2RACA

Amicyanin reduced, ph 7.7, 1.3 angstroms
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMICYANIN)
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2racA00
3S3CB 1KDJA 3PAZA 5A7EA 1J9RA 1PAZA 2YAHA 2IH8A 3NJNA 1L9SA 4YL4A 1M57B 1BQRA 1A4CA 1NIBA 4W1TA 3WNIA 4JHUA 1KV7A 5TK2A 3T6XA 2Q5BA 2XYBA 2J5WA 1NWPA 4YSQA 1AIZA 4GY4A 2XU9A 1RZPA 4DP9X 1GS7A 3OM3B 3UAEA 4WKXA 2UXFA 1M9WA 1F56A 4G7SB 4BDVB 3NSYA 3FU7A 1ADWA 1JZFA 3FSWA 4M4RB 1B3IA 3PCYA 3AG2B 2Q9OA 2DWTA 3QJRB 3D12B 3NSFA 5B1AB 5ANHA 2YXWA 1SDDA 4KO6A 4YSEA 3HEIB 1W8EA 1E5ZA 2LLNA 2ZXWB 2PCYA 4DP8X 2XV2A 1GSKA 3DKHA 2HX7A 3MBWB 3X1NA 1VLXA 3NP3A 1PZCA 3V9CA 2GHZA 3TBCA 3X2QB 4YVUA 3ABKB 2HX9A 1ASPA 1SJMA 8PAZA 2Y69B 1PZAA 4A2GA 4DP5X 1PZBA 1ILSA 3WNJA 1AZCA 2PPCA 1ZIBA 1I53A 4Q89A 1J9TA 1TU2A 3GYRA 1X9RA 3WIAA 3ABLB 3GDCA 5TK4A 4KNUA 2GIMA 3PLYA 4HAKA 3HB3B 1NTDA 1PLAA 2IWEA 3ZIYA 1JZEA 1PF3A 3ASOB 1WS8A 1AZNA 1NZRA 2CCWA 3OQRA 1BAWA 1MZYA 2H5UA 4YSDA 2UXGA 2I85A 1AZUA 2QPEB 3QQXA 1A3ZA 4G7RB 3DIVA 1GY2A 3ABGA 2EILB 3FSAA 3MX0B 2MTAA 1GY1A 2IDUA 3IE9A 1KYAA 2AZAA 3KW7A 1E30A 2FT8A 4GXFA 3SQRA 1AZRA 3N2JA 4NB7A 1JERA 2VM4A 1A4BA 2DWSA 2PP8A 1BXVA 3CG8A 1A65A 1PLCA 4NERA 5D4JA 4AKQA 1BXUA 4KO7A 1NIAA 3FU9A 4N8UA 1NPNA 3AG4B 2A3TA 2PPAA 2VW6A 2FT6A 4DP7X 1V54B 5I6LA 1ZDQA 2VSKB 2PPEA 4A2FA 3QJVB 2VW4A 3SBRA 3L45A 4ENZA 2CUAA 1GYCA 4G7QB 3EH3B 1BEXA 1WA2X 1EZLA 4KO9A 4E9SA 1J9QA 2R7EB 2RACA 3UACA 1L9OA 2YXVA 1HAWA 2YQBA 5F7AA 4HALA 1QHQA 4N4YB 2YAQA 1PNDA 1TKWA 2XXFA 1BYOA 4DP6X 1CURA 2GC7C 1PNCA 2CALA 4MFHA 2JXMA 3BVDB 4RH4A 4FAAB 1JOIA 3S3BB 5I6OA 3T6ZA 4QLWA 4AKPA 1YLBB 2BP8A 3CVDA 4KNSA 3NYKA 1QLEB 3FYIB 4FA7B 4F2FA 4JKNA 2MRYA 5I5MA 2FNWA 1X9UA 1HAUA 2YAMA 1GS6X 3FS9A 1GR7A 3UAAA 3UABA 1RCYA 4DP4X 2HX8A 2J56A 2XUWA 1R1CA 2UXVA 3IBOA 2BW5A 2FTAA 3OMIB 1BQKA 4YSAA 1DZ0A 3H4FA 4YSSA 4HHWA 1TEFA 2JFCA 2UXTA 4HCFA 3AZUA 2PCFA 2BHFA 2HRGA 3WKQA 3CDZB 2B3IA 3CVCA 3AW5A 1JZHA 4BK5C 4P5RA 1WS7A 3U25A 2XVBA 3ZDWA 2PLTA 1KDIA 1ZIAA 2YAFA 4YSUA 2P80D 3OMAB 4BWUA 2PP9A 1OCCB 1XMEB 2JKWA 2X87A 2CJ3A 4DP1X 1OE1A 3T71A 1ET7A 2AFNA 1EHKB 3NJHA 1ILUA 1AQ8A 3QJSB 1WA1X 4KNTA 4BWTA 2YARA 4GP4B 5D4HA 2IDFA 4G71B 2WO2B 4CSPA 1NDTA 2GC4C 3V9EA 3TASA 2EIMB 2GBAA 4A2EA 3UGEA 3ABMB 5I5IA 1JVOA 1GS8A 3AG3B 5I26A 1V10A 4UANA 1JVLA 2I7OA 5AKRA 4EF3A 1KBWA 3PAVA 2FJSA 2FQFA 1JZIA 1W6LA 2VW7A 4YSRA 1SF5A 3TBBA 1E67A 2DYRB 3NP4A 2BP0B 3N55A 3PAUA 3QJQB 4HHGA 3WI9A 1FWXA 4PCYA 6PAZA 1ZPUA 5B1BB 4DP2X 3T6WA 5B7EA 1AOZA 4YVNA 2YAOA 2BWIA 1L9TA 3PXLA 1AANA 3TA4D 3NJIA 3X1EA 4G72B 4ZK8A 3S8GB 4G70B 1SF3A 3PPSA 2IDQA 1NIEA 2XV3A 4YSTA 1L9RA 1SHWA 3GXUB 1IBZA 4AZUA 1URIA 4DPCX 1JZJA 4BXSV 1IUZA 1QNIA 4F7KA 2UX6A 1MDAA 1CUOA 4HIPA 2EIJB 3IN2A 6PCYA 3T9WA 1FFTB 2FWLB 2PPFA 1HFUA 2W88A 2HXAA 3NSCA 3AG1B 4A2HA 3X1FA 1ET8A 2E86A 3QJTB 4BWWA 2J55A 2YAEA 7PCYA 1MZZA 2IDTA 1SFDA 4QKTA 2J57A 1A8ZA 2QDVA 5PAZA 4GP5B 2WO3B 4AI7A 3NJMA 1AG0A 1XB6A 2VN3A 3FYEB 2FT7A 5I6KA 4A66A 1N70A 1IBYA 5B3SB 4E9TA 4GP8B 2R7EA 4TXVB 7PAZA 2FQEA 3NT0A 1ET5A 1OCRB 5IY5B 1CYWA 1NPJA 2BW4A 2AANA 5FC9A 2BWDA 2BP8B 4HZ1A 4GYBA 5B7MA 1W6WA 3S3DB 1J9SA 1ID2A 2XXGA 1SHXA 3RYMA 4A67A 1OE2A 5EHFA 4DP0X 3OMNB 3NJFA 2PP7A 2QDWA 1KCWA 1OOWA 4E9VA 2QPDB 3WKPA 4E9YA 3FT0A 2WSDA 4NAJA 2DYSB 1MG2C 2H3XC 2OJ1A 2IWKA 1AS8A 1RKRA 2FQDA 1XB8A 1CYXA 1SFHA 1JXDA 2H47C 1NWOA 3EH4B 1NIFA 1L9PA 2VSMB 2UX7A 2XV0A 3CDZA 4CSZA 3FU7B 1DYZA 4M3HA 1T5KA 1OV8A 2ZOOA 1BYPA 1GW0A 5I6MA 1AS6A 1ETJA 2CAKA 3QJUB 4YSOA 3FSVA 1AACA 4BDVA 3OD3A 4PAZA 2Y1AA 3NJLA 1CC3A 1SDDB 1ASQA 3EH5B 1JXFA 3IN0A 2GB2A 1AG6A 4P5SA 4X4KA 3X1BA 1JZGA 2HRHA 3DTUB 2I7SA 3FQYA 2N0MA 1OF0A 1UATA 1A4AA 4DPBX 5F7BA 3T6VA 3BQVA 1NIDA 4KOBA 4F2EA 3ZX1A 1NICA 2VMJA 3FU8A 1PCSA 1J5CA 3ASNB 3S8FB 2EINB 2EIKB 3NSDA 5B7FA 1NINA 2DV6A 3FPXA 2CBPA 4Q8BA 1ZDSA 5D4IA 2VM3A 4YSPA 4WTQA 4DPAX 3NJKA 5E9NA 2IDSA 1WAEA 2BO0A 2FQGA 3CVBA 3NJJA 3NJGA 3JTBA 3FQ2A 5B1JC 4UAHA 5I5JA 1FA4A 2BZ7A 1AS7A 2IAAC 4UF7C 3AY2A 2BP0A 3G5WA 1OCZB 2XX1A 5I28A 5I6NA 2IWFA 2AZUA 3IEAA 3QPKA 1PMYA 1TEGA 4E9QA 3CZUB 1N68A 2AVFA 5PCYA 3UADA 1ZV2A 1XB3A 1BQ5A 1ASOA 2ZONA 4JHVA 4E9WA 2YAPA 1MG3C 1PLBA 2XLLA 3TU6A 1J5DA 4E9RA 4E9XA 4KO5A 2BZCA 1IKOP 2PPDA 4A2DA 4L0PB 3H56A 2P80A 1SNRA 3FQ1A 4K9JA 2ZWNA 3C75A 1IC0A 3FSZA 2OCCB 3SBQA 3WG7B 1OCOB 3JT2A 2NRDA 1KCBA 1V55B 2GI0A 2HZHA 2XX0A 4A68A 4YSCA 1E65A 2IH9A 1AZBA 2W8CA 1WA0X 2QT6A 5AFAA 1PY0A 5I6PA 3ERXA 2GSMB 3H4HA 1L9QA 1AAJA 1BXAA 3SBPA 9PCYA 4W9ZA 1RZQA 3ZBMA 3KW8A 2B08A 3X1GA 1AR1B 2X88A 4AX3A 3FPYA 2TSAA 4AKOA 5B1KA 4KOCA 1KGYE 1OE3A 4HCIA 3EF4A 2DY2A 5AZUA 4BXVA 2TSBA 1KBVA 2XWZA 2OV0A 1M56B 1E5YA 2HLEB 5LDUA 5B1JA 1JXGA 3EHBB 4HCGA
chains in the Genus database with same CATH superfamily
