4K23H

Structure of anti-upar fab atn-658
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
212
Chain Sequence
EVQLQQSGPELVKTGASVKISCKASGYSFTSYYMHWVKQSHGKSLEWIGEINPYNGGASYNQKIKGRATFTVDTSSRTAYMQFNSLTSEDSAVYYCARSIYGHSVLDYWGQGTSVSVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-uPAR antibody, heavy chain
publication title Identification of a New Epitope in uPAR as a Target for the Cancer Therapeutic Monoclonal Antibody ATN-658, a Structural Homolog of the uPAR Binding Integrin CD11b ( alpha M)
pubmed doi rcsb
total genus 42
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2013-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k23H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k23H02
4BQ9A 1RZJH 2G5BA 3GZKA 5JHDA 2NXZD 2NX5E 4YHKL 4K7PH 2FO1A 2CMRL 3PP3H 4R26H 3LB6D 4OZIA 1VACA 5DZOA 3LZFL 3P9WB 5F96L 3O81A 3J7HA 3O2VH 4I48B 2H2SD 3CXHJ 3U36A 5C7XH 4ORZC 3RWGB 2IWGA 5DJYB 2VYRE 2Z31D 5ADPL 3QDMA 4PJAF 3O3DB 3V9FA 4KI5C 4KUCD 2C3XA 4NHCL 1ORSB 4NNPL 4ORGA 5IFJA 1J8HB 3V52L 3G5XB 5KSUA 2PR4L 4U1IB 1S9VA 3W9DA 4OKVB 1MRCH 3VFNA 5FKAA 1OGTB 1DUYA 3RZCB 3PWUB 1UEYA 1J0IA 3HE6C 4XB7A 3RL2A 3K1KC 3UTSE 2ZCKH 3WFHB 2ZUXA 1KTKE 4S2SA 1X5HA 1HHGB 3FFCA 3O6MH 1RZKC 4MA7L 1X5GA 3MJ8B 4P23B 2CLVB 3VDAA 1XR9A 4QHKI 2KKQA 1ZA3A 3UJJH 5DRZB 1E4KA 3QI9B 3BO8A 1OTTC 4NNYB 5JPMA 1MHCB 4O58L 1H8SA 1MPAL 3P73A 5SWQB 3AXLB 3WUWG 2EEAA 3RA7L 1CGXA 4WW1B 1DLFH 3QJFB 2ICWA 4I9WE 4O2CB 2OSLB 1EDQA 1Q9LB 4JY6B 4WI8A 5DVOA 2Z93A 1JWUA 1CLOL 5HDQL 5JQHC 3HC0B 1DUZA 3PV6A 3H8NA 3BP5B 4LLMA 5DFVD 5E08H 4YK4B 1NBQA 1R5VB 2UZIL 43C9A 3INUH 1U8OB 4UDTA 4HD9A 3TYGL 3MRNA 4LSSL 5D1ZC 4Q0XL 1N2RB 5IT2L 3IU3A 3N06B 2NY5H 4G6AC 3LKPA 2QTEA 2YPKA 4X99B 1RZKL 3RGHA 3BRDA 2X4UA 1G9NH 3VFSB 4X4MA 3KYMB 1DL7L 5T3XH 4KWUA 1J10A 5BVJB 1FNLA 4MJ5B 1T04B 5DD0L 1CLYH 2EH8L 2N7BA 1K8DB 5F9OH 3M07A 5T3ZD 3GSQB 4LCCA 4PTUA 1N5YH 2HJKA 4NZRH 4LLDB 4P5MA 2NY2B 2CUIA 5DD1H 4JREB 3VXTA 2NXZB 5DD5H 1DBMH 3X11A 3M17B 4D8PB 4P5KB 3MLYL 3H42H 4UTBL 3T2QA 1W0VA 2YUVA 5A16A 3SE4A 3S36H 1WAAF 4LPVA 4JG1L 3GMOA 2Z31B 1KC5H 2UV3A 4OGAD 4OI8A 5KSAC 4YO0B 3DX9B 5HYJA 2FBOJ 2ZCHL 3T1FB 3OB0H 3BFOA 3QUYC 4MNGA 4TUOB 4LRNH 2J8UF 2UZXB 4M93C 2VAAB 3KVQA 3PJSA 5F96H 2EYRA 3G6DH 4LCUA 4F15C 1FDLH 4MQTB 1GZQB 5ADPH 3KPSA 3ILPA 5CP7A 4NHCH 2AQ2A 5ERWB 3CMOL 3V52H 4I3RH 2AQ3A 2VJXA 4UI2A 3C60A 5E5RB 5IW6A 2FH8A 1JWMA 3FQXA 5B39B 1M05B 2DBLL 2ZSVA 4LHUB 4DOHB 3DETD 3BX7C 4UNUA 4KDTC 1OGAB 2ZUQC 3LKQB 4N8CL 4PGBA 1XCTB 2HTLD 4QCIA 5K59E 1T7WA 2X1XR 4BQ6A 3QZWA 4BFBD 3PP3K 2YZ8A 1G7QA 3L5XL 4MA7H 1E6JL 5GS2D 3O9WB 5DA0B 3TM6A 4R6UA 4ELMA 2HT4D 1I7TB 3P9MA 4O58H 4QXTA 1MPAH 4NSKA 1UEMA 4HEPG 4KK5D 3C5ZA 3X12B 3RA7H 5ESVB 2APWA 4UNVA 5C07B 2P8LA 1S7WB 4FQQA 1HQRB 1CLOH 5HDQH 3KPLA 5CZXD 1OARL 5I6XB 1LE5B 4PJ5D 2BOCB 3O11A 4NZUL 2UZIH 4KKAD 3KPNB 5EO9B 4XC1L 5CGTA 3TNMA 4LSSH 4WHYG 3N0PB 5GJTL 4MAYD 4YXKL 4NC2B 4ODVL 5J9PB 1RZKH 2BSRA 4NN6C 1GAFL 5GRVK 3QWRD 3HS0A 5J6GA 4P5TC 3RU8L 3MRKB 1O7VA 5DD0H 4J6RL 4L3EE 5J13C 2C9AA 2EH8H 1ES0B 3QFJA 1TJGL 1MCRA 3GK8L 4IJ3B 3PDOA 5BXFA 4HIIA 4PGZA 4EI5D 5DQJA 3CDFA 1IRAY 3NCFB 2DQHL 2BHUA 4URTB 2BP3A 3KLAB 3K46A 4K94C 4OT1L 5KJRL 1Y6NR 3UZEA 2DLTA 5FA4A 4DGVL 4KAQL 3TA3A 2NY1D 4PJ8C 2BSTA 4CVXA 2DI7A 3ZMRA 4OLXL 1KT2B 4X80L 3U30C 4XPGH 4EDXB 2F5AH 2DTSA 2O5YL 2QQKH 3QH3B 1CVSC 4JG1H 1CD1A 5JUEH 5I73C 1J87A 3OAYK 3PXHA 1DBKL 1GZPB 3CXHK 1D5MB 3PUCA 4MYWB 4LPUA 2Z8SA 2ZCHH 3ARPA 5J12B 4PFEA 1BF8A 3OAUH 3B3IA 3THML 1ACYL 3PIQB 3WHE1 3QP3A 2X4OB 4HUXB 1ADQL 4JKLA 4KI5E 4JO4L 3W39A 1S5IH 1LEGB 4HUMB 4K94L 4PP2A 2WBJD 4JHWL 3CMOH 4RDQG 4O2FA 2YS4A 4PJ7A 4JY4A 2UZYB 4FXGB 4W4OC 4Q58C 1Y18A 4PRIE 4W4OA 5D5MF 2FX7H 2XTLA 1U3HA 2DBLH 4XCYA 1CT8A 1M71B 3MLXL 4Z7NE 3VXSB 1YZZA 1YEGL 4N8CH 4FN0A 2A6IA 1NGWA 1MAJA 3L95B 3FT4B 5BZDA 3L5XH 4PJ5B 1EJOL 2ENSA 2HT2D 1S9WB 2LU4A 1E6JH 5IROC 1XT5A 1RFDL 2EE2A 4PPTA 3RNKA 3IFPA 5D7SL 5EBMB 4MAYB 3KPOA 1NKOA 3ZKNC 4OZGA 1OAKH 5HHOE 3DBXB 3U9PH 5L7XL 1D7FA 4ZAKC 5EUKA 1KLGA 4K7PX 5F9JB 3BZEA 1OARH 4WO4B 1KN4L 2RCSH 5KS9F 1A1OA 1I1CA 4NZUH 4ACPA 4XAKD 2H6PA 3GBMH 1XIWB 4XC1H 4ZFZA 3TH2T 4XBPB 2I9TB 1IL1B 4WFED 1HHJA 4YXKH 2CR3A 1I1YB 4FMKA 5KVGL 4KJWD 1A3QA 5BS0D 5HHMD 2PYFB 2F19L 3MLTB 5C3LD 5I74B 4TVSa 3RU8H 1A4JA 3OX8B 4J6RH 1IC4L 5KN5B 2VB5A 5JXEC 1TJGH 3HG1E 3WE6B 1QSFB 1NAML 3GK8H 4AENB 1AD0B 2I27N 1NMCC 1U3JA 3ARDC 5DJCB 2DQHH 2ADGA 2AXJA 1SYVB 1MOEA 4GKOA 1QACA 1LD9B 5BRZE 1NGZA 4OT1H 5KJRH 1BQHG 1KG0B 2Q76B 4JHBA 4DGVH 4KAQH 2BY3A 4LLQB 3LN4B 4XMKL 4YBLB 1F6FB 5IB5A 3DX8A 3ARVA 4OLXH 3IJYA 4PB9L 8FABB 4X80H 5HYSB 1L7IL 5F1KC 4NKIL 4EQ3A 2EDOA 2J8OA 3D2UA 3ULSB 4J1UB 5DQ9B 3VFOB 5CBAB 4M6ML 3BRGC 3O2DA 5FYJL 3LPGA 1DBKH 4PJFA 3OKMA 4NOFA 3QNXB 4CADB 2VLKA 1PBYA 3ARTA 2V2WB 1DE4B 4DFHA 3THMH 1OLLA 4GUPB 1ACYH 5JMRA 4JFHE 1CXFA 4JO4H 4XBGB 2Q6WA 5DJ6B 2DWEB 4K94H 1MIEL 3QQNA 5E24E 1CICA 4O2EA 2FCBA 1NUFA 4JHWH 1QA9B 4V1DD 1NCTA 2DJSA 3QXTA 2GK0B 1ZA6A 4DEPC 1P6AB 4KI1A 4I0PD 5B3NA 3MLXH 4LCWA 4OFYD 1YEGH 4GW1B 2FD6L 3KAAA 2FO4B 4WV1B 4JCMA 