2RACA

Amicyanin reduced, ph 7.7, 1.3 angstroms
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PROTEIN (AMICYANIN)
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2racA00
3FSVA 5PCYA 2MRYA 4DP6X 1SFHA 1OE3A 5B7EA 5A7EA 1CC3A 1E67A 1N70A 2PLTA 4A67A 1JVLA 4N4YB 1BYOA 1GYCA 2HLEB 1I53A 4AI7A 2NRDA 1JZGA 5I26A 2B08A 2XV2A 2X87A 2Q9OA 1AAJA 3PLYA 1MDAA 2QDVA 2UXGA 4BWTA 3GXUB 2A3TA 4W9ZA 5AKRA 1XB6A 5TK2A 2BP8B 3T6XA 4BK5C 1SHXA 5I5MA 1DYZA 1ILSA 3T6ZA 8PAZA 1AR1B 2P80A 1OCZB 2JKWA 2UXTA 5I6NA 2GHZA 1NWOA 3X1GA 1EZLA 2P80D 4K9JA 2UX6A 1J5DA 1X9UA 4GYBA 1NIEA 4DP0X 4HALA 2CBPA 2Y1AA 4QKTA 5AZUA 1E5YA 4L0PB 3X1NA 2AANA 3FYEB 4YSDA 2HX7A 3TBCA 2PPDA 1TEFA 1J9SA 4G7SB 3PAUA 5AFAA 4DP4X 1QLEB 2I7OA 2QPDB 7PCYA 2GI0A 3RYMA 1GW0A 1W6WA 1AIZA 2VN3A 4DP5X 3FPYA 3BVDB 3WNIA 2ZWNA 3X1FA 3IE9A 1OE1A 4M3HA 4A2EA 4EF3A 3NP3A 1OF0A 3FU8A 1RKRA 2PP9A 4M4RB 2HRGA 2Q5BA 5D4IA 2H5UA 4YSEA 1IKOP 1BXVA 2PP8A 4E9RA 1SNRA 3ABKB 2VM3A 2CALA 1N68A 2ZXWB 2BP0B 1QNIA 4N8UA 3S3BB 2XLLA 3OD3A 1SFDA 3HB3B 2UXVA 3S3DB 2DY2A 1GS8A 4ENZA 3NT0A 1KV7A 3KW7A 4AZUA 3S3CB 1RCYA 1ETJA 1IUZA 1SDDA 4KNTA 2CJ3A 4A2HA 4E9WA 5FC9A 3TU6A 4F7KA 4GP8B 3OMIB 3ASOB 3N2JA 1SHWA 2DWTA 1TEGA 3EH5B 3ABGA 3ZIYA 5B7FA 2XVBA 1A4AA 1FFTB 3AG2B 3SBQA 2YAQA 1OE2A 1A8ZA 1TKWA 1M9WA 1AZNA 1ID2A 3GDCA 3TA4D 3FSAA 4UANA 1MZZA 4BWUA 1MZYA 4KNUA 3UAAA 3DTUB 2AZAA 6PAZA 1E30A 2VW6A 1URIA 5F7AA 2EIJB 2YXVA 1PMYA 3FPXA 3FU7A 3QJSB 2HZHA 1GR7A 1KBVA 1NPJA 1PNDA 3WIAA 1SJMA 1NIAA 3UACA 1WAEA 3FU9A 4DPBX 2QT6A 2XV3A 2CCWA 2H3XC 3QJUB 2BW5A 1T5KA 2IDFA 5D4JA 4F2FA 5B3SB 2PPFA 2J55A 4DP7X 4E9XA 2GIMA 4YSOA 5PAZA 4NAJA 1E65A 4FAAB 1FWXA 1EHKB 1CURA 1JZEA 3QQXA 1NWPA 1ASQA 2BWIA 1W6LA 1KCWA 2DYRB 4KO9A 4ZK8A 3MBWB 3FQ1A 3X1EA 2PCYA 2YAPA 1ASPA 2WO2B 3DKHA 1BEXA 4HAKA 3DIVA 3H56A 4JKNA 3WNJA 4BDVA 1NZRA 4DPCX 2JXMA 2BWDA 3FU7B 1NDTA 3AZUA 3ASNB 3OQRA 2E86A 9PCYA 1V54B 1WS7A 2YAEA 3T6VA 1JZJA 1AACA 2FJSA 3UADA 2B3IA 2VMJA 1R1CA 4NB7A 2GBAA 1KDIA 1KBWA 1NINA 3T9WA 3NJGA 2PCFA 1AOZA 1PLAA 3OMNB 1L9PA 3FQYA 3QJTB 2CAKA 2XUWA 1WA2X 3SBPA 1UATA 1V55B 1XB3A 2QPEB 3FS9A 3ABMB 4UF7C 4DP8X 5F7BA 4E9QA 1SF3A 1AG6A 1GY2A 4YSSA 4E9TA 3OMAB 2FQEA 3NJNA 3CVCA 2IWFA 1OCRB 1ILUA 3SBRA 2TSAA 1JOIA 1GS6X 1ASOA 2BW4A 2WSDA 5I6OA 1ET5A 3WG7B 1J5CA 2EINB 2HX8A 5ANHA 1PZCA 4KNSA 3T71A 1QHQA 3HEIB 2XU9A 2BP0A 3WI9A 3WKPA 5LDUA 4FA7B 2RACA 4BXVA 1BAWA 2IH9A 1CYWA 2FWLB 2YARA 4Q8BA 5I6KA 1JXFA 1KGYE 1IC0A 1JXDA 1PLBA 5E9NA 2GB2A 3PXLA 3NJFA 4A66A 4BXSV 3FQ2A 4GY4A 3CDZB 4AKPA 2HRHA 2UXFA 4NERA 1RZQA 1ZPUA 4G7RB 4A2DA 3NSFA 1NTDA 2DYSB 3QJRB 2GC7C 4DP1X 2YXWA 4WTQA 1GY1A 1PNCA 1TU2A 1OCCB 1ZIBA 1YLBB 4RH4A 2YAMA 2QDWA 4G71B 2XXFA 1KCBA 3CVDA 4KO7A 2W8CA 4GP5B 1NIBA 3T6WA 2VSMB 2AVFA 2HX9A 1AS7A 2VW4A 4WKXA 3NYKA 3G5WA 1HFUA 4TXVB 2IDQA 1PF3A 1E5ZA 3ZX1A 4E9SA 3PCYA 4X4KA 5D4HA 1NIDA 3AW5A 2HXAA 5B1AB 1A65A 1L9QA 2VM4A 1AG0A 3FSZA 2FTAA 1IBYA 5B1JA 4DP2X 2AZUA 1L9OA 5B1BB 4KOBA 3C75A 4HHGA 4YSRA 3X2QB 1BQ5A 1A4BA 4E9YA 3H4FA 1IBZA 2BHFA 4AKQA 1VLXA 2XX0A 3PAZA 2XX1A 4A68A 3CDZA 5I5IA 1AS8A 1NPNA 4QLWA 2IAAC 3NSCA 2I7SA 1JZHA 3AG4B 1A4CA 4E9VA 1AZBA 1M57B 4BWWA 2PPAA 4HCGA 2FT7A 7PAZA 1ZIAA 4W1TA 5B1KA 2J5WA 2BZ7A 4UAHA 3IEAA 1J9TA 2OCCB 3SQRA 1BQRA 2Y69B 4G72B 3CG8A 3KW8A 5EHFA 1ZV2A 4YSPA 3ZDWA 4AKOA 3NJIA 1JZFA 1SDDB 5I28A 2YAHA 2I85A 4P5RA 5TK4A 1V10A 1X9RA 2BO0A 4A2GA 2YAFA 3ABLB 4HCFA 3AY2A 4JHVA 3TBBA 1CUOA 1J9QA 1NIFA 2H47C 5B7MA 2DV6A 1J9RA 3AG1B 3H4HA 4YSUA 4PAZA 3EF4A 1PZAA 3QJVB 2OV0A 2FT6A 1ET8A 4CSZA 4BDVB 2GSMB 2BP8A 2YAOA 3U25A 1AS6A 1XB8A 3PPSA 2PPCA 1JZIA 2YQBA 4PCYA 3UAEA 1OOWA 4MFHA 1WA0X 4HHWA 3ZBMA 1B3IA 3BQVA 4G70B 3GYRA 1BXAA 2JFCA 3X1BA 3CZUB 2EIMB 1ZDQA 1NICA 1AANA 4KOCA 2IDSA 2R7EB 3JTBA 4YVUA 4YSTA 4YSAA 2BZCA 4HZ1A 3FT0A 3NJMA 4KO6A 1GSKA 1W8EA 4Q89A 2W88A 3S8GB 1OCOB 3NJJA 3NJLA 3NJHA 4AX3A 4JHUA 2GC4C 3QPKA 2FNWA 3FYIB 1PY0A 3OM3B 1BQKA 2VW7A 2IWKA 1PLCA 2J56A 2TSBA 3D12B 4YSCA 4HIPA 2R7EA 3PAVA 5IY5B 2MTAA 1SF5A 1FA4A 1AZRA 1BXUA 1HAWA 4F2EA 1ADWA 2WO3B 3FSWA 2IH8A 4KO5A 2XYBA 3L45A 1PZBA 6PCYA 5B1JC 5I6PA 2LLNA 1JVOA 1ET7A 2FQFA 1JERA 3WKQA 2FQGA 1ZDSA 1GS7A 3IBOA 3NJKA 4DP9X 1F56A 1AQ8A 2IDUA 3JT2A 1MG3C 3N55A 1WA1X 1XMEB 1KDJA 1KYAA 1WS8A 3UGEA 2EIKB 2AFNA 4G7QB 3IN2A 1L9TA 3EH3B 2XV0A 2N0MA 3IN0A 2ZOOA 2XWZA 4GP4B 1A3ZA 2PPEA 4P5SA 4YSQA 3MX0B 5I5JA 1AZUA 4DPAX 4CSPA 1RZPA 1PCSA 4HCIA 1L9RA 4A2FA 1MG2C 2CUAA 3AG3B 5I6MA 2OJ1A 1PAZA 3V9CA 3NSYA 1L9SA 1CYXA 1M56B 1DZ0A 3UABA 2UX7A 2PP7A 3QJQB 1HAUA 2ZONA 3V9EA 4YVNA 1JXGA 2X88A 3S8FB 2FQDA 3NSDA 3NP4A 4YL4A 2DWSA 2EILB 5I6LA 3EHBB 2J57A 3CVBA 2VSKB 3TASA 4GXFA 2XXGA 2IDTA 1OV8A 1BYPA 3ERXA 2IWEA 1AZCA 3EH4B 2FT8A
chains in the Genus database with same CATH superfamily