1HH6B 1IBFA 1OD9A 3KWTA 3PAZA 4M5YH 4L1DA 5AENA 3DO7A 5I1KH 2C4XA 1BQRA 1V3LA 2DMGA 3LNGA 1A4CA 1MHEA 2XI9A 3MUHL 4R26L 4MXWH 3VI3A 2EVJA 3P3YA 4GXUN 3T0DA 4MJ6A 4ORGB 4PJ7E 3CXHK 3DX4A 4X5XB 3GEWB 4I3RL 3QP3A 3RURA 1GYWA 3RBSA 4PJAA 2G5UA 5ITFB 2WIIB 4FEIA 5D8JH 4CGUB 1IJNA 1N7ML 2YOCA 3WIIH 2NXZC 3T4AA 1KYUA 3WFBH 2YRPA 2IBZX 2F9BT 3AG2B 1PKQB 1SDAB 3PCYA 3DPDA 3JTSB 2K9FB 1GSMA 2KC0A 4ADIA 3L5XL 1QZ1A 5EIVA 3LEYH 1AE6H 3GSWB 5LGHH 5JIDA 1EHXA 2I9LA 5AVYB 3N3EA 3VXMB 4QMEA 1UACL 1D5IL 5INDA 3VDCA 1LDPL 2XKSA 3FN3A 2DLHA 3D07A 5IB3A 1S8DA 3IMRA 5IVXF 2GJ6D 1B6DA 3GZPA 3HE7B 3IDXL 3I2CH 1UEMA 1YYLL 2Y69B 4M61A 4F1ZA 1JZ4A 4M93B 1ZK5A 1HKFA 4WENB 4AE1A 1QNZH 4K3JL 5FUCC 3Q6GL 2DQEH 3G3LA 5KYYB 4EI5B 1U6AH 1I8IB 5T1DH 1YQ2A 3DOIA 1ZEAL 2YEZB 3AM8C 4HVBA 4FFYL 1BWWA 2EIEA 3VXSE 2QSCL 3L1OL 1RZIA 2CGYA 3ASOB 3WS6A 4DGIL 5EUOB 5GISH 4PJCB 1FL6A 2I85A 1A6ZB 3MN8A 5DRXA 5CM1A 1W8NA 2EILB 2WMPB 3C5JA 3LN9A 1EAPA 1GPOL 2NY4B 4R9HA 3AUWB 1C5CL 1F42A 2V2XA 3H9SA 4PG9B 2WXMA 4WNQA 5HTSA 2HKHH 1NFDA 2APFA 4MS8D 5JMOC 3BZEB 3WKYA 5D1XC 5DVLA 2GTZA 1S7QB 2F6AA 1BXVA 5EO9A 5KBPA 4UZGA 1YYCA 4JFQA 2AK4E 3S7GA 2ICWI 2C3XA 1DANU 4PGZA 4AZ8B 3GMRA 4Y4HB 3EYUH 1QSVA 2N3JA 3RAJH 5D2LE 1A9EA 1MLBB 4PWJA 3JWDL 2FT6A 2MJWA 1B2WH 4N2EA 1OAUL 4HKXA 4BK5A 2LV4A 3LXAA 5HYQA 4E0RA 3BYYA 2AAAA 1ANUA 2PPEA 3SGDH 1VGKA 1YNTA 2J1ZA 2VWEC 4G7QB 5FYJE 1BEXA 4OLWL 4WK4B 4CDGC 5I1AB 4L8DB 2DJ4A 4Z76A 4F24A 3QRBA 4NQVA 3HE7D 2BVQA 3GTNA 4PJ7B 1QHQA 2YAQA 1PNDA 3DSFH 4L3ED 1JZ7A 3RIKA 3PL6C 1T1WA 5C0ND 1S3KH 2ZAIA 4KVPA 3QUXB 1HHHB 4TNEA 3NPSC 3SJVE 1ZT4B 2XPGB 1RZ8A 3APFA 1QUNB 2BP8A 4P5TA 4YXHH 3NYKA 4D8PB 3PU7A 4OJCA 1WF5A 2AKRA 2V5MA 4CADB 2FNWA 2HRLA 5TDNA 1X9UA 3V7AE 3QDGE 2L8AA 4JG9A 2ARWA 2EADA 2YAMA 1I7TA 1IEHA 4BFBD 1IBBA 3WUWB 3FQNA 2JCCE 4QRQB 3X3GH 1HI6B 2NY4D 5F72S 2YZ8A 3FONB 4G9FA 3UTTD 5J11C 3A47A 3N85H 3OKYA 2O4EA 2BW5A 3T0EE 2NY3C 3HS0C 3OMIB 4G42B 4RLDA 4AW4A 2WYIA 2DLEA 2MWCA 3ZMNA 1Q9OA 2CXKA 3DX3A 4YSAA 5F9OH 3VQMA 3BVVA 2PCFA 2HRGA 1P5UA 1X4ZA 4AIZA 1FO0B 3BIKB 5CZRA 1FI8C 3WXWL 3MU3A 5J6SA 1W72A 3QFJD 2CPCA 1DQQA 5LAXB 4FI6A 4DVBB 4Y4HD 3OXRA 4NJ9L 1RY7B 2P80D 2OLDA 3VXSB 2E5EA 2EXYD 2ALAA 2IQAB 3HZ3A 3H85A 3GMLB 1ETA1 3QIBD 3GD1C 3S3JA 6FABL 4ODWB 3O41A 2KI6A 3W9DA 2R4SH 2P8PA 4XAKE 3DJTA 1S7SA 4OF7A 2AHIA 3JV4A 3MMEB 3VG9B 5D1ZI 3DTDA 1QX1A 2YS4A 2NDFA 1WA1X 2WVVA 3O6ML 2BSSA 2Y25A 2X09A 3NJXA 1FN4A 3QAZB 1L6XA 1E2VA 3BE1H 5H37H 1YMHB 1GVIA 3SQBA 2GC4C 2PYEE 2V8MA 4LPUA 5ERWA 5AYUL 1CICA 1U93B 4B97A 3C60C 4BHUA 1X5XA 2GBAA 4JRYA 2AK4B 2OR9L 5IW1B 4CMMB 5I1GH 3DJ9A 5D2LB 1N2RA 1A4KA 1F4XL 2DLFL 4KKBC 1JVLA 2BNRD 1JCKA 3FT2A 1IMHC 4JM0A 4K5NA 2NT1A 3TZVB 1T7WA 2H0PA 4IU2B 2X2JA 3OMZA 4YSRA 3L95B 2G75B 3UBXA 3TBBA 1RJLB 2JKLA 3OQ3B 2V7HB 3GUTB 1YEGH 1TVDA 1FWXA 2CJUH 1KN4L 2HTLC 1LE5B 1HQ4A 1EGJL 1ITCA 4ANKA 5GZND 4Y2DC 2HMID 5DD5H 2OYMA 1ADQH 5F88B 3FT1A 1INQB 2VLJD 2GUOA 3PXLA 1AANA 4HQQH 5JOPE 4P9MH 2FX9H 4ZUVA 4DK5A 2NY2B 3QDJE 2J25A 3SJVB 2V0AA 3VXSD 4WSKA 3HN8A 5EV7A 1W72H 1N4XH 3CLFL 5JW5A 1BZEA 4HKJB 3KL0A 3VD7A 2X4NB 3QDGB 3MLVH 3P2DA 1URIA 4FZEH 1U2YA 3KDMB 2XACC 4XCEB 1W0WB 4HS3A 4HIQA 4WZ9A 3RDTA 4POZD 4S2SA 4TLUA 1KUMA 2JCCB 3IN2A 1NKRA 3APNA 4AYID 1XGUB 2CGZA 3T0EB 3HG0A 3RWGB 3UJJH 3O8XA 2RR3A 5AAPA 5KJ4A 4CN4A 4M6NL 2FJGA 4JN2A 4BWWA 4R0LA 2J88L 3HC4H 2CJSA 4QKTA 1B4JH 1A1OB 5E4IA 1IX2A 1FAIH 1ZVNA 4C4KO 5J6HA 3HUJE 4JY6B 1C8PA 2FYYB 3HHRB 4YLQT 5HVHC 1Q0XL 4AENA 2AMGA 1RVFL 1DJWA 1TMCB 3TZVD 5BNXD 4V2BA 2Y7SA 3RGVB 1Z3GL 5FYJD 1OCRB 2HFTA 2BW4A 4ZMNA 3OAZH 3ROOB 1T2JA 4FQQA 5JA9A 1F11A 4X6CA 1WFTA 4AUYA 4LDLB 2BNQE 4M8QA 2FGWH 3FB5A 5DJXA 4AEHL 2VMDA 1UA6L 3M17A 5EF2A 4AL8C 3L3OA 5EU6A 1CS6A 1Z9SA 1MCOL 4HYTB 4PJDE 3CFEA 4KPHH 4RQQA 3SJVD 4BSWB 5JZ7D 5I18L 4XNDA 3VD5A 5CS7A 4ISVA 2WB7A 4RGMC 3ZTJG 2FEEI 2MPVA 2FB4H 4KMLB 2IOMA 3HMXL 4P3CL 2V5TA 1N0LA 5TDOA 4BFEA 2ZOTA 1JXDA 1BJ1H 1AO7A 5KVGH 1E50A 4OJFL 5IHUL 1RK1B 3WE6A 1WFNA 3HI6L 5LJYH 3TJPA 3SIKA 5DRZB 4M3HA 1CTMA 3GGWA 4BFNA 3RVVD 1WYJA 1JV2B 4EUPB 2WLZA 5J8OA 5GRZA 1IAOB 1KLUA 4RX4D 1IC7H 5HYSA 3VRIB 4UIMB 1JNNL 3ZL4L 1QVOA 3L16A 3EIFA 1WC7B 3LPGA 3QDJB 2WBJA 1ASQA 1BBDH 1OXYA 2NY1B 3ZDZB 4WI0B 4YHNB 2GEQA 1AG6A 1XZ0B 4OCMC 1XF4A 4PVMA 4X4KA 5JO5B 3HPJA 1WZ1L 1BCIA 3CSTA 3DURB 1NCDL 4XAKD 3RGVD 2VDMH 4XP1H 4B50A 2CU9A 1HHJB 2BIIA 3REVA 2EYTA 5BUGA 5E2JA 5E08H 2COQA 3QCVL 2DLGA 4LAQL 4Y9CA 5FF6B 1KZYA 4Z95H 5IT2H 3RPKA 2PYED 2CBPA 1JGEA 1KXVC 1MQKL 4JRXA 1AY1L 2HFGH 4PRPE 1Y7VA 4X6DF 2X4RB 3MRFA 2CHDA 2WVSA 1JHTA 1DBJL 3HUJB 1YEIL 4CJ1A 5IFAH 2BK8A 3O6FA 1MUJB 4GAGH 2WKOF 4XB7A 3G08A 4PTTB 5FXCH 2Y9RT 5HDQH 2B2XH 3H2WA 3U48A 1F3DH 3G5WA 4JO3H 3V0WH 1P5VB 4KK8C 2AZUA 5FK9B 5C07E 4CU6A 1ZA3A 3BZ4B 4UTBL 2ZXQA 3S36H 3TBVB 2VXQH 1KB5B 2L0DA 4N86A 15C8H 1G9MC 1Q38A 1RZ7L 3MO1B 2BNQB 4N0FB 1GGIL 4DHLA 1ACYH 1M7XA 4NQXB 1G9HA 3E8UL 2G60L 5JOPD 4XCFH 1UWEH 5D7LD 3QDJD 1TTRA 2NY1D 2XT1B 4PJDB 4WFED 4N90E 1GMEA 1PDKB 4P3DB 4UTAH 1CE1H 1I9JL 4F15B 1L3NA 1LP9A 3S36X 4BA8A 4OLXH 3MLXL 1KPVA 4FNPA 4LEOA 1FO0L 3BZ5A 2IEPA 1J5OH 4H0HB 1OTUC 4K7PL 3H2QA 5FA4A 1P2CB 3FNKA 1TFHA 3IMVA 3PWUB 4FL4C 4PJ5D 3EGDB 5H35A 3TVMA 1UM4H 2X4SA 5HDLA 4PRBB 1JNHA 4X83A 5DI8B 4WO4D 2IF7A 3ALXA 3IDJA 3TBSA 