1FI8C

Rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
79
structure length
78
Chain Sequence
PLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCLHRLGGKLENKTLEGWGYDYYVFDKVSSPIEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NATURAL KILLER CELL PROTEASE 1
publication title The structure of the pro-apoptotic protease granzyme B reveals the molecular determinants of its specificity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 2
structure length 78
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1fi8C00
1P0SE 4NIYE 1SLWA 1ID5I 1SLXA 2Y6TE 1EZSA 1SLUA 1EZUA 1IFGA 1N8OE 1SLVA 1XXFC 1AZZC 4IW4C 1ECYA 1ECZA 1XX9C 1FI8C 1XXDC
chains in the Genus database with same CATH superfamily
4EPSA 1WFTA 4XB7A 3RVUC 3U30B 1MUJA 5C70A 3ARBC 3FB7A 4KH9A 5T3XE 5EF2A 5D1XC 4AEIL 3DMMB 4KQ3H 2UV3A 2XT1B 4PJDA 5HGDA 1C12A 4WU5A 2GKIA 1SBBA 1HZLA 4YDNA 3ZRFC 4HOWA 4NYLA 4PRDA 2FR4A 2WYHA 4NN6C 4UILH 4D8OA 3U2SA 2F53D 2HFTA 4P2RD 3LNHA 1DVSA 1YNLL 3GSVA 4K07A 3UH8A 4OF7A 4FZ8L 4UU9B 2MEJB 4E41E 1Y0LA 1J0HA 4V1DD 2VSCA 4ZUUB 2WAHA 4DUVA 1QTPA 3DRTA 1PW3A 1HI6A 3QRGL 2MKWA 4G43B 1GGYA 5T1LA 3SGDI 1M7IB 5FDYA 1U8PA 2Y9RT 4KROB 1TMCB 3DKHA 4AENA 1JZGA 3AMLA 3C5JB 1ZHKB 3EH5B 4NZJA 1BDYA 2G3XA 3TN0D 1M3JA 2W65B 5GGSB 3H56A 1D9KD 4KV5E 4HIHA 3MJWA 1DHKA 4PRAA 2VL5A 1UGNA 4IRZL 1O75A 3G6JF 4QGYA 4XMTA 2JJTC 3DGGA 1KV7A 3IMWA 2AHIA 4ZFOB 1TJIL 3R7QA 4OF6A 5TE7L 1WFJA 4KGJA 3TT3H 4P57A 3IWVA 3B9KC 4PJXE 4JM4L 1V55B 2X88A 5JHDE 4P23B 3UJJL 2MMXA 4L4TE 5FWRA 3IDMB 4P9ML 4QHNA 4WRLA 4PCSA 2QR0B 1GPOH 2QELA 5CEZE 2HKFH 3FQNB 5E4OA 3B6SB 3FCUB 5CNHA 2OSLA 1TFPA 2GY7B 4IBYA 3OGCB 3KPQA 4PY7A 5DHMC 4TQEH 5KVEH 5MENA 1NCAL 2Z31C 3LX9A 3K74B 3PGFL 3FB5A 3KLDA 4K0OA 5KJ7E 1FL5B 5DR5L 3TO4C 3ASWA 1BFOA 4F8NA 1SFHA 1KCSL 3SBWC 5LQBL 1RJZB 2IGTA 3FFOA 4O02A 4AIXA 1QSEA 2ZCHH 2X28A 4AZ8B 1FORH 3L9RB 4OI8A 4OFVA 3GIZH 1QSVA 1EH9A 3EF4A 4JZNA 2HT3D 1OE3A 4WJ5A 3T3MF 5HI5C 3PWPE 5I66B 1SJEB 4P9HC 2JVUA 3IJYB 3QW9A 4PJ9A 4CSPA 1XR8B 2B0SL 3BUDA 2PKDA 2Z0UA 4QRUB 1WD9A 4X4ME 1T0MA 2CRMA 5K1JA 2VIRA 5BV7H 3N43B 3VXUB 5D2NE 1IQWL 2VT0A 2XWTB 3GT6A 3K2UH 1JWMA 1JGVL 1PZ5A 2VDLH 3MX0B 4FXKC 5AD0A 5I23A 4K7FB 1KCVL 3UERA 2QPUA 3BPCA 4LPVA 3OAZK 3BPOB 2I25N 3CFCH 3CZUB 3VSTA 3LD8C 4QRQA 2NZ9C 5IJVA 1V7NL 1NCTA 4Q0XH 2F5BH 1I3RA 4GIOA 2P47B 4MDJB 1PZUB 3EZJB 2GC4C 2OP4H 1EJ6A 4YFDB 4MAZA 4JVPA 2AQPA 2NUTA 5E0FA 4P2RA 1WBZB 2ZF8A 1W8OA 1AHMA 5ETUB 1MW3A 4BYHA 2CBOA 3QUYD 4GRLB 3VRLE 5IHUL 2FBRA 3LDBC 2DWEB 4NQDA 3V4PA 3FYIB 1B90A 1ET5A 2BPBA 4JFEB 1J9TA 4KY1L 1DVQA 1I9JL 5DS1A 1TIUA 1KJMB 5C09A 3BKCH 4IMLB 3HRPA 4XTRC 3APCA 3MUGB 2XV3A 2QL1A 4N0YH 3RWJA 2OMWB 4ETYA 5I5MA 2CPUA 4V2CB 5AVSB 1UCBH 2W80C 4LEXH 1S9VB 2VKWA 5EU6A 2DJUA 1WIPA 3FAWA 1NANI 2P5PA 4LU5H 1QSFD 3BUTA 3QUZD 4TLTA 1D9KA 3PWJB 1RUML 4U1LB 4Z7VA 3FO1B 4ZTOL 2AZAA 5DJ2A 3HS0C 3G6JE 2VN4A 4U2ZA 4DKEH 3EW3B 4DJMA 1WCQA 2ADIA 5FYJD 3CSYB 4D0CA 4JFYB 4FQCH 1BPLB 1TZIA 4OT1H 4HKBA 2XQBL 4KGLA 3LRSA 5JO5B 4HS8L 4YGVA 3RFRA 4ZSOB 4GQ9L 3U4EA 2P5EE 1ZTMA 4ZFGL 3REWB 3VI3A 1LK3L 4GAGH 3SGEI 5EBLA 3J27A 2JLLA 1DUYA 3QJHB 1U6AL 4HJGA 3H8NA 5EZIL 1AH1A 2UZPA 3UAJA 3TXAA 3QYCA 4KK8C 4YNYB 3CDYA 5KYYA 2AK1H 4F7PA 4XR8C 4TMPA 4P4KA 5EA0H 3QCVH 4MXWL 4I3SH 1FZMA 1QUNB 2YUVA 4KRPB 4XP4L 4ZMAT 4U1KB 3VWJA 1A9EB 2AMUA 5HHOA 4HWEL 3L5XL 3FONB 2Y1AA 5JLZA 3NJIA 1QFUH 4X4KA 1UKTA 1UQSA 2ITDB 3QZLA 2H9GB 2XBTA 1NGPH 4X99A 3T3ME 3UYRH 2ZUYA 1N9PA 4HV8B 3ZU8A 5C9KA 4XC1H 5IB2A 1WGVA 4NUGL 1X9RA 1U2CA 1U4EA 1U8QA 3F7PC 5DQ9B 4DK3A 1F13A 1FFRA 2ZSVA 4FP8H 3S37L 3T8VA 2J20A 1QFWL 5IKCA 4BHUI 4N90D 3LIZL 2YARA 1P5UA 4YSDA 5GS3A 1HKLL 1QEXA 1G0XA 2E59A 1WQVT 1E4XL 4J3SA 1RJYA 5TDNA 2CDGB 4I7ZC 1J8HA 4BUQA 1WS7A 5JQ6H 4I18C 5EWIL 2R0WH 5KJRL 3QI9C 1VFOA 5KBNC 4YE0A 2O61A 5F1SA 5DEFA 2EDMA 1YJDH 2MWCA 1Z6JT 2NY0B 3Q1SH 3FCBA 4JFHD 4JKMA 4O51A 5EUOA 5F3HA 5IBUG 5TF1H 3ZJAA 2HT2C 3KVDD 4G9FA 4WI9A 1J0ZA 2MCPL 5FIEA 5LJYH 3B5HA 4XC3H 3L13A 3V4VB 1UKSA 5BVPL 4WW1A 4M6NH 4LHUA 3DSFL 3ZW3A 4TVSa 1KCUH 4MMZA 4YSTA 3BT0A 1I8KA 2OCCB 1DFXA 1JXFA 4YC2B 2AXFA 3SKNA 4QLWA 5LN8A 2LLLA 2LFGA 4HLZG 3ALPA 2JKNA 4U1MA 4BV1A 4CN1A 2Y36L 2J1WA 2MPVA 4N0UB 1BEXA 4KHXL 2EIJB 1A6TB 1KIPA 3EOAA 3VWKD 5A2BA 5D8JL 3UTTB 3IN2A 2F7QA 4TPRH 1T5WA 3OJ2C 5ES4B 3Q7JA 4HJTA 4C8XA 1QO3B 3QUZA 5DJAA 3U7AA 4JZOA 3VXRB 2E7BA 1R3JA 2CUMA 4OTXL 1FC1A 5DURB 2GY5A 3A5VA 3VA2C 5GGQH 1FLRH 1S7XB 5GRXG 1EJOL 1ZVNA 1L9SA 1UT2A 2DRUA 3D69B 4XZUA 3OM3B 1QTSA 5JOFA 1NIDA 1S7SB 4GRWE 2WLNA 1S7WB 1AIFA 3MA7B 2Q2LA 3MDJA 4H4NA 4J6IA 4RMQA 1C1EL 2GIYA 3OXRA 4RGNE 4TQ8A 2V7NA 4QKXB 5B38A 5BV7C 1XF4A 3M46A 2HZHA 1GS7A 2X0UA 4HH9B 4WHTA 2JQZA 5L2KE 5DRNA 1D6EB 3KM1A 1KXTA 1I7ZA 2ZAHA 5EO9B 2ZPKL 3WS3B 1PIGA 3IKKA 4X0KB 4FFYA 4R90L 4WU7B 5CGBA 1ZSHA 3O4LD 4HPOL 3H6JA 5C0JB 1KEML 3O9WA 5IM7A 5DHXB 4P2QB 3WNPA 5IB5A 2EDQA 3BOVA 3PF2A 4P5KB 5GRVL 1QYGH 2BSBA 4EVNB 1J48A 3AS1A 2IOIA 