA 5CGMA 2DLHA 1SJHA 2VQTA 4KDTC 1M7UA 4MDIB 3H85A 5A43C 4OZIB 1IGTA 4MLIA 4HUVB 5JIIA 1INQA 1J0IA 2WBJA 5CLTA 2HFTA 1KCRL 2XZQL 4PQXA 3DK0A 4XPHL 3KL3A 5GGTH 5ICXA 4DFIA 4RRPG 3HE6A 3ZT7A 2DKSA 1FZJB 3O3BA 3JYCA 2CO6A 5CJXC 2Z4QB 5BJTA 3ILPA 1AHWA 3EJYD 2ZX6A 3T6WA 1F3RB 3VQ2C 1FBIL 3DVGB 5GRWA 4X83A 5HYJD 4OJAA 2IGTA 5DSCA 3GSVA 1K8IA 4XZUB 1UFGA 4TRPL 5BRZD 3EJYC 3U2JA 2QDWA 3D09A 3L3IB 1QTYT 1HYSD 1J10A 1QI5A 1RL1A 3GGWA 3L4WA 4LGSB 5HHMD 4P46D 4AYBA 2RD0A 4ZD3H 2GJJA 2HVJB 2AXHA 3VDCA 2B8OT 1GC1L 2ZOLA 2BVTA 3FONA 2I25N 1GGBH 1LE5A 1GRWA 1UXSA 3ZKQD 4TUKH 5FYLD 1UENA 1HIML 1II4E 2DH2A 2LVEA 5C0CA 3ZDYF 3EJQA 3EFFA 5B1AB 2YQ3A 4MA1B 2XXMB 5DJ2A 1MHEB 1QQDA 3QI9B 3TX4A 4GY4A 2X4OA 3SCMD 2DWDA 1MREL 4N0YH 4NQUA 1YY8B 5E4IA 1TLMA 2DPKA 3QPQD 2XTJD 3F7LA 1TQCB 3D39B 3RTLA 4KZDH 4X7FC 1PCXA 3FN0H 4GRLB 3NCFB 2IDSA 3NYKA 3ML8A 4B9FA 1UWXK 5DQ9A 1JGIA 2WLIB 3DBSA 5SX5K 5C07E 4HCGA 4UCFA 3CVHL 4P5KB 5DHYA 5B7MA 2FJSA 3BDYH 4AMWA 3H8NA 1RU9H 1BBDL 2BWIA 1T04A 1MCHA 5FUCE 3EYOB 3B9DA 2IJ0C 2GJRA 2W8CA 2GHWB 3HN8A 1KY7A 2EIZA 2A38A 1GY2A 3IDMA 1MFEH 2GJZB 3A3YB 5A2CA 1S9XB 1TVHA 3LN9A 1KPVA 3HZMA 1I1AA 4H8HA 1TSRA 3S5LA 4ZAKC 1ED3B 4R4FL 3FS9A 4KMQA 2WXPA 4MS8D 4HEME 4NWUH 1LEGB 4Z7QF 3REWA 5LXGL 3U82B 7CGTA 2WXRA 3CZNA 5DRWB 3CXHK 1XSJA 5JHDD 1D6VH 4KI5F 1H3PL 2F54A 3C6SA 1IGYB 2WBJD 3NACL 1AKJA 4QNPF 4FLSA 3BUDA 5IMOB 3QHFL 5EBLA 4ICWA 5F1KC 4EIZC 4EN3B 3BT0A 1T83A 3Q0HA 1ZTXE 2EDWA 2WW8A 4FQ1H 3VFMA 4YHZL 1JHKH 2HRHA 4A2DA 3VI4E 3A67H 1TZAA 4ALAC 3BP5A 3VWKD 3VMPA 4MX7B 3QRFM 3D39E 1OAJA 5L2KA 2VLRD 4LESA 3JWOL 3T0XA 2I9TB 1CD0A 1J1PL 2X2IA 3RL1B 1B2YA 4U33A 2WLLA 4I13B 1B0IA 5CZXC 4LLYB 1E2ZA 3P30L 2PW2B 2DYSB 5F7DA 2E74C 4ZO9A 2C3VA 2GUOA 5C0BE 3RL2B 1CD8A 3V7AE 1TU2B 3W82A 3PWUA 3H7BA 2VMCA 1IM3A 3BZ4A 1JMXA 1IGJA 1JL8A 3AQYA 1NEZB 2DV6A 2WLNA 4N0CC 1E2WA 1SHWA 3QXWA 4BBWA 1XFPA 3EBGA 3DSFL 3ISRA 5D2NC 5KSAD 3QO0A 4HF5H 3SYPA 2YD2A 4QRPD 2FJGA 4L3EE 3JUZA 1BQUA 1TZHA 5LO7A 3CE1A 4WV1B 5E94B 2ATPB 1F3DH 3SDCB 3VYOA 4WUUD 2YQ2A 2FIRT 3LZLA 1CXIA 5BS0D 2AGJL 3MBWB 4EDXB 5JYMA 4M29A 4S1RL 3IMUA 3F12B 2OJZL 3QORC 3WL9B 4BA0A 3DO4A 1Q72H 4I9WE 4I5BA 4A6YL 1HEZA 2NLJA 1GYWA 1MLBA 1T7VA 4NNYB 1YPZA 1BFOB 5GZOA 3CN4A 1E7VA 4I18A 3RWIB 3PWVA 2V5TA 1H6UA 2VR7A 3OX8B 3V5DA 3IB4A 3QEGL 5CBEB 5GS0D 2WQRA 2M26A 3QORD 3I3BA 4KNSA 5EIIA 2XN9D 4GRLA 3NDYE 4HGMA 4WGWB 1CT8B 2B2XL 2XXGA 3SQBB 3VO0A 4F7KA 3S37L 4NO0A 2G75A 1D5BA 3R0NA 3ZGHA 1ONQA 5I9QB 3OKKB 1IL1B 2ZCLL 2C9SA 2FX8H 2E7CA 3TA3D 4DKAA 5L88L 4BZ2A 3B2PA 3IETB 3ULVL 1SBBA 5LCVL 4QXUL 1IGMH 1RQ5A </