1FI8C

Rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
79
structure length
78
Chain Sequence
PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCLHRLGGKLENKTLEGWGYDYYVFDKVSSPIEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NATURAL KILLER CELL PROTEASE 1
publication title The structure of the pro-apoptotic protease granzyme B reveals the molecular determinants of its specificity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 2
structure length 78
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1fi8C00
1SLXA 1XXFC 1ECYA 1AZZC 1XX9C 4IW4C 1SLWA 1ID5I 1SLVA 1SLUA 4NIYE 1N8OE 1EZUA 1ECZA 1XXDC 1FI8C 2Y6TE 1EZSA 1IFGA 1P0SE
chains in the Genus database with same CATH superfamily
1YYLH 1MREL 4Z7NE 3TWYA 2E4TA 3BC9A 3IDIB 1JHTB 1D3CA 1NGPL 3QWNA 4L4TA 5IFAL 2CCWA 1LXMA 5JW3L 3CZLA 2H32B 4Y2OA 5CBEB 3E0GA 4LGSB 4Q6KA 1FUNA 2Y36H 3UO1L 2CBQA 3AAZB 3G5ZA 4NKMB 1CPUA 3DRQA 2R0WH 3TN0D 3EW3B 4YVUA 2AFNA 1OAUH 2VQUA 3VD9A 2ZXQA 5I0VA 5KSUB 2JI2A 2VQ4A 4KX7A 5IB1B 2GJ6B 1AJ7H 3SE8L 3ASWA 4AEHH 3O6KL 1KIPB 2BIOA 2JQMA 4PRPA 1UWGH 3LH2H 1RMFL 2PETA 4OT1H 3P77A 5FPIA 2WNKA 2NRDA 3GTNA 4KKAD 4M61A 3TONA 3GD1C 1BBDH 5E2TL 5C3TA 5ISZB 5TE7L 2Z92B 3K6NA 2BCMA 1H8LA 4PB9L 2OL3A 3NQIA 2Q7AA 3MLSL 1FHNA 4POUB 3BPNC 3GBDA 5TF1H 2IPKB 1I8UA 3INUH 4XGZA 4XNQB 1NPUA 3WD5L 4GT7A 3NZUA 2HJLB 4ERSH 2QMJA 4ORZC 1AZUA 4GG8B 4ZFOB 1VKXB 4HAGA 1U58B 2CMRL 4KJQC 1YMMA 3SE3C 2NY5H 4BD4A 4G2AA 5LNGA 2CO6A 1N2RB 2NZ1A 4BM7A 3EJYC 1E9QA 4KK8C 5D2NB 3N2JA 2WXKA 4XXDA 4HUCA 4AGQA 4N8CL 2JCCA 1HZHL 4NEHB 5DURB 2XKSA 1PG7X 2WTPA 4NCC1 4GH7B 4XZUB 3WFEL 3IJEB 3HCVA 3MV8D 1AY1L 1O7SA 2WZPA 4EXKA 4DESA 5CD5C 1QUPA 2C4FU 3AG3B 1RZKC 3FZUD 4BRVA 4Y16C 4LCVA 3DURA 3H8NA 3QWQB 3MJ7B 3GZQA 4XNBA 1BEXA 2WJ5A 3CSPA 3EO0A 1VADB 4DN3H 2BXYA 3VD2A 5AAMC 4NFCA 3AC0A 1C12A 1D5ZB 3GM8A 3WEMA 5GGQH 3HOGA 4PJAB 4OTXH 3BLKA 5H37A 5AG9A 1U8PB 2ORBL 3CDZB 3CDYA 1UGNA 3TGXA 4XI5D 1AKJD 2XN2A 5BVJA 1E9PA 1KCVH 1AO7B 3L13A 4Y5XC 4EI5D 3BX7C 3N85H 2NXZD 3GXPA 1V3KA 3A3YB 1A64A 3VX0A 1IBGL 2VLME 5E6UB 1T0PB 3WFBH 5L2JB 1ZDQA 4PLOB 2WAHA 1BAFL 5HHQB 3WIFB 1VIWA 4B6ZA 3D0AA 1IKFH 3N5AA 5AW4B 3V2AR 4GKNA 3ZDYE 3BAEH 1MCBA 1M9WA 3LKSB 3RJOA 3FF8A 4ABWA 4G6AD 1NLBH 2ICEC 3NT0A 4M5ZL 4JRXE 4NP4H 1FO0L 1VGKA 2NPLX 4EZJA 4L5FH 5CWSB 4OM1H 2VXUL 2YPKA 4LLVA 4YHZH 4HCIA 4NQCB 3SY6A 4HIPA 2A9NH 3KPPB 2XWTB 3RDTD 2DKSA 3CZNA 5DJYB 5AYTA 3CHQA 2F8IA 4Y19B 2NW3A 2YD1A 2JJTA 4KO7A 5K9OB 1ED3B 4G8GA 1IGYB 4N3TA 1TQCB 4L1SA 1L0XA 3QNZB 5EN2B 2AJUH 3EKCA 3DXAD 5MEOA 2FGWH 3FN0H 4PWIA 3GEFA 4Y5VC 3GSWB 3X13B 2O6EA 2ZWZA 2IFGA 1IAMA 3ROOA 3X3GH 4A7QA 2ATKA 4K8RH 3KWTA 2VDMB 1EJ8A 3RP1A 5A2KH 1CYXA 1KULA 1BD2D 3NEXA 1EHLL 3CHXA 2X4UA 4JO4L 3B9KD 1C5DA 1ZSHA 3CSGA 2V6HA 4OV5B 1NM9A 1HYRC 1UOLA 5DJCB 4GKZA 3R1GL 4MJ6A 4OAWA 5MEND 5MEPA 3R8BB 1A4JB 1FSKC 4A39A 1H8NA 2XZAH 3LRMA 3WJJC 3U9WA 4LSPL 1JGLL 1KGXA 1BAWA 5F7DB 4QXGL 2AK1L 2X9YA 4YFLF 3C60D 1CK0L 2DIBA 4I5BA 3T0VA 4P06A 1EA9C 2HFFB 3OJVC 3DVIA 1E2VA 2KYIA 1OPOA 2ZCLH 5F6HJ 4L4JA 4YDIL 1NEZA 5HPOA 2WC7A 1N4XH 1XF5B 3D9AH 5DD5L 3IDGA 2QGDA 1IAII 3LH8A 5HYSB 2Y6SC 2BSEA 4WK2B 5DO2C 5H37H 1MY7A 3ATDA 3I6LE 5E00B 4YXKH 4XN5A 5K9JL 1G6RL 1EJOH 3FAWA 5AKSA 1HILA 3VXRB 1L6ZA 2B08A 4ACPA 1G9NL 4P59H 3NQKA 4IGBB 1T7VA 2ZOLB 5J7CC 1IMHC 3FPYA 1S7UB 2FQFA 5FUZL 1LWHA 1FL3B 4N8PA 1MWAL 2PXYB 3CZUB 2R2BB 3GSVB 4XXCC 4OW6A 1PKQE 4X42A 1NFIA 4WJ5B 3EJZC 3ABGA 1Q72H 5IBTH 4L23A 1KYOK 1VPOH 4P2RD 3BRGC 4J4PC 4X9YA 3QRGH 4LHUB 1WCBB 1MAMH 4TQHA 1QP1A 1O9WA 1PZ3A 1RZGB 2AI0L 2EC8A 1ZHNA 2MFNA 3MREB 4I88A 5E95B 4L29A 2KZKA 2P8LA 4UTCA 3MBEC 2FATL 3DMMC 4W9FC 1QRNA 2OTWA 2W88A 2QSCH 4ODXA 1FBIL 4DQOL 3DX6B 1NEZG 3DK2A 2JB6B 2YFOA 3HMWH 3FQUA 5D96C 5FYJU 4F9PA 5KYUB 1LEIA 1UXSA 3PPSA 5JPNA 5D7JB 3ELAT 1XCWA 5DQ9B 4MB1A 1CICD 4PTUA 1IAIM 2AJZB 1E28A 1TENA 2G0KA 5LN4A 5I74B 4BQ8A 4Z7QB 2YD4A 2J25A 4GT0A 5C08D 4I7ZC 4XN4A 4XBPA 1KCBA 3QZOA 4OSUH 3S3JA 2HT3C 3HE7C 4NO5A 2BNRB 3GFUA 3G04B 2AMGA 3ATFA 5GS1B 1KFAL 4NI6A 1XF4B 2SEBA 2PPDA 4WI9A 3F83A 1FN4A 2A1WL 3MV8E 1HJCA 3IU4L 5EHFA 3TNMB 1IBBA 3G08A 3HI5L 3F65A 4WI5A 1A9EA 2HFEA 3FBKA 4XCYB 3L81A 3V0JA 2LE9A 4HPOL 4LSTL 3UOAB 1A6AA 1UQSA 1QACA 3MCKB 4APXA 2FSDA 3LNFA 1W72A 4NNYA 3VTAA 3AS1A 2DEXX 4YL4A 5KVDE 5I1LA 3OF6D 1FI8C 5DRZA 1Y6KR 3N43F 4FI6A 4HX1B 3BH8B 5I1JH 4LO9A 3P30H 4Q8BA 2D31A 4NKDA 3ARFC 3LQZA 4NNPH 4NRZB 1ZLSL 3TJHC 5HDWA 4M1GH 3L4UA 2AQSA 1WA1X 1C7SA 3G6AA 3TBVB 3VWKB 4HEPG 4OCRH 5C0IB 3KBHE 4HIXL 3V4PB 1S9KC 2DB8A 4JN2B 3TO4B 3WLBA 3M7OA 5JDSB 4P2QE 4R90L 4Q9RL 5DEFA 4OKDA 1IIKA 3U9PH 1GL4B 4TUJB 1JWSB 3WNIA 2UX6A 3CG8A 1MCEA 3IVKB 4P46C 3AGWA 4NM4H 3O81A 3BZ4B 3O6FC 3RVUC 3WAKA 5C0RH 4HS8L 5CJ5A 3UBHA 1H6UA 2KT6A 4G1MA 5AB9A 4M6MH 5D4IA 5I16A 3DUHA 2C26A 5DJ0A 2Z7WA 5DHYB 3JWNG 4GRWF 1LO2L 2BRRH 4RMVA 5JW4Q 1UD2A 4HDIB 4YJZL 2AEIT 4NWTL 3U0TA 5F7MC 4MD5A 2YN5A 2AQQA 3GMPA 5AVRB 5E99L 2VN4A 4PJBA 5FOJA 1KSRA 1MVUA 1FNAA 3DOHA 3RIAK 3RL1B 3QG6B 1BF5A 5IHUL 1MPAH 1YC7A 2Y4SA 3DROA 4QHNB 5DLML 3QEGL 