2VOTA 4X7CC 2VXTH 2HG5B 2JKTM 1BOYA 2XIIA 1IGJB 2CHNA 1X5GA 2A83B 2GSGB 4YFLI 1KPVA 2VRKA 5CGMA 5D4JA 4KJQD 5K9OB 3ARBB 4NO3B 4AEFA 2BMKB 1IC7L 2MNJB 4PB9L 4Z78B 3KWWB 1A7QH 4DVRL 2OJ1A 1FVCB 4WEMB 2ADFH 5DTFA 4KMTL 3OKMB 4F3FA 1KN4L 3DX6A 1CVSC 1A7NL 3EYOA 3GSOA 4NN6B 5FOJA 4BK5C 3IGKA 1U8HA 2Y72A 5D6CA 1A25A 3OTTA 3TNMA 3UFIA 3LEXA 5IW1B 3TBSB 1KJVB 3QS3A 3VDAA 3WFDL 1DTUA 2EXSA 3ZQXA 1CE6A 1I3GH 4AVIA 2YAHA 1NFKA 3FU7B 3T0EA 4XO8A 2XTJC 4O02H 5E56A 4QJ5B 1T4KA 2JCCF 1G9NH 1ZXQA 2OMZB 4TQIA 3FUEA 2EDOA 4RDBA 1N70A 2IVFC 3OKLB 4HCIA 1EVTC 4HXAL 1B4RA 2CKNA 2UZXA 3KBFA 4QXUH 1MHHB 1W9XA 4N2AA 2D0GA 3HPJB 3BUPA 1UJTA 1W8EA 2X9YA 1JGUL 3N50A 5TFSL 1ZLUK 2R0KH 3F6IA 3V6OA 3NP3A 3SDDD 3HG3A 4FQ2L 3C5ZD 1F90H 5L2JA 4E9VA 1I82A 3FO2B 4UYPA 2X4RA 4LARL 5E2TL 5HYQB 1P9MA 1XSIA 3VWKA 2HAZA 5HVWA 1T1ZA 4DPRA 3F8UB 2NXYC 1JZ6A 5CILH 5HGHA 3Q9QA 4DESA 1PF3A 2GSMB 4LLYB 4PRPB 1ZS8B 3H2QA 1JYWA 1G7HB 2ZWZA 1X5AA 1ZK9A 2EICA 4LLAA 4XRCB 1JVLA 2CGZA 3L1EA 2BSRB 3GBNH 3NTCH 2DEWX 1NTDA 1XGRB 2CO6B 3MREA 1OXYA 5I1CH 4QI3A 2VO5A 3RA7H 1IGMH 4YZWA 2Z64C 3EJYC 4ZFOL 2Z31B 3OL2A 2EVIA 5T3ZD 3KLAB 5JOPE 4UB0L 1KGYE 1LP9F 4MTMA 4KKQA 1RI8A 4KH2A 5AVXB 4BWUA 4MJ5A 3UMNA 3GXNA 4KUCD 5DGQA 3V4PH 2P5WD 1Q9OA 4LSQH 3P9MA 1V3LA 3S3SA 3KXFD 4RMTA 3W9EA 4X4XA 4DPCX 3BZEB 3SDAA 1NBYA 3E3QE 4HVBA 1SM3L 5I1EH 1QACA 1X9LA 1QRKA 2F9BT 3I9GL 3O4LA 5CD3B 4B5EA 1DO6A 4TF4A 5F7EL 1F4XH 4ES8A 1YY8A 3VFGL 5E8PB 5EO1A 3ATDA 1MF2L 2IBBA 3FMGL 4HGKC 5C0BA 4AYDC 4FXKB 1SFDA 2A6IB 1OAQH 2F58L 2DQCH 3IS0X 4WI6A 1NC2D 5D1QC 1UB6B 4LZKA 3ARGD 3F05A 1FF5A 2V2WB 4GT7A 2WLIA 5BRZB 3JWDL 3MV01 1XX9C 2Z8SA 1F1GA 5KYXB 1JNLH 1N64H 5B1CA 3LD8B 5A6LA 5ID0A 2HLAB 1OF2A 4W9KC 4WJKB 1WT5C 5M94B 1MFCH 3U9WA 2GYSA 3IKCB 3EO9H 4OV5B 1Y7VA 1FO0A 4NQED 3TWYA 1XF2B 3A0OA 1V3JA 1TZGH 4JFSA 3QJQB 1QLRB 2WMPA 1OEZW 4JFPB 5ERWA 2A5UA 4GEIA 4H1LB 3VFSA 1BX2A 3O41A 1GY2A 2ADYA 3CXHK 4DN4L 1OAXH 1J12A 1CU4L 2EDFA 3LH9A 4M7ZC 1XT5A 1KYDA 4FA8A 3CDGB 1G6RA 4XP6H 4G82A 1WC7B 3LV3A 8FABB 4LAQH 3LDBB 2WO4A 2GSIB 3DK2A 2JCCE 3S88H 2V2TA 1BZ9A 2ZNWA 4NBZB 2BFGA 2QQKL 1N0LA 1HHIA 3QQ4B 4JDTH 2BFVL 1RVFH 2F61A 3X3GH 4B96A 5ACZA 4PJBA 2Y7QA 5LNGA 4G7VL 1KACB 2EIKB 1KENH 1IGYB 1OPGH 3IJHB 2ZT9C 4N3UA 5F96L 3WNJA 3FB6A 5B1BB 2WLLA 3GJEB 3FRUB 4LBEA 1D7DA 3FQWA 2NW3A 3RIFK 3C5ZA 3I75A 1JHTB 4YHLH 4PV9B 4U1JB 5CBAB 4OZGF 4TYUA 2CHZA 2OJZL 5IOPA 4CGUB 4PRNA 2FWUA 3BQUC 4X98A 1AGCB 3U7WH 3VQMA 1XCQA 4QTFA 5F8QC 3T2NH 2DD8H 2XVKA 2PWDA 1DSFL 4HT1L 4N2FA 1HH6A 1TQWA 2VDPB 1ZLVK 2VN6A 3ZDWA 1DQTA 3DUSB 4JRYE 3SGKA 1NCBH 4A2LA 1PMYA 5IVNA 3MROA 4YLQT 3MUZ1 2YXVA 4WO4A 5I8EB 3MNDA 1LP9E 3PXJA 2GK2A 4JFFE 1D5MB 3O4OC 1BQLL 3STZA 1M9WA 1X4YA 2DQEH 2X1WL 4PJEF 1E8ZA 4P46A 2NSXA 2DB8A 4MQXC 3SIKA 1AMXA 2B2XL 3BD4A 1FVDB 4LLMB 5EULV 1LE5B 2B9BA 3CU1A 1NCDL 2K70A 3U1SL 1HYSD 3BUQA 1TKWB 2I26N 1C5DB 1FH5H 2PCPA 5DT1L 1HFUA 1JDDA 4GAAA 1G9NC 1VZHA 1AZZC 1AQDA 3II3A 3CN3A 4Y19D 3M45A 5F72S 4JHAL 2CZNA 1PX4A 3C87A 4CGTA 1OTUC 3QNYB 1NUDA 2AEIT 2R0ZH 5ESVA 5SWSD 2WYZA 2CLVB 4C57C 4I18B 5FYJH 3PFUA 3ARGA 1OSPL 4QOKB 2DI9A 3QI9B 1ZT4B 3WNMA 3K5SA 2X38A 4YJZL 2WWNA 4ZYKA 3QYMA 5DQJA 3RUGF 1ILSA 3WUWA 2J2ZB 2I9TB 1BWMA 1QR1B 3BZ4B 1A1OA 1IBGL 1KGWA 1DL7H 3BAIA 1PKQA 4N6RB 4ZO6A 1TJHL 3BHBA 5M95B 1EGJL 5D2LB 4NQEA 2FSDA 2BVPA 4JR9L 4ODUA 4L8CA 4FFYH 2V9TA 1UD2A 1HT6A 4OSUH 1AHWA 1G1KA 4CNIA 3LS4H 1ZPLA 4GI8A 1VGKB 1T2JA 4IIQA 4MB3A 4J3BA 2IH1A 4QAWA 3LZPA 4FF9A 4Y8AA 5LN4A 1IT9L 3PJSA 1G9HA 4HYTB 2NNRA 3DVIA 4NWUL 3EJRA 4AYMC 3V4VL 4CVXA 1LEGB 3DIDA 2XJLA 4CILA 1EDQA 4BKLA 5CUSL 5K5YA 3CZFB 2YXWA 5E2UL 4YHKH 1Z5LB 3W0WB 4YDJB 2QZ5A 2YZ8A 3WN5A 3MRDA 1GC1H 5HHPB 4XP5H 4G6AD 2YRPA 2XN9A 4KNSA 3RDTD 1R5WA 3ZPDA 3NJFA 1KPRA 4JVWA 3DV6A 5C07D 2A4CA 2D0FA 4OZGE 1AZUA 2MQCA 2EEAA 5T5FL 1FFQA 1R5IA 3JT2A 4MQ7A 3T6QC 5C7XH 1WDAA 3TN0C 2WLKA 5E2JA 2SEBA 5AOMA 1CXFA 1D9KC 1J11A 5E5MB 2GC7C 2PPAA 2X6MA 3Q8FA 3LQAC 4WNJA 5BV7B 1S7UB 2Z92A 1FHNA 1I8UA 2VDLB 3JWOH 4PRIB 2FLMA 4I3RH 3CQQA 3FTYA 4TQPA 2HJFB 1VJSA 4KVCH 2KPNA 3DETD 4QWWD 5JDJA 5CD5D 5KZCB 5KSAD 3MRPB 1RUQL 2IFFL 1YEEH 3IDIA 4M7JL 1A6AB 4G5ZH 4TNVF 1DR9A 1PLAA 4BFIA 2QV4A 1GYVA 1CLYH 3B7YA 3FN0L 1BAWA 4PJEE 1O0VA 2XOTA 2CO3A 3TZVD 1MCPH 1RERA 5FEBA 3L3GB 3P4MB 1P7BA 2EVHA 3DIVA 4JKPH 2IH9A 4RMSA 4TSBL 4A04A 4QAMB 4ZQTA 3BGMB 3TBYB 1XBDA 4QIRA 4OCRH 3BH8B 2I5YH 5J1AA 4WF7A 5AZ2H 1D5XB 5FYKH 3AQXA 3S98A 3LKOA 1A4JA 3WFHB 5IEHB 5JA8B 1HC1A 4OZFG 4HBQA 4DZ8A 1SMOA 4QTIL 4YAQB 4DETA 3G3LA 1MZYA 4U1IA 4L1HA 5GS0D 3WY3A 4NJ9L 2VDMH 3UBXB 3L1GA 1OP5K 1WUZA 5SWSA 5BZDB 3WTXA 2E8ZA 3QXAA 3N3EA 4J3UA 4X7DC 4CW1B 3MU3A 2V8LA 4FFWD 5HHME 4DPAX 2FHFA 1G7IA 3RUGE 3EJZD 1E0OB 2FX8L 3X14A 1XBRA 1VHPA 2XTJB 2XYCA 1AS6A 4G6JL 5I1AA 3KG5A 4L8BB 3MLYH 3P9WB 4ERSH 3PY9A 3IPBA 4ODHL 2Y23A 2EH7H 3MV7D 5KYUA 2DQIL 3KNBA 4WKZA 1FG2A 3CQFA 3S97C 1AXSA 2OMYA 3ES6B 3M86A 1UATA 4X6CB 4MAYA 1A6WL 2D31B 5HHXH 1FYTD 5IBTL 