1FI8C

Rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
79
structure length
78
Chain Sequence
b'PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCLHRLGGKLENKTLEGWGYDYYVFDKVSSPIEPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NATURAL KILLER CELL PROTEASE 1
molecule tags Hydrolase/hydrolase inhibitor
source organism Rattus norvegicus
publication title The structure of the pro-apoptotic protease granzyme B reveals the molecular determinants of its specificity
pubmed doi rcsb
total genus 2
structure length 78
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1fi8C00
1EZSA 1N8OE 1FI8C 1SLVA 1EZUA 1SLUA 1XXFC 2Y6TE 1ECYA 1SLWA 1XXDC 1AZZC 4NIYE 1ID5I 1XX9C 4IW4C 1IFGA 1SLXA 1ECZA 1P0SE
chains in the Genus database with same CATH superfamily
1IAMA 5KYWA 3S96A 2UXVA 2ZNXA 3G5YA 2O5ZL 4ANVA 2E6JA 2CR0A 1YEKL 5IVXF 4FE9A 4EOWL 1QZNA 1R5IA 4XI5C 1GYAA 4PB9H 2W38A 4WSKA 1DQLL 2IH9A 5GRWA 1YUKB 2BNRD 3U4AA 5JHDA 3KLHD 3EGDB 1H8SA 2EYTA 1DSWA 4AM0Q 3L1OH 2EDKA 2F0CA 1OGAA 3ALXA 4P8QA 1MRDL 4UT9L 4E5XB 4JHWL 4X83A 3ZL2A 3BD3A 5TK2A 3I2CH 4KTDL 3D69B 5EEXA 4GYBA 3IT8D 4HX1A 5CBEA 4N4YB 3HE7B 3ZDZE 2Z1PA 1MW3A 1JWUA 2PETA 3QO0A 3CFUA 5FHAL 5C3LD 1SLVA 3AU1A 3RKDC 1CVSC 2FRGP 4G7YL 3ES6A 4B9GA 2ZXCA 5EIQA 1I8LC 5IB2B 2K6ZA 5AB0A 2IPTH 2DQCH 5KW9L 2GI7A 2NR6C 3KWVA 3NIGE 2NXZD 4XCCL 1BAWA 5DHVA 4MKTA 4Q9BA 1BYPA 1YYLH 4JM2B 4YFEA 4YOKA 4FMVA 5EF0A 5CP7B 1TTUA 1X9LA 1FNGB 1VDGA 4LCVA 3BDBA 7TAAA 3EOAA 1UH4A 1GC1L 2LOEA 1OAJA 4JFOA 4ZFOB 1PBYA 4HJ0C 1K4DA 3DVFA 3Q5TA 4ZD3L 1E9QB 1F3DH 2V2WA 4DEPB 2A4ZA 4LEXL 5KYYA 2NY0C 3CZLA 2BXZA 1A3QA 2ATPA 1ZV2A 3PGCB 5AAWA 2X4NB 4NRXA 2CIIB 1W80A 3HE7C 2NW3A 2LVEA 1FL3A 1UKQA 2XUWA 2B9AA 2L7JA 3WNLA 1HSAB 1FNEB 1OARL 1RPQA 2BSSB 2BK8A 4BJLA 4KVCL 4XPFL 2H2SD 5IVXB 4OZ4A 2M8XA 4AQOA 4BFIB 2OTPA 5CZKA 3EKCA 4LB8A 5IJKA 4KKAC 5IEHA 5L8LB 5GRJL 1L7TL 2F7RA 4RAUB 3S4SG 5F0MB 2DQEH 2YGVA 3STZB 2VRQA 4IOIB 3EJZD 3RWCA 1HK6A 5HGHB 1D2OA 1HX0A 1N2RA 2H32H 4L3CA 5D4HA 5AL8A 2P5WA 4POYA 3IFNH 3AMLA 3OPZL 4H8HA 2AABL 1JHTA 1BJ8A 3X12B 5T3XD 1JZIA 4JFPB 1WSST 4P5SA 5ADOL 3H7LA 2ZUVA 4CA4A 5DQ9A 1ZSHA 4HK3J 3F83A 3TF7C 4N0CD 2GSIB 2B59A 2YJQA 1OCOB 3W37A 1NGXB 4ZNEE 1JGLL 3VG9C 1JS4A 2KMWA 3VFWA 5I6OA 4IBQA 1NIDA 2J6EA 2VLLA 3CUPA 5K39B 4WK4B 3QRBA 3RVUC 2PXYB 5D70L 4AJ0A 2AVGA 2WLKA 3GSVA 2K70A 2HJFB 2RIKA 3ZSTA 5KAQF 1C5CL 1KY6A 3N91A 3HI6L 4FQCH 2P80A 5FB8B 3LSOB 1AXSB 2BS9A 4ELKA 3WELA 5DLML 1KCRL 3FMGL 2QVIA 1A9EA 3PIQA 3BAWA 3MRGA 4XZUA 4X80H 4GIPD 1ZOXA 4QAWA 1VSCA 2O6DA 4GI8A 2L3BA 3DVIA 4YC2C 1I7UA 4JANB 1RK7A 2ZP0T 5E6RB 2AS5M 1SDDA 4HUNB 3ZBMA 3OKMA 1T1ZA 4XRCB 4NPYA 1C5BL 3HC4H 2GC7C 1O5PA 1RK0B 2ICWI 1URLA 3K1KC 1A21A 1KN2H 2FBJH 2R4SL 3KBPA 3VXRA 5KG9B 1NTDA 1E30A 4FQJH 4OUOA 5DEJA 3T8XA 3H3KA 2Y5EA 2CO6B 3P9LA 4LLUB 5HJGA 3EG9A 5E6UB 1QTYT 4WI3A 1AOZA 1IC0A 1FRGH 1LXMA 2K3TA 3GO1L 3PDDA 3CVHB 3QDHA 1KGJA 1QPKA 3LAFA 3QZNA 5I0XA 2A73A 4ZTEA 1CCZA 2V5SA 2N0MA 4URKA 1RK0A 5I8EA 2ZUYA 1RZ7H 4H20L 4H8WL 5AW5B 4GQ9H 3FFCB 4Z7NE 3HUJE 4ATTA 2EVJA 2VT0A 3HNTL 2JCWA 4Y5XC 1NCCH 1Y6NR 3H4HA 5EZIL 3QXDB 3V6BR 3VB9A 3II1A 2HLEB 2KLRA 1HH9B 5INCA 4N5ED 4DZ8B 2P5WD 3E6FB 3L5WA 3ZZSA 1MNUL 3DURB 3PXJA 3ZKQD 4JHAL 4F15B 3X3FH 4ZDHB 1TTAA 2COVD 1LYQA 3D39B 1HE7A 3R1GL 4V1DE 5F6IB 2A6IB 1F3DJ 4F7EB 4XMLL 4KI5D 3T8XB 5JUEH 5C3IA 2BSEA 1HNFA 3D85B 5CM1A 2KUTA 1UH3A 3GBDA 1IKFL 1C1EH 2RA1A 4XC1L 1CI5A 3JZ7A 1B0RA 3VXSE 1BXAA 2AI0H 3H1ZA 3C2AH 4BFOA 1RIHH 4Y2DA 3EOYG 4PD4K 3CZEA 2VW4A 5I18L 3KYKL 3MJ7B 4N5UA 3QUXD 3W82A 5DDHA 4AVJA 5IJVA 5KJ7E 5DD5H 1TYJA 3RQ3A 1AZRA 1U2HA 1E8YA 1WAEA 2G4GA 2B8OT 3HAEG 3NN8A 3O81A 4YGVB 4F33A 3ZKSD 3TJPA 3DYOA 1A4BA 4YSOA 1MWAL 2DEYX 3LQZB 2ATKB 2BSBA 4PI0A 1RIVH 3MGTA 2DQIL 4KO9A 4LHJB 3Q1EA 5FOBA 5JHLL 2YOCA 3T3MF 5K9KB 5LGJB 2V17L 3RU8L 4ECNA 2ZAIA 3HG1E 4AGQA 3PL6B 1ZA6B 2CR3A 3DXAD 4GRLC 5D1QE 5L7XL 3VI3B 4ODBD 5TE4L 2H32A 4GAYA 1ETA1 3IAPA 1YMMA 1RUPH 3TV3L 4ZX3A 1CFSB 1P6AB 1MDAA 3L4ZA 1YEIH 4GSRA 3BRGC 1RU9L 2OMVA 4LPWA 4MKMA 4S0TD 3CDFA 3T1WA 3RX7A 3LVTA 2K1MA 2P8PA 3O0RL 1R5WA 3VW3L 4HKBA 1NQBA 1BM3H 1JWMB 2OJZH 1CLOH 3ARQA 3O4LB 3Q6GH 1HINL 3MCLL 1LD9B 4HWNA 3O6KL 4BKLB 3MR9B 1HCYA 4P2QB 5K9OA 3QDMD 5F21B 4LSUL 2ED6A 2IH1A 5DJDA 1L0PA 2EDHA 5L6YH 3OJDB 2IQAA 5E4AA 2WVSA 4A6YB 3RYMA 3VRIB 1GVIA 4XCYA 4I13B 1QEXA 2W9LA 3MV8E 4B97A 1HVXA 1Q9WB 1ZLVK 3TT3L 4Z23A 4MSWA 4JFSA 2VLJA 1M57B 3EF7A 2XZCH 3WY2A 1K8IB 3K2IA 1I3RA 1KT2A 2NY2B 1NCJA 1XDTT 4HWUA 4JO8A 4CC4C 4PY7A 2X3BA 4PP1C 4XPBL 4TLSA 2QV2A 4NNYB 1MCRA 1MCOL 2EO7A 5LAXA 3U2JA 3FQRA 5AKRA 1IFRA 3NYKA 4HUWB 2VOTA 5C07E 4AQZA 3QFJA 2GY5A 4PYGA 1CFNB 2WYHA 4ZXBD 4P48A 3WY1A 2R0ZL 5BS0D 4Y1AE 3NFSL 4YHZL 4P9ML 3HG1B 3PUCA 1OSEA 5CP7A 1MHCB 1BYNA 4LSRH 2R39A 1FDLH 3VI3E 3VSQA 4YS4A 3P9MA 3QR2A 4OFQA 3F7QA 2CO6A 3P9LB 4LLUA 1Q0XH 3ESVF 2O1AA 2ZKMX 1WCQA 4GQPH 1CT8A 1BFTA 3QXAA 4PLOB 4WJ5B 3LRGA 4P2OD 5DRNA 4U1JA 3L3IB 1W9XA 4TNGA 1DJWA 3WHE0 1T0NB 1IM3D 1GOGA 5F7UA 1AP2A 1INQA 4FFYA 5DZVA 3TJEH 4HPYH 3IN2A 4CU8A 3ZDXF 1D6VL 1ZTXH 