1JPFB 1RH8A 4XNUH 4OUUB 3LNDA 1KGYE 1A7QL 2VXQL 4MA1B 5C0BD 1K8DA 5KVDL 4GP5B 1S9WA 4WV1A 2A6KB 3F7KA 2ZUSA 3GHBH 1NFDB 4HUVB 4WI0A 1BD2E 1YEJH 3E1ZA 5GS3A 1KPUA 3UTQB 4IQHA 1IQDA 3TVMD 4M7LT 2PPEA 3HIZA 3CXDL 3VGGA 4A6YB 5J89A 5HJDA 1RIUL 1QATA 5C07D 4ZMNA 2VXSH 5GPRA 4RGND 2I5YL 5IBLC 2WLIA 2ADFL 1M2VB 5I6NA 2EEFA 2ZNWA 5H8DA 5EZOH 5E9DA 4LVEA 5GZOC 3WTTA 1E4XL 4PM1A 3FO9A 1W0WA 3FH5A 4HZAA 1TJGL 1TMCB 2YXFA 4JFTA 5HI4D 3FQTB 3V6BR 4DP6X 1FFPB 4N0YH 5SWZD 4D3CL 2ADYA 2A9MH 5TD4A 1SYVB 2X38A 1L9SA 4YHLH 4TRPL 1QSEE 1RVFL 1XSIA 4NFBA 3TWCH 3G5ZB 1ZIAA 1R46A 3PHOA 4Y1AB 4G11A 2N4IA 3V0HA 3OGCA 5EF1A 4OF7A 1VLXA 3BW9B 4HH9B 4RAUA 5JHDD 3HZ3A 3RHWF 1DQMH 3CIQA 4R0LA 1T5XA 2C1PB 2FSEB 3OKEA 4HCRH 3FYIB 4L05A 1GPOH 2EXWD 4XMVA 2GEQA 2BMKA 4M8VA 3RNKB 3RBSA 4TL5A 2Z0UA 4ZMYA 5HI5C 3ZYJA 4AV0A 3QQDB 3M7FB 2CKNA 4M61B 4NXKA 4AYSA 2XOTA 2GUYA 5C0GB 2NX5B 3TS8A 3UYOD 2XBTA 4O00A 3VFTB 2VSCA 3ME0B 4PJ9C 2X05A 2OL3B 3AWGA 2TSAA 4NQXB 2EDYA 1EWHA 3J07A 1EDYA 2JVUA 1R5IB 4XGZB 4KNUA 5GXBB 4P2RE 3V4VH 1NCCL 3WGUB 2G4GA 1BVKB 1N12A 4KQ0A 2V7NA 3ARDC 2AVGA 2CLRA 3MOQA 4BFGA 5D7IB 5ESQA 3T4YB 1HFUA 2RCSH 5DD6B 4KK6C 3U6XS 2WYZA 1JZ8A 3I9PA 5EMYA 3FT4B 1OTTD 4UM8B 3PV7A 1KIRB 3W9EB 4MNQD 5B4MD 5LXGL 2IGTA 3HZKB 4FRWA 5DC9B 1VHPA 4QF1B 1YEKL 4AY0A 4HGWB 1TNMA 3DHPA 4QT5B 2MCPL 2GIMA 1S9VA 3EJSA 3D3VD 4TPRH 1J0HA 4YDMA 3U4EA 5TDOA 3IXAA 1FDLL 3IJHA 1U4FA 4J2XA 3KPSA 3A67H 5LCVA 5C08E 3UAJA 1J0JA 4HAKA 1IT9H 3BSZL 4BK5A 4ZQKA 4BQ9A 3VD1A 1CT8A 1NDMA 5L2KD 4ZS7L 3HFFA 3O3UN 6TAAA 1JDDA 1FVCA 2F68X 4X0KB 1RK0A 4NOFA 4E41D 4XPAL 4LRNL 4BEIA 1ZVSA 1MHHB 2ZJSH 3QIBA 4H8HA 4E5XA 1OK0A 3MX0B 4LSSL 3VYPA 2EYRB 1SXBA 1ECZA 1UG9A 3E6HA 3ARGC 4IIQB 4HOWA 3A6BL 2WWNA 3KL0A 3L3GA 1AAJA 2CK0L 4U6HA 4ODUB 4GRMA 4ZTEA 4Y5YA 1JN6B 1QBLH 3K8MA 1MCOL 1IC7H 4J3OC 2F5BL 5GS0H 5LGKA 1T80A 1GW6A 2YUWA 5ENWB 5IBUG 4MVBC 1IGIH 5GRWA 3WJLC 3NFSH 3OB0H 4PRHA 2GEEA 5I6OA 3Q44A 5B1KA 4NPYB 2UWEB 2W60B 3G3LA 1VGKB 3S96B 1EAPB 1KZYA 5EA0H 3ZE0B 4BRJA 5D72H 3AS3A 1JHLH 2PKDA 3MV11 4L4VD 1T2XA 1KGJA 3SKNB 3L1EA 5F0LB 3Q0HA 4KKNA 1WIPA 2E7LA 1ETJA 2XSKA 2VNCA 1N0LA 5LQBL 3PXLA 2L7EA 3F7LA 3RI5F 4AIEA 1UT1A 4DJMA 1WP6A 3V7AE 1TFHA 2X3BA 4JY5L 1WCQA 1IEHA 1FWXA 5BZXA 3ROOB 2DJSA 3O9WD 2ENYA 3WL9B 4AVIA 4MZ3A 1G1YA 3G9AB 2NXYD 1TETH 5CEYB 1NBQA 2BIPA 2X4UB 2ITDA 2Q8BL 5DJ6A 4JGJA 1T4WA 5IW6B 3FT1A 1IAOA 1T5KA 1WGVA 2LV4A 5SV3A 5JHLL 2HJFA 1HVXA 1JVLA 4ZYKA 2F19H 3B2VL 4LCUB 3WY4A 4B95C 1AHKA 2BIMA 3SDDA 1QPXA 5MEPB 3QO0A 2YPVA 4IU3A 2VDOL 5BRZA 1BXAA 3LZQA 1EAOA 5INDB 2BM3A 3NIGF 3OZ9H 3EFFA 2PWFA 3P73B 1CFTB 3C6LA 5DUPL 4XWGL 3RUGB 4C55A 4OFQA 4ZFFB 2FT8A 1J5OL 3H2QA 2XQBL 2MRYA 2P4AB 4U1NA 2KC0A 5LCVH 2WQRA 3FYEB 3ZDXE 4BCYA 5DFAA 3POHA 3ZKXC 5IFJA 3V0FA 1NEZB 1MCWM 1ZT1A 3KJ6L 4ZXBC 1CXEA 3AY2A 3DTDA 3IDGB 3OKDB 3S3SA 3QE5A 5D70L 3ZL1A 4NO3B 4NAQA 1F4XL 1WLHA 3HLAB 4PWGA 1Q1JH 1XGQB 4JM4L 5C09A 1A7PH 5KBDA 2FT6A 2YZ8A 4NQEA 5SWZE 4Y8DC 2OI9C 5E6IB 1DEDA 4U0RC 3JTTA 2QVMA 3ZHNA 1KYUA 5AW5B 3IFPB 5LXVA 1AZRA 1MFVA 3RWJB 4LAQH 5ANME 4Z5RB 2DRUA 3FH7A 1CFBA 3GXUB 3PL6D 3KYNB 4Z7NF 1QNZL 3S35L 4IBUA 5G2NA 1NFIB 2BP8A 4LU5L 4PGCB 5JHDE 1EDQA 1ZLEA 3LX9A 3LEXA 1QLFA 1CBJA 1C16B 1HT6A 2QKIC 4M5TA 2XVKA 1NL0H 1VAHA 1ZHNB 4Z95H 4MJ2A 4OCMC 3B56A 3QBTB 4L29B 4XT1C 2E74C 4K07A 5DVOA 1UKSA 4YWGL 2P8LB 3UERA 3GK8L 4RRPA 3S35X 1MXGA 1QRNB 1WFIA 1UC6A 1AR1B 1WBZA 3AM8C 3QJOA 5CP7B 5GS2D 2DQCH 3B83A 4XXWC 2NR6D 2JXMA 3FQUB 3C12A 4LBEA 3T2NL 1UXSB 15C8L 5CSZB 2LU3A 3MV9D 4PTUB 1F6AA 2VRKA 1E28B 3SDYL 4HH8A 2OCJA 3C87A 3ECWA 5KOMC 4AMWA 4MNQE 1I1YB 1I1FA 1TR7A 2FBJH 2I27N 3ARED 4TN9A 1P1VA 4NO5B 1EHKB 3KPRD 5IMOA 4MA7L 4AVHA 1DJWA 3ILQC 5DFVC 1J1OL 4K73A 3MVSA 3P4MB 2GY7B 2I9LB 4J3WA 1OE3A 2H1PL 2F5AL 2IH3A 4R9HA 3OQRA 2IO5A 4W9EC 3GI8H 4EDWL 5CZKA 3ZL4L 1K3ZA 1A9EB 4HJEA 4JFYA 5CF3A 2WO2B 4ZNEA 2V5TA 4JMXA 4JRYE 2DMKA 5DDHA 3IMWA 1W72B 2ZXEB 4NNYB 5L2KE 2DLHA 2XJLA 3MTXA 1IC0A 1UA6L 1NGQH 1TTAA 4E41E 4P4RA 5KVMC 1NBVL 3TBCA 4A2LA 5T1KD 2NNFA 2D31B 2R2CA 1UOKA 5TF0A 4KTDL 1OPGH 4WDIB 1YEGH 3U7YL 4N1CA 3QXDB 1CXKA 1X5JA 3MGTA 4F8PA 1NC4B 3UIZA 1TVBA 3V8OA 4W6XB 4TTGA 5F9AC 2ARJQ 3BQUC 3JVGA 5IHLB 4P05A 2MTAA 4QO1B 2CGZA 1ZLUH 1JNNL 3VQ2C 3Q6GL 3MNVB 3DARA 2X12A 3MXWH 4Q6IC 1NAMH 1M6OA 3NTCL 1E4KA 4FQXC 4NN5C 1TZHA 4G71B 4IKLA 4X6BA 5IT2L 1GJIA 1RPUA 3PNWA 3U7AA 5F7EH 4GSXA 4FA8A 4L4VE 3MLXH 3VFUA 4PS4L 2QADD 4N0CC 5IWLC 2H0FA 1HCZA 3QORA 2ZYHA 4YL9A 2CD0A 4Q9BA 4S0HA 4FL4B 1MCIA 4KVPA 3ZDYF 3GMPB 3SE4A 3QPQC 4OLVL 5IOKA 1IBDA 3WEAA 1HTYA 2F8OA 4M9PA 4XP6H 4CDGC 5CD3A 4N22A 5INCB 3QUXB 5HGGS 4YHKH 1PL3A 3SYCA 1VFAB 4OJAA 3BP5A 1U2YA 2BOBA 3T2QA 4E42B 4J6IA 1K8DB 3MJWA 3G7TA 4KK9C 1S9WB 4GBXD 4JDZA 4RMBA 5HHMD 4OZFA 4WI0B 1NCOA 1WBYA 4WTZG 2D0GA 4WCYL 1Z5LB 3QPKA 4MASA 5L6YL 1P84J 2VH5H 1IM9D 1RZIB 4PB0L 4LP5A 5CP3A 2MCMA 1DBJL 1XGYH 3IFOA 4K71B 1HDMB 3GLDA 4FFWD 4HC1L 4ATWA 1KN4L 5LWYL 1DN0B 2J5WA 5AVZB 1MIMH 4KDTC 2JKJA 2UVFA 5JIPA 1SPDA 3CZFA 2IGFH 3WV0A 1JTOA 1DFXA 5IQ9B 1VRSA 1EJ6A 4M62L 3DX3A 3WSQL 1SGKA 