2EEXA 3RZCD 5SV3A 5CJ5A 5EEYA 5IW6A 5F1NB 3UL4A 1E67A 4W9IC 4FE9A 1RFDH 1O5PA 3QPQD 2QJDA 5F1SA 4KKPA 1W72H 1GZQA 1AXTL 4TNVK 2CG9X 2SODB 4KQ4H 2X1XR 1CDJA 1V3JA 5C08A 3AT9A 1OW0C 4HSCX 2NY7H 2Q10A 2IAND 3V5DB 4ZFZB 1L3NA 3WIHA 5IEHA 3QZOA 2P45B 1X5HA 1R46A 3ZYZA 5FA4A 1F2XK 1OT2A 2NY4B 4HPHA 4MMXA 1ND0B 1CGTA 2J6EL 2MHAA 4OFDA 1U8CA 2X4PA 4NUGL 2PYEB 3U2SA 3VG0H 1Q4NX 4A04A 2COVD 3PUCA 3RPIA 4K7PH 1RVFL 1A4JB 3B7SA 1OPOA 2F08A 3BFOA 2Y1AA 5G5DB 3WAJA 5CM1A 1LMKA 3QHFL 1XWVA 1JZ7A 3G5XA 4KV5F 4M6NH 4Y4HD 1NBQA 4QHPA 2YD2A 3WD5H 2G0LA 3TLRA 2GBTA 3AROA 3MC0A 5IQ7L 2DYPA 4X5XB 1G9NH 4OM1L 3L5WB 2NYYC 1DDTA 2GI0A 1MAMH 3HG3A 5E7FA 2DBJA 1B0RA 5JIHA 5T1DH 4ELDA 5EO0A 3DHJA 4LSQL 3E2HC 3SPVA 5E1AA 1THAA 2WM0A 4UILL 3UC2A 4W81A 1HWWA 1CDYA 2VDLL 3VWKA 1LK3L 1KXVC 4RMRA 1CL7I 1JMZA 3S37L 3P9MB 3IDMA 3QA3A 5IQOA 2EP6A 1JPSH 5ESQA 3MRIB 1IVTA 5G5DA 5J8OA 1PJ9A 2X89D 3HS9A 1HNFA 5J6HB 4C58B 1LEIB 4XN4A 3MBXL 4IDJH 3FQTB 1ZV5A 3NBNA 1GS8A 2PXYA 4U1MB 1ZY9A 1ROWA 2HVKA 5CBEB 2YRZA 3RLSA 2VDNH 1M1XB 2CZNA 1ZV9A 1UTDA 3L3GB 1X9QA 1RULH 3DI3B 5BJTB 3QQ4B 4MHHI 3UDWC 4L0ZA 4WENB 3WS3B 1YUHB 3JVGC 4WHDA 3O2DL 3DX2A 1CLOL 4U1KB 3QNXB 5C0AB 3AG2B 3T2NH 3C2SA 4M61B 2Q7NA 1FZOB 4PB0L 2DLFL 1KC5L 1NAML 4FKKA 5CINH 1BQHB 3GDCA 2LQRA 2WB7A 3BCDA 2VXQA 4RWHA 3BZ4B 4KNUA 3UAAA 1O9WA 4BFRA 2JI1A 1Q9KB 1HKFA 2VLJB 2DQDL 4PJHB 4FTVD 5I0XA 3D06A 4QGYA 5E08L 2Z65C 2ZWKA 2BIPA 4P59H 2J71A 4PRBA 5D7HA 1PNDA 1NIAA 4PW3A 5IBLC 4OLVH 4ZXBC 4ZODA 5E9DE 2JMRA 3UACA 4G6MH 3SPJA 3C8HA 3QUXA 3FB5A 1MN4A 4XNMB 3X11A 4NC0B 3U0TB 3RI5K 1DJXA 4DVRL 5H4YA 3QQDB 2JCWA 2FBJL 3FUKA 5EIQA 3EJQA 4QOKA 1ZMYA 2GK0B 4KKCD 3SDYL 4I0CC 5IFJA 3PYCA 3UBHA 4E9XA 2Z4QB 2XICA 3D3VE 1WZ1H 1BZ7A 2VDOL 4E9LA 2ZOKA 2D7NA 5I1JL 5B8CA 1D5XB 3CFBA 3O6LH 4OCYL 1K85A 5JW4N 1IKNA 1XF5A 2ZZUT 4OIFA 4HMDA 4P46A 1BJ1H 3IF1A 2ADIA 5FW6A 2OMBA 1AYRA 3DSNB 4UM9A 4WJ5B 4F9PC 5L7XL 2PN5A 2VDKL 3HE6B 2KT6A 5K39B 1RUQH 4CBZA 1T7WA 1KXQA 4JRYB 4LLQA 4ZK8A 4ELKA 2WNKA 5B38B 5T3ZD 1QFWH 3QWOB 4DERA 2VQUA 3DIVA 2CR0A 2CK2A 5D7SH 4PJXB 5EC1A 3EJYD 3VI3F 2HFFB 2HJKA 5IMLB 1QWNA 4Y2DC 3ALWA 2X7LA 3FOLA 1JRHI 3ASNB 4GJTB 3S35H 1PQZA 2XCMC 2FEJA 3MRPA 4MA3A 3UROR 3DRQA 2HKHH 3II1A 5DD1H 5I6XB 3R0MA 2VZVA 1CLOH 2VMJA 1RUAH 3VGDA 3WNPA 4XCNB 2OI9C 2LTQB 4IRSC 4UNVA 3FQYA 4KUZL 2EC9U 5DHVA 2ESVD 1MJJB 4OFIA 5HHQB 4JBSA 4G1MB 2OXHA 4QRPA 4L2LA 4R3SB 5FM5M 2F53E 1HHIB 1AKJB 3C5JA 4PJ8B 2E9JA 2QPEB 4HDIA 2VC2B 1Q0EA 3EFOA 1EAPB 1HC1A 4Y1AE 3EGDB 3BWUF 4DP8X 1CBVH 1F4HA 1JZ3A 3ZLQC 4FS0A 2A74C 2DQGH 1AG6A 3HE7C 4JFXB 4GINA 4X7TA 4NN6B 3GXNA 5BV7B 3IYLW 1QPKA 4ZSOA 4AYID 1FFRA 3SE4A 4B7IA 3AQZA 2D3JA 3FB7B 2EDBA 2ORBH 4ODWB 1RPUA 1GAFL 2BRRL 1CDHA 4XN9A 5SX4H 5FB8A 2DJSA 1ZA3B 3EJUA 5EZOH 4ABQA 2DQHH 2HKFL 2FRGP 4IKKA 3JSSA 1EQWA 3SDXA 1VFMA 3ZN6A 2R4RL 3EDJA 5CD5C 5F6HI 2NY4C 4NKOA 4FXKB 3QNYA 4H0GA 4NYLB 4NRYB 4PV8B 4RDQF 3E38A 3EADA 2UVFA 4HJJL 3ZDZB 2XQYG 3LVEA 4N85A 1PG7X 1VKXA 3HS0B 3JTSA 3G6JB 3SKUD 3UJTH 2YSSA 4PGDA 2LV4A 4CVWA 3FO2A 4KHXH 2DAVA 4WTQA 4QJ5B 1GY1A 1INDH 1MFUA 5DJ8A 5SWSB 4FHKA 1NGZA 5AW2B 5E1HB 1SJVA 1CZ8H 4EEEA 1TMQA 2APFA 2IFGA 2W65A 3RKPA 4O5LL 1C9SA 3B1TA 12E8L 5KUKA 2X53A 4MKTA 7FABL 3AVEA 3B2VH 3NFNB 1B3JA 1PF3A 5J4MA 1GZPB 4FFTA 4O9HL 4TF4A 5GSVA 1KPUA 1NCAH 5B1AB 3B7UX 2ZSVB 3U30B 4N86A 3O4OB 4OJCA 3U4BH 3Q06A 2X38A 4H8HA 4YDMA 4TNWF 1DSYA 1OGAE 4M43L 4WV1B 3HUJA 4JFFE 4KKRA 5D96B 5DK2B 3VW3H 1U2HA 1JZ6A 1RUPL 3KWVA 4DTGL 4HT1L 4XO9A 3K2MC 1A4BA 3HKZA 3TC9A 5IESH 4YGVA 1X6LA 1UH3A 1QI4A 2YPLB 3JWDL 3MV9E 2CO1A 5HTSA 1S9KC 3ISYA 4PJDE 4ZPTA 2VABA 1CD0A 2CIKA 2R69H 4AYBA 3W38A 3ULUC 2WBKA 4JY4A 4MNHB 3V0AC 2RA1A 2XQBH 4L23A 3GJFB 1QLFA 4G8FA 4RLDA 1ZTMA 3KVQA 4G8IA 3D18A 2F1AA 1QWUA 5J56B 2E7LA 3IXAB 3S6CA 1MCSA 4JQXC 2D31B 1XGTB 3K3QA 4JDVB 5F7KC 1JXJA 4LGPB 1TLMA 1ZHBB 2VXSH 2EIZA 1OAZL 3WJLC 3ZZQA 4H88H 5KAQF 4PJXE 4AMKL 2Y1VA 3M86A 4ZJ9A 4B5ZA 3SDAB 5TF0A 1BLNA 4RFEA 1PEZA 2MIZA 5DJCA 3ZDWA 1XF3B 3HKFA 2QMKA 4FQQB 1SDDB 4AKOA 3GXIA 2ADGB 4C57C 3BPCA 1CDGA 3C08H 4P5RA 3PAYA 1OM9A 4R9HA 4GRMB 2F5AH 3WEXB 5AVVB 4HCFA 4NGHL 5SWQB 3ZRCC 2H45A 3QARA 3ATAA 4OF3A 4GI8A 4ANVA 2VN4A 4OIAA 3CFUA 5J0BA 1MW2A 2VQ4A 4AEHL 3DYMA 1SDAB 2YA2A 3PHQB 2F7QA 1SM3L 3D3VB 2XRAH 4MHHG 5BQDA 4XX1G 4TPRH 3O3BB 2Y9RT 4AEFA 3OVUB 4NT6A 4FFWD 2PWEA 3NABH 5D6CA 1AO7A 2F1BA 3AXLA 5T3XD 4ENED 1KCSH 5CP3A 3WXWH 4EI6A 4PVNA 3KJ4C 1LWJA 2YQ3A 3O4LD 3BWZA 3QUZB 1NGWB 3QJFA 5I2IA 1E42A 3NRPA 5J6GA 3FT0A 4B0MM 4HIIB 3S8GB 3APNA 1CF8L 3LPFA 3ULSB 1RK0A 2F0CA 3L81A 5C0AE 3MRLB 4U6VH 5GJTH 3CFJA 4WFFD 3OHMB 3PGDB 2F54A 2R7EA 5IY5B 3C5XA 4CW1A 1XFPA 3BP7A 4BA8A 3HJ0A 4J6RL 3QDME 3JUYA 1ADWA 4NPKA 4GSXA 2R1YA 3P77B 1UXLA 1C12A 1A6TB 1L7TH 3QZWA 1FFQA 2HWZL 1JERA 2HN7B 5LCVH 5A1AA 3JUZA 3FUJA 5BVJB 4FQIH 4NQEA 1ZDSA 4HIJA 3BJLA 2OSWA 4POYA 3F7YA 1PX3A 1GGIH 1WBYB 2IOOA 2IIJA 3QUYC 5KS9E 3BGFB 3UZQB 4FA8A 3IN2A 3F12A 2TAAA 3WUWA 2ICWI 3T0EB 2HH0L 3VGEA 4F1ZA 2B2XH 4Y4FA 2IWGA 2IPUK 3GMMA 4ADGA 1A3ZA 1TT6A 3GJEA 4ETQB 3QC6X 3MX0B 4M7JL 3TJEL 3F04A 4EVNA 2A1WH 1I82A 2PTUA 3MJWA 3CLEL 4JM0A 4G1MA 4FQJL 3V95A 4ONHA 2FSEA 4XVUD 2X9XA 1YNLL 3MLWL 2A9BA 5I6MA 1R3LA 4NUJA 4NS0A 3E8VA 5ECGA 2P43B 5BMFL 2A6JA 4X4XB 1L9SA 3DETD 3KM2A 3KPTA 