3V4PB 1NSNH 4W9LC 5IHUH 4F5CE 3MLTB 1WP6A 3EZJB 2UZYB 2VDLB 3MRHB 1Z5YD 1MH5A 3OTTA 4WNQB 2Y0SA 2O93L 5K33A 3I2CL 4KTDH 3WMQA 1WISA 2YD7A 4GRWB 2XPZA 3CSGA 1QBMH 2VB5A 3B83A 1LDPL 3CHPA 3L08A 1Z9MA 3VFTA 1J0KA 4N25A 3DUHA 4D9QE 2EVIA 2IDUA 1L0XA 4KKBC 3D6GA 2JKWA 3UC0H 4XNZC 4G42A 1CT8B 2X1WL 4A66A 1E4XH 3VWKA 2NY1D 2GIYA 4U1HB 4DPRA 5ACLA 2L7QA 2QL1A 4GP5B 4K9EL 1Z0NA 5ICUA 4JKPL 4ZUWA 4NN5B 5EO1B 1PZBA 1HWWA 35C8H 4GSDH 2PO6A 4M3JA 2OX5A 3MROB 3DUSB 4ZMYA 3WBDA 4ZFGL 4HKJA 4X0KB 3HE6C 4P23A 4YDMA 2YGPA 3GUTA 1U92B 3GSOB 4YXKL 3N2JA 1N2RB 3BAIA 4PBVC 3T2QA 4D94A 1UXSB 3SN6N 1HAWA 5CN3A 2V5YA 4ONFH 4OM1L 3Q43A 3DHUA 2QR0A 3KPNB 1KBPA 5GZOD 1JPSL 4JGJA 4FFYH 1KWKA 4MZ3A 2VWEE 1I1RA 1RZ8B 3SOBH 1NC2D 1WS7A 2IXQA 2R2EA 2BHUA 2WANA 4LNRA 5PAZA 3QH3B 3GHPA 1A4KB 3PWUB 3TBCA 4WUUA 3V4VA 4NIKB 3NZUA 4FQJL 1HKLL 3GHBL 4NQTA 4Y1SA 5BOZG 4NRXB 2IQ9H 4HZAA 3SKJL 3V0VB 1U3HC 1U8KB 3TBWA 2B08A 4NQQA 1V05A 1MCKA 1G7LB 3AG4B 1JDCA 3IGAA 2APBA 1TMCB 4KX8A 4OZFH 4YZFF 2XTSA 4J2XA 3SKOB 3EG9B 3OR7A 3PAVA 5FM4A 4LFHD 3LH8A 5EUOB 3DK2A 5KVEE 4JDEB 4UAOB 2IDCA 4ZOAA 3VFUB 3U0PA 3KEHA 1OF0A 2WLLA 5ABAA 2G0LA 1MXDA 1PY9A 3O6LL 1QWNA 4NBZB 4F7KA 3HFML 2CJUL 3FU3A 3OAZH 2ITEA 3JWNC 1QBAA 2CQVA 2ZSWA 4QRTA 2EICA 1KGUA 1U8OA 3PWNB 4R4FL 5E8EA 1DVFA 3HE6D 4MJ5A 1X7TA 3JWNE 3QZWG 2ZPKL 1EHLL 4U1GC 2CCLA 2BERA 3P73B 3G08B 4IBSA 2FHCA 3O11B 2X4UA 1WA0X 1RMFL 3PNWA 3UTSA 1DQML 2XPGB 3OB8A 2FGWL 4L5FL 1KCRH 3FMGH 4JUSA 5T3XL 2RALA 5EV7A 2V37A 3FUHA 2QGBA 2BC4B 3SY0B 2W9EH 1UADC 3A6BH 3BAJA 3Q6FA 1Y6KR 5CJ5A 1VACA 4CMHC 1VIWA 1E4JA 3BEWB 3O45B 2F54D 4HJGA 3B9KD 1WWWX 4HKXB 4YDKL 1JZ2A 1H15A 1FP5A 2XVKA 5DA4A 2Y2TA 4HJ0D 3FL7A 3ZW3A 1LP9E 3L3DB 3SKNA 3MSPA 1A7NL 2ZNWA 1KULA 2AAVA 1PTZA 1QFHA 1XHHA 4YSRA 1FYHB 1BZDA 4P2YA 3QWRA 4ZMLA 3BHBB 1GGBL 1AG0A 2FEEI 3S8FB 1LHZA 2AI0L 5G5DA 1AHWC 3M17B 4XMXA 3VGHA 4BZ2A 3UTZB 4K3DH 2QKIC 2WAHA 4NKIH 3HNTH 5HDOA 1NCCL 4RFEA 1IAIH 3I75B 3FONB 4HH8A 4NKMA 2EIJB 3EYQD 3R06A 5IMMB 4C55A 2NXYB 4BH8A 5FUOH 1T03H 2ENYA 5DZJA 3JV4B 4YSEA 3PPEA 2VR9A 4MMXB 5I1KL 5L6YL 4DESA 1URIA 3V6OC 3MKKA 1E7VA 4BSJA 1AQKL 3HZVB 3VD5A 5E8NB 4CDGC 2OL3L 3QQDB 4WFFD 1QI3A 4JM0A 5C2UB 3GJFK 4G6JL 3ARGB 1NCHA 4MYPA 2R0LH 1BOYA 4GKSB 4GAAA 5ESAA 2BSED 4FFZL 4JNXA 4JRXE 2V6HA 3GBNL 4Y4KB 5D7IA 2H3XC 3LKPB 4PJGA 5CJOH 5LGYA 4AEHH 3EDFA 4N1HB 1AO7A 4W6WB 3U0TB 4TLKA 3NUKA 1ZPLA 5DHEA 5SWZD 3A22A 3E8VA 5TPWL 4D9LL 3GMOB 4OTXH 1NDTA 4M48L 3NCYS 1QSEA 3P4MA 1IB5A 3DRQA 4X9IA 3SKMA 2XACC 3LS5L 4BSVB 3GJEA 4HK0B 3F84A 2OI9C 4U3CA 2BOCB 3TZVA 5DURD 2FIKA 1X5FA 3V4UH 2GY7B 3RWJA 3HKZA 4MJIB 5B1BB 2OMUA 3I6GA 7PAZA 1PCSA 1FH5L 5DUJA 5DVMA 3QQ9D 2XNAA 1XGZA 2Z93A 2ZJSH 5D1QC 3RJOA 5F88B 5SWQA 2C9UA 5IROA 5T3ZL 4Q14A 1ZKAA 1TQVA 2AK4E 1E3ZA 3HAEA 3GXTA 4OU3A 4N8PA 1R0AL 2FEJA 1EDYA 2C9AA 2DI9A 3LKNA 2BY1A 3FBKA 4Q89A 2OSWA 1QLEB 2QVMA 4JMNA 3MNDA 3BQUD 1OP4A 1KFAL 4UBDD 4X7TA 3H7BA 4PRHE 3RWHB 3W38A 1F4WH 1AKPA 3G5YB 2MCG1 1V5JA 5AKTA 3LN4A 5I1CL 4IBTA 5ETUA 4G82A 4W9EC 2VAAB 3IJ9A 4NO0B 2OCJA 3U9PL 4XMKH 2CDEA 2M2DA 1YAIA 1ZJBA 3B9EA 4J4PC 1D5ZB 2FWLB 3LZLA 4B5ZA 3U7YL 3ZYJA 3VXMD 5TDNA 3MDJA 4K3HA 4PTUB 4NKQB 5DMYA 3O4LD 4KAQH 2N1KA 1DFBL 2Y5TA 1NANI 2JLLA 1MCJA 2X1XR 4JANA 3WXWH 1FHGA 3LNDA 4PJ5D 1A22B 4HXBH 1RZJC 1VZHA 4MMYA 2KQMA 2OXGA 2QDWA 2VLKE 3FCSA 3QEUB 3I6KA 4JVWA 4QOKB 3ECWA 1JV5B 1T66D 3QCVL 5IB1B 3CDZB 1ZS8A 4IU2A 4B9YA 4F7PB 2ORBH 3DO4A 3H42L 4JKNA 3F7VB 4N0UB 3KCPB 4AW4A 4YHZH 3K2UH 2EUWA 3ZE1F 3WSQL 4FQXD 1IIIA 3UZEC 1EBPA 3IETB 2A83B 3SO3C 3OMAB 3DDGA 1L4IA 4NSKA 1HS6A 1W16A 3JT0A 4FI8A 1K5NB 4MJID 5ELIA 5INDB 5JYLA 3C8KB 5LAPA 2YJLA 2O30A 3Q3GB 5SV4A 4LCYB 5HHMD 2SEBA 5ACMA 2Q6WB 3UC0L 5DJAB 4J23A 4EE2A 1R3IL 3GSUA 1JERA 4NQED 2P48B 1YO4A 4H8VA 3BAEH 4DFIA 3L5JA 1MHEA 4PH8A 4FGMA 1G6VK 4X4MA 2LV4A 3NSXA 2D8KA 4PGBB 3ARZA 3ZT7A 2X0VA 3D4YA 2DS4A 1K2DB 2Q8AH 1R17A 5FEBA 1UB5B 3BZEA 4JQXA 1CZ8H 1J87A 3H3BC 4DQOH 2IAND 2JFCA 4KDVA 4ANUA 1GH7A 4OD3H 3TYGL 1S7QA 1RZ8A 1SLUA 4M7KL 5GGQL 3S8GB 3O6FD 2BMKB 4WV1C 1P5UB 3T3PB 1OGTB 4GRLA 2R51A 3S96B 3OKDB 1COBA 3IU3A 4QRUA 4X8JA 4ODVL 4GG6F 3CVDA 3SEPA 3G5XA 1ICTA 2F8OA 3T6XA 2HTLC 4KXZI 1BVNT 1IM9A 1UYWH 4YC2B 4E42A 1XTLA 4TTGA 1NCWH 3N85H 4F7TA 4LSQH 4CVZA 3DXAE 1N7ML 5D1QD 4OUUB 3SQRA 1SJHB 1VCBC 1JZJA 3BW9B 2AQ3A 2AXGA 3FQWA 1AGCA 5H2BA 4W6XB 2QHRL 3T6ZA 3OPUA 1F3RB 1DVYA 3WFZA 1P7KA 2XG5A 3MXWH 1BX2A 2R1YB 2DKMA 3WIFA 1AQ8A 4CU7A 2GJJA 3PP3K 2I07A 1I8MA 4OF7A 1IVTA 2ZUTA 5J6SA 2HJLA 2BMKA 2BNRA 4PI2A 3GBLA 3V0GA 1WWBX 3VD7A 3QPKA 4X9HA 4B0MM 2HX9A 4NUMA 5GS0L 3HN5A 5KVGL 5C0CD 2IPKA 3ULUC 2H0FA 3L95A 2LAGB 3OKEA 4KUCD 1NC2A 1FUNA 3MJ6A 1TTRA 5I1HL 4XOAA 2B14A 4H26B 2K3HA 2LGNA 2BWDA 3O3AA 2YUXA 3Q5YA 1NCIA 5F0PB 1HEZA 5IHWA 3MRMA 3BKCL 3H9SA 4JFHD 4PVNA 5DHVH 1CXFA 4AGMA 2FX7H 1MOEA 2IBZY 3PFQA 3RNQB 2IWKA 3HFFA 3TX4A 1FAIH 4IKJA 3DX6B 3QPQD 4W68A 2DIEA 3TT1H 3WTYA 4GG6B 3U4KA 3Q2WA 3X3GL 1DJYA 2IOMA 2VXTH 3UYPB 4IRJD 4I87A 2YAFA 4HJGB 1MN4A 2CBMA 2ITFA 1P5VB 5LNGA 4JFEA 1T03L 4PRHB 4PJ9A 2ZQKA 2BNRE 4E41B 3FO1B 