2RACA

Amicyanin reduced, ph 7.7, 1.3 angstroms
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMICYANIN)
publication title Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin.
pubmed doi rcsb
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2racA00
1PNDA 1KYAA 1J5CA 1ILUA 5A7EA 1ID2A 5I28A 3NSFA 4BXSV 1WA1X 3UABA 4K9JA 2YAOA 4NERA 1FA4A 1M9WA 2PLTA 3S8FB 2FQDA 1A4BA 3ABMB 1AG0A 1PLCA 2HRHA 3WG7B 2YARA 1SF3A 2Q9OA 3HEIB 2Y1AA 2OCCB 3WI9A 4HZ1A 5F7BA 5TK2A 3ZIYA 5I6MA 1ET5A 1X9RA 3NT0A 3NSYA 2JKWA 5B7FA 1EZLA 1NINA 1KDJA 2HZHA 3X1EA 1OCCB 3DTUB 3FYIB 4BWTA 3ZX1A 2J56A 2YAEA 4JHUA 2AANA 4JHVA 3S3BB 4A67A 1E67A 4FA7B 3NJMA 4F7KA 2J55A 5FC9A 1ETJA 3FQ1A 2VN3A 2IWFA 1IKOP 2I85A 4HAKA 3WIAA 2ZOOA 5I6PA 1IC0A 2GIMA 1KCBA 2YAPA 2XXFA 1AZRA 2PCFA 4YVNA 2WO2B 5B1JA 1CUOA 1ET8A 2GC7C 1PF3A 3FQYA 3UADA 2IDQA 2XX0A 4GYBA 1AS8A 3PAZA 4F2FA 2PPFA 4YSCA 3RYMA 1IUZA 2QDWA 1A4CA 1NTDA 2J5WA 1NZRA 4DP0X 5AZUA 3FSZA 3NSDA 3X2QB 5F7AA 4KO9A 1J9RA 1MG3C 2FT6A 4W9ZA 3H56A 2AVFA 2DY2A 4KO6A 3SBPA 4HCFA 1KCWA 4PCYA 4YSOA 3ABKB 1AOZA 2PP8A 1OCZB 2IWKA 2BWDA 3ERXA 3EF4A 4N4YB 1QLEB 1A3ZA 2I7SA 1V55B 1GS6X 1GW0A 2IAAC 3NJFA 3EH5B 4BK5C 1JVLA 1V54B 4P5RA 4BXVA 1TKWA 1WA0X 2YQBA 4E9QA 1M56B 4WKXA 2MRYA 4WTQA 1ASOA 3AG3B 1ASPA 1HAUA 1GS8A 1L9SA 2TSAA 5I5MA 2UXTA 3OMNB 4UANA 4YSQA 4YSEA 2VW7A 1AIZA 4GP5B 4M3HA 4E9WA 4RH4A 1UATA 3OM3B 2IDUA 2P80A 1SJMA 4G72B 1AZBA 1XB6A 1QNIA 4DP4X 4AZUA 2I7OA 4CSPA 7PAZA 1OOWA 3CZUB 4YSDA 3NJKA 1ZPUA 3T6ZA 1NWPA 1OE2A 1SDDB 2HLEB 4YSPA 5I6OA 2LLNA 1OV8A 1BXUA 4X4KA 3ZDWA 4Q8BA 2PPAA 1ZIBA 1ASQA 1MZZA 1AZUA 2IH9A 1T5KA 4DPAX 1BQRA 4E9RA 1NPJA 2BZ7A 4AKQA 2FT8A 2BWIA 1BEXA 4F2EA 3PXLA 4Q89A 3KW7A 2QT6A 1B3IA 1L9RA 2FJSA 1SDDA 1AZCA 3UACA 2CAKA 1URIA 3IN0A 3EH3B 1PLAA 2RACA 3CVDA 3EH4B 2XU9A 1NIAA 1AZNA 2J57A 4YSTA 1PAZA 1KBVA 2HRGA 3SQRA 1ZDQA 1FWXA 1AAJA 2FTAA 3L45A 6PAZA 4HHWA 4AX3A 3T71A 3C75A 4GY4A 1OF0A 2EINB 4HHGA 1PY0A 4EF3A 3IEAA 3UAEA 1AACA 3NJNA 5I26A 2YAHA 1RZPA 2TSBA 1CC3A 3N2JA 2XUWA 4NAJA 1A4AA 5TK4A 4DPBX 4AKOA 5D4HA 1DZ0A 2VMJA 1FFTB 1EHKB 3BQVA 2EIJB 3PAUA 4YSAA 1TEFA 2H3XC 1KGYE 5PCYA 4BWUA 3JT2A 3AG1B 2EILB 4E9TA 1MDAA 2PPCA 3NYKA 2MTAA 1NIFA 3OD3A 2UXFA 3TA4D 8PAZA 2PPEA 3CDZB 4G7SB 1JZGA 4KOCA 3QJUB 3HB3B 1GSKA 4KOBA 5B1AB 3JTBA 1ZDSA 4G70B 2FQFA 3PAVA 3X1NA 1W6WA 2YAFA 3WKPA 4DP1X 4ENZA 1TU2A 3FPYA 3S3DB 3IBOA 2Q5BA 1I53A 2BP0B 1ZIAA 2XV0A 2YAQA 3NJJA 2XV2A 3QJRB 4TXVB 4FAAB 3DIVA 1AANA 1WS7A 2WO3B 5D4JA 4QKTA 2NRDA 5AKRA 2GB2A 1AG6A 3CDZA 1L9TA 4E9XA 1A65A 3MBWB 1JZIA 2BW4A 2ZWNA 3D12B 1JXDA 2FWLB 2HX9A 5B1JC 1KV7A 1L9QA 5I6LA 2UX6A 2BP0A 4AKPA 1J5DA 3TU6A 2HX8A 2JXMA 5B1BB 5I5IA 1M57B 2XX1A 3QJVB 4HALA 4N8UA 4YVUA 3X1GA 1V10A 2GBAA 1TEGA 4E9VA 2QDVA 2XXGA 1PZAA 2IDTA 1BYPA 2BHFA 3BVDB 2VM4A 1AS7A 6PCYA 4A2EA 4YSSA 3QJSB 3AG2B 1OE1A 1J9SA 3H4HA 1SFDA 1XB8A 4A2GA 5D4IA 2XV3A 4YSUA 2VW4A 3QJTB 2AZAA 1L9PA 1PMYA 4ZK8A 4E9SA 2P80D 1ET7A 1MZYA 2HX7A 1ZV2A 4YSRA 4DPCX 1JXGA 1BAWA 1WA2X 1NICA 1NIBA 4P5SA 2QPEB 1NWOA 1RCYA 1N70A 3U25A 1HAWA 3QPKA 1J9TA 3NP3A 4DP2X 4KNSA 2YXWA 2PPDA 2UXGA 1XB3A 1GY2A 2BZCA 2UX7A 4W1TA 1QHQA 2ZONA 2GI0A 4NB7A 7PCYA 1GR7A 2B3IA 5EHFA 2CJ3A 5B1KA 2IDSA 3OMAB 5E9NA 3UAAA 3X1FA 5ANHA 3FSWA 2XWZA 4KNUA 1AQ8A 3FPXA 2EIMB 1R1CA 3S8GB 2VSMB 2ZXWB 3WNIA 3OQRA 3FU9A 3UGEA 1VLXA 1IBYA 1HFUA 1OCOB 3EHBB 3AZUA 1BQKA 3FS9A 5I6NA 4MFHA 2FQGA 1CURA 2CBPA 3NJIA 1AS6A 1SNRA 2FQEA 2X88A 2UXVA 4HIPA 1NPNA 4M4RB 3T6WA 2CCWA 4KNTA 1PLBA 4DP7X 2YAMA 2A3TA 2IH8A 2GSMB 3FSVA 3SBQA 2JFCA 3S3CB 1SHXA 2DV6A 2DYSB 2GHZA 2VM3A 5LDUA 3FU8A 4A2HA 5IY5B 1JZJA 1DYZA 2Y69B 4G7QB 4GP8B 1SHWA 1IBZA 2OJ1A 5AFAA 2XVBA 4BDVB 3TBBA 4BWWA 2OV0A 3T6XA 4AI7A 2XYBA 2B08A 2PCYA 3NJGA 1CYWA 3AY2A 3IE9A 3FT0A 2R7EB 4CSZA 2IDFA 2FNWA 4A66A 2DWSA 2QPDB 2GC4C 5I5JA 3OMIB 3MX0B 1ADWA 1BQ5A 1XMEB 3ABGA 1MG2C 4BDVA 4YL4A 4QLWA 1L9OA 1NIDA 1SFHA 2BP8B 3ASNB 3NJHA 3DKHA 4UF7C 1RKRA 1PZBA 4JKNA 1PNCA 1RZQA 1JVOA 1WS8A 9PCYA 3QQXA 2R7EA 3G5WA 4KO5A 4HCIA 3GDCA 2DYRB 3PLYA 2AZUA 1JZHA 3FSAA 3TASA 1BXAA 4GXFA 4DP8X 4HCGA 1ILSA 3GXUB 5B7EA 3ZBMA 2BP8A 3QJQB 3NP4A 3PCYA 1KBWA 2XLLA 1E30A 1NDTA 1AR1B 3ASOB 2YXVA 2CALA 1BXVA 2H47C 2VSKB 3T9WA 3WNJA 3N55A 2N0MA 4A2FA 3X1BA 3CVCA 3FU7B 3V9EA 2PP7A 1J9QA 1KDIA 4G7RB 1PCSA 1N68A 1E5YA 3TBCA 4DP9X 1SF5A 1W6LA 3AW5A 2BO0A 3WKQA 3H4FA 2CUAA 2BW5A 3AG4B 1NIEA 1JERA 3CG8A 2HXAA 4G71B 4KO7A 1BYOA 3NSCA 1GY1A 2WSDA 3FU7A 3FYEB 3T6VA 2VW6A 1YLBB 5B7MA 1OE3A 1X9UA 5B3SB 3KW8A 1A8ZA 1GYCA 2W8CA 3CVBA 2AFNA 4E9YA 4A68A 3IN2A 3PPSA 1CYXA 2FT7A 2E86A 2PP9A 4UAHA 4PAZA 2IWEA 3V9CA 1F56A 4DP6X 1JXFA 1PZCA 2DWTA 1WAEA 4L0PB 5I6KA 1E5ZA 1OCRB 1GS7A 1JZFA 2H5UA 3ABLB 4GP4B 3SBRA 1W8EA 4A2DA 1JOIA 2X87A 3NJLA 4DP5X 2EIKB 5PAZA 2W88A 3FQ2A 3GYRA 1E65A 1JZEA
chains in the Genus database with same CATH superfamily
