2RACA

Amicyanin reduced, ph 7.7, 1.3 angstroms
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (AMICYANIN)
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2racA00
5PAZA 1AG0A 1JVLA 1B3IA 4E9TA 5F7BA 1JXDA 2PPCA 3AG4B 2WO3B 4BXSV 5IY5B 2QT6A 1JZGA 4HHGA 4JHUA 3FS9A 4A2FA 2VM3A 1AZCA 3BVDB 3JTBA 2GB2A 4YSTA 4GP4B 2QPDB 4RH4A 3PAVA 4M3HA 3T71A 2QPEB 3G5WA 2IDUA 2Q9OA 5I6OA 1SF3A 2UX6A 2EINB 2R7EB 4E9QA 1M57B 4AKQA 1JVOA 3NJFA 3CDZB 1HAUA 3X1GA 5B7EA 4PAZA 3NYKA 2OV0A 4HALA 4A2EA 1IKOP 1CYXA 3PAUA 2VMJA 4Q89A 1W6LA 2YAMA 2BP8A 2YAQA 5AFAA 3IE9A 1AS6A 3U25A 1PZCA 4E9SA 1E5ZA 6PAZA 1X9UA 2JXMA 2PP9A 2PPFA 1V10A 1ZDSA 3CVDA 3X1EA 1JOIA 2ZONA 1AANA 2BW4A 3NJGA 1TEGA 5AKRA 1OE3A 2UXFA 1A4BA 3FSAA 4GXFA 4JHVA 3PLYA 4AI7A 3DKHA 3QJRB 3OM3B 2XU9A 3T6ZA 4AX3A 1E67A 1OF0A 1SFDA 2I7OA 3X1FA 1ID2A 1KV7A 2EIMB 2PPEA 2VSKB 8PAZA 2AFNA 1GSKA 2FQFA 4A2GA 3NSYA 4YSOA 2PLTA 2UXVA 1M56B 1NZRA 3H4HA 5TK4A 2IAAC 2IWKA 3UAEA 3ZIYA 2CALA 3ABMB 3V9CA 2FT7A 1SHXA 3AG1B 4YVNA 3SBQA 2DWSA 1ILSA 3AZUA 5I28A 1T5KA 4YSQA 2VM4A 5I5IA 1ZPUA 2I7SA 1V55B 4BK5C 1N70A 4GP8B 4AKOA 3TA4D 1AZBA 4BWWA 4BDVA 1JERA 2XX0A 2BW5A 4A68A 1XMEB 2AANA 2XXFA 1KCBA 4HCFA 4KNUA 1L9PA 3QJTB 3NP4A 1EZLA 3NJIA 1ADWA 4E9XA 1W6WA 3GYRA 1ZDQA 2DYRB 4P5SA 2H3XC 1OE1A 1AQ8A 2BO0A 5D4HA 3DIVA 1OE2A 4WKXA 1WA0X 4DP8X 1PMYA 2XV3A 2XWZA 2ZXWB 4DP1X 9PCYA 1DZ0A 1NIEA 3NJHA 3H56A 1RKRA 4X4KA 3NSFA 1NPNA 1A4CA 4HHWA 1XB3A 5D4IA 1HFUA 4QKTA 3WKQA 1A3ZA 4HCGA 1SFHA 3FQ2A 3UACA 1J9TA 5I6PA 3S8FB 1MG3C 2CCWA 3ZDWA 2YAHA 1YLBB 5A7EA 3EH3B 2AVFA 3N55A 3T6XA 1AOZA 3FU7B 2H5UA 4UANA 5I6MA 1CC3A 2GBAA 2BP0A 1J9SA 3AG3B 1EHKB 5LDUA 3UGEA 1W8EA 2PP8A 1KBWA 3CZUB 2BZCA 4A67A 1BQKA 3AG2B 2UXGA 2XYBA 3AY2A 1TKWA 5PCYA 2GI0A 1NICA 1BAWA 3S3CB 1AR1B 2VW6A 3RYMA 2HXAA 2FT8A 5B1JC 1L9QA 3NJLA 2OCCB 3BQVA 2FT6A 1OCZB 1ZV2A 1SDDB 2EIJB 2DYSB 1PAZA 1RZQA 3QQXA 1ASPA 4E9RA 4YSEA 4G72B 3OMAB 2J56A 1NIDA 2XV2A 1OV8A 2IDFA 4YSAA 2FWLB 1RCYA 1ZIBA 4N4YB 1IUZA 1GR7A 2HZHA 1A8ZA 2XLLA 3NJNA 1L9OA 3FU8A 1SHWA 5B7FA 2GIMA 4BXVA 3CG8A 1ILUA 3OD3A 3FSZA 1BXVA 4WTQA 1QHQA 3T6WA 1NTDA 4EF3A 2E86A 4AZUA 4ENZA 4W1TA 3X1BA 3PXLA 2CAKA 2FQEA 2I85A 3TASA 3S3BB 4F2FA 2XVBA 4KO6A 1PZBA 3S3DB 1IC0A 1KDJA 2PCFA 2B08A 4NERA 1NPJA 2IH8A 3WNIA 4UF7C 1PCSA 1AS8A 2BP8B 2Y1AA 4YSCA 1XB8A 4G7RB 1BXUA 3FPYA 3JT2A 3X1NA 1R1CA 3X2QB 4GY4A 2GC4C 1NIFA 1X9RA 2B3IA 1BXAA 1ET7A 3FPXA 1WS8A 1GW0A 3FSVA 2AZUA 5EHFA 3S8GB 1GS7A 2MRYA 3QJQB 3FSWA 3AW5A 1URIA 2YQBA 3C75A 1V54B 4DPCX 1A65A 2VN3A 4L0PB 4QLWA 1KDIA 1UATA 2P80A 1ASQA 3NJKA 4DPAX 5B3SB 3N2JA 1E65A 4JKNA 5B1BB 1ET8A 3QPKA 2HX9A 5I5MA 2AZAA 2IDQA 2A3TA 1ZIAA 3IEAA 1JZEA 2NRDA 1QLEB 1CUOA 4MFHA 3WNJA 1OCCB 4E9WA 3EF4A 4A66A 4DPBX 2Q5BA 3UABA 3KW7A 2DWTA 2IH9A 1E5YA 2DV6A 4GYBA 3DTUB 1PLCA 1E30A 3CVCA 3SBPA 4DP4X 4K9JA 3FT0A 1NDTA 3PCYA 4KO5A 4KNSA 4G70B 1BYPA 3NSDA 7PCYA 2CBPA 3UADA 3NT0A 2FQDA 1OCRB 4TXVB 4BDVB 1WA1X 3GXUB 2N0MA 3V9EA 2JFCA 4G7QB 1BEXA 1AS7A 1A4AA 1ASOA 1PLAA 4YSRA 2XV0A 2EIKB 2YAEA 2YAOA 4DP6X 1I53A 2VW4A 3SBRA 5I26A 3H4FA 1OOWA 1SJMA 4YSSA 1BYOA 1AAJA 2R7EA 2CUAA 2J5WA 4DP2X 3ZX1A 1FA4A 2FTAA 4KO9A 1KYAA 1SDDA 1GS6X 3T6VA 3ABKB 3CDZA 1L9RA 3ASNB 2FJSA 3TU6A 2PP7A 1BQRA 2BZ7A 4YSPA 4W9ZA 2UXTA 4YSDA 1AACA 5FC9A 2BHFA 1GY1A 4P5RA 1KGYE 3ASOB 1M9WA 3UAAA 1DYZA 1NWPA 1WS7A 5F7AA 1CURA 1FWXA 3ZBMA 4A2HA 2WSDA 2ZWNA 5I5JA 1MZYA 1PLBA 2GHZA 2HX8A 3HEIB 3NJMA 4G7SB 4DP5X 1WA2X 1AIZA 5I6NA 5I6KA 3OQRA 2GSMB 3FQ1A 7PAZA 2QDWA 1AG6A 4HCIA 5B7MA 1J5DA 2BP0B 1J5CA 3MX0B 1NIAA 3D12B 2IWFA 1AZNA 2IDSA 3EH5B 4A2DA 5ANHA 1ETJA 5TK2A 3NSCA 4N8UA 2QDVA 3IBOA 2MTAA 4HZ1A 2GC7C 2TSAA 4YL4A 2JKWA 1TEFA 1MZZA 2P80D 2YARA 3ABLB 1JZFA 4NAJA 3IN0A 5B1JA 1HAWA 4CSZA 1L9TA 2J55A 1OCOB 2PPAA 3SQRA 2OJ1A 4G71B 3EH4B 2YXWA 2W88A 3EHBB 2YAFA 3OMIB 3OMNB 3WI9A 4BWUA 2VSMB 4KNTA 4NB7A 1NWOA 1JZJA 2BWIA 3FU9A 6PCYA 2PCYA 2YXVA 3GDCA 1SNRA 4YVUA 4GP5B 3QJUB 1KBVA 4KOCA 3NP3A 3PAZA 2UX7A 1IBYA 3FYIB 1PZAA 2ZOOA 2J57A 2Y69B 3FYEB 4YSUA 3NJJA 2WO2B 3ERXA 5B1KA 2HRGA 5D4JA 3WG7B 4DP7X 4F7KA 3TBCA 1QNIA 4E9YA 4FA7B 1JXFA 2W8CA 4AKPA 3WIAA 5B1AB 3TBBA 1AZRA 2YAPA 2RACA 3HB3B 2FNWA 5I6LA 4Q8BA 2VW7A 4UAHA 1IBZA 3ABGA 1N68A 3FQYA 3T9WA 2HRHA 2XUWA 1PF3A 1KCWA 1PNCA 1VLXA 2HLEB 2H47C 1JXGA 1F56A 3CVBA 4F2EA 3FU7A 2IWEA 3L45A 5E9NA 4E9VA 1XB6A 2XXGA 4KOBA 1FFTB 1PY0A 1MG2C 3PPSA 2BWDA 1J9QA 1GYCA 1JZHA 1MDAA 3KW8A 2DY2A 4BWTA 1NINA 1GY2A 1L9SA 1NIBA 1ET5A 4ZK8A 2IDTA 2PPDA 1JZIA 3QJSB 4M4RB 2LLNA 3WKPA 3IN2A 4DP9X 1PNDA 3MBWB 1WAEA 2X87A 2FQGA 1RZPA 2HX7A 4HIPA 2TSBA 4PCYA 3QJVB 1CYWA 4FAAB 1J9RA 2XX1A 1TU2A 2X88A 5AZUA 2CJ3A 1SF5A 1AZUA 1BQ5A 4DP0X 4HAKA 4KO7A 2EILB 4CSPA 1GS8A
chains in the Genus database with same CATH superfamily