3A5VA 3HFMH 3TGXA 3DBSA 1RURL 2W0FB 3KLDA 3Q48A 4K0OA 5IG7B 1RPUA 3BRDA 4Z0XB 4UDTB 4YDKH 3GI8L 4AENA 1ETZA 25C8L 5FYKL 2QZQA 4G6FD 2A0LD 3O3DA 4FNTA 4YN3A 1T3FB 3DC0A 5BQDA 1M53A 1DQTA 5IQNA 3CVIH 1IUZA 2OR9L 2WXQA 3L7FA 1S3KL 3L1EA 5HHOB 2IADB 1U8OB 3MLRL 3PWNA 5DJAA 5I6LA 4UDTA 4XR8C 1TITA 3FSWA 5KOMC 1DLFH 1SY6L 2ZOLA 3CXDL 4KUCF 2V8MA 4CU6A 1A1NB 1YEWA 2IOOA 1PDKB 5EBWB 4N26A 4GEIA 4IEFA 5IESH 2MQ3A 5EU3B 4PP1D 5DJZB 2NY4C 5HHPA 1AS7A 2WINA 3BVTA 1RZIB 2GK0B 4AH2B 4HJTA 5DD3L 5JNYB 5A6IA 3NGBB 3L4UA 2VR5A 5JHDD 1XR8A 4XPGH 5EDXA 1AQKH 1YEGH 2BCKA 4WU7B 1N6QH 1OAXH 4YH6A 2WXPA 2ZCZA 3R18A 1G7LA 3SPCA 1BD2E 5FA3B 2OSLA 2F9BT 1AXIB 4P3DA 1U8LA 4QHUA 4P23C 2ITCB 1UD8A 2DAVA 3UABA 1M9SA 3WEBA 1CD9B 1T7ZA 2CO7A 4NO0D 4XODA 4ZNEA 1KTJA 1G5GA 2VDKB 2YXMA 3SYPA 5CEXA 4A39A 3ABZA 3EJQA 4YE4L 1QW8A 2H6PB 4OTXL 4AC2A 2KLSA 2F54E 3NIFB 1T1YA 4HV8B 1RZKC 4P3DB 4KZ0A 5IMOB 1NMCC 1YNLH 4ZO7A 3E9TA 1DJIA 4JN2B 3QJTB 4RH4A 4HWEH 1NJ9A 5GHWL 3E2HB 3V4UL 1D2PA 2CAKA 4UOW1 1MRDH 2TSAA 4JHWH 1G4RA 1MQKH 4GKNB 1MW0A 5F7EL 5CR1A 2BNQE 5T3ZD 2R0LL 2BHFA 5CJ8A 1JTPA 2WYIA 1S9XA 3DGCR 1NC4D 2P9RA 2WLHA 4FFVC 4NKDA 4F5CA 1NCAL 3D39D 5FYLD 4ODWA 3GB7B 2WNWA 2EH7H 2CHWA 4QLRA 4OZIF 5F2FA 4G43B 2WM0A 1J1XL 4QOKE 2MCMA 5IB2A 5MEQB 5DJXB 3K71A 2BXYA 3LPOA 3O6FC 1QTSA 4KKNA 5E70A 1E9PA 1ZD6A 5I5JA 3ASWA 2HH0L 5I6PA 5JXAL 4EI5B 4ZW5A 4PLJD 3EJCA 1BQLL 1SQMA 3UJJL 3MRIB 1D6EB 3UPCA 1LO5B 5AAWC 1QSZA 1Q0YH 4JZOB 1P4BH 4RFNB 3LNHA 2Q2LA 2JKLA 3P11H 3HRZC 4I4WA 2Y1YA 4MFHA 4XNUH 4KPHL 4EBQH 1R0AH 3KVDD 1WFOA 3F5WB 4WEMB 2J21A 3QHFL 5C0EB 4G7YH 1SBBA 3PHOB 2DIBA 4TQIA 2E7BA 2YWZA 4DF9A 5HJ3B 2YBRB 1L9NA 4FXKC 2N56A 2Q8BL 2C3HA 4FQQA 1FZJA 1BZ9B 1UA6H 3MBED 4IRJA 1H3GA 5I1EL 4KKPA 4FI7A 2WMPB 1WVZA 3RWEA 5IIEB 3I9GL 1IJ9A 1NUNB 3EO0B 4R7VA 5EEWA 3ULSB 3BUIA 3HC2A 5D7KE 1S46A 2ZSVB 4HKZA 2FZ3A 5MEOB 2V3EA 3TBYB 5K9QI 2AQNA 5DQDL 3DI2B 4XTRC 3P0GB 3QEQD 2JE8A 4AIOA 1H5BB 3G6DH 4O4YL 1RY7B 4LPVA 1CE6B 1KNOA 4JDTL 3ORJA 3LKSA 1IAKA 4TNEA 3V0WH 4W4NA 3P3UA 4GH7B 1AR1B 3VXUE 2I5YH 1FV1B 1KYAA 4NQCD 2PR9A 3RFZA 5TDOB 5GS1C 4HIIB 4OF5A 3LD8C 1HZHL 4KFZC 4HEME 5D7SH 4ZUUB 5I1DA 2DM4A 4XCYB 1KB9K 3KPQA 3DPDA 3K2UL 4KJYA 1KIUA 1SOQA 3HG3A 4M7LL 4OLWL 5EU3A 2CDGA 1IKOP 4EI6B 3UTTE 3GTNA 3FFCE 1OAZL 1PIGA 2IDTA 3JVGA 5IBUB 2VDML 3OLEA 2KC0A 4O51B 4DWHA 3FJTA 4I2XE 4RA3A 4YAQB 4ZAKD 4A67A 1ZT1B 4QYOA 3ZKND 3WN5C 4YHNB 4X8JB 3EGSA 4KMQA 2YARA 3GXDA 4LBEB 4KXBA 4P9HL 4EI5C 4WENB 5I1HH 3S35X 1XSOA 1IIKA 2P43B 2NZIA 2BRQA 3GBML 4OD1L 3O3EB 4A7TA 5KYUB 3W56A 4MZ2A 1FFPB 1MI5A 3O2VL 4GSXA 5MP6H 5KWYC 5CLYA 4PWIA 5LXGH 1W72B 3KJ4B 4JO2H 4LCWB 4R3SA 4YHYB 1BG1A 5FGRA 4PW9A 1LO4H 3BQVA 1SZNA 3MOBH 5F3BA 5I28A 1A1MA 3PY9A 4E9VA 2E47A 4G80A 2F08A 1GAFH 5E8OB 1ES0B 1FPTL 4QRBA 4AEFA 4AGOA 4CVWA 2YD9A 1GOHA 3GMOA 4HGMA 3N9GL 2X4SA 3OD3A 1PG7X 1B6DA 1E90A 3QORA 4A2GA 4LLYA 3IK2A 5B3NA 3MJ7A 2EXYD 3OQRA 4BRJA 5IGXH 1OT4A 1E6OL 2XFXA 4JL1A 2Y2WA 3BZFA 1I1FA 4I0KA 3X3FL 2ZG2A 5TJWK 4OCMC 3F85A 3NMEA 5IK3A 3H9YA 2NY0D 5HYSA 3MRMB 4WFED 3Q0HA 2BJML 3ALPA 4EIUA 3TEXA 4Z78B 3D50A 5JORA 1XF5A 1NFDB 1HXMA 3LIZA 2NY4D 2JF1A 4MQ7B 4PJ5B 4OZGE 1XF3B 3QNZB 5FCSH 5I18H 1RERA 1VPOL 3U36B 4JO3L 4HW6A 1HH9A 3DO3A 3CG8A 1IV8A 4BK8A 5EUKB 2PKDA 1I9IL 5DD5L 5T3XE 4RGND 5DYFA 1I7TA 4WI0B 1OAYH 1CGSL 4NNPH 5BV7H 5JORB 4ZFFB 2A5UA 4MCNA 3DX0A 4BV1A 1L6PA 2CNYA 2D31B 4MZRA 5CZRA 3JXAA 3T3MB 3TO4A 4UQIM 3HVNA 4QGYA 5EOTB 4UQEA 5J11B 1N0XL 3S3CB 1KBVA 3ULSA 3DHMA 3IMRA 3HKFA 3OKYA 4E36A 1HEJC 1GYUA 4G8GD 4ORGB 2GK2A 2R0KH 5JPNB 4WW2B 1SBSL 5DFAA 2FD6L 4ANXA 4WEEA 4KQ3L 2BINA 4L2YA 4PJ7A 5F9AC 4YE4H 2ID5A 3KEDA 3ZE1E 1BLNA 3VXPA 1L9QA 4H0HB 3IVKB 4HZ1A 4P2OB 2BP0B 1MFMA 5D4IA 5CZXC 1ZEAL 2LFGA 3BIKA 3LYRA 4NNXB 5B39A 4TSBH 7CGTA 2H26A 3AY4C 3KWXA 5AYTA 4WI7A 4NXSA 1ZRUA 3EH2A 3G6JA 3QFJD 5DD3H 1CE1H 3MUUA 2V17H 2D31A 4YDJB 3DX3A 3RU8H 4AVHA 5I6KA 3QFJB 2AEOA 4IM8A 2HJFA 1NCAH 1MCFA 3BMWA 1NEPA 3EBIA 4K8RC 4QXGH 1T6WA 2JTYA 4RX4D 1UWYA 3STBA 5ISZB 4PS8A 3T4AC 4PTTB 2AMGA 4R90L 4O2FA 1GY2A 4HDIB 4FQIL 4GKZB 3OJ2C 1W6LA 5E1IA 5D7LA 1CLOL 1X4YA 3H3PH 3Q6GL 3QZOA 4M43L 4MYWB 5D1XB 2K0RA 3FU9A 4YHKH 4AX3A 2N7BA 4HA1A 2H3KA 1USQA 2OFQA 3L7EA 5HYSB 4L37A 2WZAA 3WIHA 3WL9B 4Z7WB 2OLDA 3BXNA 1WIOA 5DJDB 5IEKB 4OQTA 1S78C 2MQGA 2UXTA 3LQAC 2P5PA 3D25B 4KO7A 2H45A 1CU4L 3HG2A 1N6QL 4BKLA 1U3HA 3ZX1A 1RZPA 4Z18A 4HH9A 5BRZD 2VDNH 4F58L 3LEXB 4GSQA 2EDRA 3FW6A 5F9DC 5AZUA 4KO5A 1YJDL 2XKUA 1LWRA 4DW2H 2Z7ZA 3NK4A 4AT6A 2NY7H 4BE6A 3S3PA 2B16A 4DETA 3WKPA 2JQMA 1BVZA 4JPIA 4HJJH 1I8AA 3HB3C 3V8OA 5IB5A 4Z7QB 4X6BA 1XIWB 4DN4L 4C56B 4BXVA 1CBJA 1BBJB 4IOSA 1D5XA 4S1RL 3SSGA 4B3EA 3JTBA 1UURA 1A5FH 1XF2A 4P99A 5E8DL 1CFMA 4IRJB 1DUYA 1CR9H 4NJAH 5IEKA 4M6NH 1QSFE 5G4NA 1AJ7H 3DO7B 3ZO0A 2BH0A 5DD1L 2VDPB 1IC5L 5I6XB 3GS0A 2NR6D 5T1MA 2WINB 2WQRA 1QLRA 4PJ8A 1GW0A 2Y07H 4L9LA 4ZW3A 5DUBA 4AIZB 5BOJA 3GPEA 1CFTA 4Y2DB 4LVEA 5CLTA 3SKUD 2JXMB 2OTWB 5CCJA 3IJEA 4WKZB 1PNDA 3HE7D 1ZT4A 3DDFA 1MSPA 1JWUB 3QO0B 3PHSA 4DAGH 2VLJE 4O9HH 2C3GA 2X2JA 