3T0BA 3EG9A 3MRQB 5HGBA 5J89A 1M1XB 4KQ4H 4OQTL 5C3LD 1FCGA 5E08H 4IRSC 3VGDA 3WYRA 3BIKB 4MMZC 3WHXA 5DJ0B 3ZHDA 3QUMA 4LEOA 5IGXH 4WFFD 5E6ZA 2WNWA 4JFQB 3KH3A 4MNHB 1C5CH 1OLLA 2NXYB 5FA4A 1U91A 2FH6A 4NRYA 4BH8B 3QUYC 4PJ7B 3T4YB 4YHZL 1IILE 1YEHL 4ZX6A 1JPFA 3D06A 5E4IA 1QPKA 3QQ3B 5DSCB 2R1YA 3DGDA 3AS3A 1F8TL 3IFOA 3QULA 1IC1A 3L95B 3OV6A 1KBWA 3L6FA 3J8F7 3RDTA 2HKHH 1VFAB 2V33A 5CFHA 1JNJA 2WYTA 5C07A 5F3FA 1FO0H 3OXSB 2V5RA 2R9HD 3R19A 4PFEA 4D2NA 1ML0A 2NOYA 2W8CA 3QUZC 5AB0A 1ID2A 4JDVA 2I7SA 5IW6A 4FGMA 2J72A 2AEPL 4O2CA 3K4AA 3PWUB 5DD5L 1E5AA 1G6RH 4J8RA 4AK2A 4FQJH 3QG6A 3RIAK 2ZXBA 2F19L 3FRPG 3LVTA 5F7DA 1EEQA 2Q7AA 4UAOC 3WD5L 4F7MA 4PLNC 3KPMA 1J9SA 3DO7A 4JAMA 1T89C 5KSAA 4G8GA 4Y8DC 3T4AA 4AYBA 5I76A 3Q2CA 3HG1A 2AV7A 3OB8A 3A47A 1U42A 1WFUA 3RL2A 3TZVA 4QR7A 7CGTA 1RK7A 1EEYB 3DECA 3A67L 4L3FA 3S4SG 3TVMB 3VXSE 4DTGL 1HHGB 5KN5A 3QARA 1JGLH 1GW0A 2VDRL 2YMXH 1I1AD 2OMUB 5TDPB 3CLEL 3ULSB 5I1GL 1H6TA 1H5BA 1YMMD 2E7HA 3ILQD 1ET8A 3TJEH 4P9HL 3ERXA 2NRDA 1DVFC 3F12B 4RX4D 1QAWA 2ZG3A 3D30A 4H8UA 4HIPA 2VR9A 2XG4A 3MLWL 2MQ0A 2G9HB 1MFNA 4GMSH 4GW4A 5I1IL 3L9YA 2DQUL 1ECZA 5LAXA 1ZLVH 1D5RA 1MUJB 2IAMA 2HT4D 1J5DA 2KI6A 4FMVA 1H9DA 4YBQC 3UACA 3IRPX 5T3ZH 3FH7A 2E86A 5JIDA 1YUKB 3HUJE 1MCDA 5BJTA 4KZDL 3B7UX 4M7ZB 4PJDB 5HGDB 1C12B 4WU5B 5LBSA 2OK0H 4FD0A 4Y1AE 4NYLB 3SQOL 4PRDB 3UTQA 4KK5D 4M5YH 1BM3H 1YEIL 2ZOOA 3LNFA 1IEAA 4E9TA 3U2SB 2B1OA 4JO1H 1YN6A 3L16A 1JMXA 2B8OT 4NKQB 2AAAA 2CUIA 43CAA 1ZV2A 1Y0LB 5D6DA 1BVZA 1A6PA 2OULB 3QHZH 1XDTT 1KUMA 3DRTB 3KR3H 5FB8B 1HI6B 1JE6A 2O5XH 4LASH 1W80A 1FYTA 3VD3A 4BRJA 3MACL 1A7PL 3TT1H 3MOAL 1U8PB 3AG3B 5B1AB 3RJOA 2ESVA 2MHAA 3BH4A 4RISL 2ZXWB 3UZEA 4AENB 5IMLB 1U8OB 5AAMC 5EEXA 2VSDA 1IAOA 4LLDA 5C08E 1INQA 4HIHB 4BGLA 1I8LA 4MRBA 4PRAB 3V6OC 1MJ7H 3L4XA 2VL5B 1FNGB 2FAUA 4JO8A 3VM7A 5F3BA 5IJCC 3HZKA 3DGGB 4M62L 1JFQL 2GFBA 3ELQA 3B43A 2A9AA 3ARRA 1SF3A 2Y22A 2EIEA 1MLBA 2E4TA 3F6JA 4JMXA 4P57B 2NNAA 1AIZA 2DPKA 3MXVL 5E1QA 1U0QA 1LEKA 4U0QB 5I6KA 1CG9B 3GF8A 3DOIA 4K5OA 3KGRA 4J1UA 3PCYA 1JWSA 1DQIA 3O4OB 3QJRB 1BVKA 4KU1A 4WEUD 3TO2A 1C8QA 2YRBA 1R5VA 2H7WA 1FWXA 4OLYL 1I1RA 2YD9A 3WOVA 1BW8A 3LZQA 1RZ7L 2OSLB 4CN6A 4PY7B 3GPSA 5MENB 4NM8H 4R8WH 3FB5B 2CKBA 5IIEB 1BFOB 5L88H 3SYQA 3NSFA 1DBJH 2VAAB 1QATA 1JOIA 5IB1B 1G7LA 3DRQA 4O02B 1SN0A 3KPNB 5D7JD 1AZCA 3QDGD 1QSEB 2CRIA 1QWUA 2FSEA 3HC2A 2G5UA 2CA4A 4GBXC 5J0BA 4PY8I 1XIWD 3H3BC 4NQCD 2DYRB 4JZNB 4NIKB 1WCBA 2CJUL 1X5FA 3CHPA 1ACXA 1JXJA 3BUYA 3RKPA 3NQKA 3H9SA 2VIRB 4RX4A 4P4RA 4X5WA 5HYIA 4WI0A 1SYVB 5AD0B 1JWMB 1PZ5B 2H3NA 3OZKA 3GYRA 4PMEA 3JQOB 4P3CH 3BPCB 1WPCA 4UDTA 3G04A 1PD1A 3VCLA 1TSHA 5GGVL 3AY4C 3MGTA 3IFLH 3QYNA 2DQTH 2O72A 3DURA 4QRQB 5GZNA 5IJVB 5J11C 4PJHA 2Q6WA 3O2WH 2QPSA 3TP4A 1I3RB 2BS8A 2ZF9A 3S96A 3ZZSA 1FGNL 4HCRA 3SO3B 4S10A 1ECYA 2WXFA 1F6AA 2NUTB 2F53B 4P2RB 2GJ6E 2K1MA 4WWKC 5LVEA 1MCCA 3A6CL 3G5ZA 3K0YA 3KPSE 5TQ2H 3L1OH 5EDSA 2HN7A 2NUPA 2J1ZA 4V1DB 4YR6B 1CD8A 2ENPA 4G1EB 2YPLE 1P84K 3OX8A 4I0KA 2IIJA 1KDIA 3GMRA 3H85A 1FBIL 3HTLX 1IEHA 3RWJB 3WKYA 3A4AA 5F9WB 4HK3N 3F7KA 1KB5A 1CDIA 3EJJX 5EU6B 4NEHB 2UVEA 2KUTA 4YSCA 3N43F 4PJ5E 1CGVA 3TN0B 4XOBA 3BZ5A 4ILDA 5IW3A 4M9PA 4A7GF 1D9KB 4UTAL 3MRIA 5AFAA 4MSWA 3RNKA 4Z7VB 3LPFA 4XO9A 3SDDC 1AD0A 5DJ2B 5FA3B 4YXHH 2ZCHL 4ONGH 2NY2D 1PGRB 4L1DA 3QUKA 3QR0A 3SPHA 1J0JA 1AHKA 3GIZL 4ALAC 2DJSA 2ADIB 4D0CB 2P80A 4PU2A 1TZIB 2B77A 2DWYA 3RY6C 3LRSB 1JNHA 2GTQA 3E8VA 4K94H 4YGVB 2HVJB 2JI2A 3U4EB 1HNGA 1SN5A 3VI3B 1FNSH 5AOIA 5ANHA 5EBLB 3LZFL 2JI3A 1DUYB 3UTPE 5BV7L 1KFGA 2PWGA 2Y1VA 3K2UL 3QEHA 2VDLL 1LILA 4F7PB 5AOZA 1UXSA 3KMDA 2PPEA 5H37G 1J0KA 1EEZA 3QUMH 2UYLA 1UWGL 3MPCA 4P4KB 1FZMB 3L3IA 4M3JA 3F5WB 2YPVL 1G7QA 4O2FB 3K6IA 4NAMA 5D7JA 3VWJB 3E6FA 3M1BA 5JLZB 3OKOA 4A7SA 4LCVA 4M1DL 1L9TA 1RPQA 1XIWA 4Q0XL 3LNIA 4NQCA 1IBZA 3MGOB 5I2IA 5BPPA 2OP4L 5MEPA 3KYMA 4KWUA 2EO1A 1B4JL 5HDLA 2QMKA 2RALA 5CP7B 4B9CA 4YN3A 5ABDE 3RE0A 1E4WL 3TCLA 2DQJH 3WE6B 1M4KA 1X44A 1GGIH 2YWZA 3DYOA 2EIZA 5IKCB 1S78D 4P07A 5ILTL 1AGBA 1TZHB 3KL5A 4GT0A 1DQLL 3E7JA 4HJJL 5CZRA 5TDNB 3BKCL 5JPNA 3QWQB 4XBEH 1B2WH 1CFMA 1EZUA 2AXJA 4XPTH 3T1WA 3ARGC 3VH8B 1SLVA 1U8JA 2FJHA 3IN0A 1BIHA 5EUOB 4LKCA 3GTTA 3PAUA 4XAWH 5JIIA 2J5LC 2E74C 1S2EA 4LU5L 1OE2A 3SCMA 3EDJA 4WWOA 4ACTA 3OZ9H 5GGSY 2W9LA 2LU7A 3WNLA 3PV7A 1DYZA 1ZHLB 2CK0H 3QHFL 4WW1B 4NC0B 5JIMA 2X4PA 4AQ8C 1GSKA 4MMZB 1AHWC 3OKEB 4FQCL 4OT1L 1K6QL 4MJ6A 3O45B 3ET9F 4MFHA 2W9EH 5IMMA 2H41A 5K69A 4AYEC 3QUYB 4GKZA 3UBXG 4JUTA 3SKNB 5HJBA 1BXUA 4NOFA 5FK9B 2X10A 4AQAA 4K23L 2W38A 1JVKA 5JXED 4ZS7H 3LVEA 3EOAB 2EDNA 5GS0H 1GL4B 2AK1L 1LWRA 2UZYA 3VXUE 3IDXH 5EA0L 3QCVL 2F7OA 3KBPA 1VDGA 2ZWNA 1QSFB 3QUZB 5DJAB 2AQQA 3G5WA 1R3JB 4KO5A 1A8ZA 5CHNB 5B1KA 2A9ML 2WKLA 4EZMA 5LBSH 4ELMF 4N26A 8PAZA 1HEHC 4XZUB 5EIQA 3L3DA 1QLEL 1GYCA 1HH9A 4UAOB 1JZJA 2Q7NA 1NA8A 1NGPL 1I8IA 3EGSA 4YDIL 3BT2L 1IQDA 2D2CC 