2HJKB 1QO3B 3JV4A 4W70A 2ALAA 4J2QA 4R4FH 5C0EA 1CIDA 3P4LA 4DPRA 3B2UC 3T4AB 5J57B 2R4SH 4ZMLA 2E86A 2JB5H 1KB5L 3CDCA 4PGDA 2A74C 5IMLA 4IHOB 3PHOB 4F80A 1FZMA 4QRFA 1F1AA 5FYKH 4JJOA 3MRGB 4MJ4A 4OKVA 4Z78A 2EDNA 4LL1A 3T6WA 2ICWA 3GJFB 1KG0A 4M93B 1AMXA 3PJSB 3DX8A 4R0LB 1AZBA 2NY1C 2V2WB 4W4OC 2GSIA 2IMMA 2CNZA 1PZUB 4X5WA 1WHOA 3OC5A 4K0OA 5FGCE 2H45A 4L8SA 4FKEA 5FUCE 4LASL 4LSVH 1COBA 5DMIL 4LP8A 5FKAB 5E4AA 4QTHA 4M7JL 3GM0A 2H6OA 5GRUL 5BZWB 2XACC 4KH2A 1T1XB 4YHYB 3C8HA 5I17B 5I1DB 1I9JH 3LZFH 4F7EB 3D4CA 3WXVH 2OTPA 4IRJA 2CLRB 2PNDA 4APQB 2HX7A 3RWDB 1ZPUA 2YEZA 4ZPVA 1GGIH 1WBXB 2H47C 5HI3C 1INQB 1KJ2A 2CBTA 3PGDB 4O58H 5T3ZH 1U3HA 5IBUB 1AQKH 1A3ZA 4K2UH 1HKLH 2FQGA 3VA2C 3NZHH 4HWBL 4XBEL 3UDWA 4AKOA 4AQ1C 1P7QD 2X70B 4MB3A 4X5RA 3VFMB 4IW4C 3UMNA 4JQVA 4O2EA 3W0WA 2XZQL 3D0VA 1F02I 2A38A 1TYJA 4HKXA 5DS2A 2X4OA 3MV9E 1BGXL 4KKPA 4RQQB 5TDOB 1B0GB 1Q0YL 3N9GH 3W37A 3NSDA 1A4BA 3PUUA 3IJHB 2WXQA 3LB6D 4BH8A 4OZFH 5IB2B 4MLIA 1JRHL 3WS6C 3VVWA 4EKXA 1G7MA 4DGVL 4ZX6A 3U6RA 4UIMA 3WIIH 3WLWC 4DUVA 3HNTH 1NDMB 2HFGH 3KPRE 2A83B 2TSBA 3RVVD 4XAKE 2D8KA 4CA4A 3SBPA 2D4FA 4WO4A 5F9DC 3CX5K 2ZD0A 5IB5A 1ZVSB 3VFOA 3EYFB 1T21A 3NACL 4M7ZC 5JW4N 3HHMA 1HHIB 2C3HA 2W9LA 4N2HA 3L1GA 4RMSA 5FHAH 4AUYA 1ERNA 2J2ZA 4YAQA 3WHE1 2KMWA 3BOVA 4IM8A 4OV6F 3B34A 3QUYC 3ROLB 3UBGA 5DSCB 5LN8A 1AOZA 1BF2A 4OCYL 3M8OH 4QRPD 4U1LB 2QGEA 2CLVA 4DKAA 1QWNA 3D39B 5JW5B 1I1AA 5E5UB 5LDSA 1SVBA 2XXCB 4GXUN 5DVMA 2IH1B 1U8OA 4FXGA 5EC2A 3VVVA 1ZMYA 1PYWA 5IB4B 4CILA 2JELH 5HYFA 5E2WH 1AHWC 5ALCL 5HGBB 1NIBA 5FO7A 3QULA 2V3DA 2VZOA 2YR3A 5ANHA 3AG4B 5EO1A 2BVPB 5IJKC 1R47A 3P11H 4XCEB 5E56A 2JIXB 3EJCA 3NH7L 2FIKA 1QG3A 4EI6A 1S9XB 1PY9A 2FCBA 1EVTC 3HE6B 3EUUA 1V7NH 2W9DH 2X2IA 3LRHA 4R7DA 2XI9A 5AB1A 1LNUA 4DPBX 5KYWB 4FQ1H 2P5WE 4RNRA 5EEXA 4KXZH 1NC2D 4JDTH 5J1TC 4TVPH 1LILA 3BT2H 5KJ7E 1I31A 4KVNL 1JPST 2YFNA 4KV5E 5DC0A 3B5HA 2CUAA 2VZ1A 1A1OB 2COVD 2C9UA 2QTVA 2X6UA 2MQCA 3ARBD 1GHFL 1R5WB 1HEJC 1LP9B 1D5IL 4HBCL 1NCTA 1AS6A 2E9WA 2VR4A 3IYLW 4JZJA 2MTPA 3SYPA 2ITDB 1YO4A 4GRLD 1AQHA 2DQIL 4D9QE 4L3AA 1KJ2H 2Q9OA 5DTFA 3KW7A 4WWNA 4YNYB 1ZHKB 1LEGB 3VFPB 3CUPA 5IFHL 4ZYKB 2J8UE 5DK0B 3RVXD 4NHUA 4J23A 1YRKA 5SWSD 4Q9CA 5HYJB 1UA7A 2E9JA 2DLFL 5EU7E 1OSEA 4UF7C 5CJOL 2I07A 2WWMD 1UD8A 3CHOA 1EXGA 2BSCA 3P3TA 1MF2H 3Q8EA 3MYZA 3LCYA 1I7ZB 5A2FA 3WFCH 1CC3A 1XB6A 5JIQA 1HN1A 3AS2A 4HLZG 5GIRA 3AT9A 4I18C 4KJWC 5ESVA 3QI9D 1DQJA 2HT2C 3QDGD 5IFJB 2ZOKA 4J7RA 5KW9H 2CK2A 3MR9A 3VFGL 2JK5B 3K72B 1O5DT 3MRJB 3BKMH 2JKSA 3P3SA 4NZFA 3WNPA 4QY8A 2DW5A 5C3LD 3FFCE 4L9LB 2Q7NA 3ESNA 4Q0XH 4N5UA 5C09B 1JGUL 1ZS2A 1VFMA 1MSPA 4NQEB 3WNLA 2CE6A 3TYFB 2PP7A 3OAZH 3QA3A 3ULVH 2EH7L 3HMXL 4PRDA 1SM3L 1UWXH 2NMSA 4N0FA 4DVBB 4GAJH 4MAUL 4Z7VF 3QWRA 4U49A 4FQLL 2OMXA 1CBVL 4B0MM 5TH2B 2ZWKA 5FGBC 4JPSA 4PJ6A 4PW3A 3EYSL 4RSYA 3C08H 2G2RA 3NA4A 4R96A 2Y7NA 3LNGA 2BP8B 2WBWB 5I6MA 3ULUD 4WU5B 2XN9B 3W38A 25C8H 1MI5E 3LNHA 1WE5A 1Z0MA 2WGNB 1TCRB 2P80D 3O2VL 4NQQA 5TE6H 1U8KB 2QV4A 1SXAA 1XT5A 2D03H 4MMXC 1X5YA 2ZCHH 2E8YA 4PLNC 4ENZA 3PABA 2VDKL 5FIEA 3KMDA 5E8PA 1JYWA 3II3A 2LR4A 4UOJA 2GIYA 2HUHA 3T3PB 4MNGB 1FVEA 4RZCA 5DQDH 3WY2A 2QGBA 4JN1H 3ZYZA 1WBZB 3T6QC 4MXVE 2BZCA 1K5NA 2R1YB 3KPNA 4IKIA 1N59A 5AW9B 1AZVA 2TAAA 2H4EA 1TJHL 2Z31B 4R2GC 1M1XA 4XP9H 3T77A 1FNGB 4MAYD 5ELIA 1MFCL 1NPJA 4FNPA 5AW2B 3MLYL 3UC0L 4UILL 1I7UB 4QRQA 3WTYA 4DN4H 4FULA 4P4KA 2PCFA 3QQ3B 3T8VA 5C7XH 3NSXA 4FZ8H 5I1EH 4X8GA 2E9GA 2HVBA 3OKLB 1LK3H 2YEVB 4RWYL 3IJSA 1BMWA 3R06B 5IMOB 1MFUA 4F91B 2A6DA 3QJUB 5BV7H 1WH0A 4Y1TA 1LO3H 4TOYL 3P0GB 2DI9A 3FB7B 4OLXL 5JO5B 4P2OB 5AVSB 2WUBL 5KG9B 2DQMA 3BPLB 2OMWA 3BIBX 4J28A 1NSNL 5AUMB 2QHLA 2JI1A 4P9ML 3KPOA 5F1OB 2G5BB 2M2DA 5F9OH 1EXUB 4IMLB 3OHXB 4U1HB 6FABH 3QCTL 1FL5A 1SHXA 4H8UA 1WPCA 4ABUA 2DZEA 4ZOEA 2CR0A 2GSMB 2X88A 4K7PH 1OF0A 1UEMA 4JB9L 5AOZA 4NKIL 4JQXA 3D07A 4J8RA 3C5ZC 4YHNA 4LPTA 3PWVB 3FO1A 2EUWA 3C9NA 1WFJA 3MGTB 5EZJA 1YQ2A 4QRPE 3FB6A 1TVBB 4GO6B 3LHPL 4WWKC 2YGNA 4M02A 4E9LA 2P9RA 3FOLA 4XN8A 4YGVA 4AZ8B 1A6TA 2F54D 1TITA 4HS3B 1MRFL 4TSCL 2YD2A 1FPTL 4LHJB 1A4AA 2OXHB 2N1TE 1E42A 1M6OB 2WXFA 3ZIYA 4NI3A 3B9EA 5DJ2A 3HG1B 4RFOL 1GYUA 3MRCB 4K7FA 3CVIH 2Z65C 1E2WA 5JUEL 1HAUA 5FYJD 1S9YB 3VFUB 1MFDH 3LRSA 4AIZA 3FK3A 4EQ3A 3QORB 2I60H 4F37F 1W0VB 1WHPA 1X5XA 5DQJA 4NO0D 3SCMD 1NINA 2FIRT 3GNMH 3C2AH 5KSVA 4DEPC 4BFJA 2EDXA 1L4IA 1Q4NX 1SVZA 2UY6B 5EU4A 4QGYA 1UKQA 2Z1KA 1YPZB 1N0XH 5CLZA 1YQVL 5KS9B 2AJVL 4NUGH 3R7QA 1U36A 3REWA 2ZPKH 1REIA 1D9KB 4YLQT 4OJEH 4PB9H 1BVLB 4I0PC 2BS71 2ZXAA 4MX7A 3T0DA 1P6FA 4MCYA 3WENA 1GH7A 4HJJL 1F11B 2HVKB 3JT0A 2K3TA 5J11B 1AQ8A 3Q5YA 1NANH 4FI8A 3IB4A 5MP6L 3MCLH 2H2PC 4GLRI 2CMRH 3MJGX 1NIDA 5I15L 3JVFC 1JERA 1RZFH 5GRJH 3K71A 3HI1A 3RGVB 2DWYA 3PWLA 4QXWA 3QDMB 4ODWA 2YN3A 2VC2L 4AOFA 1WZMA 1P4LA 1NLDH 2BIQA 3UXFA 3V9EA 1WICA 4HD5A 4OFDA 4HK0B 4MJIB 5BRQA 1II4E 43CAB 3HVNA 1IV8A 4YUEL 3FTXA 4UQBA 5AD0A 5C0EB 1G94A 3QIWD 3B7TA 3BJ91 3PHAA 4DOHB 1QYGL 3FFOA 3QDGE 4KITB 1DTUA 