1FI8C

Rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
79
structure length
78
Chain Sequence
PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCLHRLGGKLENKTLEGWGYDYYVFDKVSSPIEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NATURAL KILLER CELL PROTEASE 1
publication title The structure of the pro-apoptotic protease granzyme B reveals the molecular determinants of its specificity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 2
structure length 78
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1fi8C00
1EZUA 1AZZC 1XXFC 1SLWA 1ECZA 1ID5I 1N8OE 1IFGA 1P0SE 2Y6TE 1SLUA 4NIYE 1FI8C 1SLVA 4IW4C 1EZSA 1ECYA 1XX9C 1XXDC 1SLXA
chains in the Genus database with same CATH superfamily
2ZKHL 3CFCH 4QTIH 1RUQL 3UBFA 3PGFL 4Y4KD 2R29L 2R2EB 2X6UA 3VSQA 2ZOLA 1L9MA 1A9VA 2X4UA 2A6KA 2C9VA 2XWBB 4HKXB 4M62H 3ZVVA 3ZKXC 3D85D 3GHBH 4TOYL 1TVBB 5TE4H 1XR8A 2OMXA 4L0PB 1Q1JL 4X4KA 5IBLD 2BINA 2MIZA 1A7RH 3EGSA 3ULUH 2GITA 3SE6A 1ECYA 4LP4A 2R2BA 4ODSH 4GJTB 1B4LA 3BQUB 2IWEA 4DPAX 3W0WE 1RUPH 4QTIL 3GZKA 3V4UH 4WI3A 4X9YA 1IM9D 2QPDB 5ECJE 1AGFA 4GKSA 3QWOA 3V4VH 3K0WA 3U0PB 2FBOJ 4GT0A 1W16A 2CWRA 1A8ZA 2YBRB 2D7QA 4M62L 3GHBL 5TE4L 4AK1A 5FO7B 4W9LC 5D96B 3VFRA 1HK6A 1QSEE 1MZYA 3ULUL 4U0QB 3L4WA 1HDMA 4ODSL 5CP7B 1OLLA 5ALCL 4CMHC 1FFNB 4FFVC 3QQ3A 4JFDB 1RUPL 3AS1A 2EZ0C 2YSSA 4Y9FA 5F7WC 2K3HA 1L7TL 4R0LC 1DEDA 3KW7A 5TFSH 3V4UL 4PJ8C 3KR3H 1J1PH 1P69B 3C60B 1ZDSA 3F7YB 3V4VL 1UKQA 4OAWA 4N2OA 3TEXA 2Z64C 3VDCA 2NRDA 2YGVA 5KOMC 2R23A 3JTTB 3VGHA 4YBQC 5IF0A 4DAGH 3CSGA 3BRDA 5F3HA 1SRDA 2WVVA 2ZX9A 5GZND 1KENH 4XR8C 5DZAA 3PWNB 3HS0A 1NFDA 4OCLC 4OJYA 5BRZB 5MEND 3HAEG 1EERB 1LMIA 2X4RB 4BFKA 2C3XA 3DX7A 3LEXB 5EOTB 4PIBA 5TFSL 4DP0X 1MJ8H 4ETYA 3FT9A 4GO6B 3KR3L 4XODA 1J1PL 1BOYA 3Q1EA 3ARUA 4O02A 4Z5RB 3ZT7A 3C09C 3X13B 4AEIH 3EGDA 3PWUA 5CU5A 1U41A 3RTQD 2YC1A 2NY1B 1MCRA 2JELH 5I30H 1L0XA 5T3ZD 2CM5A 3TPUA 4R2GC 5C07B 4A2DA 1KB5B 4OFYA 4R7LA 2Z7WA 1KENL 4PWHA 2B59B 1NTDA 3CG8A 2JXMB 1T1WA 2VKWA 3HUJF 3D39A 4EUPG 4PRHE 2FD6L 3MLYH 1W0VA 1XF4B 2EDXA 2XTJC 3S36H 2WZ6A 3SPVA 4HUMB 4AEIL 3S4SB 5ACLA 3VXPA 5IMMB 1ZK9A 3NN8B 3RL2A 2JELL 5I30L 1PLBA 1T5WA 3LNGA 1BDYA 4Y1TA 2VLJD 5DRNA 1TVDA 3HR6A 5IJVA 4GKOA 4OGZA 4P57B 4KZCA 3FBKA 3LN4B 3TYGH 1TYJA 3MZTA 3OWRA 1GJIA 1BZ9A 3CCHB 3IJHB 3WDHA 4LCWA 3GZPA 4N0UB 4I0PD 4GI9A 2CGZA 5I1AA 3UH8A 2HFEA 1CLYL 1HAUA 3DJRA 3QFDB 4ZSOE 5F96H 1WWBX 4FP8L 3MRQB 3ZO0A 4PJ7A 4I9WE 5BOPA 3V0WH 4KMTH 2V9RA 2VDPH 2VZ1A 2GCYB 5HGDA 1CDJA 4JEGB 2CO1A 3ABGA 2EH7H 1OP5H 1GIGH 5AVUB 1ZHKA 3TYGL 2VZSA 3TNNB 2ZXAA 1AR1B 3FQ1A 3O3UN 4EXKA 3WN6A 1ZWIA 3LKOA 3PHSA 4QRTB 3VH8B 1ZLWK 4JFXB 2QBWA 1AO7A 3DRQB 1A64A 2OV0A 2UXFA 5F96L 2XBDA 3DGCR 4NZDA 4I13B 4L4VD 1P7KB 4QCIA 2OW6A 4QRPE 3V0WL 2NNAB 4FQHB 4KMTL 4QLRA 4MDIA 4W4NA 4G7QB 4F93B 1X5GA 2WWMD 2VDPL 3RNQB 3ATFA 2EECA 5C0DB 3STLB 2PPDA 4PJ5D 3V6OE 3KH3A 3ZQ9A 4NQDB 3EDFA 4ZS7L 2EH7L 2BH0A 1F1DA 1IL1B 2AEQH 1HHIA 2PWHA 5JOPE 3IPEA 1RZJC 4HEME 4X5XA 2EDYA 1N6QH 3UCRA 3QAZB 4LKXA 3CUPA 3EOAB 3B5HA 5DHVH 1TQTA 1NGZB 3FB8A 5HHQB 4LPWA 4YMPA 3LRSB 2WBJD 1S9VB 2Y2TA 3BYTA 3T0XA 3L3OC 3UTSB 1K4DB 4NQUA 4Y9GA 4V33A 2AEOA 3H0TB 1HCYA 3QDJD 2ZX6A 3RWJA 3ML9A 5B8CB 3ZL4H 4KI5C 2AEQL 4KTEL 4S1DC 4KK9D 1M1SA 2I24N 4WO4B 4RIRA 4LLQA 4MJID 3HG1E 5IB3A 1GGYA 4PJFA 3UP6A 2G60H 4CSTA 1VA9A 1N6QL 2N3JA 1KCLA 3MRKB 1I7UB 3DX2A 3TBYB 1E8ZA 1NCTA 1YUHA 4A04A 2HXAA 3SDAB 4X5WB 1AHWA 3L3DB 4HKBB 2ED8A 1F6AB 3ZIMA 2YEZA 3MBEC 2IBZX 2ZCZA 5HHOA 1QFPA 1E2VA 1JK8A 1XF1A 2Z8WC 1LQSR 3NIDB 3ZHKA 3GJFB 2OMYA 4YX2H 5EEZA 2AQPA 2C1PB 2FIRT 2KMWA 3GRWH 4FZEH 3AMLA 4JB9L 3CNKA 2PABA 1QWHA 1WZMA 3HE7D 5HGAA 1E40A 1QWUA 4HIIB 3UCQA 4PJEA 1PW3A 1U8MA 1PU0A 4PGZA 2RJMA 4J2XA 3WMPA 3VWJC 1J5OH 3LNDA 4WU5A 1HJCA 5JW3H 1MJJA 4H1LB 1U3HD 1WGVA 3L9EA 1IBGL 3KPNB 4NBXB 3PV6B 2CHDA 3JWOC 5DJCB 3CVIL 1B0GB 4MLIA 3H9YA 4YX2L 4K94H 3L7EB 2ITEA 1SYVA 3GRWL 4FZEL 4C56B 4L3AA 2H8PB 1AGDB 1KNOB 3MROA 2I07B 1ZSDB 1W6WA 1FL3A 5F1IA 3EUDA 4KY2A 1OB1B 2P7TA 1KIPB 5CR8A 5E6ZA 3QIUD 3H7LA 4JQXA 3WHXA 5KVEH 1TQWA 3C6LC 2PPAA 3RPKA 3B7TA 3BGAA 1J5OL 2VNCA 2BP0A 5JW3L 2Z4QB 3T3PB 1WS7A 2C9UA 3WOVA 4NPJA 4M5TA 2XVBA 1QAWA 1TVHA 1WBXB 2R1WB 4K94L 2XSKA 4PJIA 1KYOJ 1QVOB 5C0AE 3QZBA 4WWKA 4DHLA 5MENE 1X6NA 4HLZG 3W81A 5JYLA 3KYOB 5TH2B 3V0VA 5CO1A 5EOCH 5EIIG 2V7NA 1UA6H 5D7LD 1MRCH 2ZG1A 1PX3A 3NJNA 2OX5A 3KWWA 2FT8A 1TOXA 5KYWB 2IPUK 4ZYKA 4N8VB 1D9KB 5D1QB 5FX3A 3SHSA 3S2CA 4DGIH 4Y19A 5EIQA 2ZD0A 4P5KA 1BEYL 1QPXA 1I7ZA 3QIWB 1KYDA 3VGAB 5FKAA 1EPFA 3SGJC 1Y18B 3O4LD 3T8VA 3M17B 4Q2ZB 3UACA 4OZHA 3SCMC 1ZHNB 2P8LA 4QHNB 3EAKA 1OAKH 4UANA 5EOCL 4BHUI 2ICCA 1UA6L 1MRCL 1O5PA 3X2QB 4HWZB 2EIKB 1C8PA 2V9TA 4FFYA 4KX8A 3PHQB 3SKNB 4ELMF 1LDSA 1CD1A 1QSFB 1EZLA 5C0CD 1IFGA 2C4FU 4DGIL 4BE6A 2VLJE 1ADQL 1FNGA 1LM8V 5FAAA 3GSNB 3L5WA 1AIFB 4HUWB 1KEMH 3C5JA 4F8PA 3II1A 4U0RB 3H3BC 4E9QA 1IV8A 4KNTA 1ETA1 1CTNA 3FCTA 1E5AA 1BXVA 5HHVH 4L3EE 4XHJD 4D7PA 1JPEA 3MRLA 2FYYB 3C6EA 1OAKL 4FXGC 4JREB 1K3ZA 2UY6B 1SEBB 3NP4A 