1CGSL 3RUGA 3U1SH 3AS2A 4KJQD 2A9ML 3EYFB 2IGTA 4OF3A 1YNKL 2AV1B 2ZOWA 3KR3H 3HZKA 2VZ1A 2YXFA 1QBMH 3EYVB 1NEUA 2ILLA 2UZYB 2AJ3A 1T89A 2GTWB 3CH8A 1DBKL 1RK0B 3FPYA 5AUMA 4FQLH 1PEWA 2IXQB 1F4AA 4ALAL 4CSTA 3AREB 5HPOA 2R39A 5DR5L 4ZO8A 4Y89A 1KXTA 1BDYA 1SBSH 2BNQD 1E4JA 3BPNC 2IH1A 5B1CA 2EKJA 3BSHA 3CMOH 3NRFA 3QAQA 5EUKA 3WNPA 1UQSB 1MY7A 4G7VL 4JUSA 4LKCB 4TLTA 2VQ1A 3E8VA 4UDTA 5FYJL 5J89A 4KY1H 2DQGH 3GI8H 4PJGE 1LO4H 3BAXA 4M29A 3LAFA 4KXZI 3HC2A 3V0GA 5BRQA 4K23L 3I85A 1YYMH 4XP5H 4I5BA 4MRCA 1DCLA 2J5WA 3PWPD 4LCYA 1IZKA 3UO1L 3DGGB 4HIEA 1XH3A 1DQLL 3GUFA 2HP4A 2WLJA 3FU7A 2XA3A 1D5RA 4KH2A 4LSQH 5C07B 2IDCA 1XO8A 2ZICA 3MZGB 5E94A 3VDBA 4BUGA 5KVEH 3BUBA 1Z0MA 5EO1B 4FHKA 1AI1L 3MNVB 3QWRD 5JPMC 3KLKA 5IOPB 4HF5L 5FCUH 2FNBA 1MLCB 1HL4A 4NXSA 4XVJL 2GK2A 4BQ8A 2YK1L 1THCA 5CWSB 2NYKA 3IXAA 4S0HA 4YBLB 4BFJA 2XV2A 4DP8X 5GS0C 1Q1PA 3KBEA 3QIWB 3SDDC 2QKIB 1KB9J 3MBWB 1J8HE 5E8OA 1WVZA 3BSGA 3KPPB 4TYUA 2YN3A 5BXFB 5DWUH 1Z6JT 2BSBA 2OXGA 2F8OA 1S6NA 3ARED 2D3LA 4MJJA 5EBLA 3DPBB 3KHOA 3SDXE 5IUSA 2BOCA 2A99A 3ABLB 5DMGD 3QCTL 1JK8B 3ARBB 3P3RA 3OZ9H 3KMDA 3S4SA 2F1EA 1KFAL 1TVBA 1K8IB 3PWLA 1MJ8L 2ATPB 3G6DL 5SV4A 2DMBA 4DERA 1LO3H 1MFUA 1X5MA 1NZRA 4GKLA 3GSOB 3AXHA 3WIHL 4JHWH 2JB5L 1X7QA 4HWNA 2OZ4H 3B43A 2OMBA 3FQTA 3AXIA 3L6FB 1KEGH 4PB0H 4PRPD 1UUSA 2EE2A 4UQCA 1QR4A 1ZHBA 3KPLA 5SX4H 1TZGL 4U4IA 3HE6C 2RHEA 2Y06H 4M02A 1S7WB 2A4CA 3KW7A 2RD0A 5J12B 1T04A 5I1IL 1A7BA 5EU4B 1BM3H 5C07D 3AITA 3ML8A 5GRWA 3U2JA 1MJJA 1B88A 2X53A 2VDLH 2X2UA 1BZDA 2JI2A 2CO7B 3UC0H 2NX5E 3WO4C 4A37A 1ML0A 5I0WA 2B14A 2J1XA 5I6LA 1A7OL 3NCYP 3FB6A 4Y9BA 5HY9B 3OVUB 4NRXB 3TNMA 2HT3D 3G6AA 4PJGB 1U3HC 3VYOA 4BV1A 5HPMB 1SUJA 2HVKB 4Z0BH 2VMCA 5CEYB 2J2ZB 4R7DB 1SEBA 3VE0A 3IF1B 1FVCB 4MFHA 1TETL 2WTRB 5DXWA 4ELKA 4PJIF 3ARBD 1MEXH 1F90H 3CK0L 3VYNA 3TO4A 1PIFA 2G2RA 3QB7C 3W5MA 4OR1A 5C2BH 3GK8H 1X5FA 1CDHA 4WI7A 4L1SA 1OB0A 2W0FA 4WHDA 2UY7B 4PUBH 5EBWA 5A1AA 3VXRE 4GW4A 2UVEA 3OAYK 1DP0A 3CNKA 3ARZA 3GLEA 2ZKYA 4XPGL 4DEWA 4XNZB 1FORH 1H8SA 3TPUA 1NFAA 4M1CD 4L29B 4WNJA 4JB9L 5CBEA 1BBJA 1MJUH 1TSRA 3FO1A 3MTXA 4KGLA 3CDZB 1NDMB 1F2XK 3SDXB 4LNVA 3B7TA 3SPCA 1JGUH 4M5ZH 4LRNH 1UKSA 5A6MA 2R8SL 4YMPA 2JKSA 1SLUA 1A47A 1OGAD 3OMAB 3IKKA 4TUOA 2UWEA 5DO2C 2X87A 3MRRB 1I7UA 5JOFB 2FLBT 2P49B 1I9IH 4TVPD 1M1SA 4W9FC 2Y3AA 1AD0B 3EYQD 1C08A 1U41A 2V5RA 1GHFH 4JLRA 1BREA 3NIDE 4H20L 2DJMA 1ZJAA 1HSAA 5FO7A 1A1NB 2R29L 5EIQA 1SQMA 3BKCH 4KVCL 2R2EB 4GW5A 1YMME 4Z7UF 5T1MB 2YD3A 4L4TA 1JZ2A 1A9BB 5T3ZH 2QADB 3V9EA 1J87A 2CBTA 3LH2H 1EHLH 1U58A 5GGTL 1T66C 3L3HB 4FLHA 1HEJC 4JFTA 3ECWA 4KQ4H 5FUCE 2L4OA 2JKXA 4A2EA 5KVDH 1FF5A 3AB0C 2H9GA 4P2RA 5J7CC 5JR1H 4MXVF 4D94A 3WTUA 1GS8A 1NBVH 2EZ0C 4OGXH 2VLME 3WNLA 2NX5B 2R0WL 5AKRA 4JMXA 5J1AB 2PR4H 3V0FA 1JZIA 2VITA 1DVFC 1UCBL 5DD1H 1J8HD 2W95A 5JYMA 3LMJH 3ULUC 3M1BA 4J12A 3WI9A 1J0IA 4Y9FA 1ZPUA 4HPHA 3B3IA 4UCFA 3D52A 5DVKA 1S7RA 3HNTL 4FG6D 5DJDB 5D1XE 4NKOB 3GJFB 4OD3H 5GS1B 2W65A 5DC9B 5MI0B 5AW3B 4RFEB 5E00A 5D2NA 3VQ2C 5J6GA 2Q76B 3VXRB 3VTMA 4HAFA 2WHVA 3OR6A 3HNVH 5CZVH 5L88H 2X4QB 4U3HA 3D05A 3D2UB 3F7YB 3BT2L 2VWEE 1M7DA 3B5TA 3E9TA 2B1OA 2Q8BL 4B95C 3V0JA 1YEDA 2OMWB 3IPFA 3MRIA 2XRAL 3UCRA 2GG1A 4P57B 6CGTA 3WGVB 4ZRGA 2QADD 5BZZA 1ET8A 5L8JB 1RQ5A 2QTEA 3POHA 3HIZA 4Z7WF 4Z7VB 1E42A 2JK5A 1HJCA 1UZGA 3SEPA 1A14L 2NXZB 5FYJU 2NNAA 1WUZA 3PWJA 4R8WH 3TA3C 3KPNA 4WY7H 1Q9KB 5LXGL 3CPLB 1KBGH 3DIDA 4HS6A 2NX5D 4XNXH 4OLZH 4ZFQA 2EDMA 5BVJB 2CO2A 2FSEB 1G4RA 3NIDB 4X4ZA 5IY5B 3BQUC 5BZXA 1ZLUK 2KPWA 3WGUB 2XG4B 5GGRY 1U8CA 2Y5TA 4NQCE 1OAZH 4NO3B 3QH3A 2B5IC 1YMMB 1J9SA 1ID2A 4D7BA 1NMAH 3BCFA 3MJ8A 3MGTA 5KOVC 4LQFH 1E90A 1IAKA 1DQML 3GI9L 3Q6FA 4XT1C 3UYRH 5AZ2L 1ZLSH 4ANUA 3MGOB 4GBXC 5ITBH 3QEQE 4MA3A 3FZUD 1L7IH 5ADPH 4QKXB 3BO8B 4ZX5A 2JI1A 4HT1H 5K39B 3ROLB 1NC2A 5KVFH 1BVNT 4CGTA 5C97A 3CQPA 5DZOA 1OWRM 1LO2H 4APQD 1I3UA 1EMTH 2WXQA 3FTGA 2FQDA 2BVUA 1LHZA 1KC5L 1XGYL 2DM3A 2H32H 2W0LA 3CHXA 1ZVSA 3D2UD 1FNSL 2WGXA 4HKBB 2XY2A 4MA1C 5ALBH 4XBGA 1IC4H 4MYWB 5T1JA 1J88A 2DQTH 4J4PC 2KZKA 4KJPC 4HJTA 1OCWH 2XQ0A 3MCLH 4PRIE 5LG6A 3OD3A 3SGEI 4IKNA 3U0WL 5BZDB 3TWCL 3TYFA 4FLQA 1JXKA 2P7TA 1XCTA 4J3TA 5IJKC 2X0WA 2ERJC 4AEFA 1T2QL 2MIZA 2W60B 4KZCA 5H2BA 2G3XA 4O9HL 3OF6A 2F19L 4W9HC 2BVOB 4DPBX 1XF2B 2CSPA 4EDWH 1NIDA 4LIQH 4PJFA 1O6TA 5KUMA 3UGXA 3WJMB 1E9QA 3GKZA 3FQWB 5D7IF 1YUHA 2YPVH 4EI6B 2AS5M 4S1QH 1GOHA 3W38A 3Q13A 2AJXL 2D3NA 3MRMB 3HLKA 4TVPL 5I8EB 1TQBB 4U1SB 5DFTA 1ND0B 1OTSC 1SMAA 5IEKA 3W82A 5AB1A 3NRPA 4L1HA 3PL6B 3PIQB 2CWRA 4X4YA 2DEWX 5CSGA 3RVTD 5D6DA 2ICWA 1S9VB 1H6EA 1YEFH 4PS7A 4MMXA 1IT9L 2VLMD 4M8VA 5I76B 1IGYB 4X5PA 4CNIA 2HJLA 3EBGA 3E1F1 1CD1B 1P7QD 1VADB 5JPNC 1IBDA 3W2DH 3GSQB 5I6NA 4LL9A 4KZEL 2IWFA 1ZS8B 4QTIL 3N42B 4JN1H 1MCHA 3CFCH 2HT4C 1CFBA 4E9QA 2ZD0A 3E80A 4KX7A 1BFSA 1W91A 1G7HA 2OSXA 4NQCB 5E2TH 2I9TA 3SHSA 4JHVA 3T4YB 2C9UA 3HS0B 5DD6B 3BP7B 1PZ5A 1EEZB 1JI1A 1Q90A 5KJRL 5D1XD 4JY4A 3JQOB 4HC1L 