1P4IH 1NCUA 3CFDA 3CTTA 4P5TA 4G6FD 1GZQB 1JGEB 5KYNA 4JGUA 1ZLVH 3RL2A 2F9BT 2VDLL 4QHLB 1RZJC 3H54A 1C5CH 2H8PA 3PWUA 3ZDXF 3DX8B 3RAJL 1AE6H 1QFWI 5T1LA 5DGQA 3LIUA 4X98A 3WTSA 2GSIB 3D69A 3HRZA 1GCYA 1RQ5A 3KWVA 1FG9C 2VMEA 5D93B 2EJ1A 3CK0L 3B9DA 2D7TH 1DSFL 1F13A 3QUZC 1TQVA 3LXAA 4KQ3L 3W11C 1JWMB 2VZVA 2YA1A 3LPWA 2CO2A 3RVUD 3F6IA 4UAOC 1XMWA 1BAFH 2RJMA 5D1ZA 3ULUE 1MWAA 3OPZH 2J1XA 4DZBA 3E2HB 1M6UA 2NQ3A 4GW1B 4ZUVA 3KE0A 4JVUA 4HEMA 1NCAH 2B3RA 3FQWB 2VDRL 4K5OA 3CCHA 1EJFA 4IKJA 4M4RB 2XV2A 3CFEA 2GABA 3PWPD 1BYPA 4M5ZH 4B3EA 2YEZB 3OB0K 5L8KB 5ADPH 4D0DA 1INDL 1U3HB 3L3KB 1MW2A 3CAFA 4U4IA 4UM9A 2XWJA 3KCWA 2IVFC 5T5FA 4YSUA 3D0VB 3UMTA 5C86A 4N90E 4G80B 2Z4TA 5DEGA 3HRPA 3ZU8A 1CFNA 5DHVH 2AAAA 2IOIA 4Y9FA 3AXLA 5KSAA 2PTTB 4AW7A 4Y4FA 5HSFA 3P2BA 1KCWA 2KZBA 1G7HA 3FCGA 3GKZA 1G7MB 3EDEA 1QAWA 3SGEI 2K9UA 4X4ME 1A6PA 2L4OA 2YKKA 5L8JB 4A2EA 3JV0A 2ITFA 2PTUA 4LKXA 4OUOA 3LS5L 3VFNB 3WHXA 4CJ1A 2VZ3A 4QKTA 1TVDA 5HYQA 5C0AE 3NA9L 2HUEA 1I8LC 1KBVA 4H0GA 3MQIA 4M03A 2B1HL 2DQTL 1DJSA 3PG2A 2EKJA 4JHUA 3RU8L 4L3FA 4ANKA 4M8RA 2J2ZB 3IDNB 2CA4A 2VN6A 3ULUL 4LSPH 2H3NA 3OMAB 3EXLA 4U6XB 4KJPD 2O61B 1IO4C 2PO6C 4IU2B 1PKQA 1N3NA 2CLVB 3D2UB 4LVHB 1F4WH 4MMZA 2R0ZL 2KL6A 4TTDD 2CHXA 4ZD3L 1PYWB 4HVBA 3UTOA 1SY6L 2PYED 3EH4B 2DQDL 2L8AA 5ITFA 5L0QC 2QT6A 2SODB 3ZTEA 5LUMA 4AENB 2J4WL 1PKOA 4XAWL 5EO1B 4D0BA 3TA3B 4E0RB 5KAQG 5D4QA 3SBRA 4CSPA 1RULH 3VXME 1J8RA 2F54E 4N2MA 4Q2ZB 2IPUG 3Q05A 3C6EA 4FTVB 2R1XB 3AMLA 3IDMA 4JAMB 1U8JA 3PGFH 2ED6A 1XXDC 4X7DC 1QUNB 2X4PB 1Z0NA 4RNRB 1F2XK 2E27H 1B0RA 2A5UA 3S5LA 4GJTB 1CIUA 1XWVA 4XVTH 2Y24A 5A3IC 4M7KL 2NQCA 1MWAH 4HXAL 4JPWH 5FYJE 1H9VA 5F1NA 2QGCA 2Z9TA 4K94H 3K6DA 5DUML 2LFGA 4DVRH 1DJYA 4XPHH 1HZKA 1UJ3C 2EIMB 2X1QA 4JZJB 1NCWL 2XWRA 5EO9A 2V9RA 4G6KH 1H3UA 5IOPA 3KPQA 2NNRA 2IWGA 2IDTA 4NENA 3MV8A 1SQMA 2AI0H 3EO9H 3WDIA 4AITA 3E6FA 3NIFB 3QQNA 4GSRA 3KW8A 4NHUB 4IS6A 2HCZX 4Y8AA 4BGDA 5JHAA 4TF4A 5DD0H 5T5FH 1RP9A 2FATH 1ZGLA 4HJTA 3P40A 2XNAB 3EXJA 2VXQA 3HUJE 4J5VA 1RHHA 3TFKC 2O5XL 1BOYA 4PJGF 3D33A 1FCGA 3MRQA 3RTQC 5C0JA 1KEGH 2WINB 2A73A 3TX4A 3VSQA 2L7UA 4KO5A 1K6QL 2XG4A 3RURA 3RB5A 2OPCA 4PRIB 1YEHL 3BLBA 3SGDH 4F3FA 3PJLA 2EE9A 2VDQH 1J0ZA 3GS4A 1D7FA 2YA0A 3O0RL 2HKFL 2WM0A 1IFHH 1YNTB 2OW7A 3CPLA 4QY8B 4YDNA 5EDSA 1A6VH 1BXVA 3K6OA 3KPMA 4P2QA 4U6YA 4F93B 1TTFA 2P44B 1UOVA 1LDSA 1KFAH 4GI9A 2OA9A 3L7EB 1JDAA 1KEML 1E9OB 1DVXA 1BF8A 2IWKA 5HHNA 5AVTB 1JPTH 3IU4H 3LV3B 3QA3B 3QZPA 4PRDB 2J8HA 2O26U 4KJQD 5FYJL 4YX2H 4ZT1A 3BDBA 5IROC 4LSTH 3KL5A 3CXHK 4GG6B 5F88A 3EOTH 3VQLA 4R7LA 3ZZQA 2WVUA 1CWVA 3VWJD 3EJYD 2ADIB 4KK8D 4FQ2L 5TFSL 2VT0A 4R6UA 4AJWA 4LEEA 5CINL 4ZDHB 1ZVNA 3RDTA 2WBKA 3GMOB 4BZ1H 3JWOL 2W1NA 4DERA 3WDHA 5ISZD 3Q2VA 5CD5D 8CGTA 3VGAB 2ZX7A 4KKZA 5EEZA 4AQEB 3FTYA 4UT9L 1ANUA 4Y16D 3VM7A 2WK2A 3PABB 3LXUX 2I69A 2QPEB 4LLYA 3U46A 2DI8A 3GF8A 4RGMB 3L9BA 3X1EA 1ZPLA 5CFAA 2NLJA 1JFQL 4AUUA 4ILDA 4JHZA 3WN5B 2HAZA 5IVZA 1RKRA 2MQGA 3F58L 3AT8A 4JFDB 4K5PA 4A55A 4FJYA 1M1XB 4BFKA 3OKOA 5K59E 3PIQB 2JE8A 1ASPA 4FHKA 3PWPE 2AVFA 1ZLUK 2CM6A 1Z5HA 1T7YA 3IGAA 2DWDB 1RV6X 1FVDA 4F7CA 2PCFB 1DUYB 3BH9A 1RPQA 4Z7VA 1LO2H 1J05A 1DBAL 2B2XL 1UH2A 1I1RA 4LCWA 3PGCA 3SKUD 1SOXA 1XD0A 3DBXB 3QJFA 4XN2A 3I75A 4G7QB 1DJHA 3FT9A 1MH5A 2GJJA 1HHHB 4OFYA 5F7UA 5B39A 1UD4A 3MRPA 3ZGHA 1MHCA 5B1JC 1UCTA 5IHUH 4AMKL 1QSEA 2Y7SA 2OP4L 3NCWA 1OY3B 4RDBA 4Z77B 4JO2L 3MV01 4FFYH 1DR9A 4Y9BA 5KVDH 5AKRA 5CU9A 2V17H 5CO1A 4NJAL 2NY0B 3SO3B 4KDVA 3GXIA 4KQ4H 3TTSA 1YG9A 3GTVA 1DQDL 4PV8A 3W56A 3MOBL 3VD0A 2P24A 5JZ7C 1WT5C 1VGEL 4QOKD 4LLAA 1G0DA 3CVDA 2YAEA 1FV1A 3BSGA 2GQHA 2J57A 2I5YH 5HP5A 2UVEA 2D2OA 2LHAA 2GITA 1DBBL 4CSTA 4IRSA 4CADB 4KMTH 1E4XH 2JJVA 2GTWA 3FB6B 1YLBB 1KCSH 2PLTA 4JHAH 1HXYA 2OJZL 5KBLA 1QMUA 1A6TB 4D3CH 4P2RA 2QTEA 1IM3B 4PJFB 1LWJA 1XV8A 5CXPA 3HJ0A 3DNKA 3PFUA 2ZUWA 3I2CL 5IJVB 4PGZA 5H94B 3KWWA 5I23A 2G5RA 3KEDA 2CKBH 2X41A 1M7UA 4QYOB 1FFNA 5B39G 2Y7OA 4MCZA 4G59C 4Y19D 5BQ7B 1FO0B 4AIZB 5DD1H 4MA3A 4OD3L 1AS7A 3C5JB 4L0ZA 5KSBE 3NEEA 5GJTL 3VXQA 1R75A 1XCQA 4B9FA 5KSVB 5GGVL 1CICA 1DANU 1ZKAA 3ZQ9A 4X7CC 1OGAB 3ARUA 4JFXB 5C08A 1YECH 1U8QA 2NNAA 1TZIB 1UB5A 3CVHH 2A0LC 2Y6SD 3GT6A 5DO2D 3S98A 1ACYH 3U82B 1GGBL 1A7RL 4MX7B 2P26A 4HJUA 4MCYB 5ADOH 2KUTA 3EOBB 5DD3L 2ARJB 3S88H 3H3PH 3T8XB 5D1QC 1J9TA 1IAIL 2M1KA 1L5GA 1R24A 3L5JA 2YKLH 4HJIA 4UT6A 3TO4C 5JHLA 1AD0A 2MKWA 4AKQA 2EEBA 4MD4B 1H5BB 1GYCA 1PSKL 3DGGB 1VCAA 2VSDA 4ODWB 3WIHL 2WXOA 1XH3B 3B6SA 3EJZD 3SBWC 4UOZA 3TC9A 3VO0A 2XWXA 3QVAA 4J4PD 1K4CA 4EQ2A 1T89C 4FABL 1CL7I 3HZVA 4GQPH 3ZHDA 5LLIC 5AD0B 2J8UF 5F1SA 1JSYA 1ZHBB 5EG6C 1UM4H 4JRXB 1HXMA 5AZEH 3LHAA 3MLRH 4P5TB 3DMMD 4S1RH 3TV3L 5JNYA 3PDGA 2NY5C 3RTLA 3ETSA 5A43C 1WUZA 2EDOA 2VWEE 5PAZA 5KYYB 4ZS7H 4D2NA 1HQ4B 3APMA 2AXFB 1F97A 3NPSC 5D6DA 4J27A 2OAAA 4NERA 1EX0A 5LGHH 4PWFA 2YPLD 3BPOB 2CJUH 1RZKH 3QB7C 4LVNC 3T09A 2OR8A 3LPFA 4ZFGH 2Z93A 2VAAB 4ZW3A 4K5MA 1G6RB 1FFRA 5DZVA 3P3RA 4L1BA 2BVQA 1UYWL 4U1GB 5JIKA 1I85C 5J3HD 2HT3D 