3T6XA 1LWRA 3V9FA 3CFNA 1DYZA 5EZJA 2XG5B 1NMCC 3I3DA 2ICES 4W4OC 4GINA 4U6YB 5EU4A 3APDA 4MBOA 4BH8A 2XJLA 4NPYA 3PIQA 1WFTA 1ORSB 2WPGA 3I9IA 2J44A 5FYJD 1OZUA 3QUZD 1WG3A 5DS8B 1G43A 4PPTA 1KEML 2YXWA 2UXGA 3E6HB 5F88A 1XBDA 2N59A 2RCSH 3QJFB 5CD5D 2Z35A 3PP4H 2VTFA 3L13A 5HD8C 2HG5A 5HHVL 2K3TA 3ECVA 4NQXB 3TF7C 4LKCB 2HVKA 5JW4M 3FCSB 1E3FA 2ATAA 3IPFA 4JFFE 2R7EB 3HE6C 3BO8A 3UAAA 2XRAL 3HS9A 3QRLA 4RWHA 5E1IA 5SWSA 5BS0D 2EIDA 4NYLA 2BVOB 3ZDXF 3FU7B 5GS1B 4PS8A 3KXFB 3TEZA 3GM0A 1A21A 4JVWA 4GQQA 4M7KH 1H6TA 2RCSL 3HMXH 1UEYA 3PP4L 3O8XD 5LGKA 4JFZH 5DD6B 1QUNB 1EFQA 5EU7C 5J0BA 1U3ZA 2PW1A 1NFIA 3K6SA 4GFTB 5I6MA 4KXBA 4YNYA 3DPBB 2Y69B 5E2JA 3MUGA 3VXRD 3IMBA 1FVDA 4XHQA 1JJUA 4PWEA 1M71B 1S9WA 3IAQA 5H2BA 3V0GA 4XC3H 4JAMA 4DGYH 3VX1A 1H15A 3JVFC 1AI1H 2D4FA 2OL3B 4I18A 3QDJE 3VUAA 3O4OC 3V6BR 4M7KL 4XN5A 3BH8A 3HMXL 2GK0A 4JUTA 3K7UA 3WLBB 1ROCA 4JFZL 1X5MA 3PHOA 1CICD 4U4IA 2NNXA 1TTRA 2WTPA 2ZWZA 4TV3A 1BFSA 4R7DA 4EN3C 4S2SB 4PI0A 1HHGA 1EZUA 3RWCB 3FO2B 3QG6A 3SY0B 4Z7OF 2FR4B 3ARFA 1TJXA 1A1MB 3O6FC 5C0GA 4G8GB 1AKPA 4XC3L 3SE9H 1LP9F 1NAKH 4DGYL 4PRAA 1AI1L 3D25B 1YA5A 3MLZH 2ICWB 3L1GA 1TNNA 4XTRC 4EKJA 3SDDC 2VIRA 2Y3NA 3RUGB 1XIWC 5ESQB 4I3SL 2PCFB 4XMKH 2H6PB 3WEXA 4B9YA 3TURA 2ENSA 2O6PA 2NDFA 4ZX4A 1I3VA 3DGGA 3NCFB 3AREA 1OTSD 4BCXA 1JHLH 4NCC1 4XXCA 5SWZA 5T1LA 5ABDE 5L7XL 1BZ8A 2QV2A 1A3LL 3PP3K 3SDCB 4QD2E 3SE9L 2GJ6B 1NAKL 3WN5B 3IXTB 2EE0A 3MLZL 4Z7VF 1R46A 3EFFA 3L3IA 3TIEB 3DHPA 5I24A 2DQDH 3RIAF 3Q9PA 4XMKL 1M42A 1SOKA 1SUHA 1EV2E 3MREA 1NCOA 5J06A 2BSRA 5ETUA 2QR0A 2NR6D 4M8UA 2FECI 3U83A 3IRCA 1V3MA 1JHLL 3PS6A 4KXCA 2Q76B 2EICA 5IVNA 4L8SB 4IU2B 3E2HC 4A6YH 4MDRA 3HN5A 2PO6C 4HBCH 4I89A 3CMOH 4W9EC 3ZPDA 4KWUA 3W3BA 1CLZH 3FU9A 1MFAH 3EJCA 2AERT 3QISA 3MVSA 2CR3A 2DQDL 2AEWA 2ZKMX 4AT6A 1KBGH 1H6FA 4PRPA 4TVPH 1UH3A 3T71A 2FLRT 3PAVA 5HYEA 5I2IA 2XNAB 3PPEA 4KXZI 1F18A 1WITA 3RIFK 1NCAH 3RWHA 1RZJH 3DGDA 4AITA 3LXCA 2OS7A 3TTYA 4A6YL 4JDEA 1VFOA 3VXOB 4HBCL 2FO4B 2F1AA 5KG9B 2V4LA 4E5XA 1MXGA 3ZE2F 5AAWA 1CLZL 1JZIA 1MFAL 4HUVA 3O4LE 1KBGL 4WFHD 4I88A 2VLLB 3AU0A 4LLYB 1U8QB 4TVPL 1WWWX 3LH9A 1H6EA 3U7YH 1OK8A 3AS0A 1NCAL 3SDXB 2ADJB 2FWOB 4PRPB 1RZJL 2ICWI 4KJWD 4EDXB 2EDQA 1F3RB 3T0DA 1NEZB 2PYEE 1HQ4A 2V2WA 3F6LA 3H6AA 4G6MH 3DVGA 3R18A 3UJJH 1ND0B 1NLBH 3MRDB 1N3NA 4R7VA 1Y7VA 3SEPA 2UYLB 4FGMA 4ONHB 6FABH 1SHXA 3BD4A 1U0QA 4I3RH 5DJZB 4GPVA 4Q6YA 4JQIH 1CFQA 3B3IB 1UOKA 4GW4B 4IKIA 3DTUB 3RGVD 3A4AA 3HZKA 1F6FB 1UXWA 1ET8A 1KBKA 5E8NB 2BERA 4Z0XB 3S3BB 3U7YL 1H8LA 2BNQD 4NO2B 3LPWA 5CZVL 1AZZC 4NFBA 2HUEA 2D0FA 2VMCA 3TA4D 3ZDWA 1XGTA 5FYJE 4G6ML 4BFFA 3UJJL 2ZOLB 1NLBL 2JCCA 4B5ZA 4JZJC 1T20B 2GBTA 2X4UB 4LMQI 2A6KB 2WVSA 5C0JA 3JWOH 1T66D 1G7JA 4P59H 6FABL 4I3RL 3HC0A 3JVGC 5LBSH 2EILB 4JQIL 1XR8B 2OMXB 1FLTX 4RMBA 1EK3A 4LFHD 3H2WA 4ZW7A 4P2QD 5T5FH 2AAAA 1EANA 3EGSB 2ZP9A 1H3UA 2GITB 2IH1A 2R2BB 2JJSC 3ZDZB 4JM2A 3KVPA 3O81A 3WHE1 3QUMH 1T83A 2WAQA 4WV1C 2F6AA 2LTQC 3F5WA 1OEZW 1AGFB 4GKSB 5DVOA 5AYTA 2HTLC 3QWOB 2WQRA 3FQWA 5C0BA 3NOIA 3J7HA 1JF1A 1S5IH 1U8LA 3JWOL 2ZXQA 4P59L 2FBJH 4BM7A 1SN2A 5DYFA 3WTWA 4MD0A 5LBSL 5G4MA 2UUDK 3A5VA 5CCKL 1ID2A 5DFVC 3VFRB 4UDUA 5T5FL 4FQXC 1WK0A 1A8JH 3FTVA 3QPKA 1SDAB 1E28A 2VLKA 1HDMB 1IC4H 3UBXA 3VG9B 1YC8A 2LU3A 1CYXA 1NOFA 3NSDA 3QQ3B 3QUML 4JJ5A 5I8EB 2YSSB 3NIFB 4IRZA 4AZ8A 4HC1H 3LZPA 4RCAA 1SY6H 1R5WA 1UGKA 5DJDA 5I5IA 2H1XA 1UURA 2CNZA 2VDOL 4IOIA 4KJPC 1NM9A 4OAWB 1S5IL 4LGPB 3W9EA 5H37G 2C9PA 2ZXDA 2R23B 3GKWH 4HQQH 1WIPA 5IF0B 5F3HB 4QOKA 3N9GH 2WVVB 4U6XA 1IC4L 3HS0B 1NFDB 4GAGH 3TWCH 4S1QL 3RA7H 2YAPA 4B3EA 4I3GA 2R0WH 1BD2D 1KBBA 2EDMA 2LVEA 3DX7B 1BQHG 1I9RH 3CVDA 3LIZA 4L5FH 5CEYA 4HC1L 1KJ3H 4YLBA 3JUYA 3S96A 1SY6L 2Y6SC 4JRYD 3BLKA 4O02B 1LO2H 4J3UA 1AH1A 5KN5B 1CD9B 3EGDB 3PWUB 4RRPG 35C8H 5KSAD 2YC1B 3D08A 3IXAA 1I1FA 1MI5E 4Q52A 5CSGA 3TPUB 4DEPB 3GKWL 4HQQL 4GUOA 3WD5H 4HOZA 1F8TL 3IJYA 1X5AA 1UCBH 3N9GL 4UZSA 5B7EA 3TWCL 1Y6MR 3FH7A 5L2JA 1OAZH 2AK4D 3RA7L 3KWXA 1T1WB 4B9FA 1E8YA 1HHHA 3EO9H 3D39B 5I0YA 2R0WL 2ZAHA 2DYRB 1I9RL 1KJ3L 3BUBA 1OALA 1FV1A 1DVUA 1OE3A 3SPVB 3W0WA 1LO2L 1XD0A 4ELKA 3VXPB 1BZQK 1L4IA 35C8L 1ZLVH 3ZOAA 3D07A 3RL2B 4BELD 3CHOA 2KUTA 1H3XA 1T5WB 1TZ8A 2DMBA 3C60C 1DL7L 4LCCA 1GKEA 5DRNB 3NZSA 5IJVB 3WD5L 5TDOA 1J86A 2WUCL 3F3HA 4HIXH 1KPUA 4U7MA 1CGXA 2P26A 4D0CA 2NLJA 1BZ9B 1OAZL 4G6AC 4PY8I 1SVZA 2X5PA 2UWEE 1DJYA 4LCWB 2JE8A 3TZVA 4J3SA 4WLCA 1T1YA 5I1AB 2HFEB 2HYMA 3JTBA 4LT7A 1G9NL 1ZIAA 3F65A 1DJXA 2ICEA 4N2KA 5T3XD 4PJ7B 5JXED 1UA7A 1WH0A 4H8WC 4KO7A 1CYWA 3TBWA 4G72B 2ZUTA 5HGDB 1G4RA 1OKEA 3N40F 2NY1C 1UOVA 5MEOA 2XIDA 2Y1VA 4HIXL 5PAZA 3S6CA 3SODB 1S2EA 1ZHKB 1LDPH 2FIKA 1I9EA 4DN3L 3U4EA 1ZWIB 3QJSB 5EMYA 1GOFA 2CRZA 1AO7B 1QEWA 4MJ5A 2DRUA 4B9GA 3N42F 2DYPD 4B96A 2UV3A 2OJZL 4QCIB 1PY9A 5SX4I 3FC8A 4FE9A 2YKLH 3RG1C 4IMKA 3CHXA 2VABA 4LSQH 4MDIB 5DK0A 4RX4D 3VM7A 4H25A 4HUUA 4L3CA 3HTLX 4XNYH 4WFHE 1XDTT 2I25N 4B9JA 3FHEA 1HZKA 2VDNB 5I8OH 3QXVA 1ZGLP 4JPKL 1LDPL 1QHQA 1MCWW 4Q6IA 5FM5M 3O9WD 