5JDSA 4JO4L 3MRMB 4XMXA 4GW5A 1B4JL 3IKCA 4PJHA 3OKMB 5DMIH 3AS1A 2WNXA 2WTRB 4KJWC 4D0DA 3WSQL 5TF1L 4JHUA 3FS9A 1D5XB 2ESVD 5D55A 1W72L 4GIPD 1PU0A 4XP5H 1ROWA 5K39A 3SCMA 4AEHL 1A6WH 4OLUH 1HZHL 4OFVA 4XCNA 4AC4A 4E9QA 1BQLH 5FLVA 1JVOA 2A2QT 3MRLA 4X5XA 3GSNH 5EBLB 1QLFB 3BZFA 4B7LA 5E6ZA 4AG4L 1E6JL 1AO7D 3NCFB 3L2LA 1ZD6A 3L54A 4G6AC 5IUCA 2VL5B 3ZMEA 1R19A 1EXUB 2C3VA 3HJEA 4JRYB 3VFPA 1T22A 1NCTA 1JJUA 4QY8A 4NBZB 5EOQL 4YFLI 2R59A 1KIPA 5D7JC 3QRFM 4TLUA 3GSXA 1IEBB 3VQ2C 1OE3A 4RAHA 3ROOA 4HBCH 4IBYA 4CNIA 4H26B 4LB8A 3FCGA 4X5WA 3Q8EA 3X1FA 4PJDA 5GRJH 3STBA 2YGVA 1EJ6A 5I6XC 2VSKB 4TQ8A 3F58L 3TNMB 3RGVA 4ERSH 4NP9A 4HAFA 5CEZH 3RKPA 4XP6H 4F33A 4MVBC 2IOIA 4NHUA 4PJIE 5F9OL 3RDTA 3TFBA 1Q9OA 1G5AA 1RZ7H 2AGJH 1X5IA 4OB5L 5SWZA 2APFA 3UAEA 3VX0A 3KNBA 1FLRL 5BVJB 2OXHB 3AG1B 3JWOC 3HMXL 1T5KA 3GSUB 2ZUTA 4KJQD 1JPTL 1R3HA 3W56A 1KV3A 1NCAL 1QACA 1V55B 4HV8A 1VRSA 2WLNA 3KXFB 1H3GA 3EJQA 2XRAH 5EN2B 3I74A 4FQQA 2QVTA 4HC1H 1EZSA 1O0VA 4GG6A 3S5YA 5C0ND 3D2UB 1HL8A 3EOBB 5HYSG 3AU0A 2A74B 3NJIA 2K9FB 3IFNL 4U0RC 3S35H 4OU3A 5E9DD 4P5SA 4WDIA 1MNUL 2H3XC 5KANG 2ADYA 3U4EA 5BRPA 5DMKA 4KUZL 3DIVA 3RWIA 4WKXA 1AXTH 4P5TA 2JKLA 2QMKA 4DP1X 4HJTA 4WGVB 5MP6H 5DD6B 3VYNA 4XRCA 4JDTH 5T1LB 3GMQA 5DWPA 3NSFA 4KDTC 5EZOL 4P07A 1U2YA 1II4E 2Q0ZX 5E08H 4WLCA 4X0KA 4QKTA 1FP5A 2JB5H 5GZOC 2K3TA 1LWHA 4HCGA 4CAGA 1NCIA 2OZ4A 1D6VL 3S8FB 4FE9A 3QPXH 2AK1L 1J48A 1T1WB 5JZ7C 3QORA 1N26A 2YD9A 2E6QA 1JVKA 1J1OL 4LFHG 3MRCB 4PRHB 2JKNA 1ACXA 2YMTA 3HPLA 4MMXB 1ZA3B 3EO0A 5I17B 1J0IA 3HG3A 3L9EA 2X42A 3AG3B 4NPYA 4WHTA 2C3HA 2ZSWA 4D3CL 3IPEA 3MR9B 4OKVA 2UWEF 2BZCA 3WE1A 1J0JA 1NOAA 1YSOA 2H1PL 4FL4C 2UXGA 4MD4A 4LU5L 3RNQB 3B56A 4ZMXA 3L4ZA 5C0GB 4AIZA 5DUMH 4OLVL 5AAWA 4MJ5A 1HE7A 2CO6A 2P44B 1MAJA 3BEVB 1AQHA 1Z7JA 4XNBA 4RGOH 1FAIL 3QW9A 1L9QA 1OHZA 4FYRA 3PGCA 4C56D 3L3HA 3FT3A 2VTFA 5E5MA 4A2MA 3AMLA 1WFUA 3NFPA 2RGSA 1N64L 3O6FC 1G0YR 4QRPE 2EXYD 5EULV 2IWGA 4BE5A 4KI5D 4TUKL 1HQRB 1EAPA 5IVXB 1T80A 5FA3B 3W9EA 2H6PA 4JG1H 1OALA 2FBOJ 2XFXA 1HCVA 4JFDE 3A4EA 2NNAB 3ZRCC 1G9MH 5LCVA 2XACC 1RCYA 2PW1A 3IJYB 4NQDE 4RMQA 5L8KB 4FCAA 4JDZA 5D8JH 4XH2A 5I30L 5IJBC 5BQ7B 3CVHH 2IH3B 1I8UA 1SUJA 1CXLA 2IALB 3DVFA 1SYVB 4C54A 4PLOB 1J0ZA 5AVWB 4UI2A 5BXFB 4FLQA 4M5ZH 3HS0C 3INOA 3WGUB 1MI5A 1I7TB 4MNQD 1MUJA 1JGEA 3SJVD 3RG1C 1BXVA 4R2GD 1C1EL 2DLTA 1BFVL 1JIBA 2QPSA 1FZOA 4PTTB 2BSBA 4NRYA 4QTFA 4ZUTB 3QJFA 4PWJA 2VLJD 2WTPA 4FNRA 4YFEA 4AW4A 1DBML 5D72H 5DUBB 3MMEB 4OJFL 3CZEA 4YE4H 2XVKA 2Y7MA 5I1EH 2ZOLA 3SE4C 4JQXC 2JJVA 5JHDE 1JPEA 1X7QB 3PGDA 4ZQTA 3UBXB 3BAIA 1JZ7A 3MJWA 3ULUF 4N8PA 4RRPM 2YD6A 3WNLA 4AQ8C 3TJEL 3L1GA 3LDBC 4HWZA 4KK8D 4AM0A 3TOPA 5I9QC 5IB3B 4PJ8A 1XGYL 4R83A 2ZICA 3NJKA 4GO9A 4ZSOA 1AI1L 1LO2L 1UWGH 2HJLB 1R3JB 1IM9A 2IDQA 3G04A 3U79A 1T20A 3WN5C 3IEAA 5F7MC 4ONFH 1FO0A 4P5KB 5MEOA 3RVWD 1HVXA 5KOVC 1VZGA 1PGRB 2G5BA 5JDJA 1H9VA 1DSWA 4XT1C 2WZPD 5CSBA 2H32H 3FT2A 2ZT9C 2DIAA 4X6DF 1I7ZB 4TOYL 5ADPL 2MCPL 3L6FA 5E2WL 3T77A 4YL9A 5HYFA 4FZEH 4X4YA 2FO4B 4EOWL 1J1XH 1X44A 3IDMA 3QNZB 4NC2B 1L5GB 1NGXB 1MHPL 3FQTA 2G9HB 2QTVA 1W91A 3MLUH 2RR3A 4M43L 4FXGA 1CR9H 5C07E 4DKEH 5C6TL 2QFPA 5HGDB 5FYJU 3NSDA 4ODUA 4Y16D 5DQ9B 1BVNP 5AZ2H 2AABL 2Z8RA 1HH9A 3KL5A 2EKSB 4HJ0D 4TXVB 4P2QE 5D1QE 5DJDB 4BDVB 3OG6B 2DQUL 3E8VA 2X1PA 2OMYB 1A25A 3LEXB 5HXMA 4OF0A 1DVFC 5FM8A 1A4AA 4KVNL 2J5LB 1EUUA 5FO7A 1DBJL 4DP6X 4PJCE 3F7YA 3HE7A 1MW3A 1U8CA 1AAJA 2R7EA 3TN0D 1FA4A 5FAAA 3T2QA 1W8OA 3V0IA 3V0WL 3OPUA 1BD2E 4RBPK 3QDJB 5E6IB 1FORL 2NXZD 2O1AA 3VVWA 2FJSA 1G5GA 2BNQE 1S2EA 2V5MA 5FCUH 2J4WH 2OTWB 3Q8FA 5J6GA 3DPBB 1T1YA 2DN7A 1WAAE 3QHFL 5T8IA 5DO2D 35C8L 2H41A 4YHZH 1A9BB 1RV6X 4FI8A 4IMKC 3WNKA 4DOHB 4F9LC 2E7CA 2Y5TB 2LGNA 3ARDB 4P5RA 4UV7H 3V4VH 3H9SD 5BZZA 4POUB 5KSBE 1N6QL 3Q48A 4MQSB 1AXSA 2B2XL 2ZXEB 2C7UA 5D7IA 3UZVA 2WCGA 3DETD 3SY0B 3MAWA 3PWPA 1GIGL 4CU6A 4XP9L 3DV4B 1PDKA 4POZD 3R1GL 4YK4B 1NCUA 4ZAKD 1R5WB 1AG6A 4PP1C 5AOKA 3HNSL 4KKCD 4PRPD 4PW4A 4BA0A 1L4IA 4UDUB 3VWJD 2BHUA 4QJ3B 5ANHA 4G3YH 3THMH 2QSCH 3KWVA 1FIGL 4PY8J 1VFAA 3KYOB 4QRBA 5F72S 5A2JH 4LZKA 4LVNC 3ET9F 3QZBA 1LO5A 2FYVA 4OH2A 4CSZA 4MB5A 3F7PC 5LGJB 5F9DC 2KPNA 4I89A 4PP2A 2D7PA 1TSHA 1HSAA 3LRKA 1EAJA 3MBEA 3MV9B 1RULH 5EU5B 3FO0L 1L7TL 3QUZB 4YQXL 2YKKA 1OWRM 1ORSB 1GOFA 2CNZA 4X6FB 3ULVE 4P5TD 1BLNB 1RZFH 2NZIA 2C9XA 3O3DA 1YPZF 3H2PA 4GW1A 4XO9A 1NLDL 1XGQB 2Z9TA 3C8DA 1E9OB 3GSRA 4QRRE 5EIVA 1P5UC 4KITB 5MEND 1JZJA 2ZF9A 4XPGH 4PW9A 1U58B 1S7QB 1C12A 4U3HA 5EO1A 3MV8E 2VABA 5I1GH 4HUXB 5D7JA 2EIEA 4GP5B 2K9UA 4N3TA 5A40E 3B9EA 2XWXA 4MMYA 1N59A 3C5XA 3DX8A 4X6EB 1QI5A 4GSDH 2DICA 2J57A 5AYUH 4GS7C 1U4FA 3VNZA 3LQZB 5DHMC 4CMHC 3HG4A 3J2PA 4ABQA 5BRZA 4F7KA 4KK5D 4XPAL 4WTXA 4U6VH 5ENWB 4U6HA 1GVIA 3BAXA 4KRPD 1FV1A 1YC8A 3HJ0A 2NR6C 4Z0XB 2FNWA 1F6FB 1IGIL 3ZTEA 5I8KH 1NEPA 3KS0H 4OLXH 1RZKC 3HBPA 1N5AA 2BLFA 5FO9A 1J1PL 1VFBA 2XICA 2Z8VC 3TXAA 1U4EA 4YXHH 1LWRA 2VDQH 2ZCLL 2V3FA 3UBFA 3ARED 1VPOL 1G7JB 3N43F 3ZE0B 2Z6FA 3UYRH 1D9KA 3JV5A 1UM5H 2R29A 3KW8A 2OTUA 1LHZA 1WEJH 1WUNT 3TO2B 1BIIA 2VDNL 3FF8A 3U9PH 3HZYB 4ODWB 3VI4A 2NXYB 2XG4B 2XPZA 3QJSB 2DIEA 2F53E 1HOCB 2DIJA 2HWZH 3MGTA 2W59A 1HHHB 4OF5A 4Y5YB 5DK0B 3WFCH 4ZMAT 5AB2A 4AQAA 