3F8UB 3HE7D 3V0WL 4KROB 3BZDA 2X6MA 3K7UA 5I0ZA 1A4KA 2XX1A 5TDNB 2YBRB 2F5BH 4O9HH 1DVFB 4ZUVB 4P23A 5CGMA 1DQQA 5ISZE 3SE9L 3NK3A 1E8WA 2P5ED 3QEUB 3QW9A 2A7BA 1DP0A 1RL1A 4I3GA 2NY6C 1AACA 3PQYD 5IMKA 4D0DB 4BZYA 3E9TA 1PD1A 4JM2C 3DOIA 1C8QA 2F58H 4KPHH 5D7JD 1ITBB 2XA8L 2XWJB 4G5AA 2X87A 1S7XB 3T0EB 5DJZB 2XXMB 5CZXC 2A9BA 1G0YR 3NSYA 1NGYA 3BWAB 3ARFD 4JO8A 4NC1C 5DEGB 4A66A 4BE5A 3JXAA 4K23L 3TJHD 4CL7A 1T5WB 3ARWA 4TLUA 1BZOA 5AKTA 3GLAA 3GSRA 5F9WB 2IPTL 3LIZA 5D2NE 4K15A 1G7HB 1KUMA 2BNRD 4H1LH 1RK1B 4MGXA 3QHFL 3H42L 4N8VG 4NN6B 4P5KA 4MXVF 3UZVB 5IVNA 3HC3H 1NMCC 4FQCH 4OLZL 3M17B 3TH4T 3RWIB 5EU6D 4LKXB 3MNZA 4HF5H 5GHWL 3V7AG 3WHXB 2QQKH 4P46D 4EDXA 3TV8A 3O6FD 1HESA 4UT6H 2BH0A 2JKWA 2IQ9L 3RIFK 3RWCA 1EERB 8FABA 3O6LH 5LVEA 5GISL 3B2VH 3WKPA 1KJVB 1FNFA 3I50H 4UBDC 4UV4L 3AG2B 5ANMA 5B8CB 5MEQB 3WNNA 3V6OE 4G70B 1URIA 3QJVB 3TN0B 4J3SA 4QNPE 5DUPH 4YDKL 1TTCA 2ZX5A 2VDPL 2OJEA 1BMGA 4QOKE 1YAZA 1OGTA 1ZGLP 2MPAH 2ALWA 2VMCA 1UZ8B 2VN7A 5ITFB 3IDYC 1XF3B 2BNUB 2QELA 3ZSSA 2W0FB 2ERJB 3L6FA 3WTVA 2Z35A 4NZTH 4XCNB 5J12C 4D0BB 1DO6A 4ANWA 3NBNA 2CGRH 4ZS6D 5SX4H 4FYTA 3L4VA 2W92A 5GJSH 3CFQA 4KTYA 3ZLQC 3B1TA 1P9MA 4M48H 3IDMB 3A4DA 2IFFL 3CFCH 3GXDA 4BGLA 3FUIA 1XGZA 4WTXA 3ZIMA 1AI1H 4TUKH 5IBLD 5AOMA 3U30B 2I32A 3OAZK 2MEJB 4OZIE 4WEEA 4JLRA 5EUOB 1GYAA 3UPRA 3EGDA 5GZOD 2ZWYA 4XHJD 5JOFA 4X5QA 4PJ8C 1HXKA 4Y19E 1OE1A 2HWZL 3OZLA 1QNZH 1I7TA 3KPLA 4U2YA 4H8WH 3C5SB 4ZAKB 4MA8H 3B7UX 3QIUD 5D9SB 4FQIH 1T2QL 4LLDB 2DJ4A 4NENB 4WENB 1EHNA 1V5JA 1J1XL 4RFNC 2WZ5A 4LCYA 1TCMA 1ZGLB 4G6JL 4JRYA 3FN9A 3WTWA 2YXVA 5ECGA 2UZYB 2FL5B 3DYPA 3BVVA 4MNHA 3GS0A 4K3JH 5L2KA 1R3KA 1F0LA 4DO5A 1GGCH 3Q8AA 2VLKA 2EDQA 1Q9LA 2A73B 4E41A 4NNXB 5HI5D 3QR2A 3S34L 1CXLA 3LIZH 3L2LA 2XG4B 5E8NA 2MQ3A 4ZX4A 2FX9L 3HFMH 1AKJB 4HSCX 4PGEB 2EEXA 4EI5B 1E40A 3BKCL 3GPSA 1KLFB 5CBAA 5I30H 4G9FA 4PJ9D 2NXZB 4TVUA 5L4IA 4HC1A 2HG5A 4PTTA 4XTRC 1BECA 2JJTC 5BS0B 5FK9B 3SKMB 3TO2B 3UTSD 1OD9A 2X42A 3GO1L 2ZICA 1V05A 3CQQA 3ESOA 2J88L 1PTZA 4N2CA 4QI3A 1RUAH 4M7LL 2C9VA 2X6AA 5HHNB 3W39A 3VFSB 2ZG3A 4UDUA 3B8YA 4KX9A 3ILPA 4KK6D 3QJXA 4NQSB 3LQAH 1NUFA 1YY8A 4U6VL 3K5SA 3G9VA 3T0AA 1XX9C 1MXDA 3U4BH 4X4KA 3BKYL 1J7VR 5F88B 1AIFA 4BKLA 3ULSA 4L4VA 4X4YB 1KB5A 2C9QA 4KY1H 4N86A 3RDTB 3X3FH 1GR7A 3MRHA 1UA6H 1L7TL 2VLRD 3MNWB 3RG1C 1AMYA 4P99A 4PJGA 5LBVA 5I1GH 2CH8A 2NX5D 4TNVK 3NCYP 3VNZA 2H7WA 3DXAB 4OGQC 2YBGA 3RI5K 5CEXB 1EZLA 1OB0A 1A25A 1TZAA 5CKGA 5T1MB 4Z1PA 3O9WA 3PREA 4YO0B 2WJ7A 3ABMB 4MQ7A 1BD2B 2NLJB 4WI3A 5IVZB 3MJ9L 5D1XA 5IZ7A 1C08B 3B9KB 3QCUL 4FFTA 3FT3A 1ODAA 5E9AA 4DKEL 2LLLA 1JNNH 3OKOB 1SQ2N 4XOEA 5EN3A 1JF1B 1E5AA 3ARGD 4LPCA 1FAIL 4KXDA 5DA4A 4WIQA 1HHKB 1FNLA 5DHXB 4K3DL 5MENB 3PQYE 3BUYB 3S9DB 2CDEA 5CFHA 1FVDB 4HHGA 2XTJC 2OJ1A 1YJDL 4DK3A 2WCPA 5AVQB 3EH1A 3JV5A 2C7FA 2YD5A 5DEJA 4J3OD 3THML 1SMOA 1B9ZA 1RLBA 3QJFB 1RU9H 2AP2A 4MVBD 5F3HA 3I75B 3C60B 4FXTA 1QLEB 3GIZL 4HWBA 1WC7B 1E4HA 1DVZA 5B39B 1YMHB 4Y4KA 1MHCB 3GEWB 3ZY7A 4FGMA 4RX4A 1LK2A 4PRBB 3HI6H 3ILEA 1BFVL 3LSOB 1KC5L 1YYML 2CXGA 2MOQA 2BNRE 4LPYA 2LTQB 2QBWA 4DUXA 1SJHA 3BZEA 1ETA1 2XFXA 5EU6E 5MI0C 5DJDB 2APSA 3BFQG 3GSNH 4FXLA 3EGXA 1S4IA 2XU9A 5HPMA 4OLWH 1TTGA 4LQFL 2ADJA 4U05A 4FFZA 2PW1B 3NAAL 1NWPA 4PVBA 3I6KB 4FQQB 3V9CA 2BSTA 2NY7H 1AGCB 4OJFL 4ENEC 4WUUD 2AKRA 4KKRA 1E7UA 2ESVD 4MMYA 2HLEB 1O7DC 4LDCA 5CILL 1H6EA 2GTWB 2W65A 4M8UA 5JPNC 4GEJA 1IU1A 3DK0A 1HXYB 2MKLC 5D2LE 3CSTA 2FWUA 3V0VA 3REVB 3Q1EA 2OMZA 1AVAA 4IDJL 4P2RB 2EYTB 3QXAA 3DOSA 3OQ3B 3OG6B 5AVWB 5LGJA 1H3XA 5EOCL 2QSVA 4DKTA 4L0PB 4EF3A 4YBLC 4Z3HA 2DMGA 4K9EH 4R8WL 3PJNA 3FTUA 1MJJA 4FAAB 3NIDB 1KBGL 2XRAH 2Q3ZA 4ONFH 4CUCA 3RB7A 3VA6A 1TLKA 4EIUA 2R8SH 4RLDA 2GK2A 1ZLVK 4OIIH 4O5LH 4G9DA 5E1QA 2XWDA 3WNMA 4JY4A 1XBDA 5KVFE 1OCRB 3IMUA 5BCAA 4KI5C 1CICB 1MCRA 1G87A 3CC1A 3CMOL 3MV9A 3V4VB 1R0AH 4OD2A 1OARH 4UQIM 1KMGA 3U6XA 1ETB1 2FZ3A 4ZXBD 1WAPA 2ZSVA 4G3YL 1DLFH 5C08B 1XZWA 2XVBA 3U9UB 1XGTA 2NNAB 4GMTL 1JK8B 4LF3A 4AQ8A 1AGDB 1SEBA 2AEPH 4P2CG 1KJ3H 3QSKB 5DMGD 3EADA 3AREA 5IVXE 1TTUA 3RY6A 3KPRA 1J88A 1NOLA 3KVDD 5CJXC 4XN9A 1XF2A 1LYQA 1AP2A 4F2MB 3OGOE 4PJCE 2H9GA 4H4NA 4H7VA 4XPTL 1SVCP 3MLWL 4F7PA 5E70A 4XBEH 5JLZA 2VDOB 3B6SB 3NGBC 3HPLB 1YUHA 4LOUC 4OZGF 4TLTA 4O2CA 3FUDA 5GSVA 4RGOL 3HZVB 4GQ9L 3V4PL 5DVLA 1EGJA 2WQVA 5T1KA 2W9EL 5I8KL 3LMJH 3SPVB 1L9TA 3ZE2E 1X6LA 1V8HA 3CSYB 3QAZC 3HUJF 4ZJ9A 5EUKB 3APDA 4ETYA 2EO1A 1V3JA 4L1TA 2RALA 3UTSE 2BERA 4AMXA 1IEBA 2UZIL 5KVFL 3WFHA 4FFZH 2GT9B 1RUQL 3TEWA 1AXSA 3EAKA 3IAQA 4DGYH 3IRPX 3AROA 4QTIL 5CJQH 4BUHA 4N8VB 1IL1B 2P5WA 1S7VB 1U2CA 4BKSC 5TPWL 4X7SH 3N44B 4WV1C 4JKWA 3VFVB 2A77L 4HFWB 2BVQB 4XPGH 2XC8A 1OQOA 3HMXA 3ZR6A 5JPMA 4YZFE 4JREC 5BO0D 3N50A 1WIOA 3OLEA 4OCYH 5SV4A 3SD5A 3QJTB 1U3ZA 3BVNB 2EO7A 1XSKA 2G3MA 4DP9X 3IF1A 3ILQD 5DFVD 2G75A 5F97E 4YHOL 4HP5A 4XVUC 4G6ML 3WG7B 4UUJA 3FUHA 1F45A 1Y18B 1PZDA 1W0YT 4LVOC 3FMGL 2NX5E 3ZT7A 3ZDZE 3FU3A 3MACH 4NAMA 5FDWB 2J8UA 1T0NB 4HLEA 2GBTA 4Y2LA 4WFFD 2B9BA 5CSGA 1TZGH 