1HHIB 3STBA 3CN2A 4BCYA 3TFBA 3OLDA 2J20A 5IB2A 4U1SA 4Z3FA 3ROOA 5C0IA 1YDPA 4PRHA 3RVWD 1OARH 5A3ID 2YKLL 5FO8A 4LKXB 2YN3A 3D4ZA 4IOFC 2K6WA 3CUPB 2H5UA 4UV7H 3CZJA 4LSQL 3FB8B 4TLUA 4HYTB 5J6SA 1E9OA 4U4BA 2G0LA 4KUZH 5CU9A 4MASA 3UTQA 1BZ7A 3RWJB 5I8OL 3ABMB 4KROD 2OZ4H 2BNQE 4JO1H 4KAQH 5C6TH 4L8DA 4KKBD 4RIRB 1XCXA 4LZKA 1AR1C 1JV5A 4IRJC 3VA2C 5IB3B 2G2RA 2XPYA 3WXWH 4PJFB 1KIRA 4FKEA 2P42B 4X8CA 1OARL 1JVKA 3K6OA 4YBHA 3KJ6H 4CGUB 1GPOH 5D2NE 5LNGA 2XVGA 1YUHB 4DO6A 3U1QA 4BXSV 2KT6A 5EU6A 1AHWB 2YEZB 4K3GA 4P99A 1BQLL 4KUZL 4P2QE 5HHOB 4OFVA 1JK8B 3VVWA 2OMYB 3VRLE 2OZ4L 2I69A 1SXCA 2FTAA 4KAQL 3ZSSA 4Y4HD 2VZOA 5C6TL 5HGAB 3UL4A 1YPZA 3DDFA 1TZGH 4PJEB 4L37A 2EKSA 2E75C 1ZOXA 1U8MB 2YQ2A 2QTVA 2NXZB 3U30C 2AXFA 2L8AA 1GPOL 4WU5B 1MJJB 1MN4A 3M8OL 1U21A 3GSUA 5GQBA 3KJ4C 1FFPA 2BSEA 2XQYA 3WFEH 1AQ8A 3ET9F 4YC2B 2ADGA 1XCQA 1I7TA 2Z34A 4I5BA 3PWLA 4YHKH 1T7WA 1DTUA 3P40A 3MROB 1AOZA 3OKKA 4K71B 5GGVY 1FL3B 5F1IB 1NC4D 5I5MA 5CXPA 2P7TB 2BY3A 3KG5A 1JNHA 5AW2B 5DVPA 3WHXB 4KFMA 5CILH 4IKLA 3FTYA 3QO0A 3WO3B 1UXMA 3UTTA 2BP0B 2CO4A 3H8NA 2MCG1 2ZWLT 4AJWA 4DZ8A 1X44A 2IEPA 2IDUA 3B37A 4Y2LA 5B4MD 3VI4E 3D2UA 3WFEL 5C70A 1KELH 1X6LA 3IJSA 3H9ZA 1TVHB 2W88A 3OJ2C 2D3NA 5SX5H 4FMKA 4HHWA 5IQMA 4FFVD 2XJKA 4PJIB 2HP4A 2WXFA 4PD4K 1JK9A 1GMEA 2ID5A 4WWKB 4YHKL 1LLAA 4DP4X 1LEIA 4L29A 3H3PH 4TVUA 3WL9B 1UOLA 2X44D 3V0VB 1I1AD 4NQTA 5D1ZD 1MDTA 2V7NB 2VJ8A 1U8IA 4S1RH 5I6OA 1MWAA 4JRYE 2OX5B 3KWWB 5CILL 1BX2A 4ZFGH 4XVSH 4Y4KA 2BP3A 4F7TA 3NJIA 4R9HA 4YBQD 4Y19B 3L5HA 4Y5XA 3B5TA 3TVMA 2P8MA 4P5KB 4YR6A 3T4YA 1KELL 5I73B 2BRRH 4K23H 3BC9A 3D85A 4MA1B 5CN3A 5FKAB 1KTLA 4OZFA 3ULUF 4UV4H 2AK4E 5J1TC 4QRSA 3OZ9H 3H3PL 4OZHB 2P8LB 3UTPD 3KCWA 3AG3B 4TUJA 4AQZA 2Y1AA 1OP5K 4YHYC 4OM0L 3S97C 4S1RL 5CINH 3R06A 3BPOC 4BUHA 2DW5A 3KDMA 3KM1A 2FL5A 2XA8L 2DD8H 1ZE3C 3V5DA 3OXRA 1IM9A 4KJQC 4RWYH 4XVSL 1CD1B 5CEZD 4IIQC 4ES8A 5KSBE 3S34H 2CLZA 4Z7NE 1YYMH 2P3YA 1B2YA 3LEVH 4GI8A 2OXGB 1FNGB 1BM3H 3L5WB 1MY7A 3IKCA 3K8LA 3C5JB 3NCEB 3P0VH 3PAYA 4RDQG 2BRRL 4K23L 2VW6A 1G7IA 1F11A 4ONOA 4UV4L 3FCTB 3UZEC 2JTDA 3OZ9L 2PTTA 4B9CA 3FT2A 4H0HB 3MRLB 3QJTB 2C5DC 5FLVA 2I9TA 5EZJB 1H3TA 1W6LA 3QO1A 1SHSA 1CURA 5ECGA 2DD8L 3QARA 5EU4B 5T3XE 2Y7OA 4BH8B 3EXJA 1PX8A 3QQ9C 3PIQB 2P47B 1TLMA 4NPYB 3S34L 3WTVA 3IDIA 2B20A 3LEVL 3IGLA 1MXDA 4HAKA 1BM3L 3P0VL 5D1QC 1VEPA 3APCA 3O6ML 5F88B 4NXSA 2WV3A 3CQPA 2Z35B 2AXJA 5AOIA 3ZE0E 1HZHH 1X5LA 1DFXA 2HG5B 3QIWC 4GKZA 5GZNA 4XVJH 2HVKB 2JJUA 5MENA 3AGWA 4MYWB 1T21A 1C1EH 5ANME 3UAFA 3BO8B 1A1OB 1E43A 4WAFA 5JHLL 5SWSB 3I3EA 4NYLB 4UOW0 5KANG 4XNQA 4J3OG 5IBTH 3RBGA 3RTQA 5GGSY 4GMSH 3WTYA 3FQNA 4NQCD 2CJSA 1HZLA 4XGZA 1ZV9A 1M7XA 2E59A 2CALA 1KWKA 4XVJL 2PW1B 1NFIB 3K6SB 3ML8A 3GLDA 1YG9A 3HFFA 3T3MB 4Z8FH 3P2TA 1C1EL 3W82A 1Z9SA 4YNYB 5HHMD 1C5BH 4HG4J 2DQHL 3MUGB 1JYNA 4JREC 1DLHA 1CZ8H 1FVDB 2IH9A 3CDYA 1S9WB 3HI5H 4IBZA 5H2BB 4JAMB 2AVGA 4K4KA 1ANUA 5IBTL 1H15B 5LWYH 4GMSL 3EO0A 4I18B 5ITFA 1P9MA 1A7OH 2R0LH 4GYBA 2GI0A 3BH8B 4CKQA 1IIKA 1Z5YD 3CFQA 2GK0B 1UJ3A 1AGEA 3FK3A 2YPLA 1OM9A 3PHOB 4B50A 2LQRA 4AYDC 4R7DB 3WLWD 4N87A 4AJYV 1E8WA 4Z8FL 3U4BL 3QG6B 1EVTC 2WP3O 2YQBA 4LGSB 4XZUA 3V0HA 1JG9A 3ARFB 5EEYA 3WFCH 1UT2A 5C0GB 5BVPH 5LWYL 1F58L 4PRAB 4Z76A 1PZUB 2HLAA 3FUNA 3G08A 2R0LL 1A7OL 3VFOA 5F9AC 3P02A 4ZX3A 4S1DD 4ZI8A 2DJMA 4NC2B 2DI8A 2Q7YA 2VIRB 1P5VA 3KCPA 2P28B 2WYTA 1F3DH 3WEXB 1VESA 5J9PA 2D3JA 3CFUA 3FN9A 5IJKC 3DGGB 1OAQH 3AREB 5BUAA 4EJ1C 5B3SB 3QB7C 1FVCA 5CP3A 2DQCH 2EE2A 2JB6A 2ZNXA 5T1LB 2J88H 2R51A 3FTGA 2GUOA 1I3GH 5TE7H 4LL4A 2X0WA 2WN3A 4L4VA 5BVPL 3MBED 1IC0A 4H8WH 3AADB 4TTGA 3ZKQD 1PEWA 1JP5A 1EJFA 5CCHE 1VKXA 2J21A 3EFFB 3L3IB 4PJ5A 5D2LA 3JXAA 2GJPA 1VACA 4IS6A 4MNQD 2F15A 3HOGA 3MREB 4YL9A 4KGLA 2BSRB 4FZ8H 4JQVC 5ETUB 2QR0B 1OAQL 1RD6A 3F84A 2VR5A 2DQCL 5E08H 2J88L 5HDBF 4NJ9L 1I3GL 2NY3D 4OIIH 5TE7L 2DJSA 4AX3A 3ARBD 5I76A 5EEWA 4H8WL 4LNRA 3EFDH 4UT9A 2HVJA 3MYZA 5TGBB 4X7EC 5IVZA 4IBYA 2VUOA 4GSUA 1PEZA 4OGYH 1EEZA 2WBJA 3TH2T 1OAYL 4IQHA 3CZNA 4QKXB 1XZ0A 2Q3XA 3PYCA 3ZGHA 4MB1A 1DO5A 1R33A 3LRLA 3QDJA 2A77H 2TSAA 4AT6B 3QUYD 2WLKA 2UZPA 3OKNA 2YD5A 3A0OA 3TFKC 2QLVB 4FZ8L 3DJZA 2HX8A 2GHWB 5E0QA 5I2IB 1IGTA 4HV8A 4BWTA 3C5ZD 4MJIA 5D7KD 3VFSA 2GFBA 4BSWA 5BUPA 4KJYA 5E08L 1OAJA 4NLHA 4OIIL 3EYOB 3KS0H 2JJTC 3BWSA 4JPWH 2ZNWA 3NPSB 4E5XB 4YFLF 3RFZA 2YD1A 5K1VA 4ATWA 4OGYL 3RVXC 4HUVB 3SOTA 2G5UA 3D33A 1NANH 3VSTA 2EP6A 1EWHA 4TQHA 5FC9A 2A77L 2NY5L 4YHNA 2PWFA 1PZ2A 1CFNA 4N1CA 4X6CF 1ZT1A 4W6XB 4X7TA 1LEKA 2NYZA 3HE7A 3UBHA 2LLGA 2TRYA 4YDLC 2VN6A 5IHZB 3VD5A 5CEZE 2WUBH 1JPST 2Z1PA 3F7PC 3MC0A 3WIHA 2X9YA 1HQ4B 2V2WB 4JHWH 4QT5A 2F53E 4JPWL 3DVGB 1N3NB 4L8SC 2G0KA 1U3HA 5TE6H 1UD8A 2GTZA 3QJXA 4YSTA 3VD9A 1KF9B 5A16A 1CFQB 5T8IA 4PB9H 1CXEA 1URZA 4NNXA 3ZTCC 3HZKB 1UXWB 2XU9A 3QUXA 5AOMA 4L1HA 5H35A 3HG3A 5ICYA 3N41B 3OKLB 4YXHH 5E94A 4GRMA 4OLYH 4TSAH 3LSOA 5KBPA 2N01B 2WUBL 3EYFA 1TT6A 2B1OA 1JHTA 3QIUA 1DCLA 3FO1A 4AUYA 4JHWL 1XGTB 1FCGA 4C47A 2X9ZA 2JCCB 4UTBA 