3QEQB 1KBKA 1IKOP 1R6VA 2E74C 4KRPC 4J3WA 3DVGB 4XGZB 1OHQA 5FM5M 3SDAC 2GJPA 4FJYA 1F6FB 1UADC 4XAWL 5E5MA 3ZLQC 2ZWNA 3QPXL 1EAQA 3FO0L 3PV7A 4U31A 5DUML 4OM0H 2G30A 4PV9B 3U82B 5IOKA 3R1GH 2V17L 4UOJA 1DBAL 1FCGA 3P40A 1QO3A 2K8MA 4QIRA 5G4MA 3HN3A 3BDYH 4FYRA 4JE4B 4PJXF 2L7QA 4KHTH 3PWNA 1CGVA 4WHTB 2HWZH 5KN5B 3BUYB 4G6MH 1QTYT 2GBTA 3A6CL 1G5GA 3GSRA 1FLRH 3DK0A 2VXTH 3QZWA 4KZ0A 4OD1H 5IBUG 5EPMA 1MCLA 2GSMB 4A1RA 3QUZD 4B3VA 1A02N 5CHNB 3C60B 3SBPA 2ADJA 1O7DC 3I74A 4PCTA 4Q4IA 4ZS7H 5D1QC 3V4VB 4HLZH 4ZMOA 1YDPA 1NCAL 4KFZC 4LGRB 4WFFE 1JS4A 1Z9PA 4AG4L 5FKAA 1T21A 3PUUA 1TJMA 3PHAA 2ETWA 4AQ1C 3S96B 4YHML 1D6VH 2CUIA 2LE9A 4JFDE 1L0QA 4BRJA 1KBVA 5D1ZA 3L3IB 2VKXA 1L4IA 1T83C 5B3JF 2A9NH 1VRSA 4NQCD 1NEPA 3Q48A 5GJTL 5FV1L 2HLEB 2Q3ZA 4E42A 4JJHA 2NY3D 2LLGA 1PIGA 4FJ6A 4PMEA 5DWPA 4LCCC 1PG7H 4LGSB 4AQZA 1YO4A 4JCLA 5AOIA 4XMKH 4Y2DB 2VDKB 2X3BA 2FX7H 3QEQD 1I9RH 3GNMH 1M9SA 4KK6C 4ZOCA 5I1HH 5IMLA 1NIBA 2Y5QA 1MFCH 4QAWA 1ONQA 4J3BA 4O58H 5TK2A 2J8UE 3EO9L 3W39B 5IV2B 3KH4A 4A7SA 4MRBA 4NUJA 5EU3B 1VGEH 1KJVB 1B6UA 2D7TH 1FG2A 1PG7X 2XPZA 1JV5A 1A9VA 1OAKH 3D12B 2W9DH 2VXUL 5IEHB 3TYGH 5ALCH 4JHBA 1DVZA 4X5QA 2VCOA 3QI9B 4HZLA 2H26B 1W8EA 5C0GA 4PRID 3WLBA 2DLIA 3VI3F 1NBYA 3PGFH 2PCYA 5EOTA 5ABAA 1GSKA 3ZT6A 2IGFL 5HI4C 1LMIA 5A7BA 2XZQH 2XZAH 2GBVA 5CGBA 4NKIL 2ZJSH 3V8OA 2YUZA 4PJAF 2HRPH 2CKBA 1BMWA 3MLTA 4GO6B 4KKBD 3QNZB 4NJAL 1VHPA 4WI3A 2PPCA 1ESOA 4L3AA 1EFXD 4PGBA 2OAAA 4HIHB 1K4DA 3L3KA 4RAVB 5GGRB 4WEEA 4XPAH 4QRPA 5C8JA 5DVNA 3MRDA 4ZUWA 1EUUA 5C0RL 1J7VR 1SOXA 3O81A 3VFWA 3ARSA 2FRGP 4I87A 5B39G 3SBWC 2HTLD 1G0XA 3RKDC 1GW6A 4YSDA 4Y2DD 3VXQB 3KWWB 3L7FA 1A6UL 3B83A 3DIVA 1HCYA 3FSAA 4FQPA 3RB5A 3D85B 4XMXA 2WUBH 4L1TA 2WPGA 1JHKL 3IE9A 4RGMB 1KPUA 4XP6L 1KYAA 1RZGA 1T1YB 1Y0LB 4EN2A 8FABA 4YBQD 2EE6A 4L9LC 1XL4A 1SVCP 2LGNA 2SEBA 2MOGA 3MYJA 4PU2A 1XIWA 4HHAA 3QXUA 2D03H 3FUHA 1SGKA 4HULB 5D6CB 2O6CA 4JFDB 2W59A 4KKCC 1BXUA 2R4RL 1H8OA 2OXHA 3DBXB 4PS4L 4WV1B 3FF7A 3KWUA 1MFAL 5GRJH 3STZA 5FYLE 3AG4B 4RGOH 2FSDA 1V54B 1PX3A 1M3JA 2CK0L 3UCQA 5CR1A 2PWEA 1ZV5A 3QO1B 4K7FB 2HLAA 3L45A 3RWDB 2C9VA 4YPGA 3NIGE 2RCSL 4EIBA 1EZLA 1NCCH 1J9QA 1R5IA 2BVPB 2PXYA 2EIDA 4N2BA 3RJDA 1NSNL 4UNTA 1NFDF 1OF2B 2J8UB 5L4FA 1AP2B 1TKWA 3GMNB 2PR9A 3PNWB 3ZK0A 5CMAB 1GZHC 1CURA 1PNCA 4I77L 2UVFA 3EO0A 2D0GA 4QF1A 2CKBH 1OARL 2JXMA 2PW2A 1WWCA 5EO0A 2AV7B 3PHSA 4R3SA 4KRMB 4WHYG 4F8NA 2A9BA 3ZO9A 1WBZB 5CLXA 5JDSB 4PVLA 3WEXB 1Z2KA 3C8KB 1YNTF 3EGXB 4ERSH 4XX1G 1HAUA 4P4RB 4X9YA 1NBZA 1GS6X 1JPSL 4ONGL 4QHKI 5FCSH 5IMKA 1E7VA 4PD4J 3LKPB 2UY6B 4IGBD 1WBXB 4LOEA 1R1CA 1MVUB 2VAAA 4HFWB 4GG6E 4ES8A 1IC5H 2DL2A 2W81C 4WFFD 3GWJA 1CFNB 4OD2B 4UU9B 1SY6A 2JFCA 4MCMA 5F1NA 3FCUB 2C4FU 1WG3A 4JFDD 5IVOA 2V2WB 2IBZY 3FDWA 1CE6B 4EIGB 2YAFA 3HI1A 2QGDA 4WKZA 2XTJD 3EFOB 4KTEH 3OLEA 4ONHB 3LJ3A 1GZQB 4K3EL 1AGBA 2K4WA 3HG1E 1BOYA 1HHGA 1BD2E 3IMTA 5MENA 2VE6B 3VU2A 4PG2C 1BJ8A 1YJDC 3RVWC 3VFGL 1U8IA 3UBGA 2AJVH 4FQ2L 3DBSA 4X7DC 4BWTA 4HAGA 1C7TA 2YARA 3FFOA 4I85A 4QTHB 3MV7A 3OV6A 2E76C 1E8XA 3IKCA 1SVZA 4M9OA 1KIQA 12E8L 1GAFH 1G1YA 1OO2A 1MHHA 2BIPA 2YN5A 3CZLA 4N8CH 4P5MA 5F7MC 4FL4B 5EF3A 3BDXA 3IDMA 3STLB 5AD0A 1CF8L 3KGSA 3BZDA 4F80A 3MXVL 2AJUH 4JDTH 4LDEB 2FYVA 4C4BA 5L2JA 5I0VA 4NQDE 4AT6A 4NEHB 2OMZB 2FUQA 5IMMB 2JMRA 1MAKA 2WBWB 1DN0B 2EE3A 4UUJA 1IEBA 3CQQA 3OGOE 2VW7A 3P0YH 5I9QC 5LN4A 3BSZL 2Y2YA 3NIGB 3MREA 4PR5A 2DD8H 1AXSA 3OKKB 4OGYL 4QRRE 5KSBE 4ZO9A 1VFBA 6PAZA 3UYPA 1Y6MR 5B1BB 4ZXBD 4CU7A 3IMUA 4O02A 1TJGH 3LYRA 1UXWA 4PJHA 3DJZA 1D2OA 3ECVA 4PRDB 4P2OA 4XNYL 1V7MH 3EOTH 1HVXA 3B2VH 3PE9A 4JO4H 4BZ2A 4UQDA 1SY6H 1USZA 3VWJC 5D93B 4DKDC 3BFOA 2DQCH 2NUPA 5AB9A 4WW2A 2OULB 4N2HA 4IM8A 4G70B 4FA8A 5FUZL 3RWIB 2FEJA 4F91B 1MDTA 3DRQA 3H7LA 5TF0A 3ES6A 1HL9A 1ZHKA 3KM2A 3M7FB 3MV8E 3T08A 2C3VB 3BPNB 3Q2WA 4M7LT 4JFFE 3QNXB 4AUUA 1LE9A 3P9MA 1JRHL 1I1RA 2WN2A 2DQUH 1BOGB 5FHBL 1VFMA 4NQEE 4WWOA 5F9JA 3IETA 4LXFA 3ZTNH 4GG6B 2EXSA 1R3JB 3MNWB 3QFDB 3VFMB 2CHZA 4F5CA 4IRJA 5DJCB 4JDZA 3CBJB 2DQ6A 2A6IB 5HVWA 1ES0A 4Z0XB 1OQOA 1OTUD 1TCRB 1MOEA 3NACH 4HMDA 7FABL 3QUMB 2BRQA 3O0RH 4NQSA 5F7UA 5LAPA 3UGUA 5FYLD 1NC4A 2R1YA 1JYXA 4K5MA 4QCIB 1R24B 1QP1A 3FUKA 5JPMB 2X38A 1FFRA 3HG1B 2DPKA 1BD2B 4QOKE 4TXVB 7PAZA 4UNVA 3NT0A 4LHUA 4BRVA 3OKLA 3C5ZA 2QQKH 4DK6A 4ICXA 3X11B 3SDDB 4EN3C 1IO4C 4JM4H 1TQWA 3SPHA 2Z93A 3GMOB 4JE0A 5B7MA 2J43A 3VFUA 4GSQA 5E4OA 2EEFA 1OAQL 3OMNB 1KCWA 4O02H 4KI5F 3RNKA 4N0UA 4ZUSB 4Q9RH 2BC4B 2J71A 2YRZA 1NCWL 3FCSA 2C1PB 5LUMA 3NFNA 1IGCH 1Y1DA 2E6PA 3AY4A 1D5BA 2D73A 3I50L 4M48L 1E28B 2VO5A 4X80L 2FEDC 4FX5A 4NCDA 1CYXA 2WZ5A 5CSZA 4E5XA 4JM2C 2BFVH 3F58H 5D7SL 3LSOA 4X6CF 1RHHB 1T1XA 1DL7H 1UOKA 5GZOC 3QO0B 2VC2L 3PPEA 1AC0A 1BZOA 2UX7A 3EFDH 3OGCB 5KSBB 4E41D 4JVUA 2JKNA 1UEYA 3A4AA 2R1XA 3OKMB 3HE6B 4KHXH 4YFLI 2VQUA 1YEHH 3K3QA 4AL8L 1WE5A 3ZQWA 1KENH 4LLVB 1ZTMA 3LNDA 3CE1A 2EUZA 2HKAA 2OS7A 1FVDA 1SJVA 4JFPB 4LLDA 3X1BA 5C7XL 1QPKA 2RFXB 5FLVA 