3OXRB 3WKMH 2A77L 4XC1L 2WP3O 4HX1A 1TSRA 4PGZA 1TQCC 2VUYA 35C8H 5B38B 3L2MA 1XF4B 5JXAH 3O3DA 2QV2A 1IBYA 1MFAH 3SE3C 4Q9QH 2EDRA 4OLUH 5DMIH 3JYBA 2FT7A 2RCSL 3FTSA 3LH8A 1I7ZB 3IU4H 4KX8A 3TWCH 5BNXD 3KYKH 4MD0B 4EBQH 5DMKB 1JZ3A 3DIFA 2X4QA 4Z5RA 4E36A 3F85A 3QR2A 4LEEA 1U92A 3AQYA 2ZXQA 2Y06H 3DO3A 4YWGL 5IB5B 5TF1L 3IDGA 2C9SA 2TSBA 5DFVD 1NJ9A 4MLSA 3CWGA 4PTUA 2K6YA 2CNZA 3NN8A 4R0LA 1J8KA 3VAEA 1CWVA 2F5AH 4E41A 3FT0A 3GKWH 2OR9L 1ZLEA 1EBPA 1Z3RA 2VITA 2WBXA 3CFQA 3M1OA 2YO3A 1CL7H 4O9HH 4XVUD 1TQBC 1ODAA 2J57A 2ZCLL 5C0FB 5D5MA 5IMOA 2EEFA 4IRJD 3V79C 4O58H 1E9QB 1X6LA 2EE0A 1ZT1A 4M4PA 3HI5H 1EQWA 1NUFA 4NKOA 1I85A 3CZNA 5DTFB 4F3FB 3DX6B 3TEWA 4TSAL 3HN5A 2X4OA 2NQ3A 1CBJA 3GSOB 4FQQB 4TNGA 3FU6A 4ZSOE 5KVDH 1EIBA 4UNIA 3TCXA 5D6CB 3GTNA 3TNMB 5JW5B 2CKBH 5B22A 1JF6A 4PUBL 1CE6B 5AW5B 2XI9A 4MDRA 3QFDA 1DQQA 1T22A 2BNRD 2YSTA 4TNWF 5J12C 3T0EB 2QPDB 5TPWL 1AQHA 1DZ0A 4CA4A 1EHLH 4U0RB 4HOXA 3EYFA 4OCWH 4HUNB 3VFUB 2UZXB 1MRCL 3EJPA 4K94C 5DK3A 5JHDA 1LWHA 2K3TA 2RFXA 4L4TA 4NUJB 4XXCC 4BFNA 5C0GA 3THMH 4MS8D 4XVJH 4AH2B 3JWNC 2CBTA 4OFIA 4XNAA 1XGUA 5AW1B 5I8OH 2FBJH 3FTXA 3BEWA 2AJXH 3KEHA 3LRGA 4GXUN 4QHLA 3TURA 3BMVA 3ULVD 1RP8A 4ZZFA 1KTDB 4JS7A 4BIKA 4F37K 2WXJA 1GR7A 1GAFH 2OPCA 2NR6D 2O4EA 2X4RB 4JM0A 4Q14A 5JXEA 5ACLA 3VWKB 1OP4A 1QI3A 2F1BA 3II1A 4P5MA 4LCWE 5HGHB 1LO2L 5JHMA 3D2UD 1MEXH 2LR4A 2OYPA 1ZSDB 4DGUA 4M6OL 4KXCA 2FL5A 4G6AC 1ZK5A 2PCXA 5D55A 1XGTA 3UX9B 6FABL 3MREB 1OOWA 1FIGH 1L6PA 2VDMB 1F4HA 3HKFA 1YYML 4HCRH 2VXTL 4B27A 3L4CA 1A21A 1E8XA 1GOFA 3P3RA 3I3BA 2EJ1A 5D2NA 1BYOA 1RMFH 4PHZA 4ADGA 1BV8A 1KYAA 1MVFA 4R4FL 3FFDB 2DMKA 3Q2VA 2APBA 2RHEA 2Q7YA 2YEZB 3DETC 3P9MB 4QWWC 1CT8A 2YA0A 3W9EB 5CD5C 1JPTL 4X4XB 1PY4A 5KSAC 3T4AC 3PPSA 3IJSA 4WTZA 3HFMH 2XU9A 5A2FA 1AS8A 3O4LB 4RESB 1HS6A 1KB5H 3K0WA 3LKNA 3L4UA 4WI7A 1YY8B 4ZRGA 1IFHL 3QVAA 5E6IA 5EO1B 5SV3A 1SXNA 4N0UE 3TZVC 2VDNH 4M1GH 1Z5HA 3BVWA 1D3CA 2CO7A 1AXIB 3UTTE 2DM3A 3R18A 1G9NL 4MD5B 2QSVA 1CGYA 1TCRA 4XNQA 5G4NA 3MI6A 4ZD3H 3TEZA 4JPVL 3VD1A 3VXRE 4GQRA 2VR8A 4AE1A 4BQBA 3OLIA 3DOSA 5FM8A 4UNVA 1MCEA 4TUJA 3FOMA 3VYNA 5FFGA 2OMVA 4IRJA 2NTFA 2BRRH 4R83A 4POYA 5FO7A 5C0EB 1JCVA 4GW1B 3KJ4C 3WMSA 3GDBA 1OF2B 5EC2A 1MRDL 2QQLH 2BSDA 5J11B 3OB0H 3B2VL 3QORA 4LIQL 1PNDA 2BY1A 5GS0C 1FO0B 1Q8MA 5K9KA 4LRIC 4POZD 2WMPB 5DFWH 1NCHA 4UQ9A 2QZQA 1J10A 3O41B 5C6PB 4NUMA 4XP1H 2HUHA 4LLQA 3UXFA 4OM1L 1GA2A 4U6YA 3EJZC 4WO0A 3K2KA 1G6RB 3ESUF 3LV3B 4DP6X 2X4NA 1WICA 2V2TB 1BZ9B 3NTCL 3U6RA 3TF7C 2VLRD 4DUXA 5ACZB 1OWWA 5I1CL 2E9IA 4P2QE 2YJQA 5HI4D 1DQDL 2ZP0T 5CN3A 1F3JB 1OW0C 4XI5D 4HLEA 1E50A 4QJ3B 2F8XC 4F7CB 4HXBH 5ITFA 4XO4A 1DVYA 4FMFA 2Q3ZA 2DMCA 3QJFB 5IJKA 3FB6B 2WLLB 3SDDB 4LBEB 3MCYA 3EKCA 2AJVL 3FQWB 1CXEA 4RMUA 1XCWA 3C5ZB 3I75B 2GJPA 5JORB 2VN5A 3N9GL 4JKNA 4XN8A 2HMIC 5KYWA 2NR6A 5IOPB 4PRNB 5F7UA 1YNTA 4JFZH 4MAUH 5B3SB 1KSRA 2WGNB 3BP7A 1XCQB 3ZUCA 3MCKA 2WC7A 3EZ8A 4EN2A 1W16A 4FTVD 1F4XL 4HS3A 4N2KA 3ASOB 4OIAA 4WWPA 4JFOA 4JFVA 3AG4B 1F58H 1BGXH 4XCFH 3V0JA 3I2CH 2OJEB 3LQAL 4BEIA 3CG8A 4KPHL 3V8CA 5I1LA 4X5QA 3PP4H 5E03A 1F1DA 2W95A 5CGYD 5F88A 5F71A 4AX3A 4MA3B 3MROB 2R9HC 4DCQB 4NKIL 1ACZA 3STZB 5DGRA 4HIQA 4C4KO 1RAMA 3OKKA 2N0MA 1A6VH 1Q0XL 1PZCA 1W72A 4TLKA 1UJ3C 1AZRA 2DEXX 2A6KB 2Y5TA 3CSFA 3QJSB 1IU1A 2P5WB 4PPTA 3D0AA 1C7SA 2XPGA 4KKAD 2G0LA 1TZGL 3V0AC 1D6VL 2F74B 3ARSA 1EPFA 4MQSB 4TSCL 3WO4C 5MP6L 3RTLA 2Y6SD 3QO1A 1QLFA 4UQ3A 3U2JA 4GP4B 1KCKA 5T8IA 3CVCA 3TJHD 1AQDB 1PG7X 1RPKA 2EACA 4YZFF 4XP6L 1XVSA 4OF8A 2CM6A 2EDKA 3ZYZA 4LAQL 1JPSH 4RAUA 3WV0A 5IG7A 1XF5A 4N1CA 4K4KA 3E80A 3DNKA 5ESVB 2UUDK 4JDTL 1HDMB 4PRPE 1RVFL 2OYLA 4DP1X 3IJ7A 1I1AC 2WP3T 3ARGB 4JK0D 1CYWA 3U0PA 3ILQC 2R69A 2DWSA 4U6VL 4ZYKB 1SN2A 3L4WA 3CBJB 5DQJB 3WUWB 4TQHA 2J5LB 4D9RD 1I53A 1A1OB 1O5DT 1OPGL 1U8MA 4ZBJA 1PKQB 2Z8WC 1XF1A 3BHBB 4YHML 3WEBA 3X11A 4NQEB 3W39B 3HJ0A 4BSJA 3RZCD 2BVPB 4F20A 1N8OE 2YKLH 3KM2A 4ODUB 4N2MA 4L8CB 4FNSA 4PW3A 1CTOA 2HVKA 2HT4C 2J25A 1WWAX 2QQNH 1AHWB 4GKNB 4CNIB 2GBUA 3O11A 4WHYG 3T2NL 3IAQA 4JN1H 2DD8L 1KNOA 4N24A 5LXGH 2ALAA 3ZZ1A 3PJSB 3VD5A 2JKWA 1JJUA 4KK5C 1DBAH 3RAJH 1SLWA 2VWEC 4M93B 4L23A 3HNTL 4QRRA 3ZY7A 4LLVA 1D5ZA 3PIQA 5GISH 3OKDB 4F9LC 5AVTB 1WH0A 4QRBA 2EP6A 3RVXC 3A22A 4YHNB 4AUJA 1Z32X 4BKLB 3OHMB 1Z0MA 5L2KA 2GT9A 3H2PA 1AVAA 6PAZA 3WIIL 2ZP9A 2MJWA 3TBWB 4PP1D 5MERA 5EOQH 3WN5B 3MRDB 1AKJD 2XN9B 5TGBA 2IDCA 3F7VA 1KPRB 4UF7C 3SYPA 3HAEG 3DV6B 3H0TB 4KDTA 4RGOH 2BSED 5BRZE 2FJUB 4L1SA 3HIZA 4OFPA 4ZJ9A 2YBRB 5DJXB 1R5IB 1XCTB 2DW5A 4Y16A 5DRXB 2X2UA 1MJJB 1KJ3L 2SEBB 1YYLH 1IBDA 4LHUG 1JV5A 2R2BB 4RRPM 4GRMA 3VYOA 4FTVA 5D2LF 1UOKA 1A6ZB 1CXHA 4MLIA 1FE8H 3QAZC 4HKZB 2YAFA 2OA9A 4H8WH 4P5SA 1RZKH 5CJXA 5F7YC 4K5PA 2F1AA 4IDJH 5ICYA 2AJUL 5HDWA 3EH1A 4BFIB 3GZPA 3CPUA 2HTLD 4OIIH 3C5SB 4MA8H 2CRYA 3M07A 1PDKA 5DCCA 2OLDA 5CEZH 5I0YA 3BN9D 4F93B 5I19H 1EXUB 3HNVH 3NUKA 2R23A 5EG6C 4QHUB 