3T1FA 3SSGA 3EDEA 3N1PC 5C0JB 5DUJA 5TE6L 1G7JB 3A4EA 3MX0A 3HC0B 4WGWB 1RZPA 5C0NC 5T5NG 2EINB 4X8JA 2R27A 4HWBH 4AIOA 4NC0B 4B6ZA 5FCSH 4PB9L 3VFGH 2VXQH 2WLNA 3HUJB 4YXHL 4CSZA 4JM2B 4OLYL 2KH2B 4TSAL 5TD4A 2HT2D 5D7LA 4H2AA 3F5WB 5EB9A 2C9QA 2CJTA 1OCOB 5A40E 3FQWB 4PD4J 3B2PA 5C0BB 4NQCE 1JF1B 3Q48A 1MCOH 1U8LB 1JPGA 5HD8D 2ENQA 3JV6A 1UM5H 4MD0B 4OCYH 3VQ1C 4HWBL 5FV1L 3AG4B 4KGJA 5HSFA 2ZOWA 4UDUB 1UYWH 4POYA 3GBNH 5F1KC 3VFGL 2VXQL 2JKNA 4HU2A 1E28B 3HE6D 5DJXA 2VLKB 4YEFA 3JWNG 3UBXB 2E8ZA 1P5UA 1I85A 4Y8DC 5DC2A 5HHME 2W9LA 5KS9E 4JJ5B 2HTKC 2R39A 4AZ8B 2V5YA 3I9PA 1R5WB 1MNUH 3QGVA 5DJDB 2R69A 5GXBB 3H9SB 2CO6A 4IOIB 5C0CA 3TP4A 2VZUA 4XCFH 1MCOL 1WFIA 4K0OA 3W9EB 3F64A 4Y1SA 1UM5L 4H1LH 1IAIM 4OCYL 5CLZA 1UYWL 4QOKB 3ATDA 4Z7QF 4OLWH 3EKCA 4QHLA 3IDYB 1DHKA 4FKHA 4AVJA 2XWTA 4U6XB 3RVUC 1WFOA 1E4KA 3DIVA 4GRLC 2W92A 5CEYB 1BVOA 5KUKA 4XAWH 1GZPA 2OYLA 3ABKB 3S96B 3DX1A 4Y5YA 1KWGA 1XH3A 1MNUL 4YJZL 1ZDQA 3GT6A 1JGUH 3FUIA 4PWJA 5LGHH 1OANA 3IXAB 1ZANH 3QUZA 1I1FB 1H19A 1E6OL 2QSQA 3FHQA 2EEXA 2BNRD 2GIYA 1ZLDA 2HFGL 1FFRA 3IJYB 2NUPA 4OLWL 3VSVA 5L2KE 2VLMD 4C55A 1HHHB 1R17A 5AZEH 2APSA 4WEBL 4NUJA 3SGDI 3BAWA 4XAWL 1PG7H 3D0VA 2WLJA 1FV1B 5A2FA 3OV6A 1CDIA 5DWUH 3W0WB 1JGUL 5LGHL 4XTRD 4ELKB 2RH0A 3NEXA 5BS0A 4XP6H 5JHDD 4JKMA 1JF5A 5SWQA 1ZANL 1FCCA 1LILA 1BF5A 1DQTA 4LCCB 1X7TA 2VH5H 4MNQE 1ET7A 3HC3H 3VQ2C 5TDOB 4MCZB 1KPUB 4Y2OA 1E90A 3BMWA 3O8XA 4J8QA 4YHIA 2DIBA 2NLJB 5E6ID 1IKFH 2V2XA 4G8IA 5FYKH 4YXLH 3RHWK 1Q9KB 5JOEA 2QVMA 3MOBL 5AZEL 3TZVB 4I85A 5FUCC 1UHVA 3MRRA 4TN9A 4ZW8A 1T1YB 3IAGC 3ESPA 1FNAA 1PG7L 4MA7H 1WTLA 2XZAL 1O7DE 3CX2A 3P9LA 5DWUL 2ICEB 3B34A 3BVNA 3VXRA 4PJAE 4R7NA 4XP6L 4G43A 3TBWB 4B9IA 5KBNC 3UBXI 1D7CA 4LRIA 1AQHA 3BD3A 3DUSA 3KPOA 1TEYA 2B0SH 5MEOB 3VD2A 3CSPA 4ELME 2FIKB 1Z2KA 3QZWG 4YXLL 1IKFL 1MG3C 2F68X 5ICUA 1CICA 1K4CA 1IGJA 3U4EB 1A4AA 3C6SB 3UC2A 5D7KE 1IB5A 2YFNA 4MJ5B 1QEWB 1U30A 4UOQA 3BESR 1YNTA 4U2YA 4LK4A 3KYKH 1PS3A 2BOLA 3VO0A 4XB3A 3CLEH 4KK5D 2VABB 5DK0B 4H25B 4HUUB 4D94A 1CIDA 4L3CB 3HLKA 4K7PH 4GFXA 1E4XH 2B0SL 1VEMA 4C57C 2GY7B 5GS0D 3O2WH 1HE8A 2BVYA 2EUXA 3QYMA 3L08A 4Q6IB 5B1BB 2AF2A 3L5JA 1QFUL 4OJFH 4AQOA 2ZWSA 4KVNH 4UIMA 5IB2B 2WGNB 3N55A 3KYKL 4JFVA 4NZRH 4U1SB 5C0IB 1E0OB 2Q8AH 1YDPB 1T6VN 4FYRA 4PRHB 3ROOB 1PQZA 4N8PA 5FO8B 4A1RA 4K3DH 5HPMA 3BIKA 3NUKA 5CN1A 4PLKD 1E9OB 3FU3A 5J8OA 1W91A 2O6EA 2GVYA 1MELA 1BZ7B 1RXLA 32C2A 3O2WL 1B6DA 3UTQB 4Q6KA 1EEYA 4PJGF 3L8QA 2L7EA 5EOCJ 2DH3A 5HYJE 1CF1A 2XTSA 2NR6A 4L8DB 4OJFL 3LB6C 5C08E 4PGEA 1DEEA 4HMDA 1JV5B 1T03H 2G2RB 2Q8AL 1KIRB 4NZRL 4XC1H 4ZMTA 1LGVA 1G7MA 1X9QA 2DIAA 4K3DL 4DKEL 1WC7A 2Q86A 1JPSH 1GGUA 5EU6B 2P9RA 2D3LA 4E9TA 2YGPA 2FECL 4O51A 4X5PA 2EO1A 4B9PA 4F92B 1E7VA 4KXZH 3TCXA 2A4EA 4BEIA 2EDNA 2OL3H 4JN1L 2IG2H 4HSQA 1WWAX 5IHUH 4NRZA 2D9CA 1PL3A 3A6CH 5B1JA 4K3HA 1OLZA 1YPZB 1T03L 1NL0H 4Y16D 3MCKA 4L37B 2EKSB 4FXTA 4X7SH 4XC1L 1N10A 1HXKA 3K71A 2W91A 1INDH 1B6UA 2AXFB 1BEXA 4NNYA 3BT0A 3T0AA 1I9JH 2ATPA 2JH2A 3MOQA 3MGOA 4AVIA 3N04A 3WYRA 2J2ZA 4R4FH 3GSUB 3NESA 4F5CA 5TF0A 1WAAF 1FFPB 3SYPA 4KI5F 4Z7OE 3D9AH 2OL3L 1XCQB 1G5GA 1I7TB 2JNZA 4I5BB 3PWLB 2IG2L 4YGVA 3BPLB 4LSTL 4BZ1H 5IHUL 4PBVC 4U33A 1IT9H 1GZHA 1LP9E 3A6CL 2CA4A 3OKKB 4MXWH 4GP5B 1NL0L 4M8VA 2MQGA 4QYOA 2AQSA 2NXYC 2AQ3A 4X7SL 1JNHB 3ZE1B 2GSIA 3DYPA 1PPIA 2NX5B 1RCYA 2NW3B 3BDYH 1CT8A 1NCGA 3QO0B 3OQ3B 1O7SA 5D55A 3UTTB 2I32A 1I9JL 4PB0L 4AGNA 4BUQA 5DFVD 4QRAA 2QFRA 4R4FL 4DZ8B 3BOVA 5HI3C 3MA7A 3D2UB 4QXTA 2CHWA 3IJSB 2NY4B 3BVXA 1ZLVK 3D9AL 1T6WA 1INQA 4MHHG 5HYSA 3DJSA 1AHWC 2YUXA 3O3DA 4FFWC 2YAHA 3RGVA 1ETJA 1A25A 1JK9B 3CVHH 4BZ1L 2I5YH 1LEIB 4OCWL 3IFLH 1IT9L 4L29B 4ODWA 4JKWA 4MXWL 3CIQA 4AGOA 4UBDC 3WXVH 2BNQA 2VN5A 3VD4A 1NEUA 1U8IB 1MWAB 3U9PH 3BDYL 1BX2B 4P9MH 4OW6A 4HPYH 5D1XE 4HEPA 4PJXA 4Y4KB 3ZDXB 4F7TB 1MJUH 3DUHA 2JSFA 3GKZA 2AXHA 2NXZC 4Y5XB 4ODVH 3TVMB 2P8MB 2BNRE 3L5IA 4LDOB 4YR6B 3T4YB 3FQRA 1K6QH 3GBEA 4JPQA 3BLBA 1WVZA 3D85B 5CSZA 4DW2H 1KTLB 4OZFB 3EF4A 2VLME 4TNWK 1W8NA 1CXKA 2Y4SA 4P2QA 4QHUA 2EVGA 4K8RC 2ADIA 3IFLL 3ZK0A 1CVRA 4GIAA 1J8HE 1Y1UA 1RJZA 2ZXCA 3ZMNA 2Y6SD 4OZ4A 3WXVL 5KJ7E 3FRPG 3KWVA 3R06B 2BS9A 3U9PL 4PJCF 3KDMB 4R4NC 4N8UA 2FL5B 2HX9A 4XO8A 3V5DB 3OXRB 4P9ML 1IM9B 4HPYL 3GEFA 4N6QA 1V54B 1RU9H 3U7WH 2CLZB 3MBWA 4ODVL 4BD4A 1WO2A 1TNMA 2XFGB 4AW7A 1SEQH 1EAPB 3EJZD 3IKCB 1OV8A 1YECH 2HA1A 5FK9B 1K6QL 3R7QA 2LAAA 4DW2L 1G7IB 1F11B 2X6CA 3BUIA 4XX1E 3MRJA 2BSTA 5AALA 4N3UA 4KPHH 2I9LA 3SN6N 2PTTB 2BWQA 3FT2B 4V1DD 1RLWA 4TYUA 4XXWA 3VMPA 3FB6A 4JKPH 2CQVA 2DWDA 4NO0D 4WWKC 2I9TB 3QO1B 5EUOE 2VLRD 3K91A 1RERA 3HHRB 3DWTA 4FERA 1RU9L 2YD7A 3VFWA 3U7WL 1DVFD 4DTGH 4C59B 3S3CB 1SEQL 3BI9X 5ILTH 1YECL 2VT0A 2EXSA 4G6AD 1M53A 4KPHL 4ETQA 1ZHBA 1IC1A 1AD9A 4MA1C 5GGTA 2NT1A 5HDQH 3AZUA 5LQBH 5MENB 4JKPL 3VFPA 1Q1PA 1YEIH 2QDVA 2CZNA 4PGBA 1T21B 5J13C 2X1OA 3BIAX 1BD2A 3W11C 3GIVA 2EVJA 1I8UA 4PBWD 4JRYA 4DTGL 5JZ7D 2A74C 4XNQB 5FDYA 4AKPA 2IQ9H 5KSAA 2PXYD 5ILTL 4HCIA 1QR4A 3FQNB 2DMHA 4AQEA 5C0RH 