1FO0A 2P24A 4LPYA 3SQBA 3QIBD 1QFUL 1EJOH 4JM4L 1M7IB 1RFDH 1T0NB 3ALWA 3MLZL 4U7KA 5TQ0L 4JG0L 1HILA 5EUOA 5D7SH 4ODWB 5K9JL 1SYSA 3QSKB 4DGIL 5E95B 4OZFG 5HSFA 1MJ7L 1U93A 1DP0A 3HI1B 3ULUH 4JE4B 1KN4H 4U1MB 4UIKL 1BAFH 1DANU 4GQ9L 2DYPA 2DI9A 1W2KT 4RA0C 4BH8B 3I50L 1DLHB 2QR0B 3O3DA 4QRQA 2P48B 3KXFB 5I9QB 3G5XA 4DKAA 4U1IA 3V5HB 4PJAB 4OKVA 3D0LB 3RZCC 1KJ3L 2QV2A 1MEXL 4N0YL 5IVXF 2F19H 5C09B 2NLJB 1Z5LB 3MV7E 3P2TA 4JFXB 3DX6B 1BOGB 4LSPL 3WFHA 1NAMH 1RURL 4ZUTB 2WK2A 5AG9A 2X4NB 1ITCA 3SN6N 2R4SL 4HUNB 4P23A 1U8JB 1NUDA 4HUUB 3QI9C 2PCPB 1WC7B 3QI9A 5J11B 3B9KD 1SJHB 4UILL 2AV1B 4JO1L 3V8CA 5SWQA 2GTWB 3AXLA 3T0AA 4M8QB 1I8KB 3QJFA 2OSLA 4GAJL 5D72L 3V2AR 1FFNB 4PB9H 3U4AA 1L7IH 1A7OH 2BOBB 3RVTD 1M6OA 4POZD 2KL6A 5GRJL 2D31B 4YK4C 1Z0NA 4KRLB 3V7AG 4M6MH 4V1DB 5FYJH 2HKHH 3MRFB 5IBUB 4R0LB 5TF0A 1N2RA 2XWBB 1ZGLB 3RIFK 5FDYA 4C59B 3DVGA 4X99A 3G5VB 4IEFB 3MRMB 3VFSA 1PEZA 4JHAL 1JK8B 3GB7B 4YDIL 5GRXG 4X98B 4FTVA 2BVOA 5J06A 3OQ3B 1MIEH 3O6FA 1X4YA 2Z91B 2ADJA 4LMQE 5D6CA 4P3CL 3PWVB 1V7ML 4NZDA 5DMJB 4GW4B 3QDGD 5C2BH 3GSQA 2GIYA 1WT5C 2NY2C 4XPAL 4WI6A 4HQQH 4CU8A 1NC4D 1HWHB 2FD6H 2ZOLB 4HKJA 4PGDB 3ZYJA 1MVUB 3O2DH 1S5HB 1ZVSB 5EIVA 4P5KA 2Q8AL 1QFUH 3B6SB 3NIDF 3MLZH 5TQ0H 2VXTL 4JG0H 4WTWA 1WZKA 4JFDE 3FB8B 2Z31A 5K9JH 4WFFE 4DGIH 1CLZL 5HD8C 1UCTA 1ZGLM 3MRDA 4YO0A 5GGRB 5IWLC 1EXUB 1I3VA 2DM4A 5DI8B 4TUOA 2MCPL 3BIBX 2VAAA 1N4XL 4X4ZA 1URLA 4GQ9H 4KRPC 5E2WL 1QRNE 2EECA 4K3JH 4U1HA 3DNKA 4KPHL 4G9DA 2ICEB 3HN3A 2J8UB 3I50H 4XVTL 2GYSA 2ITCA 2IBBA 1GYAA 3GI8L 1YEEL 3B9EA 1I9JH 1SVCP 3NTCL 5FYJE 3QIWB 5F6IC 1KJ3H 1MEXH 1OW0C 5D1QD 4G6JL 4F2MB 4N0FB 1OGAA 3VRJB 1XCTA 5LGKA 2EYSB 1F3RB 1IGML 1B88A 4YHLL 5HY9B 2R4SH 2OK0L 3O9WC 5DTFB 1P84J 1T2XA 4CUCA 5MP6H 1XGUB 4BH7B 4JO1H 4X6BB 1D5IL 3KPPB 3QUMB 1CDCA 2W0PA 1B9ZA 3F7QA 3FOMA 5D72H 3SCMD 5BVPL 4MQSB 4HWUA 3D18B 5C07A 2PF6A 1HYRC 1KLFA 2IJ0C 5GRJH 5MENE 5I6XC 5HJ3A 4JFFB 5GJSL 1FYTE 1J18A 4TVPD 1ITBB 1GOGA 5EO9A 2M1KA 2PYEB 4Y19E 3OGOE 4Q7DA 2O61A 3KWWB 2K9UA 1CL7I 3S98A 3OR6B 2DLGA 4OUUA 3UYOD 3MCG1 1INQB 3E2HC 2AP2A 3CH1A 1RULL 4JHAH 5F72S 4YDIH 3HHRB 1YEHL 4CMMB 1IE5A 1KN2H 4PRPE 5J1AA 1RJLA 4YJZL 4FQXD 4P3CH 1ES0A 4PJEB 4IJ3C 3NCBB 3SE8L 1GGIL 5EOCJ 5ISZE 5J8OA 3SJVE 3GMQA 5EZJB 3SE9L 3UTTB 2EIEA 4NDMB 1QR1B 4PRHD 3MJ9L 3DRTB 3L7FA 2NZ9D 2OX5A 4PG9B 3JVGA 3E8UL 3X3FL 3L3HB 1U95B 2VXTH 2VSDA 2VLME 5C9KA 4DN4H 3S7GA 3RY6A 3SQOL 1CLZH 3DMMB 1T03L 1BZ9A 1D5MA 2F5BL 4PRNB 5JW4R 1C7TA 3NA9H 3VGBA 5LVEA 1N4XH 4W68A 3TIDB 5E2WH 3U48A 1KACB 3PIQA 4HUXA 4KPHH 1Q38A 3R8BB 1J8HE 3ZKXB 3IXAB 1LEGA 3H7BB 5F1SA 4ZQKB 3GI8H 3MUJA 1A14H 4R3SB 4JLRB 3E6FB 3NTCH 2KBGA 2ORBL 5DT1H 3VDCA 1JN6B 3OSKA 3S8WA 2WQ8A 3PP4L 2B7DT 4G6JH 1M71A 1AC0A 3HZVA 2XZQL 5CD3B 1XF2B 3NFPB 2IGFL 1OQOA 3FT4A 3L95A 1CGSH 1QSED 4PJ5A 1OP9A 3UYRL 4NO0D 4NKDB 2QHRL 4TOYL 4F7MB 3N1MC 2R1WA 4G8IB 5FYLL 5IBLD 1D5IH 4W6YB 5EBMA 4MAYA 3ROLA 5BVPH 3GMLA 3W5NA 1PKQA 3QWRA 5F9JA 4WO4C 4EZMA 5GJSH 2K1MA 1FP5A 4PJ9B 5C0CD 1CE1L 1FVEA 1D5BA 3GIVB 2CXGA 3ARGD 3MNZB 1XIWA 4Y5XA 1FORL 1N8ZA 3HI5L 3G9AB 1CU4L 4EI5A 1JGEB 4U2YA 3SKNB 3WL9B 5B8CB 4LPWA 3RJQB 3P4NA 2XNAB 4ZXBD 2Z8RA 1RULH 3QR2A 5IV2B 1OL0A 2I24N 5I74C 4OZHA 1SJVA 3MLTA 4FFZL 3HRZB 4OAWA 3P0GB 5CFHA 1IBGL 3QRGL 3FB6B 3K0WA 3WE6A 2Q3AA 3QWOB 4JRYD 1QSVA 4I3GA 4M7LL 2F54E 2Z35A 1AD0A 2QQNL 4QXGL 3RVVC 2APTA 3KJ4B 3B8YA 3SE9H 3PABB 2CGRL 5DJCA 3LRHA 1SY6A 3VGGA 1NFDF 3RFZC 3MJ9H 3MBED 4M7LT 3GIZL 4X7FC 2X40A 4ZYKB 1KG0A 5IG7B 1U3YA 2R0KL 3LN4A 3E8UH 4DZBB 1BQHA 3BKCL 3X3FH 1ZMYA 4LSQH 1IM9B 5HYSA 2AQ1A 3GSOA 1AGCB 3A67L 5SWSD 1HXMB 4HS8L 4PJCF 4J1UA 1MCEA 5DQ9A 2WBJA 3SQOH 5CBAA 1T03H 2AVGA 1HHKA 3A6CH 1K2DA 2F5BH 1ZEAL 3QNXA 5ACZB 5DJDA 3BPLC 5L8JB 3RWIB 2V2WA 1DE4A 1B0RB 2GTZB 1QLFA 2J5LB 3KDMB 2VDML 1QFWL 3JTTB 1BP3B 2NY0D 3G6AB 4XBGA 4QLRA 4LRIC 3X3GL 5LXGL 1HI6B 1TZIB 4GLRI 2G2RB 2ORBH 2GK0A 3BH8B 1JGDA 3PP4H 1P84K 1YDPB 3RWHA 4WV1C 3P3YA 4PV9B 4X6EB 1F11A 5IHZB 2XZQH 1A9EB 2IGFH 1YPZE 2FL5B 3ZYOA 2CDFA 5GPRA 3FB7A 3F62A 3IKCB 5C0CB 1DANT 3UYRH 3RDTD 3F8UB 2QHRH 4TOYH 3LRGA 1J0KA 1VGEL 5HGHA 4RDQF 2RR3A 4LLYA 4G8FB 3X14A 5EBLB 1MH5B 3V6FB 1MI5D 5F89B 1SEQL 4XVSL 1A22B 1TIUA 3V6OC 4N9GB 5JIPA 1Q0XL 1I7UA 3MXVL 4OZFA 5F6HJ 4PJHF 4NC0B 1MLBB 3PF2A 3L3IA 2HVKB 1DBAH 2XA3A 5C08D 4OV5B 2VR9A 1FORH 3HI5H 4KK6C 3ARBC 4Z7OE 3QHZL 1CU4H 3C09B 3FO2A 5I9QC 4TULL 5ITFB 4EI6A 3SGEI 1FCGA 2V2TB 1A7QH 4NQUA 4XXDB 2CK0L 3FZUD 4Y4FC 3D0LA 3S6CA 4E42B 1XR8A 3DI2B 3S5LB 2W0KA 5C09A 4LHJB 4KKCC 5BV7B 3L3KB 4R7NB 4ZUUA 3M1BB 4D9QD 4FFZH 3IF1B 4U1NB 1Z5LA 2XQYK 1IBGH 3DX6A 2HMIC 3QRGH 4FMFA 1BOGA 2MWCA 4ZUTA 2ED7A 3HPLB 1G7HA 4M7LH 1RJYB 2QQNH 4QXGH 1U8JA 3GSWA 5DJZB 4HUUA 1GGCL 2CGRH 5J11C 2I5YL 2CUMA 1HYSD 3GIZH 5GS1B 4QRTB 3VGAB 4H1LB 2R0KH 2L4OA 2JB6B 4U6XB 3BKCH 1FFNA 4KJYB 2A73B 4RMQA 2BOBA 1JPSL 4YEEA 1YNTB 2OL3L 1LO5A 3A67H 2NY0B 3FT2B 1S8DA 4HS8H 2D31A 1CDJA 3HB3C 1U8PA 5GS0C 4V1DA 1PEWA 1JPST 4R0LC 4WUKH 4C57C 1ZEAH 4WEMB 5FYLE 4I0PA 4XH2B 3MZTA 4WU7B 1EZVY 1ZGLA 4MSWB 3FO1B 4OFYA 5J6HA 