1MY5A 2Y36L 3F85A 2MHAA 3MV8B 1BD2D 3X13A 1CQYA 3WO4B 3K2MC 1A6VL 4OH2A 3UTSA 5GSVA 2FR4A 5GS0D 1ODAA 1T3FB 4NCC2 4BZ1L 3QUYA 3SDDD 1GZPB 3KL5A 4UT9A 3VXNA 3GS4A 1U3HB 4NQEB 1Q72L 4YQXL 3M1OA 2EXTA 5K69A 3ULUE 2YBGA 1XTMA 4NRZB 5GS2D 2AP2A 3FPXA 3T3PE 5F93C 4FABL 1G9NH 3ZL2A 4JY5H 2W91A 3DI2B 2IFFH 3CVBA 3US9A 2OTUB 2Y0SA 4OI7A 4Y5YB 4FMFA 2OMYB 1MRFH 1X5IA 3IT8D 2WSKA 3NABL 4NQDD 1A7QL 2IAAC 5DMJB 4ZFGH 4UF7C 5I1JL 2PWDA 3S88L 4JPKL 3WUZA 2ADYA 4Y4FA 2DLTA 4QOKB 3OLDA 2YUXA 4BFGA 3FOMA 1O75A 5E4AA 2XCMC 1CTNA 4QRRD 2HJKB 1AGEB 2FH8A 3CZUB 2PW1B 4RRPG 5LNDA 4C54A 3K4DA 5F0LB 5C9JB 4U2ZA 3G5ZB 1FZKA 2H1PH 1EV2E 3X3FH 4D3CH 3TU6A 3VD4A 3O3EB 1E5BA 5K9KA 5IHWA 4XC3H 3JVGA 3P3TA 4A2DA 2WP3O 1YN6B 5ECGA 3RPIA 1JDAA 2ICEA 3GRGA 4N28A 2VABB 1YEEH 1R0AH 3MV8D 2ESVE 3MJWA 3MROB 4JFFD 2NQCA 2FUTA 2Z4TA 1N8ZB 4JS7A 3V0IA 4CVXB 4X8JA 3JV6B 3OKOB 1G6RB 4GRLD 1AVAA 4FTDA 4XN4A 3UDWA 4Y2OB 4O2FB 1U3HD 1XXFC 4NQED 2HZHA 4RESB 2YPKA 1HOCB 1KTLA 5AWNL 1G9ML 4WWKC 5I15L 3BKJL 5IBLC 4UT9H 1CL7L 3WFDL 4HDIA 4Q9CA 1F6LL 1MFDL 2P5WB 1XGPB 3F65A 4JHAH 2BVYA 1WJ3A 1GGCL 1OSPH 4G3YH 2K1MA 1LP9F 4U1KB 1UM6L 2XFXB 4DZBB 2IPUG 1HNFA 1QFWL 3AB0B 5DK0A 3U6RA 3D25B 4ZDHA 4QOKD 2ITCB 3LEVH 3EF4A 1NGZA 1E9OA 2Y7QB 3BAWA 2DBJA 5CD3B 3K4AA 3VXUD 4RDQF 5BJTB 1S9YA 1I31A 1CDUA 1MIMH 1OSYA 1CDGA 1DVFB 2FECL 2EDDA 5FYLL 1QSFD 5BS0A 4NOBA 3TT3L 4QLRA 5DSCA 3JT0A 3RUGF 3VNZA 4OIAA 2DYPA 1GXEA 5B1JA 4RFOH 3G5VB 4OY9A 3WNKA 2WKLA 3T3PB 2WK2A 3RP1A 2APVA 1R17A 2IGLA 2O93L 4NYLB 5I8KL 2UZIH 1JWSB 4LBEA 3K2KA 1MXGA 4PIRF 1KN2L 1Y6KR 4AYFA 2UUDK 2IANE 1L0PA 4RNRB 5DO2D 3VCLB 4FP8L 3V4PH 4G8IA 3V6OC 3BHBB 3SCMB 2KLTA 2CDEA 1XSJA 2VO8A 1ROCA 4OLVL 3GRWA 3MI6A 3EJCA 4N8VA 4KTYA 4PJ8A 4B60A 3F7PC 3VXTB 4D2NA 2WV3A 3UPRB 1X9QA 2GJZA 2KL6A 2VDPH 2J1KA 3FUFA 3MV9A 1M2VB 1I8LA 4NM8H 4MJIA 1NA8A 1MRCH 2BRRH 3IE4A 3L54A 1T66D 2XVLA 1NM9A 2PCXA 2EH7L 3N06B 1F58H 4V1DA 3UJTH 4ZG1A 1H3PL 4JG0H 3TA3B 1CBVH 1ASPA 8PAZA 2ESVB 2EZ0D 4EQ3A 1Q0EA 1MFMA 3DWTA 4X6EA 2Z31C 4Y16C 3HZVA 4J3SA 4U1LA 4QJ4B 1N0XH 3QUML 1J9TA 1GC1C 3SOBL 2C34A 3DUHA 1DVFD 3F01A 3GDCA 3RLSA 4AM0B 2Q7YB 4ZW5A 1P0SE 3L4XA 1CGWA 3FT4A 4MNQA 4XCYB 2Q6WB 4L4VA 3HNSH 3ULUD 4F7EA 2ZX8A 3KPRA 4DN4H 4WSJA 1Q9LA 2NZ1A 1E6JL 1WS8A 2RALA 3MOAH 2FWOA 3NK3A 1HXMA 2H5UA 2R0KH 4I3SL 2JJSA 2ZSWA 1HNGA 3TNNA 2CDFB 2QPEB 2XWRA 5DTFA 5GS0L 1GY2A 1MHPH 3D4YA 4GBXB 3WAKA 5E0QA 3EDDA 5I1LB 4F20A 3OKDA 3SQRA 5CUSL 3ZY7A 4H8WC 4ZFOB 1MH5B 3U36A 2Y72A 3L5WB 1M7IA 3CCHB 1I4FB 1A4BA 4G8EA 4Z7OF 4C56D 2HFFA 2NW2A 4HJGA 1DBMH 3WHE0 1NANH 3VSQA 2GKIA 4MA1B 5DRWB 4Z8FL 3BP4A 4YO0B 1HHKA 3GSXA 4X9FA 1ZHNA 1Z9OA 2K7PA 4Q9BA 1CGTA 5CEXB 1I7ZA 4PJ9D 1QHPA 2AK1L 1VEPA 3EZ8A 3CC5B 3DNKA 1CIUA 1S7VA 1SYSA 1WA2X 1A7PL 5DJAB 3LS5H 3BP5B 2R7EB 1DJXA 3TA3D 4Y5XA 5TQ0L 1F8TL 1O7DE 2IANB 5AW7B 4FFYA 4PJEE 1IAIH 4U6XB 3BJLA 5D1QE 2IAMB 3N9GL 3LPOA 2D7QA 4RZCA 2XJKA 2GITB 3V0VA 1CU4L 4RH4A 2D9CA 2W07B 4Z78B 3OHXC 5IBUB 5T33L 3V6ZB 3MLYH 3OB8A 4YNYA 3WN5A 3BQUD 1IE5A 2MEJB 3PJSA 2CCVA 1EXUA 4GPVA 1BZ9B 1XGRA 2EKSA 3S3SA 4NI6A 5GGQL 1KTDB 1DVTA 2NSQA 4EMZA 4N2LA 1HZKA 1MHCB 1UUNA 4Y5VC 3FS9A 3WIFB 1W2KT 4IMKC 3IWUA 4GBXD 3CVIL 3GS7A 3IWVA 2J56A 4L3CA 3C5SB 3FCTB 1A6AB 1VPOL 3IBOA 1EZVX 1F18A 2ZKHL 1OT4A 1N7MH 4P8QA 3ZT5A 1HTYA 1H8LA 3RY4A 1DZ0A 4X7TA 1F1DA 1UWGL 1TEFA 4HHWA 5JIIA 3AZUA 2QQNL 2BHFA 4RMQA 2B3IA 4X7EC 2O5NA 1S5HA 2WQXA 5JPNB 3L5XH 3IS0X 4GRWH 3PHOB 4DKEL 1I1AC 3C2AL 3ABZA 3JV5A 3CWGA 4IDJL 4JVWA 3VRJA 4F8QA 2O1AA 4WUUA 1D5IH 2CMRH 2DKUA 2WWKT 4MZ2A 4BWUA 3EO1B 1XV8A 1BF8A 3BPLB 3DIFA 3P9LA 4J4PD 3T71A 1NAMH 4KJPD 2M26A 4QXTB 5LNGA 4MHHG 1O5DT 1SHSA 3IDXH 3U9UB 1YYLH 43C9A 4OLUL 3AXLB 2X7LA 5HHVL 5TJWK 4LSRL 4KRPB 2NNRA 3KYNA 4JQXA 2P9RA 3Q6GH 3SDAB 1SOSA 1UWXK 1ZEAH 2AXFB 1FV1A 3II2A 4WWID 4B9ZA 1QYGL 4M5YL 4FFYH 1QPPA 4X9HA 4XX1E 1KCUH 2D3VA 3L1OH 3MRBB 4DGYL 4MXWL 4DGIH 1NL0L 2UWEF 1OP5K 3ARXA 2P8LA 3K6DA 1IGFL 3CVHB 4BCZA 4MNHA 1JWUB 4M8UA 1FH2A 5I26A 3WKNA 3KLQA 2A6DB 2WWMD 4P0DA 2KLSA 4IMLA 4CUCA 3PAVA 5AYQA 5D8JL 3UJIL 1OTSD 1TQTA 2P5PA 1L7TH 2BOBA 2XICA 4TSBL 2XKNB 1C5CH 2MPAL 2EDJA 1FFOA 1A1MB 1MVYA 3W0WE 2ODIA 4L1LA 3ZOAA 4BKTC 3LEYL 3LN4A 1MW2A 4YHPB 4J1UB 3T65B 5HBBA 5IQLA 3IDIB 4PJEB 5D1QB 2ZXGA 3BKMH 3HRZA 4HBCL 3FB7B 4LLUB 3QJHA 4CBPA 5B39B 2G3MA 2VZ3A 1RPKA 2OBGA 5IB5A 1BYNA 5M7QA 3BVNB 3JWDH 4AQ1B 1A2YB 3FQ4A 2A6JB 2HT4D 3LEXB 2VISA 4GSDH 3I2CL 3H0TA 3L4YA 4QHUB 1MCIA 2OMXA 4XNUH 1QNZL 4OLWH 3S5LA 1XSOA 2CLZB 4LCCB 3BVUA 4X6BB 4XVUD 5F96L 1U6AL 2UX6A 4MCNA 1U91A 1MI5E 1CG9A 3FQUA 4KRPD 3ULUL 4IIQB 3CFDB 4ZAKA 5IQ9B 1FFTB 1Z66A 2X6CA 4UM9D 3SDAD 5FOBB 2V3EA 2MQCA 5DUBB 1R19A 4JQVC 3LRHA 4M8RA 4ZFZB 1KIUB 3E0GA 1EEYA 4ABVA 4AIOA 1KT2B 4K0OA 3ZUNC 5IESH 4XNMA 4KUZL 1GMIA 2FHBA 1N70A 5DJ8B 5B3SB 1P1VA 4HUUA 1EGJA 4NXKA 1XR9B 4P9HH 3WFHA 3VGBA 5CAYB 1C8QA 2AQTA 3RWCA 2J6WA 3DYOA 3ZKXC 2C9PA 2C9QA 3Q8AA 3ZO0A 2H6UA 2GJ6A 1B2WL 5D1QD 4NBZB 3S3DB 3WXWH 2BX5A 2X9XA 1SJEA 3QXDA 4NJ9H 2UZPA 4Y2NA 1E4XI 1THAA 