1SYSA 2X4QA 1BLNA 1CGYA 2LGNA 3KBEA 3Q1SH 2FSDA 5F9WC 4HK0A 3HZVA 4XGZB 1OZTG 1UENA 5HDQL 1EX0A 2AK4A 4UWQB 4LDCA 4J39A 1UWEL 1YEIL 3RY5A 1JNNH 1Z9SB 1JDDA 3M1OA 5DHVA 1DLHB 3EUUA 2IXQA 4GBXC 5JMRA 3VNZA 1JYVA 2IQ9L 5IIEA 3EO0B 5ITFB 5C0RL 3VDBA 1CR9H 5CGYD 1PNCA 4WW1A 4UU9A 4M3JA 2ZKWA 1UJ3B 1AGEB 1IVLA 5MI0B 2YPLB 1J0KA 2QZ5A 3VFUA 4Q0XL 4TQ8A 2GYSA 2RGSA 2J7LA 4Z7WA 1NEZG 2O5XH 2L7UA 1CFMA 5JIIA 3AITA 1JNNL 4XZUB 2V6HA 2WN2A 3DX8A 4IW4C 1SBSH 1BAGA 5I17A 3WNJA 1FNFA 1DBJH 4TNWF 5JXEA 3SPJA 2EIJB 4Z76B 2HLAB 2MTAA 3G08B 3VFOB 1TJIH 1BCIA 1U93A 2FBRA 2Q7YB 1P5VB 3KCPB 4NRXA 3CU1A 1OGPA 3BQVA 3CH1A 3VYNA 5J9PB 1KZQA 1QFWI 4XMLL 5SX4H 4HJ0D 3D7PA 5SX5K 2O5XL 1JZDC 1CGWA 2EDDA 5I1IH 1FVCB 2PW2A 4BINA 2JB6B 4IEFA 4DFIA 1UC6A 4F57H 5HHXH 3FTGB 2DYPA 2GUOB 1SBSL 4LNVA 3ZZQA 4KBPA 4L4VB 2Y7MA 3K5SA 5ANMA 3RPBA 5M94B 3BAEL 3GUTA 4TXVB 5BO0D 2NZ9C 4O02H 2G3ZA 4RX4A 5J89A 1P53A 3CZGA 1TJIL 1VKXB 3BD5A 4PJ5B 4XBGA 5D2LB 4I2XE 3F58H 3Q13A 1VACB 4MAYD 4IS6B 1KGIA 4X0KA 4JUSA 5GHWH 2KLRA 5L8JB 1S9XA 3GO1H 1F4YH 5IEHA 2ZWNA 5TTRA 3QRFM 2DN7A 4MS6A 3O9WA 5DEZA 1TTBA 4FNQA 3QJUB 5I1IL 2B9AA 1AZVA 2WANA 4F57L 5DDHA 5HHXL 1MFEL 2QZQA 3GSXA 4OM1H 5I76B 5LBGA 4LNRB 1WA0X 2EDFA 1D7FA 2HVJB 3SKJH 1JI2A 4O02L 1DVTA 3H4HA 5IVZB 4L0YA 4D9QD 3VX0A 1EEZB 2P4AB 2WBJB 3ZDYF 1CIUA 3F58L 3H9HA 1XZ0B 2R15A 5GHWL 3QDJB 1SOQA 4LL9A 1I8AA 3GO1L 1F4YL 3OKNB 1Z1WA 1FYHB 1CS6A 2EVIA 1MCFA 2ZXGA 3T2LA 1IGTB 4HV8B 3MGAA 5D7EA 4MJIB 3VFSB 2GFBB 4BSWB 4KJYB 2NW2A 2FT7A 3CDCA 4XPHL 4OM1L 4DO5A 3IDMA 4XXCC 1N18A 1VB9A 5CSBA 4PJDE 1PLGH 3RX8A 3SKJL 5KZCD 4EOWH 3QRBA 3OKMA 3RFZB 4TNVK 3QJVB 3CFJB 3MFGB 2YARA 1X5HA 3HBQA 1OGTA 1F2XK 3R8QA 3U36A 5KJRH 4YHNB 4OF8A 4W93A 2YRPA 5CCGE 5JLZA 1CFNB 2FEDD 4Z7UA 4HP5A 1ZT1B 5A2BA 4X7TB 1JDCA 1LEKB 3ARDD 3HE7B 2OP4L 3NSFA 1N8ZA 4HIQA 1FJ1A 4U2ZA 3MLSH 3S37X 1Z9LA 4L8BA 4Y7OC 2Q6WA 7FABH 1NBVH 4QT5B 2EIEA 4K9EC 3EJTA 4PVMA 2PKDA 1PLGL 5F6IC 2YA2A 5IHLB 4EOWL 3RX7A 4E9RA 3T4AC 4JM4H 4UT6A 2GTZB 4LVNC 4UNUA 5A16B 2YD2A 3SD2A 2N0KA 3S2AA 4NNXB 1ZKAA 2QPUA 4V1DE 5H37H 3QUXB 3FBQA 1KGXA 5H35B 5ICYB 1CFSA 2PTVA 4UNIA 5E94B 4KNQA 5BQ7A 4J7RA 4GRMB 1NC4A 2WWNA 3LSOB 2HT3D 1RIVH 3EYFB 4I77H 4NN6B 1X9RA 3QIUB 1JHTB 1E2WA 2D03L 3FO1B 3PHAA 7FABL 1NBVL 4RMSA 5IHWA 1ZRUA 2PETA 4N26A 1F97A 2DM2A 2J5WA 1OT2A 3MJ9H 3T1FB 4KQ4H 3CWGA 3WJMA 4GUQA 1MFVA 3MX0B 5DHXB 5E1QA 2MKWA 3OHXC 5JO5A 3NPSC 2A6JA 3JV0A 4X8JB 4ZS6C 3ULVC 3W9DA 5D5ME 1JVLA 1JRHI 3OKOB 4KRLB 3RX5A 5E8DH 4L4JA 2VDNL 1REIA 3WDIA 2BIQA 4R0LA 4BQ6A 5IK3A 1I1AA 3FQXA 5D1ZA 3B9AA 5D7LB 1RIVL 4I77L 3ARZA 3GMQA 3N91A 4AMKH 3FPYA 3CTTA 4Y1AD 2J72A 3MJ9L 2XX0A 5B7FA 4KQ4L 1I1CA 3OR7A 5IVXF 1JPGB 3A67H 4WCYH 5I5RA 4KK6D 3JV6B 3R19A 4YSAA 1EHKB 1N68A 5E99H 1ZLEA 3QDGD 3SGEI 2XXFA 5FYKD 2BIOA 5E8DL 1Y6NR 2BLFA 4QHKJ 4PJBF 5DJXB 3B3BA 5AL0A 4ZW6A 3F00A 5DURD 5CBEA 5K9QI 4WWOA 2FDBP 2J8UA 2QLYA 5FR3A 4JL1A 2EEBA 5JPNC 1FZJA 5CJOH 3SYOA 4AMKL 3P4LA 4YO0A 4E9YA 2QVTA 4Z3JA 5AB9A 2CO6B 4PW3A 2NQCA 2X70A 4UOJA 5C0CB 3MLVL 1I82A 2DQFA 4ZOCA 2ZQKA 4WCYL 5L8LB 4P5SA 1H3PH 5E99L 2EO7A 3B6SA 5FWRA 4E2OA 1B9ZA 2EXWC 4K8RH 1ASQA 3B83A 3VXSA 4QHLB 2XWTB 2XPZA 5A2AA 4OI9A 4LVOB 2UXVA 1BZEA 5A2JH 4YSPA 3HG0A 3N42B 5G4OA 2FX9H 4F7PA 1ZJAA 1GZPB 4FHJA 2OYPA 3ETSA 4Y5YB 1CI5A 1XH3B 5CJOL 3WSQH 4P05A 3HB3D 3RGHA 1XGUA 4UDTA 1T83C 1C08A 3LS4H 3FFOA 3GTNA 3QUZB 3D0AA 2LLNA 1H3PL 1I1RA 5E6UB 3LN9A 2NUPB 4HWNA 3OKYA 1ZPUA 5AWNH 2R9HC 1AJ7H 4CVWA 4JFHE 5E51A 4NUJB 1QI3A 2FX9L 1SXAA 2XN0A 2CO3A 3D0VB 5JIKA 1M05A 1ZY9A 5GGRA 1YEHH 1RZQA 2Y3AA 3WSQL 4AJVA 4H8VA 4ZMPA 2YBGA 1YEKH 5KW9H 5AW7B 5BS0B 2WIIA 3LS4L 5SWQB 3GYRA 2AVFA 3K8KA 3A24A 4JBSA 5LGYA 1QATA 1QRKA 2D73A 4NQCA 5IKCA 1DCEA 3AWFA 4Y2OB 1XAUA 2F7OA 1KTJA 3ISWA 3O8XB 4YHIB 3AQYA 2DTSA 2V2XB 5AWNL 3Q5TA 3MRRB 4A6YA 2WTOA 4A7TA 5IQ9A 4Z3IA 5D6DC 1PKQE 1AAJA 2CAKA 1YEHL 2M83A 3P9LB 3GS7A 3PAZA 1NCCH 2H6UA 3BVNB 3GIZH 5DZNA 3VXRB 5KS9A 1IO4C 2WAHA 1YEKL 5KW9L 4ZO8A 4FFYH 3RZCD 4G43B 1KCVH 3K5RA 1GSMA 1OO2A 1S3RA 3CSTA 5DXWA 2H47C 1DVSA 1GH7A 3KPOB 4BK4A 4YE4H 2BIMA 4ZO6A 4NCC2 1TJHH 2R4RH 1RUMH 5DEGA 5DFWH 1CICB 1K4CB 1IGJB 5CLTA 1LO4H 3WKNA 2CJUL 1P7BA 4HZAA 1YNTB 4BFGA 3QP3A 5HDOA 3GIZL 3L5XH 1CXIA 3ZHFA 3I3BA 1VJSA 5F9OL 3LKNA 4FFYL 9PCYA 1KZYA 1KCVL 4ONFH 4DP8X 4X4MA 3LPOA 1IFRA 3TFKD 1RHHA 1E5YA 3P54A 5I26A 2YGOA 1PZAA 2GC4C 5AKRA 2Y5TA 3D4YA 2DMKA 3INUL 3UYRH 4LCCC 1CGVA 1TJHL 2R4RL 4P2OC 4F9LC 1QSVA 3FOMA 2WB1A 1GXEA 4GRWB 1LO4L 4LRNL 2FT6A 4G9DA 3FW6A 4UIMB 3LZNA 1OIOA 4W81A 1H5BC 2E6PA 4LIQH 1C8QA 3L5XL 1PQZB 3RVXD 4L2LA 2XT1B 5HPMB 3UZVA 3BIKB 3V4PH 3MBEA 3MV7D 4ONFL 3F12A 4ZMYA 4DP7X 5HVHC 4JQIA 2AAVA 3EW3B 3D18A 32C2B 2VDKB 3UYRL 1EEYB 4MNQA 4OCSL 4ZO7A 3BMVA 4FF9A 5D7IA 8FABA 1VGKB 4WI8A 4PGEB 1DEEB 3EJYC 2FWSA 4DKDC 1JTPA 1U42A 2WM0A 4LIQL 2JKRM 1G7MB 2X4SA 1WC7B 1Y6KR 3ARBA 2Q86B 1XX9C 5A2LH 2XWRA 2MCPH 1TIUA 4JPVH 5C92A 3MLUH 4PJAA 3DROA 5F1SA 4B7IA 4O51B 2RB8A 3WV0A 2MH4A 2I60H 3U0TA 3ARPA 1LWJA 5ANHA 5LB1A 5JHMA 1G0YR 1NCUA 2ZX5A 4X7DC 3ZL1A 2DWXA 3QUYA 