2MQCA 4P0DA 3QWNA 2X09A 1D6EA 5ADPH 2V2XB 3F64A 2O6PA 3F7QA 5SX4I 5CUSH 1CWVA 4X5WB 5AAMC 5L0QC 3KLLA 4PU2A 2KZKA 4RA3A 5DDHA 4HU2A 5DJAA 4RMWA 4ZT1A 5ACZA 3LRGA 1S78C 3WFDL 4S1QL 1KTLB 4F7EB 1E7UA 4LFHD 5DHVB 3OAZH 3AC0A 1U3HD 5F7NC 5KVDE 1HEJC 3ERXA 2IWEA 4R2GB 1WFIA 5F0JB 5HYQB 4M6NL 4HQQL 4HIXL 1K4CA 2GCYB 1IFRA 2RCSH 4AM0B 3H6AA 2KL6A 2P1YA 2DTSA 2VERA 1SEBB 5E0QA 1FVCB 1KJMB 5B8CB 1WFNA 5CJQL 1A0QH 4P2RB 3BDYH 5C08D 5IEKB 1MQ8A 1HIML 3TO4A 4PRPD 4FXGA 1UXWA 2ZAGA 4PTTA 2WXFA 1D2PA 3ARED 3CFQA 4BCXA 4DEWA 2CKBH 3QUYB 4N2OA 3ULVD 2D7MA 3IJSB 4O2FA 2FEDD 3DBXA 5A43C 3R1GH 3IGKA 1MPAH 2D0HA 1I31A 1CT8A 1ILSA 4Y88A 2OXGA 1E0OB 3T8MA 4BKLA 1E5UI 4MAYB 4EUPA 2GHZA 1U58B 1N12A 4XVSL 1FVEA 1RZIA 4AQAB 2BPBA 1G7LA 5D1ZC 4ODSL 1IL1B 4NQCD 3ZE1E 4B5EA 4DH2A 1T1YB 5D7LB 2XZZA 3QFJB 4HBCH 4P57A 3D1MC 2ED6A 1WAAE 1DEEB 3OBAA 3QPXL 2KQNA 4WJKB 2Z31B 3WN5B 2PPDA 4AE0A 1C8PA 4AVHA 3ARRA 4JN1H 4JQXA 1EERB 1DJZA 4XMLH 1UFUA 1HH9B 3RYMA 1X5GA 3IFPA 4UYQA 2WWMC 5GGQL 4F5CA 3BSZH 5C0BB 2FB4H 3IMVA 1H8NA 3O11B 2V8MA 3NP3A 2HWZH 3W5MA 1DJHA 3OXRA 4NO3B 5C0CA 5I8CA 1FLTX 1FLRL 4YNYB 4CW1B 1GC1L 3GSXA 3VGAC 1FBIH 3U82B 4YAQA 1F3RB 5T1MA 3DGGB 4DEPB 3BSGA 4N8UA 4U1KA 1OF2B 4RESB 3OD3A 1NMBL 3STLA 3CVIL 3QI9B 2CBOA 4Q2ZB 1SOKA 2MQGA 3MNVA 2OYMA 4WI3A 3UYRH 3QDMA 1OP4A 1WUNT 1OSZA 1E6OL 4ELMB 2YMOA 1M7DA 4YDIL 1MLBA 4A7UA 3JWNH 3DMMB 4PJBF 4LLMA 1R5VB 2GTZB 2VDRH 4PB0H 1D7DA 3FO2B 3IDGB 4TQEL 5EU7C 1XF4A 4YN3A 2YSTA 2XG5A 1MVFA 5I9QC 5DVPA 1LDSA 1UD4A 1XD0A 4NQCB 2Y3NA 5JHMA 4X99B 2F7IA 4POZC 1HQ4B 2GK2A 2XPGB 4HEMA 4XO5A 3FB6A 1ZTXH 4AVIA 2GY7B 3BZEA 4NO5B 1TSRA 3KLHC 4EZJA 2ZYHA 3I85A 5A2IH 2ZG1A 3HBPA 1AIFA 3PP3H 3FZUC 4CNIB 3C9NB 3OKLA 4JPSA 4DN4H 4XC3H 5C0IA 4OI8A 1EEZB 4UT6L 3V0WH 3GS7A 4IBQA 4UQ9A 4RMUA 2X6CA 4PJ7B 2VZTA 1NCJA 3EOAA 2H3XC 3BP6B 3UAJA 1H6UA 2EEFA 3QG7L 4LSUH 4X8JA 3FK3A 4KK6C 2NDGA 5GGSY 1JRHL 1XGUA 3TL5A 3U9PL 4LOVA 5B3SB 3H85A 3NRFA 1EFXB 2VTFA 3P4MB 4B3VA 5F1IB 4DP7X 1EPFA 3DIFA 4JO1L 1JF5A 3OKMA 4NAJA 3G6DL 1DCEA 4NZJA 1C5CH 4BFIB 2MH4A 3QQXA 4G8FB 5DS8B 4OM1H 4R7DA 1VFOA 5E1IA 2K4AA 5C0NC 3APMA 1G6RA 4IRJC 5E5RB 3CX5K 1P2CB 4JFQA 1MFVA 2C9AA 2F53A 2WO2B 2AV1B 2OJEB 4KDTA 4U1GB 5H94A 4E0RB 1S7QB 2AJVH 5ANMB 3UPRB 4FFWC 1JFQL 1N0XL 2ICCA 4AMWA 3MA9L 4JRFA 3RUGE 1QSED 4S1DD 3NACH 5E4OA 4LP8A 5EZOL 4ZUUA 4JZOA 1U4FA 2YRPA 2WUCL 1I7UA 3HC4H 5DFWH 3QG7H 3T6VA 1HZKA 1S7SA 4JO2H 1L6XA 2EIEA 2O5ZL 3VFUB 1WDAA 1PAMA 4ZX3A 3QCUH 3UEQA 3CD4A 5IJBC 2W0LA 2ZXBA 3R8QA 3QDGE 1NINA 3WJMA 3KPSE 4XPGL 3VA2C 5HHME 5HGBB 3U4EB 4PUBH 1L9PA 5IVOA 4K7PY 4PRHE 4W9HC 4N6RB 3ZHLA 1TCRB 3TVMC 1AMXA 4AJYV 3FS9A 3ABMB 4UF7C 3E2HB 3RJOA 4J8RB 2C3GA 2EIZB 1N26A 1H6EA 3ML9A 5CCKH 3CDGA 5B8CC 5FGRA 3NJNA 1VESA 3IFLL 4RQQB 2IWFA 4NM4L 5AUMA 1J11A 1GS6X 4C8XA 2E7HA 4AL8C 1KJ3H 3KR3H 4HUNB 4U31A 1J5CA 1FV1A 2EINB 4TVPD 3WDJA 2M2DA 2ERJB 5BVPH 1Z1WA 3WXWL 2O5XH 1SBSL 4DKFH 3BPOB 3BVXA 4XBGB 3TT1L 5LDUA 1SYSB 3MRNA 2MOVA 3U4EA 2CDEB 4HJIA 2QPSA 3FONA 1C1EL 1JV2A 3C6LB 5C9KA 4PJ8C 1IC0A 1CS6A 4JKKA 5E9NA 5HPOA 2GB2A 3IDXL 2QR0B 2A2QT 2OW7A 4NJAL 4XHJC 5C0ND 4C59B 4Z7OF 5I1IL 4WUKH 4FP8L 1JGEA 4ODWA 4K94L 4MNGA 4XZ4A 1ZJAA 4BZYA 3QNFA 3VFNA 4D0CA 3RX5A 1PNCA 2DB8A 2OR7A 2JI2A 1LD9B 5D70L 1E27A 1LILA 4XVUC 1D9KD 3GHBH 1FUNA 4RGOH 3VTAA 2ZP0T 2DMGA 3D25B 1EAPA 3PFUA 1OLZA 1BG9A 4JE0A 2AW2A 3VWJB 2DKMA 2WTRB 3FC8A 1KCSL 4LT7A 1RMFL 8CGTA 4N0YH 4F7MA 2PXYB 2XT1B 3GBLA 1GGBH 3NYKA 3ENEA 1FCGA 2NUPA 2VR8A 5F0MB 2VQTA 4L4TD 4CAGA 4EXPX 3VXUB 2YGQA 5E4AA 2DQEL 3R0NA 3PCYA 3VB8A 4AV5A 1F1AA 4JM2B 1N7ML 5F6IB 1KPVA 5CCJA 5JMOC 3QJHA 4IOFD 1EUUA 4JY5H 1A7PH 2FTAA 4Z76A 2R29L 4RGNC 4K3JL 3CH1B 4X6DB 2PWHA 3IWUA 2FJFB 3BDYL 4D94A 4JM2F 2V4LA 3IS0X 3L5JA 3LN4B 3UIYA 2BHFA 5ID1A 1VGEL 3V7AE 5L4JA 3BESR 1ACYH 3C5SA 4PW9A 2XX1A 3OR6B 4AQOA 1QRND 2AJVL 2J8UA 3HLAA 4MVBC 3F2LA 4ABVA 2VXSL 4PIRF 2ENJA 1E6JL 3ET9F 5AZ2H 2X70A 2WLLA 3WE1A 1FJ1B 1JGLL 2L7QA 3PWUB 2R1WA 2J5WA 3UTOA 1RJLA 3MBWA 1TFHA 1OF2A 1VHPA 1WBXA 4OUOA 2NY2C 1OARL 3WCYA 1MCRA 3EFOB 4NIYE 4W68A 5BZDA 1LO4L 1PY9A 3IDIA 1SXBA 4R0LB 1RHHB 4XGZA 1G5GA 4ADJA 2IBBA 2H8PA 2AGJL 3CCHB 3CUPB 4F2MB 1TO5A 3EJZC 2EZ0D 1OTSD 2FJHA 2W94A 2BHUA 4X6CB 1AJ7H 3KVPA 2WINB 1P1ZA 3L5IA 4CC4C 3MRFA 1NAMB 2BJMH 5DMYA 2BVYA 4QRUA 3RURA 1G1YA 2QQKL 3OL2A 3QS2A 1QRNE 4F9LC 2YAOA 1X5IA 5L7XH 2PPCA 3PU7A 2UWEB 1QQDB 4RMVA 3OSVA 5HDQH 1XCWA 3AQXA 4L37B 5FM5O 1VZGA 2C5DC 3DX1A 3FU3A 2BIHA 3H9SA 4PRHA 5MENB 3R4DA 4ZXBB 4L3EA 3KLDA 2O61B 3ULVC 2XWXA 2EAEA 3QXAB 1R6VA 1QWHA 3NJMA 4KO6A 4QHNA 2I27N 4ZQTA 2KC0A 3LCYA 1OEZW 2UWEF 3N0AA 3VX1A 4L4JA 4Q9QL 3P30L 4PJHF 2EQDA 5FLVA 1A1OA 3BT2H 3VXSB 3IJYB 4Z6AT 5EEVA 1O9ZA 3ZRSA 4OIIL 1NFDA 1PY0A 5GGRB 2X3AA 4YHML 4IMKC 1PLCA 4QHMA 4JFED 4S1DC 2TSBA 4NRXB 3GI9H 1YEHH 5AVQB 1I9EA 2MTAA 1SF5A 4Y4HA 1GKEA 4OLEA 4X80H 5LGHL 3QYMA 1CDUA 4JG5A 3WTVA 3QUZC 2ZYRA 2AEPH 3H9SB 2OA9A 2IH8A 2E27H 4FZ8L 3FUEA 1MCJA 4ZTOL 3KG5A 4WFEE 1NMCC 5ISZA 2Z4TA 3CFKA 3DJRA 4LLWB 5HVWA 3MLXL 