1RZQA 4LAJH 3TTSA 3H2WA 5E1AA 5BZZA 4LCUA 3FUJA 5CZVL 3RBGA 3WJMA 1HILA 3U46B 2JJSC 2ZD0A 1FGVL 3MGTB 1MH5B 1DVFB 5MENB 5BPPA 2LTQB 1TZGH 3P30L 2XICA 4N8VG 1AMXA 1WZMA 4QHMB 1I3UA 1AO7B 4CNIB 4LKXB 2AJ3B 2Z9TA 3TA4D 2VSKB 5I75B 3UZVA 1Z9SA 4M56A 3NIGF 3MLPA 3JUZA 3EXLA 2XZQH 1AIFB 5HVHC 3QJUB 1A2YB 1UCTA 3NCEB 2W9DH 4LGPB 4U2YA 3V79C 4NAQA 2XJKA 3DOHA 4XMVA 4FQ2L 3RFRA 3WAKA 1GGIH 4IGBD 1FQ9C 3SHSA 1A6ZB 2YPLB 4M61A 4NZRH 1IJNA 1CXHA 1RJZB 1S5IL 3DJRA 1D5MA 2CLZB 3L16A 4AZUA 1D5BB 2DWSA 3ZLQC 5C09A 4AL8H 1I9RH 3O3BB 1CJYA 1I8IB 1SJEA 1AQDB 1TTGA 2QGCA 3BT0A 4JCLA 3CMGA 3MRBB 4LFHG 2JI3A 5HYJD 2RHEA 5FKAB 3KXFE 3UYRH 2G2RA 2BSCA 4JKKA 4QRSB 4B27A 1JFHA 3U48A 2I69A 4KHTL 3IMVA 3ZE1B 4GY4A 3UPAA 3MRGB 4AYFB 1ECYA 5CJQL 3SZ6A 1SDYA 1X9UA 1ZPUA 2UXFA 3KPSD 3PL6C 3SPGA 1TETL 3BLKA 3BP4A 2HG5B 2R23B 3WIFB 2BSRB 3FUIA 3A4AA 3MODL 3UYOD 2XG5B 4L1BA 3FFDA 5I19L 4AEIL 2CHXA 4N8UA 4ELMF 4D9QD 1XR9B 4ZRGA 3CX2A 4KTYA 1DANU 3BC9A 2HLFC 5GS3A 1O9VA 3JYBA 4CVZB 5C0CE 4ZS7H 2F61A 4HETA 1C12A 5I5RA 4HWBA 3MACL 5E56A 5HI5D 1XGQB 4NXKA 4UDUB 2F8XC 3GB7A 5AEAA 3QORB 1MUJB 1OPOA 2XA8L 4I18A 3LY6A 4LPCA 4PJBB 2RTTA 3SCMB 1GS6X 2YAPA 5FGSA 5FKPB 1G7PA 4Z3JA 5KN5A 2J1KA 3ESUF 4JG0L 5CBAA 4HEPG 1C5DA 1JN6B 2DI8A 1QUPA 4NUJA 3S3JA 2WD0A 5TGBA 3A23A 1UATA 4OJDH 4M6MH 3QI9D 4GUCA 1DSFL 4QI3A 2YPLD 3SY6A 5FXCH 2WTRB 1BZOA 1DBML 2ZCLH 2XXMB 1RJYA 3X1FA 4WWKC 3ULUL 3WNMA 3M46A 5FYLH 3RVVC 1RIUL 3C5XA 1XCTB 3PGDA 2GJZB 1DR9A 1DHKA 1NEUA 2YD8A 1CFTB 2WBJC 4F20A 1TZIA 4YDIL 3OBAA 1EPFA 4YLBA 5DZPA 3FHQA 4U2ZA 4A2DA 1T22A 4OAWB 5ABZA 4WJ5A 5L4MA 4YXLH 1A66A 1PKQB 2RD0A 2VZSA 5FUOL 3CFEA 4JJ5A 4TQEH 3LXCA 12E8H 1KF9B 3NJMA 3T09A 3UFIA 1EXGA 4Z7OE 5E03A 2PCFA 1ONQB 2YLKA 2R29H 3R4DA 2CJ3A 5DI8B 1WQVT 1H6EA 1E65A 2LU3A 2DJSA 1RUKH 3F64A 4FXKA 3AVEA 1F11A 4PJCA 4TS6A 2B1AH 5DHVB 3NVQA 1AHMA 3UO8B 2V9RA 3ZDZB 2R83A 2ADJB 5TE6H 4EN2A 3P3YA 4UILL 5HDQL 2ICEC 2VSDA 5LCVH 4UUJB 4XBGB 4A2EA 4R90H 5D6CA 3GEFA 2DV6A 1FVDA 5JIQA 2KT6A 2WWNA 5AOMA 2WBJD 1KNOB 4LRNL 5JMRA 3C09B 4MD5A 1ADQL 3RWGB 2DLHA 1H5BA 2VR4A 3DKHA 1ILSA 1HC1A 1FIEA 5HTSA 1D9KA 2Q1EA 3MQIA 4LLWA 4MLSA 4N8CH 5DJCA 4F7CB 2QQNL 5DXWA 5EZLB 5L9DH 2R9HD 3T08A 3IDJB 3ARBB 3GUTB 2CLZA 4CC0A 2JCCB 4P5TA 4AIEA 3QI9C 4TNVF 4H1LB 4QF1B 2J8UA 4A1RA 3ZK0A 1DBAL 4PLKD 5IFHL 3BO8A 4G6JH 2W65A 5GS1A 5F8QC 3TZVC 4KRMB 4IQHA 4AITA 2R15A 2QFPA 3P1VA 3HG5A 1IC4L 5ITFB 5DGRA 4X4KA 2BIIA 4J7RA 1EEYA 1R33A 2CE6A 4NFCA 1LLAA 3QDMA 5IMLB 1V54B 2HRPH 4OF6A 3VSVA 5J1AB 1BZEA 4D9LH 3WFDH 1GKOA 1KACB 3SE8H 3FNKA 4ODHH 4XCCH 5I1CH 2A9CA 4GG8B 1U91A 2F2HA 3KLLA 4S1RH 4C4KT 4AM0B 3ARDC 4OZFA 2X4OA 3T6VA 3MNVB 3NCMA 3IJSA 4JLRA 4ABVA 2FR4B 2Z8VC 3LH2H 4DERA 2OMUB 4KH9A 2J8UE 2WP3O 1S8DB 4P2OA 3SYOA 3IDXL 4Z7UA 4F1ZA 5T3ZH 1XB6A 4XN8A 3FRPA 1W8NA 3BIAX 4P06A 1XEDA 3MRCB 5FO7A 3RUGF 3TBTA 1BMZA 4N0CC 4HC1L 5E4IA 2QSCL 5D5MB 2X5PA 4ZS6D 5CHNB 3VFMB 4ABQA 3GSQB 1KFAH 4MQ7A 4R2GD 3VQ1C 1SEBB 3QIUB 1LE5B 3IETA 3PLYA 2B2XH 2OI9B 1EEQA 1PW3A 4ODWB 4V2CB 2F54B 3PUUA 5T1MB 3DBXA 4HT1H 4G7VH 1MJ8H 1MJ7L 3HCVA 4KBPA 4M1CC 5I16A 3ECQA 3ARDB 2DMCA 2EC8A 3KXFD 4N0UA 1R46A 2WY3B 1D5IL 1ESOA 3QG7H 1KXQE 1SOXA 3TOPA 1T21A 2ZG3A 4JO5A 2Y1AA 1YDPB 3W0WE 1NUGA 5KANI 2P49B 3EO9H 2Z0BA 3UAEA 4DP7X 4UQ2B 4FA8A 2L4OA 2OS7A 1ZLSL 4DTGL 1OZTG 4WV1B 1BD2D 2VDRL 3S37H 4P5TD 1SVZA 2GG1A 4HUKB 4LKCA 3GMLA 3EYUH 1N6UA 4ISVA 4LDCA 1DJHA 4S2SB 3V6FA 2X38A 1GOFA 2WWMD 4DKFH 2PR4H 2J20A 3CZUB 1DO6A 4HIQA 2VDLL 1E40A 3VQ2C 5E8DH 1H3UA 2CPCA 2Z31B 5A7BA 1CDBA 3MVSA 1PKQA 2YFOA 5HHOE 1RAMA 4MAYD 1EZVX 3ZQ9A 1VCAA 2W94A 1TZGL 4NBXB 3UG3A 4GXVH 5FDWB 1NPJA 3I84A 3S5LB 4Y5YA 5BO1L 4CADB 3WOVA 2WZ0A 4L8SA 3FQTB 1SM3L 4NWTH 1L9SA 2GJRA 3OZ9L 3GXNA 1PLGH 4C4UA 4KJYB 3TH4T 5JPMC 4LPTA 4ES8A 6TAAA 4TVPE 1W15A 1GGCL 4O02B 1MY5A 2H7WA 4LO9A 1NCWL 1ZA6A 3F2LA 4AJWA 4B3VA 3CH1A 3LVEA 1IQWL 3FN0L 5HJDA 2GBAA 2OA9A 3QQ3B 5C07D 3L48A 3T1FA 1KGCE 4OJFL 3FN9A 4JL2A 4G9FE 4M8RA 3SBPA 3WUWA 4E9QA 2J56A 3RZCD 2J55A 3TEZA 1F13A 2BY0A 5L2JB 4ZUSB 4M9PA 2DTSA 2HTKC 5I6MA 3DRQB 4HWBL 5KJRL 4OLUH 3P30H 4J3WA 4XBEL 3S48A 4IMLB 5JHDB 4PJ7F 1BGXL 4M7KH 3OXRA 3NDZE 2JNZA 2NX5A 4J3XA 3QPXH 4PJBE 3UZQA 1URZA 3FTZA 4PJGB 5KSBF 2YPVA 1E8XA 4OV5B 4CADA 5IJKC 2CDGB 4EI6A 5CD5D 2HPOA 1HL5A 2FBJL 4NFDA 1Z66A 3WO4C 2DQMA 3Q9PA 1AKJB 1TTFA 1E42A 3PWVA 3FO9A 5C0DB 2AJXL 2PPCA 1GGIL 3QZWB 4FNLH 2VAAA 3IAGC 1AY1L 4JFED 3JV5A 4OVUA 4X50A 3L81A 4XC1H 5EUOE 4RAVB 4KK8D 4ALAH 3US1A 3FHAA 4E9SA 3S97C 1BJ1H 1PIFA 1WZAA 3V5KA 3KDMB 2NYYD 5LBSL 5LXVA 4QXWA 1LO2H 1DJZA 3C6LC 4QMEA 5SX4I 5HHXL 1I1AD 3W1ZA 3ZZQA 1F58H 3OGCB 1X3DA 3QNXA 5BVJA 1D5BA 4I0PD 3KG5A 2AJUH 4RMVA 1NBYB 4PJBF 3QJHA 1LO3H 4PJ5A 5BUPA 5BVPL 1JNHB 1G1CA 3L6FA 3RWJB 1BX2B 2VJXA 3QP3A 3AG1B 3CX5K 2QPFA 1TG8A 1UOKA 2CM6A 4K94L 1AR1C 1GGYA 4LLMB 5M7QA 1J18A 3PFUA 4MCYA 3S4SA 4TSCH 1VHPA 5DJXA 3K71B 3CVIL 5HDQH 1FYTA 4RGOL 5BMFH 1KGWA 3K46A 2ENQA 1KTDB 1NCGA 4IBUA 3MACH 4BSWB 3D2UB 5EPMA 3NACL 3C6LB 3QNYA 1VAHA 4G70B 1J8HD 3AU1B 3UO1H 2JJUA 1Q9LB 5IQOA 1ZA3A 3RPKA 4NN5C 4EF3A 