3IGAA 3ZKNC 5C86A 1MAML 2ARJB 4EDXA 3F84A 6FABH 2XJLA 1DQJA 3LIZA 4OZIA 4FLRA 4EKXA 3V6FA 1GGBH 2X70B 3SE8H 1TIUA 4PREA 5IMOB 1CZ8L 2H3XC 2IG2L 5I1EL 3WTSA 1SFHA 1QA9A 2K4AA 4KI1A 1TFPA 1YQVL 2FJFA 4KV5F 4KK6D 4POUB 3ULVF 5KS9A 2WOBA 5F7DB 1YPZA 4YXHL 3W0WB 4Y1AE 1OGPA 4ORGA 1T5KA 3HC3L 2Y6TE 1I1YB 5AYUH 3BFWA 2DM4A 1XBRA 1JBJA 1XSKA 4F92B 4Z7QF 3CHRA 1E3FA 2OR9H 5ITFA 2WIIA 4L9LB 4K94H 1ZA6B 1PX4A 1PKQA 3X3GL 5GSRB 2DLFH 3L9RB 1JXFA 4UQBA 1AGCA 2CBQA 2Q10A 4HG4J 4ZFOL 2DWEB 4M00A 3GSWA 3TBYB 4KTDH 1E4KA 1OF0A 2IMNA 4WO4B 2X4OB 5DYOB 1IGIL 3JYCA 1P9MA 1KN4H 4UAOB 1EGJH 1BZQK 1MI5B 5HI4D 3QQ3B 4MCZB 1YCSA 3HE7A 3TFKC 3JV0A 1KCSL 4RWHA 4RRPM 2WLNA 5B7FA 5DD3L 4L3EA 3HMXA 3CLFH 4LSSL 3NZHL 4HLJA 5KYYA 1C5DA 1FYTB 2IO5A 2CA4A 4NNYA 2PF6A 2XWTB 4PLNC 5C0FA 4NO0A 5JW4Q 2BO0A 3CFJA 3NJJA 1K9TA 1FA4A 4I3GA 3BE1L 5EUOA 2A74C 4I0KA 4PJFF 4D0BB 2OQJB 3RKDD 5I28A 5DK2B 1TEYA 4XPHL 1FL5A 1PMYA 5CJBA 3W0WD 2IPKA 3DO4A 5GGUA 5I1GL 1WPCA 4M6NH 1XF3A 2XN9A 3UTTA 3FTWA 3VFOB 3MLPA 2BNUB 2XWBB 1KGUA 2CHWA 2J88H 4FQXB 4PI2A 3BEWB 5ISZE 1F02I 4JCMA 2EEBA 3HZYB 2BFGA 2X2IA 4DEUA 4E9RA 3GSNB 3WNOA 2CIIB 2JTDA 3P77B 3K6NA 3L2MA 2WGNB 3QFJA 4KKCD 2E0PA 1HT6A 1A5FL 1YEGL 2VIRB 1SOQA 4XI5C 2RIKA 4Y4HA 4Y7OC 4BA0A 2P80A 1II4E 4K9JA 2P24B 2QMKA 4RSYA 1Z3GH 1DSFH 1IC0A 5IVNA 3QIBA 1ADQL 1M6OA 4OIBA 2AF2A 4F9LC 4HQQL 2BJML 3GPEA 2E8YA 4RVBA 2D7OA 4UV7H 4AEHH 1UA6H 4Y1AB 3HJ0A 3HN5A 3UZEA 1NCNA 4RMVA 3QDHA 5ABZA 1B4LA 3SE4C 5I18H 1CXEA 3MBXL 3DX9A 4WK0B 4WJ5A 2VB5A 1IU1A 2XQYK 1S9XA 1ZT4A 2W9LA 4P3CH 1T1ZB 3HW7A 3NRQA 3KW8A 5FO9A 4UTBA 3UJJL 4F9PA 3ISYA 2TAAA 1WFJA 4GKZB 4KOCA 4OJFH 5A6LA 2AJZA 4FXKC 2BNRA 5T1LD 1S5IH 3HI6H 1ZHLB 3ZJAA 5CN1A 5BPPA 5A2BA 2V33A 2O72A 1B3JA 5E6ZA 3WUWA 3CVHL 3MRJA 4ODUB 5ANME 4QRQA 1HI6A 3H8NA 4G42A 3ZL4H 4EZLA 5I66A 1OAJA 4ZMZA 2BS71 3S3CB 2NCEA 3B1TA 1QEXA 3K72B 5GZNA 5KG9A 5LG1A 2LU7A 3IS1X 5IJVA 3BIKA 5HGGS 2VLJA 4ZOEA 1RD6A 3HAEA 1WZ1H 3O4LE 4B9CA 5LAXA 1WQVT 3KH3A 2BLFA 2V2TA 1NCDH 1KV7A 3QULB 5F3HB 1TZIA 3ELQA 2R2BB 2JLPA 2IQAA 5E9DA 5DJ0A 3WLWC 2MQ0A 3VTTA 1G7IB 4YSQA 2XU9A 4LKXB 5E7BA 5EN2A 3ARDC 4GOSA 2N01B 3BWAA 1IRAY 3NIFF 1JZFA 3ILEA 2CUHA 3QCVH 4OB5H 2VDRB 3RWEB 1UH2A 2DWTA 4L23A 3RVWD 4P4KB 4N1EA 4GINA 3VFNB 2X2HA 4BFOA 1HSBA 2FB4L 1XCQB 2H41A 2XQBL 1AY1H 1UG9A 5ISZB 3HEIB 2XVGA 2HTKC 4OZ4B 4DUXA 1BW8A 4FXGC 3BGMA 1YEIH 4PBXA 3QQ9C 4PQXA 1J8SA 1U93A 4MCYA 5EFIB 4JRWA 3FULA 1CTOA 4OFKA 5EC1A 3WKML 3B9KC 5IW1A 1ZKAA 5E4EC 3VFSB 5D5ME 5D2LA 4YVUA 4ODXB 2PTUA 1TCMA 3VNYA 3LN5B 4UTBH 1CI5A 1T20A 5E2UL 1AZCA 3L4CA 3MRPB 1RZ7H 4IU2A 3T3MF 3L95A 2G75A 4B9YA 4AQAA 3PLYA 4H2AA 3E8UH 2IWEA 3GJFK 4IDLA 3B2XA 2Q86B 4BIKA 4HH8A 1SJHA 4EN3B 1FGVL 2AXGA 1LE5A 3DV4B 4OCLC 5HJGA 1FIEA 5KVMC 4U1MB 5IKCB 2OMVB 4J8RA 3ME0B 5F88A 4X6DE 4DUVA 4J3OC 3V5HB 4CA4A 3IVKA 4IBUA 3VWJD 3QXAB 4OI9A 1FIGL 3MLZL 1ED3B 4HWBH 4YK4B 3SJVA 1FO0H 1K5WA 3EJZD 4AVHA 4K7PH 2WQAA 2HG0A 4GXFA 3VGAC 2X4NA 3K2UL 4OFYD 1X5ZA 5F97E 2CM5A 2PP8A 3KDMA 2IQ9H 4JM2B 3TH4T 3L13A 3UIZA 3ZDYF 5LQBL 1XGQB 5ANMB 2JCCA 5HHQB 2A9AA 3IPBA 4OZHA 4QNPE 1BPVA 4HU8A 4HP5A 1TTUA 5ISZD 1IVLA 1YNKH 3BH8A 2JKTM 2B2XL 1JMZA 2G4GA 5B8CA 5A2JH 2AQQA 2BDNL 4K9EC 2D7NA 1DBKH 3UBHA 3GPSA 4NOFA 4IEFB 4RX4A 3O4LB 1A1OA 5D7HA 2DTSA 4ALAH 3IU3B 1M6UA 3LQZB 3WEOA 3D0AA 4JY6A 4R7VA 2FYYA 1G7LB 2YQBA 3AVEA 4ODHH 3LNIA 1ACYL 1DQTA 1F4HA 3SZKC 5DR5H 1R3HB 2EAEA 3WS6C 4NN7C 4GB9A 4N8PA 1CXIA 3RGVA 3A4DA 1A4JB 1H5BC 1WGOA 2X5PA 5KANI 3TPKA 2P3YA 1D6EB 5DZJA 4UTAL 3BZFB 4EN3D 4FA7B 3FYIB 5FYJH 2ITDA 2NLJB 3B1UA 1IL1A 4MGXA 1QQDB 5DRNA 2GSIB 1J5OL 2ADGA 1UWYA 3D3VE 2P28B 4ICWA 1JCVA 2PYEA 2ATAA 5E7FA 4Y1TA 2AQSA 2WXNA 3TN0C 3VI4E 1AFVL 1DQLH 5D5MB 2X6UA 4KXCA 2FTAA 3DSNB 3GTVA 3U1SL 3EH1A 5D9SB 4NFDA 2BWQA 4CSSA 4AUJA 2FBJL 2FEDD 3AW5A 4BK5C 3KR3L 4JM2D 3V6OE 2LVEA 5A16B 4HF5H 1O9ZA 2JJWA 1H15B 1LLAA 2X3CA 4Z23A 2J12B 2K6ZA 3BH9B 5ILTL 1CDBA 4XVJH 5C0CD 4HUWB 3O9WC 2YK1H 3MUJA 5DRZA 5AOJA 2JKWA 3U2IA 1JV2A 1SMOA 1VCBC 2Q1EA 5KSAD 4HWUA 4EUPA 3JWNC 5DF0A 1IAOA 1EHKB 1T4KB 4X6DB 4OUUB 4ZYKB 5BUPA 1JPGB 4X0NA 5D7LA 3WMQA 4UILH 4ZUTA 1SBSL 5C0AB 4YH6A 3DETC 3VU1A 4MSWB 4OQTH 4OM1L 3D69A 3QCTH 5ICUA 5T3ZD 3GSNL 4MNGE 3RTQB 4L0YA 4KTGA 1MJ8H 3LZFL 3GI8L 3G6DH 1F41A 1HHJA 1S9WB 1WAPA 1NUFA 3IJ8A 4LEXH 4QAMB 4PJ5A 3ZTCC 5BV7C 3EYSL 5GIRA 1YYML 5IVZB 3WIHH 4AMWA 1P7KB 3NEXA 5IJBC 3L1FA 4WO4A 5FF6A 4UANA 4WWKB 1Y18B 4CMHC 1QR1B 4DTGH 3MLRL 2X6MA 4E36A 3RU8L 1TZGH 3US1A 4G6JL 4ELDA 1WBYB 1YJDL 5DJ6B 4OFQA 3SY0A 1NGWB 2NR6D 3QARA 5DS2A 5KVEL 2DMHA 2K6YA 4CW1A 4GAYA 1ZT1A 2OJZL 3PAUA 2OP4L 3HUJA 2PO6C 1MUJA 3UG3A 1QI4A 1EO5A 4DP2X 5LVEA 4PTTA 5T5FH 1KXQA 3MDJA 1JGDB 4GG8B 2VJ8A 4FF9A 3OB0K 3D09A 4QYOB 5IQMA 1P84K 4G72B 1WWBX 1A7OH 4L8SA 3PPSA 3DX1A 5DWUL 3MO1A 2R29A 2A73B 2BNQA 2ZUYA 3RY6C 3I6LE 4LPYA 4KROB 5DZAA 1HKLL 3DX0A 4Z5RB 3BWUF 2KLRA 1OB1A 1JZJA 2JV6A 2O5XH 2VDNB 2VZUA 1QNIA 4I8DA 1FHGA 2WVTA 3OZ9L 4FQCL 4J6IA 2CA3A 4LNRB 4EUPH 4J5VA 2ATKB 5GGTA 1Z9NA 3VI4B 4JZOB 