3U6XA 5C7XL 2DQIL 2DYPA 3D85B 3ULVC 4KDTA 3P69A 1LMIA 3H54A 3TM6A 2XX1A 5HHMD 2MIZA 5GHWL 2H45A 5GZOA 3BZEA 1IGTA 2D0HA 4DP0X 5F3BA 4H8PA 3O4LE 4U1HB 1P4IL 2GK0B 4LCWD 4E9TA 1EEZA 4D0BB 1GYAA 5F9JB 2XNAB 4KH9A 3A6CL 4CJ0A 1SEQH 2G0KA 2GJRA 2X4OB 3JZYA 1EV2E 4HPYL 1Z2KA 4IOSA 4M3HA 2ZOWA 2XZQH 3HVNA 4H0HB 4NWUH 4XXWC 5I6OA 1AGCB 4L5FE 1TCMA 5IQ9A 2VDRL 4IS6B 4JY5L 4F57H 1ZSHA 1M57B 3KYKH 5B3JE 2FUQA 3PDOA 2MPAH 5F1NB 4AEIL 3OJVC 4ZUUA 4ZBJA 4S1DD 5K33A 1FJ1B 4AV5A 1JV5B 4WSKA 3D1MC 1S4IA 1MWAH 3MRKA 4RZKA 1CBJA 4K8RC 1G87A 4DAGL 1TJHL 4FNUA 1J88A 3AY4C 3IE9A 5CMAB 3ZTNH 4IRJB 3O6FA 1Z0MA 1IRAY 2Y72A 1MHHA 1AFVH 4RMBA 1XFPA 2CGZA 3X1EA 3RZCB 2CO2A 2ZONA 3KPMA 4Y4KB 1AGDA 5DJXB 4OGYH 2EVFA 3UTPD 4V1DE 1QSEB 5AKRA 5H94A 3FSAA 1UD6A 3KL0A 3VG9B 3SDDC 1MWOA 1KFGA 4OI9A 5DJ8A 3HRPA 3ULVL 1VACB 1LP9B 4KTDL 1R5VA 4LQ1A 1TQWA 1KIUA 2KLRA 2Q8AL 1FYTD 1NAMB 3D4CA 1U8KA 2WXIA 8PAZA 1R4XA 4NYLA 5H37G 1G1OA 1F18A 4JVPA 5F89B 1QFUL 4B97A 1BBDL 1QNZL 2PLTA 2AK4D 1AR1D 1J5IA 1A3LH 5IM7B 4PBDA 1E9QA 1DHKA 1PX4A 1T0MA 3HE7D 3V7MA 4I0PC 1JHKH 4OZGA 5EZJB 3Q44A 3B2UD 3RTQA 1HILA 4XC3H 3PREA 1SHXA 3QDME 5I28A 5ECJE 4XR8C 1BVKA 1GGBH 2E27H 4KMTL 2JK5B 1VGEL 2OMWA 4KKBD 4LLDB 3B9AA 3SE4A 2Z92A 3K2IA 4JQXA 1N70A 4D9LL 4ODSH 4PBXA 4AUYA 3DSFH 1AYRA 2KBGA 1EEYB 2NQCA 3UTZA 4MA7H 5F9WB 5J06A 2VQTA 5C8JB 1ADWA 3B2VL 1JV2A 4OSUH 2ESVE 3LIZA 4OD1H 3AM8C 1ZGLA 1MQKL 2X44D 4L4TB 1UUSA 5F0LB 5CGYC 1RJYA 4XP4H 4PJXA 1AHKA 3II1A 4N0RA 4P49A 5IVXF 2Z4QA 2XTLA 3H56A 3QWQB 4L9LB 1G6RH 1RKRA 2KS0A 2CR0A 3F12B 1ZOXA 5C08D 1BZEA 2A73B 3NFNA 3UCRA 2KQMA 4QRPA 2VIRB 3WKQA 2X1XR 2BP3A 1ADQL 3TEWA 3VVVA 1Z9OA 2VWEE 1PJWA 3ZDWA 4PJ7A 4LCVA 4OY9A 2BNRA 4L4JA 4GEJA 3MBED 3N55A 4LHUB 5E8DH 4A6YL 4LLUB 1S5IL 1SOKA 1A7QH 1RIHH 4OF6A 1W80A 5TDNB 4NLAA 1Z6JT 4FQ2L 3F04A 3L1FA 4LESA 3ARGA 4NBYB 1E90A 4YS4A 2HYMA 3NUKA 3RA7H 1LE5B 5HHNA 1DVFA 5ESVB 1HKFA 1F6AA 1BQKA 5D6DC 4ANWA 2A9NH 3OGCB 4P0DA 3RL1B 4UNVA 1TKWA 5TTRA 1QFWH 2X3AA 3ES6B 4HH9A 1UCTA 5C3TA 2CKBA 1NICA 4WW1B 1OF2B 4QF1A 5C6PB 2J72A 3OXSB 5CF3A 5MEQB 1CLOH 4DZ8A 4BZ1A 5FDYA 1F1GA 1BAGA 2DD8H 3ZTJG 4QYOB 4IMKA 5JPMB 4F9LA 2NY3B 1T1XB 1XIWB 3KR3L 5JHLL 4JCWA 2CM6A 1KN2L 3APDA 1OAZL 4Z7UE 1XF1A 4C8XA 2YUVA 5AKVA 2ZZUT 3LVTA 5JOFA 4UNIA 5LHDA 4DO5A 4YSAA 25C8H 4NENA 4PB9H 3N1PC 4AE1A 2BSEA 1OVZA 4CILA 2QLVB 4M29A 3MLTB 1YQVL 4FG6C 5SV4A 2CDGA 1UB5A 1FN4A 12E8H 4J3OH 3U46B 2CDEA 3IMWA 2OK0H 5E9DE 4I3SH 1NGQH 4ZPTA 5ID1B 1P2CA 3INUL 4EN3B 3AQZA 5EFIB 4IBZA 2NY2B 4JPQA 4JREC 1B6UA 4J2XA 3RWFB 4LLMA 1BZ9A 3Q6GL 1TCRA 1INQB 2YD4A 4HFWA 4ENZA 3T8MA 5BS0A 1LK2A 3MRJA 2W65A 4PS3A 3MTRA 1D5MB 2VERN 1IL1A 3VI3B 2VWEC 1QR1A 3QZMA 3FFCD 3MLRH 3V6ZA 4HKZA 4M1GH 4XE5B 2B08A 3KPOB 3D18A 4WI9A 1A9EA 3HR5A 3HCVB 5DJZB 1RU9L 1VKXB 1BXUA 3FPYA 4AVKA 4AIEA 1P5UA 2DYPD 3OZ9L 1QEXA 4IDJL 5SWSA 5C0JA 2W9EL 2GCYA 4IU3B 1NCCH 3GHEL 2EEBA 5I15H 3MCKB 1I7RB 3BOVA 1EDHA 4BFOA 3FSWA 4FFYA 43C9B 2WJ7A 4ZZFA 3QC5X 4KRNA 1JWUA 2NDFA 4PJCA 2PW2B 4U2YA 1K8IB 4TUOB 3WEXB 5FGSA 3O8XC 1OP5K 2P5WB 3UP6A 1XF2B 4FHBD 2BPBA 5SWQA 5A2LH 3PABA 4KAQL 5D7LD 2GFBA 3CSPA 3VXPA 2NCEA 1YYLH 1JZEA 1BD2A 2F7IA 1CUOA 2NY7L 5E8PA 9CGTA 3IJ7A 3MLXH 1ZLSL 2BNQA 1KEGH 1B9ZA 2NR6A 3UABA 4GIAA 1YJDH 5EIQA 3CXFA 4PRAB 1WAAA 2FNBA 4IOSD 5T5FH 3NFSH 4C56E 4UQ2B 3N85L 4D94A 3CVCA 1KCRH 3E9TA 2E7BA 3CC5B 3KPSE 3EFOB 4TLSA 2R69A 2CO4A 4XMVA 1QSFD 2WVTA 3ZDYE 4CKQA 5C0EB 1HYSC 3OKOB 5EC2B 1OSPL 4AL8C 3QXWA 1RHHB 4CMMA 2G60H 3MRNB 4B50A 2ROXA 5CCJA 4R4NC 1PKOA 2E74C 4KJPC 2PNDA 1WA1X 1JSYA 4Z7VB 2H0JA 5KAQF 1FDLH 3S35X 4A7QA 4ONGL 1I53A 4ORGB 2PR4L 3MRBA 4U3SA 3EO1A 4K3EL 5EF1A 2R1XA 3A0OA 4M7LT 4WO0A 2QEJA 3PHQA 4WI8A 3BPOC 1F0LA 4MNQE 2HN7B 3FO9A 1OP9A 2FTAA 3SJVE 4IHBA 3QAZB 5CKAA 5GGTL 3QP3A 4D9QD 1LO3L 3R7RA 5TPWL 4ZZKA 2PP7A 4LHJB 5M94B 3LYRA 2VLJE 3U0WH 3KPQA 1BEYL 4MCZB 3MUUA 4UZSA 3LRMA 1F3JA 2VJ8A 1HSBA 2WLLB 1G9NC 1Z9SA 4QRRA 2OSXA 4X83A 3ZBMA 4PV8B 2R4RL 1A5FL 3T0BA 1ZGLM 1DQKA 1TTRA 1UWXK 1KLGB 2Y23A 2BINA 1CD8A 3BVVA 5CEZE 4MA1B 1ZVYA 4UV4H 4H8QA 2VLRD 4N0CC 4WUKH 4G1EB 1NGWB 1WV7T 3KH3A 4QRFA 2JLLA 2R2EA 1DL7L 2B0SL 2O26U 1OSZB 3FH8A 1S7SA 4XN4A 4KY1L 1U8LA 2CLRB 3AB0C 3S88H 3EJYD 4XXWA 5LBSH 3Q1SL 4EMZA 3QQNA 3K2KA 3MUHL 2CA3A 4LSDA 4XXDA 2GG1A 2F61A 3WEOA 3GEFA 5KTEH 5JLZB 4HX1B 3K6IA 3ZE0F 2F74B 3SYAA 4X42A 1C5CH 5HHVH 5CCKH 4YX2L 3BPNB 3NPSC 4KROC 1MF2H 3PJNA 2RCSH 4Z3GA 1JPGA 4NQED 5IBTH 3AY4A 3QNXA 5EU4A 4BWUA 3FN0L 4LLQB 3MRGA 1QBMH 4HK0B 1CGSL 1M1SA 1S7XB 3MYJA 3LD8B 3O9WD 2OL3H 1XCTB 3QCUL 1F4YL 5A2KH 1N6UA 1AGEB 3BW9B 1UJ3C 2X09A 3A24A 5DJAA 2AJYH 4OBSA 3VXUE 1UXSB 4LSQH 4FFZH 1BZDA 2XWRA 2DQTL 3FYEB 3EOTL 1NM4A 4G8FB 4OGAD 3RVTC 4O9HH 1TJIL 5BJTB 3MV7B 4QNPF 2F53A 1IT9H 1G9NL 1NC4B 2DWDA 3ARGD 5K9QI 1M3JA 2DQDH 1CGVA 2G9KA 2P9RA 5GS0H 5H2BA 4E41D 4UQ9A 4E5XG 2EDJA 2R0LL 3RUGB 4AMKH 4DZBB 1A14L 3HPJB 1KIQB 4J7RA 1UFGA 1H6EA 1KB5A 2HFFA 4I0PA 1N2RA 1J87A 1EHNA 4UIKL 4Z95H 1KCUH 1A1OA 4XWGL 4HQQH 2H47C 3H9SE 4ZNCD 3D39B 5DK3A 