2IPKB 1O7DE 3KL0A 1I8AA 2A1WH 2E0PA 3FQUA 3SN6N 1L4IA 2FLBT 3UPRA 3HHSA 2B20A 3QXVA 1C16B 2JK5A 4F8PA 1YECH 2VO8A 1WFMA 2OTWB 3RHWF 5D7JC 1WA2X 3LS4L 3LKOB 1A4JB 4DN3H 2DI8A 4LLUB 4DZ8B 3UOAB 4YZFE 4ZAKD 3ATEA 4Y19B 4CRPA 2G3MA 1XIWC 4WK2B 5AVRB 5B38G 1MNNA 2Q8AH 3ZSTA 5SWZD 1CGXA 3GHBH 4PBWD 4U1IB 5FCSH 4PS4L 3WFCL 5BVJA 4OUUB 5SWQA 5SWSB 2FWSA 4R7NA 4WV1C 4WAFA 2D7MA 1R3HA 1E7UA 3GM0A 4I1RA 4YHKL 5K39B 3X14B 4BWTA 4O4YH 2KMWA 2EDBA 3UG5A 5IQ9A 2ZIDA 3C12A 2FZ3B 4MX7A 4HSCX 4XP5L 3CFBB 4JPKL 5E0QA 5HDQH 4A39A 2E9BA 2LTQB 2CK2A 2XIDA 3MJ9A 3JVGA 1GGTA 5H4YA 3BAEL 3RJQB 3SKMA 3RZCA 5FYLD 2ADJA 4WKZB 2YD0A 2VXQA 1FG2B 5C7XL 2Q86A 2OMYB 1A6UH 3O3BA 3ESMA 4XVSL 2WWOA 2QSCH 3ZZLA 2GJRA 3EG9B 4UT7H 3KCPA 3FFCD 3QDAA 5HGBB 3TA3C 3ARDD 4I3RL 3F7LA 4G42A 1DJSA 3WHXB 3EFFA 3QUMB 4LEOB 3V0DA 3FHEA 1G6VK 4HHGA 5HI3C 3IFPA 2WQ8A 4FHJA 4PJFF 4Q9BA 5FA4B 1U91B 4NRYB 4XPHH 4PS7A 2BDNL 1U3ZA 5E6SB 3FF8A 1NBQA 4OCXH 2R1YB 2EECA 3RL1B 1B0GB 1AKJA 2IH3A 3L6FB 3RDTB 1ZPUA 4N9GA 1YYCA 4S1DD 4QOKE 1B4LA 5C07B 4KTYA 3RX5A 2FHCA 4JPSA 1UC6A 4KBPA 5IY5B 1J05A 2VE6A 4AW7A 2GI0A 4NLHA 1A7RH 4JDVB 1JHLH 5BZXA 2A73B 5IW6B 2B4CH 5D2LE 4J8RB 2NY2C 3AGVA 3Q5TA 4LSPH 5F7DB 3IGFA 3V4UH 3WUZA 4F7MB 3KPMB 5AW0B 3DO7B 2UZIH 1MHCA 2MOGA 5LKNA 3BWUC 4JAMB 4PJCA 5KSAB 3T4AB 5I76B 1TEYA 4AMWA 1DP0A 3B2UC 5GGVY 3ZTNL 3IETA 4DH2A 5KVEE 1QMUA 2R2CA 4PV1C 3RL2B 3BKJH 5GPRA 1UOWA 4Q7DA 3P69A 3TZVB 3FTWA 9CGTA 2J8OA 3G9VA 3UTSD 3WJMB 4PJ7F 3QCUH 3SPIA 3W0WE 3P77A 3KDMA 3WBDA 4B50A 5DJCA 5KN5B 5DJYA 5E94A 2AJZA 3APDA 1WK0A 1G94A 2JCCA 4W68A 4Q6IA 4FXGA 1II4E 4ZAKA 2WZ5A 2EDLA 3KJ4B 5LGHL 5HHXL 2DWDA 3GM8A 4CADA 5SWZA 4FXLA 4G6FD 2XG4B 5KBPA 2LU5A 4GW4B 3A4FA 3BVNA 4BCXA 4KK9D 4ISVB 3US9A 2RJMA 3QRBA 1KELH 1T20A 1AO7D 3VGGA 1HEZA 1IC5L 4PRIE 3MRRB 4C4KT 3PWLA 5BJTB 3H7LA 2AGJH 1S78C 2BOBA 3NA9L 4U1SA 1I85C 2DH3A 5D4QA 1J88A 1PY9A 1VENA 1ZE3H 3UTQB 1W72H 5FHAL 4UV7L 4F5CA 3FPYA 2FIKA 2CDFA 1IEAB 3TASA 2HKHL 1PAMA 4C47A 2B1HH 3JTTA 4GXVL 1EWHA 1BMWA 1YN6B 3ZDXB 1FO0L 3MV7B 3EOBA 43CAB 3CVIH 3VXME 5LWYH 5JUEH 2HVBA 5DVOA 4PYHA 4F15C 5L8KB 5K9QG 5EU5B 5FO9A 3QGVA 4NO0D 4AJ0A 3PV6A 2XZAH 2R2HB 4PGEA 4HFUL 3CVBA 4H8WC 1FYTB 1KXHA 4FQJL 4J2XA 3FFCA 3ARDA 2P8PA 4JFFA 4DZBA 4I5BA 4XO5A 4TV3A 2ESVB 3GRBA 4CJ0A 1KEGH 1HE8A 2MPAH 3HZVB 4XAKE 1AYOA 3V6ZB 3R1GL 4PJFE 4U1NB 1HXMA 4JFWA 1NL0H 2VJ0A 4LLDB 4XNDA 5DO8A 1HK6A 1INQB 2R69H 5DJ6B 3R8BB 1I75A 2EC9U 2FB4H 2PR4H 4IK7A 4NJAL 1E6JL 5E99L 3VXQA 4EUPA 1BQHB 5F3BB 3VXNB 2GFBB 1ACCA 1HINL 5JXEC 2PW1A 3S8FB 3IF1A 1NCIA 2KPWA 2NNAB 3H2WA 5L4JA 3VW3H 3D25A 1LEKB 3UZVB 3CSTA 1XD0A 4PJDF 3T9WA 4F27A 4ALAL 4J1UB 2DAVA 2OXHA 2XTJE 2YMXL 1JWSB 4Y2DD 3F58H 1BVKB 4I0PD 4OIBA 5DK2B 3TO2B 4I77H 4NIYE 1Z5YD 1R5VB 4LB8A 2EH8H 4J3VA 4YUEH 5I71C 4Y1SA 1CFVH 3RNQA 3ZMEA 2JTDA 2W92A 3B56A 4JANA 3LKRA 2CKBB 4GSDH 4GSQA 4IIZA 4CUCA 1N6UA 3CQPA 4X6CE 3QJXA 5F8RC 3BWSA 2A74C 5T1DH 4GUOA 2HG0A 3CDZA 1U3NA 3DRQB 1MCNA 2FSEB 2L0DA 2OK0L 5IK3A 1MCQA 3TM6A 4AGQA 3VYPA 3SY0B 3UTSA 2LT9A 4AXWA 4PJ7E 1WCBB 1Q9LA 1P7KA 4OB5H 1I1AB 4ZS6D 2G2RA 4B7LA 2VJXA 1YMMB 1KXVA 3BUYB 5DFVC 3BVVA 3LN5B 4X42A 3TBTA 3B3IB 4X5WB 1B3JA 2XZZA 2X1PA 1PG7W 2ZONA 3KR3L 1G5GA 4H2CA 4WI0B 4BQ6A 2R29A 2H3NB 4HLJA 5F7LB 4LASL 5AUMB 2H2PD 4TVUA 5KWYC 4LPWA 3DUUA 3WTSA 4AJVA 1U4FA 4UDTB 4XVUC 3G04B 4NI6A 1HIMH 3O8XD 1AO7A 2YEVB 2JB5H 3DURB 4HEPG 4IRJC 5DUPH 3UTZA 3EXJA 3P3SA 4NCC2 3GXFA 1QHOA 5KSBB 5C0DA 3X3FH 1WA1X 4TM9A 4PJHB 3ECQA 4OZGA 4UNTA 2Q6WB 4P3DB 3FHAA 4TULL 2I85A 2J8UA 4TRPH 5HXMA 5F9OH 2YK1L 3S96B 3T5WA 2DI7A 1M6UA 1PQZA 5DVPA 5I75B 1XB3A 3AWEA 1F6AB 3ASNB 4M29A 3BC9A 1ORQA 4IHOA 5FPIA 2J6WA 3G5ZB 3U4BL 4NDMA 4R96A 4M8QA 3US0A 2B4CC 2HN7B 2NUPB 1JWUA 2EO7A 1B4TA 5I5RA 5JW4R 4XWOD 5I9QB 4LEBA 1UCTA 1WZMA 4D0DA 4OZHF 3BUIA 1D2PA 1DSYA 2X87A 1YEKH 3WUWG 4N2CA 3N1GC 1F6FB 3UTOA 5IT2L 2XN1A 2HFGH 5GRUL 3GNMH 2WXNA 1KB5B 4NM8L 4R8WL 2MRYA 1OM3L 4UAHA 1OKEA 1WV7T 4UOJA 1LO3H 3T08A 4QEGA 5BRPA 1IGTA 2FK9A 3PNRB 5J06A 4L8SA 4NN5C 1ETZA 3RG1C 3V95A 1RZIA 3MRIB 3CFIC 3EJCA 5IJKC 2AJYH 3ULVC 1AD0B 1WAAA 4L8DA 3HZYA 3V6FB 1LO0L 4Y4FD 3MV11 3QAZB 5HGAA 4H8PA 4ZMPA 1RHHA 1HSAB 5HYFA 3MJ9H 1DLFH 3IWUA 2JV6A 1E67A 4JG0L 4PJDE 2RQEA 4X8XA 3A24A 3D33A 4KKBC 1S7VB 2VXQH 4MA7L 4I0PA 5L4MA 2WXLA 1BZEA 4QRFA 5F7NC 3V0IA 4R5VA 2WBWB 3DJZA 3BSZA 3HBZA 5E9NA 5FKPA 3C6SA 3QEHB 4N2BA 4A2HA 4NENA 3CC5A 3CFJA 3GD1C 2XWBA 1HAUA 3EH4B 5DFAA 1UXSB 4AJYV 4P3CL 3RUGA 1EEZB 1UVQA 2UYLB 1SBSH 3L3IB 3OVUB 4Y9GA 1J1XH 3ZSSA 2UX7A 1G7QB 2DQTL 3BFOA 2AFNA 5D7JB 3KPPB 3NACL 3QDGB 3E6FB 2DDQH 4IEFA 5C0RL 3OKOB 4PS3A 1JRHH 3FT4A 3JV4A 2VZOA 1XIWB 3O2WL 4NQCB 4W4NA 3ZMNA 5TK4A 1E9OA 1MWOA 1KGCE 2IXQA 3KWXA 5EZLA 5I2IB 2X6UA 3KYMB 4HMEA 3B34A 4TUOA 3CD4A 4Z7VF 2BVOA 4WV1B 2J6EA 3TCLB 4JY5L 1C08A 3L1OL 2P9RA 3BPLC 1FA4A 4P99A 2EIZB 4DP2X 4F8QA 3L4ZA 1AGBB 2DJMA 1UWFA 3AB0C 5ID1A 4K8RC 1X5MA 4KTEH 4LNRB 4LRNH 4ZOCA 3RVVD 4HAGA 4RZKA 