5LGHH 4YHYB 3CGTA 4C56D 5JW4M 4F7CB 1VA9A 1QFWH 2VDMH 3G5VA 3QYCA 5LCVL 3GO1L 1FH5L 3HUJE 1QVOB 1T3FB 4WVRA 1JK8A 3F7RA 3GB7A 4X83A 3SOBL 1VERA 3C6LB 3VXMB 4X98A 1E27B 3OG6B 3TC9A 5EIQA 2Z91A 5MI0C 4NZTL 1C1EL 3CD4A 3E1F1 3NCMA 4TNWF 5LXGH 5AWNL 3GSVA 2CIKB 4XP4L 4GW4A 5JDSB 2OZ4A 3GSNA 4BKLB 5DFWH 5IESH 5DFTA 5JW3L 4YDVB 3WFDH 1IQDB 5KZCD 2BNUA 3WNOA 4KROD 2ZOLA 5FXCH 2D03L 3SDXE 4OLEA 2HKFH 4PGDA 4CNIB 5D2LE 4TTDD 4FG6D 3CX5K 4MJ4A 4TRPL 1V05A 3VI4F 4FQJL 4ONOA 4P2RB 1BFTA 1UVQA 2MKWA 5LAXA 2O5ZL 5C08B 1VGEH 5EIIA 1DQQB 5BOPA 3STLA 5D96B 4RAUB 1CTOA 2A74B 4F8QA 2BNRB 1LNUA 2OMBA 3BN3B 3D69B 1WAAA 3U79A 3SKMB 1QEWA 1EXUA 2VUYA 1YY9D 5DQDH 2IAMC 5EWIL 3MXVH 4QO1A 5DI8A 2VIRB 3HMXA 2DQEL 1UZ6E 4H0HB 2V5RA 5E8NB 4PREB 5C0AB 5BZWB 3VFMB 3QHZH 1SVZA 4RMUA 4TULH 4Y4HC 3LAFA 1Y0LA 3NCYP 2J8HA 5F3HB 3E6HA 2X4PB 3QIWC 1AP2A 2CK0H 3ARWA 5IMOB 4N0CD 4NGHH 3MLVL 1UZ8A 2MSPA 1QSFE 4L9LB 4N0FA 5C0BB 6FABH 3CLEH 2DLEA 1C7SA 4R4NC 4HF5L 5CMAB 3JV5A 1GGCH 4P49A 1XGUA 3IDYC 4BH7A 4WUUD 5I2IB 4PYHA 4NQDB 3QDJE 1V3KA 2DLIA 4Y1AB 1PQZB 4TUJA 1JPSH 1WEJL 4G8GB 3T0EB 3TO4C 4JFFA 5IHBA 1II4E 2FYYB 1I3GH 3MUZ1 3ZDYF 1MCBA 1OTSD 2W65B 2EIBA 4BK4A 4IRSC 1KB5L 2OM5A 3QDGA 3OR6A 1CK0L 4HJ0C 2WIMA 2EC8A 3BWAA 5I8OL 1INQA 1EGJH 5JO5B 3OAZH 5LCVH 1FNEB 1TCRB 2AJUL 2CR6A 5TFSH 1FH5H 4YQXL 3SOBH 4RFOH 5C71A 3PGCA 5L8KB 4UV7L 3QUML 4GSDL 1AFVH 4NZTH 1EO8L 4H88L 1C1EH 4PJEA 1WQVT 5AWNH 4OLWL 3T04D 2DOCA 4XP4H 3AU1A 5FCUH 1IVLA 5A43C 2DDQL 1K8IA 5EZJA 4GRWE 4FFVD 4NDMA 4P48A 1QR1A 4K2UL 2MQ3A 2D03H 4RGND 4AIOA 2WW8A 2MJWA 3DRTA 5GS0H 4GXUM 4MWFA 4PG9A 4WI5A 1CD9B 5D1XB 4RX4A 1WBYB 4U1LB 4GG8B 2H3NA 2FJFB 2IPUK 1CZ8L 5INCB 1U95A 3U46B 3SE3A 2OTUB 4APQB 2FECL 3DMMC 4DWHA 4NYLB 3RWFB 2VZTA 2DJUA 4CJ1A 1AGFB 3QUKA 5EWIH 3LS4L 2R4RH 1U8IA 2YMXL 5D1QA 2VE6B 3NACL 2DQJL 2M2DA 3MJ6A 3HZMB 3TIDA 2Y07L 4NQVB 5E70A 2F53B 1S9YB 4NUJB 1CF8L 3ZDZF 3O3EB 3H7BA 4PJAE 1C5BL 4H25B 5DC4B 2OP4H 2SEBA 2A9ML 1JN6A 3MLVH 4GQPH 4WUUB 3ARFB 3BYYA 4NC1C 4HCRA 1X5FA 2H45A 1CBVL 2JTDA 4J3VA 1NCWL 3QUZB 5ESAB 5IJKC 1QBML 5EBWA 5CD3A 1BWMA 3BW9A 1J1OH 1ZLSL 5E8EA 2X9YA 2UWEF 2V5MA 3MACH 5EZIL 5CJ5A 4ZFOB 2E9WA 1KCVL 4S11A 3DUSA 3CVIL 5FHAL 2WNGA 3JSSA 4QWWC 4G8IA 3LKOA 5DMKA 2CRIA 2KDGA 5TH2B 1G1YA 3CSBA 4GG6B 1IAIM 5D2NB 3MR9A 4O02H 2LVCA 2B2XL 1WEJH 5DMGD 4PJ9C 1H3XA 4OLVL 4KZDL 1NC2D 5DJ8B 4PG2A 4BUHA 4NQEB 3GIVA 1JPGB 1KB5H 4JGJA 2RJMA 1I1AD 5GZND 4JKMA 5MEOB 1JGEA 1JNLL 1TTFA 2EDQA 5B8CC 3K4AA 3WL9A 1MCWM 4PJDE 1BLNB 5I8OH 4RMWA 5LBSL 2B4CC 4HS3A 4PRHA 2XNAA 2AJUH 1J8KA 5IV2A 2EIDA 3ZSSA 4RBPK 3FB5A 5FYKL 1X6LA 3IS1X 1ORQB 3WJJC 1ZT7B 4UV7H 3QUMH 1XF4A 3WJJA 4GSDH 3B9VA 1EO8H 3QUXB 4AEEA 1KXTB 4OLWH 5A40E 1MAMH 2DDQH 2OJEA 3MSPA 3PABA 1U3ZA 5GIRB 4K2UH 1VENA 2UYLB 3ILQD 3V6ZA 1DCLA 2YWYA 3KPQB 1DBJL 4ZYKA 5IG7A 5ICYA 1EHNA 5J1SC 4EUPG 4U1JA 3FONA 1V7NL 1NFDB 4Z77A 1SJEA 1RZGB 1QKZL 5F1OB 5IMLB 1IM9A 1CZ8H 4JAMB 1DQDL 3U0TB 1HXMA 3Q2CA 5L2JB 2B4CL 5HPMB 4RQQB 2DWDB 4M1GH 4HUWB 3LQZB 2BNQD 5CLWA 2EXWD 1A1MB 4W4NA 4XWOC 3K2MC 3OKKB 5ACZA 4PJCB 3MLUL 4IIQB 5KAQG 3T0DA 1UWEL 2YMXH 3NBNA 3NACH 2J5LC 2J8UE 1X7QB 2DQJH 3OKOB 1TETL 1BD2B 2C1PA 1TZGL 1IKNC 1E4WL 4D9RD 1UKTA 2Y07H 4LDEB 3REWB 1NMBL 1BFOB 2HG5B 1CF8H 3V4UL 4JVUA 1QSEA 5EU6E 2DQTL 1EHAA 1C5BH 2A6JA 5IB1A 4NO0A 4BSWB 2G9HA 1Q72H 1HI6A 3BH8A 2X4RB 1CXHA 4MD5B 5LGJB 4X5WB 2WZPD 4OZIE 2X70B 1CBVH 1YDPA 2IBZX 2ZG3A 1F4AA 4X6EA 1QBMH 1A9EA 1RK1A 4H0GA 2BVPB 2DQFB 5B38G 5BCAA 1ZLSH 3VXUB 2FL5A 4NQCD 5EZIH 5E03A 5ESQB 5C0CA 3QDME 1KCVH 3CVIH 3W2DH 3VI3F 4ZFGL 4ONHB 3S96A 3ARGA 1KV3A 3RWJA 1S9XB 1W8OA 2EKSB 4R8WL 3MGTA 3QT2A 4HKZA 1U8KB 3SDAB 1EEYA 3IDNB 1MH5A 3QHFH 3AM8A 4PLKC 5F89A 3TBTB 2EC9T 2X9XA 2B2XH 2ESVD 4ZXBA 4N9GA 1PZ5B 4MA8L 1QSZA 4OLVH 4RMTA 3WXVL 4E9LA 1ACZA 3RUGE 2AI0L 3BDYL 2HFFB 4IBLT 5EOTB 4JPIB 1U6AL 4PJHB 4X0KB 3DPBA 3UJTL 5CKAA 1GGYA 1VKXB 4JRYA 4N90E 2C4FT 5C9JB 4D3CH 4XT1C 4H8WC 5LBSH 2YN3A 3JV4A 1EUTA 3MBEA 3MA9L 3LRSB 3SGDI 3BP4B 3RKDC 3WIFB 5JR1L 4GRLD 4LCYA 1ZANL 4QRRD 4U1NA 3OKNA 2NTSP 1IZKA 3C2SA 3RX7A 2HFTA 5SWSA 3HPLA 2XT1B 5GGTL 1RJYA 5K9KB 4WHTB 1W8NA 3BYTA 4Z0BH 3T2PA 2F8OA 5A1AA 5GS1C 3STZB 3E0GA 1KCRL 3VGAC 4A6YB 5GS1A 1DBJH 4QRTA 2VZVA 1HDMB 1NLBL 3MRRB 2CRMA 1R3HB 1R3JB 2X44D 1V7NH 2JB6A 2Z0BA 4U6XA 4FRWA 2ZKHH 3LV3B 2Q87A 1QKZH 4JGUA 1YNTA 4RWYL 5FECA 3FTGB 3FT2A 2B4CH 3S88H 5E6ID 5JA8B 1O5DT 2KQNA 2ADFH 3TFKD 2AKRA 4RIRB 3D39B 4S1QL 3KNBB 4GAYA 2BXYA 3MLUH 3UZQA 2X6MA 4XH2A 4WU7A 1UWEH 2ZWLT 4YHYC 1TMCB 3FO1A 4ZPVB 3H7LA 4UT6L 1MCOL 1TZGH 4F7CA 1NGXB 2NTFA 1HQ4B 3C6LC 1QVOA 1T3FA 3MC0A 1E27A 4M62L 3D1MC 4GBXB 3RKPA 1Z9OA 1Y6MR 3MFGB 3NMEA 3ZE0E 5HYJE 3VFWB 4BKLA 3KJ6H 3QEQB 5D5ME 1E4XI 4WI2A 3TCLA 1OAXL 1IQDA 1MI5A 4OLYH 5T33L 2WBWB 4PV8B 4PGJA 4CNIA 4OSUL 5FYKE 3CDCA 5EBGA 4ZFGH 2PN5A 4L8SC 4HAGA 1HHIB 1NGYB 3CZJA 5C08A 3GJEB 2EDBA 1YEDB 4TUKL 4R8WH 15C8H 4MAUL 1JRHI 2A74A 3MRGB 2ITDA 4JJ5A 3C8DA 2VL4A 3RVWD 2MKLC 1ZLUH 1T4KB 4WGVB 3BGAA 4CVZA 3MX0A 4IHOA 4MA8H 2OTWB 3WXVH 2VIRA 5CP3H 2RHEA 1WBZB 4Y5VB 2QSTA 5KS9E 2WWMC 