5DD0H 5DJ6A 4XNXH 3IFNH 4NRZB 4UYPA 5F7LB 1KGJA 1T2QH 2GSGA 1UQSA 3MCKB 1ASPA 4IJ3C 4N2DA 4JGUA 3C5ZA 1SF5A 2IAMD 3X1EA 2A4ZA 4Y1AE 3K71B 3S48A 3FTSA 5C0ND 4NNYB 4P46D 4Z18A 2ATPB 2DLIA 3MGOB 2J2ZB 3MLUL 1R75A 1KUMA 1FP5A 3QDGE 2NSXA 4NLAA 2I60L 1A7QH 1C5CH 1PFCA 5FYKU 2KZBA 1UATA 3BAIA 3B2UC 5F89A 4YGVB 4QNPE 5DD0L 4K9JA 4XNXL 1Z9OA 3IFNL 3DX9A 5LO7A 2YEQA 1T2QL 3GHEH 2VDMH 4HC1A 3CZFA 4QYOB 3BZ5A 3MTXA 1LEGA 2GSIB 2A7BA 1EBPA 1JPFA 1CT8B 2CGYA 5ADOH 2ZG3A 2LE9A 4XBPA 1MRDH 3PQYD 4ZMXA 1SXBA 2X0UA 1YMMD 5E2TH 2YQ3A 3BWUC 3SGJA 3GSQA 1TQUA 2EDLA 3MA7B 1BBJA 4QXTB 1A7QL 1C5CL 1U6AL 5AVSB 3MV9A 1INQB 1LYQA 2Q7NA 5HYSB 4RGMB 1VZGA 3O3DB 4F27A 4ODWB 3UBGA 2VDQH 4M4RA 4AYGA 1CDYA 2O6CA 3GHEL 2VDML 3LNFA 4FJZA 2BNQB 2BZDA 3T0VA 2D7OA 2HMIC 1HWWA 3SE8H 5ADOL 4K9EH 4Q89A 3TA3D 1PSKH 3OR6A 4PJXB 2Q0ZX 3DETD 4B5EA 1MRDL 4JE0A 3NCYP 4CC0A 4N90E 2VSKB 5E2TL 1ITBB 3V5HA 4KOCA 1KLUA 1NLDH 3RVUD 3HI1A 5CSZB 4FXGA 2OJ1A 2ZX7A 4P2QB 4QHUB 3WO4B 4BA8A 2ADIB 2YJQA 1RJZB 2YHGA 1AR2A 3V6OC 4OZ4B 3BDBA 3APMA 3MCLH 4NAMA 3BPLC 3GMNA 4ODUA 5C09D 4H4NA 5ENWA 4P49A 3SE8L 4K9EL 5F7FA 5F97E 3WY3A 4QPEA 1EZVY 3VMNA 3BKCH 1AXIB 1YN7A 3DV4A 3LPPA 1JF6A 2BVPA 2IC2A 2HLFC 1A4BA 1I8LA 5DD1H 2OI9B 4GG8A 3ULVH 1ULVA 1NLDL 3T04D 3EYSL 1D7DA 4WEMB 3AVEA 4UQAA 1RKRA 1RZFH 2CUAA 3MRJB 1RAMA 1CI3M 2BSTB 3PABA 4Z77A 3IS1X 3NIDF 2CG9X 2I9LB 3NFNA 3HE6A 2A6DA 4O5LL 4P9HC 2DL9A 7PAZA 3FB6B 3MCLL 4DP5X 2AZUA 2H0FA 3Q7JA 3CQQA 4YHLH 3GMPA 1XF2A 2XIBA 3G5ZA 3VFWB 4X6CE 3UXFA 5M7QA 2F7IA 2R2CA 2KBGA 4OLXH 4K2UH 4XPGH 1QZNA 5BV7B 4WJ5A 5CGTA 4DK3A 4JG0H 5ADPH 4V11A 1RZFL 2IFGA 1ETZA 3II2A 4QYAA 4ETQB 2DQIL 1ZHBB 2XBTA 4UQ2A 1BA9A 1OHZA 1AD9B 1A6VH 4QLWA 3MXWH 4FJYA 3CK0H 4A2LA 3VFPB 3TJEH 4ZNEA 4ZUSA 1HS6A 3VQMA 4PGBB 1BD2B 1CDGA 1NKGA 3GIVB 4IBSA 4CN1A 5CJXA 1E9PB 4YHLL 4JRYB 2VXSH 4G2AA 2COQA 1NCWH 1CDCA 5EN2A 4G5AA 4L1SA 3MRPA 1WCQA 5KSAB 4YN3A 1XD1A 1NJ9A 3QUHA 4K2UL 4XPGL 3SYQA 3T3PF 4M5SA 5SV4A 3ZTDC 4AQEB 1QBAA 1SYSB 4JG0L 5ADPL 2X4QB 1BLNB 2W60A 4S1SH 4HK0B 3HZVB 4K5OA 4Z78A 1N5YH 3V79C 4JLRA 4LSVL 1A6VL 3O3AA 3D2TA 1KG0A 1B2WH 2AK4B 3ERXA 3CK0L 3DX3A 4GP8B 4AG4H 2QPFA 4UIKH 1JXGA 3COOA 4Q9RH 1M1XA 5HDBB 4C8XA 1G4MA 5DHVB 2VXSL 2IXQB 3OF6D 3P4MA 4OJCA 4YE0A 1NCWL 4I1PA 4PCKA 3WMQA 2QELA 3SDDA 5IIEB 1EFXD 5JHDA 4HD5A 4KKLC 3QC5X 2C7UA 4U6HA 4CN6A 3U46A 4EI5D 1V7NH 1ZD6A 4ZMQA 2OZ4A 4WW1B 1IGYB 3KGTA 4UU9B 1XGYH 1G1KA 4ZTEA 4S1SL 1QOKA 1YLBB 1N5YL 3VFUB 4AE1A 5J3HD 1KFGA 1GHFH 5E6IA 1UA3A 1B2WL 4Z7WB 4AG4L 5JQHC 1M2VA 2W94A 5I71B 1VGEH 2XC8A 1J0YA 3VMOA 2AJ3A 3KS0J 4Q9RL 5GZNC 4DQAA 3MV8D 4OD1H 3DX8B 2JQMA 5I17B 2VJ0A 5EUOA 4IRZH 1NDTA 4G82A 3F85A 1JDAA 3QDMD 3QBTB 1MREL 3OZKA 3GLAA 2WTRA 1V7NL 1ZMYA 3SPHA 4EVNA 4HOXA 1U93B 1Q0XH 1ZGLA 4NRXB 1XGYL 3RTQC 3CH1B 2BCMA 3PV7A 1E5BA 5KVGH 2B77A 5C2BH 3D8MA 4ABUA 2BNUA 2PW2B 3OXSA 4IEFB 1PAMA 5GRXG 2ZUXA 5HGGS 5I1DA 3FS9A 5ISZD 2DKMA 4GAYA 4OD1L 2YRBA 2JF1A 4XN4A 4J6IA 4DUXA 2DYPB 4AEHH 2IBBA 2B9BA 2CHZA 4A37A 4Z7QE 4XO5A 1KGUA 3JTSA 3LNIA 4IRZL 1G1CA 1WDAA 3BWZA 5ANMB 1BMZA 3GUTB 1R9FA 3HZYA 1QACA 4P06A 3NSCA 5KJ4A 1PIFA 4XBGB 2PP7A 4ANKA 1Q0XL 4BV1A 1J7VR 4X98B 2DI7A 1HVXA 4X0KB 3W1ZA 3P3UA 4M6AA 3SE4A 1S9XB 1P9MC 3VRJA 1PLAA 4MGXA 5C2BL 3JZ7A 4WHDA 3O9WB 1UJ3C 4E9VA 4FLHA 5DDHB 5DZJA 1H9DA 4AEHL 1OGAB 2AV7A 2NCMA 3LIZL 3GSXB 5E9DE 1USQA 1HNGA 4I0PC 1YMME 3HVDA 2FVNA 3O11A 4FG2A 5BOZG 5FUOL 4ZTOH 2IAND 1L0YA 3UBXG 3H55A 3H9HB 3S3PA 1JIBA 4E68A 1F41A 3VGGA 2DKSA 4GOSA 2NXYD 1N26A 1UASA 4LLMA 4KROB 4W9GC 5LCVH 3HNVH 1TTAA 5FDWA 1IM3D 1YAIA 3PXHA 1JHKL 3D4CA 3O0LA 1O75A 2E9BA 3P77B 4ORZC 1JZ3A 1FG2A 3Q5YA 3RGBA 5HI3D 3IDMB 5EG6C 2NYYD 3RE0A 4OKVA 3F7VA 4PI2A 4MSWA 1ZT4A 4ZTOL 1J05A 2ERJC 3I6SA 2VQUA 3OKMB 4FFWD 1DSWA 4HLJA 2VQ4A 1G7QA 2EACA 1OGTB 2GJZA 1G7PB 2EEAA 3G5YA 3MFFA 3QUGA 3E0GA 4MBRA 3U36B 3ESUF 3UZQA 4D2NA 4HS6A 4UBDD 4LASH 2WWMC 5JLZB 3B5GA 1WT5C 4Z7UB 3EH5B 3HNVL 4LPCA 1AZUA 3H56A 1NCDL 1XMWA 3EYVA 5C09E 1N8ZB 1HL4A 1FJ1B 3PG2A 4Y16A 2OR9H 4MMXC 3VFVA 2QL1A 4L8BB 4M6NH 2Q6WB 4OJAA 3WDJA 2CMRH 3DA0A 4N2LA 3JVGA 2OMTA 4LGRB 5B39A 2Z1KA 4LO9A 2YAFA 3U2JA 2XTJE 4K8RD 3C9NA 4ZO9A 3R4DA 5JW5A 1RJLA 1Q9OA 4LASL 2WBJC 3RUGF 3D4GA 1RSYA 4R4ND 1IKNA 1CFSB 2A0LD 4RFEA 2CUHA 2XCMC 3GI9H 4WV1A 1JBJA 1R24A 3QSKB 2DWEA 1NC4B 3NG5A 1Q8MA 2YWZA 4KK9C 3CJJA 4QXGH 2Y36H 2CMRL 4RMRA 3K81A 1AS7A 2YZ1A 3NVQA 4L9LA 3WJMB 2FYVA 4FQXA 5JO5B 2A6JB 3GRBA 3CFIC 3W9DB 1LO3H 2CDGA 4XP5H 2GEEA 3IU3B 4QWWD 3U48A 4R0LB 3GI9L 3C8KA 3ILDA 2BP8A 5IK3B 1I1AB 3FQXB 3MUY1 4OFPA 5D1ZB 5EO9A 1TZOA 1SUJA 2VRQA 1CTMA 4ZUUA 2ARWA 4QXGL 5AOZA 2WXIA 3GMQB 2V2TA 2BIHA 5EV7A 2Y36L 2OKMA 4PJGE 2P44B 4GIPD 5DQ9A 3OR7B 3WHE0 4QRRD 4PJDA 3O0RH 3QR1A 4HJEA 3IBEA 5HBBA 4DEUA 1U3HC 1L3NA 1XHHA 1S6NA 4XP5L 1T89A 1GGIH 1WFNA 1WPCA 3W11D 2OMWA 3U79A 1FAKT 5DO2D 5CBEB 4IKNA 3LQAC 2I26N 3FFCD 1X4YA 2J8UB 2OSLA 2NY2D 4J2QA 1FZJB 4GT7A 2KPWA 2MRYA 4YO0B 4AGMA 2WQUA 2VR6A 1NCHA 2MOVA 4DP9X 2X70B 3FSAA 4NN6C 2DQFB 3HJ0A 3MJ7A 3QIUC 4FOMA 2JKSA 3O0RL 4AMWA 5DJAA 1T4WA 5KYNA 2ZOTA 4JO5A 