1S8DA 3P4NA 2FJHB 3MRLA 1UYWH 2APWA 3O8XA 3LPPA 1M2VB 4NP9A 2WTPA 5MENE 1HTYA 3EYUL 4WK0B 1UM5L 1EAJA 4GKOA 4Q9CA 4YXHL 4ONGL 3TH4T 4Z95L 4POZC 2IDQA 4G8AC 4YXLH 2IMNA 3V5KB 3WN6A 2X89A 1QSEE 2WQVA 3WNOA 1PLGH 2Q20A 2I9LA 3BIBX 1GY1A 3C2AH 1T2QH 2X6BA 3TF4A 4WI3A 1P4BL 1CYXA 5BS0D 5GRJH 3TBVA 5KOVC 4AQAB 4Y7MA 1XGPB 1SOSA 2WCSA 3PPEA 2KL6A 4P49A 4GMTL 3LCYA 2D9QB 4JRLA 5HI4C 1U8CA 5IB4B 4AYFA 1JXKA 4XI5C 1WIOA 4LIQE 4MZ3A 3S5ZA 2ZAGA 1CR9H 4TL4A 3STLA 1CFQA 2YZ1A 3VD2A 4JQIL 1EJFA 2XUWA 3QG7H 3P4LA 2D7TH 3NVQA 3I6LE 2NY2B 3SBQA 4HJ0D 3RWCA 4Y4FA 3IVKA 4IU2A 4BSWA 5EUOF 3L3DB 1HH9B 1SDDA 3OKNA 5ALBL 5I6XC 3MOQA 2VZSA 4ODWA 1IQDB 2B5IC 3KAAA 3BX7C 3BUBA 5LG6A 5FYLH 1MIMH 3O3DB 3GGWA 1A4CA 1GYUA 3S35X 3WIFA 2DL2A 2B3RA 2F53E 3NESA 4P2RE 5ABAA 1MCRA 1H8OA 2C9XA 4W6WB 5A2LH 1TF4A 5CJXC 5DQDH 3TOPA 5CGYC 2Z8RA 5DHVA 3RWCB 4GH7B 4V1DE 4TS6A 2OAAA 2X4QB 5IREA 2VR6A 1U92B 1MG3C 1UM6H 3NZHH 1N68A 4WDIB 2D0HA 4Y1AA 2F8IA 1AC0A 1NJ9B 1BFVL 4XAWL 2HRGA 4Q89A 5EO0A 5AVQB 3W9DA 4EUPH 4BXVA 2QHLA 5EU6E 3WDHA 5DK0A 4J3OD 4KKAC 4RIRA 2CK0L 3HC0A 2OX5B 2VITB 3I3DA 4Z76B 1EO8H 1F97A 1FG9C 5C3TA 3B5GA 4ODSL 4Z7VE 3TYGH 3RWGA 2HB0A 1OSYA 4PJGB 5D5MB 3JUYA 3AROA 5IMOB 3H9HA 3QBTB 3FQRA 3TJHC 5IF0B 4AYGA 3LKQB 1ZT1B 2WW8A 2FWOA 4NKOB 2R4SH 2L7JA 5C2UB 3QIBD 2X4OB 3LIZA 4QNPF 3F65A 1H3WM 1PYWB 1N12A 2WZAA 5EIVA 3HG5A 4ZS7L 5C08A 1O6SA 5GS0L 2X2IA 5DRZA 5CN1A 2VZTA 3RWIA 2XXMB 12E8H 1QR4A 1W0VA 4YPGA 4F15B 1DQQB 1T22B 3MJ8A 2NQCA 4KKCD 1EERB 3MXWL 3PWNB 2P8MB 3KBEA 4NFDA 1I3UA 5AW9B 3EYFB 2AKRA 3RZCC 4M1CD 5JHDB 4L4TB 3S5LA 5C0GB 4MCZA 3WKML 2Z35B 3RBGA 4OGYH 5CCKH 2PYED 1IB5A 3QFJD 5F6IC 3GJFK 3D4YA 4U1HA 3BEWB 2EADA 5K33A 1MFAL 2I7OA 2QKSA 5G5DA 2R29H 2BERA 4JFTA 5DVNA 3IYLW 1BZDA 4X0NA 1QASA 3KYKL 2NCMA 1ZDQA 4FKEA 5HP5A 2EXWD 1JS4A 1KT2B 4P5MB 4PIRF 4G3YL 4ESKA 4PP1C 2Y06L 1MVYA 3JVFC 1KY7A 5A2CA 1DJHA 4A37A 4RQQA 4H8QA 5I71B 4IBVA 3F04A 5IHBA 2CLZA 4GKLA 5EUOE 4KXZI 3GKWL 2R1WA 4K7PH 3DX1A 2F54D 3V5HA 2YJLA 5JW4N 1T5XA 3L5WA 5D2NB 3EJQA 1T04A 4L9LA 4FZ8H 2WUBH 4HZAA 1P4UA 1T83C 4F1ZA 5JQHC 1MG2C 4W81A 4PJIA 4O58L 5J4MA 1LDSA 3LQMA 1TTGA 1JD9A 4N3TA 3G5YA 1SLUA 1TJGH 2WK2A 3FTZA 5B21A 1KJ2B 5IHZA 1HHHB 3DXAD 4L48A 3IJSB 3M88A 1FZJA 3W37A 1UD6A 2ZG1A 1QABA 1RZ8A 2NMSA 1MH5A 1CXLA 1HNYA 4LSRL 3BN9C 1K5WA 3GRGA 1THCA 4JRXD 3MCLL 2ROXA 1F4AA 1NPUA 2GJ6A 4LVHC 3SB3A 1EHLL 5F9DC 3SKJL 3KPSA 2BOCB 5DO2C 1TCRB 4XNQB 1H6EA 1K85A 1QSFE 4RMWA 5TE7H 2CR0A 1TZAA 3N42F 4UOW0 4QXVA 2XLLA 5I73C 3DOSB 4Q6IC 2YPLA 2OTUB 4TUJB 3FOMB 2YFNA 4XVJL 4AVJA 4BSVA 2OMVB 4IRJB 2NTFB 1MHPL 3S3DB 3ZK0A 5FO7B 4ZAKC 3U1QA 3UJJH 2EUVA 2FBJL 5FYJE 2AJXL 2P28B 3KL3A 5AAWA 3Q8BA 5AQ0A 1QSZA 2HJLA 3H9YA 4KKZA 3BSZH 4QNPE 1UWXK 4KXAA 4I48A 4QHKJ 1GAFL 5K9KB 1KYOJ 4PJ5A 3MYZA 5AYQA 1MCIA 4HKXB 2WVVA 3V7AG 1NCAH 3COOA 4N8CL 1UOVA 4LLQB 5DR5H 2VN3A 1L6ZA 4U6YB 4EN3D 3MO1A 1UZ6F 3VNYA 1CGUA 1MEXL 1A7OL 2BNRB 1KCSH 3U48A 2X4NB 5LQBH 3DMMA 2X40A 2QADD 1M1SA 3U6RB 3POHA 2V3FA 3CX2A 4J4PD 1U8IA 4GNKB 3SHSA 4JX0A 2QHRL 1OF0A 1SMAA 3F7RA 4R7XA 1ACYH 3QFJA 2J6EH 5ITFB 2B0SH 3GLAA 1RMFL 3DV4B 5CF3A 5MI0C 4KQ0A 2O5YL 1DO5A 2UXVA 3EBHA 1WS8A 3CHSA 4YBLC 4BE5A 3OG6B 1IQWH 1JGVH 5KYWB 4XN5A 4NZRH 4G43A 2NSQA 1YNTB 1VFBB 3HFML 3MCKB 1NFIB 4N90E 5CP3A 5ANMA 2V5YA 1ICTA 4YSSA 1TQTA 4JFOB 4QHPA 3CN1A 4ZUVA 2ICWI 4S1DC 3UAAA 5I1LB 1V7NH 3QEUA 3B3BA 3RB5A 5F88B 1WWWX 4JFHE 4ZXBD 3OC8A 1BCIA 4EQ2A 4ZD3L 1I1CA 3ECVA 4Y5VC 2F54A 2YLKA 1IM9D 1NEZA 1QHQA 1AG0A 4MZIA 4DKAA 1FZKB 4IOSD 4H7VA 2F18A 3S3JA 1W72B 1T0OA 3RX7A 1VB9A 1E8WA 5IHUH 2Y5TB 4P23A 5EUKB 2QQLL 3IDMA 2E76C 2CBPA 4KY1H 2EUXA 1I9JH 1L0YA 2QR0A 2ERJB 3QRFM 4LT7A 4Z0BL 3FQNA 3OMZA 3DXAA 5AG8A 3QZMA 3O3EA 1IAII 2CJ3A 4M61A 3V6OE 1Z66A 3QO1B 4UQ3B 4HAKA 2VERN 3BVXA 4M6ML 4XP1L 3SD5A 3SQRA 3BPLB 4PD4K 4PVLA 1SOQA 1A65A 3T8MA 3AB0B 5E8NA 1TR7A 1RUMH 3RIFF 4ZTOH 5IG7B 4L18A 1OP3H 1OAYL 5DEGA 3SE8H 3GTVA 4AQZA 1ODUA 3U0PB 4DW2H 1CS6A 3AG1B 4IMKC 1KFAL 1NC4D 4HS8H 2DQHL 2GJZA 5JTWA 3ZL4L 1AMYA 4GQ9H 2UXGA 4HXBL 1XR8A 2Q76A 4NKDB 4ZFGH 1U8MB 1JTTA 1LK3H 4OLVH 1QVOA 3PU7A 3X11B 5F7BA 1U6AH 5EZIH 3EO1A 3MX0A 2AERT 4KK9C 3B1TA 5DHVH 3U2IA 1L0PA 2HVKB 3WELA 4K7FA 4JFZL 4ZZKA 4MAUL 3O11B 1NOLA 4KUCF 1UZ6E 3MFFA 2BP0B 4MXWH 3ECWA 1HU8A 4AM0B 4W9DC 1KNOB 1YY9D 1LM8V 4OKDA 1UURA 4XP4H 4AWJC 4FKKA 3T2PA 1BGXL 4QRRB 5DVLA 1DJWA 1RIUH 1D5ZB 3O4LE 3PIQB 3QRLA 4LLVB 4RWHA 3L5XH 3MUY1 4HWEH 5K1NA 3NBNA 2H2SD 1PG7L 4AZUA 1NIEA 3PP4L 1OANA 1ID5I 3CN2A 2GT9B 1HWWA 4MQTB 3LH2H 1WBZA 4EAEA 4IOIA 5MERB 5SX4H 3IGAB 3S37H 3LIUA 3MQIA 4AVHA 4UI2A 5AZUA 3Q43A 1BEYH 3PWPD 4Z0XB 1JGDA 1YLBB 3F7VB 3IMVA 5KVMC 1AOZA 3LIZH 4Z3HA 2DWEA 1HKLH 3B37A 5I66A 1RZGA 1FL3B 5IP4A 1E4XH 3ABZA 1KTCA 3IBEA 5I6XB 1I3VA 1A8JH 3BIAX 4FQXC 5FWQA 2YLHA 5EWIH 1JV5B 3IMUA 4P5TD 2CO1A 4GRMB 3LXBA 2B9AA 2D3JA 4FTVB 3PWVA 3WS6A 1H6UA 2VH5L 1XHHA 5T5NF 4BJLA 2WLYA 2XA8L 1H8SA 4U1LA 3ZX1A 4M43L 3SPVB 5BVPH 