4I5BA 3WTTA 2PUQT 3VH8G 1S9XB 1YEGH 2ITCB 3QFDA 3RKDC 2EYSA 1QI5A 5KZCD 3V0FA 1OP5H 3PY9A 1A3QA 4I2XA 3GXFA 5C0DA 3V2AR 3M8OL 1NCUA 4LP5A 2YD7A 3JBG7 3LZLA 5BZXA 1B6UA 4B95C 3MRQB 4P2CG 3FB6A 1I9EA 2GABA 5TDOB 5CBAB 4L9DA 1M3IA 3QEQD 1ZT4A 1PL3A 3QEHA 4Q4IA 3O2VL 3PL6B 5DVNA 1C5BL 1BQSA 4DEUA 1XMWA 5A2AA 3FUKA 5C0BA 3HZVB 4HLJA 4JLRA 2Y06L 4JB9L 4O51B 5GGSY 3P4MB 4DVBA 4H0IA 4P04A 4L1HA 4L5FL 1OK0A 1QRKA 4FQ1L 4JVUA 2HTLC 1G6RA 3IBEA 3EYVA 2I85A 1I1AA 2NXZB 5HYQA 4HJJH 4QRPD 1WK0A 4MCYA 3GHBH 5B1JA 3D7PA 2EADA 4C59B 1KN2H 4PRPD 5KSAA 1NCGA 2WK2A 4AJVA 4F7MA 3NZHL 5KVMC 1AO7B 1IQDA 4I0PC 1K4CB 1QBAA 1DFXA 2DQ6A 2QDWA 3ZTEA 3LB6D 3Q1SH 1CJYA 4N8CH 4PJCA 3SKJH 3W9DB 3QUGA 4DP0X 4ODUA 2FIKA 3QDJD 2VDKB 1GOHA 4FHBD 3K6OA 4KO9A 3EYSH 5JTWA 1MG3C 4UM8A 4AGPA 3V4UH 4NQDE 2AVFA 1G0XA 4TVPE 4HCFA 3SDDC 4NWTL 3RDTA 4X5QA 3G5XB 3L17A 4YSOA 4M02A 1ODAA 2YGVA 2J5LB 1A7PL 2Z0BA 1UEMA 3ULAB 3FZUD 3QQ3A 5HHOE 4QNPE 3BP6B 1V7NL 3EH5B 3R8BB 2K1MA 3V6ZA 1DVSA 4WDIA 2DI7A 4PJIE 2E74C 2YQBA 3M86A 1M56B 3MV9E 4YHNB 2W92A 2MRYA 4Y2NA 2ZUUA 3NFNB 4JFEA 1HAUA 1I1YB 1OARL 3K7UA 1ID5I 3BVXA 1X4YA 1P5UB 4JQVA 3DOSA 1JN6B 5CCKH 1XO8A 3BWUC 3MROA 4FG6C 2OSWA 4HV8A 1CLOL 4MNGA 5EOTB 4TOYL 4D0CA 3CFBA 3ULUL 1T04A 4OCLC 3OLDA 5AB1A 1RZFH 3AXHA 3HG5A 3VMNA 1QSZA 5EU6E 2O6EA 3DO7B 3UTTA 4YSDA 3DROA 3C6SB 1U0QA 1EXUA 2DQHH 3Q1EA 4ACTA 1JMXA 4HPYH 2AERT 3LNEA 2XQYK 3EYOB 1KLUB 4XO3A 5HDBF 2NSXA 3SE9H 5B3NA 1RULH 1L6ZA 4PJ7F 4WGKA 1AIFB 5AVSB 2EE6A 1MAMH 1OW0A 4JRYB 1WZ1H 3KYKH 2DH3A 3H9SD 3QQ4B 2H41A 1L5GA 1KC5L 3PRZA 4HIXH 3VG0H 3EW3B 4PJFE 2BZ7A 3EO1A 4XVTH 5I73C 2BWIA 3VFOA 5FM5O 3TLRA 3BIKB 4LU5L 2BS8A 3LTVA 4L1DA 1DUYB 1SDDA 1LD9A 2HFFA 4XZUB 4BEIA 2J1KA 2XPGB 4PJGB 4M1GH 3WIIH 4GQ9L 4L4JA 3FTYA 1U8CA 5AL0A 4AVHA 4OKVA 2LLLA 3FONA 3AMKA 4ZW3A 3MSPA 4XE5B 3BO8A 1UA7A 2AV7B 4MS8C 3LQMA 4LSRL 5DRXB 1O7DC 4PGEA 1DQML 4PRHB 4KQ4L 1V3JA 5C0JA 4KI1A 2VLKD 2DMCA 3DSNB 4QCIB 5CEYB 4YE4H 4JZJA 3LRKA 3FQXB 5CJOL 2F15A 4WTZA 2DQEH 3VD1A 3BHBA 3W0WD 5I0DA 3MU3A 4POZD 2TSBA 4LASH 1WAAA 4Q0XL 2IANB 5E5MB 4NAJA 4RGNC 3B56A 5HD8D 1JE6A 4JQIL 2WQSA 5IIEA 3LKQA 5JOPD 4Z7UF 1THAA 5HJBA 2HP4A 4QWWC 3GSNA 4ONGL 2H9GB 3RLSA 1UB5B 3MRPA 3U6XA 2ZWZA 4BFIB 3Q8EA 5DJXA 2DWYA 3AG1B 4TTDC 5EULV 3LN5B 3UMNA 5FO2A 3IGAB 5CD3A 4HWEL 1J1XH 3QZBA 3ZL4L 1EFQA 3U7WH 5I16B 1G7HB 1A7OH 4I18C 3SPVB 4KZDL 3U7YL 5D72H 5DT1L 3IPFA 5LHDA 2Z4QB 3CUPB 3QO1A 2V7NA 3E6HA 5DFVD 2ZKHH 2WTPA 3MYJA 5IROC 4B50A 5IQOA 3QR0A 2Q5BA 3O9WC 1S9WA 3PV6A 2ZP0T 3LEYH 2R0ZL 1AXTL 1XH0A 2Z91B 1WT5A 1EHAA 1KB3A 2IOOA 4GEJA 1EJOL 2FJFB 2ZJSL 4N8VB 3HG4A 4O4YL 4IRZH 4LSPH 4PV1C 1EFXD 5CMAA 1JRHI 3DGGB 5DTFA 4HUWB 1IMHC 3GS7A 1FORL 1CF1A 3HVDA 3LIUA 1A7RH 1MCJA 3B5GA 3LSOB 2AC0A 1FRGH 2WQAA 5DVMA 1CBVH 2YS4A 4QT5B 1U95B 4JO1L 3SKOA 3D05A 2MNUA 2EEXA 3DUSA 4X6FA 2BP0A 4C56D 1PSKH 2V37A 3C60C 4Z7WB 3T09A 2VDPL 3LRMA 2PTVA 1TEGA 4FA8A 2YFOA 4DN4L 4K4KA 2IDTA 4XZ4A 4Y9CA 5CGYD 4L4VE 3CX5K 3FRUB 3SY6A 1CR9L 4JMNA 1IGTA 3FNKA 3N0AA 3TO4B 3GI8L 1R5IA 5I0YA 4LQFL 4WW1A 3FF8A 1G7IA 4AG4H 4KJYB 5IB5B 1BZ9B 3G5ZB 4D9LL 2CLZA 2OXGB 4K5PA 1E5CA 1KTLB 1RK0B 2VWEE 2JCCB 4L29A 2OK0L 2PR4H 1F58L 3CFKB 5JO5B 1BFVL 1S9YA 5I1JH 4HEPG 4PRAA 3PGDA 3LJ3A 3MO1B 2XC8A 4JFXB 4FGMA 5ICZB 2D9CA 3WIHA 2IGTA 1K9TA 4FEIA 4QR7A 3V4PB 2NNFA 1Q9KB 5D7IF 3A0OA 1TNMA 4XH2B 1M7DA 4JY4B 4QOKD 4ZFQA 1JNHB 2P42B 4TSBL 5I1LB 1E6JH 2YGQA 2Z34A 3VXUB 1UJTA 1WO2A 2WLLA 3SDCA 4AMKH 1BMZA 4I7ZC 4ADGA 2KDGA 3BH9A 1ZPLA 1VF5C 4K94L 3VGHA 2XKNB 1QATA 1AD0A 5IGXL 3X1FA 4KVPA 2E9BA 3FSWA 1T7WA 5CS7A 5D5MB 5INDB 1T03H 3QORA 3BVNB 3SKNA 7FABH 1JHLH 2EC9T 3TVMD 4R96B 3ULUC 1KXTB 4Y5VA 5BCAA 2HN7A 4MCNA 2XNAB 4IKNA 4J7RA 1SQ2N 4S0SD 5FV2A 4W9KC 3FB7A 4ZZKA 5C7XL 3PGFL 2FQGA 1CXKA 1RZ8A 3HUJA 5T1KB 1GZHC 4G6JL 2E7LA 2X88A 5IUSA 3MLYL 2G0LA 4BA0A 3R4DA 1BOGA 3FXIC 3JWOL 4DETA 1NCCL 2DQIL 4N1CA 4BKTC 4DHLA 2WXPA 4HEME 4NGHL 3KLKA 4UWQB 2K8MA 1D5IH 1MWAB 3VFWA 4U1JA 2X2YA 1YAZA 4AGOA 2Y24A 5LAXB 5GHWL 3I3BA 5D7JB 3KLHD 4KH2A 3WFDH 4KUCF 4UDUB 4WU7B 4CGTA 3TCXA 1B0GB 4WO4B 43CAA 2V2WB 5LDSA 4YZFE 2VO5A 4ELKA 1QD0A 3P3TA 2WLMA 2JJTC 4I9WE 4TUKL 1PLGL 2ENQA 3HS8A 3UZEA 1TCMA 4NUGH 5LCVL 3KPSA 2A83A 5CHNB 4JN2A 2FWOA 5KAQF 4Y5YC 5CJXC 1XIWD 4LP4A 4PGDA 5I76B 2XFXB 2RQEA 3IMTA 5ADPH 3TV3L 1BEYH 3M1BB 2Z31A 2Y07H 4HWZA 1WBZA 1T2QH 1KBGH 3PYCA 1WFIA 3FC8A 4J12A 3LKPA 1SFHA 2XTSA 3GMRB 4HOMA 2Z9TA 3QPQD 3B3BA 2NW2B 1EHNA 3VXRB 1PZBA 4JKNA 3U0WL 1KPUB 1QBLL 3QJHA 4BFGA 3WFCH 1QR1B 3U4BL 3CSBA 3JV6A 4AQZA 2OULB 4MMZB 5GGQH 3LKRB 5KVFH 4XCFL 1CE6A 2A9NL 3W37A 3DYPA 3ZKXB 3ZDYE 2WMPA 2NLJA 1EGJA 1DVYA 1HXYB 1LP9F 3K2KA 1BVKB 4ZFZB 2OFQA 3HLAB 3S35L 3C6LB 3FL7A 3QRGH 1MXDA 5IKCA 2ID5A 1BGXH 2OZ4L 5I1AB 1FNLA 2E8ZA 1KYOJ 1AR1B 1FYHB 1LQSR 3BH4A 4KVCH 4X8XA 4ZUSA 3U4EB 4X5LA 2YXVA 2B1AL 1F90L 4DKEL 4FXGA 1BXVA 4KAQH 4L4TB 4PYGA 3S6CA 4GBXB 2R4SH 1ZS8B 2AJYL 2XWXA 5KEZA 4PG2A 4V2CB 3L7EA 1BM3H 4LRIC 5F2FA 1X4ZA 5FA3A 2AEIT 3CVHH 5HHOA 1DJSA 2O6DA 2X2UA 3RFRA 2VN6A 3AG4B 5L2KB 3ZHNA 2VUKA 5FPIA 4QEGA 4Z0XB 3FOLB 5GRXG 4ZXBA 1JPTL 4EZLA 4L8SA 4MHHI 4NM8L 4OCRL 5E4IA 3HNSH 4OF8A 3AU0A 4L8CA 4KKAC 1ZV5A 3MJGX 1CMOA 3V0VB 3MFFB 3DRTB 5AKSA 