4WEUD 5E8NB 4FFVC 3NOIA 3IDNA 3D34A 2PTVA 4UT6H 3V0WL 3BH4A 1BQSA 4LVNB 5C0BD 4QAWA 3OZKA 2IF7A 1AH1A 2P7TB 4MBRA 4XOAA 3DC0A 5HHOE 1FVDA 4Y5VC 2GEEA 1R47A 2AABL 3K71B 4IEFB 3L3GA 1DQVA 3FCUB 4PJXF 4Y89A 2Z31D 5AOIA 4N0YL 3VFOA 3BPOC 1HI6B 3HNTH 4FLOA 4QT5B 3C87A 1L9RA 3FUMA 3D05A 4U6HB 5IFAH 4G6JH 3OAUL 5AW9B 1BFVH 2VM9A 2NYKA 3MV7B 2OJ1A 3FQTA 4PY8J 4X5PA 4ZFZA 5JXEC 4ZMOA 3NSYA 4OSUL 3WIFB 1L7IL 4FQ2H 1NEUA 2GUOB 4KJQD 3V9EA 1YQVL 5ESAA 1IEBB 1MREL 5HDBE 4UZGA 1YJDL 4X4YB 5EO1B 1SXNA 1RIUL 2J57A 1OAXH 2XNAA 2ZSVA 2DLTA 5D2NE 5HXMA 1NUFA 1YPZF 3TASA 3NA9H 2D9QB 3BUTA 3TCTA 5FLUA 5EN2A 2XZAH 1AGFB 1DVTA 4KUCF 4XX1E 4PRPB 2J1XA 1QZ1A 3QDGD 5C0JA 1ZHNB 4OCYH 2PO6A 5DQ9A 5AKRA 3FSVA 5DJ2B 4YDNA 4H8PA 4AQ1C 3Q6GL 3RRQA 2BY3A 1YPZB 2PCPA 2KDYA 3MLRL 4KROD 3PHOB 4R0LA 4OD3L 4ZTOH 2Y7SA 1VIWA 1DSWA 1Z9NA 1JRHH 1S5HA 1XGRB 2WUBL 4WI8A 4XWOD 5I26A 4N0CD 1U3HB 2YZ1A 4ZMTA 1I8UA 3QJHB 3U2JA 3X12A 1TUPA 2J6EH 1NANH 4XN1A 4ACPA 3LKOA 2JQMA 1IT9L 2QDVA 3DVNB 2Y7QB 2GKIA 2QFPA 1CDBA 1J8HE 4JX0A 3EHBD 1J1XH 4Z9KB 1OGAA 1N59B 3GC3A 4FTVB 1TZHA 4G3YH 2J1WA 3PHSA 4JFYA 1CD1B 4PW4A 3KWUA 5I5MA 2WLZA 2XTJE 3T6ZA 4AQ8C 5E6YA 5C0FA 3QWQB 2JKWA 2LU5A 2XWJA 2UXTA 3BOVA 3L4CA 1A7OH 5KYXB 2NTFA 4ELMA 4MDJA 3SOTA 1SXZA 5I1DA 4BGDA 4A7TA 2O5NA 1MH5B 4JFDE 2FHFA 3K4AA 3MYJB 2X44D 3R7QA 5KYWA 4LIQH 5LAXB 4XCNA 1LWHA 2PTTA 1KELL 5JHDE 2BWQA 4WV1C 5D96C 3HMXA 2WQVA 1D5BA 1EGJA 2VDLH 2L7JA 1DQKA 5AFAA 1FNHA 2J88H 5L2KB 3MLSL 4XHJD 1A7RH 7PCYA 3MREB 1I9RH 4CGUB 3LQAC 5H37A 5TDNB 1Y1DA 3WNIA 4JO4H 4WEBL 3DROA 1YY9C 5GRYA 2BOBB 4YDVA 4X7DC 1FNLA 1CICD 1UM6L 2Z1PA 1HL8A 1AO7B 3AXLB 3EDEA 3PGCB 2PP9A 4QD2E 5LCVA 4OR1A 1IFHL 1DVFA 1N5AB 1YEEH 4WK0B 1ZTXL 3WU1A 3CSGA 5HVFB 1OANA 1IKOP 2PP8A 4RQQA 4WO4D 1EVTC 1QLEH 5C2UB 3TURA 3GTNA 2R2HB 3O3EA 4QTHB 3ZR6A 5F88A 3DO7B 2EKSA 2I69A 4YHZL 1ZHBA 4X9HA 1DEEA 4N3TA 3BP5B 4XP4L 2UXVA 1RSFA 1KXTA 3IS1X 4K3DH 4ZUWB 4WCYH 1U8IB 3CZJA 5DRXA 2AJXH 5DK3A 3VXRD 1FFPA 3TESA 2P5EB 2J88L 4JY5L 4LFHG 5IG7B 1SDDA 4KNTA 4MAYA 4EUPB 5DQDL 5FC9A 4TVPE 3OMIB 4IU2B 1A66A 1MDTA 2PKDA 4WJ5A 3VI3E 4FNLH 4DGVL 1E4HA 2V2TB 1FNGA 1LQSR 1XF5B 4L1SA 3G6DH 3H9HB 4UDTB 5EU6B 4HIXH 1R3HA 1UKTA 3QHTC 3GIVA 4PJGA 4L48A 3BZFA 2K7PA 1Q1PA 4B95C 1IFHH 4GRWB 1R4XA 4XX5A 5D7EA 4MD4B 4BSJA 2X4OA 2YAQA 1CE6A 3AQDA 1HHJA 1KTDA 3EJSA 3L3IA 1M9WA 2IG2L 4HWBA 4PG2C 4UTCA 5DO8A 1EZVX 1FI8C 3WENA 1ID2A 1FN4B 4UANA 3ARGA 3VH8B 5D70H 4U1LA 1MZYA 4JJ5B 4B3EA 3K46A 4U2ZA 3G5VB 2ZF9A 4CVZB 3OHXA 3OLGA 4A7QA 4KUZH 3FOMA 3FU7A 1F4AA 4KU1A 4ZS7H 2VDML 1WHOA 2VSCA 1KIRB 3RVVD 4P5TC 5ES4B 2WOBA 2CDFB 4J3SA 3QT2A 2C7UA 3QO0A 4FQ2L 4G1EB 1IBGL 2KLSA 4APQC 2CCWA 5GJSL 2BW5A 3CC1A 4FRWA 5MERA 4K5OA 5KTEL 3DUHA 1NBVL 2WKGA 5DYOA 4GXVH 4J4PC 5IOPA 3LS4L 2K0RA 1MXGA 1KB5L 3EOBB 3VXTB 3L1OH 2DJ4A 5FCUL 1XO8A 1OM3H 4F9LA 4ZAKC 2JF1A 3F7RA 3TEZA 4CC0A 3U0PA 4HS8L 4S1RH 2Z92A 5CCKL 3FN3A 3Q8CA 4OU3A 3D33A 4ZS7L 1ZLEA 1ASPA 2NY5H 3DA0A 4D2NA 3D4ZA 2GVYA 3SPVB 2W92A 4CU7A 2YD9A 4TUJB 2YPVL 2YIHA 3KXFB 1MI5E 1QSZA 1N59A 4FTVA 5EZIH 3LRLA 3EYSH 2N7AA 4BK4A 4HOZA 2HSIA 4MZRA 3B9KD 5K33A 2EE9A 4H4NA 5T3ZH 3SD5A 4HT1H 3ZGIA 2YXFA 3MRIA 2VXTL 1X6NA 2Y4SA 2PWDA 1KGXA 1JGDB 2CA4A 4HH9A 5FYJD 2E7LC 3N85H 5JXEA 4I0PD 1KN2H 2O93L 1OHZA 1JPTH 2XRAL 3BEVA 4LHUB 1NOAA 4Z7VE 1UZ8A 1Q94A 5IJKC 1EBPA 3LZNA 3D4YA 1EDHA 4WW2C 3TO4D 4WIQA 4TULH 1J12A 2Z92B 4N6QA 5JQ6H 5K9JL 3RWDB 5IREA 5DQ9B 3W9EB 5JXAL 5TQ2H 2Y2TA 4P3CL 4ERSH 2UZXA 2CPUA 4Z7UB 4ANKA 1SF3A 2FWOA 1CTOA 3AACA 3VFTA 4YSSA 4E9TA 3T2NL 5C97A 4W6XB 4X6FA 2FQEA 3O3DB 4KFMA 5K59F 3KJ6H 3TA3C 4HPYH 3O45B 5CD3B 5BNXD 3SBRA 3ZYOA 2NX5A 4GI6A 4UIKH 1IAMA 1TPXB 4EDXB 5D2NC 4OUUB 5C3IA 3R8BB 3EYQC 1D5MA 1CFVH 1CLCA 3V79C 4KRPC 4NXKA 3VFRB 1QPPA 1UM6H 1OALA 1QLRB 4JRYA 5E1GA 5HY9B 4KV5E 1JXFA 4CJ0A 2J7LA 4QRTB 1HNGA 1RPQA 1U95A 2QBWA 5AVRB 5E8OB 3JV4B 1OSZB 1T03H 1AC6A 1T83A 3N91A 2C34A 4YHIB 2APTA 3LSOA 3ROLB 2GAZB 5JIDA 1FGNH 4DP1X 3CVHL 1N4XL 5TE7L 3V4UL 2W9DH 2LE9A 2ZPKH 3VTTA 3U0TA 1BIIB 2E7DA 5C0RH 3ARGB 3VH8A 1JZ8A 3DV4B 3U4BL 3GBMH 4NQDE 3MOAL 3CFKB 3P4NA 3GSNH 4MD4A 5JIIA 3FFCB 5D7LA 1UG9A 5AVYB 3UYPB 4D0DB 4YQXH 5DJCB 4OZIF 1G7LB 4ZX6A 2X6VA 1D5XA 1E5ZA 1UT9A 2WOYA 3CFBB 3UPAA 5J9PA 1U58A 1UWGH 3SDXF 3APCA 1HILA 4U3SA 5C0CE 2R9HC 1ZLSL 1M2VB 4QTFA 3RGBA 2YD4A 1YDPA 3JBG7 3UYRL 1VGEH 4CC4A 3DXAE 3EZJB 3QNXA 4OD3H 2EE6A 3GRWL 3VFGH 2B0SL 4CMHB 1BFOB 1E4JA 5IQLA 4YX2H 2XWTB 3JZ7A 4KZCA 2N1KA 4I1PA 4C4KO 1P9MA 4JE4B 2VKWA 1Q9KA 2VLJA 1UQSA 4OKDA 2B15A 1XMWA 3RX7A 4GOSA 3WEAA 4KJWD 4RFNB 1GW6A 4JFDA 3G9AB 3EHBC 1TJGL 1BAFL 4IRJB 1I3UA 2IPUG 1ZWIA 1P4BH 3IJSA 5HYJE 2CMRH 3IDJB 4PRNB 5J6HA 3LXBA 4L8SC 1MCNA 3SZ6A 4FA6A 1MF2H 2BERA 4L8SA 3P4MA 5I1KH 1YMME 3KS0J 2VISB 2ROXA 4ZMVA 4EI0A 5KBKA 1M1XA 3POHA 3SDYH 3SIKA 2XVGA 5J1SC 4Y16C 5T33L 3OG6B 5F7MC 3FQRB 3TBYA 3US0A 2G3NA 2WHVA 3QULA 4KKQA 1HOCA 4XVJH 4B9PA 2MKWA 4Y2OB 5EOTA 4BFEA 2B14A 5LJYH 1YEKH 4FEIA 2WV3A 3C2AH 3CPUA 4KY1H 3AUVA 4FQLL 4JZJB 2V9RA 3OWRA 3PJSB 