3LKRA 2IWEA 4F3FA 1L6ZA 1BM3L 1ZA6B 2G0LA 5C09D 2WV3A 1H15A 1FFTB 1E27B 2FGZA 4LP8A 1PY0A 5C9JB 2IQ9H 2EQDA 3RB5A 1MJ7L 3FRPG 5ANMB 3LNDA 4Z7OB 3MVSA 5FFLA 3HE6C 4AT6A 1X4ZA 4LSRH 1IQWL 3B37A 3CFDB 4YO0B 5I1LA 3MKGA 3TL5A 15C8L 3FAXA 2E7HA 1KIRA 1QWUA 3BIAX 3CVIL 3AM8A 1MHCA 2R1YA 3QEQE 3TIDB 3BT2L 2R0ZL 4IOFC 4AK2A 4Z0BH 4LDLB 4Y1AD 2PR9A 3OR6A 2FD6L 2BOBA 4PLNC 4HUWB 1NBVL 5JUEL 4RX4A 1SEBB 3DMMD 4PB0H 4ZMTA 5J3HC 5GS1B 3I6KA 4NS0A 2H3KA 2FWSA 3NDZE 1G0XA 4MD0B 4HJJL 2K4WA 4AQ1C 3BKCL 5AW3B 1LP9F 2FECI 1MPAL 3MLYL 1DLFH 5MENE 1BZ7B 3P2TA 1IGFH 5F2FA 5HY9B 4HJ0C 1AG0A 2F54A 5J1AA 4TTDC 1BJ1J 3IE4A 2P8MB 3JTTB 5E4EC 1RZIA 4KKAC 5HI3C 1ZCRA 2BFGA 3MJ9L 3QIBD 2CGRL 1AZCA 5JW5B 4NKMB 2NPLX 3X13B 1P6WA 5D6DA 5DGQA 2VDLH 1QTSA 4JL2A 4DUXA 3ARQA 4UIMB 1RJZA 4DVBA 1DJIA 2GITB 5FOBA 5MERB 4OM1L 3WDJA 4WF7A 2MEJB 4JKWA 1P1VA 4PRBA 4LCCC 1FL3B 3QUXB 1VGKA 4YH6A 2A4CA 4E42B 1H3WM 4G8IA 4P99A 3LRGA 4K2UH 3QDMA 4HALA 3CFJB 1DBBH 2RAMA 3STLB 1N5YL 4G2AA 2I07A 1E5ZA 3DETC 3GSVA 1CICA 3X14A 4ADGA 4GBXB 2CJSA 3VFNA 6PAZA 3S9DB 5IQ7L 4R26L 5JIHA 1Y0LB 3IXAB 2YS4A 4O2CA 5F9AC 2O61B 1F8TL 3M7OA 5B22A 5LAXA 5J13B 1TEGA 1CFNA 4FXKC 1GGIL 3FCTB 3HW7A 1JGDB 4Z18A 5J57B 1HNGA 3IVKA 3BZ4B 1ORQA 3CN2A 4RFOL 4BHUA 4QRUB 2DH2A 3Q2VA 3W39B 4JFZL 1WFNA 3DUUA 4N2GA 1S78D 1OKEA 2J88H 4O2EB 4PJIB 5T1KA 1BZOA 1OAKH 2K8QA 5K9JL 1P4UA 2Z7UA 1G9MC 3PFQA 1YMMB 4YSOA 1QQDA 2R2BB 3RDJA 5L2KD 4JM2B 4APXB 3MODH 3JUZA 4U1LB 1HIML 3FZUC 3LMJH 3L3JA 1YEEL 5F93C 4XMTA 4FQJH 3I02A 5LNDA 4D9RD 4NSKA 2FEDC 1J86A 2EYRB 1CE1H 4KQ4L 1ZPUA 2Z8SA 4YHOL 5E1GA 3WS3B 4PLJC 4PJ5D 4NXSA 2W07B 3X12B 3EIFA 2D31B 4PJBE 4Y5VB 5I23A 1HHKB 4XP1H 3BRFA 4HW6A 1JERA 1QTYT 3AU1B 1C9SA 3B9KD 4KX8A 4LLYB 1E6OL 1DDHA 4QHLA 2CE6A 5I66A 3VXOA 3BVNA 3W0WE 3H1ZA 3G6JF 3IDGA 4XMZA 3REVA 1YECL 1A1MB 3C08H 3KYMB 5IF0A 2SODB 1CE6B 1SUHA 3O8XA 4XZ4A 1UYWL 2GY7B 3MLPA 3V0FA 3H55A 1V3JA 3QO1A 5GGSY 5TH2A 3UTOA 1DZ0A 1SY6L 2OP4L 4FQXC 5CINH 4M62H 4N5ED 4AQEA 2P5EB 2XWTA 3OB0K 4IGBC 2CRZA 2HH0L 1T6BX 1OGAE 2QL1A 2BSRA 4Q14A 4L8DB 4TNVK 1A3ZA 1QUPA 1DO5A 1QHOA 2XHNA 1JD9A 4G8GD 4W70A 1MFEL 4JPVL 1AHWA 1I85C 4X98B 1NGZB 4P9ML 4X6BB 4Z23A 2B4CH 4NKDB 2UY7B 4DQOL 5EZLA 5ADOL 4GRLB 3NGBC 4DETA 1KBGH 1UB6B 2XKNB 4IEFA 3VQMA 2LTQC 5GSRB 3RWGB 4OT1H 5K9OA 1DLHA 2XYBA 5DT1L 2F8IA 5E0QA 4MQXD 5I8EB 5T33L 1UH2A 1FYTE 4I77L 2CO3A 1T2QL 4J3XA 3P9MA 1NAKL 3OHXC 5C0CD 4ZTOL 3MRIA 4LCIH 5ADPH 2IANB 1FBIH 5K1VA 4DF9A 2HXAA 1ONQA 1A6TB 2CLVB 1CB4A 3BYTA 1KMGA 1VA9A 2FHBA 1E4HA 3A4DA 4FP8L 3ROLB 1CDYA 1U8PB 2CD0A 1FF5A 3DROB 4OM0H 1GGCL 5BOPA 4NKQB 1IAIH 5HHQA 1E2WA 1LLAA 4MASA 5INDB 4UTBA 2EDFA 4G72B 1EIBA 2AI0H 2WXGA 2MQGA 3WHXB 2ZF8A 5HHXH 2GJ6B 1NIDA 4IBLT 1OV8A 4M7KL 1IFHL 3DYOA 1IU1A 2AQ1A 3A5VA 1NBYA 4N24A 4YBQD 4QXUH 4M7JL 5E00B 1KULA 1R17A 1L0QA 1KJMB 2XPYA 3LKOA 4Z7WA 4WCYH 3UERA 2DQHL 1A8ZA 4P4KC 1ZJAA 2DBLH 1QATA 2XLLA 1S7RA 4P2RB 4WV1B 2QVMA 3IDXH 1OHQA 5DUJA 4MDIB 5EO9A 5ISZD 4Q6IB 4N0YH 2ZKXA 5FF6B 1OM3H 3KVPA 4S1DC 3SN6N 1BCIA 3ETBJ 5EIIG 4ONFL 1NEZA 1TZOA 3TA3C 1LVEA 3F5WA 5CP3H 2ZX9A 3CQQA 1TVHA 3C8KB 4LSPL 4EUPG 1BF5A 1NMCB 2JQAA 2ICWB 2YLHA 3UL4A 1U6AH 2XVBA 3SDAB 1FNSL 3KPSA 4M9PA 3AQYA 4Z7VF 1NPJA 3LKNA 1G7HA 4FEMA 4JFED 5D1ZI 5KVGE 1WFTA 4RX4D 5KN5A 2ZYSA 2N1KA 3O6MH 3MLUL 1ET7A 3D30A 3DXAB 3RPKA 3D9AL 1EZVY 2IPUK 4LDOB 1PEZA 3QJQB 4NI6A 3P0VH 3GSNA 1T89A 1V54B 4HSQA 2DQEL 4F8PA 3UBXG 1UJ3A 4PH8A 3HHMA 3CX5J 4EI5C 2MKWA 1FVEA 3OAUH 4ZMVA 1JGUL 2H9GA 3QIWB 3QH3A 5HGAA 1ZLWH 1XAKA 2LU4A 4WWPA 3SB3A 5E1AA 1G7QA 1LM8V 3PXJA 1OCCB 1TTGA 3EYQC 1FHNA 4OFYA 5AB0A 4PJAB 1E5YA 1Q9LA 2FK9A 4EZMA 3QXAA 3KVQA 4CADB 1E4JA 1VHPA 1JGLH 1Y6KR 4CGTA 2XN9B 2WOBA 3FMGH 2WXOA 4R4FH 5J5EA 4FTVD 2XQBH 3EKCA 3TEUA 3D05A 4Z3IA 4NOBA 1Z5LB 3II3A 4CU8A 3QQ3A 3VJ6B 3FT0A 4RNRB 3RX8A 2XWJA 4BIKA 4BKLA 4IK7A 2XKSA 1I3UA 1VERA 5SX5H 1INEL 3R0NA 3IAQA 3NH7H 3Q8AA 4M5YL 4Y5XC 5T3ZD 5AEAA 1S9YA 1ZVHA 2V7HB 5DJ0B 1S9XA 4BK8A 4NZTL 2Y7NA 2GEQA 1CICD 4F7MB 4YSRA 1MCPL 2PWGA 4N2AA 1S46A 4D7BA 2OR9L 4I0CC 5EUOB 5D2NB 1BQHB 4NO3A 2VLKD 4DGIL 4LMQE 2O5ZL 5E2VL 3DJRA 3N42B 1AGBA 3VMNA 1JZDC 5HHOE 1SXNA 2B1HH 4P3DA 3T6VA 4JEGB 5TE6L 2YPLB 2Y7QB 2YBRB 4HC1A 3NACL 4MZRA 4MA3A 1ACCA 1SQ2N 1FNFA 5FC9A 4WUUB 1CK0L 3FFCE 5DK2A 4NJAH 2VRAA 1BMZA 2R1WA 2VDRB 5A3ID 3ZDZE 4AUJA 5I8OL 2I9LB 1I9RL 4JPIB 3QHZH 3NIDE 1LO0L 4ZO9A 2YD7A 1XWVA 2K45A 1WBZA 1SJEA 2B9AA 2DLEA 4LASL 2JMRA 4QXGH 4Q2ZA 1S7TB 3FQ1A 4XPGL 5F1KC 3WBDA 3D6GA 5EEVA 3VXUA 4MCYB 1HOEA 4UM8A 4OD2A 2IWFA 4K5LA 1CF8H 3ZT7A 4NZUL 2WN2A 4Y19A 4PR5A 4N8UA 4FEIA 3RWEA 2QADB 1NJ9A 1YEHH 3ARFB 4LBEB 5D7LE 2P80D 1MH5B 5B1JA 1UASA 2YKLL 1EFXA 3EGDB 1MCSA 4J8QA 4JFVA 1EHLL 3UZQB 4NZDA 1AGFA 4YLCA 2BMKB 3WDIA 4LCCA 3TBTA 1A3RH 2GABA 1PFOA 4EZLA 5KAQG 4JN1H 4MX7A 1T1ZA 2VN4A 3KLLA 3BZ5A 4JDVA 4EAEA 3EUUA 4ZW6A 5A2AA 3VFWA 5F6IB 4G1MA 4AWJC 3ULUH 4KNTA 4XMPL 3DVGA 2I25N 2OI9C 1U8OA 3WFHA 1I1AB 4ZFFA 4JRXB 2X4NB 5HD8D 1XF5A 4FXKA 3TJHD 2O5YH 4X6CB 3FU0A 4N2EA 1FVCA 2I24N 