3LQAH 4ALAC 1XBRA 1FIGL 5F7FA 3HPJA 1UXSB 2AFNA 5FOBB 4S10A 1EMTH 4A68A 3FBKA 4TUJB 2VDLB 4RZCB 1Z0NA 3KG5A 2X4UA 3VI3B 3V9CA 1O6SB 2CO2A 1DHKA 2CH8A 3P9MA 4CU7A 4J2XA 3ZL1A 4L3ED 1CVSC 2C1PB 3SBRA 3DV6B 5L9DL 4MJID 5IQMA 1FLRH 2BOLA 3GQFA 1ZHLA 2Q86B 5GZOC 4NIYE 5J06A 4RDQG 4BKSC 3PAYA 4HQQL 4OJAA 2CGRL 1CZ8H 4P2QE 5I5IA 5EEWA 2DQTL 4NQED 1V27A 2XDHA 4UT6H 5I28A 4XMKL 3SDYH 2R9HC 5D4QA 1FDLL 3CCHB 1DR9A 1BZ7B 1FYTB 4GOSA 3VA6A 4RFEA 3ILEA 1DJWA 1Q90A 1CDUA 3D48R 1HC1A 4FG0A 1M71B 1T83A 1PZ5B 1FL3A 2BHYA 1SF3A 3T1WA 3GFUA 5AAMA 5IWLC 3PWLB 4HS3B 2Y1AA 4ZSOE 5AVVB 1FUNA 3WI9A 1HL4A 4XMTA 1T1WB 4U1LA 5ACMA 2GJZA 3MREB 1DVUA 3PQYD 2PCFB 4AWJC 2F1AA 2DF3A 3R0MA 4NO5B 4NEHB 2JE8A 5C0IB 4OGQC 2FJGA 2NY3C 1KUMA 4HCRH 4K3HA 4DZ8A 5IHZA 2ITDB 4HAKA 2HJFA 1M6OA 5MEPB 5TH2B 2C9UA 3AM8C 1J05A 1B0RB 4EDWL 4A7QA 3BKCH 1AZRA 2WM0A 1H19A 1BJMA 3IJ8A 2YEZB 3FQYA 1MCEA 1BW8A 2ZOTA 3EGDA 2XTLA 5AW1B 4ZMAT 3GMOB 4TUOB 1U21A 3SPGA 1I3VA 1DVFD 1KJ2A 1Q1JL 2B5IC 2DMHA 4M6ML 1MHEB 1ZJBA 3NCMA 3MLWL 1UC6A 2ARJB 3JVGA 3WIFB 5D7LD 3O6LH 1U3HB 2ICWB 5GGTL 1TMCB 1PFCA 4N9OB 4TN9A 3RU8L 3L9YA 3T65A 3HI1A 1CU4L 3L7FB 1X5IA 3FTXA 1SMAA 3SBPA 5GS0D 1XVSA 1U2CA 4B9JA 4N2IA 4EUPG 2R1XA 1FZJB 1TOXA 4IRJD 4Z7QE 4ZS6C 1QLEB 1QW8A 2VLLB 5L8KB 2AXFB 3P73A 2EZ0D 3EYQD 3VXMD 1JNLL 5BRZA 4P06A 1MJ7L 2N7BA 5FFGA 5MP6H 4ZNCD 1UXLA 4PJ8A 3QW9A 4JRXE 2VJ0A 2XA8H 4AVIA 4EI5C 5HHXL 3UG4A 3CSYA 5JNYB 3GBNH 3GZKA 2DDQL 2O30A 4WHDA 4CADB 4WKXA 2QSVA 1HNGA 1IAIM 3QA3B 3L3DB 4X7EC 1ETZA 4TRPL 2EEDA 4YK4C 3F12A 5BNXD 1NGWA 1JAEA 2GIXA 2UXTA 4WIQA 1I8KA 3OMNB 3RUGF 1K3ZA 3ARBC 3AREA 4KY1H 5F0PB 3NABH 3OR6B 2VC2L 5I8CB 4ZUWA 2ADFH 4PJXE 3RWGB 4HC1L 4G72B 3NN8A 3UYPA 2K70A 1QNIA 4DP4X 2Y1YA 2DI9A 3W2DH 1I85A 1XF3B 3ARVA 3DIFB 3NJKA 2AQTA 5FHAL 1KCVL 4R0LC 3GMMB 3U0PB 5DMGC 2BLFA 4U7SA 4P9HC 4UBDD 5SV4A 3S4SA 1T7YA 4Z3IA 4L2YA 2EIDA 1ZIBA 5KBNC 2LFEA 3IGUA 3TF4A 4UM9D 4NRZA 2Y2WA 4GKOA 2GCYA 1NPJA 4WNSA 3OKLB 4ZI8A 3U1SL 4H2AA 1MWOA 2JKSA 3LIZL 1CGSL 2B2XL 1CFBA 4ELME 2ROXA 2CAKA 3BWUF 4U0RB 4WFHE 1E4WL 3F2LA 3RY5A 4HUNB 3EAKA 3DYOA 1EO8L 3FUHA 2MTPA 3MTXA 2BY1A 4NFCA 1A7QH 3WFEL 2WLIA 2VMFA 3UTPE 1WBYA 1KGXA 3SO3C 5DJ2B 1OTUD 3EYFA 3BESR 4HHAB 5ID1A 2XSKA 1HYSD 3RIFK 4N5EC 3AS3A 3DMMB 1OGTA 3S7GA 5A2JH 3IFOA 3QRLA 5D96B 3WGUB 3CC1A 2CRZA 2YBRA 4N86A 1NMCB 4LHUD 1UXMA 3QDHA 3QFJB 4X4XA 2AJUL 1YEDA 2UUDK 4AGNA 2ZOUA 3BKJH 3I84A 4Y19B 4TVPH 3QEGL 1MNUH 4HUCA 1XCTA 5E2VH 3IU3A 3V0WL 2Y7SA 3S3PA 2ARWA 3LEVH 4BA8A 5DO8A 1KGYE 5L7XH 3APNA 2YMXH 1I1AD 4KY2A 4H20H 4UV7H 2VYRE 4EOWL 1ZV9A 1OOAA 4HEMA 5AYTA 2HFGL 2UUDH 5EWIL 5ISZE 5TGBA 2W59A 1QZ1A 1A8JH 4JAMB 4PJHF 4FNSA 4ZMVA 4R4ND 4Y16C 3EFOB 4JDTL 3VAEA 2P8PB 1A6AB 5D71L 5I18H 2QMJA 5DQDL 5B1AB 4PREB 2WTRA 4YBLB 1F00I 3CFJB 3GSUB 5BV7C 1UWYA 1FP5A 4I3SH 5C0CE 4E5XA 1LTXA 1WHPA 3NPSC 2KLSA 2NY7L 1G1OA 5GIRA 4FJZA 1XGUB 1QR4A 2D7MA 1WS7A 4XBMA 5G4NA 3VE0B 4LVNC 2GY5A 5F21B 2GB2A 1O7SA 1G7PA 1DQLH 1O9VA 4W4OA 1L0YA 4JFQB 3SO5A 2DAVA 2CHZA 5E6YA 3ZY7A 1JZIA 3ZYZA 4UU9A 4NC1E 1B9KA 1BCIA 3D12B 4Z7AA 4WFGD 1VHPA 5DWPA 2IBZX 3WJMB 5LGJA 5I6LA 2I60H 1B3JA 2J2ZA 1CD8A 5DRWB 4DUWA 5KSVA 2HX8A 2ESVE 3JT0A 5E1IA 5I71C 2WLHA 4FTVA 3B7TA 2XXGA 3L9EA 4P46A 1UJ3C 1DBAH 3AWGA 4YQXH 2CO3A 3CWGA 2NT1A 3ZTCC 4DTGL 6PCYA 4ZMZA 2QPFA 4I48A 3MKGA 4P5TB 1CTMA 4YIQB 2EVHA 4X4MA 2X4NB 4Y4FA 1FL5B 2WYIA 4L9LC 3SD5A 1S9VA 2AZAA 5DS8A 3RAJH 3WMSA 1P7QB 4X0NA 3MXVH 1CXEA 3U9WA 1RUKH 4ONFL 4GS7C 2GJPA 1AGEA 3KPLA 2I07A 3BPLC 4QMEA 2DWEA 1BAWA 2IAMA 2GUYA 1MRFL 4RA0C 3CFDA 1EAPB 5K9QG 4WENB 3M17B 3HAEB 3K8KA 3IT8D 2FUQA 4U6HA 3KE0A 3O6FA 4EQ2A 4QHPA 4XNDA 3NP3A 4WWKD 5DWUH 5BUPA 3LHPL 4I9XA 2A74C 1FGNH 2BSTA 3FCSA 4ANVA 3OKDA 4EN3B 1XB3A 2X44D 4TS6A 3IRZA 4WEMB 5EZJA 3ZTJG 5T1MA 3K0WA 2V7HB 4PRIE 4YBQD 5KSUA 3SGKC 2BK8A 5HDQL 3HE6B 1KJ2H 3OMAB 5DK2B 4NN7B 3P69A 5AQ0A 3JTTB 1DUZA 3TEYA 3B4NA 4PJEA 3DTXA 1GPOH 3KEDA 2OBGA 1G7QA 3CZNA 4EBQL 1WV7T 1MF2L 5DUBA 3WELA 1JPST 3VA2C 1H3VA 3E2HC 5JHLA 4M56A 1MLCA 3CZJA 4ELDA 4PPTA 3UJTL 3IJHB 2VN7A 3L2LA 5I6NA 2BCKA 3UJIH 4APXA 3A6BH 3HMXA 2C9RA 3I50H 4WK0B 4QF1A 2PCPA 3BSGA 4UZSA 3TNMB 1J88A 4A7GF 2XV6B 3IFLL 1YC8A 1SLWA 3QUYB 4IBSA 2AI0H 2CKBA 2FHFA 5ILTL 1KB5H 1Z9SA 2CPUA 3PIQB 4A6YA 4M7ZB 4PD4K 4HW6A 4XTRD 1SHXA 3T0EC 3Q3GB 2Q2EB 4AK2A 3W1ZA 4HJTA 5IY5B 3HNVL 1DQJB 5L88L 3VXQB 4NQCB 1U41A 5I0VA 4HGMA 1TTRA 3R19A 4M4RA 3PL6D 1T21B 4FYRA 5CP7A 1HJCA 4GW5A 1Z5LB 4XN8A 3ULUF 2XIDA 3ORJA 2IOIA 5LNEA 2TAAA 1MW1A 3LS4L 4LPWA 4QIRA 4YDIH 5HHMB 1FLTX 1U8IA 3VJ6A 4U7KA 3P11L 5KBDA 4UIKH 4NZFA 5IFAH 4X8CA 4MNQB 4FLRA 3MUGA 2NXZD 3HC3H 3UBXB 2FYYA 4GQQA 4XBPB 3S88H 2XKSA 5CEZD 3GT6A 4OQTA 1RHFA 1IQWH 4R26L 4WI8A 3WTXA 2BH0A 4UOQA 1IGJA 1KGCE 2C3VA 1SHMA 4MQ7A 1FJ1B 4NZDA 3IKCA 4P05A 2B4CH 5T5FH 3HN5A 1TYJA 1JRHL 2P4AB 2PYFA 4HIQA 1FG2A 1ILSA 2UZYA 3MXWH 5EBMA 5FYKD 4DVRH 5FYLL 3G08B 1A14L 1D5RA 2EC9U 5IQ9B 3RZWA 2F0CA 4GG8B 2PR9A 3I6KA 4XXCA 3U9UA 3VFGH 4X7TA 2KHAA 4KITB 3S35X 1AHMA 4A2FA 1G4RA 4FQQA 5D6CB 4CMHC 