4A6YL 2IAMA 3HC4L 5C0BB 1P53A 3FOMB 3U1SH 2OZ4L 1CU4H 1OAKL 4GBXA 1NKRA 2DH2A 2KH2B 3BYTA 3D87B 3HLKA 1A66A 1NGXA 3LEYH 3QJQB 4KTGA 1WZ1H 2EIBA 1IM9A 5GS0C 3TVMB 1Z3GH 3K2MC 1L9NA 5F0PB 1XB8A 1KV3A 3LVEA 3DHUA 3QPXL 4QRSB 5BVPL 5C07B 3VYOA 1ND0A 5PCYA 1GAFL 4RGNB 1RUPH 2YAMA 4NJ9L 4S10A 4RFEB 4ZUWB 5GRYA 3GSRB 1V54B 1NGZB 2X6CA 1GCFA 5FWQA 1CFQA 4U7MA 1R34A 3TURA 4R0LC 4PRNB 3BQUD 1U8HA 4EIGB 4XCCL 4I0KA 3BAXA 1TXKA 3TBTA 1JZ7A 2N1KA 3FFCA 3MNZB 2EDDA 2O6CA 5K59F 4EDXB 4R7NB 3I3BA 1W16A 2E7DA 5SWZB 2YLHA 5E1IA 1WRFA 1C9SA 2P48B 3E3QC 1FIGL 1OAQL 4FQXD 4DF9A 3GIVA 3QZBA 5IFHH 1MY5A 2VZUA 2ZP9A 1MCLA 3QQ4B 4XPBL 1D5RA 5L4MA 4N0CD 5D8JH 2RFXA 2VOTA 4Z6AT 3TT3L 4OD1H 2V9UA 3KHOA 4NSKA 3UTPD 3TNNA 1WAEA 1EGJH 1V7ML 4XC1H 3QPQD 3QNXB 5JHDB 1I4FB 2DTML 3O41A 2EEDA 1OHQA 4XNZB 1CDJA 1MI5A 3O2DL 4UNUA 1J1PL 4UQ9A 5DVKA 2H3XC 3OBAA 3D18A 3C09B 4WHYG 3TIDB 3EG9B 3DRTB 2IMNA 1NKGA 3L6FB 5C6TL 4WUUE 1QPPA 4Z7UE 5CMAB 1BM3L 5DJ8B 5AW6B 1RP8A 4FKHA 3SGJA 3VMOA 1DFBL 1P4UA 4UINH 2YK1L 1DBKH 4OCSL 3C75A 3TZVA 1U92B 1LVEA 4XPFH 3K4AA 4ELMB 5H35A 4KZDL 1ZEAL 2HT4C 1P2CB 1B88A 1RY7B 5C6PB 1EIBA 2BP0B 5DT1H 1OSZA 3UAJC 1WD8A 3X17A 4BK5C 1QABA 3FCSB 5C0DB 1JL8A 3KXFA 2WVVA 2QJDA 2WQSA 3PPEA 4H40A 4ZMZA 3UBXB 3UPRB 2DQJL 3KGTA 4MNQB 4EUPG 3QIBC 1P7QA 2QQLL 3AGVA 5DRNB 3D25A 4HIJB 3M1BA 3B2UD 4JFFB 3FT2B 3V5DA 1CGVA 3D3VB 5E6YA 3IRCA 1A1MA 4JR9H 2Q86A 4HCFA 1J0KA 4MB5A 3VXNA 1U41A 4Y5YC 2DLGA 3AITA 5I5IA 3FUJA 1HYSC 3JYCA 3X1GA 4Z3JA 5KSBF 4NZUH 5AOLA 4PUBH 1U8IA 1KXTB 2V7HA 3UAFA 1IBFA 2B0SH 4NLAA 1DZBA 4OH2A 2J3SA 4XN1A 2J72A 2P8PB 3LRLA 1CE1L 2ED7A 2NY1D 3OKMB 3MRIA 1R3KB 3QRLA 4WGVB 4XCFL 5AW0B 2Y3NA 4MHHI 5E8OB 4QR7A 1HC1A 1XAKA 3P9MB 2ZCKL 3MLYH 1MHEB 1EO8H 2WQXA 5IB3B 4U3XA 1T3FB 1YNLL 2CBPA 2IANA 4XVJL 4Z8FL 1W8NA 2D7PA 3BUBA 2DMBA 4NO2A 1J5HA 2HG5B 4PTTB 1NAKL 4HYTB 1XSOA 4QRPA 1LE5A 5E6SB 2E7LC 4G5ZL 2CZNA 4I3SL 1AOHA 4JPKH 3CLFH 4G42B 5IJBC 1U8NB 4UDUB 1DBML 1JZEA 4F15C 4IBWA 3TLRA 1HOEA 1QKZH 3S3PA 3FQXB 4FX5A 3STLA 4MCMA 4JPIA 2ZP8A 1GOHA 4IBZA 3ZRCC 5I6XC 2R0KH 4L4VB 5IKCA 2DLEA 3WHE0 4A38A 4B5ZA 1Z9PA 3QZWG 1HNGA 4HU8A 4LSUL 4DFIA 5F7NC 1HKFA 4TSAH 1B2WH 1RSYA 3SDDC 5FB8B 1YN6A 1PBYA 1YZZA 4OB5H 1CGSL 4JB9H 4PLKC 1NC2A 1GZHA 4ZQTA 4Y1SA 1S3KL 1KWKA 1JPGB 3C6LC 4LQ1A 5EO0A 3ZHLA 3GHPA 1NAMB 3ARRA 5FHBH 5LAPA 4BSWB 4LCIL 2C1OA 3ARBA 3LHPH 4N0UE 3GI9L 2NXYB 2OLDA 5F96H 2VL5B 3ZTNL 2Z4QA 4HWEL 1KCRH 1MNUL 1S78C 3FU0A 3NUKA 5EC1A 3H3KA 4OF5A 5ABZA 1Z3RA 3AY4A 2NSMA 4HPHA 5CLYA 1D5MB 4C83B 4GKLA 4B53A 4ISVB 3QUYD 1QASA 1XGUA 1I3RB 1RJZA 2CRYA 3QH3B 5CUSH 1JV5A 3MCYA 4FC3E 4MQXC 1JNLH 5HVHC 3IFNL 1IKNA 1MIEH 3NCEB 4PRAB 5F3HB 5D6CA 4HJSA 2ADGA 2DMHA 5F89B 2EACA 1UACL 5EOTA 4CKVX 1M7DB 2AJVH 1EEZA 3QI9A 3QDGA 3MYJB 2XDHA 2UZXB 2WD0A 3JWNE 5FO9A 1JYNA 3D4ZA 2HVJB 3FQNA 1DHKA 1PFOA 3EGXB 1ZVHA 5HPMB 2XICA 4OZHB 1YDPB 1N64H 4HOMA 1XZ0B 2DYPA 4UB0L 4Q9QH 1OZTG 5MP6H 5IQ7H 3CN3A 3FO2A 4S2SB 4OGXH 2BSTB 5FGCB 5LJYH 3B2XA 2Q76B 1FL6A 3DV6A 1E6JL 5AYUH 4AV5A 3MBWA 2JNZA 3QFJA 3PL6B 4KZEL 3ZSTA 2CUIA 3KM1A 3UTPE 4E9YA 4FLHA 4AG4L 5AENA 1HCFX 3G5XA 1O0VA 4DW2L 1JHKH 1MKFA 1N10A 1XTMA 4KO9A 4GOSA 3GKWL 2OMZB 3NABH 4PV9A 3GDCA 5CZRA 2YD0A 1YN7B 4KUZH 5DJXA 1KENL 4PR5A 2P80A 4YLCA 5LGJB 1QHQA 2ZUQB 5ICXA 4Q52A 1KOAA 4PW9A 4HIEA 3MO1A 3LKOA 5T3XE 2CM5A 3HE6D 2VRAA 5DJAA 1SYSB 3QYNA 1OAYL 4NM8L 3BRFA 2FEDC 3PHSA 4GAFB 4NN7B 4Q74A 2VDLH 4P5MA 1FH5H 3ZPDA 5IHBA 4P3DA 3FCTB 4GAGL 4X4ZA 5EF2A 4WFGD 3QJRB 4JY4B 3MV9B 1CMOA 4KJWD 4MAYA 2HT2D 4OD2B 2IC2A 5GRVK 2D9CA 2FZ3B 4MJHA 4NDMA 5D71L 4AGLA 2VABB 4KQ3H 4AGOA 1ONQA 1UWYA 1IQWH 2VZTA 1BZ9A 3DVNA 4LF3B 3U0PA 1NCHA 1KLUB 2VLJA 1KIQB 4NUJB 1RD6A 1K9TA 3F5WB 2KERA 3N0AA 3AREB 5L8LB 2Q2EB 3KPRB 2ZSWB 3ZK0A 4YSSA 3KR3H 3OHMB 3L2MA 5GGUB 5KOVC 2YARA 5C0AA 3AQDA 3EJTA 3VGFA 3L17A 3EO1B 1XF2B 2OX5B 2G9HA 2XQ0A 4H26B 3MLZL 4Y88A 4XWOC 5HHPB 4G1EA 1ZSDA 3VXSD 3TYGL 1MCQA 1JPSL 2AGJL 3ZL2A 2PPCA 1FNEA 2Z64C 1XIWA 2EECA 3MUGA 4ZPTB 1X4YA 1D6EA 3RBGA 4ZRGA 3VMPA 1A2YA 4FG6C 2K45A 1SBSH 3NZ8B 1CLOL 3RWFA 2VJXA 1E4KC 2VW6A 4WSGA 5GGRB 5E8EA 4GQRA 3UC2A 5T1KB 3GHEL 5T3XL 4QRUB 4DGWC 3RVWC 2O4EA 4X9GA 3V6FA 1QFPA 4PGJA 3AU1A 2ZKHH 5DK2A 2VERN 3FTGA 3S6CA 3GMMB 4AQOA 1WTGT 2ATAA 4GS7B 4WFHE 5TGBA 1LQSR 4LCCA 2XKUA 4O02A 1IEBB 3VXMA 4E36A 1FA4A 4R2GD 5EBWB 1CR9L 1DE4A 4LIQE 4ONGH 5G5DB 2F54A 2G3XA 5T1DH 3MKKA 4TULL 2FWOA 3WKMH 2N59A 2Y9RT 3MNDA 4QXUL 4I77L 3GMRA 1F90H 4Z76A 2X4QB 3HNSL 4OQTL 5IIEB 3W57A 2MH4A 1MQKH 3D09A 4J8QA 3WGVB 2QADB 4H20H 4N4YB 3SDAA 4W9JC 5J11C 3GXNA 3GQFA 1OP5H 1G9MH 2R0ZH 2UYLA 1ZANH 4F37K 1CD1A 3TPUA 1RFDL 2MHAA 3IPFA 2Y23A 4OZGA 1JI2A 3O4LD 4OR1A 4WWPA 2E75C 2W81C 4LSRL 2Q3XA 5CIPB 1J8SA 2RIKA 3SZKC 2J8UB 3UBXI 3NRFA 5ECJE 3HC0A 2B39A 2JTYA 1Q9KA 3MA9L 4HIIA 4UT9A 5BMFH 1CLYL 4GBXB 2UXGA 5HHMB 1GJWA 2VDKB 1GJUA 4FP8L 3HUJA 3HG4A 3A5VA 1LEKB 4YIQB 5IQMA 1BP3B 3P69A 1IC5H 1IM9B 4M3HA 4WNSA 2AK4D 1W91A 3EDFA 4UV7H 2F74A 1SOSA 3DX4A 1SOKA 3C5ZD 1ND0B 2GTQA 3ZBMA 3LN4A 5ID1A 2YRPA 1E6OH 4HXAH 3SSGA 3TIEA 3CSBA 4WWKD 