1CIDA 3Q5YA 5DLLA 1WBXB 2CO4A 4XNUL 2HN7A 4X99A 2DM4A 4PTUA 4WI6A 5AW6B 3ZTNL 2O5YH 5EO9A 4BFOA 3WUWB 3ZKND 1RZKC 3ARGD 2Y1YA 2FWOB 4JAMA 3ZKSD 1FYTE 2XN0A 4R84A 1S5HB 2ERJC 1C5BL 4ZW7A 4BSWB 3ZK0A 1NBYA 1INEL 4P23D 2BZCA 3JWOL 1RSYA 4EPSA 1A21A 6FABL 1PLGH 4M5YH 5FO7A 5DI8A 2DQEH 3P0VL 3VFMA 4EKJA 4F33A 4I7ZC 4UTBA 4YO0B 2AJSH 1XIWA 4KKZA 1G7IB 1IGYB 2P5WB 1KIUB 4OZHB 3N1MC 3TNNB 3ZUNC 3OM3B 3P1VA 4TNWK 1XXFC 5EUOF 4RGNE 1BD2E 1O6VA 4YSCA 4HIPA 4KVNL 2N1TE 1HWHB 4CDHA 1AZRA 5CJOL 4O51B 2CUHA 4JPKL 5IMOA 1MF2L 2X4QB 1CL7L 3RHWK 4CN6A 3THMH 3QXDA 2W91A 1QRKA 4YK4B 5C3LD 2DQTH 4OZHF 4PV1C 3LD8C 3ZVVA 1P84K 3FO1B 2QGEA 3BQUB 1MIEH 3NJKA 1MIMH 2H1PL 5ICYB 4QO1B 3QEQE 2OZ4L 3U7YL 1WA1X 4NENB 1GYWA 4OZGA 5KSAC 5HYFA 1DUZB 4NCC2 4GKLA 1D5ZA 2NY6B 5FKAB 3EOBA 4U3CA 3RVVC 2BJML 3VXTA 2DQIH 2F58H 4NT6B 4F3FA 3VG9B 1W0WB 2BNQB 2DDQH 4MNGB 5C92A 1DQML 1DVSA 1Z2KA 4FI8A 2K6ZA 3ORJA 4UWQB 2AK1L 3CTTA 4AEIL 3QO1B 2XACC 5IVNA 5IB2A 4Y4FD 1Q9LB 5DUBA 1A6PA 1HEZB 1YMHA 4P5TD 1RZPA 3I9PA 5EU6A 5DJDB 1MG2C 4IQHA 1QD0A 5B4MD 3CLFL 4PS8A 2JELL 3FDWA 1WC7A 5DWPA 2K6WA 1Z5YD 3SGDI 5K9OA 1QSVA 2O30A 4WW2A 3UGUA 1YEFL 3QXTA 2IAMC 2LU3A 2YQ2A 4HF5L 2MPVA 4WFHD 5K9KB 2F7PA 2OL3H 4TNEA 2ZCZA 1HXMB 1EEQA 2VSKB 3KPMA 3CU7A 1E9OB 4R7NA 3VM7A 3RVXC 3C08L 3I6GB 2FHCA 2FJGB 3D39B 3BVWA 3GSOB 5DQJB 4UDTA 2MQ3A 4XPBH 4NP4H 5TD4A 1AZCA 4IHOB 2A4ZA 1RVFH 4BK8A 1KELH 4DAGL 2WYZA 4YXKH 1G4RA 3ELAT 3FO0L 4WSKA 5I1CL 1LE5B 4X4MA 35C8L 2PLTA 3GUTB 2J8OA 3V0VA 3PGCA 2VABB 2A0LC 1BZ8A 4Y1AD 1ZS2A 3BD4A 4XO3A 2A83B 4A55A 4MDRA 1ODAA 1WICA 2P28B 2ZIDA 3CMGA 3T77A 4ZW3A 5JXAH 3VWKD 1MDAA 1IQDB 5LN8A 4PJ6A 8FABB 5I19L 3FRUA 3QWRD 2DLEA 1IC7L 2P8PB 3F7LA 5DC2A 3T6XA 1NCHA 1X4YA 3X3FH 4S1SH 3UPRA 3TO4C 4K0OA 1G7QA 1R3LB 2IBGA 4TVUA 3OJDB 1G7JA 4JGUA 4ZDHA 5I9QB 1TYRA 4YDVB 3SYOA 4JANA 4BHUI 3HR5B 1VACB 3FCBA 2HVKB 1J5DA 5JORB 4TUKL 3GM0A 1U8MB 4P5TA 3Q13A 3C6SB 1T7XA 3KPRD 1XH2A 2V5SA 3E1ZA 4F2MA 3EFFA 4PGEA 5DXWA 2D7PA 1NCDH 1XAUA 1CR9H 2ZCHL 3IJEA 4NJ9H 5ESQB 2I7OA 1F58H 5LBGA 2QPDB 1WBYA 3NCMA 3QNYB 1RJZB 4PG2A 2HPTA 4PY8I 2VZOA 4GQQA 4X6FB 2C1OA 2AK4E 4XNQB 2CR6A 4ESKA 5HGDB 4PWFA 4HUWA 4GG6E 5ID1B 3P30H 2HYMA 4M4RB 4PB9L 1FDLL 1I85A 5C0IB 3GFUA 1A3RL 3FB7A 3Q1SL 3RWCB 3GMLB 3P0YH 3VXME 3EFFB 1KC5H 1NAMH 2G9KA 3ECWA 4CNIA 4NZTH 2VM3A 1VADB 3KH4A 3C6SA 4IU3A 2ZCKH 4JO2L 3HHSA 3RWHA 2VMCA 1WFUA 4K2UH 2DQJL 1DL7L 4NDMA 5JQHC 2NCMA 3DXAA 4JFEB 3S3DB 4MJID 5D1QD 4LVNC 4DGIH 3NUKA 4JFFD 1U33A 3D7PA 3APDA 5IBLD 3CDFA 4RMBA 1PBYA 5E6SB 4AYGA 3K5SA 2EUZA 1RIHH 1IEBA 2MHAB 4WI0B 5TTRA 4WGWB 3BW9B 4X7TB 2R83A 2Z35B 5EU7E 2IQ9L 2R0WH 3DDFA 4PJ5A 3ASOB 1JP5A 3FU6A 3WELA 4Q9QH 1RMFH 3RP1A 4QXGH 5KSAB 5HBBA 4D9RE 3U7YH 3KPNB 2XQ0A 5IMMA 1LLAA 4HLEA 1B6DA 3TFKD 5FFLA 1TCMA 4PRDA 1M3IA 3IU3A 1J1PH 1BMGA 4PJAF 3BPNC 1HSBA 4NOFA 3N44F 3LNDA 4QOKE 3OKYA 1YA5A 2WQAA 3I75B 4UT9A 5IOPB 3VW3L 9CGTA 1ZXKA 4PWHA 1XSJA 3FOLB 3AWFA 3FPXA 3HE6A 4ONFL 3RILA 3VNZA 3UJIH 1JNLH 4YNYA 5JR1H 3HMXH 1RLBA 4PGCB 1ZGLM 2WBXA 4NZRL 5ALBL 2CD0A 4GKNB 5EIIA 3QEQD 3F7KA 3MRJA 4FFYH 2Q8AL 2NPLX 5HI5D 4U3XA 4A7SA 3QIBD 5LKNA 1N19A 1IGFH 3M1BA 5ERWB 2JIXD 2G3XA 4L8DB 1I9JH 2FVNA 3V4VB 3NFSL 1CFBA 4AQ1B 3OHXB 5IIEB 1AC0A 4FHJA 5TE7H 4LCCB 3V4UH 5IW1A 3NPSC 4XR8C 1ECZA 1FN4A 4AOFA 1HJBC 5JDJA 1JZEA 1N0XH 4FABH 4Y8DC 3ESPA 2XQYA 4PRBB 4FZEL 3EOYG 2WYIA 3DXAD 2UY7A 1Q72L 4ODXA 4R5XA 3RJDA 4IRJD 1N0LB 4U1NB 2B1AH 2MWCA 5I75B 1USQA 3X11B 4ZBJA 1MY7A 1B6UA 2HFTA 3SOBH 5JR1L 2BINA 3W2DL 3RGVC 2PO6C 4UB0H 3O9WD 3N85L 4I3SH 5E8DH 1FIEA 5AAMA 1Y7VA 3T8XB 4GO6B 5I76A 2R4SH 3IJ9A 4PJEE 2VR5A 3CLEH 2ZUWA 2BIIA 3T1FB 2K1MA 2O6CA 1F6LL 1NEPA 3TEUA 2EDWA 2H6OA 3GTTA 5CXPA 4G8IB 3T9WA 4WEMB 5TF1L 1YEJL 4F37F 4NFCA 3OKEA 3HCVB 4HX1B 1IGCH 4FQPA 4RWYL 3BKCH 1V55B 3BLBA 4YHPA 1JK8A 1CI3M 1XB3A 3C12A 2WKOA 4L4TB 1I3RB 4ZZKA 1T04B 5FYJE 1R5WB 3GXMA 4MYWB 3P4LA 4GBXC 5FK9A 4P05A 2WXOA 3V6ZB 3VQMA 4Y16D 4NZUL 1BJMA 3RWEB 1CXLA 3LNHA 1NBVH 1PYWB 1INQA 3K4ZA 3B4NA 4LIQE 2HX8A 1IQWH 5FO8B 4MCZB 3FH8A 4GLRH 2XA8H 1WWCA 3E3QC 1CGUA 1I85C 3LXUX 5BZXA 5KZCD 1WYJA 4K5NA 3PWPD 5KOMC 1GGYA 1PGRB 4BQBA 4XRCA 1O7DC 4ZSOE 4POUB 2WXKA 3K4DA 4F24A 4A2DA 5BRZE 5DSCB 1VJSA 4L8CA 4AH2B 1GGBL 3WL9B 4I3GA 2WLNA 4RSVA 5DUPH 1IILE 1TU2A 4FJZA 1ZIBA 3EW3B 1RJLB 4LPTA 2BSCA 1P53A 2H3NB 2X1OA 4LPXA 4Y7OC 3Q0HA 3PWUA 4FLRA 4M5SA 2L7UA 4NQEB 3IGLA 2MCMA 2AVFA 4WNJA 2IAMD 3BDBA 1AQDA 3HMWH 3QIWB 1KTBA 3G5WA 3RFZA 4AEHH 3LKRB 5JQ6L 2X4PB 2UUDK 3MR9B 2CLRA 2VXUL 5FGBA 3QEHA 4A63A 4DUWA 4LCIL 2HXAA 3S3JA 5ADOH 4Y4KC 2G4GA 2CO7B 3TYFB 4ZZFA 2VN7A 4PD4K 5LXVA 5KSBE 3SJVA 3LKPB 4LHUD 4OJFH 3L3OA 2AZUA 5DZNA 4I0PB 1EAOA 2WCPA 5CLTA 5BZWB 2AXFA 2CGRL 2CRYA 2X7LB 3GEFA 3GMNB 4NZUH 2APSA 3BN3B 4M5ZH 5GGTA 4ADIA 4JRLA 1HZHL 4LOUC 1G6RH 3P11L 1AQHA 1TIUA 5GJSH 2GUOA 4OAWB 4ZRGA 1U93A 1IB5A 2QHRH 1RZJC 2QR0A 4B53A 1BOGA 4HYTB 1ETB1 3CDCA 4X7FC 4ZQKA 5T3XE 1MLCA 1SJEA 3MJ8A 1DQDL 3OXRB 4HZLB 4NO3A 3BSZA 1X5JA 3BVNB 3V5HB 4G11A 3WTWA 1OM3L 1MFCH 3KPRE 