1R3KB 5JW4M 3NBNA 1PDKA 1SUHA 3QQDB 4PJHF 1KPRB 1TETH 3AT9A 2C26A 2VR5A 5C0DB 1XD1A 3CK0H 1JDDA 4W6YB 3OKEA 2CO6B 3PWPA 4YDVB 2OZ4L 1P1ZB 3JWNG 3KVDD 4WW2F 4ODSH 4Y9GA 2FZ3A 2FL5B 4MMYB 2UYLB 3EJPA 3WJLC 2O6EA 3I9AA 4YZWA 4U3SB 1XB6A 2P5EE 2KH2B 2CE6A 3QWRA 3CAFA 1KBBA 4PW3A 2Q87A 5IBLD 3NOIA 2VUYA 1XR8A 1S78C 1UWXH 1SVBA 4QYAA 4YXLH 3WENA 1BM3L 4Z3HA 5CCJA 3AT0A 3T8XB 1XCXA 5EDXA 4JB9H 4AM0Q 4ZPTB 3F8UB 1CJYA 1UZ6F 1IQWH 1FNGB 3QJFB 3RZCC 3SZ6A 4AH2A 2GTWA 5HGBB 3WU1A 3S5ZA 2IXQA 2JE8A 3CN2A 3KPQA 4GKSB 2R8SH 4PJIE 4MNGB 5EHFA 2IV8A 3AREA 4Y16B 3WHXA 4F7PB 3TV3L 3FSOA 3QZLA 2WXHA 4GT7A 3VWKB 4KXAA 1ZVYA 5BW7A 3MLSL 2VXVL 3RDTC 2WSDA 3T2LA 4GMSL 3EYOB 4H20H 3S34L 1AS8A 3D3VD 4M6OL 2EDHA 4H5SA 4LKCA 3WS3A 3P11L 1UA7A 4OKVB 1DQIA 4AGQA 4KVCH 2Z35B 1NIFA 3H7BB 4PRPA 5G5DA 5C2BL 5K9OA 5E5LA 3I6GB 1BVKA 4JGMA 1DYZA 1URZA 3V5KB 3MRNA 3DGGA 1D7CA 3EAKA 4LVHC 5GGSY 4QHPA 1FFQA 3MLUL 1CC3A 4X99A 2L7JA 1JGVL 2X1PA 5CIPB 43CAA 4HW6A 2A2QT 2R0WH 3IN0A 4LPXA 5EO1A 4LBAA 1P4UA 2FATH 3B9DA 3D0VB 4C83A 1Y1UA 4F7TA 2EIZA 2O30A 4WWNA 3WBDA 3U4KA 1JGUL 5CWSA 4APXB 3UG5A 1I82A 2QVKA 3VVVA 3U7YH 4FNUA 3MBWA 4PMFA 4XE5B 3HNTH 3KPPA 1D5XA 3UBXG 4OU3A 4JGNA 3OHMB 4H26B 5BXFA 1I9IL 1SBBA 3K71B 2Z31D 2ZAGA 4R4BA 4Q8BA 4Y16D 5I1DA 1G7JB 3O3BB 3WDHA 1Q94B 4HPOL 4P3WA 4HWEH 2GK0B 1LK2B 3QQ4A 2CLVB 3ARBA 4LQ1A 1CQKA 3NVQA 4U6TA 3BKCL 5F1SA 2P5EB 3ZE2F 4JFWA 1T03H 5T3ZL 3BT2H 3EUDA 3GSOA 4LCUB 4XWGL 1D3CA 4ACPA 3B5GA 2H0FA 3BIBX 2VSCA 4Y2LA 3L6FA 3RL2A 3MRLA 4Y5VB 5KVDL 2XRAH 2UZXB 2K8QA 4NDMA 1ZWIA 4OGXL 4LLMA 2WBJC 1S7WA 1SEQH 3MA7A 3GMQB 3QBTB 2PR4L 1A14H 4PJIB 2ZUQC 5DD1L 2O26U 3EOAB 5DC2A 5LXGH 5EEWA 5C0BD 4PV8A 3H56A 1I1AB 1KTKE 1OGAA 3RIAK 3I6LD 2GTQA 4YS4A 5K9JL 3FB8B 2FJUB 1DJGA 2ZOKA 2N4IA 3QIUC 4NRYB 5HY9A 2VLKE 3HPLA 2VL5B 4TQ8A 3THML 3L48A 4OD3L 5F1KC 5F9WC 5T3XE 5E8NA 5HPMA 2XX0A 2HVKA 1FNEA 2IMMA 1DQMH 2VDOB 4JFUA 5AZ2H 4R7DA 2LU3A 3DHUA 2XOTA 3GSUA 1F00I 3HNVL 4TF4A 4UQ2A 1EWHA 3IF1A 3WFEL 5BMFL 5CZVL 1FVCA 1BQHA 3G04B 3IFLL 2VLLA 3BUPA 4FQ1L 1XGYH 1WHOA 4QY8B 3FL7A 2G2PA 1FNSH 2GIYA 2UY7A 4AKOA 2ENJA 1GL4B 1KGYE 2VMFA 4R97C 3PFUA 3K8KA 2E46A 2B39A 3GMPA 2YKKA 2XQYA 1N18A 3VQ1C 4FGMA 2CZNA 2NNCA 4P2QB 4R8WL 3UZVB 2DQMA 1B0GB 1J8HA 3PHQB 5JIPA 1H6FA 4HC1A 4D9RE 3O3UN 5DEGB 5ACMA 4I2XE 5LDUA 5D96C 3U0WH 2HG5A 4OLZL 5EZJA 2HVBA 3S2AA 2PABA 4EPSA 3I3EA 1XQ4A 3KNBB 1J9RA 4Q6IA 1HESA 1T2QH 5A2LH 1JI2A 4NNXB 4W1TA 3WNIA 1I1AD 1FGNH 4O9HH 4ODVL 2CIKB 2F19H 1OAZL 4GAFB 3BPCA 3LV3A 4X42A 5F6HJ 2WLMA 4JZJC 4QHNB 3TVMC 3MRRA 1TO4A 3K4ZA 1AIZA 5JOFA 1A25A 4LQFL 3ARYA 1AD0A 4JO1H 3UYRL 1K5NA 2OL3B 2AJXH 1F1AA 3BC9A 1QZNA 4UBDC 4HT1L 1A1NA 1KIPB 35C8H 4WTZA 3PV6B 3IM1A 1JPEA 1FJ1B 5HYJB 4RGNC 1LO2L 4P5KA 2R2EA 1EMTL 4TUJA 5CGYC 5HD8C 1BLNB 2C3HA 2VDNL 4LF3B 1E5ZA 1RJZB 4K55A 3FOLA 4PWHA 3ZN6A 1OIOA 4NN5C 2ADIB 1BQLL 5K1VA 1IT9H 3K6SB 3LKOB 3NN8A 2QGEA 4KJYB 4PN6A 4FJZA 4G80B 1DQDL 4G6AC 2EDFA 3G5YB 3TBCA 2MMXA 3VUAA 4FFTA 4KZEH 2XN2A 3DECA 1U3ZA 4QTIH 4DKFH 1OCWL 3HFML 3DVNB 3MCLL 1ERNA 1ZIBA 1CFSB 1GIGH 2ADFH 2L3BA 4AEIH 2ITEA 4AXWA 5CU5A 4EO5A 1NBQA 5EU7C 1JMXA 4LZKA 4MX7A 4NPJA 5EA0L 4MDJB 3ZKXB 5CD5C 3QZPA 1PF3A 3UAFA 3C8HA 3SKMA 1WAAE 1MZYA 2YSSB 3BXNB 1FDLL 4PGCA 2X4UA 1T0MA 3SGDI 4XAWH 5DJDA 2NTFB 5L6YL 2F54E 3HMWL 3QPXH 3GJFA 1T5WB 3MC0A 4M1GL 4HIXL 2MTAA 3BRFA 3FO0H 5DHDA 5D4QA 1LO5A 2C9RA 3K74B 4QUOA 3EDFA 2V17H 2Q76A 2VUOA 1ZV9A 4APQA 3ZKQD 1T5XB 5B38A 2VM4A 1GC1L 1KIRB 5IUCA 4JKLA 5CP3H 3D2UA 4NERA 1SLXA 4AKQA 4UOW1 1WEJL 1U2HA 1U36A 4B6ZA 3A6CH 1N9PA 3CSYA 3ZZSA 4I2XB 4RDQG 4KC3B 2V8LA 4Z77B 3AAZB 3LTVA 3GXMA 4NNPL 1NCAH 1ZK9A 3IXTB 2H3NB 3QEGL 2G2NA 1Z5YD 2Z7ZA 1BJ1J 1H0DB 1F2QA 1Q9WB 1DUYB 4H8WL 3WTYA 2VLKD 2GC7C 5C0IB 4CKVX 4XXCA 5GJTH 4M93C 2EDOA 3QDMD 3SKOB 3QWQB 1AIFA 1BECA 5T3XD 4FAAB 5B4MC 4A55A 4JO8A 4PJXE 5I6OA 5IGXH 2JIXD 2XG4A 4EI5C 1QRKA 3IK2A 1E0OB 4X98B 1KY7A 3UC2A 4LOUC 1ITBB 3DMMA 1BFVL 1ZSDA 4TQHA 1IKNA 3KL3A 5E6RB 3R18A 1QACA 4MMZA 4PB9H 3EO9H 5ACLA 3ZKND 3MGOA 5DMKB 3GXNA 3C9NB 1LNUA 1UD3A 4DP4X 3LKNB 3FC8A 3GJFH 3AM8A 5F9DC 2F8XC 4BQBA 2B1HH 4ZO7A 5IW6A 3BMVA 1AQDB 2UXTA 3PQYE 3ZPDA 1O6VA 1P7QA 2VGLM 1BVOA 4Z7NF 3C6SB 4N2KA 5INCB 3EXJA 2GVYA 4U1JB 5HHOE 4DGUA 5JLZA 4IHOA 5DJ2A 3SGJC 4D9RD 4WRLA 4ZS7L 5F21B 2B20A 3GXTA 4DGVL 2IGFH 4Q97A 4LAJH 3QUHA 1D6VL 3ULSA 1BZ8A 4UI2A 3W9EB 5F6HI 5D1XA 2F54B 2A9NL 3QJSB 1F3DJ 4NJAH 1X44A 4Y88A 1CFTB 2WO4A 3X14B 2W60A 4G83A 1EVUA 2X89D 1L9NA 1SN5A 4F3FB 3BP6B 2MNUA 2FX7L 1PJWA 3KPSD 3C09B 1M42A 1KB3A 3MRGB 4NT6A 1QLFA 3S5YA 5C0RH 1IKFL 4HETA 4MDRA 1RUML 3D51A 1KLGB 4UMGA 1M7UA 3FQWA 3O2WL 1TYJA 3QUXC 2LLLA 1D5ZB 1MPAH 1ETB1 4EI6A 1N6UA 5E6IB 5BQDA 5KTEH 2Y7MA 3MRMA 1V10A 5JORB 3TFKD 1VGEL 5HDOA 4DPRA 1WV7T 4BFKA 3JXAA 4EF3A 1ND0A 1VKXA 4HUVA 1DANT 4KRNA 1QFHA 5JMRA 3BIAX 1MCFA 1QSEE 1A3QA 5HGDB 3PIQA 4XP6H 2W9DL 3V95A 3CZEA 2NQ3A 3QUZA 4OLYH 5ALCL 2BSRB 4PJAE 1LEKB 1E40A 4Y19B 3UO8B 1S9VA 3A23A 3KXFE 3I9GH 5I76A 4PTUA 1G94A 2VYRE 2R4RH 1CD1A 2R69H 