4BSVA 2XG4A 4MMYA 3B6SB 4DGWC 3HW7A 5LXGH 5CN2A 1UOWA 3LZFH 3VXSB 4GQRA 1GGIL 3EBAA 4TTDD 4ZW3A 4N9OB 5KBLA 4M29A 3L16A 1NCIA 3LPGA 4V1DA 1HESA 1UD3A 4PJHE 2GIXA 4NO0A 4F7PB 4TQIA 1M7UA 5DZOA 3SDXF 2VLRA 4OR1A 1QFWM 4HUKB 1XGUB 2WQSA 4UDTB 4NPKA 3QDME 3SKMA 1C08B 4BWWA 1FHNA 3GXDA 2ED7A 3S0PA 5KYXB 5K9OA 3U9WA 4PJ9D 5CJ5A 4WO0A 3LOWA 2ZAGA 1KGCD 4ONGH 4M1DH 5DUPL 1RZKL 3FHAA 4YBLB 4HW6A 5LXGL 2QGCA 4G80A 2WO4A 4PCYA 2CUMA 3LZFL 4FAAB 5F7BA 2OQJA 1V3JA 5IESL 5D5MA 4P9HH 4YEEA 3T65A 5AG9A 3TJHC 1OP3H 5ISZE 4MRCA 5K9JH 1FH2A 3EHBD 1M05B 1I85C 1P5UC 5GGRB 4K7PY 3UADA 3NCWA 1MWAH 3QAQA 3AY4C 4LLWA 3K1DA 2WIIB 4CC1A 4KKAD 4HT1H 2N4IA 2PXYA 1WD8A 4GG6E 4NQCB 4ONGL 5IKCB 5KYYA 4M1DL 1QYGH 1J0HA 5D1ZI 3NGBB 4U1KA 5E23A 2W8CA 3AG2B 5EC1A 5GRWA 5DMIH 4P9HL 4OZFH 4YPGA 3U25A 4UQDA 3D09A 3ZDZF 2NUTA 4A6YB 3GSVA 5K9JL 5J6GA 5D7JD 1F56A 3LZRA 5IQ9B 4OUUA 4XHJC 2XXCB 4LVOC 2ZUWA 5HHMB 5KS9B 1MWAL 3SQBA 1T5KA 4W9FC 2X4OA 2IANE 2YA1A 4HT1L 4Y5YC 4MTMA 3NDYE 3M7FB 1BVNT 4FG6D 4PJCE 3K4DA 3H53A 1CLVA 1EHXA 2Y5EA 5J1SC 5EWIH 1AE6L 5DEGB 5DMIL 5F1OB 3QE5A 3WEMA 5CD5C 5FO2A 3T8MA 2ZAIA 5JIDA 1U3YA 2Y07L 2ZX8A 1RZIA 1RL1A 1QD0A 2ZCKL 2LT9A 4YVUA 5EULV 1EUUA 4EZKA 4HIEA 2PPEA 3FTXA 3NIFF 4IHBA 5D7HA 4BRJA 5AW4B 3ZL2A 1QMUA 3LEYH 3LKNB 4NAJA 4NWUH 4M6OH 3MRIA 1QFWH 3HPJB 3LHPH 5FGCB 3ARTA 1ODAA 1HEZA 3IAPA 1N70A 2WXQA 1RHHB 1ZS2A 3PRZA 5G5DA 4N25A 2BW4A 3TV3H 3WKYA 2FQEA 2Y5TB 2RMNA 2EYTA 4B9KC 1N0XL 1D2OA 1PKOA 2YMTA 5EWIL 3VFNA 3FOMB 4IRJA 4YS4A 4PY7A 4B95C 3KLHD 3P4NA 4CDHA 1OSZA 1OSPL 1X4XA 1NFDF 1CFVH 5FW6A 1H8NA 4G9DB 3O8XC 1MCDA 2O30A 1G5AA 1UUNA 4LLVA 3BSHA 3DHJA 2AP2A 3LEYL 4NWUL 3UZVB 1YYCA 1PZ3A 5IJBC 3MBEB 4M6OL 1QFWL 3LHPL 3F12B 5FHAH 3UERA 1FFQA 2E8YA 2WXRA 2OCJA 4FEMA 4GQZA 3D18B 3I02A 2IADB 5T3ZH 4MAYA 4LRIC 3E6FB 4MNQB 2HN7A 4Y89A 2D7TH 3QPXL 4WNJA 4X6DE 2XV3A 5D7IB 3FUDA 1F0LA 4JKLA 8FABB 3S7GA 3IWVA 4UUJA 3U1SH 1HI6A 3HAEA 4F8QA 3SPIA 3DNKA 3V0FA 2F5AH 1CICC 3RKDC 4CADA 3BVWA 4M8RA 5FYLD 1E7UA 5GRZA 2NY3B 1WTGT 4FQ1L 4OUOA 1BBDH 2X4SB 1PKQA 3ARBB 5D72L 1T7ZA 4HOMA 3QQNA 3IDUA 4NT6A 5FHAL 1DLFH 1JGDA 3WNPA 4J3OD 1ECZA 4PJAB 3DROB 1U2YA 4POZD 4AQ8A 2IPUG 3LKSA 1IC5H 4HMEA 3NJLA 1S7SA 4ZD3H 1MNNA 2VW7A 3ALXA 5T3ZL 2BRQA 1XO8A 1KC5H 1AQDA 2X42A 3MNDA 3QUYB 5E8OA 3ZMRA 2D7TL 1DO6A 5DJ6B 5ID0A 4JHAH 3FUHA 4GI6A 4OSUL 1CE1H 1N12A 3EYQD 3C6LB 3KHOA 3QWRD 4N85A 2GSGB 4OCXH 1MFBH 1NCNA 1T4KA 1UQSB 5EF0A 3U1SL 2F5AL 1SQ2N 5F93C 3C5ZB 2XN9D 3E8UH 3D0LB 3VXUD 2Z92A 1MLCA 4M7ZC 2FX8L 3QULA 4H26A 4QRRE 4PJ7F 1WICA 4ZS6D 4CL7A 1DLFL 5DVMA 3ULVD 4PYGA 1A7NH 5I1LB 4DIXA 3AB0C 3T2OA 1IC5L 4UM9D 5IM7A 5CJBA 3V7MA 2VSDA 3ARYA 2X1XR 1XSIA 1KC5L 4IBLT 4OF5A 5F89B 1HKLL 4ZPTB 3VE0A 1ADWA 4JHAL 1NGQH 3DX9B 5IUSA 3QNXA 2KZKA 1MY5A 3FFCE 3ARDA 1MFBL 3CZFB 2EVFA 1C9SA 3EZJB 1LEGB 1JMZA 3E8UL 5E2VL 1JPFB 2VDLH 4IDLA 5CP3H 3TBVA 3LXBA 4XBPB 4Y9EA 3M46A 1A7NL 1E42A 3LZLA 3IGKA 4LVHB 1DBKH 1VADA 1BBJB 3PWPD 3MV9B 1T6BX 1IILE 2ZF9A 1S7VA 2G9HA 1NGQL 4M4RB 5AKVA 1PBYA 1WEJH 1C7TA 3MOAH 4PWGA 1HE7A 4IIQA 3O3BB 2X1PA 3K80A 2VDLL 1QQDA 3A4FA 2IH8A 2W59A 3OR6B 2A9AA 1JRHH 2NY0D 4MAZA 4KVCH 2J8OA 4JANA 1CCZA 3V5HB 3PUCA 1DBKL 2EXWD 2QPSA 3ZT6A 4UT9H 3LPFA 1WS8A 1KLUB 2IOMA 3HI1B 1TCRA 4HETA 4ODXA 4BFRA 3DX0A 4FXGB 4XNMA 5CIPA 3EBGA 3G04A 1FAIH 1WEJL 4LP8A 2ORBH 3ZDYE 3GMNB 4ODUB 2DV6A 1GZHC 2W95A 1NWOA 1TKWA 5GZOD 5ENWB 5I1CH 1W0WA 4PJFF 4BK8A 4BXVA 3SGEH 4PY8J 1JRHL 3MXVH 3DV4B 2Z4TA 2BVPB 4KVCL 4Y8AA 4KJWC 1FC2D 3V6FB 3GI8H 4GG8B 4UT9L 1L6PA 4WUUD 2H2SD 2UY7B 4AUUA 1BVNP 1FH5H 1J48A 4AM0Q 3QDGA 3PABB 4TSBH 4Z77B 1QBMH 1QP1A 5ERWA 4XMPH 3RWFA 3NFNB 1FAIL 4U1NA 3HE6B 2A6DB 3EXLA 4RGMC 2ORBL 1VEOA 4WFGD 3RGVC 1W0YT 2ZXEB 2XQ0A 4PJEF 3BZEA 2BY1A 2A38A 5DJ2A 1YCSA 1ICTA 2GTQA 2FGWH 5I1CL 1NGYA 3FZUC 3GMPB 3X1FA 1XF2B 2AQ1A 3G5ZB 4KTYA 5JQ6H 3MXVL 3RWIB 1OAXH 2K9UA 5I0XA 2YQGA 3GI8L 1ZVSA 2EAEA 2AQ2A 3OB8A 4WJ5B 4XMZA 1NUDA 4YSOA 1ZHLA 3IFOA 5D2NC 2PPFA 2ADYA 4TSBL 1ETZB 1QBML 1T66C 4XMPL 1U58A 4UQ2B 1NGWB 1OCCB 1S7WA 4TQEH 5DJ8A 3OAZK 5HHNA 1S7QA 4ZUSB 5TQ0H 3LQAH 3DVNA 4X9GA 1A9BA 1AHMA 2FGWL 3DXAA 2DJ4A 3IBOA 4GS7B 4R8WH 1RPUA 2X9XA 2VWEE 5HPOA 5JQ6L 5I19H 5C07D 5EN2B 1OAXL 3WIHL 3KNBA 3MRPB 4H8HA 1NJ9B 5BZZA 2IGTA 2VO5A 4UTBH 4LEEA 2YAMA 1AIZA 2W60B 5KVFE 4JNXA 1NA8A 4OD3H 5E4IA 4HCRA 4Z78B 2ZUYA 4PJIF 2CBOA 4JLRB 1UZ8A 1D6EA 3O3AB 4TQEL 4U3CA 1KG0B 4JRXE 2Y23A 5TQ0L 3LQAL 4NBZB 4BFBD 3Q8BA 1FDLH 1M1XB 5K9QG 1RZ8A 1X7SA 4JDZA 3ZJAA 4R8WL 2WZPD 1LE9B 3P4MB 5I19L 5DC9B 3GMMA 3SDDB 5JHDB 2P43B 1DVZA 2ZPKL 4U05A 4U6HB 2C7UB 4UTBL 3U46B 4P2OD 1KJ2A 3QS2A 4OD3L 5IREA 5BV7C 1H8OA 1WSST 1M3JA 5H4YA 5DMYA 4KFZC 1QSED 4NQVA 1M2VB 4OZHF 3BKYL 4OTXH 3QXUA 4GW1A 2OCCB 1FDLL 2AJ3B 1V7MH 4HIJA 5EIIA 3US9A 3ZQWA 4KY1H 2G2NA 5AB2A 3LTVA 4C83A 3IGFA 1MCJA 1QLFA 5EUOB 4KHXH 3D69A 3WNOA 5KBMA 4PJBE 3RZCA 2R69H 3G6JE 4D0CB 3WFBH 2WTRB 5I8CB 2J1WA 4EVNB 3WIAA 1ZAGA 1ZGLB 5PCYA 5KSAC 1QSZA 4ZG1A 3DKHA 4CC4C 3EJYD 4YDMA 5SV3A 1LE5A 4IBVA 3L3KA 4NKIH 4ICWA 4FNLH 1EZSA 4GSXA 2CPUA 4OZGE 5KVDE 4OTXL 