4PREA 4QRRB 3BDYH 3OXSA 3VFMA 1U6AH 1EFXD 2DQGL 4MGXA 4U1SA 5ICXB 2VL5B 2YA0A 4HC1L 5HGDB 2CJUL 3AAZB 3J8F7 1VESA 3IRPX 2AEIT 3O8XC 5F3HA 2W0FB 2R23B 5IMOA 5T5FL 3H2WA 3VE0A 1AQDB 4P57B 4XRCA 4YBQC 2JJWA 4P99A 4L9LA 1QBLL 4ODTH 4E41B 2DMBA 1ZANH 3UX9B 3BKJL 1N0LA 5C86A 1HINH 5C0BA 5F6HI 5DEFB 3EYSL 4L3CA 5I1DB 5GGTH 1PW3A 5KW9L 2DTML 5E6IB 4IRJD 2VZUA 4MB4A 5FOJA 1ZHLA 1ZHNA 5I17B 1GRWA 1KCRH 3QXDB 2OQJA 4F7TA 3NPZB 4OCYL 1FZMB 1N64H 1CGWA 4C56A 5TPWL 5DJ2B 1JHLL 3T0EC 2J7LA 4G8GA 2YD4A 1K5NB 4RWYH 4H8WH 5H37H 3T0EA 4AG4L 1I75A 2EKJA 1RUQL 4FZEH 1G0YR 3TPUB 4S1QH 5T1LD 2XOTA 3SDCC 3TO2A 1RZ7L 2J3SA 4NP4L 1DTUA 1KBGH 2XACC 1T5XB 2JJUA 4OD1L 2BC4A 2IANE 4UT6H 1YMHB 3BZFB 2OI9B 1FNEA 1TCRA 5F7KC 1KFAH 2WMPA 4EEEA 3BPCA 4I77L 4M62H 1MELA 4H1LH 3LKNB 4Y4KB 3HLAA 3EAKA 1KGCE 1R0AH 5T33H 2FJHB 4HJJL 1NAKL 4G42B 3CJJA 5J1TC 5D1XA 3FQNB 1WBYA 4U1LA 3GSRB 4XP1L 4GG8A 2FJFA 3FMGH 5TE7H 4TUKH 3VWKB 4APQC 2E7BA 3EO9L 3TBVA 2D4FA 2VISB 4RFNB 2EYTA 2R39A 1HN1A 3DROB 1YMMD 3I6LE 1AGFA 2AXGA 3MLPA 2VE6A 5FO7B 1FZKA 3HZMA 4MQXD 2R2EA 3P0YL 3I2CL 2HN7B 5E00A 1S9YA 1F3DH 2DQGH 4NUJA 1ONQB 1I3RB 4P46B 1G7PA 2C7UB 4HC1H 5C0DB 2CJUH 4CDHA 1ZWIB 4KMQA 3U2SB 4MB5A 4OZGE 4P2OD 1CDYA 4KK8C 5GGSB 1BIIB 3ARFC 3ZKSD 3W5MA 5T5FH 4WUUA 3QUZC 4G43B 5IVXE 1QBLH 1DFBL 3BKJH 3DURB 3MOAL 4NQXA 1A0QH 3KPRD 5KW9H 2DTMH 5D7LE 4PJXA 2GJ6B 4NHUB 4NFDA 4Q9RL 3TH4T 4I13B 5DO2D 1B4JH 1QQDA 4R2GB 2UWEB 1U8QA 3B2UD 5F7EL 3KPTA 5TH2A 2P5WD 1WBXB 3RTQD 2FGZA 4GG6A 5D2NA 5D9SA 3EYUL 1DEEA 4J8RB 4PLNC 4LNVA 4P0DA 5TPWH 1JHLH 4PBVC 5JQ6L 5IQ9A 1KYOJ 2DMKA 3HNVL 3MV11 3VJ6A 3W0WD 4XZUB 4JFED 3IFNL 4DCQB 1JGUL 1JPGA 3TZVB 4F58L 5IIEA 3QNYB 5HI5D 3CFEB 2WINB 4YZFE 1KENL 1PKOA 1RZ7H 4NP4H 4POUB 5CIPB 1P7QD 1BLNA 4OD1H 3VXME 4N9OB 3G04B 4ZSOB 2FEDC 4JRXB 4LU5L 1IEBB 1T2QH 4Z7UA 5C0FA 4I77H 4LBEB 3BP7B 3VMNA 1IGCL 3QUXC 1N3NB 2PTVA 1AR2A 1BJ1J 1F90L 3DX7B 4PYGA 2WANA 3VWJD 4ENED 4PLJC 4IS6B 1OWRM 1I85C 4KJQD 2MQ0A 5EU5B 1B0WA 2VLKE 4HKBA 2P49B 2YA1A 1UM6L 3VXQB 5GSVA 5I66A 4HJJH 5GIRA 3T4YB 2UYLA 4XXCA 1NAKH 3VD7A 5K9OB 2XWJB 1UYWL 3KPQA 4P2RE 4TQEL 4OUOA 5ETUB 2GJZA 2OXHA 4FQPA 3TIEB 4XP1H 4EUPA 5DHYB 5IMLA 4KKLD 5FKPB 2BNRE 3FQTB 5FGBA 3VFPA 2EDDA 2NY6D 5L2JA 1FAIH 5HGAB 5HPMA 3EO9H 4RQQA 5T1MB 4QY8A 1OSPL 2WLYA 1WCBB 3OKKA 1ZKAA 4OGAC 4HPOH 4YX2L 4IIQA 1MFCL 3MNWB 2AEPL 3WKNA 2IH3B 2ZNWA 2IFFL 4OLZH 1X7QA 3OKOA 1CYGA 2ARWA 2XZAL 2YPLE 2NXYD 3AREB 3P0YH 3I2CH 2AJ3B 5I15L 3WFBL 3REWA 1BFOA 2HG5A 5E56A 5CGYD 5EUOE 1QBBA 4N5ED 4BSWA 2OLDA 4ZTOH 4H20H 2KH2B 2Z4QA 2JK5B 4MNQE 1ZHBB 5B21A 1BF2A 2ZSWB 4PR5B 4K71B 1LE9A 5A3IC 1WFUA 3RAJL 2L0DA 1DFBH 4CN6A 4KUZL 2XKNB 3WN5B 3O4LD 4LOUD 2H32A 1UQSB 5HI3C 2BVPA 4N0UB 3CFJA 1IAIH 5B38A 1NC2A 1HH9B 3TVMB 4LHQB 4ONHA 5DZNA 1JMZA 2IADA 5EB9A 4P2QD 4TTGA 3RWCA 4M1CD 2OCFD 2EKSA 3EJYC 3SDAC 4ZOBA 1A6UH 4Y5YB 1P5VA 1FG2B 5DK0A 3VXPB 3EYUH 5KVMC 1DQML 1M1SA 5ACLA 5JQ6H 1H8NA 3HNVH 4ZDHB 3DHMA 1FNGA 1NBVL 3EO0B 5DUBA 4DAGL 3IFNH 1Q94B 2F8VA 4M03A 1JGUH 4KKBD 4JPIA 4F58H 1E6OH 4JDVB 1KENH 5H2BB 3RGVD 4KKAC 3LEXB 4Z7WF 1QLEL 2ICWI 1I8LA 5E1HB 5EO0B 3NCJL 2FGWL 4LU5H 1G7IB 5I1IL 4JFQB 1IGCH 3BP4A 5GGQL 2I25N 3PQYD 4YHIB 5E7BA 3R8QA 3F6IA 3QRFM 5DF0A 1UH2A 4QHMA 3VFTB 25C8L 5IKCB 4HMEA 4L4TB 2BNQA 2EDJA 3WNLA 1UM6H 5HBBA 1W0YT 1JWSA 2D3VA 1VFMA 3BPOC 2A2QT 3STZA 1UYWH 3UO1H 3HE7B 1R3JA 3ES6B 3N1QC 4Q9QL 3W9EB 2HLFC 4WWKD 1A4KA 1CD0A 1Z9MA 3C87A 1U41A 2GSGB 4HUVB 3QCVL 1OM3L 2P42B 5BO1L 4RRPG 1KTDB 3IFOA 4XCNB 3PL6D 1K85A 4HDIB 2VLJD 4AJ0A 1AGBA 1XAUA 4IOIB 4WI4A 5EH1A 2PXYB 4YX2H 2XTJD 5DEGB 1MFCH 2IFFH 3QCUL 1HKLL 2F53E 2G75B 4XC3L 2ED9A 1XF3A 4ZPVA 3RI5K 2DKMA 4QTIL 4KZEL 2XZAH 2D7PA 4F80A 1KLUB 1HQ4A 5I15H 3WFBH 2RB8A 2DQCL 2VRAA 4S1RL 4A6YL 2NX5D 1A21A 5JOFB 4GBXC 4WHYH 3AROA 1DQJB 4OQTL 4X9FA 4FNLL 3ARXA 2VQTA 5E2VL 5I1AB 5F1IB 4ODUB 5A2LH 3VFWA 4Z7VF 3QEQA 4ISVA 5D7JD 5LKNA 4YLQT 1T22B 3RAJH 2IFGA 4KUZH 3TJHC 2AS5M 3QEHA 4L3AA 2ESVA 4L4JA 3SY0B 1OD7A 3BEVA 3QXAB 3L7EB 1VFAB 4UAOB 5FUOL 2N56A 1L7TL 1Z2KA 1S7RB 4AM0A 1NCBL 1OP5K 1AJ7L 3D5OF 1HHIA 1NGYA 3IRZA 3L3JB 3LDBC 3EGSB 1YEDA 1Z9LA 1KYOK 4Y89A 2EZ0D 2V5SA 3MRGA 1NL0L 4Q2ZA 1DQMH 1Q9KA 4GKNB 1T4KA 4P4KD 3WS3B 4G80B 4DKFL 3MLRL 3V0VB 1W72L 5CSBA 2VLRD 1U42A 1X5ZA 2WLZA 3EFFA 4Y5VC 3DO7B 2FLRT 4GRLA 1NBVH 5IW1A 2Q7YA 4DAGH 1AKJD 2YWZA 2FBJL 4QRRA 3ZTJG 1A2YA 5E94B 2NY3D 4JZOB 1FBIL 4G8EB 1H3UA 4UIMA 5ICXA 1D6VH 1QLEH 5HGDA 4Q9CA 3AAZA 2E27H 2P44B 4JKKA 2W0FA 2FGWH 5HI4D 1A7RL 3IB4A 4LQFH 1AQDA 4P57A 5I1IH 1QFHA 4L5FH 4XP6L 1NCNA 5HPOA 3QPQD 4MJID 4UQ3A 2GK2A 2AJVL 2X9WA 5JZ7D 1DN0A 2NW2A 3D87B 1TTGA 1BJMA 4KK9C 5I1DA 25C8H 5T3ZE 5E6IA 5ENWB 3V6BR 4EVNB 1ZSDA 3FJTA 2B1HL 2VLJB 4NO5A 2FHFA 3QEGL 3KYNA 4ODSL 2JCCA 2NY7H 5I17A 5SX4H 5IK3A 3LQMA 1KPVA 3OKEA 3QXDA 3RIFF 1BVLA 4PRAB 4UOW0 3TP4A 1WTLA 4Q9QH 1N59B 4S1DC 5DJ2A 1JF1A 3OR7A 2XFXB 1K5NA 3IS0X 2FX9L 5FHBH 3QCVH 1OM3H 5BO1H 4V2BA 3TPKA 5AD0B 5TJWK 2EEBA 2YN5A 5LQBH 2DS4A 2EE9A 3FO0L 3K8KA 4WY7L 3MJ7B 3QCUH 1HKLH 4B7IA 1T5XA 3VRLE 5FOBB 5BW7C 1I8MB 4KZEH 4QTIH 1YMHA 3ARYA 