1WFJA 5FKAB 1MCHA 1YNTB 3BPOB 1T3FB 5AALA 3QRFM 3QUXC 1ROCA 2EXWC 1JK8B 1IE4A 2F5AH 5AW6B 3MRDB 4R90L 2JIXB 2EYRB 4LL9A 4OR1A 3H4FA 4WI5A 4F93B 4NUJB 3MGTB 3NZ8A 4NPJA 2R0KH 1G0YR 4H5SB 3B8SA 3L5XH 4JRXA 3G5VA 4KX9A 2YUZA 4WTXA 5MENE 3EJZD 3IDGA 2YD1A 1BFTA 2KQMA 4X5PA 4HG4K 1W72H 3DBXB 2CHNA 5AZEH 3ZRCC 4MBRA 3J7HA 1PX8A 1OK8A 3KW8A 1GYCA 2MOVA 1JDDA 4QAWA 5IMOA 2Z93A 1CFNB 2IV8A 2CO1A 4MJ5B 2VDQL 4WV1B 4QHLA 1WLHA 3DURB 5CCJA 1Z1WA 3CPLB 3SGEH 5SX4H 2J6EH 4LDOB 4PJXA 2CIKA 2E47A 2YD0A 1G4MA 1E5ZA 3WTWA 3MJ8B 1OSZB 1JZFA 5K5YA 1CN4A 3D09A 1W8EA 4Y4KB 1XGPB 1C5BH 1PKOA 1QP1A 3Q2LA 4QKXB 4EEEA 3N1QC 3KYNA 4FQLL 1SJVA 5T1LB 3NJLA 4F5CE 4DUVA 3F84A 2GJ6B 1CG9A 2BOBA 2X4PB 3N1GC 4FQ1H 5SWZE 1O75A 1FFNB 3NSFA 4JG9A 4U4IA 3K71A 4E2OA 1YUHA 2UWEF 5CKGA 3VI4E 4JN1H 2DMBA 4XVSL 5JORA 5CSBA 2J8UB 2FQDA 1A4BA 1G94A 4X6CB 5I8KL 3ZUNC 5EF3A 5LBVA 1P53A 3TXAA 4EIZC 2DQDL 4WHYG 2YARA 3NZHH 3UTZB 1U8PA 1QMUA 1AGBB 4ETQB 4ODHL 3B43A 1ZJAA 3ZIYA 2WYHA 3H55A 3LNHA 3R06A 3NGBB 2WXHA 3L13A 3CFCL 1H5BA 2AJVL 4UZGA 1IU1A 5CJBA 4PJ7E 3KDPB 4ZMPA 3GHEL 2ADIB 4ETYA 1OB1A 4NWTH 2CDGB 3U1QA 4LHUG 1CTNA 4CN6A 3S8WA 4JFYA 4U1NB 5T1DL 2RR3A 3BT2L 3EGXB 1D6EA 2F7RA 4K3DL 5J0BA 3V6FB 5HHPB 3RL1A 1FNAA 5IVXF 2ICWJ 3DVNB 4FQXB 4M03A 5KBLA 2GT9A 1D7FA 5IESL 1DO6A 5AVWB 5AW3B 5IQ7L 3C87A 4YFLF 1J1PH 1OARH 3ZDZB 2AP2A 1PKQE 1R3KB 1JGLL 1HSBB 4ZX6A 5FS5A 4KQ3H 1IL1A 2FO8A 4HJGB 4KHTL 3RRQA 2B0SL 1CLOH 1SYSB 2R27A 4POZC 1XD0A 2F7IA 3IE4A 4TOYH 3ZHFA 5GGRB 2BSRA 5HD8C 1ZTMA 5GZNC 3TJEL 2LU4A 1OCZB 4OZHE 2R56H 3VX1A 1NFIA 2QKIC 5EFIB 2JJSA 1JFHA 2NNCA 4G6AC 1C8PA 5E8OA 1RI8A 1YN6A 2WQWA 4NDMB 4XBEH 1L4IA 2IAAC 5DZPA 3TX4A 3TYGL 4JMXA 1JVLA 1SXAA 2GAZB 4LKXA 1MI5E 3H7BB 4BH8A 2KLRA 3QEUA 3O3DB 2ICEB 5SWSA 4APQB 2MQGA 5HDRA 3LXCA 2H32A 2NTFB 2RJMA 2R23A 4WTQA 2VISB 5HSFA 4WCYH 1KBKA 1ASPA 3HMXH 3UCRA 1KC5H 2FSEA 4H25B 2VLJE 5SWQA 1ZOXA 3R7RA 1E27B 4E41B 5DFVC 4JZNB 2W38A 4LU5H 1JV2B 5DJ0A 5DJCB 1BD2B 2FWSA 1FGVL 4EDXB 2ESVA 2D7PA 3F64A 1RUQH 4ZXBD 4A6YH 4K7PY 3D07A 3QWQB 5JW4Q 3QT2A 3O3BB 5IM7A 2KZBA 1F18A 1TSHA 2ZD0A 1ITBB 5K9OA 3BX7C 3WJJA 5LNDA 2F19L 1LO3L 1OY3B 3RKPA 3ZE0B 2XZZA 2HYMA 1ORQB 3CBKB 1NWPA 2Y1ZA 3RA7L 5GISL 4EXPX 3EOTH 4MXWL 5IBTH 1DQMH 4KQ4H 4W9DC 3UOAB 2ZUWA 5ETUB 1OF2B 3RNKB 2PPAA 3ZVVA 4FLHA 4OT1H 1A6ZA 1Q9WB 1VA9A 3KPMB 5L6YH 1BPLB 1F11A 1PBYA 4NQSA 1HH9A 2UZXA 1S7WA 4I2XB 5L4FA 2H3NA 3QI9A 3MGOA 5CGYC 3V52L 2QPUA 2BNQE 4NKDA 2MQ0A 4P2OB 2FVNA 1DJXA 2W80C 4Q0XH 1IGYA 4M5SA 3OPZL 4AUUA 1AZCA 1AH1A 1JSYA 2NXYD 2TRYA 4Q6IC 3NDZE 5DJZA 1E8WA 3CVDA 1MUJA 1E4XI 4Y1AB 1PD6A 2IMMA 3KS0J 2YKLH 3VRJB 1YY8B 3W39A 2E4TA 4WY7L 4M61B 5IREA 4PJBE 5E0QA 3K3QA 3ZL4H 4M8RA 1HU8A 1A47A 4U1SA 3EYVB 6PAZA 2V2XA 4GJTB 1CGXA 3L4VA 4JVPA 5DT1H 3U7YH 2HMID 4KZDH 2E7MA 5FECB 1U8QA 5IMLA 1PEWA 4K5LA 5JHDA 2X42A 4BSVA 4HWBA 4GNKB 1UGKA 5EN2A 1B4LA 1IQDB 4JCLA 1XXFC 1J8KA 1GCFA 4GQRA 5TPWL 1I3RA 1WUZA 2R0ZH 1AXTH 4PB9L 4NHCL 5FIEA 4RGOL 1EJOH 4ODUB 2FIKB 4YMPA 4JGNA 1A0QL 1T80A 4WTZG 2BOCA 3BSZL 4HWUA 3RWFA 1HTYA 2DWDB 2NZ9D 3BGFC 5H35B 4AOFA 1OO2A 3NIDF 3QK0A 3TVMC 2K45A 5F9JA 3ILQD 4N0UA 1N8ZA 2Y25A 1KCLA 4XHJC 3UTSA 4LDEB 2R2HA 4G7SB 4XN9A 1LWJA 1MH5B 4RWYL 4G6FB 4UT9A 3HHMA 4DN4H 4XOBA 1B6DA 1UADC 4QXVA 1G0DA 3D6GA 3EXLA 1N59A 1UOLA 3G6AB 2E7HA 1GMIA 2ZP9A 1CR9H 3BN9C 5E6IA 3NCYP 2NSQA 3IBOA 4K23H 4YN3A 2OLDA 2ZCZA 3T0VA 4LAQL 3WY1A 1I53A 2IF7A 1U6AL 1CS6A 2AXGB 3IS1X 1R3LB 4JDVB 4K3JL 3PP3K 3HLKA 4LXFA 4TXVB 5F89B 1E8YA 4HUXA 4JFEB 1CDBA 1T6BX 3MNWB 2PWDA 1QZNA 1VFBB 1IJ9A 3D52A 1R17A 2OYKA 3UG5A 3QIUA 4PSPA 2WBXA 3KLHC 4JQXC 4FQJH 4FX5A 2X89A 4ECNA 4MNGB 1JD7A 3UAJD 4O58H 3KWUA 3ULVD 3PG2A 1KV7A 1JGEA 3PJLA 4HOXA 1WFMA 3GIVA 1MCPL 3BUBA 3F00A 5BRZD 3AS1A 4P57B 4PJ8D 1HYRC 3F04A 5FYLE 3B2VL 4YR6B 1OPOA 3QJVB 2E6PA 1VZIA 1XIWC 4H44C 1HIML 1QRNB 3RJDA 4F2MA 1TVDA 5T3ZL 5KYYB 3C6LD 3IETA 1IGCH 2HLFD 5DMKA 1URLA 4F7CB 4GFTB 4K94H 4JFFE 2CJTA 1UM5L 2DB8A 5TE4H 4L4TD 4MAYA 5D4IA 3MACL 1A1OB 1L5GB 3QPQC 4GBXD 3NEEA 1IFGA 4GKSB 5DR5L 4K7PL 1MCNA 3T3MB 1E3XA 4D9RD 2NOYA 2O6FA 2FX9H 5F7EL 4LEBA 2IQ9H 4DPCX 3S3JA 2AK4E 2Q7YA 1WUNT 5IW6A 1WA2X 1NICA 2KS0A 3HPLA 4L1LA 1CXIA 3AWFA 1WFTA 1X5KA 4LSUL 2CE6A 1U8CB 1WHOA 2VLRA 2IADA 3PGFH 3BDYL 3DX9B 1S4IA 3WFZA 1U9KA 4G6JH 1JXKA 2Q8BL 2HFEB 3MBED 4GSQA 1XH1A 1J1OL 2AMUA 5DZAA 3CDCA 3JWOH 1P4BL 3PFUA 2ZONA 2DQIH 2WUBH 1JV5B 1LP9E 1F1GA 3FB8A 2EDLA 4IIQA 4TLKA 4HIEB 1OHQA 4NGHH 3KWWA 4XCEA 2W07A 2DYPB 2VDML 3CVHB 4GKNA 4WFED 1BAFL 2WQUA 4K5NA 3KD4A 2X40A 4B3EA 3BHBB 3A6CL 4X7FC 3S8GB 2HJLA 1F1AA 1URZA 4DN3L 3T2NH 5D6DA 3ESPA 2HLAA 3FUFA 5EUOF 4TUKH 1PLGH 5IMMB 3OTTA 4D9QD 2K6ZA 2X4QA 1NSNL 3PABB 5HPMA 1A4KA 4RCAA 3AZUA 1U4FA 1BBDL 1GC1C 2L7QA 3PWPE 4MFHA 1NANH 2CXGA 2Y22A 1SNRA 1SDAB 1JHTB 3BZDA 4OM1H 4FNUA 4WZ9A 5E8DH 5E8NB 4XXWA 2WN3A 1YCSA 1FYTD 2E9JA 3VUAA 2WLNA 4P8QA 3S0PA 4S0HA 4U49A 1N0LA 4P3CL 4M62L 2FHBA 3BKYL 4R97C 2C3XA 1AYOA 3QUKA 1IRAY 2XTJE 3V5HB 3U0WH 2V7NB 4DZBA 1VEPA 4U6XA 3VFUB 4A2HA 2IOMA 