4AK1A 1MRDL 4PS4H 5DHEA 1MFAH 2ZYHA 4FXKB 1QOKA 1ZS8A 4H1LA 2MQGA 3ELAT 2XZQL 5LXVA 3FUEA 4PJXB 3DXAA 3D6GA 4KDVA 2KQNA 2ZJSL 2YD5A 4NQCA 1TLKA 4F2ME 2O61A 3U6XS 2F7PA 4WVRA 5CU9A 1S9KC 2BIOA 1NSNH 4K71B 2F54D 2VAJA 1YY8B 4XPAL 4AGOA 3LKSB 2CRZA 3QEQA 1JSYA 1D7BA 3VFRB 2I32A 4XGZA 5I23A 3GBNL 1NQBA 1HCFX 4MLSA 2WAQA 4I77H 2ZQKA 4XI5D 3UBXI 1WD8A 2XIBA 4NHUA 3LXUX 3NCYS 3PQYB 2OK0H 1JF1B 3MNZB 3N40F 2XWDA 3PY9A 3ARDB 3GMMB 2WZAA 4H8HA 3VRLE 5HHOB 2XC8A 3ISRA 5AALA 3BSZA 1I7RB 2C9AA 4LMQE 4MXQC 1TQSA 4ONGH 4YX2L 2C1OB 1BG9A 4ANXA 3FUMA 2BVEA 5JNYB 3RFZC 2VTFA 2D03L 4PRIA 2Y4SA 3ARVA 1A6TA 3H9SE 5FGCE 3TT1L 1CYWA 3TS8A 1WWWX 2APWA 1NFDE 5GRJL 4UV4L 3QK0A 2K70A 4JQIH 3B9KB 4RGOL 5E4EB 2R23B 2Z8SA 2WLIB 4N2MA 3VMPA 2CHNA 1M53A 1WTLA 4K5PA 2PP7A 2KDYA 1EFXA 1CFMA 1IM9B 2GAZB 3QJZA 1WHPA 2QPDB 4LSUH 1NCCL 4FC3E 3AU1A 4K3EH 5C09E 5ADOL 5I2IA 2Z0BA 3FT0A 2NY2C 3EFFA 4NAJA 4PGEA 4OVVA 4MZRA 3DO7B 2E59A 3F7LA 2IWKA 3VFGH 1MHEB 3UMTA 3V4UH 5MEQB 4LCVA 4FQ2H 4NKMA 4MJ6B 4Y2DA 3OXSB 5T3XL 4OZFA 1HXYA 1QSEB 1JDCA 3JWNE 4HK0A 3A0OA 1T0PB 1SYVA 3TEYA 3OB0H 5BO0D 1NCJA 4PJAB 12E8H 1J12A 5FM8A 4G43A 1OV8A 3T4AB 3WLWD 4NP9A 3PQYD 5LCVH 1PAMA 4XVSH 5I6MA 1KJVA 2EDRA 1CF8H 3VGAB 3MXVH 3FO2A 5HHOD 4OZIF 4TPRL 4NLHA 2I9LB 2D7MA 2PKDA 3EH5B 3G5XA 1T7XA 3NCMA 3RTLA 3K8MA 4FFWC 3V0HA 5INDB 3BJ91 2FO4B 1JZGA 3VW3H 4F2MB 2I7SA 3BSZH 5IB3B 2DQHL 3ULVC 2JLLA 1PY9A 5KS9F 4TTGA 1XEUA 1YPZF 2B4CC 2I60L 4OCNC 3R0MA 4M61B 5JIKA 1U42A 5J13C 5E1IA 3TO2B 3B9KD 3JTTB 2EIKB 3KPOA 3Q3GB 4G6KH 3F6IA 3QNZA 3V4VH 3GBML 1IM9D 5FUZH 4HIHA 4DPAX 2AQNA 1RZIB 4NN7B 5E51A 4YLBA 2AJVL 3N6YA 3NJKA 3CXHJ 1H5BB 1WAEA 2EUWA 1FL6B 3EOYG 4AYGA 4HJ0C 3PGCA 5F7NC 5DRXB 1JRHH 1H3XA 3C5JB 5GHWL 4PLKD 2XTSA 5FHBH 1EAPB 4PVBA 4KMTL 1OCZB 2LAGB 2XX1A 3KWWA 1QSED 1T2XA 4UDUA 2V2XB 3H9SB 3IMWA 5FGCB 4J3OD 3ZTJH 1JYNA 1JGIA 3P1VA 4WNQB 4M7JH 1NFDB 1U8PA 3ORJA 2EUXA 2VDKH 4IGBA 3DX6A 3TN0B 2GTZB 3KXFD 3ESNA 1XB3A 1FUNA 3GXPA 2NY6D 5EO9B 1Y0LA 5DVMA 4JRYE 7FABH 4RA3A 1N10A 3U4EA 3GMRB 4GS7B 3P0YL 2LFEA 1A9EB 3ALPA 4UWQB 2MKWA 3CU1A 5D7JC 2PMZA 3IDNA 4HKXB 4FNTA 4JFDA 5C09B 3QRFM 4E0RB 3MCYA 4XCCH 4BZ1A 5EUOF 2CG9X 1SNRA 1YNTB 2EEAA 5KYWA 2ZOLA 3O9WB 2FIKA 3DX7A 3C75A 4MYPA 4ZSOA 5AW8B 1V7ML 3EOTL 3N43F 4Z76B 1PZ2A 4JO4L 7TAAA 3QO1A 2BVQB 3B2UC 3MJ6A 1FRGL 3SD2A 3SGKC 3TURA 5GGVY 2BVPA 3CIAA 4L05A 1OAQH 5C08D 4Z3TA 4XZ4A 2WINB 3ENEA 4XTRD 1PY0A 4N0YL 4U0QB 4P5TB 5C0EA 1JZ8A 4P46C 2XV6B 1KGCE 1JPFA 4H8UA 2AKRB 3SDCC 4GAAA 4X80H 4W9ZA 5TDNB 4C47A 3ZTNL 5BV7B 1I7TB 1WBZA 2TSAA 4F37K 5D7SH 5JXAH 3HG5A 1LDSA 3C8KA 3FQNB 3RFRA 4G9FB 4CMHB 2JELL 3H9SD 4P4RA 4F8TA 4HGWB 2FHCA 3ESOA 1TO5A 1KXVA 1WD9A 2G5RA 1Q9OB 2B59A 4OGZA 2UY6A 3TN0D 2PCFB 1P5UB 3QXWA 4R96A 4J39A 4AL8H 3T2PA 3IYLW 2PO6B 1I3RB 4NI3A 1TTFA 4OD2A 3EHBB 4ZXBA 1TZOA 5F7KC 3TCLA 2VXSL 4X50A 5C7XH 1G7QA 4L48A 5C09D 2V2WA 1YHPA 2Y36H 3DROA 4RFNB 5F8RC 4AOFA 2MCPL 3O41B 4BCXA 1CE6A 3F7KA 4ZW8A 2P8PB 3O9WD 3R8BB 4NZTL 1A6VH 2CR0A 5SX5K 3GBDA 4H0IA 4BZ1H 5DQJA 1RZPA 4F15C 2UXFA 2WVVB 2PUQT 2VE6A 1Q72H 2BINA 2BSSB 1ADWA 4YQXH 1UD6A 5SV3A 3UG4A 4NENB 3U7AA 1E7UA 4QHMA 5KSUA 3SQBB 3D7PA 2P8MB 4LPVA 4PIBA 3I75A 5EU6E 5FPIA 5ERWB 4FABH 2QVMA 1B9KA 5CJQL 3MFFA 4JRYB 4GLRH 4ACTA 1TMQA 1K85A 1U95B 2F0CA 3F58L 1ACXA 3HS9A 1JIBA 2ED6A 3VD0A 1DL7L 2IALB 4YDKH 1A4KB 3EFDL 5I1JH 4N2IA 3FT2B 3S88H 3ARWA 3IB4A 1E43A 2QZ5A 4JPKH 5SX4I 3L8QA 4LSVL 3V9CA 4JFZH 1AO7E 2R56L 3ZU8A 3MACL 3ABKB 4QJ3B 1SJMA 1JGLL 2H6PA 3OAZK 4PS8A 5D1ZC 3SD5A 1FZMB 3UBXB 4AY0A 1BAFL 2OMZA 1MNUH 3VYPA 4BM7A 1WICA 3O45A 1KENL 4WEUD 4A7QA 3RILA 1HQ4B 4U6YA 5IM7B 3KDPB 1DTUA 1OLZA 3Q9QA 3BLBA 2GUOB 2PO6D 3RZCB 2A38A 3IRCA 4EKJA 1ZGLM 4XMUA 1C16A 1AZNA 3UYOD 2FO1A 1LEGB 5E5RB 3MA9L 4HEMA 5JW5B 3B6SA 4R7NA 4WHCA 2F53D 5MEOA 1T22A 5DD0L 4TQEL 3TEUA 4GXVL 4J6RL 2YRBA 5D2LF 5HJ3B 4HJSA 3PFQA 1NDGA 1KJMB 3QWOA 4JFSA 2J6EH 3RDTB 3FK3A 1UD2A 2X9ZA 3VGGA 2AZAA 1RJYB 1R34A 1WLHA 2CO4A 4PY8J 4AC2A 5E95B 1AKPA 1JERA 3A3YB 4GQPH 5AWNH 4C55A 1G9MH 6TAAA 3TCXA 3O8XB 5I15H 3BKJH 1BV8A 4UQ3B 1CL7H 3SYCA 3ZHLA 1BOGA 1J11A 5JXEC 3WFDH 2YOAA 2XXCB 2XZCH 2FJGB 1MFDH 4E41A 4R0LB 3MNWA 3FXIC 2Q8AL 1GGCH 4BSVB 3EBIA 5J6HB 1N5YL 3DV6B 3Q2LA 2QVTA 2A6IA 3NZUA 2SODB 1QFWH 1TCRA 4IYKA 2CUAA 3EH3B 2G3ZA 3QHZL 3QUMA 4AENB 3NZSA 4MD5A 3UACA 4LEBA 1BMZA 2IC2A 2QKIC 3QIWC 1LYQA 3Q2CA 4OCYL 5KZCB 1ACZA 4HALA 2H1PL 4QCIA 1R24A 5ICZA 4ZZFA 2H8PA 4FQQB 4ZUUA 1BD2A 1F11B 1S78D 3OBAA 5FYLH 3OX8A 2Q2LA 4X6FA 3TT3H 1HXKA 1A8JH 2JCCF 3FAWA 4M8QB 4XC3L 1CFQA 4B9JA 1ICTA 4OZHF 5DJXB 1ZT7B 2NUTA 3GXFA 2OSLA 3T6ZA 1NJ9B 3M17B 4JW3A 2YEVB 4MDIA 3SDDA 3X11A 5FFOA 3RZCD 1YEEL 5EU6B 3V55A 1Z9SB 3PABA 1LM8V 2MRYA 4RQQB 3BD4A 3QHFL 5I8KH 1AYOA 2LR4A 2AABL 4K9EL 4FRWA 1KGCD 1PFOA 5DQ9A 4BD4A 4RZKA 1TR7A 4OJDH 1LP9E 3T6QC 1M4KA 1XIWC 1N0LB 4FP8H 5TDOB 2UXVA 2Z6FA 4G5ZL 1AO7B 5FDWA 1BQKA 4I4WB 3H4FA 2AQ1A 4NQDA 4D7PA 4OLVH 3L5IA 4JHAL 1YC8A 4ZW7A 3WKQA 3D8MA 5DHMC 4MVBD 1MREL 2Z7YA 1R33A 3GGWB 5J12C 1KTJA