3QRLA 3QZLA 3IEAA 3QEGL 3O3BA 2OCCB 4AIZA 3BVVA 1XF2B 1PZ2A 5HDOA 4DCQA 1A3LH 2E9BA 3GK8L 1L0PA 3SDAC 2GTWB 5JHAA 4OCXL 2AJ3A 1EZVY 4XMXA 5E2VH 3J2PA 4CMHC 3KW8A 5C09B 1RZIB 2YKLH 1NKRA 4OQTL 5HDLA 3RA7H 4JL1A 1JZFA 3SKNA 4RMTA 4FERA 1HINL 1Q38A 3NK3A 3D69A 1DO5A 4HD5A 4MCNA 4YGAB 3VAEA 2XZCL 3POCA 1CUOA 3F6IA 2JK5B 5E2WH 1J9RA 3HZVA 2CHXA 3MNWB 1YEFH 4XMPL 1XHHA 2V17L 3IKCA 5JIQA 1MCEA 4CSZA 1KFGA 3WFZA 1IKNC 5C6PB 3F83A 2DQHL 2HKFH 3FTGA 4G59C 4LCCA 4MZIA 4ZUSB 3VI4B 3ZE0E 4X5RA 5IM7B 3MLWH 4W4OA 1B9ZA 4UNUA 4GT0A 3X1BA 1YCSA 2YEVB 5F0LB 3SE8H 4K3EL 4WHYG 1X5AA 1XSKA 1BM3H 1P4LA 3IETA 1KBPA 3OC8A 3N43B 4Y19A 1SPDA 3QZBA 4IGBD 2C4FU 4RDBA 4D0BB 2YLKA 4XBEL 4ZX5A 3I84A 2Z7UA 4N2EA 4LNVA 1XL6A 3KHQA 2IMMA 1J1OL 2WMPA 2GBVA 1P7QA 2CDGA 2UZXB 1DVFD 1IT9H 5I16B 3VRIB 3GS0A 3S8WA 1DE4B 4I13B 5AOKA 5SWZE 4YHZH 3M46A 1DQLL 4NPYB 2H26B 4DQOL 2Q20A 1OXYA 4PRAA 4LSDA 4IBYA 4U7MA 2PR4L 3MZTA 3I2CH 1YNLH 4EUPH 4F2EA 4XNZC 1DSFL 3ZIMA 4Y9FA 5H37H 1UOWA 3ETTA 1QATA 1M6OA 3CFDB 2ZG3A 1GVIA 2F7RA 1NJ9B 4X4XA 5CO1A 2W65B 4BZ1A 1XIWC 5LGKA 1GS7A 4KH2A 4K15A 5KWYC 2JKXA 4A37A 1AQ8A 4WKZB 1NGZB 2WLKA 3BW9A 4HIQA 2FSEB 4MTMA 1WS8A 2EIKB 3HI1B 2GJPA 2VXQH 4FQXD 4L8BA 3UO8B 3VXMD 1EHXA 3L16A 4XNQA 1EEUA 4JZNA 5L2KD 4XZUA 1TQSA 5DWUL 1M3JA 3WS6A 2CO6B 1BVLA 5DHVH 2F19H 2J21A 2ENSA 3FU5A 3LHPH 1A1NB 4PRAB 1BPLB 4N87A 4PJDF 4HCIA 3S35L 1ECYA 2QADB 2I07A 2FIRT 4IRSA 4Z7QB 4RX4D 5AL8A 1EHNA 3VXPB 2WXHA 3UAFA 4TTGA 4PLOB 4PB9H 1T0NA 3P02A 4X4ME 4YHOL 4P2OD 5FAAA 1AYOA 4FD0A 4I48B 3C5SB 3CZKA 4MAYD 3QRGL 3UABA 1C16B 3DUUB 1HAUA 1UKSA 5CGYC 3KE0A 3P2BA 1L3WA 1WGOA 5BQ7A 3U9UA 1IBGH 3IJ8A 4C4BA 4RFNC 4Z7QF 5IB3B 3U0PB 3EHBB 2CLVA 3BP7B 5GGQH 3VG9C 3IFOB 5E99L 4ZMZA 4RNRA 1AE6H 5JOPD 4ZFQA 1IAOA 1J0JA 4NHCH 3VRLE 1ZA6B 4K7FB 2WXGA 1G84A 3QCTL 5FA4B 4FI6A 4NNXA 3L54A 2JH2A 3BO8B 2AJZA 2FGZA 1NLDL 2CM5A 1EFXD 1N70A 2KLTA 4C56E 1P9MC 1S4IA 1JVLA 1QEWA 1MVUA 5FYLE 1T66C 5I2IB 4JDZB 1JF1A 4TPRL 3NSJA 5CZKA 4KXZH 1CGWA 1E8XA 1FVDB 1A7OL 3SE9H 1U2CA 1Y0LA 3KH3A 3TWYA 4XMVA 3MLPA 3LJ3A 2BY0A 4XP6H 1BVKA 5FGSA 5AVXB 3TFBA 3DUSA 4NWUL 3VFNB 4D0CB 2VDMH 4W9ZA 2HJKB 5IMLA 3MROA 3Q8AA 1N0LA 4BK5C 1OZUA 5TPWH 1JTPA 4B0MB 3RVWC 1J9CT 4E5XB 4JHAL 3WYRA 1U8IA 1UWYA 5DRXB 8PAZA 4GG6F 4XPAH 3R4RA 2G0KA 4P2OB 4J2XA 2EEBA 4Z3GA 4DJMA 3MOBH 1SN2A 1HWGB 1KXHA 1L6PA 2NSMA 4GYBA 1JYWA 1DBJH 1K5NB 4XCFL 5EF3A 4HHAB 4XAWL 4CSTA 4WAFA 4N0UB 4EBQH 2XFXA 4LQ1A 1FORH 1XGTA 3B6SB 3Q5OA 3TA3B 1QLEB 1ZVHA 5HGHB 3AMLA 2DQIL 5DEFB 3UPCA 2BNRE 4CBPA 1AIZA 3MROB 3APFA 4NO0D 5EOCJ 4Z95H 1JL8A 3IE9A 2NSQA 3HLKA 4FQCL 5CSBA 3VFWA 4D8PA 1ZOXA 2K70A 1WD8A 2HG5A 3QI9D 5DO2C 3FU8A 3GZOA 4KAQH 2AXJA 1E5AA 3T4AB 1MWOA 1Z3GH 1EO8H 2EXTA 5D1XD 3T3MB 1MCLA 5C07A 15C8H 4IBWA 4LL1A 5EU4A 1V7NL 1Q9LA 3RDTB 5HGBA 1I3GL 1G87A 5I6XC 4J3OC 4XT1C 1J5OL 1QNIA 3ZDZF 4AV0A 2B1HH 1F11A 2X0VA 2I60L 2XLLA 3HS8A 3BRDA 2EH7H 5FGCB 1FZOA 1JCKA 4M7JH 2H7WA 4NZRH 2XVLA 2WVUA 3UP6A 1TVBB 1DUZA 4QKXB 4H20H 2J4WH 4KJPC 3LRSA 7TAAA 4YBHA 4P5KB 4PJ9C 1CE1L 6FABH 3N2JA 3CCHA 1KCLA 5EORH 2EUWA 3MYJA 2CO6A 1SHWA 3N1GC 2DWTA 3FUDA 1JVKA 4J1UA 4MKMA 1MFMA 5I73B 4JZNB 1UEMA 1WD9A 3LIZA 1XF1A 4MB1A 2FBOJ 4ONHB 4YXKL 4Z3IA 5D7LD 5I23A 4U1MA 2H0EA 3O4LB 4PJEF 4EVNB 2HKAA 1CMOA 3Q8FA 2ARWA 2ZG2A 1SN5A 4BH8A 2AK1H 5KVGE 5FUCE 2R29H 3MRCB 1D5IL 4OZGE 1W72B 4LSPL 1W15A 2MQ0A 5F1IA 2XZAL 1T6BX 5KYYB 5F7AA 3QJSB 4YXLH 4JDEB 4BD4A 3X12B 3VFSA 1P4IH 4PJIE 1MIML 2H1PH 2Z34A 1JNNH 3O4LA 1HYSD 4OCWH 2QVFB 5GZOA 3FNKA 1NLBH 3QJUB 4OLWL 5C7XH 1OW0A 3QQ9C 3VG0L 2IDFA 2Q8BL 1C7TA 1X5LA 3BPNB 4TQIA 1IE4A 4G9FA 4UOZA 1UYWL 3EDFA 5CHNA 4MQTB 1DBKH 2QFRA 3BUYB 1R34A 4XE0A 4FZ8H 3GSRB 3HR5A 2ZUQB 2D3VA 5ESVA 4JG1H 4NQXB 4ZAKD 4Z7WF 4U2YA 1E4WH 1PCXA 4OBSA 1NWPA 1ASQA 3HI6H 3WTSA 2HTKD 2BOCB 5I1IH 3UTQA 2OXHB 4PP1C 4QRPB 2HLAB 4Y2OA 2DJUA 5EA0H 5EOTB 5EPMA 4L3CA 3T0BA 2DTML 3FQ1A 4NQVB 3Q6FA 2JJSA 4QYOB 3TIEB 1XD1A 4HAKA 3VTMA 5B38G 2BWDA 1BLIA 1BBDL 2C1PA 1IC5H 3LV3B 4LCUA 3REVA 1OCWL 3CZSA 1V54B 3LRHA 5FYLL 4ZMLA 3VFGL 1AACA 4TVSa 2XWTA 1EO5A 5EBMA 4HZAA 4QF1B 5FUZH 1KTRL 3MXVL 4CADB 2OR9L 1VZIA 4WQOA 3PHQA 1PLAA 4EOWL 1LXMA 1WA2X 4N0UA 4AK1A 4JRWA 3SBPA 1U0QA 1UATA 2QTEA 5EC1B 4YXLL 5IB1A 3OXSB 5J9PB 5ERWA 1F4WL 1RUKH 3T0VA 1TNNA 2IAMB 1GOFA 2K3TA 5EUOE 2LT9A 2BVOA 3SYPA 2Y2WA 3FFCA 4P23A 4RGOL 3VWJD 3HNVL 2HT3D 4O5LH 1J5IA 1UVQA 4LCWB 1ASOA 2MNJB 3EJRA 3WMSA 1N3NA 1PZCA 1CXIA 4QHUB 5EZLA 1BZDA 3T71A 4FFVD 3FBKA 1LK3H 3VD4A 1MNUH 4LOFA 4LMQE 1QFWI 3KPOA 5I74B 4D9RD 4JFPB 4O02A 5T8IA 1A1OB 1LE9A 5F3BA 1I8LA 3OZ9L 1AFVH 3G08B 5F21B 1AY1H 1BCIA 4GY4A 4EN3C 3SQOH 4G42A 3C6LD 3HG4A 3V4PL 3WNMA 2VO8A 1QMUA 3ZRFC 2J6WA 2I60H 4XPTL 2X1WL 43C9A 1NSNH 2IANA 1MIEL 3HG1A 4HQQH 3UZEA 2JCCA 1X5FA 4XO8A 2E9WA 4WV1A 5DK2A 2JV6A 3H42L 4Y16B 1HL4A 1DQIA 3T6WA 4WWNA 5JOPE 4I9WE 5DVLA 1SQ2N 2DF3A 4UZSA 3ZHDA 3VCLB 4YS4A 2CGYA 1GGCL 3ECVA 3MUUA 1EGJL 4JFWA 4MB5A 2E75C 4R7DB 4X4KA 2P5WA 5FO9A 3S2AA 2VDQL 2R1WB 2AJSL 3DV6B 2OJZH 1AFVL 2YC1A 