3CFKA 1PL3A 1VJSA 2WB7A 1NCDH 5HI3D 4Z7OB 1YJDC 2QQKL 4TSAH 1E5CA 4HQQL 1B4TA 5IFHH 3HC3L 2HRHA 3VTTA 2ESVD 1A0QH 1DL7L 3DSFL 1BP3B 2K4AA 3BFQG 1XGTA 3BVDB 5DJYA 2ZXQA 3EBGA 4OFYD 1RJCA 3FQTA 4CUCA 1Y1UA 4LHUB 1YEFH 3V4LA 1WLHA 5HYIA 1U8JB 4XO9A 2RQ8A 1YVLA 5BXFA 1NC4A 1I1AC 4FXLA 2J57A 2LR4A 1ACXA 3CH8A 4N1CA 1OTUD 3Q3GA 3NSCA 3WIAA 3LQMA 1HI6A 2NZ9D 2UYLB 2WLIA 4PSPA 4QNPE 4LP5A 1E2VA 4G8EB 1OSPL 2XVGA 3DUUB 1IBZA 2HVJB 3GSWB 4N8CL 1TJMA 4MXWL 5ICXB 1MJJB 3AROA 1EANA 3DX2A 1DLHA 4XPGL 5IVNA 1OTTD 3CPLB 2PN5A 2VDOB 1VFOA 3NSJA 1KB9J 3QDGD 5D8JH 2HKHH 4YHIB 4XP6H 5DJZA 2AJVL 1P4LA 5IVXA 1G4MA 3QEHA 3M88A 3QDGA 3DNKA 1P9MC 1YLBB 1P2CA 3QZMA 1ZS8B 3F58H 3LEVH 5F96H 1IC4H 3AM8C 1Z9PA 3OLGA 3PL6D 3EJRA 3GLDA 2C7UA 3N6YA 1GSMA 4FMFA 3US0A 3VH8A 4K8RD 4MBOA 3WDJA 1KZYA 4U1MA 1HCFX 1EZUA 5IW3A 2ADJA 3SE8L 4NQVA 2NQDA 5GGUB 4JX0A 1JXDA 3BKYL 5F7MC 3REWB 5K1JA 3U4EB 5AD0A 2HFEA 4L37B 4P9MH 2F53E 4UTAL 3IMBA 2P5EA 1HZLA 3E1F1 2Y72A 4FNQA 4LP4A 3SDDC 3VXSD 3AY2A 2WXNA 1ACYH 4OFKA 1ZHBB 2J1YA 1GCYA 5I1LB 1E0OB 1M4KA 5DLLA 5J3HC 1BWWA 3RA7L 1A14L 5F7DA 5EBMB 3CFEB 4JJ5B 2FJFB 3AQXA 3O4LA 4GINA 2PYFB 4JPWH 4WF7A 2YN3A 3IFOB 4F37K 4OT1L 4XN9A 5JQIB 4I3SL 5I8KH 4FADA 4HX1B 1W0YT 4U1KB 5A7EA 5CBEB 3FHEA 1A4JA 1ZT7A 3TJEL 1R5VB 1N67A 3QJQB 4IOFC 3BN9D 1KYUA 2PR4L 2ZXWB 4OFVA 3TZVD 1PD0A 4UM8B 5F3BB 2X70B 1VLXA 3V10A 5LHDA 4LIQE 1CK0L 4Z0XA 3MRIA 3EDKA 1XCWA 4IYKA 5BUAA 5F9WC 4PJ5E 1A9VA 1B4RA 2VIRB 2VMFA 1UHVA 3SE9L 1QI5A 5LJYH 3B5HA 1AYOA 5FKPA 3UYPA 1G7JB 3OZ9H 2UWEB 3MGAA 2XY1A 3TIDA 4ZMZA 3RY6A 5AYQA 4JRWA 2V2XB 3CHRA 3S37L 4YWGH 5AFAA 5JDSA 2EKSA 4NCC2 1ZE3H 5DQJB 5C08B 1BIIB 4FYRA 3CDCA 4FYSA 1MJ7H 1MJ8L 4HCFA 2P8MA 3HC0B 4PRAA 4S0SD 5J1TC 4MX7B 1JMXA 5DFWH 3IDMA 3D85A 4N0FA 2F53B 3LS4L 4LOVA 4YNYA 5GS0C 1CFNA 3B4NA 4K7PY 4U31A 2ZKYA 4Y9BA 3IDIA 1I7ZA 1YMHA 4U33A 1Y0LB 5F3HA 4BKTC 5J89A 3VWKB 4CC1A 5EF3A 5L0QB 2BVEA 4X7SH 4DZBA 4Z7OF 3V7AG 4FFYL 5I8OL 4GXVL 3O4OC 5INCB 1I9JL 3ARRA 4AQ1C 4DZ8A 3UEQA 1UD3A 1FBIH 4JDTH 1C7TA 5TDPB 3D0VB 4KKLD 1M7XA 4XN4A 3VVVA 1IGCL 1MVUA 2CJUH 2KZWA 3I9PA 4X5XA 2CO7B 5D72L 2Z3FA 3MJ8B 1U8LB 4U7SA 2IQ9L 2C3VA 3RVTD 1EK3A 3SKJH 3OKOA 1RJZA 5ICXA 2JV6A 4XP5H 2X3CA 5GZOA 2GPZA 5HDBF 3TFKC 5D7SL 1DVQA 3PJLA 3A67L 2BZ7A 2YR3A 3GXPA 1REIA 2P52A 5I0VA 3LTVA 2VABA 3TXAA 4EQ3A 1CLYL 4JN2A 3FUNA 5HXMA 5KTEL 3WKML 1CYXA 3NJNA 3P0YH 4QRPA 3VWKC 5J8OA 5KJRH 3V7AE 2PYFA 3D3VD 5DJ6B 4OM0L 4S1DD 3ZDYB 1ES0A 3A4EA 5EF1A 3ZSSA 4P3CL 1CICB 1IGML 1N8ZB 2EQDA 1OWWA 1SM3H 3L9RA 1PJ9A 3T77B 4M9OA 4KZEL 5K59E 5IBTL 1EHXA 3D3VE 2MOQA 1HHKA 1H3VA 2P5EB 2YZ8A 5AVXB 3QUZC 4XAKD 3T4AA 1GGCH 2YPVL 3NCFB 1PFOA 1N18A 2Y7NA 4OD1H 3CAFA 4BWWA 4ODUA 2WB1A 2IPUG 1MJUH 1EFQA 1AGFB 1A7NH 2AJXH 3IN0A 1I8UA 4X5QA 4FG0A 3MV8B 3QA3A 2F6AA 2MCAA 2VUOA 4XGZB 4M8VA 5DEFB 3IFOA 2MHAA 3EH1A 4AH2A 1GAFL 3K72A 1A65A 1PX4A 3S9DB 1G9HA 2D3JA 1I1YB 2EIBA 2X05A 4WVRA 5DWUH 3VWKD 3G9AB 4BA8A 3CSBA 3CXHJ 4R8WH 4ZMPA 5EU7E 1QHQA 1FFOA 1TNNA 2OBGA 4KI5E 4N2EA 2ZX8A 3UP1A 2MHAB 1ZIBA 5JIKA 1JHLL 1TCRA 4JFDA 4BFRA 2KQNA 2R2HB 4E2OA 3L7FB 3TFKD 3HR6A 3RIAK 1MIEL 5DMGC 2XIDA 1RUQH 3F62A 1CFQB 4RMSA 3IFNL 4GS7B 3SE6A 1HESA 3K2KA 2AV1A 1AGFA 2EE6A 3P77A 4G1MB 4XMPL 1J9CT 1FNFA 2CJTA 1T0MA 3CHSA 5MERB 3VCLB 3CWGA 5EBGA 4LSDA 4XB8A 5D71L 4PR5B 3BWZA 4MA8H 3GSNH 1GC1C 3FTSA 3OWRA 5TDPA 5H35B 3FFCA 3G6AA 3IJHB 4ZO9A 3WXVL 4NX0A 4LIQH 5I73C 4G1EA 1ILUA 1OK8A 5L8KB 1E27B 4L3EE 4WTZA 1BQ5A 4DP4X 2WKOA 1GHFH 1MFVA 4UTBA 4KJPD 1I7ZB 1CDUA 3B37A 4U49A 5IIEA 2HX8A 5AW8B 3F12A 1AHWA 4J4PD 4X4XA 3ZHKA 1AYRA 2J44A 1QASA 5ANHA 2H8PA 1MFCL 2WC7A 3PNRB 3P4OA 4HFWB 5TTRA 3V6ZA 3U79A 4WLCA 4F33B 3HB3D 3L7EB 4MHHG 4JM2A 4I85A 1OHQA 3VMOA 5FYJU 2CBQA 4PGEA 3WS6C 5ITBH 4OQ1A 1SHWA 2N01B 5JQHC 1UT2A 3WNIA 4KKCD 4A7SA 1JZ5A 4IMLA 3MJWA 3RVVD 3N41B 1F4WL 5DRXB 4FOMA 3R7QA 4FLOA 4L1TA 2YEZA 4XX5A 1CIUA 2BY3A 3FT2B 3KCWA 3H6JA 1YY9D 2WLNA 1A6PA 1M7DA 2X0UA 1RHHB 4N0UE 4PWEA 4X9FA 4IRSC 5IB5B 4Q4EA 3NRPA 5F7HA 2D2CC 4MRBA 3ECBA 4F92B 1PZ5B 3D8MA 2GHZA 5E9DB 2DJ4A 4H40A 5D8JL 2CKBA 1CXLA 5SWZA 4Q6IA 3BWSA 4BWUA 2PPEA 3NSFA 2EACA 4GG8A 1U3ZA 4UM9A 2HRGA 4JPVL 3KL5A 1NGQH 1UM5H 4YDLC 3O9WB 4OFYA 4KQ4L 4MNHA 2WZ5A 4P4RA 2FQGA 3QIWC 1RD6A 3C12A 4XMZA 3HI5H 3H3PL 1GMEA 2NW2A 3RP1A 1GPOL 4RGMB 2A9AA 2QBWA 5DHYB 2GSGB 4O2CB 3VNZA 4BDVB 4KROD 1CK0H 3RPIA 4IBLT 5GGVH 4MQSB 5GRUL 3GIVB 3VO0A 2QMKA 1B6UA 4AV4A 4PJDA 4MMXA 2EDYA 1EEZA 2IGFH 4Q9CA 2DH2A 3WENA 4U6HA 1LNUB 3OKEB 4IBWA 4W9ZA 4AKPA 4G2AA 5F96L 3AS1A 2APVA 2GJ6B 1NL0L 5B1CA 3CSPA 5IVOA 1UWFA 4PJFE 5H37A 1MF2H 4NNYA 2ZOOA 5F1SA 5EO0B 1ZWIA 2FEDC 1JOIA 5I1IH 4I89A 3RWIB 3ISWA 3BQUA 5B3SB 1P2CB 2WKLA 1CFQA 4RSYA 2XN0A 3KBEA 4JY4B 4EN3C 4JFXA 4IIQA 4ANWA 1CLZH 1VZGA 4OZFG 3HMWL 3SYQA 4F57L 4JZJC 4A6YA 3SDXA 2AJYL 4CN4A 2F54A 5BV7C 3WTVA 1P4IL 1KPVA 4DKEH 4WFHE 4DCQA 2YD3A 1NLDH 2RB8A 4KHXL 1CN4A 4DQOL 4L8BB 1EH9A 1KJ2A 1UVQB 1OE1A 2DZEA 4R4BA 5DT1H 4E9TA 2JIXB 3UTPD 4S1SL 2XWJB 3WIIL 4LARH 1TPXC 4D7PA 1J88A 3MO1B 4ZT1A 2YA2A 1TYEB 4M8QA 3NIGB 2NPLX 2Z31A 1U8JA 1G43A 