1JWSB 4ZOEA 1D7CA 3CX5K 3FTVA 1FG2A 3O4OB 2XFGB 4QXVA 3BSZL 3QQ9C 4WEMB 3S7GA 3T08A 4A7VA 3QEQA 3BN9D 4BFEA 2W0FA 3G7TA 2X89A 2QTEA 5KVGL 2A4EA 2NUPA 3GM8A 3WKMH 3ARBD 4PGJA 1CFQA 3P54A 1S3RA 3LS5H 2BY2A 5INCA 4JPSA 3RFZC 4HWEH 2F8XC 4LSVH 3FQYA 3VSQA 1Q9KB 2YRZA 3CVHA 3AACA 4K5PA 2I9TB 1FSKC 5HDQH 2YSSB 4OQTL 2R4SL 2AMUA 3EYFA 4OQ1A 4HKJA 3FB8A 4Y9CA 1DJXA 3L3DA 5EUKA 4L23A 2BH0A 4YDJA 4N28A 2X5PA 1AHMA 1SJVA 3FTUA 1UKSA 3VXQB 1JYXA 3C5JA 2A9CA 4G82A 2NLJB 3DX7B 1SJHB 2VLRE 2J73A 2OSWA 5HDLA 3SKNB 1A2YA 3R06A 3REWA 4R3SA 5DWUH 3H53A 5I82A 4QLRA 1CZ8H 1SM3L 3EW3B 3HG0A 1BX2A 2NT1A 1ZEAH 1ED3A 5J11C 3ZLQC 4M3JA 3K6FA 4DGWC 2WWKO 3HTLX 4BSWB 3PWLA 4IK6A 3KD4A 1R6VA 1TENA 4FQXA 2MJWA 1SLXA 4HJEA 2JIXA 3P3UA 4PCYA 3FH7A 1RURL 4IGBA 4KFMA 3EFFA 4Q58C 3O4LB 3F85A 4MMZA 2EO7A 1AZUA 3ZUNC 2J6EL 2LQRA 1ETZA 2FZ3B 4GJTB 1MRFH 1I85A 4WVRA 1KZYA 2FX9L 1ZVSB 2H8PA 4R0LB 3ZRFC 2WJ5A 4JGMA 3PV6B 4HIEB 2H32A 2APTA 3LZOA 3ZL4H 4JM2F 1WGVA 3CLEL 3D0VA 1HKLH 1T4WA 2J8UE 4GP4B 3BVXA 3MPCA 2HKFH 1MCQA 2QPEB 2GSGB 2MH4A 1IC4H 1GZPB 3KPLA 4OIFA 5TQ2H 7CGTA 5JW3H 4WW2B 2Y6SC 4POYA 1C16A 2EZ0C 4JFFE 3OHXA 5EBMB 2LHAA 2XDHA 4EDWH 5L88L 4H2AA 2I60H 1LK3H 3UTTA 2X6CA 3BO8A 4E41E 3CDZB 3GMLA 2D2OA 3BIBX 5B7EA 5E6UB 2OV0A 4BFRA 1MHEB 5H35B 4I4WA 1F5WA 3HVDA 1HCZA 1CL7L 4Y8DC 2BZDA 2C9RA 3GFUA 3UTSA 1X9UA 3K6SB 2EDWA 1SDAB 2DM3A 3ECUA 2BOCB 4PJBA 1HEHC 1PYWA 2IVFC 1K4DA 2XWBB 2JE8A 1KCLA 3AXLA 3UDWC 2FJGB 5GRZA 3WUWB 4DN4L 1NGPL 1HXYA 4XMLH 2R9HC 2Z91B 1FNEA 1WC7A 3ECBA 3FFDA 4LVOC 4KXDA 4OZHF 1H8SA 3V4LA 1KCSH 5ACZB 5I0WA 5KSUB 1T03H 3PLYA 5D2LE 4DTGL 3W0WA 1C8PA 3UEQA 4GKNA 1QHPA 2FE0A 2Y7LA 1Z32X 1OF0A 1HCYA 3SGEI 4UTAH 1KV7A 2EIMB 4P4KA 1QA9A 3JWNG 4WO4D 5ESAA 3V4VA 4HPOL 3EGXB 3MREB 3FQUA 3QG6A 3DRTB 4HXAH 1B3JA 4DKAA 3IJ8A 1DFXA 4FHJA 3LKPB 5CU9A 1A8JH 2ZCHL 4GNKB 2YWYA 3H4HA 1EDQA 2H2PC 1OGAA 3D33A 3TA3A 1XEDA 3EBIA 3NJVA 3IJHA 4MWFA 4XNYH 3EO9H 4ABUA 3G5ZB 5D96B 4J3OC 1AMYA 2FBRA 2BSTA 4G6MH 3SBQA 1N8ZB 4FLOA 2ZCZA 1VSCA 3B5HA 3B1TA 1F4WL 5L7XL 4PD4K 1UH4A 4GP8B 2Q86B 3TA4D 1WCBB 2GJJA 4F7TB 2H7WA 2PXYC 1OK8A 1RIVL 5E8DL 5DRWA 2FSEA 1XMEB 4LPVA 4KXBA 4O4YH 5AOLA 5AYTA 1WQVT 3DX2A 4WTZG 2WLKA 3HFMH 5GJSL 3VCLB 1W6WA 1IVTA 2KZ1B 3MBWA 4DSYA 5IT2L 2JLPA 2ORBH 3ABZA 1DSFL 2VR5A 3T3PE 4W9HC 1Y1DA 4FNTA 1CD0A 1RSYA 2YD1A 4XHJD 4EI5A 1RZGB 3BKML 3TZVB 4G9DB 5IJDC 5F96L 3WNOA 2Y7SA 5EWIH 1SVBA 3BKJL 3VWKC 4BH7A 5EOCL 2O6FA 1YUKB 2DJMA 3BQUC 4I3RL 2WWMC 1CFMA 2VE6A 4PWIA 4M7LL 3VYOA 2YLKA 4WHYG 4YIQA 1CLOL 1HFUA 1AO7B 4BFNA 5G4NA 3D69B 3ML9A 5DSCB 1TG8A 2Y5QA 2D8KA 4X9HA 4NQTA 5KSAA 3QARA 1S7WA 3DV6A 1ESOA 2YAHA 5JQIB 1L7IL 2X2JA 3CFBA 3WTUA 1MVUA 4RQQA 5J1SC 4Y5XA 2PO6C 3GKZA 4OCWL 3CZNA 4W68A 1YDPA 4LHUG 4ZX4A 1P4LA 5IIEA 4K7FB 2EJ1A 3ILPB 1W8EA 4JR9H 3CHRA 4RWYL 2WUBH 4JN2B 4HYTB 2PCXA 3HNTH 12E8L 1OD7A 4ZS6D 5F44A 2W92A 2XI9A 3NK3A 4O00A 4W9KC 4N8VG 1M6OB 5E8NA 3D4YA 1UADC 3VA6A 1CLZH 2D3VA 3DUSB 4U1GB 3RJOA 4L8SB 3JVFC 3D09A 1BG1A 2YWZA 4JPWH 5L2KE 4ISVB 2NYZA 7FABH 1A0QH 5EMYA 2X89D 3BVTA 4XVUD 4D9RE 3DJ9A 4I5BB 2XV6B 1OP3H 2DAVA 3ZDXB 2C9SA 1DJSA 1TZGL 5CWSA 5D93C 2VN5A 3GS7A 3TO4B 3WE6B 4PJ5E 3M6DA 1BWMA 3W57A 1JNJA 1CXKA 2EO9A 1DN0B 3VGAC 2VISA 1UCBL 3LZQA 4QWWC 5E9DB 5JPNC 4NAQA 3KPRB 3HA0A 4PJAF 5C0BD 4RGMB 3I6GA 3GEWB 3ISWA 3LN5A 4PJEA 4Q52A 3E2HC 5D71H 4QT5B 3O11A 4TV3A 5GPRA 1N67A 4WFGD 1UQSB 4F9PC 5DA4A 4YDLB 1MXDA 3I3EA 2GIXA 3B4NA 4JY6A 5AALA 4XCCH 1IAOB 3L7FB 2BK8A 1U41A 4L8CB 1L6XA 1RIUL 3A3YB 1XF3A 1I1CA 3K6DA 4PJGB 4NERA 3SHSA 1F02I 3GZQA 4X5RA 2Y1AA 1KEMH 5EUOF 3HC2A 5DJCB 5IOKA 3T09A 3PL6C 3X1NA 4Z7QB 3MNMA 1HNYA 3NABL 3QWOA 3WAKA 3N42F 3GTNA 1ZK5A 1HINH 3FUNA 1GL4B 4JVWA 3MCLL 4JO2H 5L0QC 1K5NB 4FQIH 1MWAA 1A7BA 4HIIA 2LVCA 4XBPB 4N22A 2ADJB 5CSZB 1E65A 4APQC 1MLCA 1OB1B 2EE9A 5I5MA 3EUDA 1CGXA 4OI7A 4LVHC 1BBJB 5KYYB 4NP4H 3QRBA 4BH8A 3CGTA 5HHOA 2NRDA 2IBGA 5GSVA 1TQBC 3B8YA 3MSPA 5F3HA 3U30C 3RIAF 3BT0A 4C56B 1CU4L 3A67L 5KVDH 2IBZX 3OWEA 2GPZA 1EMTL 3W9DB 3GJFH 3K91A 3RFZA 4M7ZC 4HMDA 1SBSH 1ZLUK 4K71C 4A7SA 5DS8A 5EOTB 4IBVA 3Q6FA 2H26B 4HJSA 4JRYD 3GSWB 2IFFL 4XPFH 4HK3J 1ZE3H 1X5FA 1RD6A 1KLFA 5AWNL 1FNHA 1MAKA 2WXMA 3RX7A 3AADB 4KNSA 5SV3A 4A7TA 3T5WA 1ND0A 3SDXB 2C9AA 2Y06H 3B9KC 5GS0C 1EEQA 3MGOB 5CEYA 3T2LA 4UINL 2BSCA 2MHAB 1FL5B 3DYPA 3V5DB 1JHTA 1F90L 3MLZH 3R4RA 4G7QB 4NDMB 5EF3A 4NQQA 2ARJA 3FC8A 5IREA 4ZW3A 3L8QA 3OPZL 4MNQB 5JHMA 4QHPA 5I26A 4NT6B 4MA8H 4R2GB 2NQ3A 3HAEH 5CHNB 4MSWA 4F80A 1CTMA 2JJSC 3RNKA 5EEYA 1IQDB 5ISZE 1LO4H 1GS6X 1TYJA 3ZKND 3DDGA 2X3BA 3FK3A 2H3NA 1EHAA 4XNQA 4NNXA 1MCEA 5J12B 1XDTT 2C9VA 3QC6X 1OPGL 5KZCD 1E9PA 4MJID 2UXTA 4OCNC 4R5VA 1AACA 5CN3A 4FABL 2X4QB 1KYOJ 2OYKA 4NN7B 4X6CF 4DKFL 3ILEA 4L3EE 1OTTD 4JFEE 2BS9A 3AABA 2FB4L 4XCFL 3H2QA 3JV4A 3HLAB 3FCBA 3WFBL 4OTXH 5L4MA 1WIOA 1G6RA 3EGSB 5B7MA 2OW6A 3DGGA 3NZHL 1ZV5A 3T8XB 4C83A 3ZYJA 3EH5B 3ESOA 5JDSB 2YD0A 2AQ2A 1E42A 3IKCB 4OGXH 4PJHB 4YGVA 1TO5A 4KRMB 3GQFA 4W9EC 3WY2A 2BIOA 2D7MA 4D0DB 3HB3C 