2H0JA 1O9ZA 2OSYA 2C5DC 3ZGHA 3DSFH 3KS0J 5ICYB 4PVBA 4BBWA 2YD6A 1G9MC 4XOCA 4Y2DC 3CSYA 4AV4A 4JFYA 4I0PC 4F8OA 4RAHA 1PDKB 4IOSA 1ZD6A 5JO5A 4GAJL 2VM9A 3HE7D 3GWJA 2O5NA 3MBXH 2R23B 2RGSA 4NC1C 1ASPA 2Y36H 3NIGB 2ZYSA 2FGWL 1SHXA 3QJHA 4HJUA 3BJLA 1UHVA 3UPRB 4KHXH 2DQDH 3HHSB 4URKA 3L4TA 2JK5B 5D8JH 3AW5A 3ZYJA 4FLQA 1SMDA 2WNKA 3VGEA 4W93A 3CDFA 3LN4B 4N85A 4JN1L 2H6UA 1DSWA 5I1JL 5BW7A 3BRDA 2CGRH 2YUXA 4Z7UF 4U1KA 5TDOB 3AGWA 1A9EA 2X0VA 4NO2A 1MVUB 3ZHKA 1EJOH 4YDLC 2AI0L 3FONA 3II2A 5SWQB 2GCYA 4ZS6C 3AC0A 5AVZB 1R3HB 1C1EH 1YEJH 3D12B 4HV8A 2G5BB 2JE8A 4PG9A 3GO1L 4W4OC 1OAKH 1H19A 1CFTB 5CCGE 4XMWA 4GFTB 4MX7B 3O0RL 3SDCD 5D1XD 2H2PC 2R2EB 1TVDA 2BK8A 4JY6A 5T3ZE 4M5SA 1EGJA 5FV1L 3SKMB 4LCWA 3RZCB 3T65B 1JTOA 4KVNH 3OAYH 4DKDC 1FFTB 4M3HA 2Q86B 5I0DA 3QK0A 4YQXL 3QC5X 2BIOA 4HPOH 4YHPA 4ELMA 2P5WE 3IK2A 4KI1A 4MNQD 5F6IB 4F7TA 2XKNA 1IVLA 2BP8A 3MAWA 3DWTA 3ENEA 3TIDB 3KCPB 1MIEH 1FE8L 1HHJA 3FN3A 2VDKH 3D07A 4G80A 4TLSA 1UENA 4H8WL 3NCYP 3ZRSA 2HCZX 2WZ0A 4WFHD 5DMGD 1EX0A 5DC9B 1F00I 2Q8BL 4BFRA 4NP4H 1J7VR 3BWAA 4MA8L 4YX2L 4OJFL 1IC7H 3MTRA 4D9QD 4PB9H 3HBPA 1AKJB 4DHLA 2ZOLA 2ED7A 3WLBA 4B9KC 1TO4A 2XZCL 3QQNA 2JMRA 4KMTH 1KN4H 2MOVA 2AP2A 4U3SB 1A7NH 2VERA 4PEEA 2VE6B 1LGVA 4RA0C 3QSKB 2K9FB 1BJMA 1RLWA 3VB9A 4RZCA 2YXFA 1UWXH 3EYSL 1PKQE 1R4XA 2ZUTA 3UTTA 5GHWL 2WWMD 1YECL 4RFOL 3WFDH 3MJ7A 1ZKAA 5E4EC 3B9KD 4NQEE 1Z9MA 1EAPA 1QO3A 3F3HA 2Q8AL 1J5IA 4DO5A 3D3VD 4PJCB 2D4FA 2WQXA 3FNKA 1DFBL 1S7XA 3ULUD 3HPLA 2XQ0A 3CZEA 3IETB 3EO0B 4XP9L 1S7WA 3MA7A 4PP2B 3P3UA 1I7UA 3TO4D 1CI3M 2CIIB 2HJKA 4TUKL 1JGUH 2D7OA 3HE7A 4ABWA 4Z6AT 5F7HA 2RTTA 2BXZA 4S0HA 4HH9A 4ZDHA 2AK4D 4QXGL 3UAEA 3A4DA 2ZXDA 3BMWA 3P1VA 3KDMB 5EO9A 5DJYB 5FO8A 4LARH 1F41A 5E94B 4PS8A 4X0KA 1KJ2L 3UIYA 4FL4B 1X7TA 5I73B 2EQDA 2MKLC 2V0AA 4Q6IB 5CP3H 3M6DA 3HBQA 1B3IA 3PP3H 1A6UL 1JPGA 4ZAKB 3RTQD 2OTPA 2FX7L 1L9MA 1F11A 1KC5L 2AABL 2MIZA 3LRKA 2YC1B 4UT7L 4CADB 5SWZB 5D7LD 4BM7A 2VABB 4P5KA 3BVNB 3KBHE 3DVNA 2HG5A 1HEZB 4YVUA 3N5AA 2ZCKH 3PWLB 4UQEA 4UB0H 2A83A 4WTZG 4WSJA 4U1SB 1P7HL 1RY7B 3CFEB 2CR6A 4XCCH 4KJYA 4A67A 2DS4A 4OCXL 1QFWI 4YXKL 3RIAF 3SDCA 2G0KA 5D1XA 2CDFB 3RVVC 3KWWA 4Z78A 5BXFA 3O2VL 3MNZA 1FVCA 3JTTB 3LNGA 3OKMA 3S36H 5KOMC 3EOBB 2FBOJ 2O6CA 3D51A 3RWHA 2YGOA 1SM3H 1UZ8A 1LO4L 5D70L 2JNZA 3NYKA 3I9GH 4NQVA 1VCAA 5FO9B 2VXUL 1JHLL 4MNQA 5F7EH 5KUKA 4PGEB 2Z7ZA 2B4CL 4AIZB 4KAQL 3FFCB 4HBCL 2BHZA 1MF2H 2W0KA 1WSST 3ARDB 3FU7A 3FMGH 4I5BB 4OQTA 3NFPA 2F58H 2OMZA 2CQVA 1CDJA 3K7UA 5T1KD 2IPUK 4UT9L 4XTRD 1NDTA 4Y19E 3PFQA 4TTDD 3VGBA 2E9WA 1E2VA 2VMJA 2XZQL 5BUPA 4I87A 1BD2D 3VQ2C 3JWDH 4EUPB 3VXQB 4X80L 2KDYA 3Q44A 4A7UA 2JWYA 5SWSE 2DQGL 1R3LA 3EDFA 5DYOA 2PW1B 4J2QA 3ULVL 3IF1B 3EADA 1BBJB 3WFZA 5FC9A 3D25B 1OAZL 1MQ8A 1RQ5A 3TEXA 5IWLC 1DLHA 4Y5VB 5HYQA 1PAZA 5C0CD 1P7QD 4OF3A 4ZUSA 1CU4H 2VXVH 2VJ8A 3ILEA 2AEQL 3NJXA 3K6FA 3B2MA 3NEXA 2WCPA 1V8HA 3B9KA 3OHXA 3Q5YA 3Q9PA 5CN2A 3RNQB 1ZGLM 4WNQA 1L7TL 3GB7B 2EVFA 3CSGA 1RZFL 3FN9A 1P69B 1DQMH 2X1QA 3D3VA 4FLOA 2BIQA 2Z7WA 3JWNE 4X7EC 1KLFA 1KGUA 2BFVH 1P4IL 2CO6A 2I60H 3DPDA 3MBEC 1CBVL 1NEPA 5A2IH 1R9FA 3P40A 1KCLA 1NSNL 4KK8D 4AGMA 3V55A 1I1YA 2Z31A 4G7VH 3QFGA 3TO4A 3LZOA 5AW7B 3SEPA 4BFOA 5D4HA 4UYQA 1HVXA 5IK3B 3SBWA 4E9WA 5F96H 4N5UA 1QFOA 5DVMA 3UTSB 4FI6A 4R7DA 1UA6L 1FFPA 1Q9LB 4RETB 2ZX8A 2VLMD 1PZDA 3H7BB 4QXWA 2XV0A 2EZ0D 1PTZA 2G2RB 2VTFA 2D3NA 3VE0A 5JUEL 3EXLA 3BZEA 5IHHA 1BA9A 3TBTB 5C07E 3P0VL 4R6UA 3UBFA 5C92A 4HS6A 3UGUA 2NQDA 4HT1H 3WMPA 4J3OC 2ZWKA 4HUXB 4G6FB 4FCHA 4K8RL 5CIPA 4OCYL 4X9YA 3W38A 1AO7B 2V5MA 1MAJA 2XSKA 5D93C 1UB6A 1IIIA 1WP6A 2V2WA 1BQLH 2R69L 3FT9A 5C0DB 4PQXA 2FB4L 3QIBC 2J8UB 1JHKL 1OGAD 4BELD 1OARL 5KYXA 1NGZA 1PQZB 2GPZA 4WZ9A 1OCZB 1G4RA 4APQD 3BDYL 1ORQB 4UUJB 3VW3L 4OV5A 4NDMB 4R96B 3V0GA 1CJYA 1E28B 1JWUB 1QLRA 4KKCC 4H1LA 3U1SH 4XN4A 4JG1L 4NO0B 6TAAA 4Y9FA 1SF5A 4I3GA 4YDKL 4I77L 5IQLA 4D0DB 5DT1H 1QBBA 4YH6A 4AGLA 1HL5A 3C8HA 4YUEL 1LLAA 3CNKA 5GIRA 2GTZB 1DE4B 4XCNA 4JHAH 4M1CC 2R8SL 1UXWB 4KDWA 4U1GB 1JNNL 1YEFL 1Y18B 1U58A 3MV8D 4CU7A 3QQ4A 4K71C 5CR1A 1IGTB 3U7YL 3F62A 1T6VN 4N22A 4L8SB 1FVEA 1ETZB 1OSPH 3L7EB 3ARFD 4AIEA 3DOHA 2WKGA 4K55A 1HL8A 3HZYB 4MZ2A 1UFUA 3CXDH 4H2AA 1UEYA 1HCZA 4LSSH 5HGAB 4ZG1A 4ONHA 1RHHB 2P49B 1IBGH 1JPEA 5DZAA 2EXYD 4PREA 3FRUA 1EGJH 2XG5A 3DTDA 3HS0A 5AVYB 1PZBA 2EXWC 4B97A 1OCRB 5KSBF 4ZT1A 4PJHF 3SSGA 3MRNB 5CBAA 4JR9H 2ZUQB 5DJZB 4Y4KD 4Y2DB 5C0CA 4I0PB 1P7QA 3D4CA 3GS0A 4ZMVA 4LL4A 4BA8A 5F70A 2YWYA 5FKPB 3GIVA 4GJTB 4JHUA 3ZDXE 3MV7E 2WLMA 4Q9RH 1IT9H 4NENB 3CC5B 1KYFA 1KIQA 3CFJB 2IV9A 3G6DL 3UYOD 2WD0A 3RFZC 3WTTA 3ZKQD 5DYFA 3RUGB 1UVQB 2DQFA 3U4KA 1FYTE 5CUSH 3ROOA 3W5NA 5DUPL 5E2UH 1E3FA 5I8EA 4IEFB 2FUQA 3X3FL 4HOMA 3TV8A 4RFEB 2EE6A 1JV2A 1G1YA 3DYPA 4WFFE 2APVA 4PCYA 1E9OB 1OQOA 2PP8A 5F9OL 3KJ6L 2Y6TE 2XKSA 2JQMA 1N5YH 2PABA 3S6CA 1JAEA 1HX0A 4TUOB 4YDLB 2C3VA 1MI5D 2JXMA 5CSGA 