2R1WA 5ICZA 1PMYA 3D69A 3OJMB 5EO9B 3BAEL 4OLVL 5JQ6H 3BKJH 4A6YL 4AG4L 4F2ME 3MRNA 3DLQR 3QEHB 1EA9C 1JPTH 3W2DL 3K6SA 2W9DL 3ME0A 2BVOA 4DUXA 4N2IA 1XQ4A 4N6RA 1E8WA 1FO0H 3WLBB 3QRGH 4CMHB 4E5XG 1DQQA 4EN3B 2ADIB 1M05B 4PGBA 3TONA 3M7FB 2H26B 1SFDA 5IOKA 1J8HE 3SB3A 1JRHL 1K5WA 3SQBB 5KBNC 5C6PB 2KERA 3AUVA 3IVKA 1BSIA 2GIXA 3NA4A 3ENEA 4PJAF 4R7DB 4K55A 5EO9A 1CDJA 4LSVL 4M1DL 3GXUB 3TL5A 2BNUA 4U4IA 1G7IA 2QJDA 3B9KB 3MV11 4X7SL 4EAEA 4Y2DC 4TUOB 1IBGH 4PBWD 1XSIA 2JIXA 3F8UB 4N85A 4KHTH 1C5BH 4NZTH 2V7HB 1MY7A 3SGKC 2QLYA 1MAMH 2QKIB 2F5BL 1CGYA 4G72B 2VLKD 5J6HA 5ENWB 3G5WA 3MLWL 4N2GA 3TO4B 2ALAA 2BRRH 1E4KA 2FNBA 4WTXA 5IFAH 1KB3A 4PSRA 5I17B 1A7PH 2XDHA 1PZAA 4IRSB 3I6GB 1A1OB 1IGTA 3B3IB 4XNXL 3CSTA 4XI5D 3NCCB 3G7TA 3S35H 5FCUH 5DS8A 3HS8A 3I85A 2LW3A 4AGLA 4AMWA 2Q7YB 3BCDA 1JNNL 4F7MB 4XNBA 4ZAKC 3FQXB 1KC5H 2AJZB 4G8FA 1YUHB 2X6UA 3HIZA 4LHQB 1MCPH 1CB4A 1TF4A 1MCHA 2QVFB 2XG4A 2WUCH 3P54A 3ZE2E 5E24E 3IU4H 5FUZL 3WE1A 5KYXA 2Z65C 3QDJD 1QD0A 3E80A 3SCMD 4MD4B 5KVDL 4PRID 25C8H 4MJIE 3M1BB 4DP8X 5D7KD 5J06A 2HWZL 4WGWB 4K23H 4RMWA 2NY6C 2YAEA 5JW5A 1RIHL 3G5XB 4ZS7L 3KL0A 1SJXA 4X6FA 3MA7A 3P0YL 4ZPVB 4M5ZH 1YQVH 3QUKA 2YAMA 1ZGLB 1LDSA 4GP8B 4HMDA 5FV1L 5F0JB 2DI7A 1E28B 3RGVD 1FLRH 2BSTA 2VIRA 3B2DC 1HNGA 3K74B 2YMXL 15C8L 1A1MB 1KXHA 1TVDA 3P9MB 4UMGA 1MWAH 3U6XS 4K3EH 1JRHI 5AWNL 2IWEA 2F8VA 4G9DB 3MRHA 3DVGB 1GZHC 3GXIA 1UXLA 3QQ4B 4N6RB 4JBSA 5FYKH 3WY3A 5EIIA 3HPJA 1VEPA 4WCYH 3VYNA 1BQUA 5L2KE 3P73A 4LZKA 3MBEC 3CN1A 5K93A 4UOQA 1OAXL 4YHOL 3VXME 4MJ5B 5BW7C 5DUPH 3QYMA 2EE9A 1RIUH 1AC6A 4JZJB 4GIOA 3MLRH 4BZ1H 1ACZA 5H37G 5BV7B 1H15B 1VKXB 1MPAL 4JS7A 4DP2X 4MB1A 1UZ8A 2YD0A 1HH6B 2VLKA 4L8SB 3QG6A 4XXDB 1J1OL 3Q6FB 4IHBA 4R97C 5LBVA 1J5OL 5IY5B 3VXUB 4JY5H 4YXLL 1DVTA 4G6AD 3SY0A 4WZ9A 3ZTNH 4MQTB 1O6TA 4UV7H 3TM6A 3UCQA 1OSYA 5C0FB 3ARTA 2OMXB 3SPVA 4KNUA 4UT9A 1ZV9A 3B9VA 3KCPA 2DQHL 4ONHB 3WS3A 2OQJA 1DUYB 4XWGH 5GHWH 3TO2A 2IPUK 5CS7A 3UAJA 3STZA 1WYJA 1YNKL 3GKZA 3LRSA 3PE9A 4X5WB 1OGAD 4XO4A 4OQTH 2JKIS 3AGWA 2CDFB 1FVDB 2GABA 1FF5A 1QFOA 4KQ4H 3QEQE 1QR1A 5E2UH 1ZVSB 3JVFC 3WHE1 2V2TB 1U3YA 3CZGA 3GMQB 3AUWB 1D5MB 4FG4A 1JSYA 1XCQB 2FH6A 4LCCB 5HDBE 4N0YH 1UJ3B 2O72A 5DFVC 5D6DC 4L8CA 2NNFA 5GQBA 3A6CL 1DE4A 2XN9B 4HWEL 3NOIA 3DUUA 1Z5HA 3GSWA 3OR7B 5E8PA 2B3RA 3U6RB 4YR6A 3KHQA 3NSDA 4MDIA 4WI9A 3UJJH 1MCIA 3WG7B 4ZMQA 2DLGA 4OGXH 5C0BA 3FQNB 3H56A 3QUYA 5DRZB 1GY1A 3V0VA 4CSTA 2FT8A 5CGBA 2PXYC 1UH2A 4HFUL 4JQXC 4X9BA 4DKTA 2DQDL 3U30C 1UFGA 5ESVA 3ZYIA 5D2LB 4Y4KC 3GSQA 1R3JA 1T20B 4G42B 3SGJA 3K72B 1JV2A 3M86A 4V11A 1MAJA 5E94B 3T2PA 4CC4A 1U2YA 1AVAA 5DR5H 2XNAB 1G9MH 2ROXA 1AD0B 1X6LA 1AGDA 4GUPA 4Y16A 4ZFOL 1CLZL 1CD1A 4PG2C 3S88L 3F7RA 3WCYA 1JIBA 1HCZA 1UT1A 2O5NA 1BQLH 5DK3A 1N26A 3LNEA 3AXIA 3LZFH 3QZLA 2BOCA 4NUJB 4UNTA 3TZVB 1UXWB 1OF2B 3U2SA 4AUYA 1Q0YL 2PF6A 1GGBH 1F86A 4AM0A 3U83A 1OE2A 5DT1L 2VXQL 5AW7B 3VXTA 4I18B 4XE0A 4TUUA 3SDCB 3EFOA 5FM8A 3FOLB 1KZQA 3FPYA 4MAUL 1AE6L 1E28A 4YSPA 4MWFA 1E4XL 4J3SA 4MJ4A 4OIBA 2DICA 1OW0A 5HHQB 1P7HL 3IB4A 5EU7C 3MA7B 2VZOA 1F90L 1M71B 1ORSA 2H8PB 1T04A 5MI0C 1NMBL 3ZL1A 5KSBE 3SPJA 3FYEB 1OEZW 3VG0H 3BZ4A 3ARVA 3RTQD 4YHMH 4RWYH 3RG1C 3BPLB 1EZSA 3IFPA 1M1XA 4Q4IA 5IW6B 4KKAD 3OAWA 4KWUA 1D5IH 2X40A 5GISL 5T1LD 2IDFA 1LP9A 2EIZA 3QNXB 2GJPA 2FT7A 1EFXD 1QPPA 1L3NA 4OF3A 3A47A 1NH6A 1NC2B 2F7QA 1FIGL 1KY7A 3QDJE 4JZNB 5AL0A 4AEHL 2X28A 5F71A 2DYRB 4X6DA 5TQ0L 4MTMA 3U4BL 3QIBA 4LLDB 1WV7T 3VXQB 4HGWA 4ABUA 1MLCB 2YC1B 4YSSA 2R8SH 4BINA 1S9KC 2JKJA 5JW3H 3U36A 2Q0ZX 3JVGC 1T4KB 3C5JA 4WEUD 2ESVA 3CC1A 2LLNA 3B34A 4PS3A 3TO2B 3C8DA 3LMJH 4NQUA 5AUMA 4L1DA 1HZHH 1G7MA 3IJ8A 3JQOB 2YMTA 4PBXA 4PHZA 3TP4A 2PTTB 4B9KC 4XPAL 3KE0A 4HULB 5CF3A 4BK5A 1TEYA 4MQXD 3NJJA 4MX7A 3WAJA 1A6WH 1GJUA 1KJ2H 5DI8A 1MI5E 2I7OA 2QPSA 4QHNB 3UAAA 3VI4A 3D33A 5MEPB 1BAFL 4J8QA 2BDNL 1BIIA 4O58L 1CO1A 1WD8A 4IOFD 4M7JH 5J6HB 2W0PA 5D2NA 1HHJA 5D1ZI 3TBSB 4LLWB 5I66B 1QFUL 4RFOL 1EZVY 4HD5A 4P4KB 2YK1H 1JTTA 2UY6A 4DN3L 1E3XA 3BESR 4LARL 2UWEE 3T4YB 1ZLUH 1F45A 5FUZH 3RAJL 2VCOA 1T5WB 1QI4A 5EU4B 3TN0B 1AXSA 5C0NC 3GKWH 4XMKL 2KKQA 3BKJL 4A6YH 3L9YA 1HZKA 3WLWC 4WU5A 3ERXA 1PLAA 4OCLC 4Y4FA 4MASA 1FO0L 3GUFA 4FXKB 4JO2L 4MB5A 1B9ZA 3GMMA 4XO3A 4NRYA 2BP0A 4QXUH 4EDWH 5KEZA 4WI5A 1U8IB 3LV3B 3IDUA 3PU7A 1N8ZA 3UL4A 4JFFB 1N12A 2DQ6A 2GITB 3IM1A 4WUUE 2DQGL 4OCSH 3EDDA 4HUCA 1JMZA 1NIAA 4KDTC 1Z6JT 2P8PB 4PVBA 2UY6B 1NCBL 1B2WH 3AZUA 2J1XA 4Z3GA 4Q9RH 4EVNB 1CGSH 2XYCA 2OJEA 3H9ZA 3LV3A 3DSNA 4IOIA 1NM9A 3RWCB 1KIUB 4TTDC 4WFHD 4WUKL 5E08H 4MD0B 5KSBA 4HIEA 1QEWB 3F65A 1KTKE 5DFVD 2F53D 1G9NC 5IF0B 4DP1X 1K8DB 1IEBA 1BVKA 3BN3B 3OM3B 1A4KA 1KTCA 3PP4L 5D55A 4CVUA 3MRRB 4K23L 4XHJC 2EKJA 4MMZC 1XV8A 1I1AB 2D03H 3ZMNA 4FFWD 1VPOH 5JPMA 4S1DC 5AZEH 4M5ZL 3L2MA 1JD9A 3NJKA 5BZXA 1BA9A 4Y9GA 1MIML 3A6OA 4FG6C 3RTLA 1HHIB 2C1PA 1TVHA 1PX8A 3CC5A 3DPBB 1OM9A 1QO3A 3FAWA 5EZPA 1N64H 2VMJA 1NOLA 5DO8A 2Y5TB 2GW5A 5I1KH 3LX9A 5J7CC 4JJHA 3F7YB 2DQEL 3SGEI 3BVXA 3SO5A 1E2ZA 1SHSA 5C0FA 