3OX8A 3WTSA 2NW2A 1TLMA 3ZSSA 3DGCR 5A2IH 2VDPL 2PCPA 5FV2A 2Z1KA 5KBKA 2CO1A 3AS3A 2BP5M 4LOFA 3BWZA 1U3HD 3IU4L 4WRLA 4HIJA 1K3ZA 5G2NA 3CPUA 4HS8H 4KGJA 1F4AA 2OSLA 2ZX6A 2YK1H 3CLFL 2B59B 3EH4B 3WHE1 3B83A 5JIDA 4LO9A 3OMIB 1GYVA 1UXWB 3JWDH 4UYPA 4ZOAA 1DBKL 3K5SA 2QQKH 4M5SA 2Z31A 3MRPA 2AJVL 4Y16B 5AVZB 2K1MA 4PRHD 2XSKA 3BZFB 3C9NA 2HPOA 1XBRA 3DIFA 3IPBA 3P30H 3SSGA 3UDWA 2AQQA 2GKIA 5KSAD 4QY8B 3GBML 1HWGB 4YXLH 1NGYB 1E4XI 2UX7A 1ODAA 4GO8A 1AIFA 1KG0B 5CJOH 2ZOOA 1KIPB 1JI2A 1CLYH 2IF7A 4M6NH 3TN0B 3MACL 3ROOB 4DP7X 3SE9L 1FZKA 2N0KA 2NXZB 5BO1L 3IJSB 3X3FL 1FL6A 1TQCB 1TQVA 3T0XA 1XR9B 5ESQA 2QZ5A 2YAPA 3U7YH 3CBKB 2AKRB 3LRSA 5JHBA 1JUFB 3ABGA 4JKPH 4EKJA 4E2OA 4F33B 4NHUB 3SDYH 5D4QA 1JXGA 1A6ZA 3BPLB 5SWZB 4XAKD 4H25A 4HCRL 3A6BL 4ZAKB 3FTYA 4WW2F 2CWRA 4JO1L 4PRPB 1R3HB 2A38A 2VC2L 1U95A 3V4UL 3LB6D 3VFUB 3VWJB 3X3GL 3PIQB 5CM1A 2FAUA 3HMWH 3ETSA 1UOKA 5A1AA 2ENYA 1ZRUA 1WBYA 2X1OA 5IOPB 3PWVB 5HDWA 1XXFC 2MCMA 2PPDA 1IBFA 4HHAA 3CHXA 1PPIA 4PJ9A 5B8CC 3MLSL 2K8MA 3VTMA 3WAJA 4FNLH 4JFFA 4OGQC 1UT2A 2C3XA 4K23L 2MTPA 2VDKL 4MQTB 5CCGE 3VG0L 1WAEA 2APVA 2DBJA 1JTTA 1RFDL 3CQFA 3GK8L 4JZOB 4R96A 4WQOA 5DMKB 4OLYL 3VWKA 3BQUA 1GPOL 2VMCA 2G2RB 2EEDA 4P5TB 3DX6B 1GKEA 2ZJSL 1UT1A 1J9RA 1G7MA 1S9VA 3CU7A 1I7UB 1CT8A 1GW6A 4JFYA 2CJ3A 3S5LG 4XRCB 3GMQB 1GC1H 1DBBL 2DQJH 1YEKL 3DHJA 4XPTH 3BP4A 2BIHA 2OJZL 4X0KB 3SZKC 5CN1A 2CZNA 5GS2D 4HUNB 2VDMH 1RPQA 1B3IA 5IB5A 2AXGB 2G3NA 1WICA 5FUZL 4L3CA 2PO6A 5D2LA 3FT4A 4GB9A 3RX9A 2XA8L 5T5FA 5FCSH 3F7QA 3IFOB 4A2FA 3HPLB 2EDHA 3JTBA 2NY4D 3KH4A 1WIPA 3PAVA 3IXTB 3ZHFA 1TJGH 2Y22A 3I9IA 3N41B 4KRPB 4WHTB 4FZ8L 4NPYB 4Y4HD 3ULSB 4KDWA 4X8XA 3VXRA 2UX6A 3D87B 4AYSA 2EINB 4XVTH 2WQAA 1HH6A 2B4CC 4U6TA 2HAZA 1PTZA 2IV8A 4L29A 3FTZA 3UC0L 4LQFL 3WFCL 4DPRA 1HAUA 3CPLA 1ZT1B 4HS6B 3LVEA 3WEAA 3V79C 3FUHA 2VXTH 2YAMA 2YAQA 4P23D 4ZW7A 2DQGL 1YYML 4E9SA 1XGTB 1RUPH 4ZUWA 4M6AA 2PP9A 1M2OA 2QHRH 3AREB 2BRRH 2PPFA 3L3HB 3PGCB 5DRZA 5LGHH 5A2FA 5AVXB 1JOIA 3IRPX 2MOVA 2ZAIA 3DC0A 3MUGA 1MXGA 1OWWA 4BZYA 4KX7A 1QFHA 1T2JA 3DX9B 4DIXA 2H0EA 3H7BA 4XODA 1KYUA 3TVMC 3TJPA 3KWWB 1E67A 5JPNA 1UFUA 5A43C 3CFCH 3FQWA 4LEOA 4JDZB 3ARTA 3GI8L 3G5VA 4Z3TA 4J39A 2FGWL 2VMEA 2NNFA 4OIIH 4F9PA 4N25A 1G7LB 4LNRA 5IVZB 2E47A 5T3ZL 1NFDF 1DQML 3GSQB 3S3PA 5CBAA 2UWEE 5HHMB 4Y89A 1MUJB 1JGEB 3IWUA 4ODTH 4E0RA 1IX2A 2J20A 1DBAL 2WUCH 2B3RA 3ARDD 2DWSA 4UAOB 4KKPA 4HF5H 2VKWA 2VM4A 4YHIB 3TX4A 2ED8A 1ZKAA 2ZP0T 2X4RB 4LCWB 4RWHA 5C0DA 3G08B 1AZBA 3PL6A 5LBSA 3MRDB 1P84J 4UT6L 4MLSA 3VGDA 4O2FA 4ABWA 2NY0B 4I1NB 4IOIA 1YEFL 1HHGA 1UD8A 2YO3A 2OTPA 3QJTB 2VXSL 4JHWL 3PGDB 5JORB 5JW4N 5A6LA 5HYJD 1NLBH 2Q7YB 4K94H 4BD4A 3QGVA 4UB0L 4APQA 1ZK9A 4IIQC 2F8VA 5IB4B 5CUSL 4PJ8B 3FUKA 3ZDXF 3N0PB 5ICZA 5IVNA 3JWNH 4B6ZA 1G4MA 2HTKD 2OL3A 4X4KA 2XT1B 1IM9B 3QUZD 3QZWA 4ZUSB 1A4CA 2A1WH 3GNMH 3LKQA 1FO0B 1O9VA 1BV8A 1JGVH 3PGFH 5D4IA 3VU2A 5MEOB 2A9DA 4XN5A 1F97A 3ELAT 1SFHA 1KENL 2CM5A 3GHPA 4XMKH 1FFPA 5K1JA 4FFZA 1WGOA 3RKDD 4MZ3A 1K5WA 3Q9PA 3UAJD 3IDMB 2FEEI 3S4SB 1YA5A 3H42L 5IW6A 1EBPA 3PHOA 1P5VA 3VFVB 3CSGA 2ICEA 4WIQA 3EFDL 1P7QD 4Q4EA 1T0PB 4K7PY 3ZTCC 3FTSA 3LY6A 5HJ3B 1OTSC 3JV6A 2B8OT 2Z7ZA 4WCYL 4PJGF 4PGDB 3L3KB 4H1LH 4UU9B 4HSAC 5I1IL 3IGAB 2HFTA 2AK4B 3ULUE 5FO7B 1AR1B 2JJSA 3ULAB 2AQNA 4ZPVA 3DK2A 3O3EB 3HE7B 1J8HA 4L4VA 3QIUC 4Z7QF 1AYOA 5JOPE 5E7FA 1QP1A 1X5AA 4OLWH 3OAWA 4S0SD 4AGLA 3PWUA 5JQ6H 4Y9FA 3V6OA 4YDVA 2YA0A 4L2LA 4XNUH 1PAZA 2L7UA 4CBPA 1YEGH 1FGNL 1RQ5A 5MEPA 3FB6A 1UOVA 1DE4A 4KFZC 4KZCA 4ENED 4YNYA 1COBA 2YPVL 3QUML 4F2MA 2IAMD 3C60C 2Q8BL 3GMRA 4X9FA 2XV2A 4X6DE 3T0DA 2X4TA 3HC3H 2E5EA 2IIJA 4GSQA 2APWA 3EYUL 3HG1D 2BFVH 1AXSB 4TSBL 3UZVB 5E4AA 3LEVL 1XSJA 5KYWB 1UA7A 3GRGA 3PWPB 3W2DH 4UOW0 1PDKB 4ZFQA 3GXIA 2V8MA 1G7PB 2V6HA 2NXYD 4AGQA 2NUTA 3QWRA 4KI5F 2D9CA 4XXCC 2J8HA 3CSBA 4WTQA 5D1XA 2ZSVA 5C08B 1O7DE 2ITDB 1VFAB 4OD3L 3D3VE 1N3NB 3SDXF 1R3IH 5I71C 3HI5L 5DEGB 5ICUA 4F2FA 4NO2B 4PJ9D 3RL2A 1CDUA 1RH8A 3S3DB 3DHMA 2G2PA 2PCFA 1KB9K 2ZXDA 1I8AA 3MBEB 2IH1A 4P4RB 1GTNA 43CAA 4IJTA 4QHUA 1JRHH 1WTGT 5IB1A 1FAKT 3O3DB 2B3IA 1G94A 4N9OB 4GW1B 1UH3A 2OZNA 2DMCA 4LNVA 3NH7L 1H19A 1NCDH 4KV5F 5GJTH 1MREL 2H4EA 4L0PB 3C6LA 2HJFB 1TXKA 3BGFC 1UATA 5B4MD 3OGOE 1UJTA 5L9DH 4DPAX 4DH2A 2Y9RT 2VABB 4NN6C 2OR8A 5F88B 5B39G 1I8MB 3ULUC 5DEZA 5IV2A 2DMKA 1KC5L 2WNWA 3PWJB 2WBJD 4ELKB 1JTOA 4I2XE 4MFHA 4MMYB 4LSTH 4B9ZA 4KXCA 1W16A 1KPVA 2H0FA 4GXUN 4AGMA 2AHIA 3TBVA 4LOVA 3UYPB 4NQVA 1AVAA 3NTCH 3KLHD 2ZOKB 1YO4A 3I2CH 3RP1A 3ZKXC 2EDBA 3NIFF 3S2AA 5J89A 5F7HA 4L3EA 4Y2LA 4HUVA 4DVRL 3JYCA 2YGPA 3O41A 4K9JA 4NZJA 3UTQB 2E76C 1ACYH 4OZFG 3ZUCA 4PJHF 1NCHA 4Z77B 3DLQR 4UMGA 3I9GH 4RA0C 4Y4KD 3BWUF 1N5AB 5FO9B 1KFAH 5BMFH 2X4UA 2X05A 4YHKL 1QRNE 3EJZD 3IM1A 5E8OA 1YPZE 3LHPL 3DURA 3ZU8A 3JT0A 5F7EL 3OXRA 3SBRA 2P3YA 4ZX5A 5KBLA 3I6LD 1D9KB 3FQ4A 1NL0L 2H2SD 1FNGB 5I1JL 5ITBH 3O6KL 5B8CA 2J5WA 2OTUB 4KHTL 4X9GA 3M8OL 4JUSA 4WFHD 1IKNA 2Y24A 2YN5A 2ERJC 