4XOCA 3QXUA 1ZIBA 4KK5C 4LIQL 1KV7A 3GJEB 1U8HB 5DUMH 3ZKNC 3QRFM 1TPXB 1H9DA 3MMEA 1RZ8A 3BHBA 3E1F1 5HTSA 4YR6A 4P2OD 3WNOA 5D7LA 2O5NA 1PLBA 3TT1H 4BFRA 1ZTXE 4L8SC 1RURH 2DI7A 5HBBA 1N5YL 1QWUA 4B9YA 4XNDA 3GIVB 2IG2H 1UM6H 1YNKL 2IQAA 2Y2WA 4EUPB 3SPCA 3K91A 3BIKA 3OV6A 4JJ5A 4GNKB 4JFPB 5EBLB 3IAPA 4AM0Q 1HH9B 4Q14A 4OF6A 4Z7QF 3TNNB 1A3QA 1KDJA 4PLJC 4IRJC 4A2GA 4XB7A 1VB9A 5F9JA 3VQ1C 4UOW1 2IWFA 5FA3A 5CEZD 4HUUA 1H3PL 3PWNA 1NCIA 1R3IL 1MEXH 1HCYA 3PFQA 2P7TB 2UZPA 3RY4A 3UDWC 3ZKMC 2COQA 3CN4A 1EZUA 2BDNL 4O02H 3D39E 4PP1C 1C5BL 2HKFH 4Q56A 3VXUD 4Z0BL 4I0PD 1LO5B 4ZTPH 2XQYA 4PGBA 3WXWL 1G5GA 4PFEA 5B7MA 4NIKB 3KHQA 3J2PA 4MKMA 5T33H 3DTUB 1OGPA 3IBEA 2WKOF 4G8AC 4MSWB 4XP5H 3WYRA 5I18L 4PCTA 4DAGL 2FLRT 3HS0C 4NGHH 2H2PD 2PUQT 5TQ2H 2D3NA 2LAAA 3PWPA 1MJ7H 4DGIH 3POCA 3ES6B 1EEYA 12E8H 3MJ8A 4IOIB 2WXIA 3WO3B 1Q0XH 4IOSA 1L9RA 5ICZB 2RTTA 2XIIA 1AQDA 1UCBL 5D2LF 4WO4C 4NIYE 1N8OE 1ZTXL 3FQ2A 1CG9A 3FQYA 1P7QB 2E56A 5KBPA 4YFLI 2A9CA 1BVZA 2NSQA 2PABA 3BWSA 4CN1A 4WFGE 1MVYA 3V5DB 2PMZA 3BIAX 4D94A 3PU7A 1G1OA 1KELH 4QUOA 3IJYA 4UYQA 3VG9C 1LP9E 4FN0A 5AW1B 3QZWB 3QDHA 3M46A 4GKOA 1I1AC 2DAVA 3QG7H 1FHGA 1HAWA 5IHZB 2W59A 2XPGB 4FXGC 1VFOA 1F4YL 1H6FA 3DBSA 1AGBB 3L95B 4PSRA 2X4NA 1EVUA 2YGOA 1S7SA 2CQVA 4P2YA 3MRIB 3BUTA 3UBFA 3MGOB 5AAPA 2O6PA 1A6WL 1BX2B 4HJGA 3VTTA 4JO3L 1EFXA 3QUZD 5GGSA 2E76C 1HE7A 2VDNH 4JFEA 3PAYA 4DP4X 3K3QA 3VXSE 4KHXH 4NZRH 1QFWL 1PDKB 2K6ZA 5IVXF 4G8EB 3QP3A 2IALA 3I9AA 4QRPB 1FF5A 5A7EA 5I76A 1LDPL 1WAAF 1SBBA 2VKXA 1LO4L 4P57A 2HPTA 4ZMWA 3RZCD 3WIHA 1JP5A 3LS4L 1CTNA 3O4OC 5F2FA 2J71A 2AJSH 1KYDA 1OT1A 3KJ4C 1VFUA 4FNRA 3IDUA 4AL8H 2VSKB 3BE1L 5DWUL 3IMRA 5KSBA 1R3JA 5IW1B 4RRPM 3KLAA 5BV7C 5DXWA 1BZ7A 3DI2B 2KKQA 1ET5A 4A04A 4KHTL 4JO1L 3ZE1E 1J9SA 4L48A 4Y9EA 1NC2B 5LGYA 1JZGA 2E9BA 2LW3A 4HZLB 1UATA 2GC4C 5SX5H 1SN2A 3IDJB 5F3BB 2GSGA 4M6AA 2WP3O 3ARBB 4S1DC 2NCMA 5CZVL 2NYZA 4W1TA 3T6ZA 1IEAA 3BYYA 3MI6A 3Q1SL 5EC1B 5FV2A 1AKPA 3WFDH 4GRLB 4R5TA 3O4LE 2EINB 4IK7A 3UJTL 5DZJA 3DUUB 5IV2B 3DPDA 4LEXH 1G1CA 4ORGA 3VW3H 2B4CL 2VDRB 1NCDH 1OVZA 3IETA 4ZUUA 1FZJA 2EC9T 2PO6D 2VE6B 5SWSB 4CNIA 1RJZB 2AV1A 1BXXA 1RUKL 2XVLA 1ZLDA 5SWQB 4XP4L 2KLSA 3WU1A 2AK4E 3ZDZF 2EKSA 2ADGB 4WI4A 3N1FC 2LQRA 2X9ZA 3G5VA 4U1IA 3FB5A 4G7YH 1W6WA 2DICA 3QI9B 4OBRA 4KOCA 1RJYB 3DJZA 2B5IC 1KXQE 1JHTA 4M5YH 3O2WL 4NHCH 1GGBH 4F33B 3E9UA 3BXNA 2H32A 3FONB 3Q13A 5CBEA 5E6RB 3MOAL 5CN3A 1EANA 4FOMA 2XTLA 1N6QL 2HN7B 3QCVL 4PY8J 1MFEL 2WYTA 4OF3A 4QLWA 2XN0A 5A3ID 3FSOA 4RGMC 4HUKB 1PZ5A 1CD8A 2GBVA 2XPYA 3VFPA 1PSKH 3QDJD 4J3OF 4PHXA 4WNJA 1PLCA 2EYSB 4OCWH 5F21B 5KSUA 5IB1A 5B38G 4I8DA 3VWJA 3WIHH 2GJ6A 2LLGA 3MGAA 3F7RA 5DHEA 1FC1A 4UMGA 3VD4A 2F08A 5DJXB 3Q06A 4PIRF 1CTOA 4OLUH 1Y07A 4ZW8A 2G30A 5ISZA 4ZW5A 4P4KC 5CEZE 5ICXB 3TA3D 4FQPA 3MODH 1AXTL 1ETZA 1NCBH 2Z92A 3US9A 2AXJA 2P43B 4EOWL 1TEGA 1DQLH 3GMNA 5F7BA 2W0LA 3VXUE 1BLNB 4QHPA 1QZ1A 2ICWI 4FLSA 4PEEA 3X1BA 3UO8B 3VG0H 4XNQA 1A14L 4FQJL 3TFKD 3LZLA 2HJLA 3OXSA 4FA7B 2HRPL 3A47A 3RTQD 2HXAA 1P84K 3ISWA 5CR8A 4R5VA 6PCYA 2Y2TA 1VKXA 1A6ZB 2WSKA 5L7XH 1EAQA 2XG5B 3HG1E 1JNHA 3BVUA 3EHBC 3M1OA 1PQZB 4MAYB 3HA0A 4Z7UF 4KXZI 1PPIA 1A65A 3BDYL 3SN6N 4DK5A 3EJPA 2OKMA 3SHSA 4YPJA 4IBSA 4NDMB 1N2RA 3H55A 2DQ6A 3UJIH 5D2NA 3U2JA 2YMTA 1RZJH 4GFXA 4PHZA 2AAVA 2UWEF 3UPCA 3HNVL 1DVUA 4XZUA 3IJEA 5I5MA 3A4AA 4JQXC 1DL7H 3ZE0F 4ZSOE 1IGTB 1YPZE 2VRQA 1ZLWH 5JA9A 2A4ZA 4ZX5A 2GAZA 5CCKH 2WBJB 3MJ7A 4N2NA 3WFZA 1GZPA 5IROD 1IKOP 2P46B 4KMLB 5HDBB 5DHVB 1OM3L 3VTMA 3ZT6A 5B7EA 1OM9A 2NOYA 1SXSA 4PJHB 2WLNA 3VX1A 3V6OA 4GQZA 1D5ZA 1D6EB 3LKNB 4PJAA 4H88L 3G6DL 5CEZL 2C9XA 3CDZA 3G6JE 2DF3A 2XVGA 3BGFB 3LNIA 7FABL 4XC3H 5E8EB 3EYQD 1W8OA 2ZKXA 5IGXL 1EH9A 3DECA 3C8DA 2EEAA 4V33A 2FWSA 3AU1B 3RGBA 3WMSA 2H32H 2IAAC 1I9IL 3FTGB 3H42H 3WIFA 3RFZB 1HL5A 2OMYA 3LZRA 4ZFZB 4HQQL 4KXAA 2FHFA 2RMNA 2CAKA 2EDBA 3GINA 2VMFA 3N04A 5BJTB 2F54B 4AH2B 2NDFA 2IQ9H 4MXQC 3HKFA 3UJJH 2QQNL 2FWOB 3RUGF 5DMKB 3SYOA 2FO4B 5D55A 3P9LA 4V1DD 1AD9B 1HL9A 1I1CA 2X0VA 3ABZA 2N7AA 3OSKA 4BK4A 1A3RL 2XWTA 4FS0A 1QFOA 2ZUXA 3ZYIA 1QOKA 4Y19A 5EF0A 1R33A 6CGTA 4YDKH 5K9OA 1ED3A 2MNUA 2YHGA 1IGYA 4LXFA 4NO0B 2F8VA 5DHDA 3SCMB 5FYKU 3QNZA 5EN2A 5I2IA 5DYFA 3D50A 2R7EA 1OALA 3B3BA 2OW6A 4IJ3B 2JJSA 3X13A 1F1DA 3J27A 1USZA 2FX7L 2R1WA 4H0IA 4GKSB 1FORH 5DWPA 4WKXA 5LG1A 3UYPB 2EUVA 2X2YA 3DO7B 3SD2A 3L5HA 2BPBA 4N0RA 4OV5A 5F1IA 5J13C 5JHBA 5E0QA 5DJCA 3PP4H 4JHWL 3SOBL 3ZZSA 4EZLA 1M7XA 5C0NC 5FM8A 3PYCA 1OTUC 4P5TC 1A4JA 1HL8A 2VITB 1ZCRA 2M83A 3MJ9A 5I9QC 1KTDA 2UY7A 3LEVH 9CGTA 3QUML 4ADJA 4ANXA 3LN4B 4H0LC 1B6DA 5FKPA 3UTZB 4DUWA 2YOCA 3U7WL 3JV6B 3HR5B 4JL1A 4AQZA 5E0FA 3KGUA 4I89A 3VUAA 2F1BA 3HRZC 1A3LH 4YR6B 2BWIA 2HFFA 4BFIB 4E68A 4HJ0C 1RERA 2P1YA 1QQDB 3S37L 2B3IA 1G9NC 3QIWB 2QPFA 1XF5A 1MW0A 3CN2A 4IEFB 1SF3A 5C1MB 5HYSA 5D1ZC 4G6FB 4N1EA 3VH8G 5E00A 2VDQB 1ORQA 2AJXH 4BH7A 5HHXH 2XBZA 1MW1A 1VA9A 3VXRA 1TQBC 1J11A 1SDDB 5E5MB 4PWKA 4IGBA 4JFQB 2YMXH 1G9HA 2ZOLA 4HK3N 3V0AC 1S7UA 4FXKB 