1X7QA 5AW6B 1IGYB 3RB7A 1SEQL 1NIBA 1XR9A 4RMBA 4ANKA 4Q7DA 3MUY1 4KITB 5FO9A 4LVHB 4S11A 1HH6A 3NAAL 3V5HA 4RCAA 2VZ3A 2K6YA 4YBQD 2OP4H 3QQXA 3IGUA 4YIQA 3KZ8A 4IRZA 3PHOA 1R9FA 1JGLH 5FF6A 3TWYA 3HC4L 2GTWB 3X11A 2YMXH 1YA5A 1Q9KB 2QADB 4XN1A 2Z8RA 2AEQL 1FL6A 1UT9A 1A7OH 5D4QA 3U2IA 2FJSA 3QC5X 1BM7A 1IC1A 2VLJD 2QSQA 1B4JH 4R5TA 4LF3A 4MDJB 5TF1L 4HUXA 4NT6A 1WBZA 4XWGL 1WWCA 3HNVH 5K9KA 3ML9A 1GGUA 3T0BA 3X11B 4PJEA 3EOBB 5I1JL 3WJLA 3ZQXA 3QJOA 2MKWA 3WO3B 5DRNB 4Y4HC 3SZKC 4X9YA 1JZ4A 3QEQA 1JPST 4GSUA 5GSRA 2FAUA 3FTUA 5D2LE 4OFPA 3V5HB 5DVNA 3L4XA 3MRLB 1CYGA 5LGKA 5CR8A 3KBHE 1PJWA 3UBXG 4HAFA 5JOFB 2DDQH 2ETWA 1QWHA 4FULA 5DWPA 4CGUB 2VM4A 2NX5B 4JHAH 5CIPH 2LVCA 1ZLWK 5K5YA 5HBBA 1ECZA 1JPFB 5KANG 5C0JB 2CIKA 5CD3A 3GTTA 3VD0A 1I8KA 2AEIT 3LPGA 3LZFL 3UP6A 4Y5VC 3KJ4C 4BUQA 1CIDA 4YSDA 4ZFFA 3JV6A 3T1FB 2KLTA 3N42F 3NTCL 1BLIA 1TR7A 3OV6A 4BFJA 5AAMC 1BQKA 2CM5A 4KX9A 2FWSA 1QUNA 5E1HB 4PRDB 5JPMB 3JT2A 1JV2B 4HXBL 1ZVYA 2IGTA 2EC9T 3TVMA 4RGNE 3PQYE 5J11C 5F7YC 4AT6B 2XKNA 1CL7H 2BHZA 3ASOB 1NMBH 1MFBL 1OALA 1JZDC 3V5KB 1V55B 2WSPA 4Z78A 1ZCRA 3HZYA 3UTQB 1JPEA 2VJ8A 5DR5L 2BIPA 1G9ML 3BD4A 2XIBA 1C08A 4Y1AA 2X4PA 5BRZA 1U95A 1PU0A 3OC5A 3BZFB 1A5FL 3D25A 1GS7A 5DYOB 2MPVA 4EVNA 4NJAL 3SIKA 3TCLA 3QFJE 1YEHH 5GRVK 4JO4H 4HF5L 5AVSB 4P2RB 4CN1A 3BSHA 3MLSL 4KTEL 1X4ZA 2WUBH 4Z7NF 1GIGL 3T2NH 5FWRA 1FZMB 2A9BA 1KCWA 1AGBB 4GAGH 2Q76B 3RE0A 3Q13A 3RZWA 1MW2A 2CPUA 2OJ1A 5C70A 2G5UA 1HINH 3FU5A 1R3IH 3O6KH 1OM3L 1J48A 1HXYA 2WO3B 3QR0A 1J9RA 1JGUL 3IF1B 1NANH 1UUNA 2OULB 3QUGA 4JZOA 4A38A 4J3OC 3CBJB 4XX1E 3SJVB 2EAEA 5KJ4A 3N06B 4R5XA 2BOBA 1HKFA 4I5BA 4PV1C 2BVQA 1YEGL 3LRLA 4JDVA 2ZKHL 3N04A 4MAZA 5EU6B 1K4DB 2G5RA 2EUVA 3NZHH 3DX9B 5KBKA 5H94B 2HAZA 4KRLB 4R96A 1C5DB 5HJBA 5KSAA 2JB6A 4HXAH 2B20A 3SE4C 1UA7A 3HCVB 1RQ5A 4ONGH 5D1XC 2WXOA 4PM1A 2NYKA 2F74A 3D2UA 4YSUA 1N6VA 4KKBD 4G6AC 4NLHA 2DEXX 1KJ2B 4FQLL 2NCEA 3TBSA 1A7RH 1HEHC 2FGZA 4MAUH 2Y5QA 2HLAA 2ZE0A 2DL9A 1II4E 2YIHA 4IS6B 2VLKB 4J27A 3MLUH 1INDH 1H8OA 1B0RB 5FDWA 1VKXA 2YGOA 3DIDA 4QRPB 2C9PA 4GG6A 5HD8D 3LB6D 4HIXH 3BUQA 1TJIL 1CGTA 5DMJB 1H3PL 1UWXK 4AYBA 1G1OA 2XXFA 5FM5M 3NIDE 3GMPB 4G9FB 4LCWE 3DV4A 3NJLA 1IFGA 4NT6B 4L4VB 1FV1A 5GISH 3ETSA 3L3OC 5DEGA 1I8LA 1KJ2L 3OR6B 1AS8A 4ISVB 3BT2L 2AK1L 5C92A 4UU9A 2OYPA 4MB3A 1OAUH 3MCKA 3UC2A 3CSYB 1I7TB 3D0VA 4GT7A 1OHZA 1ZIAA 3HI1A 3KPSE 3OX8A 2CG9X 2VE6B 3B7TA 3BLPX 3HOGA 4PIBA 1IILE 1VF5C 5EDSA 2UZXB 2QT6A 4P46A 1PEWA 5DEGB 4JKMA 1IM9D 4X6CE 5FA3A 4WW2C 2YPLA 3I74A 4Y9FA 1F41A 3I50H 3JYCA 1IARB 1LEIB 3ULVC 1YMHB 1SMDA 1A1OA 1IGTB 2Q5BA 1NGPL 4KV5F 3WI9A 2AC0A 1AXTL 2IDSA 1EX0A 4HSAC 2BZCA 2W65B 5GS1B 32C2B 3JTSA 4ZXBC 3GSOA 3JWDH 2AQSA 1P4BL 4LASH 4HD9A 4TTDD 4OIIL 4Y89A 3ILPA 5ENWA 1R6VA 1MXGA 4MLIA 5EZLA 1TEFA 2DD8H 3D52A 1BQSA 3EYSL 4OZGB 3C5ZB 3L5IA 1O7DE 3JWOH 3WY4A 2XG4B 1RK1A 3PXHA 5F1NA 3R0MA 4XHJD 5C71A 4ZZKA 5BZDA 3BH8A 3OSVA 3FQXA 2P4AB 1BIHA 5DMKA 2B0SH 1I1AA 3PF2A 4R8WL 4TQHA 4PJXB 2GBVA 2ZWLT 5I1EH 3RRQA 5FUCC 1AMYA 1IRAY 1LM8V 1CD1B 4UYQA 1I85A 2P5WE 1KYDA 4DEUA 1E3FA 1PG7H 1AGEB 3KPPA 1FVCA 3O8XD 2CK2A 3T0XA 4DJMA 5KVDE 4DGYH 2LE9A 1KTLB 4OM1H 3VFVB 2APSA 4GIAA 1NGXA 1EAPA 1KPUB 1I1FB 1U91B 3M8OL 5EC2B 1O5DT 1R5VA 2YQ2A 4KVPA 3BEVA 4WWID 4JR9L 4ZNCD 1UM4L 1AGBA 2KL6A 5BQ7B 3ISRA 3UTTD 3T8MA 3GS7A 3V0WL 4M6OL 3FH5A 4YXHL 2AEPL 1TXKA 3WXVH 3ESNA 5IM7A 3H8NA 3E7JA 1UB6B 4Q9RL 4H4NA 1KN4L 4JFFA 4UT6A 3MTRA 5C6TL 1T2JA 1KTRL 4PJ8D 1JHLH 3IGAB 2HFGH 3AQDA 2GJZA 4XVTL 5I1GH 2DWYA 2J5LB 1MCSA 4XAWL 5IMOA 2VL5B 2ATAA 4JM2C 1RULH 2MQCA 3W39B 5E08L 4Z77B 2I7SA 1LEKA 4CKVX 2P24A 1JGVL 3MI6A 4FTVB 2KBGA 4FNSA 4XMPH 3BP7B 2MJWA 4B5EA 5FUCE 3HG1D 2B1OA 3RWIA 4BFKA 1FGNH 2IFFL 3Q2NA 3UDWA 3QUXC 3UG5A 1JZ8A 5HYJB 4A2FA 5AZEL 2BM3A 1R34A 4MMYB 2VXUL 3O2DH 1N4XH 3CMOL 1YDPA 3IDIB 3NESA 3HR5B 1J0HA 3KH3A 3VD1A 3FSVA 1PX3A 2J8OA 4PCYA 1EDQA 2XTJC 3EUDA 5F7KC 1T7XA 1FG2A 3CFIC 4JRXD 5DU7A 3EGXB 1B4JL 2A6DB 3NTCH 5IG7A 4Y4HA 1DQMH 5HHME 1T80A 2VXQA 4JFXB 3FO1A 2QQLL 4FHJA 4GW5A 3EBHA 5EBWA 5JHDE 1NAMH 1BVNP 2O6EA 1Q94A 4K3JH 4AXWB 1HSBA 3VFNB 3CHXA 1KLFB 1J1XH 3GSNB 4KKQA 1SN2A 5HI5C 4HS6A 4TUJA 3W9DB 3X1NA 1KJMA 2FEEL 1CVRA 1WT5C 4ZMWA 2NLJA 4E0RB 2JK5A 1ND0B 4K5LA 4N0RA 1CFVH 1HN1A 3IPFA 4DGWC 3VXUD 4DH2A 1RMFH 2YGNA 3GIVA 3ECBB 1G94A 5L2KD 3S8WA 3QG7L 4AMXA 2CBOA 1K4CB 5GGTL 4EMZA 4DGIH 1X5GA 4JEGB 1GIGH 1OCRB 3T2NL 1RUMH 4S1QL 4D0DB 1A3ZA 2SEBB 4JE4B 1F4XL 3QFGA 1G1KA 3BSZL 3PABB 3OZKA 1HXKA 3QHFH 5MEQA 4LSPH 5JOPD 1NL0H 5IJBC 1MUJA 4L9DA 3MRDB 3JTTB 5D7JB 3VXMA 3MUZ1 5BV7L 1OOAA 2D7OA 4IIQC 4UINH 2B15A 2BFVH 3CHQA 3HPLB 4YEFA 2XU9A 3AB0B 3FQWB 3RGBA 1GPOH 3ZKMC 2E9WA 1OGAE 1XH0A 4OUUA 2ICEB 4UB0H 3ZHFA 4Z7VB 4H26A 1ITBB 5IFJB 2V3FA 3EAKA 1SOSA 4P9HC 1QSFB 4MNGE 4I5BB 1QFWL 5IQLA 3T8VA 2E9JA 4HUWA 3AWFA 5K1NA 1EWHA 3IU3B 1T1YB 4HV8A 3MLVH 4ZXBA 3KDPB 3N40F 4MHHI 5A6LA 1QHOA 4LSTH 4E68A 2VM3A 1M2VA 4G8IA 3GRWL 4PJGE 1BOGA 3OG4B 5JA8B 1KEML 4GAGL 4EOWH 4JRXA 2VN7A 2E86A 3KPLA 4HBQA 1HOEA 2COQA 3KDMA 3BZEB 4JJOA 4NWTL 