1BQHG 4EJ1C 1EXHA 4GAJL 1CLVA 3M1BA 3WV0A 2O6PA 3VI4B 5CZXC 1OO2A 1G1KA 4OW6A 4TQHA 5E99H 2WD0A 4U7KA 3U1SH 3CFEA 1DVUA 2Q76B 4MJJA 5MHSE 3LQAH 1MFBL 2E3VA 2Y1VA 4AQAB 4Y4FD 1K72A 1UWFA 4Y88A 2WLZA 5KVFH 2DYPB 2R23B 1REIA 2QGCA 3UO1L 1CFTB 4MBOA 4Y2NA 1KJ3L 5D9SA 1BFTA 1IBDA 4NQCE 1I31A 4YHNA 3VQ1C 2GHZA 4DP5X 1TFPA 4OZIB 3OQRA 2RH0A 4BHUI 3MOBL 1A7RH 4PS4H 2IGFH 7PAZA 3GXMA 3MRFB 4HCIA 4QRQB 3WIHH 5F3BB 3QPQC 1J5CA 3IDYC 4DUVA 5ID0B 5KEZA 4KZ0A 4DK5A 5I1DB 4YC2C 5L4JA 1R24A 3FCSB 1C5BL 2HVBA 4DEWA 2ZUQB 2ATPA 4NIYE 5C0AD 4AVIA 2TSAA 4M48H 1MZZA 4ATWA 4UT9H 3CJJA 4OCRL 2YZ1A 2XWEA 3NAAH 1N4XH 2PPAA 5IQ9B 4EPSA 4OCXH 3IMUA 3U6XS 3VRIA 3IK2A 5FB8B 1FNLA 1QSFB 4JO4H 3SGEH 4LAQH 4G71B 1B4JH 4ZUUB 1XGUB 4KWUA 1HEZA 3OMNB 4LHUD 4JRYE 3WSQH 5TF1H 1NWOA 4WI2A 2WYZA 2VRKA 3EOYG 4WNSA 4YN3A 4Z6AT 1W72H 3VXSA 2J71A 4YVUA 5I19L 4MS8C 4AEHH 4XOCA 1HZHH 5D5MB 1AGDB 2QV2A 3TVMA 3RBGA 1SMOA 5H94B 3NZ8A 3U7AA 1U8JA 2HRGA 3WG7B 3HZKB 3LS4L 4AKPA 2KDYA 1MJ8L 1R5VB 1SLVA 2AEQL 4HDIA 4AG4H 2D3JA 1ZHNA 2NX5A 3HRZC 4N85A 5GRYA 1ZLWK 3G5XB 3UOAB 3PQYA 4K3HA 3T4YA 2AVGA 2Y3NA 1IBZA 2YMOA 4CVWA 6FABL 5IEHB 3T9WA 5A7BA 2EAEA 3Q01A 5GIRA 2NY3D 3N1QC 1D6EB 2XY1A 2E7LC 3TBSA 5HYSB 1MCBA 4S11A 2KC0A 4HD9A 1T83C 3OKNB 3QAQA 1Q72L 1JNLL 4IRSD 4OZGB 5L4FA 1NBZA 3N41F 3BKYL 3KXFE 3RTQB 1HILB 5FECA 1ECZA 1DANU 2BWDA 5SX5K 1S7VA 1QLEL 3VXMD 3F58H 5EPMA 2IPTL 2OMWB 2OXGA 3MGAA 5CP3A 5DVNA 5B38A 5DHVH 2IO5A 5FW6A 2AJXL 2WKOA 3K1KC 2Y07L 4JG5A 4B60A 4X99A 2VLLB 5F9OH 4NKOA 3K0YA 4FERA 3UTZB 4OB5H 4LE8A 3ZKMC 4GSRA 2LLNA 5TQ0L 1KWGA 4IIQA 2NY2D 1JV2B 1FLRH 1ZXQA 4FFVC 2NY6D 3HMXH 4BELD 1ZGLB 1RZPA 1D5ZA 3IFPA 5TE4L 1JPTH 4FMKA 1NCAH 1JK8A 3L5HA 4NQEB 4GKSB 4NO0D 4JFXA 3FQNB 1TZIB 2IMNA 5D1XD 5I1AB 1IC7L 4FMFA 4HEPG 3O9WB 3OKEA 2P28B 4KO7A 2VZVA 4XPBL 2EILB 3ZE2B 5ACMA 3STZA 3I50L 3IFNH 3PJSB 4PRHE 1TIUA 5I1KL 4RISL 1MNUH 4X8JB 5FDWA 4PJ7B 1QVOA 3QCTL 4KUZH 4Y2DC 1CFSA 5EBGA 2BNRB 4N0FA 1KTRL 4NZRL 2OA9A 5IY5B 2EIBA 3Q2NA 4U3CA 1P7BA 4KY2A 1H5BC 2KYIA 1A66A 1KNOB 5EZOH 3ARGB 2WLHA 1OT4A 2J12B 2ZWLT 5HHNB 5FYLE 4WK2B 4E41B 4NI3A 3LTVA 5FOJA 3VXTB 3ZKQD 5TE7L 4Z78B 1D6VH 5FO2A 2J25A 2UWEA 2OSYA 1B0GB 3C6LD 2AK1H 3RVUC 1PZ5A 4EE2A 1TKWB 2G5RA 2UYLB 3L4VA 3QIUA 4WWNA 2WWNA 4AM0Q 4AZ8B 5AENA 5JOEA 2NCMA 3OVUB 1YY9D 2R83A 3VX1A 1J1OH 2V2TB 4PTUA 3FDWA 3QCVH 5C09B 4DZ8B 3FH5A 2LABA 3KLSA 4TNEA 5CKGA 5TGBA 3ZZ1A 1Q90A 5IVXE 2FIKA 1BOGA 1G7IA 1A7NL 5HDOA 2E59A 2V2XA 4D3CH 1HZKA 3PRZA 1KXVC 4TSCL 2H1PH 3ARRA 3C60A 1T7VA 4LLAA 4LU5H 1H6FA 1KPUA 2A74C 1WFIA 3L2NA 2NYYC 1RK1A 4OLVH 3PE9A 2YHGA 3OM3B 2FYYA 1ZHBB 2P24A 3ESNA 4O4YL 3TYGL 5KVDE 4MXQD 3O45A 2EH7H 2WBKA 1FAIH 2X41A 3EOAB 4NBXB 3ZQ9A 4Y1AB 4ZMNA 4L2YA 1DUZA 4XXCA 4EXPX 1UB5B 1N64H 2CDEB 3C6SA 5DRXA 1NZRA 2YQ3A 4QHNA 4TUKH 4ZPTB 4PVBA 1MCCA 3IPFA 5AZEL 2W80C 2EXWC 2OMXA 3EZJB 1KACB 4LLMB 3VSUA 1TCRB 2OCJA 5HI4C 1THAA 5BS0B 4NO5A 1LK2B 1OCWL 2CBQA 2GJZA 2W65B 3MRJB 4WNQB 5I30H 4MMXC 3QZOA 1IL1B 4NUPA 3POHA 4OLZL 2F7RA 4GO6B 3PP4L 3V6ZB 4B96A 4MYPA 4UQBA 3HR5B 4ECNA 3CSYA 3CTTA 3QIBB 2X9XA 3GSOA 3NA9L 2FO1A 4JG9A 3EYOA 1BFVH 5FO8A 3CHQA 2GCYB 5KJ7E 2CXGA 1I1YA 2A0LC 4B3VA 1RK0A 3OB8A 4JR9L 4P57B 2CR6A 4ETQA 3RVXC 3LV3A 1FFNA 4NRXB 3B9DA 3QEHB 1DBMH 1TMCB 4G43B 3MA7A 2OQJA 4OJFH 2EACA 3NJHA 3V5KB 4CVZA 4PVLA 4GS7B 4L1LA 4X50A 2YEZA 2A6JA 3KCWA 5DD5L 1FH5L 2YD2A 3PWNA 2OYPA 4ZMYA 1WT5C 5D7IF 2ZQKA 4A37A 3L3IA 3P40A 5AOJA 2WLIB 3GJEB 3WS6C 5AB9A 3GHBL 1J5OL 4I8DA 3TJEH 4AYBA 3W38A 4GXVL 4F7PA 1XGYH 4HXBL 5CJQL 2H5UA 2F7QA 2XPGA 1AI1H 1LO2H 3EH1A 1YC7A 4PGZA 5MI0B 4M61A 4KTEL 1OAXL 1TEYA 2D73A 3QS2A 4WFFD 4KTGA 1KTLA 3BAJA 3C09B 4B53A 5DYOA 3EG9A 2P4AB 3Q1EA 2AQRA 2WGNB 2IBBA 1S9WA 3MRQA 3TCTA 3BP7A 3KDMA 4JCMA 3BIKA 4TOYH 2MCPH 2YXFA 2FL5A 5J6SA 1ZE3C 1Q1PA 5E2WH 1NC4D 3VW3L 4EOWH 4MAYD 5L2KB 3QDJE 2LFGA 3MRBB 3D3VA 4U3SB 4P5MB 1MHPH 2Y6TE 2G75A 4X8CA 4EKXA 4M43H 4L48A 3BQVA 1LD9A 4KI1A 1IBGL 5C6TH 1H0DA 2WQSA 4DOHE 4FN0A 1U3ZA 3WO4B 4IRZL 3GIVB 1TU2B 2AABH 4FGMA 5AL0A 3BAWA 4ZYKA 5FYKD 2VDPB 2DQUH 3IDIA 5KYNA 5FV1L 2WYTA 2NX5D 1RHFA 1E7VA 3GMOA 4KVNH 5FYLL 2HA1A 4JFHD 1GGTA 4K07A 2PWHA 2IDFA 2UZIL 4HJ1A 5JTWA 4AE0A 1Z9SB 2R51A 1ZIBA 1U8QB 1F13A 3GXPA 1YY8B 4OAWB 4I7ZC 3V0WH 3KLKA 2ROYA 1FORH 5GZND 1WTLA 4UOJA 5HYJE 5DO8A 4ADJA 3QHFH 2PYEA 4I2XA 1ES0B 1UZ8A 4ANXA 35C8H 3OD3A 4PG2C 4F7CB 1C7SA 4G9FD 1JZ3A 3K4AA 3L5IA 1N6QH 1S7SB 3MV9E 2QHLA 2B2XH 4I9XA 3EJSA 3FAWA 4BFGA 1GIGH 1KTBA 3FQRB 3O6LL 4G8GB 4XP9H 1R3KA 2YUWA 5K9KA 1TSRA 5HVGB 4YGAB 1U0QA 3R1GH 5C0FA 3WNIA 2BVOA 2D3LA 3FRPA 1M7DB 2WVVA 1NBCA 1WIUA 3HNSH 4U05A 3HOGA 5AL8A 1OT2A 2VQ4A 1KGCD 3M7FB 5IFHL 2DRUA 1T5XA 4XC1L 3S36L 1WS8A 3U2SA 1WYJA 1FIGH 2AZUA 3QNXB 4LVEA 5EU4B 2J5LC 5ICXA 3DIDA 1YPZA 2EXSA 4ZNEE 3VI4F 1Z3GL 4HG4J 3QRGL 1XEUA 2VN3A 3MYJB 4QLWA 1TO4A 1U2HA 3ZQXA 1UHVA 1EH9A 1T7XA 3TYFA 3JWDC 3FO0H 1L7TH 5E6IC 5C0CB 4MD5B 1X5GA 4IHOA 4YQXH 4HIHB 3ZR5A 5DMGC 4BFIA 3JYBA 2BVQA 5JHAA 1OGTB 4PCTA 4FLRA 3HHRB 3GBDA 1EA9C 3QUXD 