3DXAE 3PV6B 3MTRA 3G5YB 1K8IB 2IQAB 2VDNL 2H26B 2A9NH 1GGBH 2OJ1A 2OTUA 2WLYA 4HMCA 1TFPA 4U1GB 3HCVA 2GBUA 3F7YA 3L95B 3ZN6A 4PRDA 1IAII 1HL5A 2EAEA 5GRYA 1UUSA 3ZKMD 4LCCA 2OJEA 1RUPL 1IGMH 4AEIL 1J5IA 2B1AH 1F90H 4LNRA 5I5JA 4PJ7A 3QIBB 4YDLC 4RMUA 1NC4B 3MJWA 2WCPA 1Q0YL 2GSIA 1ZXKA 4LVHC 5DQJB 4HZLA 4TNWK 2AJYH 4TNVK 1WICA 2EABA 1NKOA 1CFSB 1AD9A 1CK0L 5LNGA 2H0JA 2WBJA 2WPGA 5EV7A 3UBHA 25C8H 3MRLB 5H4YA 2D0FA 3G5WA 1DBKH 3BQUB 4HCIA 4WW1B 2ICWI 1PTZA 2LAAA 5J9PA 1BQUA 5H8DA 1ZVSA 3DYMA 3BAWA 3GSWA 4NM8H 2CLZB 4OCRH 4O02H 4Y9FA 3U2SA 3GXUB 5IHWA 2OMWA 4GAJH 4I4WB 4XMPL 4PWIA 1LL1A 5C07B 1CDYA 2EVGA 2Z64C 5D1ZA 2J12B 2WWMD 2WXNA 5I1GL 4KZEH 4RMBA 5K69A 4FTVD 1OGPA 5BUAA 4P46D 3LYRA 1NCDL 1A9BA 4GAGH 4OZIE 1MFBL 1Y6NR 2OMBA 2ADGA 2CU9A 2NY0D 5I0XA 1MPAL 4HDIA 4J8QA 4YFDB 3WTVA 5ESQB 2A5UA 1G1KA 2QQQA 4N8VG 2VAAA 3HHRB 3TFKC 4P3WA 3AW5A 1OTSC 3BH9B 4AQ1C 5DC9B 1FSKB 3ILPA 1ND0B 4HQQH 2HXAA 4Z7UA 5E2TL 2DQTH 4IJ3B 3S98A 2IAMD 4PJ9B 3BUYB 5GS0C 2ED6A 3KYMB 4XMKH 1IGFH 1H0DB 4IRJC 1W8OA 5B3SB 2VLJA 2EIZA 4K0OA 4TKWA 2EZ0C 1DQDL 1SQMA 1OPGL 1Z9NA 2F53E 4E9YA 3OHXC 1EIBA 4GINA 4NJ9L 5GRJL 2Z8RA 3PFQA 4OZGF 3Q8BA 3VWKA 3X11A 1CDGA 1QHPA 1MRDH 2XA3A 2VL4A 3GBEA 5ECJE 3ZKSD 4OZFB 3H3BC 3ABLB 2ZXQA 4P2YA 3ZGHA 3QNXA 5LLIC 1H9VA 4UT9H 2F7QA 1NA8A 2I26N 5IG7B 1G9NL 4AGQA 3MV7A 3RWEB 4IHOB 1DJZA 2AEPL 1KEML 1S7QB 1D5ZA 4M5TA 1H15B 2XT1B 4ONOA 3W56A 5JQHC 4W93A 2RH0A 5F1NB 3K2UL 1BLIA 2VITA 5KVGE 5KG9B 3HE7A 5GSVA 1RUML 2Z35B 2JELL 3O8XB 1CICB 2ATKB 4X6DE 5FX3A 3WJLA 1D5XA 4MNHB 3ISRA 1VGKB 3UMTA 1HXKA 3U0TB 3VFVA 3WG7B 3VGDA 1PGRB 1OZTG 4M6MH 3X12A 1NBYB 3BEWB 3CSTA 5TK2A 3MLWH 4RX4A 5DC0A 4MDJA 2FAUA 3WUZA 2J43A 3TH2T 1BP3B 1WBZB 1NEZA 1JZ3A 3RU8H 2MQ3A 5IHHA 1YY9C 4NPYB 5EBLB 5CLXA 1JPSL 4JHVA 3L3HA 3L3KA 5E4OA 5CUSL 4F7KA 4Y19D 5HGHB 1CXFA 5JXEC 3BAKA 3D0LB 3IJYA 4NKIL 4K9EL 4N2BA 3L3OB 2GPZA 2QQLL 2ZOOA 4HXBL 2IJ0C 5DZ9A 3GLEA 2YAPA 2BFGA 3EO9H 3G6JF 4YVNA 1MJ7H 3WN5C 4PRNA 1XX9C 5D7IA 5HYFA 1T2JA 2UYLB 3ATDA 2IDQA 4U6YB 3GBML 1OTUC 4R5XA 1B4JH 1E0OB 1HYSC 1YYML 2VR9A 2O72A 3KH3A 4JFOA 3O11B 5LBSL 4FZ8L 1RU9L 4NQDB 4Z9KB 4RDQF 4HIIA 5F7AA 1NL0L 1NGXA 5F0LB 4POUB 4PG9B 1KYFA 1C12B 1YMMA 3K6NA 2XBTA 1TKWB 2D7OA 4MQSB 2O6PA 4J27A 5HYIA 5GS2D 4PCYA 2VDKL 4N3UA 4D0BB 2VC2H 2PP8A 3HHSA 5C6PB 2AJ3B 4BZ1A 4HC1H 1YECL 1KY7A 5DMJB 4JY6B 5BO0D 1Q8MA 5FW6A 3FCUB 1E28B 5SX5K 5DJDA 3NJFA 5FHAH 1KCVH 3EJPA 4PJIB 1ZA6B 2ZYIA 4UIMA 3B2UD 5IVZB 4L8CB 3MV9B 4XB8A 3UZQA 1PX3A 4CJ0A 2BSSA 5FYJD 4BZ2A 5C0ND 3HPJB 3AY4A 1QEWB 2DD8H 2Q20A 3F5WA 4PWEA 5DHXB 4HX1B 1LLAA 1G7JB 3AG3B 1L7IL 3V7AE 3U6RB 2ZUXA 3CFNA 4G2AA 5T3ZE 5I5MA 2B16A 2XQ0A 3A22A 2VXVL 2WXKA 3LIZH 1UWEL 4S1SL 5SX5H 1CGSH 3BKMH 4FQHB 4HETA 4DGUA 2WKOF 3FT4A 3WBDA 3HMWL 2NY2B 3MRFB 3L4WA 2J1XA 4P5TD 5EU6B 5DURD 2NUPA 5ICXA 1EO8H 1VB9A 3FQNA 2W91A 4G43A 5JOFA 5IEKA 1ZHLB 4FXKC 3WFEH 4AZUA 4QRUB 1XZWA 4GI9A 2WXRA 4K5MA 1TZ8A 5C0EB 3IJSB 5AEAA 3QISA 4XN1A 2WNGA 4N2OA 4J3UA 1TF4A 5I30L 4PJFB 3P77B 4UTBA 4UB0H 1BQRA 4MCZB 3IPBA 4NRYA 4AVJA 4AEEA 3CX5J 3KCPA 2C9VA 2NY4B 1FVEB 3AQDA 4NZRL 4PW3A 5I23A 1NAMA 5EOCJ 5KS9F 1VCAA 3QEGH 3RWIB 4C57C 2R69A 3LS5L 4W6XB 2BS71 5EA0L 3V0WH 5C9JA 4WGWB 5L4IA 3KPQA 1P2CA 1RIUH 1E40A 3SE8L 1IGIL 1JPFA 2LU5A 2FBOJ 3BD4A 4X9BA 4GG6E 3LH2L 5CU9A 5DHVA 4JDEB 4OGYH 3GBLA 5AW5B 2LTQC 2V3FA 5D1QA 3PJNA 4EOWH 4AM0A 1LP9A 2FO4B 3PWVB 1KBVA 2YPLE 4P23B 2B20A 1KLFA 4AQ8C 2P5PA 4QUOA 1M6OB 1TZIA 3WFBL 1XF5B 4WWKC 3GEWB 2N7AA 4N20A 5FCSH 4GUOA 5DLMH 3OAYH 1X7SA 5BOPA 3KPNB 3IF1A 1KJ2B 2COQA 1PD1A 3GS4A 4L3FA 2NY7H 4YBQC 5IB1B 3QUYD 2OM5A 5F9AC 2HG0A 2XFGB 4M7JH 5J8OA 1QSVA 2DLFL 4DPBX 3QJZA 4HPOH 1FFTB 3SBWA 3QULA 1CF8H 5FB8A 1G9NC 2R1WB 1OWWA 4W9FC 5A2IH 4X4YA 4ZOBA 4GIOA 4MXQD 3T6QC 4PS4H 1BM7A 1UD6A 3INOA 1V7ML 2OTPA 3TN0A 3EG9A 4OLWH 3VNZA 4LIQL 4NQCD 2C9AA 4Q97A 3GDBA 2PPEA 2A7BA 5B8CA 3B2PA 3B2DC 2A9CA 4GUPB 1SEBA 3X1NA 1ZT1B 1KB5B 2YAFA 3DXAA 5EU5A 1TZHB 5HHMD 3CSYB 5DJAA 1KLGB 3UBXI 1J0IA 4WW2B 4GXUM 3QJRB 3CN2A 3VGAB 5JPNA 1FAKT 4XTRC 1OQXA 1RIVL 3SCMA 2A4CA 3V6OA 15C8H 2F08A 3DVGA 3AREB 1HI6A 3O6ML 4X7SH 5MERB 1N19A 2X4TA 2ZWNA 4ANWA 4PCKA 1MRFH 1KJMA 2HTKC 4P4RA 3PL6C 2IPTH 1TETL 2CJSA 1IBGH 4U7MA 3VXTA 5LUMA 3KL5A 4K9EC 5D8JL 5B1BB 2JH2A 4HJUA 5JLZB 1EA9C 2OSLA 2NMSA 2WAHA 3LHPH 4L4VB 2YPVL 4HK3J 4JKPL 2F1EA 1K2DB 3VFPA 3GD1C 3MC0A 1GAFH 4E42B 3DETD 7CGTA 3BVDB 4KI5C 5JHBA 1RY7B 2NXZC 4ZJ9A 1YEIL 5CD5D 1CL7H 3QXTA 5HDQH 1EDQA 2D3VA 1SFDA 2AKRA 3K6IA 2AAVA 3QJTB 5IOPA 5GJSL 3HZ3A 4FXTA 1M4KA 4RQQB 5IUCA 1AQKL 2HX7A 5MHSD 3QXVA 1MF2H 1YPZF 3OBAA 4KDTA 5HY9A 1NIBA 3GJFA 4TSCL 3UJTH 3HBGA 1U8OB 4H0LC 1J8HA 3HZMB 3QPKA 3K6FA 3B8YA 1GKEA 1WBYB 3NBNA 4L8BB 1VAHA 4AQAA 3JZ7A 2J5LC 3V4PL 5ICYB 3ZOAA 4UTAH 2YD8A 3GMPB 3NCJL 2BINA 1BQHA 1IKFL 2B3IA 4U3CA 5TE7H 3HC0A 3F6JA 2CJUL 4JHWH 5B39B 3TBWA 5IHBA 4LSVL 5CJ5A 3STBA 3FPXA 5GS1B 2CRMA 3HNVH 4R4BB 4FFWC 3UYRH 3MLRL 4S2SA 2XI9A 5FUCC 4PJDF 4Y4KD 1W72B 2B1HH 1FFQA 2VLMD 3IU3B 1P5UC 4GRMB 3E1ZA 4G59C 