3RX5A 1NBYB 1XGYL 2J6EA 4GXVL 1A8JH 2M26A 2OR8A 3B4NA 2DQCH 3FQUA 4S1RH 4I18B 4QRPD 4A6YH 2FSEB 2VSCA 2D7NA 4XPTL 2VDOL 1WWBX 4Y4KC 4OQTH 1UADC 1H8OA 2P7TA 5CHNB 4FNLH 1BX2A 1CDHA 4UDUB 2V5YA 1B4RA 1LMKA 3UTSB 4MLSA 3IVKB 3MGAA 2FJHA 1UB5B 1LP9A 4G42A 1G6RL 2IF7A 1MNUH 4YR6A 4QRSB 2A0LD 3GUTB 3FQNA 3RIAK 3GSRA 1CGVA 1AJ7H 4JFYA 3KG5A 4HFUL 3VWKC 2NY3B 1QNZH 4G3YH 4U3XA 1EFXA 4G9FD 4RFNC 1S7QB 1AHWB 2PO6D 2ZUVA 5SX5H 1NL0H 2XG4A 5T3XD 4DKFH 5I18L 3MLRH 3CCHB 1W72H 2HYMA 5SWZD 3P9LB 4Y0GA 4JZNB 4AYFA 1PSKL 3ALPA 3O3BB 4JCLA 2FBJH 5FUCE 4C83A 5JW4N 4P46C 1FBIH 1ONQA 2NY4B 3DIFA 4IRJA 3DGGB 3O4OB 3N50A 4HWZA 4HX1B 1PKQE 5J0BA 3ETBF 4PJBF 3TYFA 4XP6H 2EIZA 1IQWL 3BISA 1OQXA 3DURA 4JQXC 5TE4L 2AJVH 3VW3L 1V3MA 3HFML 4JZJC 5DRNA 2OZ4L 3T4AB 4LSUL 4NHUA 1TLKA 2HP4A 4OQ1A 1CGUA 4YXHH 1YEIL 4R2GC 2B1HH 5T1LA 3QEGH 4ODSH 1DVFD 3V5KA 1BGXH 4HWBA 1WBXA 3B9KC 4OZHE 1MHPL 1N6QL 4F33A 4J8RA 3VFRA 2LU7A 1PDKA 1XGRA 2CLRB 2FX9H 3IAPA 3LEYH 4XZUA 3QPXH 4NWTH 3VA6A 2B0SH 3TZVC 4PJIF 3O0RL 3EHBC 3FO0H 3QNYA 3CFEA 2VITB 4WY7H 4F7EA 1V8HA 1UXWB 3I9GL 2V7NB 3RPIB 2YBRB 5JHDD 3QQ3B 4ZSOA 1XGYH 4GXVH 3DV6B 4OJFH 3BKML 4JRXA 3MLWL 2Z92B 3BP7A 1K4CB 4K3GA 2VDOH 3S34L 5DD6B 1FZOA 3DX7A 4IS6A 2ARJA 3DUUB 2VZSA 3DTXA 4O5LL 1U8NB 5E2TL 4OI7A 4XI5C 4IOFC 4KI5D 4H5SB 5EU3A 3VXQA 5INDA 1YMMA 3T4YA 1RAMA 5K9OA 2GT9B 4X5XB 3PWLB 1I4FA 3I75B 4HMDA 1RPQA 3G5YA 5CZVL 5ETUA 4U1KB 1J0ZA 1P2CB 3HE6D 2J12B 2X4SA 1OTUC 4ZFFA 5FKPA 2EDHA 2ZJSL 4XNQA 2D0FA 3FQTA 3FFCD 4PD4K 4M9PA 2I07A 5T1MA 2YC1A 4MD0B 1LO4L 5DJ0B 1JTPA 4WEBL 2OR7A 3MNWA 5I18H 2IH3A 1MCSA 2YD9A 3AUVA 1T7XA 5JW5B 3AREC 1PSKH 5L0QC 5I30L 1OP3H 3RWEA 3AREA 1AE6L 2MCG1 2AJ3A 5KVEL 2QQLH 3BT2L 3WO4B 2DIBA 4WCYL 4WFEE 2NCMA 1ND0B 1JYNA 3W82A 4K8RC 2QADB 1MHHA 2QSCH 4L3EB 4K71C 5BS0E 4PR5A 5HHME 2P5WA 3MGOB 2WUBL 2IQAB 3L9RB 5GGUA 3RTQA 1JZ4A 3WN5C 3CNKA 4G6AD 1JYXA 2HFEA 2XPGA 3IT8D 5TE4H 4YHNB 1UQSA 1YA5A 3VW3H 2E7LC 3H6JA 5DWUL 1J12A 4N0UA 3TVMC 3W0WA 4LSUH 4TSCL 1YUHA 4GXUN 3ZKMD 1YEIH 1KJ2L 3MNVA 3KLHC 1IGTB 5KVDL 4JFEA 5CUSL 1B0GA 2H8PB 4XPHL 5EFIB 3VH8B 4Y5YC 2DL9A 4OIAA 1M7DB 4HHAB 1P7QA 5SV4A 1FG2A 1MHPH 3GMNB 2CD0A 1A5FL 2ATKB 1BBJB 4WHDA 5FB8A 3SCMC 3WNPA 4YHML 1HCFX 2VUOA 4K8RL 1UCBL 3NZ8B 5BRZD 4HMCA 4BSVB 1NCAL 2CH8A 3VWJA 3O0RH 3IAGC 1G9ML 3BJ91 2D7MA 4JDVA 5H2BA 4A2MA 1CDGA 2PUQT 3PNWB 1FLRL 2I26N 5EO0A 4HIEB 5KSAD 4P3WA 3BKMH 3MLWH 1G7IA 3HZKB 3QUYD 3K2UL 4AT6B 1T66C 4PRIB 3U4BH 3S34H 2FNBA 3CK0L 3OJMB 4AIZA 1FLTX 3CFKB 2VMFA 3VFTA 3V7AE 4DKEL 4FQXC 4O5LH 2QHLA 5E2TH 2H26B 3WHE0 3VD9A 1P69B 2VC2L 3H9HA 5TDNA 5CZVH 3HE7A 4K23L 3GRWA 3P4MB 3IDJB 4OLUH 4QF1B 5CIPH 1IEHA 4TVPL 2ICCA 2ZJSH 5IFAH 1T83C 3QA3B 2GSGA 5E5UB 5HHOB 5E8OA 4HUVA 3D85B 1LO4H 2YK1L 1AXIB 2R15A 2BHZA 4HDIA 2PXYC 3ZZ1A 1TZHB 5DEGA 2H2PC 5D1ZB 1KELL 1W0WB 2G75A 5DUMH 1JPFB 5I30H 3O4LA 1OAYH 1WITA 1AE6H 3EYOB 4MD4B 4NJAL 1KLUA 1I7ZA 1UWXK 4KRNA 1S7SA 5KVEH 3RBGA 4HK0A 3BT2H 4WCYH 1A3LL 4G6ML 5F7UA 4EQ2A 3M8OL 1QP1A 1CFSA 1KJVB 5DJAB 4P2QA 5DK2B 3TT3L 4NRYB 1C08A 3RPKA 1H3TA 2WUBH 4JDTL 3HG1B 5C0GB 1F8TL 4OF7A 2GJ6E 3P30L 2V9TA 1BVKA 2HH0L 2BCKA 1X4XA 3GJFA 1F42A 4UAOC 1VFAA 2UWEE 5KSBF 4TSCH 4P5TD 5CJXA 5BRZB 1KJ2H 2A6DA 1D5XB 5CUSH 3IDGB 4XPHH 1GVIA 4M48H 2XRAL 3L3JA 3EGSA 4M6OH 5IF0B 3LY6A 3RGVA 2EEDA 2C3WA 3HC3L 4R4BB 1OD9A 4KDVA 1A5FH 1NBZB 4R90L 2EDXA 4GKNA 2QQQA 5DJXA 3WS3A 4RNRA 4G80A 3UDWA 3V0VA 4XNMB 4YHMH 1WIOA 1BREA 2OJZL 3TA3D 4QNPF 4FFWC 3QUYB 3NFNB 4K8RH 1QRKA 4PJ8D 5MEQB 3PQYA 5C0JB 4QOKB 1NCAH 3U9UB 4M43L 3LMJL 4G8EA 2FZ3B 3CFDB 5L9DL 3H9SB 1BEYL 1FLRH 1AXSB 1EUUA 1P7KA 5IB2A 2GY7B 4PTTA 2J4WL 3MA7A 2R0LL 3UROR 4YGVB 2GSIB 5KOMC 3SBWC 5CJQL 3P4OA 2ZUQB 32C2A 1M4KA 3CK0H 4U6TA 3SGKA 4WWKA 1YPZF 3ZL4H 4DVRL 1H5BA 5DSCB 4KXZI 3I6GA 2IBZY 3QDGE 2CSPA 2HAZA 4U0QB 3FT3A 1JNHA 2IMMA 3PL6A 4XP9H 5GRZA 2VLJA 1DQTA 5T1KB 4K3DL 1Q9WB 3ULUD 3KYOB 4R96B 1VFOA 4PRDB 1U3HD 5EULV 3FN9A 4K23H 4XX1G 1ZLVH 2FH6A 4N8PA 4U6HB 4Z8FL 1E0OB 3F58L 1KIUA 3TN0B 2GFBB 5GRYA 3NH7L 2BSSA 1YNLL 2NX5A 5HHXL 5IHUL 2YK1H 3BZ4B 5DURD 2RFXB 4ELKB 5AD0A 3CAFA 2EDEA 1I1RA 5BJTB 1T1XB 1YN6A 4Z7OF 3G5ZB 1ZXQA 5ICZA 3BGMB 5D7JA 5CWSB 1KELH 3ARRA 2R2CA 2CUHA 1I8MA 3ZKND 2Y7QA 2AABL 5KG9A 1J05B 4NJAH 4OGZA 4WFFD 4NN6B 4I18C 4MS8D 4I2XE 4MXQC 2JJTC 4ZAKD 1MCHA 1A3LH 4LSTL 1BZ7B 1MJ8L 3M8OH 1TQBB 2BHYA 2CKBB 3TBYA 3TT3H 4LSVH 1DBBL 3PHOB 3MV7B 2DQUL 4X7CC 3UTSA 4JDTH 1PYWB 2W9DL 3TV3L 4Q9BA 1F8TH 1IAKA 4OCXL 3IVKA 2FIKB 1OAQL 5CD5C 1D6EB 4MDIB 5FYJD 4JM2F 4LDLB 3D6GA 1AKJA 3VI3E 2A83A 2XRAH 3BPNB 5JXED 1FHGA 3A6BL 2P4AB 5L8LB 4EN3B 1CDBA 5B4MC 3QFDB 5CLTA 1P9MA 4JFPA 5D6DA 2EE3A 3HC3H 3HZYB 1AHWA 1MJUH 3JWOH 4Q6IB 1XH3A 4R90H 1MUJB 1RSFA 1DSFH 3ARDD 4HFWB 4UU9B 5J57B 2OJZH 3P9LA 1BWWA 5FM4A 4MJIA 4NJ9L 1H0DA 1WV7T 3HUJF 4TVPE 4M43H 3L5JA 4HLZG 2NY4C 2YR3A 5L9DH 3V4VH 1BEYH 5MEND 1B3JA 3O6KL 4KMTL 3GSUB 4HX1A 3JV6A 4JANA 2JJSA 2R0LH 1MFDL 4KGJA 4HIHA 5E2UL 4GKZB 4V2CB 4OCSL 5EN2B 1RUPL 3SDXF 3FKUS 3C5JA 3MODH 3KYKL 2Q7NA 5D2LF 1NCCL 4DVRH 1VEOA 3CC5A 4R9HA 1ZS8B 2BMKA 5TE6H 4JVPA 