4KK9C 5AAPA 1DO6A 1NLDH 5DD0L 2P5PA 2DWTA 3HRZA 4OZIF 1RUQL 4L8BB 4ZS7L 3U2IA 5FR3A 2VZ3A 5I75B 3QEUA 3AXIA 5H2BB 3H3BC 3VB9A 4GBXD 3BH9A 2E7LA 4UTAA 4M93B 3SYPA 4AYFB 3NQKA 4YK4C 1T83A 1R5IA 2ZD0A 3MFFB 4HWBL 4AOFA 3Q3GB 3ZE0E 3S34H 2FSDA 4Y7MA 1MJUL 4XPAH 3V9EA 3WLWD 2AJSH 3B2XA 3W3BA 1BEXA 5FHAL 2DPKA 5FX3A 4DKDC 1MCFA 4OJCA 2YAEA 4PY7A 3ISYA 1A1NB 1IGIH 3EJPA 4J4PC 1UC6A 3NCJL 4GEIA 4UBDD 5C2UB 1J0KA 4H0LC 1ERNA 1SDDA 5GGVY 4BYHA 1J1PH 4U1IB 3LZRA 5EBLA 4KPHL 1RJLB 2Z65C 1KIRB 4JMNA 2OW7A 2KDGA 2R1YB 5HGBA 2ZCLH 4MDRA 2W9DL 4RVBA 4RSYA 2BCKB 3OG4B 1B0WA 4FOMA 3VFGL 3WFEL 1VPOH 2BOBB 4QNPE 3ASOB 4J3UA 5D5MF 2AJUL 2EABA 4LSUL 3W82A 4XNDA 2O6EA 3I6KB 5LKNA 5JA9A 1PLBA 2VDNH 4XWOD 4I18B 1IEBA 4HU8A 4YLQT 2W91A 1IAKB 1OPOA 3GXNA 1J9CT 1GRWA 3OSKA 2CU9A 2HTLD 4H26A 1J5DA 4Y2DA 5GGUA 3SPVA 3FHEA 1IBBA 4NRZA 3CMOL 5IG7B 5J1AB 2F54B 3U6RB 1EZUA 1JWMB 1HXMB 1H5BA 2DQIH 3DO4A 5AVRB 5C7XH 3IBOA 5I5IA 3TNMA 5HJGA 3WKYA 4J6RL 4P05A 1NC2D 5GHWH 4NAJA 1YNKL 4ZFZB 4OZGF 4PRID 3EYSL 3LNEA 1KTJA 2J55A 1RJZB 3U7YL 3ARXA 4FTVB 3UZEC 2QR0A 5EB9A 1MEXL 1WRFA 5FOBB 1JPST 3B3BA 1IM3D 4P46A 1OAUL 4KKZA 5DD3L 3A6CH 1QFOA 1QI4A 2V9RA 4RRPG 4TQPA 1VESA 3IB4A 1A6UL 1I9JL 4HPYH 2I07B 1KXVA 2NY1C 2E9BA 3D2UA 1M05A 3CX2A 1CICB 3DWTA 5IMKA 3X14B 3VFNB 3IMRA 3JWNE 4HG4K 2A74A 3B7TA 4M1CC 2GI7A 2VDRH 3QUHA 4JY5H 4O2CB 4I1PA 4F5CE 2VLKB 1U2CA 1LP9E 4L18A 1PZAA 4AEIH 4PJXF 5LAXB 4GAYB 2GBTA 1WPCA 3ERXA 4Y5YC 5B1KA 5HDBB 4GW4A 1AQKH 2OYMA 3TT1L 3IVKB 5DD6A 4EQ3A 1ORQB 3S2CA 4DAGH 4WFHE 1TJHH 1EWHA 5DHXB 2VO5A 4F24A 3DUUB 3ZE2F 3L1EA 3QI9D 5AAMC 1E8XA 4PJ7F 2CRYA 2DB8A 2H6UA 1DQJB 4RMVA 3I3BA 1XCQA 5L6YL 1A64A 2Z4TA 3HS9A 4V33A 4BCYA 2GJ6D 3MRCA 5DD1H 1YEJH 4MMXA 4E9VA 4NSKB 1ZA3A 3ULVH 5I17A 1OP5H 3IS0X 4KTDH 2B77A 3KPPB 1ZTXE 2Q8AH 1QBBA 2QFRA 4ZXBA 4GRWB 2EE0A 4L1HA 5EZPA 3MR9A 5DHYB 3P9LB 3ZHNA 2E8ZA 3LH2L 3NCEB 5C0RL 3KGSA 1QFUH 2C8NA 2RQ8A 5EU6D 1GY2A 3RNQA 1BBDH 5FW7A 1QNZH 4P2RD 3O2WL 5C0GA 4L4TE 1U92B 2CK2A 1T2XA 3HZVB 2YXMA 5FIEA 1DQDL 4MXWL 2K6YA 4TUJB 5I66B 2GTWB 3BEVA 1QD0A 4BZ2L 2X2UA 1R0AL 1DCEA 2E6PA 2IOMA 4FJYA 4G80B 4XVTL 4KMTH 1K2DB 3CXHJ 1VGEH 3AAZA 3M1CA 4JHAL 4W93A 4J23A 5TH2B 3SDAD 4D9LH 1M6UA 4IRJC 3WMQA 3TTYA 1W15A 3QXVA 3QUYD 4AQEB 5EC1B 1HQRA 1SF5A 3TWCL 5FA3A 1MCLA 3WIFA 3RZCC 4Y4KC 3OAZK 4WJKB 1ETB1 2QQNH 2GW5A 3B2VH 2GUYA 5I73B 1OD9A 4G6KL 3JWNC 3VG9C 1SPDA 1UTDA 3EJZC 1MQKH 1E8YA 2IALA 2VLMD 1SYVA 4JZJB 5F3FA 1AHWB 3FF7A 1JZGA 3GJFA 3OJ2C 3QUMB 3GS4A 3BUDA 1I7TA 3CN1A 4WY7H 5EZLB 4F8QA 5J1TC 1FZMA 3G5WA 5EEXA 3OJDB 4PS7A 3NDYE 5IW3A 4RLDA 3FTGB 3GGWA 4PTTA 4DGVL 2UV3A 1ADQH 4ZUTA 4XBMA 1EO7A 6CGTA 1Q9WA 4LLWA 1E5AA 4OV6F 3QSKB 3LN4B 3G6JE 1P9MC 3MMEA 1UWXH 3MU3A 3P9MB 4WU7A 1S5IH 3J27A 2XIIA 4Y1SA 1CYXA 3VQLA 4NJ9H 4HIXL 4FQ2H 1ONQB 2JQMA 2NNRA 3LZNA 1PIFA 4JY4B 5DMJB 4ORZC 5F7YC 1X7QA 1TITA 3HAEA 5L8JB 5TD4A 4Q9RL 1AANA 1LDPL 3CDFA 4HIQA 4P2OD 5F9WC 3ZO0A 3TCLB 2GBUA 3NJGA 4A2LA 4UQIM 3TF7C 1ANUA 2VCOA 4LMQI 1T0OA 2WN3A 1T66D 4DCQA 3U9UB 2HJLA 1R3JA 3T2NL 4IKLA 4A1RA 4LCUB 1TF4A 2OAAA 1NBYB 2L04A 4D8PB 4N86A 5E1QA 1U93B 1IB5A 1V8HA 4Z7WB 2YFOA 1JZ8A 4PG2A 5ALBL 4JQVA 4KXZI 4A7UA 5IMLB 3KR3H 1HXKA 2WAQA 4ZO7A 4GQ9L 1KN2H 2FO4A 3DJZA 4G59C 1OAZH 2ADFL 5T3XD 3QFJD 3QNZA 4FQHB 1L5GA 2VOTA 4NNYA 2EVJA 1NGXA 4WJ5B 4DGYL 2G9HA 3F5WB 1FFRA 1NAML 2VXVL 1SXSA 1TVHB 5KJ4A 2I7SA 1YQVH 2BVPA 3BX7C 3FUJA 4M8VA 1PW3A 2GSIA 2WPGA 3WXVL 5DJDA 4BDVA 3C87A 4FFWD 5ABAA 4AXWB 2OMYA 3INUH 4JRWA 1BHGA 5CLZA 1DVXA 4LGRB 2QGBA 2DYRB 2P5WE 3GLZA 3L9RA 3Q6GH 4RDQF 2MNWA 4LCYB 1AQ8A 2O5XL 3QZLA 5I18L 4TPRL 4C55A 3FFOA 4ODVL 5E6IA 1D5IL 5KVFE 3QDJA 5JXEC 2GTQA 3D4ZA 2OTWA 4JM4L 1ZTXL 1PKQB 1FVEB 3CXHK 5IHZA 3APMA 2WY3B 1PJ9A 4XNXL 1XB3A 5JPMC 1XIWC 3OZ9H 5E1AB 2P1YA 1CVSC 2Y5TA 4IDJH 2W9EH 2H1LM 4NQUA 5DFVC 3FQ2A 2JQZA 3GHEH 3K1DA 3KGTA 2CCWA 1KLUB 1BQUA 3CIQA 3QXAB 2HMID 2IGLA 4FNPA 1I1AD 3DV4A 1BM7A 1FRGL 1KGUA 1R5WA 3DOSB 3GLAA 2GBAA 4FI7A 4KAQH 4P46D 4TVPD 5DI8A 2XWJB 4BKLB 4Z7VE 3UGEA 3S4SG 1RLWA 2NY7H 4WO4B 3AGWA 1ZLSH 3GUTA 4EN3C 2Q7AA 1KT2A 1S9YB 5E7BA 4GI8A 2WYHA 6TAAA 1S9XB 2NY2C 1TJMA 4QRSB 4J4PA 1BAWA 3N85H 5I76B 1B0RB 4HOXA 3MV9A 4K73A 4NO3B 3VFRB 4XVJL 3BP5A 3SDCD 3BD5A 5DRNA 1L0PA 4Y9BA 4OF7A 3SKMB 2X4PA 1FNAA 3NJLA 1AGBB 1N18A 1ORSA 2Z7YA 3P4MA 5CLTA 1ZV2A 3TBYB 5IROC 4HLZG 2Q3ZA 1AMXA 1OLLA 2J1WA 1QFWI 2L8AA 3RY5A 1HHJA 1CI5A 1E9OA 4YDKL 5A2BA 1ACZA 2NNCA 3OTTA 1WG3A 3MNVB 4QRTB 3DTDA 1I8IB 1OZTG 3K80A 4MA3B 4U7MA 1MCKA 2YQGA 4ONGH 4HLEA 4MHHG 3ZY7A 5HYQA 2Q7NA 1JZ2A 2PR4H 4HUXA 2HT2C 2FWLB 3O0RL 4K3EH 2CHXA 1TTUA 4NN5C 4XBEH 3W11D 1TZAA 3D0LA 4PLKC 2H1XA 4IBUA 1WBZB 1SJEB 3LQZA 3LQAC 3IDUA 5GGTH 2QELA 3SQOL 4YR6A 3WD5L 2EUWA 1LO3H 1X6LA 4Q2ZB 5TPWH 1BYNA 1D2PA 4FC3E 4BGDA 4ZXBD 1ILUA 4Z0XA 3UG3A 1NA8A 3F01A 1BEYH 4X8GA 3GUFA 1TZ8A 3D50A 3LXAA 4IU2B 4PR5B 2BS71 2C1OA 3RWEB 4W1TA 3TV3L 2HVJA 3ILDA 1NJ9B 4TVUA 1CG9A 3KEHA 2R4RH 5ES4B 1A5FH 3O3BB 2CNYA 3WIIL 3UZEA 2L3BA 1J11A 4KO6A 1HWWA 4U6XB 1JK9A 1MFVA