1PSKL 4JFTA 3GMNB 5FW8A 4LL1A 4P5KA 2QKSA 4U1LB 4GRWH 4K2UH 2AXGB 3QORC 4AKQA 2XXGA 3VRLF 3D9AH 5LNDA 4LL9A 3WTTA 4EUPG 1JPTL 2NY3C 2R29A 3TPUA 5L2KB 1VGEH 4GQZA 2YPLE 3RHWK 3L4CA 3I9IA 3QVAA 4L2LA 4QOKD 5HDWA 3TA3B 5JDSB 4KQ0A 2ITDA 5E9NA 3HS9A 1UJ3C 3LZRA 3MUJA 1JRHH 4KKCC 3MJ9A 1E27A 2CRMA 2VDRB 2H6UA 4XBEH 2WUBL 2VDMH 1ORQB 1QRND 5E8OA 3SQOH 5J13C 1DZ0A 5CWSB 4QHKJ 3DHJA 1A7RL 2YRZA 1CFSA 5C0AA 2LHAA 3L3KB 4N3UA 4XNDA 4P4KC 4Y1AD 5B7FA 1K3ZA 1DUZA 3MREB 4OZIB 4XN5A 1WWAX 3RILA 4BD4A 2CDFA 2V7NB 4GXFA 4K15A 2IANE 3DX9A 3MRNB 1KB5A 3KGTA 2J73A 1WZ1L 3RDTC 5IB1A 2ZKHH 3QQ3A 1EJ8A 4H0GA 4ZD3H 2NY3B 4TNWK 2MMXA 1FORH 2IFGA 1Q9LA 1G6RL 1JK8B 1UASA 4NUGH 2ZTBA 2FECI 1WJ3A 4KKZA 1YYMH 1FFOB 4BFFA 2D7NA 4N5EC 1OAQL 5DA0B 3FT3A 3T77A 1FPTH 3WEAA 3Q8AA 2AJSH 2WO4A 3WJJA 4L9LB 3MRLA 5I74C 4R7NA 3ILPB 4ZI8A 4RZKA 4H44C 2HKFL 2Y36H 1DVZA 1DDHA 3H0TB 4FFVD 2E27L 4N2AA 5I75C 2ORBL 2OZ4H 4FCAA 2DTML 3QAZC 3T3PF 1BXXA 5AENA 3MBEB 1H3PH 2P5WB 3WEOA 3NJGA 4FLQA 1WBZB 1XGRA 2YXVA 3NJFA 3DROA 1PYWB 3ARWA 5AW2B 3KPRE 3RFZB 2IAAC 4ZYKA 1U8QB 2VITB 3BAXA 5ERWB 3V6FB 4LASL 4N2BA 4AYFA 4G9DA 3BT2H 3MRFB 4N9GB 4NDMB 3J8F7 1QRNB 3VFSB 1F3JB 3PV6B 1PZDA 2EH8L 2PWDA 2Z31C 5FKAA 5LBSH 1M1SA 3MXVL 3AABA 2AEPH 3ZR6A 4QCIB 3U1PA 2FYYB 3F6IA 2VSMB 1KBKA 4PRDA 1EEZB 4JQVA 4ZPTA 2IG2L 5B1KA 2IH3A 2AJUL 5C0GB 3UTOA 1QOKA 3H42H 5DJ2B 3E38A 3I3DA 1SJVA 4BQCA 5BRZE 5F6HI 5CZVH 4GT0A 1XEUA 2QQKH 3BJ91 1A25A 5DD0H 4ADGA 5H2BB 3SKMB 3WSQH 2BNQD 1CDIA 4AE1A 1R3LA 1PS3A 1KOAA 3DTXB 3AMKA 3HMXH 4MNQB 5GRVL 4FP8H 2WQWA 2GEQA 1SDDB 2HUEA 1OQOA 4MJHA 1FC2D 2XBZA 1A3RL 4I48B 4KKRA 1UOWA 5EWIH 4LCCC 2UX7A 5EIVA 3NH7H 5CIPB 5ISZA 3UO1L 2X6VA 3ROLA 1UXWA 2R0WH 3U2SB 1EXUB 2MNJB 5FYJH 3T0VA 2HN7A 3R4RA 4Q8BA 1IL1A 1OSPH 1C9SA 3FOMA 4EI5A 3VDBA 4MGXA 4WCYL 3QIUC 1KEGH 1H6FA 2CXKA 1QWUA 4NZRL 5DLMH 1MCCA 2DQJL 1EHNA 3D4CA 3Q2CA 3ML8A 4WUUD 1RJLB 4NJ9H 1KXTA 4RZCB 4OJAA 2FL5B 3EGDA 4FEIA 5GGQH 3C6LA 3QNYB 1I4FA 2CLVA 2AQ1A 2X89D 4KY2A 4G43A 4Z7NB 4HGKC 3F58L 4KK9D 5AALA 3CFJA 2E76C 3CVBA 2XXCB 4DGUA 1GA2A 5SWZE 2ZAHA 5FYJE 3AWGA 1BFVH 4OKDA 5KVGE 3BWAA 2V9QA 2AXJA 2F18A 4JMXA 3TNNA 4ZMXA 4OI9A 1JUFB 2DN7A 1W6WA 1WZLA 4Y4HB 2FATH 4IBYA 3STLB 5L88L 3K6DA 1JWSA 3KS0J 2CNZA 1OCZB 1IKFH 4JY6B 4D2NA 1N70A 3WLBA 4EN3A 1BQRA 3QAQA 3ARFA 2A9NL 4PJHB 3X3GH 2VDNL 3PDGA 2VM9A 3HA0A 2X10A 5J12B 3QYCA 3IMSA 2Z7UA 2DKUA 2OZNA 3MCKB 4GJTB 4V2BA 2NY5C 2YKLL 4R97B 2H41A 4QHUB 2EYRA 3Q2LA 4J8RB 4JDZB 2G0KA 1D7BA 2F68X 4HJEA 4YFLI 1ZT1A 1W0VA 3IJYB 4HJJL 4JRYD 2FCBA 5H37H 1R3HA 1Z7JA 1XGRB 1HQRA 5DEZA 5HYFA 1BYOA 1DVXA 3MBEA 3W9EB 4KJQC 5B1JA 3A6CH 2A4CA 5CD3B 1A4CA 1C1EL 2VR3A 1P1VA 5CJBA 4Z76A 4BCXA 1L0YA 4U7MA 2X6BA 2GT9A 5LG6A 4AYID 1THAA 4N2NA 3FDWA 4O2FB 1A14H 4P2QA 4U1HA 4HZLB 3S36X 5GIRA 2OKMA 3FB5B 4BQBA 2HFFB 3BWUF 1KLUB 2MH4A 3GRWH 2C8NA 4QYAA 3U0PB 1TQCB 1CDHA 3VFUA 4KY1L 3KGUA 3GM0A 3HRPA 3IRCA 4W1TA 3RWHA 4FYQA 2ZF8A 4I1PA 4TM9A 4D9RD 4BFGA 4LE8A 3C6SA 4LP8A 2G2PA 5L2JA 5BRPA 2LU5A 2CD0A 3MV8A 3OC8A 5CGYC 3WDHA 3S5ZA 2FBOJ 4MZIA 2JVUA 2LLGA 3WFHB 2VC2L 4BIKA 3HZMA 4JFUA 4ZMOA 1P4LB 1ET7A 1U8KA 2C26A 1QVOA 2WXLA 3LD8B 3TBWB 1C16B 3P4NA 5IHZB 3THML 2DF3A 2VN5A 3SDYL 1TQSA 4FXGC 4JPKL 3EUUA 1IGJB 4PGCA 1OXYA 5GGTH 5DHYA 4DGIL 2BCMA 2XA3A 5HI4C 2VAJA 4DPAX 4NO0A 1SGKA 3ULVL 3IGFA 3SQOL 1RP9A 2UUDK 1EEYB 5HHQA 3QE5A 4JQIL 1RUAL 2O61B 4GLRI 4BSWA 5HGDB 3TCTA 3ZIYA 1YY8B 1NGWB 2FECL 3F5WA 4WDIB 1HHJB 2XJLA 3POHA 4XTRD 2BFVL 1CGWA 5EOQH 5CAYB 3PAZA 3FU8A 3WFCH 5HYSG 3HG1A 5ICYA 3DI3B 2XIIA 3KPRD 4U6YB 5JIIA 3W3BA 4NQSA 3ULVD 5TD4A 2JKNA 4N3TA 4Z5RB 1PD1A 4KJPC 2E8YA 2QTEA 2A6IA 1HHIA 2C1PB 3CC5B 2BDNH 2G3MA 5FA4A 1VESA 4Z8FL 2ZP8A 3WKMH 4P59H 3QO1A 4FHBD 1G7HA 1HHGA 4M3KB 5IREA 1TU2A 3KYMB 3QIBB 4LLDA 4ZX5A 3VXQA 1RHFA 3QUML 4Z5RA 3FH7A 5DS1A 1J8HA 1FNLA 4B9PA 3W5MA 5F9OL 4YNYB 2CCWA 4PV8B 4ELMA 4JGNA 1MFEH 1LL1A 1WFIA 1I8KB 3L3JB 4K2UL 3QUMB 4MCYB 3INUL 1TFHA 4V1DA 1TOXA 2VMDA 4X5PA 5HD8C 4MMZB 5F89B 1TQCC 4LLYB 2QHLA 4GRWE 1TSHA 3CFNA 4L8DB 2AANA 3KNBB 4OCXL 3FT4B 2D9CA 3OKDA 3WN6A 4P46B 5HPMA 3EO1A 1BREA 2CJSA 1E50A 5SWSB 3AT8A 1QYGH 2CU9A 2P26A 4OBSA 2H1XA 1E5ZA 2WBKA 3GGWA 1NCBH 2JJTC 1XZ0B 3RUGA 1SJMA 3K5SA 1TO4A 2ENSA 5C08E 2VDKL 3FQUB 1QVOB 3NEXA 5ACZB 1U8QA 2YN5A 3I9GH 2HUHA 2WLMA 2WJ5A 1E6JH 1RUQL 3EADA 3LQZA 4U1KA 2VKXA 2VXSH 4HVBA 3ZR5A 3Q9QA 5JR1L 4OGZA 2ZWZA 3WTUA 5B39G 5DHXB 4XPTL 4Y1TA 1A7QH 5DVOA 2WKOF 3AT0A 4UIMA 1RV6X 3NH7L 2DQGH 4NQEE 1W0WB 4QXVA 3MNZB 4X6EA 4YZWA 1KG0A 1T89A 2AITA 4MSWB 4JKPH 3KWTA 3VI3F 3MLYH 1XO8A 1MIMH 5B1AB 2B9BA 1LK3L 1UA6L 3MGOA 1KJ3L 2HP4A 3MRPB 2ZKXA 4HS8H 1MHCA 4NP4H 1XMEB 1KXVC 3U4EA 3FFDB 4FA7B 1TJGL 1BFOB 2PWEA 1TKWB 2Q7AA 4AQ1B 2AZUA 2YQ3A 3UROR 1EUTA 3NA9H 4M7LH 4OLWH 4B60A 5A1AA 5EO0A 4C56A 5C0CB 5E4EB 1XCQA 4LCCA 2C7UB 5A3ID 2BY2A 3RJDA 3E0GA 2GBUA 2OMVB 4MAYB 5C09D 3SDDB 5EEVA 3EYQC 2R2EB 1ZHKB 5LKNA 1OCWL 2MOVA 2PXYD 4OIAA 1TPXB 4LRNH 1HWHB 1KIQB 2OZ4A 2I5YL 5IF0A 2CA4A 3EYVB 4Z7UE 4BKSC 4RIRA 4GBXC 2XWTB 3B56A 3ECVA 1RVFH 5I1AB 2VL5A 1I9EA 3SJVE 3ZHLA