5T1LD 1E4XL 2AQNA 2LGNA 3I02A 3R0NA 4MBOA 3EHBB 1UT1A 2IGFL 3LS4H 2CHDA 4L3CA 4CMMB 4OD2B 2ALAA 1AS6A 3P11H 2HRPL 4UYPA 3QHZL 2ZSWB 3THML 5FR3A 3MLZL 1NPNA 3GKZA 5JW4M 3FO2B 2QSTA 2IH8A 1RIHL 2D03L 4I0PA 4XMVA 3D25A 2VNCA 4P2RE 3RUGA 2GITA 2BZDA 3RVWC 1P9MA 3EO0A 2K8QA 5J6HA 4K7FA 4O2FB 4L18A 1TEYA 3QHFL 4EO5A 4KMLB 4WUUE 4AYBA 3VCLB 3ABZA 4S1DD 4IOIB 4AV5A 3PHQA 4YWGL 2OV0A 1ZHKA 3T6XA 5I74B 3BW9A 3T5WA 1S3KL 1F3DH 1T20A 2EH7L 4K8RH 5FYLH 2B08A 4AV0A 4Z78B 3RZCA 2XN9D 3DJZA 1INEH 3UTSD 5JR1L 5I1CL 5TF0A 4FD0A 2VE6A 1PZSA 1EQWA 2WXFA 5E6ID 2PO6A 3RTQB 1R5VB 1MG2C 2KBGA 2XY1A 3FFCE 1QPXA 4YL4A 3ZZLA 4OV5A 3EH1A 3NJHA 2Q3XA 3X17A 4HK0B 3HRZB 4ZFOA 3EOBA 4M8QA 4R90H 4XI5C 2GJRA 3IAGC 5BRPA 3K6DA 2HT3C 4ZUTB 3DARA 3FTVA 4X5XA 3VXSA 3ZDYB 2EKSA 5DMYA 4JPQA 3WXVL 1S9VB 4QD2E 4JPKL 3CK0H 2X3CA 5DK0B 4Z7VE 4WI0B 2R1YB 4HKJA 5CJ8A 1C5CL 1UA6H 3B7SA 1Q0EA 2VR7A 1N18A 2X9XA 2VDQH 1QASA 5AAWA 4KJQD 4HXAL 4MA3A 4U6HB 3O6FB 5ITBH 3FQTA 3LZOA 4JFDA 1IIIA 4LCWE 2JQZA 4HU8A 1YMHA 1RVFH 3W5NA 2K6YA 4APQD 5C9KA 4HJEA 4MAYD 1J12A 5EZJB 4PJ5D 1P69B 4Q7DA 3DPBB 4FQLH 3EJYC 2FLMA 3FH7A 2H2PD 4OY9A 5IOKA 1HHHB 3CAFA 4BH7A 1A9EB 1W2KT 1BYOA 4OF6A 2GVYA 2I5YL 1RD6A 5J3HD 5HDLA 1SY6L 1EZSA 4LEOA 2EYTB 2VLRD 3LRSA 4ZUUA 4KKPA 4XVSH 2R29L 5ABDE 1YEKH 4L0ZA 3SYCA 4OF0A 4HUUB 4YHZL 5IV2B 5I8KH 1LK3L 2FX8L 4AZ8A 1AZVA 4PJHA 3JSSA 4ZW6A 3S36X 4NENA 5F7DA 1CYXA 3ROOA 4APXB 1SVBA 1Z5YD 2Z8WC 3I9GL 3B7RL 3OV6A 4OF3A 4UQIM 4Z3JA 3ATBA 1HOEA 3E80A 3C5SB 2AF2A 3L08A 5KWYC 2NR6C 3LRHA 4XCYA 1TJGH 5FCUL 3CLFL 2AJVH 4P2QB 4YH6A 1H6EA 4A6YB 5C2UB 4NKOA 4D8PA 4LL4A 3GYRA 1UCBL 4HKZB 2VXQL 4RIRA 1N5YL 1MY5A 3HAEG 4B27A 4URKA 3D4CA 1X5MA 3TO4C 4PY7A 4MASA 3WS6C 3GGWB 1YN7B 4FFYA 4ICXA 2QVTA 4XNMA 5AOZA 5T1DH 2VIRB 4EXKA 2YAOA 4FKEA 2EDDA 3CXDH 4GO8A 4XAWH 5CP7B 4ZSOB 2YPKB 1ZCRA 3E1F1 4GW5B 3ZO0A 2WSKA 4WRLA 5DYFA 3AXIA 3BRFA 4HJ1A 1TLKA 2ZIDA 5C6TL 5IESH 1HWWA 3G6DL 3HFMH 5F93C 3RX8A 5EPMB 3DSFH 3U46B 4QLRA 5D1XE 1V3MA 12E8L 4RMVA 5IROA 4KHTH 1SOQA 3O9WA 2B0SH 3DTUB 4IGBB 5GGSB 4F92B 1IC1A 4AT6A 3U30B 2QPSA 4OLUL 1S7RA 2WBKA 2WVSA 3DDFA 1CI3M 4IQHA 3TJEH 3HZKA 5F70A 5KOMC 2OMUA 3O6KL 3Q6FA 4XC1H 4B60A 3TBTA 4OLZL 4QTIL 5I6PA 1DQVA 8CGTA 2C3VB 1IC0A 2KERA 1EWHA 3FT3A 4H1LH 3MRKB 4JL2A 4MQ7B 1V05A 3N44B 3TYGH 3W11C 1IAIL 1PF3A 1UWGL 2JB6A 5FO9A 5FUZH 4JFHD 5CXPA 4DESA 5EBMB 3GUTB 4YSCA 2XJLA 3C60A 1K4DB 4IK7A 2EEFA 4FNLH 2XN0A 3QNYA 3KGTA 3BJ91 2HMIC 4QYOA 3I6KB 1KNOA 1A3RL 1QA9A 5HP5A 3FOMB 2FBJH 4XC3H 5AUMA 2DQGH 2G75B 1LEIB 5K1VA 1TQWA 2FT6A 2IPUG 3B1UA 4Z7QB 3FQRA 3VRIB 3GEFA 3TYFA 3ABKB 5AG8A 3M88A 5J56B 3O2WH 5KYXA 1DDHA 2D3LA 5I2IA 1IC5H 4ORZC 4WJ5B 3VXPB 1HL8A 3P9LA 4KXZI 4B6ZA 4AL8L 1LO3H 2NZ9C 1XD1A 3MNZB 4GO6B 2AQSA 4X2UA 2W94A 2YJLA 1YNLL 1GOFA 3FN0H 3I6SA 2IPKA 4ZO8A 2Z7WA 4I0KA 4NT6A 4ZPVB 3RA7H 5D7JC 1QLEL 4Q9RL 2QMKA 2RHEA 4HK3N 2ZXBA 3AWEA 4GXVL 4WO4C 5CILL 1MHCB 4JJ5B 1J48A 1FZOB 3Q2NA 4A7GA 5DEGB 5D55A 2X1OA 2VR6A 4Z95L 1F41A 4UAOB 1N2RA 4ZMTA 3V52H 4BUQA 4XNZB 5HGBA 3C5XA 3RWJB 2WIIA 3GXIA 1RFDL 4PJXB 3OPZH 4ORGB 3BE1L 1TCRB 3V0HA 1FZMB 4LKCB 3WUWA 5KVGH 1P5VB 2P80A 1T7VA 3QIWB 4GW1A 3TPUB 1GRWA 2WZPD 4X6BA 1ESOA 3EOAA 4MVBD 4HWNA 1NUDA 2I7OA 4PLJC 4CSPA 2X6VA 2CWRA 1MHHA 4WU5A 2Y0SA 2V8LA 3UAJC 4GW4B 2FECI 2LVEA 3IDJB 3CHQA 1B0WA 4AM0Q 2D0HA 4MMZC 1GZHA 2JKJA 1C16A 5DEFB 4NO2A 4MWFA 1K3IA 3ZKXC 5L4JA 1QKZH 1H3TA 2EVFA 2F54A 4RMWA 3OAZK 4ELMB 2GK0B 1U33A 1X5FA 3C6LC 1NCHA 2P5EA 1AGCB 3KWTA 2HLFC 3FUMA 5D93B 4NHCH 1AR1C 3II2A 2FGZA 4H26B 1F13A 4OAWB 1NFDF 3V79C 4GBXC 4XT1C 1S46A 2GFBA 1F4XL 3BSZH 4K2UH 4O2CA 4XMLH 3VXOB 3ARFB 1GGIH 2D73A 2XU9A 5DRNB 1S7SA 3OAZH 3Q6GH 5I1EL 2ZWLT 1S7XB 4MDIB 2Z3FA 4HF5L 5F8QC 4Y5YA 5KANG 5CJXA 5D2LF 1HINH 2X70B 1PZUB 3RL1B 2HAZA 2VJXA 4GAAA 1P7KB 3R4RA 4NAQA 4YFEA 3VFRB 2IALB 4KK6C 1WIPA 1ZGLP 1U6AH 3SE4C 2K3TA 1JYWA 5C86A 4YLBA 1W0VB 4ZPTA 3TNNB 4DO6A 4F20A 1DZ0A 2BP5M 3P3YA 4JHAH 5ENWB 3QH3A 5ISZB 2G3NA 2YQ2A 2Z8SA 4JQIA 4RISL 2PPCA 5LXVA 4ZMNA 2Q6WB 1MCPH 1SZNA 1ZGLA 5DHEA 3CNKA 3OKKA 4F3FB 3B2VH 4G9FE 2VERA 5E8OB 1BLNB 3NQKA 4L8DA 3H9HB 4A7SA 3BUDA 3H7LA 5C0CB 3VX0A 1TR7A 4G70B 4GQPH 5T3ZH 3GSOB 2F6AA 4XR8C 3NCBB 3DX8B 3ATAA 3VFMB 5ALCH 3ZKQD 1VFAA 4NRXB 4IM8A 1UM5H 1GXEA 1WP6A 3J2PA 3QQNA 3QIBD 4LRIA 4LGSB 1NC4D 4M48H 4JKWA 1KY6A 5JDSA 1D6VL 5SWQB 2BNUB 5EBWB 3WMQA 1EEYB 5CZVH 5F7EH 4M6AA 3MBWB 1AGDA 1N3NA 3BUPA 3SJVA 3EJQA 4YNYA 1G9ML 4G3YL 2ESVB 4OCXL 1N4XL 2FWLB 2HX9A 2WNWA 2UWEA 5E56A 3GRWL 1QQDA 3DBSA 4G8GA 5KUMA 5JW5B 3PUUA 3BDYH 3VSQA 4TVSa 3ZKMC 3PV7A 4HALA 4N8UA 4XNBA 1XF2A 1V10A 1XAKA 3L5JA 2Q8BH 3WFHA 4TQEL 3FTGB 1NLBL 2IFFL 3FTUA 1P1ZB 1T1ZB 5MEOB 4QHMA 3KWVA 4GMSL 2HT4D 1OE1A 2NPLX 3H4HA 4LOUD 1BAFH 1BZOA 1HZHL 4OGAD 2F5BL 2VUOA 4DN3H 1QO3A 1IGYB 3PPEA 4DFHA 5GZOA 4O02B 3I2CL 4ES9A 1NCAH 1QUPA 2JJUA 2MPVA 2X9WA 3ZKND 1YJDC 1NBVH 1O5PA 5CLZA 1WBXB 4NNYA 3VB8A 4AIEA 1UZGA 3FH5A 1U3HC 5I1KL 5I8EB 1WWAX 4I77L 1BBDH 1NC2A 3R7QA 5HJDA 4AL8C 4EAEA 5IVXA 2Y6TE 4PJ9D 4N6RB 1SUJA 3D39E 