3MV8B 3P2DA 4NFBA 1ZJBA 3CK0L 4QGTA 1J0KA 2H8PB 1A7NH 1KT2B 2EDEA 5B1JA 5J12C 1TQWA 2BY2A 3L3JA 2VXTH 3C75A 1G0DA 3BCFA 4M3JA 2NR6D 3ZL2A 1J18A 4H5SA 3GJFH 1I75A 3WE6B 1D6EB 4R8WL 2Q3XA 3EYFA 3CDZA 3FTWA 2ZNXA 1NPNA 3NFNA 3HI1A 3NSCA 4W9JC 2I7SA 5IT2L 4PTUB 1CQKA 5TQ2L 3AG4B 4KZDH 2EDTA 4B9CA 1F41A 4RFOH 4M00A 5AEAA 3RL2B 2AQPA 1JPST 2FT7A 1D2OA 3VGBA 4OTXH 4AYFB 1RLWA 3HW7A 5E9AA 4JFDD 4ODHL 5F9WC 3SDDC 3SO3C 2J1ZA 3WNKA 5FECA 3T0EC 4S11A 3DVIA 5CAYB 4ZMAT 3IVKB 5I5RA 1O0VA 5I0YA 5FPIA 4XCFH 4HOMA 5E2TL 2IDCA 3GJFK 3GLEA 1CL7H 3UXFA 3FAXA 1QFWM 4P2QB 1A9EA 4H5SB 1AVAA 5I0WA 2YAHA 4OZIE 1QSEA 2FEEI 2I85A 2FHBA 2ROYA 4PCSA 3QIBB 5GISL 1KTCA 3L6FA 1J9QA 2ZCLL 4LLYB 4Y2DB 5FWRA 3T4YA 3AG1B 3H4HA 4MJ2A 2ZX7A 4JPIA 4PLNC 4XCEB 1UB6B 1PZAA 4ZMPA 2EECA 1AD9A 2FT6A 3S36L 3SE9L 3U83A 2LU7A 4YHPB 4LAQH 1N64H 2CDGB 2E4TA 1UCBH 4GAGL 1TETH 4GW5A 4QIRA 4OT1L 5BS0A 5LNGA 1AGEA 3INUH 4ZX4A 1RZJH 3PXHA 1Y18B 1H3WM 2OULB 3TT1H 2YQBA 2MJWA 5IFAL 3ULSA 3BISA 3ATBA 2NY2D 4X4ZA 5SWSD 2ZXCA 3GYRA 1GL4B 3HZMB 3K6FA 3AXHA 4ABUA 2FAUA 4U6YA 2R0ZL 2NUTB 2GBUA 4MB3A 2LABA 4KQ3H 4IJ3C 1UH4A 1YYLL 4P23C 4RAVA 1DBML 4RMSA 4TNFA 5DS1A 4QHUA 5D7IE 5EZLB 3X13A 3IFPB 4M1GL 2JK5A 3OMZA 3FTGB 4ZO8A 5FW8A 2QV4A 2ZQKA 3OKKB 1JV2B 1ZLSH 3V4VA 2W60B 3MI6A 5HJBA 5E94B 4AX3A 2EXWD 4ZUTA 4KZDL 3A4FA 3VD3A 3GBNH 2C3WA 4JHUA 1JCVA 1PZDA 1YEJH 3FYIB 4DFIA 5H4ZA 2X9WA 3KYOA 4GW1B 4WTZG 3RZCA 3CBKB 3P3YA 5LQBL 4FTDA 1UGKA 3CMOL 4PJBE 3WSQH 1BA9A 2VUYA 3KPPB 3EO1B 2F61A 4Y4HC 4GPVA 3BSHA 3TYGH 5ENWA 1SJHA 5CEZH 1NDGB 3BKYL 3GKWL 4R4ND 1NMCB 4XVSH 3FB5B 5D2LE 4BFBD 7CGTA 5KS9A 2HT4D 3U6RB 4K5PA 4WFFE 5I8EA 2PF6A 1OVZA 4F58H 2OAAA 4FMFA 2FR4A 3NCCB 5HDRA 1NA8A 4NC1E 4OQ1A 5KBPA 5D1XE 1AI1L 1LO3H 5HYJA 3JTTA 4NUQA 2IV8A 4XP4H 3ZT7A 2C3XA 2VERN 4KTEL 5EBLA 4Z7IA 3LAFA 2VQ1A 5IVZA 4RAHA 5E6RB 1VF5C 1IIIA 1GKOA 3VQ2C 2GT9A 5EV7A 1K8IB 2BSEA 5DR5H 3TBWA 2V8LA 2O5ZH 2UZIH 3MRGA 1GHFH 3ARXA 1MXDA 1A14L 4GXUN 4UIKL 5AL0A 4YO0A 1DZ0A 3O9WB 3VFMB 3LV3A 3DHMA 5AVSB 2WQ8A 1MPAL 4LGSB 3VD0A 5L2JB 2R0LL 5CBEA 1I9RL 2OCJA 3NP4A 4XMPH 2DWSA 4GRLB 1S9WA 5EIIG 3KLSA 1OTUD 3SCMD 1T80A 3ARDD 5IQMA 1FH5L 5DK0A 2EEDA 4AJWA 2IH3B 2OL3A 5IGXH 2BOLA 3LKOB 4UOW1 3VGGA 1RQ5A 2ORBL 3LDBC 2WIIA 2FT8A 4LLVB 5PCYA 1JHKH 2YD5A 3QUMA 5I1DB 1T7ZA 3JWNC 5ESVB 3CIQA 3PGFL 4A67A 5JPNC 4IIZA 4M9OA 5JA9A 2YA0A 4BFGA 1GYCA 1XCQA 3K80A 1DQQB 2YC1B 1WAAF 4HCRH 1TJXA 4F15B 2I9TB 2FX8L 1MCCA 3SDXE 5T1LB 3MZGB 3A21A 1ZE3H 3ES6A 5EBGA 1W0VA 1O9VA 2IQAA 5DWUH 1SRDA 5HD8C 1SMAA 2F15A 2YGNA 4XPFL 4LLVA 1DQJA 5L88L 1OCZB 3VD7A 4G9FE 1YYLH 2GJZA 5AW8B 2PCPB 2Y7OA 5A2JH 1E3FA 5FK9B 1K8DB 1INEH 1A64A 1I1AB 3K6IA 2DI8A 3LS5L 1M7XA 3DGGA 5JHLH 43C9B 3ZTCC 5LO7A 5I66B 2X4SA 3B8SA 2AANA 1KULA 1G9NC 5F9WB 3SO3B 3RDJA 3LQAH 5E4EC 3ELQA 4YDLC 5JLZB 2BNQD 4QRQB 4PG9A 4NZ8A 3O41B 5GGUB 1MWAB 4Q9RH 4JEGB 1W6WA 4HLZG 4BFJA 3U30C 2R56H 4N2AA 1UENA 4I3RH 1QR1A 1QFOA 3FQXB 3FTUA 1BAFH 4A2EA 2Y22A 2DI7A 3U1SL 2WSPA 5JHDD 2IJ0C 2YWYA 1ND0A 1EVUA 2Z31A 3NG5A 1D9KA 2K7QA 1WPCA 3DYOA 3M17B 2K4WA 5I1AB 2BDNL 5EG6C 2EXSA 4LLWA 2X4OB 3L3IB 3VFSB 4C83B 5KN5A 3BWUC 3PGFH 4HS3A 3U7WH 3HBZA 1R3HB 2DQMA 4PJGB 5FO2A 2PR4H 1F6AA 1G7PA 1U6AH 4PR5A 4ENZA 3A47A 3KPOB 5AVZB 1TJHL 4G6KH 2FWSA 1IUZA 4BFFA 1NFAA 1ZK9A 1FL6B 3SKNB 2B1AL 4XXDB 5CP3H 4HCRA 4BINA 4E9WA 4UTAH 3TU6A 3DOHA 5C09A 3FCSA 5H35B 4HFUL 2EXYD 4OSUH 3LYRA 3CSYB 4W4OC 4N2DA 3ZDYE 1QSFA 4B9JA 4IJ3B 4P23B 4UINL 3EH5B 4LLQB 4J4PD 3T5WA 3DIDA 1NCNA 3G5ZA 3PY9A 4EZMA 4XNXL 2XVBA 3D48R 2A77H 5E8EB 3PWPE 3H7BA 4AC4A 1F8TH 1X5XA 4NO2A 5HDBF 1KGUA 3FSAA 2NNAA 3OF6A 1UM4H 1QFHA 1UB5B 2AITA 5FEBA 4BWUA 2OQJB 1BXXA 1QEWB 2W9DL 4KX8A 4ZG1A 1CFTA 2EH8H 4I1RA 2YXVA 3OGCB 4JVWA 1YMMD 2D0GA 3MA9H 2HZHA 3FCSB 5E00B 5GRXG 5TGBB 1DFXA 1I7ZB 4XNYL 5F7DA 1V7ML 3NN8A 1W2KT 4HIEA 4KDTC 5IMKA 4YXHH 2X4NB 5A40E 1JGUL 4JY6B 2YN3A 4OF0A 3HI5H 3PV6A 1EMTH 4K94C 2VAAA 2WINA 4FABL 1XQ4A 3ETBF 4M6AA 2NNCA 1AQKL 1K4CB 3TZVC 1MAJA 2E46A 4CKVX 1JNHB 4IBZA 4F2FA 2BP3A 1TTCA 5GGVY 2YBRB 1EEYB 3BVUA 5DI8B 5ICZA 2WB1A 3BDXA 5AW1B 5E5UB 1FWXA 3H0TB 3QUMH 3DUUA 4GIOA 1KEML 3WIHH 5GIRA 3B5TA 4JQIH 3RFZB 2GQHA 4Z77B 1ZSDA 3NA4A 2WJ7A 1A8JH 1XSOA 4ZYKB 2YOCA 3SPIA 1NC2D 4LCYA 1FH2A 4JFYB 5DZAA 4E41A 1T03L 4GRLD 1F18A 3MBWB 5I1GL 1H15A 3QUHA 1DBBH 3E6HB 1WEJH 1VFAB 5EU5A 4ZUVB 3FQNA 4TSAH 2Y3AA 2IQAB 3O9WC 3BKJL 4WTWA 4EUPG 1S7RB 2ESVE 3MXVH 1GGUA 4JPVL 4M4RA 4NQXA 3WTYA 2M26A 5CHNB 3R19A 1I8MB 2QPUA 3D30A 5DS2A 4ETQA 3V8CA 4G7VL 1NQBA 3VJ6B 2VL4A 1MCDA 4ENEC 1LEKB 3Q44A 1T6WA 4L5FE 5FGBC 2EE3A 3OLDA 3V6OA 2Y06H 4GI9A 4PRPA 1YN7A 3FFOA 5DRWB 5LDSA 5F9AC 4YHLH 1R3JA 3CFCH 5JOEA 2YEQA 3T65B 4L1TA 4HIJB 1REIA 1UC6A 2G60H 4B50A 1GJUA 5C71A 5ESAB 2XWBA 5LLIC 1DQQA 2IMNA 2VWEE 3DURB 2IANE 4DGUA 2K3HA 1N6QL 3FQRA 3TBYB 5C07B 3P9LB 2D3LA 1BFVL 2BW4A 3B43A 4M5ZL 4JHAH 3MJ7A 3TNMB 1FO0B 4G8GE 3WO3B 2XU9A 4UTAL 2WQWA 2WWNA 2XN9D 3EGDA 3SYAA 3HN8A 5I6KA 4URTB 4Z7AA 2VITB 5D72L 3H2QA 5F8QC 4KQ4L 2CRZA 4OF8A 4BCYA 