2VKWA 3T4AA 2A77H 2DD8H 4MJ2A 5DHVH 3SDYL 2OS7A 2R2BB 3ZKQD 4K3DH 4ZD3L 1A7PL 5D8JL 1HSBB 5BQ7B 1FGVL 1OOAA 1P4LA 1F6AB 5ISZD 4Z8FH 3F58H 4JFDB 3IXTB 4M02A 3VD3A 2X05A 4ZAKB 4ZO9A 5DA4A 4ONGL 4QXUL 1UZ6F 5IHUH 2YXFA 5HHXH 1FN4B 1CFTA 3MRPB 3FN3A 1B2WL 2NYYC 5F7YC 3WBDA 3WS6A 1OT2A 1QRNB 2NW3B 1UXWA 1X4ZA 4E5XB 5TDOB 2DBJA 3RPIA 2AABH 2ADIB 3QISA 2WP3O 1AY1L 5H94B 4PY7B 1TENA 3EKCA 5F1NB 1K4CA 4LSTH 3FOLA 2KPNA 4OFDA 2MHAB 5DD6A 1S7TB 1DBBH 4GT7A 4K7FB 4G9FA 5JXAH 4OCRL 1GH7A 1FNAA 1EO7A 43CAB 4H5SA 1U8HA 1J8HD 2W9DH 4JHZA 4OCXH 2MOVA 5E5MB 5GRVL 1KPRB 2AERT 3ARDB 1OAQH 4QHUB 1CE6B 2GT9A 3QG6B 2E6PA 3PWLA 5GGRY 3MCLL 3RZCD 2R1XB 1QSEE 5D70L 2VO5A 4TTDC 4QHNB 5I1CL 3IDMB 1IEAB 5DD3L 3G6JF 3A6BH 4IMLB 5ANME 3JTSB 5C0NC 5KTEL 3D3VB 4ZUVB 1I1FA 5MENB 5M7QA 2V2XB 3M45A 3QI9D 4M61A 2GUOB 1FYTB 1FG9C 5IB3A 1DJSA 1AIFA 5J56B 4IMKC 4BJLA 4Y19B 4G7YH 4NJ9H 1OPGL 4BQ8A 9CGTA 3EOBA 4GH7B 5EU4A 4F9LC 1JHKL 1J0YA 3DV4A 4EBQH 3CSPA 2LTQC 3OHXB 3O6KH 4KMTH 4FXLA 1DVFA 4DK3A 4JB9L 1OAUH 5K93A 4HZLB 1UKSA 4PRPB 3OJVC 1MFDH 1EPFA 5E2UH 1A6AB 4GRWF 4OCSH 2OMNA 1A6ZA 5FYJU 5ISZB 1RUPH 3KYKH 3SJVB 3DLQR 3MYJB 4AEHL 5KANG 1TITA 4FQCH 5HHPB 4JRYE 3Q6GH 1BHGA 5AZ2L 1IGTA 4QGTA 3GM8A 2QBWA 4L8CB 1MCCA 3LKSB 5D8JH 4YAQA 4ZD3H 1RHFA 1CL7L 4HGKC 1FGVH 1M7DA 2P5EE 1KIRB 3CVHL 3L3OA 1VSCA 3V4PH 2NY2D 2UVFA 4XBEL 2AW2A 2ATKA 5C8JA 1BBJA 1EV2E 5I1EL 3ZSTA 1BPVA 4NRXB 5IOPB 3DXAE 4AL8L 5SWSE 4RZCB 4QXUH 3NZ8A 4OM1L 1N0XH 1B2WH 1D9KB 5DVKA 2LABA 5FCSH 1OTSC 3IGAA 1F13A 3OTTA 3FFDB 3WHXB 4X8JB 2JIXB 1H15B 2BRRL 3QDAA 1HXYB 4XCEA 1EFQA 5HD8D 1AY1H 4C58B 1TTUA 2D0HA 3HZKA 4HXAH 5D7IF 5EZLA 3HE6A 3LHPH 4KRPD 3R1GH 4X6CE 1JV5A 3Q1SL 4Y16B 2DAVA 4PB0L 2IG2L 1K6QL 2HFGL 2H26A 3MRIB 4YIQB 3HRPA 4PS4L 3T09A 3MCLH 4LHUD 3QO1B 3QXUA 4YC2B 1G7LA 4Z76B 4WFHD 4XPFL 1OGAD 2X42A 3P4MA 4QF1A 2RGSA 5I1CH 1YEKL 3NVQA 1A9BA 5DD3H 5KTEH 3LSOB 5ILTL 5C0IA 2MFNA 3O9WD 4PGEB 1A02N 1T1ZB 4XHJC 5D1ZA 1ZOXA 2BY0A 3QIUB 3U4EB 4PJDF 1UJ3B 1NSNH 4ZPTB 5C07D 2CIIA 3FCTA 1OPGH 4MD4A 1MQKH 5I8CB 4MCZB 3OAYH 4YFEA 4B53A 3BDXA 1F58L 1JHKH 1XGPB 3OKLA 4KTDL 5JIIA 1NDMB 5CILL 5DJAA 4LDOB 1SBSH 5DK2A 4NRYA 4JB9H 3D25B 3BQUC 3DVIA 4NNXA 2XWTB 4ALAL 3MRLB 4GW5B 3HG1A 4JKWA 2HT3C 5C0GA 4U6YB 4D9QE 2F54B 1WGOA 1V3JA 5LWYL 4U2ZA 1ED3B 3PWNB 4AEHH 2YUXA 3T65A 2OR9L 3MCKA 5BRZA 3MLSL 4ERSL 1D5XA 3IDGA 2BXZA 1LQSR 1IARB 4N68A 1UACL 2R2HB 1CL7H 2X7LB 5IMKB 3F65A 3IDIB 2WIIB 5FA3B 2EH7L 1NBZA 3N85L 3QO0B 4XBEH 5T5NF 3MV9B 4YHKH 5I1EH 5KSAA 2CMRH 5ADOL 4XNMA 4AL8H 3I3BA 3LZFH 3QUYA 2XN9E 3NFNA 1LO0L 4OM1H 5D7KE 5C0JA 3PHSA 4KRPB 5E1AB 1FPTL 3GSXB 1IGJA 4X4YA 1RIVL 3U9UA 2A1WL 5EC1A 5CBEB 4JO2L 4BZ2L 3RL1B 2CKNA 4FQHB 3V0AC 4M9OA 1RHHB 1F02I 3LN5A 4NNPH 3WLBA 1AXSA 5B39G 2PR4H 4LHUG 4C56E 5HYIA 5HDBE 1HNGA 2FHCA 4OZIF 5F6IB 3C9NB 5TGBA 2UUDK 4KQ4L 4KDTA 4LF3A 2ICES 2HLAA 4BSJA 5DSCA 1YNKL 1OF2B 4NT6B 2R1YA 4WTZA 1R3KA 4PB0H 1A7NL 2IG2H 1K6QH 2HFGH 1YPZB 4NKMB 1Q9OB 2DL2A 4UQ2B 1NGQL 5AYQA 4Y2DB 4PS4H 4R96A 5F97E 1K4DA 4NQSB 12E8L 3BHBA 4G7VL 3VXSD 1MWAL 4XPFH 2Q86B 3TN0C 1YEKH 4QRUB 5MERB 2HVJB 3Q3GB 2CDGB 4H26B 4HV8A 5ILTH 3RUGF 2Y06L 2EDNA 3BZ4A 2RFXA 1E28A 1WZ1L 4ELKA 1OY3B 5F3BB 3VXRE 1NQBA 1T1XA 1DDHB 1T1WB 5IR1A 3TYGH 3EYFB 4Q0XH 5IT2H 3BGMA 4DZ8B 4JJHA 3SGJC 4LLVA 4AQ1B 3SGJA 2W60A 5FIEA 3E2HB 2C1OB 3MQIA 3PWJB 1DL7H 1F58H 4WO4D 3ZE2E 1XGQB 3F5WA 4P5TA 1BZ7A 1TQBC 4S10A 1XIWD 1JPTL 1PAMA 5FV2A 3PHOA 5DRWB 3NCEB 3EDDA 4ALAH 3ECBA 3CH8A 2EICA 4QHLB 5DDHB 2XZCL 1FVCB 1MFEL 2FIKA 4XMLL 3F12A 5LWYH 2A6KB 5AAMA 4Z5RA 1PG7W 7CGTA 3MLYH 3LOWA 4FS0A 4UTBH 2PW1B 2UY7A 2OR9H 4PJ8A 3MLSH 4ERSH 3BPNC 3I3EA 4KJPC 4EN3C 1QSFD 1UACH 2Y5EA 3QFDA 4Q6IC 4JM2B 3BN9C 3AY4C 3RVVD 4CN1A 2EH7H 3ZDXF 3WIHL 3N85H 3T3ME 1MUJA 2X4TA 2IALB 4LKXA 3QXVA 4ZTPL 2CKBL 3IETB 5E9DB 5JLZA 2MNUA 1MLCB 4X6DA 1T21B 1R3LA 1RIVH 4MNHB 2E8YA 4JO2H 4BZ2H 1CDUA 3DJ9A 2GI7A 4Z7WE 3HUJB 4XCCL 3GSUA 4OKDA 5FM5O 3ZE0F 2IEPA 4QT5A 4LGRB 4L1HA 1GPOL 5E4EB 1TVHB 5IVNA 1XF5B 1J1XL 1L0QA 3IAQA 1S3KL 1ZS8A 1YNKH 1MFNA 2DN7A 3SDXB 1A7NH 1KOAA 5D2LB 4M7JL 5IROA 3SDDB 1JZ3A 1QO3A 5AYUL 1NGQH 4UTAL 3O41B 3NCYS 4RGNE 4F9PC 3C8KB 12E8H 4G7VH 2F74B 1KIQA 1NAMA 1VCAA 3IXTA 4LLUB 2N1KA 3LKRB 4JR9L 4ZAKA 4GAGL 3HPJB 1NFIB 5FUZL 1YY8B 1FN4A 2Y06H 1WZ1H 4ELMF 4XCFL 1OSZB 1A1NB 5GJTH 2NW3A 3NGBB 4WJ5B 4ODVH 1FFPA 4E5XA 2AK4E 4KTYA 2ADIA 1AO7B 4PJGA 1GAFH 3NAAL 4YNYB 3OJDB 3UTQB 3CUPB 3NIGE 4RAVB 5F1NA 3SEPA 5I19L 1X9QA 2MHAA 3HMWL 1JPTH 1RU9L 5JXEA 1YJDC 4CW1B 3HKFA 4KK6D 4Z7VE 4RGMB 4OD3L 3KXFD 1A64A 8CGTA 43CAA 4GRMA 2XZCH 2FEEI 5E5MA 1KPRA 2VNCA 3ARDA 4QHUA 5FO8B 4OZ4A 4UV4L 4Y4FD 3QG6A 3CU1A 5C09D 1NGPL 5HYSG 2R1XA 4KKCD 1G9EA 5ACMA 4QHNA 4UUJA 3IDMA 2BSED 3I02B 2O5YH 3X13B 2HMID 3JTSA 3U7YL 3MRCA 3QDJB 4NN7C 3OGCA 5FDWB 5K33A 5MENA 2APBA 2BVQB 3UCRA 2VXUL 2V2XA 3WIHH 1BMGA 2GUOA 3VXOB 4ZTPH 2CKBH 4QOKE 3BPLB 1G7JB 3OMZA 3KR3L 3DSNA 3FQWA 1YJDL 5FAAA 3H9SE 1ADQH 3WLWC 5GSRB 4UNTA 4HH9A 3TLRA 4NRZB 2BVYA 3HB3D 3OHXA 4XCCH 5GS0D 1EEZB 1QFWM 4X7TB 3TBSB 4HZLA 4PRPA 3UPRA 3QJHB 5C0RL 5I8EB 