1GIGL 2YC1B 3NRQA 4PRIB 2WWMC 1JZ5A 3NIFE 3F58L 4W1TA 3WU1A 4U1SB 1NOFA 5E6UB 2P8MB 4XPAL 4MSWA 5DS2A 2FH8A 3QNZA 2ZKXA 1QNZL 4OZ4B 3RL2A 3MCYA 2SEBA 3BKYH 3HRPA 2CJ3A 2XACC 4YHIB 4P5MB 1DZBA 4EJ1C 1HHJB 3LAFA 3QDMA 3VH8A 3DJRA 4XB3A 3S97C 4ZFFB 3RI5F 2NY1B 5C09A 4M9OA 5E00B 4P07A 1QSFA 1AC6A 2F18A 4FDWA 5CIPA 5BJTA 4AYGA 35C8H 3LMJL 4HH9A 1V5JA 5D1QD 2WVVA 2DQJL 1I7TA 1LYQA 3CQPA 2BOCB 2DPKA 5F1SA 5D70H 5KN5A 5L2JB 3AM8A 3FK3A 2LAGB 3N91A 2BXYA 2IXQA 3QEQE 2CA4A 3CVIH 1SBSH 5T3XD 4TSAL 2UZPA 3TC9A 1BSIA 4JPWL 2VQ1B 5IW3A 3O8XD 1CICD 3RWHA 1Q0YH 5HHVH 3H2WA 2R2HB 2OTWB 5AW9B 1KCRL 3MUZ1 4QTFA 3FCTB 4F33A 4JZOA 2DYSB 1L3WA 1HZLA 1CIUA 2ZUQB 4OFIA 5HDOA 1OGAA 2BCMA 3WTYA 4CW1A 3KHOA 5DJYA 4PRPE 5E24E 3B9AA 4O2EB 1M1XB 3VGGA 1R24A 4BDVB 1RZ7H 3TIEB 4A1RA 1EJ8A 4FFZL 4XMPH 2FE0A 1FO0A 1AKPA 4L48A 3GB7A 1VEMA 2XG5B 3QIUB 5D1XA 3TT3L 4WLCA 4U0RC 1YEGL 3QDJE 5LG1A 3QQDB 4W70A 1YHPA 3REVA 1JWSA 1NCDH 3GIVB 4EI5A 5DZJA 1C1EH 1MFBH 4CAGA 5EU4B 1ADWA 5LCVA 5EH1A 4HLEA 4H0HB 1M7XA 5B4MD 1P4UA 2NY6B 4XNQA 5LXGL 1T5XB 3MRJB 4D0DA 4BKLB 1CFQA 3RY6A 2X7LA 3OJMB 3DHPA 4XPHH 5F1IA 3STZA 2Y5EA 3MRRB 1USQA 3NVQA 4CBPA 3ARBA 3DMMC 9PCYA 1SPDA 3T0BA 3SPIA 3GJEA 1AI1L 5D96C 3RPKA 4KJWD 1F4YL 2WXLA 1NMCC 4TVPD 4ONHA 4CU6A 2QBWA 5EORH 1SOSA 3S36H 2JKRM 3HG1A 4ZYKA 2EE9A 5GGRY 3H53A 4YLQT 4D7PA 1ODUA 1Q0XH 2PYEE 2C26A 5DF0A 1HCFX 4M6OL 1DQDH 2CLRA 1OPGH 2L3BA 4HYTB 5C0GB 4R0LA 2JMRA 1L6PA 1X5AA 4HJJL 2AQQA 2AQ1A 3LDBB 3GHBL 3ARXA 2IADB 3FRPB 5A40E 2BSBA 3SZ6A 2ENPA 4HBQA 2OZ4A 1J9CT 3ZL2A 3MN8A 1J9QA 1IM3A 3EIFA 4Y8AA 1PCSA 4V1DE 5E7BA 1ZVNA 3G6JE 3TBCA 1PPIA 3TL5A 3Q1SL 3SKJL 3JWNC 2PW2A 2PTTB 5MENB 4OI7A 3EFFA 4PGCB 2VC2B 3MOQA 3ML8A 2NX5A 3EYSL 1KEMH 2CQVA 5B3JF 4YBLC 5EEVA 3K2UH 4F7TA 3ZE1E 4J3OH 3V4LA 1F3JB 4JRFA 1RUMH 3RIAF 2ENJA 3H9SE 5E6RB 2HJLB 2JELH 2K4AA 3L5WA 2NY5H 2NY2D 1G9MC 5EU6D 3EDKA 3D50A 2YGPA 3D9AH 1PIFA 4G7VL 2OS7A 5KSBE 3B2UC 1A4KB 1G7MB 4UQAA 4AC2A 1F56A 3OB0K 5C0NC 3DX7B 4L0PB 5DJ8A 3ZR6A 3RHWK 3CC5A 4NSKA 5DYOA 2HA1A 4GXUN 5HYJA 3ETBJ 5SWZB 4N0YH 1JPSH 3B37A 3WDIA 5CCKL 2DLTA 3OXSA 1KOAA 1XSIA 2NY4D 5FKPB 3VI4B 2VLKE 2ROYA 4P5TC 3OX8B 4NKIH 2X4RB 2OI9B 3C8KA 4HXBH 3OAUH 1RZFL 1RPKA 3W0WE 1FVCA 2I32A 3MV01 4GAYB 3HW7A 4LSQL 5EZIH 2DQHL 1QYGH 1QUNA 4HPYL 4Y16A 1YYMH 3BWAA 1LE9A 2P5WA 3FQ4A 4I0PD 3MRNB 1ZWIB 3QWOA 3OXRB 4MA7H 1RULL 3MLVH 4GSRA 2CCVA 4P23D 4FZ8H 4RSYA 5HI3C 4PJ7B 1NQBA 5IHLB 1KDJA 3FO9A 1NL0H 3OR7B 1XZ0B 4LHJB 2PTUA 3VG0L 3ROLB 3MV8E 1AMXA 1U93A 1RPUA 2FGWL 2AANA 5K39A 4LMQI 1YYLL 2F8IA 3RP1A 5ES4B 1BJ8A 3SDDD 3NJMA 5K9KB 3F7VB 4M1CC 3DX0A 4M1GL 3B2XA 1AYRA 4Y4HB 4NN7C 1ZVSB 1NJ9B 4NN5B 4QTHB 2VO8A 5G5DA 3VD3A 4HIHB 4JG0L 2WOYA 4UV4H 2XX0A 1I8AA 1XT5A 2JCCF 2OMWB 3FHQA 5E4EB 4G80B 1PKQB 1GSMA 3NEXA 2OL3H 1HXMA 3IDMA 1U91B 2J5WA 1UJ3A 5CGTA 4LPYA 3G9AB 4IU2A 1WFOA 1R3JA 2VXVH 3DTDA 4YDVB 2DQEL 2X05A 3T4YA 4HFWB 1JS4A 2DQFA 4OZHB 4FG6D 3H9YA 2FR4B 3NTCH 5ANMA 5DHYA 3HMWH 3QUYC 4L9LA 3SD2A 4C56E 5IP4A 1IC7L 3IXAB 5CSZA 2WBWB 2BWDA 1JMZA 3ERXA 5C08E 4M7ZC 3WLWD 5EUOA 4ZUVB 1MI5B 4MKMA 5J6GA 4UZUA 3C08L 1GW0A 2LV4A 4P4KB 1NGZB 1RP9A 1L7TL 3MRBA 2I9LB 2Y5QA 3FMGH 4ISVB 2MCPH 2HVJA 5C3LD 1D5MB 5JIKA 5D5MF 4BXVA 5AVRB 4JM0A 1VADA 3D69A 5DFAA 5BS0E 1J1XL 2FX7H 2LABA 2VLJB 1HQRB 4OUUA 1S78C 1IAOA 2A74A 3KPRE 4JFDD 3U7WL 1F45A 5IJVA 1A1NA 1A7OL 3VACA 3ZQXA 5JW4N 1GS8A 5D72L 1BHGA 1FFPB 4L4VD 3KJ6H 1RZJL 5KOVC 3BI9X 4YSQA 2OR7A 3A23A 4HEPA 5INCA 3SGKA 3X11B 2Y2TA 5DQ9A 2QR0B 4PJAA 5EA0H 3WO3B 4NZTL 2V3EA 1WWWX 2IDUA 3JV4A 4M7KL 4QOKE 1JNNH 4UILL 3SE8H 5K9JL 1IGIH 1DEEB 3LH2H 5A16A 5EU3A 4W9IC 2K7PA 4IU3B 5K59F 1BX2A 1D5ZB 3CZUB 3O45B 1ZPUA 3O2DA 1UVQA 1XGYL 2DBLH 1A7RL 3HE7B 4NI6A 1CFTB 2LLNA 3N9GH 3OJDA 1FRGL 1BIIA 3QXDA 4JK0D 2G0KA 1UWFA 3IGFA 2BNQB 1K5NB 3RBSA 3ECBA 1WJ3A 3FO1A 4CKVX 4QRRA 2OMYA 1HHKB 5HHNB 3M6DA 1JWMB 3OKMB 1I8UA 3MA7B 4JUSA 2FYVA 5CZRA 1NMBL 3PDOA 1BEXA 4ZMLA 5E9DE 2XN1A 2DM7A 3X12B 3R18A 5B1CA 2FJSA 3MRIA 4X8JA 4R3SA 3CN3A 2E59A 4Q6KA 5BPPA 4AG4L 1RK7A 3T0EA 3QBTB 5FO7B 3BPOC 4QRSB 5IMKA 4QWWD 4UQ2A 4JO3H 3ARGB 4PJBB 5ESVA 1S7VB 5E8EB 3ZSSA 5I1JL 4TTDD 3FFDB 5FF6A 1ZDQA 4J3XA 5IVOA 5F1KC 5LVEA 3MRHA 1ADQA 4HHWA 4AX3A 2AEOA 1N0XL 3GM0A 4Z7NE 5EOCL 2HCZX 1MREH 5ACZA 1MFCH 3NCWA 3LKNA 4OZFG 4YHKH 1OF0A 4XBGB 2N4IA 4KQ0A 3DHJA 5TJWK 2W60A 3RWDB 3EHBD 3WXWL 1U8LB 1G6RL 3IEAA 4F8LA 2HG5A 5SX4I 1MELA 5HJ3A 1E6JL 1NDGA 1GYUA 3KBHE 4AMKL 4ZNEA 5IROD 3QQ9D 3O9WD 4P9HH 2MMXA 4N85A 3SE9L 2FJHA 4LVOB 3GXNA 4MQXD 4WV1C 3TV8A 1RIVH 4B0MB 5TK4A 5F6HI 4Z18A 4WK4B 4KFMA 4ZMYA 2EIJB 4GRLB 3VWJB 4YSAA 3INUH 3CN0A 3PHOA 2YLHA 1TITA 1T03L 5CBEA 2G3XA 4RBPK 4W9HC 2EILB 7FABL 1HOCB 4LBEB 4YUEL 1TETH 4I9WD 4Y4KC 2GTWB 4IJTA 5FWQA 1QPPA 2VDOH 3C60D 2P3YA 1EEQA 1B88A 1IFHH 4QRPA 3ARDB 2FQFA 4OZGA 1JBJA 1KBPA 4LLMB 3BUIA 1E8XA 2M2DA 4BFJA 5IZ7A 5ITFB 4JY5H 5JHMA 4N9GB 1JYNA 1MFNA 1U8KA 3RB7A 3RJOA 3HI6L 3QUXA 4KDTC 3K6SA 3RTQD 1I75A 5GGUA 1K85A 3WEXB 2V2TB 4DEPB 3KPOA 3TOPA 3VI3F 3IMWA 3FU5A 2BC4B 2JKIS 