4XBPB 5LB1A 4BXSV 3FQ2A 3TWCH 1Y6NR 2X1PA 5FYJU 3NEXA 4XBMA 4QAMB 1NTDA 4GAYB 2HCZX 3NIDF 5CINL 4LDOB 3IAGC 4ZXBD 1SUJA 5C07D 5KUMA 2XXFA 1FV1B 1BFOA 2IGFL 3WKYA 4MWFA 2VDLB 2W8CA 4GP5B 5C0EA 2VZSA 3SDAA 4GKOA 3VYNA 3EYQD 1P7BA 4XVOA 5SWZD 3LKNB 4OD2A 1QSFE 3KS0H 3U36A 3L95A 3K5RA 4EN2A 3D85D 4H8VA 4X50A 5FV1L 3ZX1A 3QHZH 1TJMA 1B0GB 1F4XL 2QQNL 5LG1A 5KBNC 5I8KH 3IF1B 1A65A 2VMFA 1F58L 3FT3A 2GAZA 1AG0A 2Z6FA 2J8HA 5HGHA 5JDSA 1WP6A 4LU5H 2V5MA 5AOLA 4MXWH 4WTZA 4DQAA 4HHGA 4DF9A 1UWEL 2UVEA 4JR9L 3I2CL 3X2QB 1MKFA 4Q9BA 5TE4L 4B7LA 1QI3A 4OV5B 2XWRA 2VN5A 2X28A 2XX0A 3CQQA 4GUOA 1XTMA 2OSXA 4M43H 3LKNA 4GAAA 3UTPE 4WWID 2YD6A 5HGAB 1S9VB 1QOKA 3TF7C 2A9MH 2QQKH 1AZBA 1G7MA 1R17A 4FXGC 5DJ0A 2RTTA 5LAXA 1HHKB 5D72H 3QFDA 2OJEA 1T5WA 4W1TA 5FHBH 2NYYD 3UX9B 4GSUA 2ICES 3D2UB 4JLRA 2N0KA 1IJ9A 2I9LA 1P1ZB 3X3GH 2WLIA 5E95B 3S88H 3RFZC 1C5DA 2AQQA 4FMKA 3LB6D 4G7VH 3SQRA 5GRJH 3AQYA 4K7FA 5A2BA 4NI3A 2VDMB 1LK2B 1FCCA 1S7SB 1KWGA 2NT1A 4IKNA 2YD0A 3WLWC 5HGAA 3FQXA 2DQFB 4YSPA 3DRTA 1Z7JA 1U91B 1WFMA 3ECQA 2HVJB 1IGYA 1NLBL 4K5MA 2X4QA 5AB0A 4XPBL 3LDBB 5DR5L 5IB3A 1IC5L 1T1ZB 5D7JC 1PSKL 2PW1A 3EOAB 4JHZA 4JREB 5T1LA 2BSSA 1PFOA 4Z7UA 1E4XL 2EYTA 1SZNA 1F4XH 2QQNH 2WZ5A 3D08A 2J12B 4HV8A 1CFVL 3LKSA 2H9GB 4FLSA 1YEWA 4XRCB 1BJ1J 4HUWB 2R23A 3BGFC 3L6FB 4FYSA 2DQTL 3DPDA 3FT9A 3VD5A 5FX3A 1XZWA 1YNKH 2JFCA 1IGTA 1BVLB 2AHIA 2YSSB 4PGDB 4EO5A 1UM5H 3L7FA 2P48B 1AANA 1HEHC 2NZ9C 4JFZH 1QNZL 4Q6IC 4UM8B 2G60L 3IAPA 4MCZA 1KEGH 2XG5B 1J8HA 4HH8A 3QSKB 5MEOA 3LPGA 2BSRB 4AZ8A 3AUWB 3JT0A 4HWZB 2V3EA 1WCQA 4AGNA 4NKOB 3AWGA 3PP3K 1SVBA 3CZFA 2R23B 4OZFB 5GSRA 2C9RA 1DVFC 4XP9L 4RBPH 3VXRB 3WFCL 5LBSL 2V5TA 4JANB 4WZ9A 1J5OH 1JHTB 1FPTH 1XGPB 3DV6A 1TFPA 1F8TL 3K8LA 1KIRA 5FFOA 1RFDL 2F53D 2A9DA 2A9NH 1ACZA 1ZVSB 4NKDA 4M8RA 2ICWJ 4M7ZB 3QFGA 1HKLL 4OLZL 1LD9A 2NXYD 4V1DE 3DTXA 3RQ3A 4Z7WB 1AO7D 5F71A 3K7UA 4ZFFB 4QXGL 1OTTD 3QORD 4O00A 2UY6A 2LFEA 4ANWA 1YYCA 2OMZA 4HFWA 2VZ3A 3TONA 3VVVA 2QQQA 3VA6A 5I76B 1SXSA 3X3FL 2FGWL 3BKMH 1FNGB 5EOQL 4DK6A 2XWZA 2VL5B 1HN1A 3OAZK 2HJLB 1C1EH 4AQ8A 1D5RA 3QRGH 4Y4HB 1BWMA 3AU0A 3X14B 1D5IH 4U33A 1YQ2A 2YRLA 4HPYL 2I5YH 1P4LB 1AHKA 2F5AL 3RWGA 4QNPE 5ICXA 1T0PB 5C2BL 5K9QI 4UINH 3SKMB 5CU5A 2JJTA 4W6WB 4KZEL 3V9CA 5DFVC 4J12A 1X7QA 1M56B 5BO0D 1FNSH 2ZONA 5J13B 3UH8A 3QZMA 3BAIA 3CX5J 2EDKA 4ZNEA 2WO4A 2A38A 1UVQB 2EABA 2F7OA 4UM9B 5DC0A 1QBLH 2BVOB 2B3RA 3LZPA 4H20L 3ZO0A 3FTSA 3MRJB 4XP9H 1I7RB 4L18A 4O02B 2OSLA 3GNML 4HUCA 4J3OH 1TQVA 3UMTA 2MRYA 2XOTA 1CC3A 5AW0B 4R7XA 3U36B 1T22A 4TOYH 5LVEA 4Z77A 3ZUCA 3ME0A 5E8OA 2OMTA 3BEWA 2H1LM 4QPEA 1JZGA 1OK8A 4X6CA 2NXZC 4WGKA 4I3RL 5KYWB 4F8QA 2WQUA 1XR9B 1RZ7H 4WUKL 4DFHA 2J8UF 2DMCA 3V5HA 1UWGL 4TL4A 1UD5A 1OSPH 3TZVD 1Z66A 3DK2A 4WI9A 4O9HH 3F58H 1OAQL 3I3EA 5AQ0A 4PJ9A 2DWDB 2HMIC 2JJVA 4M48H 1DVUA 3DWTA 4XBPA 5FWQA 3X1GA 2COQA 2DD8H 3N1PC 5M94B 3F7VA 3VXNA 4DKDC 1WVZA 4QKTA 4JRXE 2VLRE 2CLVB 3BSZL 4U1HA 1XGRA 2VXVL 3FTVA 3EBAA 4D7BA 2WKLA 3L3OB 3CV5A 5C8JB 4G7SB 5ID0B 3I74A 1ZGLP 3HIZA 2XWJB 4YFLF 3PG2A 1J0ZA 1ZANH 2AQ2A 4WNSA 5MEOB 1TZHB 2H2PC 4P3DA 4XPHL 1AR2A 5GGTL 3SDCA 1AIFB 5FR3A 2KHAA 2CO3A 5F44A 1HOEA 4DSYA 5IBTL 1PLGL 3NFSH 2W07A 1PYWA 2CUIA 3N06B 3CXHJ 3NH7L 1BXVA 4Z7OB 2DD8L 1A6WL 4JPVH 1G94A 4GLRI 4GSDH 4P9ML 3V6OE 3KJ6L 1LEKA 3P3UA 2D7TL 5FDWB 3VGHA 3SQOL 1W8NA 2MPAH 3HBGA 1JK8B 2DY2A 4Z3TA 3UJIL 4XHQA 3JV5A 3B2UC 1H3UA 1T6VN 2AEOA 5E6ZA 2J8UE 1RZ7L 2ZUXA 3H6JA 5E2WL 3T09A 2A74A 2CJ3A 4G6FD 3JWNE 3W0WD 1MRFL 2QVMA 3HRPA 4LKXA 3VFVB 4PJFB 3ZSSA 4AWJC 5C6WH 5KVEL 3GLDA 2G9HA 2KI6A 3IPFA 2QKIC 3O3AB 1VPOL 4E41B 5GGUA 2IH3A 4G1EA 3CIAA 3IDJA 2VIRB 4PRNA 3UTZA 2CDFA 3ZY7A 1JWUA 2XKUA 4YFLI 5JHLL 2EYTB 1A8ZA 4LXFA 4YEEA 3VB9A 1FGNL 1AZNA 5L4MA 3AWEA 1RD6A 4PS7A 1ZTXE 4AW7A 2EVHA 3DTUB 2EEAA 3FTZA 4X6DF 5DEGA 1CFSA 4DGYL 43CAA 3G08A 4HVBA 1NOFA 4LQFH 4ODXB 3HG1D 1GGTA 3Q2VA 3N42B 2R56L 3FUHA 2VMEA 5FYJH 1QA9A 1KIQB 2BC4B 5HVHC 3AREB 4DO5A 2VUOA 2C9UA 1U3JA 5KBLA 1I8IA 1V8HA 4I2XE 2XV3A 4BGLA 2RR3A 4WU5A 4AXWB 1CG9A 4K71B 3GSQB 1NGWA 1W0VB 4P2RD 1AXTH 4UQBA 1FL3A 2P47B 5HHMD 2DEWX 4U1LB 2PWGA 3LXAA 2C3HA 2P3YA 4N8CH 4NRZB 1WG3A 4LO9A 1MWAH 4K8RH 3CPLA 1Z9MA 1IL1A 4WUUD 4AGMA 1XXDC 4BIKA 1MAKA 2OTUA 5KSUB 1KLUB 3MLVH 2OFQA 4JKWA 1JV5A 2BWIA 3C60C 1YRKA 4XWGH 1B0GA 3PRZA 1ZGLA 2DYRB 2YLHA 4FKHA 4PSPA 1YMHB 2DWEB 4G7YH 2BVQA 3MGTA 4LQFL 2WUBH 4O2FB 2ETWA 4BBWA 4MD5A 3KPSD 4QRRD 2BFVH 5F9OL 5EEWA 2AC0A 1I7TB 2HLFC 4YWGL 3GSWB 1YN6B 4IW4C 4X6CF 2ZUUA 5HYSG 2WWMD 4X5QA 3AZUA 2WZPD 1AZZC 3WHE0 2VDQB 3QORA 5KAQG 3NQIA 5AKTA 1CCZA 2XSKA 3QUXC 1LWRA 3ARYA 2FJHB 4OJAA 1UACL 1K5NA 5F9JB 5F0PB 5BRZA 4M6OH 1J88A 4S1SL 4ZQKB 3NZ8A 3NZUA 3VRJB 4C83A 5DS8A 3I50L 5KN5B 3MRGB 2CAKA 4MA7H 3NZSA 1EGJH 3ATEA 4L29A 4HJ0D 1MRCH 3O0LA 4FQXB 2FEEL 3DARA 5ACLA 4JO8A 3LZRA 2H0FA 1GZPA 1Z9PA 2PXYD 5F9JA 4BEIA 4CVUA 4HK3N 3B9DA 4XN8A 1HSAB 4G6JL 2Q86A 3IFOA 1MCFA 3CFEA 3NGBC 4GEIA 1ILUA 2QVTA 2DIEA 4DK5A 3GMLA 2P8LB 3Q05A 3DHUA </