3EYQC 1A6AA 3KS0J 5ISZA 3MV8B 3BP6B 3UBXB 3VRIB 1J1XH 1VFBB 1TJHL 3EFDL 5DMIL 1ETZB 3RHWK 1S3KH 4GRWB 4HXBL 2GAZB 2QL1A 3SKOA 2YKLL 2EDTA 1HH6A 4M7JH 1CIUA 4PJ7F 5AYUH 3LKSA 3U0PB 4UTAH 4P9HC 1CFVL 2IH1B 3BUTA 1KIRA 1F45A 5CAYB 1G0DA 2VTFA 5JNYB 2V9RA 5KSVB 4OCLC 5L7XH 4FQLL 3TWCL 1VGKB 1T80A 1U9KA 4NRXA 5IOPA 3MREB 5AUMB 1D9KC 2JKXA 1G7MB 1TVBB 4I48A 4XCFH 4PBXA 1L9MA 3VCLB 1DEDA 3RWGA 5DJYA 3VXNB 1I7RB 3AMKA 3ARBB 5DGQA 3FFDA 5JORB 4Z0XB 1ORSA 4X8JA 2JIXA 4OZGF 1KCUL 1J8HA 2OL3B 5KVGH 1OGTA 4Y4FB 3OKDB 4I4WB 3RZCA 2IAMD 3PWUA 3BKYL 5HVHB 1IGYB 5HHQB 2W1NA 2NQCA 5I19H 1IC4H 4OCWL 4P9HL 1X44A 4YHPB 1RU9H 4MDJB 3NABL 4Y16C 4D0BB 1RIUL 1HHGA 2HRLA 3OKYA 3MJ8A 2CLVA 1QFOA 4QHKJ 4Y4HD 2LFGA 5DRZA 1MCWW 1ZHKB 4NNYA 1MCNA 1MHCA 4YIQA 3QIWD 5F93C 2V5TA 3WEXB 4UV4H 3BMVA 4YC2C 3QO1A 4WW1A 4XMKH 4NQCE 4O2CA 1R6VA 5L6YL 4L8DB 1Q9LA 4JY6A 4M7ZB 5A2KH 3QAZC 1F97A 4P59L 3HC0A 4NKIH 1CFQB 4KTEL 4HWBL 3BP5A 4R4ND 5IBUG 3O3AB 1R5VA 4DVBB 2VXUH 1U8OA 1T1ZA 1NCUA 4YZFF 5E8DL 3QIUC 5DS8B 3BEWB 1UJ3C 3U4EA 2X1QA 3KR3H 1I8IB 1YJDH 4KC3B 1KCLA 5H8DA 4XPBL 2ZUYA 4PJDB 4MCZA 3KYMA 4JFFD 4I0CC 3TO4D 4KKNA 1XGPA 1MREL 5BVJA 4MJ5A 1T04A 1NDMA 4XTRC 5MI0B 1K8DA 1XCQB 2PYED 3D25A 3V0WL 1T6VN 4IRSD 4J23A 1MSPA 4OF0A 2XA8L 5C0RH 1PZUB 4P2OC 5F44A 1D3CA 4PJBE 4LLDA 1WT5A 4HJ0D 3VGDA 3BWUC 3O45B 3GDBA 2WAHA 3JV0A 3CDGB 4R4FL 3M17A 5DMIH 1ED3A 4D8PA 2MTPA 4FXKB 4HXBH 2LV4A 1CFBA 4JM4H 1JGVL 3OWEA 3HAEB 5DLML 5DO2C 2X7LA 5IMKA 1IAOB 1NEZB 2WIIA 3UTTD 1P4IL 2ZCLL 4N0RA 5FK9B 5F7NC 3CFBB 1MJ7H 1KXVC 3QO0A 3DX9A 4FQLH 2V6HA 1C5DB 3TWCH 5IBTL 3T1FA 1FFOB 5IWLA 1B90A 1JMXA 2IAMB 4UIKH 4RX4D 3QEUB 1NDGB 2I9LB 3B43A 3GHEL 5E1AA 5IFHL 1SBBA 4PJIE 2JCCE 5EUOF 1GZQA 3V8OA 1F4HA 2ZPKL 3DMMD 4Y4HB 1IGIL 5ERWA 2AEQL 5HI5C 5JPNB 5HVFB 5EU6B 5B39A 4N0YH 1M05A 2O93L 3C9NA 4LHUA 3BKYH 2WSKA 1TQCB 1OW0A 3LKQA 3MJGX 4X9BA 2I60L 4P9HH 1KB5B 4OZIB 4LSPH 1RURH 3NABH 1RIUH 4NO3B 1A3RL 3ULVF 1OF2A 4N1EA 3O9WA 1TDQA 5JA9A 4NKMA 5EOCL 1Q9OA 1I7TA 4Y2DC 3QDMB 4UILH 1EHLL 3DSFL 3IDYB 3X12A 5ESVA 4ORGB 3RI5F 5IFJB 5KSUB 5L6YH 2Q86A 4GAJH 3D9AL 1S7WA 5FKAB 5DMYA 1DUYB 1F3JB 1HQRA 3D3VE 4P59H 1PX3A 1H9VA 2OXGA 4KTEH 1LE5A 3TO4B 2BOCA 3Q3GA 4H26A 3RL2B 3WYRA 4LVEA 3CLFL 3MJ9A 1JZ7A 1K3IA 3KPNA 4S2SB 1LP9E 4QWWD 1UM4L 4GAFB 4W81A 1AQKL 3RUGB 1XR9B 4IRSB 2AV7B 4DZ8A 1ZA3B 4KQ3L 5F21B 3BO8B 5J9PA 5JPMB 3P73B 4XPBH 3PWJA 5HTSA 2ICWB 2NXYC 3DOSA 3LCYA 1F6LL 4PJ9D 1MREH 3MRKA 1R5IB 4K3EL 1MFAL 2X1OA 4MMZC 2Z93B 1JWUB 2CQVA 1V7MH 3PV6B 4BZYA 4N5EC 1PD6A 1IAII 2F9BT 1NMAL 2HA1A 4LLMB 4OM0L 5DRWA 4XPAH 43C9B 4B5EA 4QHLA 4UDTB 1FVCA 3KLAA 1CXLA 2A6KA 5DRXB 4XAWL 4MZ2A 4JFOB 2Q8AH 3LKPB 2PW1A 4OF3A 1UENA 1JGVH 4ZUWB 1KT2A 4POYA 3MRBB 4EDXA 4OBSA 3QH3A 2DIJA 4JM2C 4X9HA 4YGAB 4RWHA 3H0TB 1P4IH 2Z8WC 2ZCLH 1GZPA 4LL9A 1VEMA 4LCCB 3RZWA 4U3CA 2MCPH 4M7KL 3VXTB 3BD3A 3X17A 4CBPA 2VLLB 3GHEH 1AH1A 1IM9D 2X4OA 5IFHH 1T21A 1T89C 4MNHA 4ZS6C 4TN9A 4G6FB 3T3PE 1CFNB 4XVTH 5A16B 2ZPKH 4KUCF 5I0ZA 3HUJA 1YEEH 1J9CT 2AEQH 3HR5B 4P2YA 2VDPL 4FXGA 4XWOD 5E4EC 1UB6B 3VXSA 5HYJB 1XF5A 5D5MB 4Z95L 1KULA 1T0MB 4OFPA 1IGMH 1A3RH 1MY5A 2IAND 3FRUB 4YHLH 2OK0H 3BESR 1S9WA 4TSAL 3SDDC 4N8VB 1FNSL 5EOCH 3SDDA 1EHLH 3DSFH 1EAPB 3O3UN 5CP7B 1CXEA 4ZODA 3BJLA 1VEPA 1MVFA 1X5AA 3MUGB 4YXLL 3DBXA 2OBGA 1KGCD 1TVDA 2C5DC 2ZOKB 3C60B 1RIHL 1JWMB 3IU4L 4MLIA 2RBLA 4PGBB 4WO4A 1Z6JT 1YY8A 1JTTA 4M5ZL 5E8PB 4JPVL 1EIBA 3QZWB 3SKJL 1OSZA 3IFLL 5GHWL 1UM4H 3NGBC 1A1NA 1AQKH 4XBPA 5KS9B 1IL1A 2I9TA 1E4XL 1LO3L 1I1YA 4GS7B 4WJ5A 4KQ3H 1CCZA 1H3WM 4PLKD 4QXTB 4Q74A 1JZ5A 3C5ZB 4YNYA 3UTQA 3WFEL 2PYFA 3CUPA 4KH2A 1YEHH 4M8VA 3RIAF 2P8LB 3OX8A 4K3EH 1MFAH 4FQQB 3KPLB 1WISA 5KN5A 1QSFA 3SE8H 1GGIH 4KY1L 4RGMC 3O11B 3EO1B 4OM0H 4AENA 4CW1A 5CGMA 1JRHL 5CCKL 4BUGA 1SYVA 2DQIL 2AK1L 1LD9A 1EH9A 4ETYA 3C2AL 2Q76A 1X5YA 4LLQA 3KPRE 2BSRB 4MX7B 5KSBE 3RKDD 4MA3B 8FABA 2LE9A 2Y6SC 3HS0B 3I02A 4M1DL 3X13A 2WWKO 5FYKU 1T0PB 3FAXA 3MV9E 3ULSA 3K81A 5IW6B 4S1SL 3VFOA 2P5WE 3QFJB 2FR4B 3PDOB 2EZ0C 4CADA 1F00I 1CR9L 4XNYL 1HIML 5DQJB 3MPCA 1G7JA 3VRLF 4QNPE 4M7KH 4P4KC 4GUPA 3W0WE 2XYCA 2WP3T 4NCC1 5GSRA 4JFEE 5F8RC 2MMXA 1OLZA 1EERB 2BSTB 2IANB 5DJ6A 2DWEA 4CVXB 4MA1B 3NIFE 2C3HA 1QA9A 3ET9F 2VDPH 4LRIA 4ZG1A 5I0DA 3K8LA 3VG9C 3QJHA 4XNXL 4BZ1L 4GW1A 4PP1C 2FO4A 3BP6A 4WV1A 3UBXA 4Z95H 4ZO7A 3VRIA 3C6LD 4XHQA 3VXMD 3B3IB 1M7IA 1FNSH 1T0NA 3NZHL 3W39B 5FYLH 1RZJC 4HEME 3U0PA 5EA0L 2XXMB 4HIXL 2IH1A 4ODWA 4O2FB 2FIRT 4JY4B 5F7DB 4ESKA 1H3PL 1Y18B 5KSVA 4MVBD 3PXJA 4XCYB 3HI1A 1JE6A 3V6OA 4U1MA 2A6IB 1CE1H 1NGWB 4XNZC 4P2RD 4L29B 4M5ZH 4JPVH 3SKJH 5GHWH 3HA0A 3VCLA 3DYMA 4BH8A 3K3QA 1DLHA 1E4XH 2QR0A 3ARBA 5H37G 3KXFA 2BNRD 4Z0XA 1KXQE 1K3ZA 4EDWL 4YDKL 2EC9U 3V5HA 4PJAA 5F8QC 1GGTA 3WFEH 4Y4FA 3KPOB 5HVHC 4I4WA 3CSYB 4OZGB 3ZTJH 1O0VA 1RZJL 2NLJA 3IJHB 3W81A 5C0AD 5DYOB 4JFXA 5EUKB 4JO3L 4YHPA 3BZEB 5IVXB 4MDJA 3Q5OA 4D0BA 4KY1H 2ATPB 1ZLWK 1AI1L 1EZVX 2X4NA 1EGJA 2C4FU 1X6NA 5DHXB 5CCKH 2G60L 2PCPA 4H1LG 1ZHKA 1WC7A 2AK1H 5D7LB 3O4LE 1SJHA 2AV1A 3WEXA 2GTWA 4JQVC 4M8QA 4OZHF 1I8KA 