2VH5H 2BW4A 3U7AA 3G04B 1BVZA 3NGBC 3WFDL 4TSCH 2MSPA 3QDGE 4F24A 1HEJC 3CXHJ 1L9QA 1RHHB 4EN2A 1MFMA 2AJZA 2ZUTA 5TD4A 2ADJA 4LPUA 1DE4A 4G43B 4BK4A 4ZMXA 1JZ7A 1M57B 4ERSL 2PW1B 1LEKB 3WKYA 4NUGL 1RK1A 3KDMA 3MCKB 3L9BA 4JFFB 5E2UL 3ULSA 3S37L 3KPPB 1BEYL 5KJ7E 4Q6YA 5J5EA 2Y07L 3FULA 4WNQA 3CFUA 1T2QL 3OZKA 3S3SA 5EZPA 3ZDXB 5C97A 2B7DT 2WYZA 3QZWB 3BPCA 1ZS2A 4F15B 4FQXC 4NRYB 3OWEA 4LSVH 2AK4B 4J3TA 4PFEA 4S1RL 3II1A 3MLRH 1T5WB 2P80D 3L5HA 4CJ1A 1MZYA 4LL1A 2F2HA 2OCJA 3VFTB 4J8RA 5AD0A 5E8PB 2BVOA 4CDGC 5DI8B 3ULUD 4NXKA 5BO1L 3KPQB 5FYKU 3ES6B 5GGQL 4YLCA 1E4XH 2DQUH 3TBSA 1XTLA 2XWJB 2IGFH 1N5AB 5E4AA 3G6JA 1LK2A 3IMRA 4V33A 4DK6A 2VDQB 2C3WA 3E8UL 1NCBL 2HRPH 3WSQH 1LO2H 3ECUA 2CXKA 1LP9B 3QRGL 2YXWA 5DA0B 4MJIE 1GY2A 1BFOB 3E3QE 3MLZH 5F44A 5I1DA 2PF6A 1KLFB 5I66B 4PP1D 4NYLB 2F54D 1RIHH 2D03H 2GI0A 5BQDA 4DWHA 4L1SA 4NQEE 1I8IA 1QVOA 1UENA 3IJEB 5DLLA 4Q9BA 4JANA 3N04A 1WTGT 5ILTH 2CDEA 4PV9A 4APQC 2ICEC 1BM3L 2GK2A 3QHFH 3CVHL 4LDCA 2H2PC 2NNAB 4PJ6A 4IKLA 1J87A 2TRHA 3PWPB 1HDMB 3D3VE 4YWGH 2WD0A 2FL5A 2EH7H 5J3HC 5MI0B 5CF3A 5AOLA 3QUMA 5FB8B 1OALA 2DI8A 4HJIA 5I1CH 5AZ2H 1R34A 4ODXA 5IR1A 3LQAL 2EACA 4DGYL 5M95B 2R0LL 1NBCA 3TN0B 3LH8A 1OTTC 4G8FB 1ML0A 1S5IL 2YAMA 2KI6A 1EMTL 2XTJB 5KBMA 5B8CB 2VLKA 4U4BA 3FSVA 1EH9A 1M6UA 2XCMC 1SEBB 1B0IA 3KL0A 4LZKA 5D9SB 1RZGA 5E94A 2VZTA 3EYUH 3OL2A 2GHZA 3DXAB 3B7YA 3TA3B 2VM3A 2WKOA 5E51A 2P9RA 3T77A 1IEAA 4BSWB 2BSCA 1D9KB 1XHHA 1JK9B 3A21A 1FLRL 1AFVL 3AAZB 1RJYB 5GZNA 1SJHB 4IGBD 4NO0A 4R2GB 5AVTB 4ES8A 3GMLB 4HIJA 5F7NC 2V0AA 1DQQB 2CK0L 4OCSH 4P2OC 3Q8AA 4A55A 1HI6B 2PCYA 1C5CH 3MLTB 1GMEA 3SGDI 4YPJA 1ACYH 2WINA 5ESAB 3AGVA 1OP3H 2X12A 5AKTA 3WNPA 8FABA 3SDAB 5CINL 2FIRT 1TJIL 3V8OA 4N26A 2WQ8A 2WOBA 4S1QH 3BFWA 3C9NA 3ARWA 5KS9A 5D2NC 3DHUA 1CYGA 3VXME 3KNBA 4LCUB 2R7EA 1N12A 3VM7A 2H8PA 4CC4C 4Q2ZA 3KR3H 2C7UA 2VMCA 1WIOA 2ZXAA 2A6DA 3OG4B 3LN9A 2I5YH 4DP8X 4BCXA 4FNTA 4H1LB 3CHPA 2WO4A 3GSRB 3GRBA 4JO8A 3D85D 5B7EA 1EFXA 2NYYC 2BP8A 4G8GD 2R29H 1KTDB 4YHZH 2A0LC 1LK3H 4U3XA 2KT6A 4YL9A 1AGFA 4FNRA 2XLLA 2GW5A 4OZIB 2J1ZA 3CQQA 1FV1B 4DGVL 5HI4C 5CJQH 3AB0B 4AYFA 3BAJA 4BBWA 3I9GH 1NUFA 3C5JB 3DPDA 4PU2A 1P4LB 1ADQH 5FGRA 1AKJB 2NUTB 3DX1A 3LNGA 3WIHL 3T2OA 5FFLA 4DP9X 2ZNXA 4PRBA 4IMKC 2ZSVB 3QXAB 5BMFH 3AC0A 4K71B 4ABUA 2NSMA 1G7LA 1UCBH 1N5YH 2X6BA 1GY1A 1UB6B 4GLRI 4MGXA 2VW6A 3F7PC 3T08A 5B7MA 3UO8B 5C0AA 2F53B 2ZWSA 1T0NA 1ZANL 3CSGA 3GSQA 2AQ3A 3H6AA 1ES0B 4F8PA 4G8EA 4NKMA 1XGQA 5E5UB 2YMOA 3WNMA 2P52A 2NT0A 3RDJA 3N0PB 3S96A 5MP6L 4L3CB 1L9MA 4JM2B 5C6TH 3U6XS 2PXYB 1XV8A 3Q2WA 2XA8L 2DWXA 2DWTA 3GBNL 1ZEAH 5FGSA 1ULVA 12E8H 4OBRA 2YRPA 4MD5A 1XGTB 5J11B 1T4KB 1ZSDA 1M2OA 3ZPDA 3Q5TA 4JE4B 1YC7A 5C09D 1ZHNA 3JXAA 2X1QA 4OM0L 1E65A 1TG8A 4UNTA 1S7UA 5A7EA 5FLUA 3GPEA 4X6DB 1SXSA 3O6KH 3N50A 3UABA 5H94B 2OX5A 2VR3A 1A6PA 1FA4A 3TVMA 4MVBC 2DRUA 1IB5A 3UPRB 1Y0LB 1IAIH 1PFOA 2XWEA 4UDTB 1PLCA 1UWGH 4JO4H 1UZ6F 1WC7A 2F7PA 1IT9H 2ZCLH 3BW9B 1OT4A 1Q94A 5C0BE 3RZCB 1RV6X 2AAAA 3UP6A 3TP4A 4QJ4B 1Z3RA 3GLZA 4X5RA 2ITEA 3JUYA 2CO7A 1ET5A 4WUKH 2JKWA 1E8ZA 2PNDA 2MKWA 4YGAB 5JQIB 3E7JA 3ZE2F 1QLFB 2PO6B 2ZOLB 4BE5A 2X2IA 3TEZA 4YEFA 1NEPA 5E1AB 3VSTA 5EMYA 2J55A 2KYIA 3H3KA 1JGDA 3L6FB 5KVDL 1XGRB 1YPZA 4PV8A 3WIAA 4JQXA 4ZS6D 1M9SA 2AGJH 4PJCE 3HS9A 4GKLA 4XN4A 4F58H 3MRMB 1A7QL 5BVPH 5HYSG 1EEZA 2K9UA 2QGEA 4Q9RH 1NANI 5ISZD 5CILH 4EI5D 2K0RA 3PDDA 4QRTB 3LXAA 3HS0B 1XIWA 5H37H 3LQAC 2JK5B 3FU3A 3F65A 1KIQA 4I1NB 5C3TA 1Z9LA 5AZUA 4J1UB 3FQTB 3QR2A 4WNJA 5EC2A 3MMEA 4HS6B 1RFDH 4U0QB 3BE1H 1KCWA 3RWCB 5E2VL 1KJ3L 3RNQB 4F9LC 1AJ7L 4JM4L 3B5TA 4N0FA 4HS8L 2HRLA 4PJDA 1T0MB 3L9RB 3VD4A 4QHNA 4X80L 7TAAA 3UAFA 4L37B 3S5LG 5L7XL 2YMXL 3GLDA 3IJ9A 3QCVL 4Y2OA 5LGYA 4H20L 4UV7L 2LHAA 2O26U 2QHRL 5DMGD 1HNFA 4RAVA 4ZUUB 1KELL 1P6WA 4GKZA 5DS1A 4F7PB 1WEJL 4U1GC 3WHXB 1FN4B 1SYVB 1VGEL 4NO3B 4G82A 4X5WB 1Q72L 2G9HA 3OKNB 5I18L 2BNRA 3MNVA 4G42B 3UTTE 4GP5B 3TZVB 4JDZA 4I3SL 3UZVB 1FZKA 3EGSA 4KKLD 4YC2B 3QIBC 2NX5D 5EF2A 1KULA 1I8LC 1JI1A 2YD9A 4NQUA 4XP4H 1MFDL 1RZKH 2OYPA 3RURA 3WDHA 2V8MA 1HSAB 3ZO9A 2FCBA 2PABA 5CLYA 3G7TA 4WSKA 2WQXA 4NKOB 2OXHB 1IV8A 2E6QA 5IQNA 3ESOA 2LU3A 4QO1A 5A2CA 5JDJA 1U8NB 1FC1A 2HLEB 4XN2A 4S0TD 3IAPA 3BQUC 4LARH 4XNMB 1I7UA 4Q8BA 2I60L 3QS2A 1QLRA 4N5ED 4BQ6A 2VJ8A 4J3BA 4ZAKB 4GIAA 3W5MA 1LO0L 1NBZB 5CSGA 2YUXA 4AKQA 4XVUD 1DBAL 1IBHA 5BOJA 5DEZA 2L04A 2Y5TA 4PRID 5IB2A 1I1FB 2EICA 3I75B 5H2BA 2N1TE 4FNQA 4GG6B 4OBSA 4L3EA 3UTQA 3RFZB 4OGAC 4MJIA 1M05B 2YPLB 3EH4B 2G2RA 5MEQA 1L9NA 4EUPH 2J25A 1RUKL 1WVZA 3CN1A 3CDGB 4FG2A 4PI0A 1M7UA 4L23A 2NY1D 4TL5A 3Q6FB 1AAJA 1FSKC 3LY6A 1WAAE 3NZUA 2VZUA 1NCOA 4LLWA 1DQIA 5B38B 2JLPA 1NGPH 2Y7LA 4IJ3C 4Y16D 3LKSB 4PJ9C 4HHGA 2O1AA 3RGVB 5HJGA 3RVUC 1FL6B 1FGNL 3H9ZA 2HB0A 1G9EA 2P7TA 2VDRH 1CC3A 4Y2DB 3ZUCA 4JL1A 4N2AA 4PGBB 4U3SB 3DJSA 1OVZA 3CH1B 1MFAH 4WFFD 5I5RA 4B9KC 1D6VH 5EC1B 3PQYA 3VMPA 3BQVA 1EHKB 1KJ2L 3WKNA 2WANA 1GPOL 1YNTF 4G3YH 3US1A 4OCXH 3NYKA 3D2UB