1IAKA 2XN9E 3A22A 2BNUB 4ZUTA 3QXWA 3L17A 3OXSB 1V7ML 1MQKH 2HRHA 5I1DB 1J8RA 3AXLA 4GAYB 4AEEA 2WLYA 4HDIA 4ZX6A 3JTSB 4KHXL 2FK9A 2MSPA 2R69L 1NMAH 3HZYB 5AW0B 4XCYA 1C16A 4MLSA 2WSPA 4MNGA 2V37A 3TEUA 5FYJH 4CUCA 4QTFA 1YEEH 3D3VE 3LQZA 4XCCH 3VRJB 4NKIL 1AVAA 4JKKA 1B90A 1KCKA 2LHAA 3CBJB 5HI5C 5JORA 1MQKL 2X1QA 1BW8A 2DYSB 2AV7B 2GBAA 3HMWH 1VFBA 3JV4A 4BBWA 5LBVA 3DO7A 3O11B 3IF1A 3S36X 4TL5A 1NMAL 2VB5A 3PWPE 3V5KA 3MV7A 1BECA 3B2UD 1TZAA 5DS1A 4X7CC 3GJEA 5FYJL 4PJ6A 3CVHA 4WO4D 4AIEA 1DN2A 4XCCL 4FQJL 4LLMB 2EJ1A 1A22B 1MRFH 5LNDA 1NPJA 5T1KA 5FDWB 1J9CT 3T3MF 2YK1H 3NZ8A 5EO0A 3RJDA 3OLGA 2Z7YA 1FG2B 4G3YH 5FWQA 2RALA 4OKVB 1R5IA 3F7VB 4ODHH 4MSWB 1ZT4B 3S5LG 2HVBA 1J05B 1Z66A 4I9WD 4B3VA 3CFDA 1G7QB 2GJZB 3MFFB 5J11C 3F05A 3G5YB 4HJGA 2CPCA 5DZLA 3UZQB 4HS6B 1F4WH 4ILDA 1FO0A 2RQEA 2J6EA 4PRID 1MRFL 3MV01 1RVFH 3D5OF 4NP9A 3EYVB 1YO4A 5JW4R 1X4ZA 4YDIH 2E74C 2OPCA 3KWTA 3ZT5A 2YK1L 1TYRA 4Y16B 1TSHA 1IAMA 2CCVA 3BN9D 3VFVB 5BZDA 5TPWH 2IAMA 2OSXA 3O9WC 4G3YL 4ZOEA 4QJ3B 1WLHA 1MW1A 1DQMH 3LRKA 3ASNB 4ODHL 5GIRB 2NQDA 2OMTB 1A4CA 2FZ3A 4P46A 5B39B 4WWID 4WUUE 1TJMA 2QGEA 3QT2A 5A3IC 1YEWA 2CCWA 3RB5A 4MB4A 2HJFA 3C9NB 5CJ8A 5JW5B 3N50A 4JFDE 1RJLB 1Q9OB 3NQKA 2ZYIA 1F4WL 4WTXA 4PG9A 4ZNCD 3INOA 4ABWA 2Y7LA 3FCBA 2HSIA 2ZICA 3MPCA 4OB5L 1RVFL 4RFEB 4ZXBD 4WV1B 2LTQB 4QAWA 1R24B 1FC1A 4YDIL 5CZRA 2DWEB 2JKTM 4KROC 2Q10A 3WU1A 5IV2A 5TPWL 1RMFH 2DM4A 4KKBC 3NSXA 1S7UA 1DQML 3EJPA 5CM1A 2D2OA 2GTWA 2V8LA 2Z0UA 3PQYA 4L9LB 5T33H 3CX5K 1CD8A 4FQXB 5E1GA 4A2FA 5BRZE 2VXUL 3LVTA 5JA9A 1CXFA 1S7TA 5IG7A 3QQDA 4MCYA 1UD4A 2E86A 3S98A 1SJEA 2CDGB 4ICXA 5BUGA 4X99A 3VXQA 2VDKH 1GGBH 3C8KB 5D4QA 3TH4T 4N0RA 5CKGA 3FH5A 5EO9B 2QSVA 4JCMA 1D9KD 2GK2A 4PMEA 1SJXA 1TTCA 3K8MA 1YEDA 1JZFA 4ZUUB 4Y4HC 1J87A 1RMFL 1U92A 3DK2A 3HG1D 4WK4B 5C07E 4UTAA 3CAFA 3MRGA 2J55A 4U7KA 3UDWA 4DP2X 3TA3A 2V2TB 1I3UA 4E9LA 1GY1A 7PCYA 5DQ9B 1R3JA 3NCJH 4G7VH 5T33L 2O1AA 3QNZB 4FMVA 4HMCA 2E7HA 4PJDB 3D30A 1J1XL 3EBHA 4O9HH 4M1GH 2VCOA 3BAKA 4J27A 5ICZA 4PUBH 2ETWA 5JR1H 4GRLA 3CSBA 3DHMA 4JZOA 2VDKL 2OMWB 1GGBL 2OK0L 2YAQA 2GC7C 4CMMA 4YHZL 2LU5A 2OSLB 3CFCL 4QXWA 4JO3H 2WMPA 1QNZH 4BGLA 5B1CA 2Z3FA 3NCJL 2X09A 3MJ7B 1CO1A 4LLUA 4DVBA 1WRFA 3UTOA 5DJAB 4BSVB 4JFEA 4O9HL 2XG4B 4MMYB 4N0UE 2PP8A 4M1GL 2WY3B 5CNHA 2AANA 4PUBL 3Q2CA 5JR1L 1U9KA 3MJ8A 2BCKA 5GRJH 1RFDH 4XNZC 5B4MC 5JW4N 3LX9A 1A7RL 3ZGIA 2GG1A 3F7KA 2ITDA 2HH0H 4V1DB 2H3XC 3K6DA 4G8AC 3ULSA 4NO0B 5E4OA 2HPTA 2VLRB 2WW8A 4JO3L 4DN4H 4KKLD 1I1AC 1WZLA 5D1ZC 5IWLA 1QNZL 1YNLH 2GI7A 5EBMA 3SKMB 1HYSD 2FEJA 1MVUA 4U1JA 4KV5E 4M6MH 5AZUA 5K9OB 4KKNA 1KLFA 1JWMB 2OTPA 3K2IA 4XOEA 1ZEAH 2K0RA 4G80B 5DZPA 5GRJL 4DGUA 1RFDL 3BKJH 3JWNE 2HFFA 4MXVE 4RMTA 1MCLA 5D5MB 2HH0L 5C0AD 3T65B 2ZKXA 3N41F 4MJ6A 5T1DH 4E42A 3UGEA 4QI3A 2A99A 1T5XB 4DN4L 1FSKC 2FEEL 4NQDE 3WJLA 4PTUA 1YNLL 2Q9OA 3OG6B 4LLWB 2DLEA 2VMDA 1U8NA 3ZTJH 4JM0A 2ZSVA 2JCCF 4M6ML 3HNSH 4AC4A 2PXYB 2YPKA 5IROD 1KDJA 5KYYB 1VFAA 3DTDA 3LIUA 3DOSA 4DAGL 3BYYA 3I2CH 4U1KB 1HEHC 3BKJL 4KKCC 5EC1B 2EO9A 5C2UB 4YPGB 5FKPA 1CVSC 3HPLA 2VERN 4FXKC 1NICA 5T1DL 3GRGA 4JM2F 2IMNA 3GSVB 4B9ZA 5J6GB 4QF1A 4UT7H 4OUUB 4YDNA 1A7BA 1MJ8L 1VIWA 1HSAA 3OSVA 4H2CA 3SQBB 3J27A 1M3IA 5AFAA 4QRQA 2X4OB 3OF6A 3R0MA 2A83A 3DSNA 2YSTA 1WA2X 3HNSL 1EFXA 3RDTD 3T0WA 3ISRA 4QR7A 4EI5A 2A9NH 3GXTA 3I2CL 3IJ7A 5E9AA 4GH7B 1IVTA 1KBVA 3K74B 4LPTA 2VM3A 5HDLA 2C4XA 4TULH 3GTVA 3MRFA 4YBLC 5D9SA 6CGTA 1JYWA 3W38A 2VN4A 2OYKA 4J8RA 1U4FA 4L3ED 1RZIB 5GISH 5L8KB 1S7XA 2GW5A 3PL6D 3MLYL 4UT7L 3M45A 4HIEB 1UB5A 1RJYA 3MV8A 4K5PA 5MEQA 4PJHA 2PYFA 3S36L 3IS0X 2BY0A 1SZNA 5HYSG 1L5GA 3MRIB 2MNJB 5DF0A 2F2HA 1FNHA 1HEZB 3BJ91 1KTCA 3L2NA 3DBXA 4ZAKC 5G5DB 2A9NL 3L95A 5BV7H 1VFMA 2EDTA 3QPQD 4LOUD 4PRIE 4R4BA 2EYTB 4TS6A 3MBXH 4W9DC 3VFNB 3S37H 2V5SA 4TULL 4CSPA 4IRJB 4GUPA 4PY7B 3B8SA 3NGBC 3P4NB 4JDTH 2OTWA 3L4XA 5GISL 4Q97A 4C4UA 4YHMH 1IX2A 5GGTH 3QEUA 2CGRH 3ZN6A 1YEJH 4LLVB 2YIHA 1IEHA 1FZOA 4JFFD 5JXAH 5E4EB 4BKLA 2CLVA 25C8H 4C56E 3HHSA 1K5NA 2XI9A 2NYKA 1Q38A 3PDGA 5H37A 3I02B 5BV7L 4MXQD 5I74B 4N2HA 4GG6A 5GRUH 2KL6A 4MAYB 2XV0A 1ACXA 1EAJA 1GIGL 3MBXL 1UADC 3SGKC 2HN7B 4LP5A 1W8EA 4WU7A 3SKOA 4ACPA 3PPSA 4JDTL 4R3SB 4Z7AA 2VMFA 4UUJB 3U30B 1HI6B 3HAEB 4YHML 1QPPA 1SHWA 5GGTL 3T3PE 3S8WA 2DQ6A 2AQRA 1SLXA 2CGRL 4CADB 1YEJL 1G9HA 3MKGA 2OYMA 1YUKB 3NCYS 4G70B 1BQHA 5FXCH 3MJ9A 3WLWC 3WENA 4YWGH 5JXAL 1H9VA 4DZBA 1PKQB 3JV5A 3KJ4B 1XAKA 25C8L 4TUKH 3ZKSD 4NT6B 1MKFA 3OWEA 5DHDA 4RRPA 1NINA 3GZQA 3NAAH 1WBZA 2IANA 3AQZA 4OT1H 1EXUA 2MCAA 3LKSB 5DZVA 5EORH 3SOBH 5JIPA 1S7SB 2BY2A 1WFJA 3CFEA 4Y5VC 3WIIH 4ELDA 5GRUL 2WLLA 1GL4B 1AQDB 1TU2A 1HNFA 5E8OB 3PGDA 3CHPA 4X4YA 5IVOA 5ID0B 1PZ5A 2X6BA 2YRLA 5IOKA 3AT9A 3W39A 1GYAA 5BQ7B 5I1HH 2AMGA 2VR4A 2XQYK 3N06B 1R5VA 1T4KB 2D3VA 1IM3A 4ZMLA 1UTDA 3ARWA 4C54A 3VD3A 3AQXA 3T2QA 4QAMB 4KKRA 4YWGL 4IK7A 2Z92B 1MLCB 1F45A 3E3QC 4MWFA 3N44B 4TUKL 3UIYA 1SN0A 3QULB 4H26B 1XFPA 3CZSA 3QJZA 1QRND 1Y0LA 1IGIH 1VSCA 2NZIA 4OT1L 5T3XH 1E9QA 2RFXA