4M7ZC 5CEZL 3U7WL 1T20B 3VGFA 5C0BD 4M1DH 4KVCL 4LSRL 4P2QE 1CFQA 3K80A 3S4SB 3BVNB 3O3AA 1CS6A 1EA9C 3MRFA 5E9DE 2AAVA 2PO6C 5L2KE 4R0LA 4XNYH 1G9NC 3MUHL 1HIMH 1T5WB 2XWBA 3BEWA 3BSZL 5GGSY 2Z8VC 2ADGB 4RMSA 3WDHA 1I8IA 2VAJA 4NQDD 4UBDC 1NGZB 4Y1AD 3MRMA 4G8GD 3T0ED 5IB5B 3DX8B 3IJYB 2AXHA 4J4PC 5K9QG 3X3GH 2XI9A 2K7PA 4XMPL 3PWVA 1TFHA 2V9QA 3D2UB 1G84A 2VDRL 3MROB 3DVNB 4XNXH 1XGTB 1WIPA 2YUWA 2VLKB 1MVUA 3CDGA 1S5HA 1ZVSA 2QSQA 3DI3B 4NM4L 5DC0A 2Y4SA 1F4YL 3B6SA 3IYLW 1G9NL 4BFEA 1QTYT 2EO1A 4LNRB 3NZHH 5T3XL 2Q6WB 1PFCA 4L8SB 5EA0H 1CICB 3FB8A 4O2EB 4LGPB 1VDGA 4HIXH 4OI9A 4S0SD 1IAOA 1J1PL 4LVOB 5ID0B 1H3PH 3CFBA 3LD8B 1SEQH 5GGRA 4XVSH 4J3UA 1FFOA 1Q0XH 4HG4J 4NZRL 2IAMA 2D7TL 5D1XD 3F7YB 5JIHA 3LEVL 5DD5L 1DBML 1NDGA 2I9LA 5EPMB 2ICEA 2P24B 4MXWL 2J8UA 1EEUA 1AO7E 2YPLB 4GJTB 2XTJE 1JGLL 4APQD 4GRWH 1AXTL 4WFGD 4X4XB 4Y4HA 4EIZC 2CO6B 3S36L 1HILB 4EDWH 5JPNA 5F7FA 4X7DC 5EUOB 5EU6A 1PJ9A 3O8XB 3P40A 3QIWA 1HKFA 1KC5L 1SYSB 5GZOC 1TQCC 2VABB 2K7QA 3GJFK 4F2MA 4UINL 5C6TL 4MNQB 3VRJA 2EYSA 1U93B 4NPYB 1KB5A 2YD6A 4JO3H 2LVEA 3CFCL 3ZT7A 1GCFA 2F53D 1P1ZB 4LRNL 1B6DA 4NO3A 1QPPA 5HY9A 2EE6A 4ZNEA 1AI1H 1F4XL 3AMLA 4I8DA 3G6DL 5DTFA 2DYPB 4XVUC 2WM0A 2QSVA 3VMOA 2G60H 2X5PA 2I5YH 4Z7QE 1U92B 1FDLL 2VDLL 4RBPH 5GQBA 4KK8D 4X6BA 3KPPA 4QRQB 3ARFD 3PWPE 3TH3T 4B50A 3QUMA 1AR1C 3QUZD 4I3RL 5CEZH 3U7WH 3D18A 1U8LB 1F3JA 2OL3H 3GKWL 5IQ7L 1BQSA 4KVCH 4LSRH 3G6JE 3TO4A 1TJIL 3MBXL 2PYEA 3JUYA 2R9HC 3U7AA 2JJVA 3RUGA 3KWWA 4IRSA 3BSZH 3SDCB 3UMTA 1A6WL 2AV7A 1RZ8B 1E4KC 5C0EB 2VLRE 4MXVE 1JI2A 3ME0A 5HYEA 1FSKB 3EJZC 3QG7L 3WDJA 2YRLA 3GO1H 1Q8MA 1MCJA 5KBNC 4CMMA 4LP4A 3B83A 3W11C 3ARZA 3WUWB 5EC2B 4NQED 1R5IA 4YH6A 1FL3B 1M6OB 4XMPH 3TT1L 2VDRH 4C4KO 3MV8E 5JW3H 1HEZB 3UTTA 2GKIA 1IFHL 2QKIB 4MJIE 3ARSA 5DRXA 3DHJA 2FEDD 4JFOA 3DVGB 4NM4H 4TRPH 3UTPD 1F4YH 4FQJH 4ZUWA 2NR6D 3QUXD 3MRBA 2ARJQ 2O5ZH 3L3HA 2E5EA 4FTVB 2BVOB 4PLJD 3ZKMC 5HYFA 3O6FB 1PY9A 2D7OA 2ADJB 4OBRA 3EW3B 5D6CB 3H0TA 1J1PH 3DMMA 2F15A 2Q20A 5HDOA 3RRQA 4LCCC 4YWGL 3QB7C 1A6PA 1SEBB 2X1PA 2X89D 4PRNA 2ZG1A 2D7TH 4JQIL 2DQEH 3LEVH 4HKJB 3S35L 5CEZE 2VLLA 5E6YA 2VKXA 4LEXL 4MXWH 1ZV5A 1CFNA 1QYGL 3SE4C 3IXAA 1JGLH 4ZQKA 1TCMA 1QLRB 2UY6A 1AXTH 4XPGL 3HR5A 2F5AL 4R3SA 4JLRA 2QQKL 3E6FA 5GRUL 5JUEL 1LDSA 3LPFA 1YYML 3HAEH 3DO3A 1UB6A 5C2UB 4UINH 4QRPE 5C6TH 3MRDB 5D7IE 2HTKC 1BD2D 2E7MA 5D5MA 5IJKA 4KV5E 1T0MA 3CFCH 3NFPA 1XF2A 5AAWA 3FRUA 3OAUL 2BDNL 4HF5H 1F4XH 1R5WB 1IMHC 4U1HB 3RX8A 4NKDA 4LLWB 1LEIB 2EDYA 4G9DB 4N8VA 4F7MA 2VQ1B 5IEHB 4XNUL 2VDLH 1S5IL 2W0LA 2ITCB 1FCCA 5MEPB 3EDKA 1EAPA 1A6TB 1JYVA 1RJCA 3MUGA 2DKUA 2ZZUT 3C60C 1P5UA 5A3ID 1ZVYA 1FAKT 4UMGA 1YYLL 2ZOKA 4WGWB 2FX7L 3GKWH 3VXUD 5IQ7H 2W59A 5HI3D 4PJ9A 4G9FE 1TJIH 2E7HA 3FRPA 3MBXH 5E8PA 1YQVL 3MNZA 4L8BB 6CGTA 5T3XE 4NFBA 2IMNA 5KS9A 4HGMA 4GS7C 1QG3A 1A6WH 3EJYD 1CK0H 3SDAD 3SKNA 5SWZE 5B8CA 1V3LA 5EDXA 3C5ZC 2DIAA 3QG7H 2YRZA 4YQXH 4W70A 3FOMB 1OAKL 4BFGA 3U9PL 4J3XA 3HRZA 4DJMA 4H88H 3TT1H 2PETA 5HJ3B 1ZT4B 3FB6A 1EJ6A 2RCSL 3QWOA 3EO1A 5CINL 3UTOA 3GBML 3WNNA 1IFHH 1X3DA 4YE4L 1MQ8A 2O61B 1CGTA 3QQ9C 1TNNA 4OUUB 1HNFA 5JOPD 4I5BB 4MX7A 5FGSA 4DZBA 4MA3A 3CH1B 5HHVL 4PJEF 2FRGP 1AGCA 4HG4K 4OIIL 5H35B 5J1AB 1RJLB 4L4VE 4ZUSB 3ZTNL 2VR5A 2FR4A 4YWGH 3OJ2C 3LS4H 3GMQB 3RWIA 1UJTA 4JQIH 1B0RA 2GTZA 3S35H 3KDMA 1IKFL 3L7FB 3JTTA 3TA3C 1IKNA 4LEXH 2HLFD 3G6AA 4MA1C 1QYGH 2IANA 4ETQB 2GITB 3D39D 3QHTC 3MOQA 1TZIA 2G2RA 5JHDE 2A9MH 5GRUH 3ARUA 4MJ6B 1YYMH 5CP3A 5FGCB 1NCWH 4D2NA 1BZ9B 4PV9A 3WFCL 2E7CA 5IHZA 5J3HC 1CQYA 5MHSD 2BDNH 3IKCA 1KSRA 1BOYA 4GBXD 5FHAH 4NFCA 4O00A 4XNUH 1LDPL 5IMMB 3U0WL 1HE7A 3QEQD 2QJDA 4G8FA 5JDJA 4RFEB 5EBLA 5F7DA 3V6FA 3ULUC 2AXFB 3RVUC 4X7SL 1YYLH 3TJHD 1U3HC 4QEGA 5GGTA 5C70A 1TPXB 4ZMAT 1P7HL 5I71C 3ROOB 1L0XA 4KZDH 3FFCE 3HZVB 1CG9B 1MLBA 4L29A 2HVKA 4YHZL 1YQVH 3UC0L 4M00A 4OV5A 3OB0K 4DQOL 5ITFA 1JNLH 2Y9RT 2RAMA 2R1WB 4G6KL 2V2TA 2IBGA 5ALBL 2J1KA 4XXDA 4E42A 4KVNL 3S5LA 4HWEL 5FYKH 3CSYA 3ROLB 5E2JA 3L3KA 4R7NA 4LVHB 3EJJX 3GMLB 3M1BA 4Q97A 5A2FA 1PKQB 3IJHA 3IF1A 4MS8C 5DYOA 3BD5A 2D9QB 3PGDB 5IVXA 3ULUL 2ATPA 1BAFL 5CINH 3NN8B 1FVEB 1D5BB 5E6ZA 1UGNA 5DJZA 1LWRA 4HK3N 3NFSL 3PDDA 4Y5XB 2E9JA 1N8ZB 1WIUA 4YE4H 5D7LA 3BPOB 3CXDL 4U0RB 4EI5B 3UPAA 4H1LA 4X4ME 3DECA 3P4NB 3H3KA 1T20A 4E41D 4KJYA 2A73A 5HHVH 3B9DA 1DQDH 4OZHB 2NY1B 2VDNL 4OIIH 4KK9D 5BOZG 1S78C 4OAWB 4NBXB 3ZTNH 2YD1A 3S4SA 3BVNA 1ZT1B 3ZDXE 3GMRB 1NPUA 1FFQA 4K7PY 4ZOCA 2Z35B 1FV1B 1NKRA 4K9EC 4OCMC 1T5WA 4MSWA 1TETH 1IKFH 3R0MA 5GISL 1E4WH 1NFKA 4S1DD 1NMBH 4O4YL 3C6LA 3VXMA 3V4UH 2DQTH 1BQHB 3H9ZA 2VZ1A 5I76B 1A7OL 3GSOB 1W72B 2CIKA 5JDSA 1OCWL 3MROA 2WBJB 3DVNA 7FABL 4MNGE 1XGTA 1XFPA 4YDVA 2HKHL 1HHKB 3RVXC 1K2DB 3OG4B 3WFCH 5DJDB 5FEBA 3PGFL 4HC1A 1QLFB 2AJYL 3KPSE 4K9EL 4P2RA 3KYAA 4X9GA 4PUBL 3VFVB 5IEKB 4Y4KD 1I9IL 4LNRA 1LDPH 4L8SA 1CICC 4FHBD 1T2JA 3U0WH 1DQQA 1NJ9B 3LDBB 4NOBA 4RAUA 1SJXA 2AGJL 4LVOC 2BNRA 3LD8C 5ID0A 3D69A 1NEUA 3SKMA 4X7SH 2GHWB 5C2BL 5T1DL 1JGDB 1C16B 4HQQL 3RWHB 3F7YA 1F11B 5E8NA