3ZO9A 4LL9A 4F7MB 1FL3A 3CFMA 4S1QH 4YE4H 2FX9H 3GSVA 2OXGB 3B8SA 4M1DL 3LN5B 3TBSA 5BOZG 1Z9SB 2A0LD 4MDIB 4U31A 2Q8AL 4WJ5A 4DP1X 3F64A 1CVSC 5EDXA 1MRDL 4HUWB 4AEIL 1WCBA 2FNBA 3FHQA 1RZGA 1TJMA 3K4ZA 4FLOA 4JFZL 3MREA 5KSAC 4Y4FC 5D1QD 3ECBB 3NJJA 3UEQA 4MB4A 4CSZA 4EEEA 2FLMA 1VACA 3MAWA 4TNEA 4XNYL 2UXVA 2B1OA 2EC9U 3PWPB 4L8CB 1L0QA 4IMKA 3DX6A 4KU1A 4N8UA 2JB6A 2GI0A 3P2TA 4FTVE 5A6IA 5KYUA 3TCLB 1KJMB 2ITEA 5D7JA 5DQ9A 3OAUL 2OBGA 2LAGB 3EYOB 2P47B 2XX0A 5LBSL 3ZMEA 2AJZA 4YK4C 1A7OH 2VDMH 3TBWA 4J39A 4M6OL 5C0CD 2APFA 1ZWIB 3CPUA 3F6JA 4X5XA 5HDOA 3O6ML 4X50A 5AZ2H 2AJ3A 4MMZC 4QHUB 2RAMA 2BNRA 1CL7L 1EAJA 2ATPB 3G04A 5GS1A 1AFVH 1YA5A 1F58L 1FP5A 2X4NB 2K8QA 2R0LH 5EU6A 1UGKA 4ALAH 4G8FB 3MJ9H 1XBRA 1B4TA 1C1EH 3HB3C 3TNMA 3NIFE 3O6FA 4YQXH 4MYPA 1WEJL 4ICXA 1DUZB 1LD9A 5BUPA 3T6VA 3MU3A 1NANI 2WKOA 2OYLA 3MCKA 3S4SB 5B3JE 1MUJB 1V10A 1YJDH 2NZIA 1QEWB 3OM3B 4WEBH 2IALB 3L5WB 2H41A 3BH8A 4HX1A 1WWAX 1WS8A 4F5CE 5D2LA 4ZMOA 4NRZA 1TQTA 2ED8A 2WUCH 1I3GL 4YDJA 1JYVA 2WTRB 1FGNL 2PYEB 3KG5A 3TBVA 2NY6D 3FTZA 4ELDA 3V4PA 4JN2A 3IGKA 1D6VL 5JDSA 2E6JA 4JM2D 4L4TD 4PJ7B 3MV7D 4TUJA 3VNYA 4WF7A 3KBPA 2ZYRA 1T0MB 2E3VA 2Z8VC 4TNWF 5JIMA 3IVKA 1RPKA 5DLLA 4HG4J 1QTPA 2I7OA 3BZ4A 5CZXD 1EXHA 4TQPA 5DZLA 1YEIH 2OR9H 3EYUL 4GYBA 2ZNXA 1MFAL 2X1XR 3AB0B 4BELD 5DHYA 2DWEB 2IBGA 3GRWL 1F8TH 4V1DE 5IEKB 4NBYB 1IVTA 4UTBL 4DTGH 1FQ9C 2F7RA 4WW2C 4PRPD 4DP2X 1OB1B 3MHZA 1L7IL 4LEBA 3CZJA 3EOAB 5E4OA 5IVXA 1IEAB 4X8CA 3RL1A 2BWQA 3EJJX 2HYMA 2EDFA 3QIUA 4XI5C 1JPFA 3T5WA 1KCUH 5B38B 1WAAA 3MXVH 4NS0A 2NXZC 2X9XA 2E4FA 4K3EL 4NRXA 4JQIH 4UBDD 1WD9A 2A6KA 4XMLL 3FO0L 4HUVA 2AABL 4ZODA 1AHMA 3UTQA 3TASA 1FZJB 3V95A 3T0ED 2OSLB 3V79C 4A6YA 3CVHB 1KPRB 2EE3A 1ZV5A 2Q7YB 2DD8H 1JWUB 1YMMD 2GFBB 5A7BA 1QRKA 1ZDSA 4KKQA 5JOEA 3CH8A 1TJIL 1ZA6B 1M2VA 3ARZA 2HKHL 4HU2A 5A2CA 2Z8WC 3FB5B 2DL2A 2VXTH 3SQOH 1ROWA 4FG4A 4PS3A 3FQTA 1FFPA 2R69H 4JDVB 2A3TA 1WITA 1IIIA 3B2PA 3NCYS 3BPNB 2FJSA 4X6CE 2WZPD 1SYVA 2XXFA 3BXNB 5KN5B 4RIRA 1OAZL 1G7JB 2WBXA 2ZOOA 3DUSB 4FNTA 1OE2A 4UT7L 2G60L 2CDGB 1A0QL 1QFUL 4OM0L 1GW0A 5K1JA 2CR6A 1MFNA 3TEXA 4Y1AA 5HGHB 2BVYA 2NSXA 2DQGH 3BW9A 1PZ5B 3IKCB 4HH9A 3QHZL 4PJ8D 4ODVH 4UZUA 4Y7OC 3FXIC 1CN4A 5DU7A 3VWJB 1THAA 2C1PA 2FSEA 3SJVD 3LYRA 1IBZA 4BFNA 4ODTH 1F18A 1PAMA 3RNKA 2MSPA 3DETD 43C9B 2RGSA 3ZVVA 3QQDA 3AS0A 3MRDB 5I8KH 1MCNA 3KYKH 5C0GA 1HH6A 2NX5A 1IC4H 1ETZB 2VDPB 2VZSA 3VXOB 3LVTA 4LSDA 3VFTA 3ME0A 4Y16B 3GMNB 3O2DA 1OKEA 4NQXA 3U79A 1MWOA 1CCZA 2G2NA 5I8CA 5AVUB 3BZ5A 1R5IA 4HD9A 2KDGA 4NT6B 3QC6X 3OXSB 4GO9A 4PJFE 5HGAB 2UZIH 1BVKA 5EIQA 3OWEA 1MJUH 1PG7L 3E8VA 3D1MC 5D7IA 1CFVH 3T4YA 4A7VA 3BD4A 2J21A 5DD6A 5I1IL 1JNHB 4YDLC 5HYIA 4YXHL 4F7TB 1ROCA 4JG0L 3FT4A 5I1HH 3FL7A 4Y5XB 2GYSA 1CF8H 4M6NL 4UM8A 5A40E 1KIRA 3W9EA 2QDVA 3HZKA 5D4JA 4Q4EA 1QZNA 2AMUA 2CA3A 4QF1A 4XTRD 1JXJA 3L3DB 5D1ZI 4HGWA 4QT5A 1MCWW 4G8GD 4ZAKD 2AQTA 1W2KT 4QJ3B 1A7NL 1F1GA 2BCKB 3MBXL 1FFTB 4JFOB 1RAMA 3FH8A 1RLWA 2C9SA 2X1PA 4HBQA 5ALBH 3MLUH 1WS7A 1OP5K 2FH6A 1IFRA 2APWA 3MFGB 1OGAE 2PR4H 2EZ0C 2GAZB 2ICEB 5FUOL 5IM7B 4IRSC 2QV2A 2AXWA 2EUZA 1GZPB 3IJ7A 1YYLL 5FC9A 1QI4A 2WMPB 2K4AA 4A6YH 1ET7A 2DQEH 3QFDB 1X5AA 4PJDB 4YSQA 4X0KA 1MJ8H 1M05B 1P5VB 1MHHA 2Y36L 2V4LA 1LHZA 1E0OB 1DQIA 1T7ZA 3MX0A 2EYRA 3B3IB 4QOKB 4IIQA 5FEBA 1HQRB 1LP9F 4C57C 2R0WL 1G7PB 1OAUL 4ODUA 2DKUA 3P4OB 4Y5VB 1NPNA 4N5EC 5BS0D 3SGDI 1JN6A 2DQUL 4Z7UA 2ITCA 4B96A 1JZHA 1QBMH 1AJ7L 2OMYB 2LU5A 1SXNA 4AEHL 2BJMH 5ENWA 1UWGL 5I19H 5HHVH 4OT1L 3LKPB 4NPYA 2UWEA 1BBDL 2W60A 3O11B 3S96A 1EAPA 2XT1B 3I85A 4OJDH 4J3OG 4AIOA 1U95B 1VFBB 4Y2DC 1HS6A 2BSED 3P9LB 4N28A 2XTJD 4LDLB 4OZIB 3I6GB 5TF1L 3INUL 5IQLA 3MV7E 3SKNA 1E30A 1IZKA 4AGPA 1LO0H 1NMAH 1ZT4B 1VENA 2DEYX 5I0DA 4KMQA 2A99A 1TJXA 2DIAA 2DTMH 3QS2A 4I4WB 5J9PA 2VR5A 1JGVH 2P52A 5I2IB 2OL3H 2R7EB 1W9XA 1JZJA 3VH8B 3KLKA 1BIIB 1GYWA 4KVCH 5HHOB 4L5FE 1W8EA 2R1WB 3PLYA 3WL9A 3MUUA 1A6UL 4YC2C 3KYMB 5B7FA 4QJ4B 5CEYA 3B1UA 4PRPE 1NUNB 3EF4A 4J6RL 1AH1A 5BZDB 2KS0A 4XMPH 5IW6A 4KZDH 3NSJA 3ISYA 4JRLA 5F1IB 3ZE1F 2A6IA 3CZKA 4LCUA 4MZ2A 5D5ME 4I9WD 2I26N 3IU3A 4Q89A 3QEHB 1EMTH 1KTDB 2UY7B 5INDA 1OAXH 4ENED 1H3VA 3P73A 1CFTA 2OMUB 4LOVA 4DN3L 4LPXA 1FYTD 4WHCA 2OTUB 1UXWA 5FKPB 3RUGA 4YHMH 4ZFFA 4PMEA 5GGQL 5D6DC 5TDPA 3T0EE 4OTXL 3CBRA 1S5IH 2NY4C 4RAVB 2C3VB 3N85L 4OJYA 3T3PF 1XAUA 4X6EA 4L18A 4M4PA 3A6CH 1RIVH 3OKDA 4PWHA 3WFBL 2B14A 2XHNA 4KRMB 4NO3A 5IUSA 4PU2A 1HHGB 3DMMB 2JCCE 3HLAA 1T1WB 1XCTB 1XGQA 3MBEB 2YWZA 1IKFL 1SFDA 2WO3B 3WUWB 1ORQB 4P23C 1E5BA 4BH7B 3BAEL 1A5FH 5E6IA 1U8CA 1WUNT 4OLYL 1UT9A 1UD6A 4XCFH 3B43A 1NLBL 5D96B 1FZKB 2GJZB 3IFPA 4H8WC 5EORH 5M95B 4NP4L 4KI5D 3RWJA 2P28B 4L5FL 5JQIB 4HKBB 4Z5RA 4OM1L 2YPLB 2XKNB 5JDJA 1FNSL 1J8HB 5GGTA 1JZ3A 5JA8B 3KYNA 1MCPH 5L4FA 3TBSB 3NJHA 1K4DB 3UZEA 2VUOA 4PGCA 2PCPB 3HE7B 3SJVE 1E4XI 4U6TA 1C16A 4TL4A 5DZOA 4N0UA 4NRYB 2AJUL 4FF9A 1NJ9B 2FGWL 2F18A 2ICCA 3FN0L 2YO3A 3NSFA 4LESA 5K93A 1E4JA 4TM9A 4HPYH 1UOWA 2VO8A 3X3GL 2P5EB 4K8RL 1VACB 3Q3GB 4QRBA