2BVOB 3ARYA 2Y2WA 3VFPA 1C08B 2Q2EB 3WIHL 2NX5D 4LLMA 4XMKH 4Z7OB 1JDAA 4ZW6A 3DARA 5J6HB 1TKWA 1UGKA 5CJBA 1E3ZA 2CCWA 5IFHL 4G6KL 1SHSA 1KTLB 3FTUA 3E1ZA 4NN7C 4JJHA 3RI5K 3VI4B 3P4NB 1CDGA 5B39A 5E4AA 3GXMA 3MRLB 4BKTC 4DVBA 1GOGA 2XQYG 1WYJA 2XRAH 3FBQA 1RUQH 2NW2A 3AMKA 3O8XB 2OSXA 4EOWL 2CLVA 4I18A 1MOEA 1O9WA 4JRYD 1TNMA 2O26U 5E9AA 3SDYH 3FN0H 4YFLF 3W56A 1ORSB 2ICCA 2X3CA 3TBCA 2J2ZA 3AU0A 1QR1A 2HLEB 4LVOB 4TSBH 3LPGA 4OGZA 4APQA 4NT6A 2I9LB 3RURA 4EN3C 2F1EA 3CH8A 3H53A 5KSUA 1WJ3A 2WQWA 2AW2A 2QLVB 4KTGA 4AQEA 4NNPL 3TBVB 1ZY9A 1VGKA 2P45B 2QADC 4OH2A 3SYAA 2PCFA 4QTIH 5GZOC 4LSUL 4J4PC 1NEUA 1EZVX 1YMME 2K3HA 4UDUA 4AYFB 3LMJH 4GO9A 2OZ4A 4W9HC 3GSWA 3STLB 1LEGA 1CFQB 2QPEB 2YPKA 3GSQA 4UT6L 4PLKD 3UAFA 1TZOA 1L9RA 2GHZA 5IMKB 1HOCB 1NIBA 4UTAA 2YUZA 5E4EB 1DVZA 3APMA 1F56A 2FX8H 3KS0H 4L2LA 2IDSA 2NNFA 3W0WA 4YDJA 1JRHL 1MQKL 3BKYL 2FRGP 2VXSH 3C08L 2P42B 4IU2B 4Y4FB 4BSWB 4BDVA 3IVKB 3OKNB 4G6JH 4OCLC 4ODWB 3Q8AA 5KSBE 3PNWA 4ODHH 2J7LA 4PJHE 1AC6A 3LZLA 2ZOKA 3EJYD 2DQIH 3GGWB 3CU7A 2MNWA 4Y4KA 3X17A 2OR7A 2VWEE 3JZ7A 3NAAL 4R2GC 2V37A 4OJAA 4KOBA 1T0PB 3QR1A 3JXAA 1H8LA 1A6WH 5KG9B 5IBTH 4Y1TA 1OV8A 4ZXBC 3RY5A 4PRIA 4PTTA 4F33A 4OQTH 1GZPA 1SXCA 1AQ8A 1XH2A 1IC0A 3OPUA 1NBZB 3ZE1F 2YPVA 1DANU 1YEHH 5EO0B 3I9PA 4OU3A 2PPCA 1ADQL 3PDDA 2COVD 4ECNA 2CH8A 5DK0B 4RIRB 5F1IB 1F8TH 4XBMA 3VXMA 1L9QA 3BVDB 2J12B 5LAPA 4YXLL 1MI5A 1WZLA 1D7BA 2Z34A 3H9HB 5D1QD 2X4TA 1PLCA 1T2QL 3C2AL 4Y9CA 1OCWL 1QUPA 3BH8A 5GGRB 3MKKA 4PYGA 2JIXD 3Q48A 3LNEA 2AEPH 5DD5H 1AACA 3BWUF 2VZUA 5IVZA 5IEHA 2ZWLT 4PJFA 3PGDA 1CXKA 2F19H 3S35L 3SY6A 4YAQA 1J5OH 2WWKT 3WD5H 3A6OA 1SPDA 5DRZB 3RWIB 3L4YA 1HEJC 4RBPH 1W0VB 1MFEL 4BK5A 1G7JB 1ZHNA 2YGVA 4LCCC 1CR9L 1GHFL 3AXLA 4Z7NB 1JMZA 1LE9B 2ATKB 2D7TL 2RMNA 2P46B 4ZMWA 2W5PA 2AKRB 2G60H 3T6ZA 3P73A 3A67H 5CLXA 4F1SA 3PQYD 3QDGE 3GI8L 1RK1A 1IZJA 4DTGH 3CXFA 3C5XA 2VDRH 2LLNA 5LB1A 5FYLL 3CLEH 1OTSD 2KT6A 5I1GH 1MIML 1YY9C 4NQCE 5H2BB 3AABA 4WCYH 5ECGA 4KJWD 4P9HH 5G5DB 2B7DT 4DGVH 4NNYB 5BS0B 3GJFB 2WB7A 2QGCA 2VGLM 3C6LD 4K3EL 4N5ED 3OPZL 2H2SC 1UD3A 3BYYA 4PJGF 3NFSL 1Z2KA 2Z1PA 4FS0A 3GKZA 2EDDA 4BQ8A 4FA7B 3JTSA 3MRQA 3R7RA 3MLWH 5CIPH 1M1XA 2Y5EA 3LKPA 4CDGC 4UIKL 2DQUH 3A23A 4W9ZA 2BWDA 3NZHL 2ZOTA 4UZGA 1QTYT 3BQUD 3R4DA 4JFQA 3E6HB 4N0CC 1PZAA 5HSFA 2GB2A 3SQOH 2A6JB 3Q6GL 5DSCA 2R1WB 1Q72L 2VC2L 5I28A 4WEEA 2Y7MA 2FEDC 4IBTA 2VQ1B 4NBXB 1BG9A 1T5XB 3V5HB 4P5TC 4PR5A 4ZW5A 1T04B 5J1TC 4DEWA 2WSPA 2CHXA 2B39A 1RZQA 2P43B 1YSOA 4PJIB 4H1LH 4HC1L 2RA1A 4CC4A 4QLRA 1KOAA 1LTXA 3G5YB 1ROWA 4EUPG 2AS5M 2BH0A 3IXTA 3MR9A 3BW9A 5IHZB 1A7PH 1FZJB 5CLYA 2M1KA 1P4LA 1RZ8B 2ZYHA 1HSBA 1JUFA 3FAXA 4LAJH 3ZTCC 1MH5B 5MHSD 4JVUA 1X4ZA 4YSRA 4AW4A 1SJXA 3HE7C 2HKAA 5EF0A 1PD6A 5CCHE 4AG4H 4EDXB 4F37F 2VDKB 3EUDA 3V0VA 3PXLA 1B6DA 3P3TA 1JFQH 3X1BA 2H0PA 2K6ZA 1OVZA 4PH8A 3H42L 4YE4H 3U46A 1DCLA 4JGMA 3MXVH 5DZJA 1OTUD 2FHBA 4PLJD 1JK9B 4X5XA 3VD7A 3ZQWA 4A6YA 4BSVB 5HYSB 4IJTA 2J1KA 5D1QA 5D93B 2IGFL 5CCJA 2OMUA 2DTSA 3MNWA 5HJ3B 4L4JA 3DJTA 1JGEA 1GW6A 2Q5BA 4BGDA 3NEOA 4HCGA 4OLYH 4CMMB 1KV3A 2R29L 3JUZA 5GRWA 3NZ8A 4HQQL 1RZ7H 2Q1EA 2WVVB 3HS8A 4KRNA 4N86A 1WT5A 2VLLA 3BYTA 4NHUA 3S3CB 2J3SA 4YPJA 4CU6A 1IAIM 2G9HA 3PGCA 1CLZL 3SOBL 5HVHC 3WLWD 1YZZA 3SDCC 2EDJA 2BJMH 2YD4A 2E7MA 4JLRA 4ZTEA 2Q3XA 5FF6B 3TU6A 3D85D 1U8IB 3X13B 4PJAA 3PQYA 4K7PL 1XEUA 3VG0H 4BCZA 3LRMA 4L05A 2CJUH 2D03H 3QFJB 2AJ3A 1ZIAA 2WUBL 1PY0A 3VSQA 1ZLDA 4FADA 1EEUA 4B9ZA 1ZJBA 3EDEA 5CFAA 1ULVA 4A2DA 4EKJA 5FB8A 4PJGE 5D5ME 1TJGL 2ENYA 1IBHA 5H35B 5DMGC 4Q4EA 1CURA 3IRZA 5ANMB 4AYID 4HPHA 5GGVH 4LHJB 4HMDA 5B7FA 5IMLA 1KLGB 1U8OA 3BQUA 3EOYG 4TOYL 4ZUVB 4KXDA 2C9VA 2DWTA 4ZMQA 1F02I 3QEUB 1ETA1 3BVUA 2HRHA 3WG7B 1FNGA 4DAGH 5HPOA 4U4IA 5CZXD 3L5JA 4IKKA 1FGNH 3RFZB 4L5FL 3TGXA 2PXYD 3L9EA 1CK0L 2F54B 1NEZB 2D73A 3WU1A 4GEJA 2F8VA 2WWMC 3A6CH 3OHXC 1CG9A 1G9ML 2X6CA 2DIBA 3ZKXC 3FTVA 1TDQA 4JE4B 1KWGA 3GBEA 3QJOA 3BSZL 3WTUA 2BVQA 1FBIH 3ULUC 3DXAB 3UMTA 3O3EB 3VRJA 4M61B 4Z3EA 5BO1H 3ULVF 1FIEA 2OZ4H 3CVHA 4WVRA 1OM9A 1H3VA 3B7TA 2VAAA 4UTAH 1K5NA 5E8NB 4JRXB 1YNTF 5IB1A 1Z0NA 3KPNA 2F7PA 1OPOA 5DEGB 4NRXB 5HHNB 3ETTA 1YEWA 4GP5B 2HH0H 4OZHA 5EEYA 3OMIB 4NRZA 2GJZB 2VRAA 3G5XB 4YIQA 4UTCA 1ACYL 2J6EL 2Q76B 4NQXA 5DZ9A 3RTQC 2MQGA 3NCBB 2P1YA 3WXWL 2VLJD 3LZFH 1QVOB 4QKTA 1OD9A 5D7SL 5F89A 1MDAA 3KE0A 1Q1PA 2GW5A 3FU0A 3EO1B 1SYVA 3ZR6A 4DSYA 5IESL 4HUVA 3P9LB 1Y07A 4NZRL 4KY2A 3NZSA 4AITA 1BSIA 3CHRA 7FABL 3IBOA 2A7BA 4N2LA 4EN3B 3MFFB 5FOBB 1UWGH 2KZ1B 4ODTL 2DQMA 3FQ1A 2YPVH 3PL6C 5CKGA 3ZE0B 4EI6A 2JB6A 3UPCA 2QADB 4U7KA 3IJEA 5C7ZA 4LDEB 4M1DH 1J0IA 3VACA 2IGLA 2WUCL 3IDNA 1NWPA 3WJJC 1ZVYA 4AV0A 1B4JH 4IRSD 2F53A 3AS2A 4IOIB 3UEQA 1HL9A 1E4WH 2R1XA 3DX8B 3LSOA 4AC4A 1JGDB 4V1DA 4HEME 3Q05A 5ILTH 5ALCL 4X6FA 5FW6A 1QEWA 4YR6A 1DQLH 3L3OC 4G1EA 3K8MA 4HJJH 1RZGB 2BSSA 3F64A 1CGSL 4WKXA 2P4AB 5TE6L 4WUUD 2Y24A 1F45A 1XTMA 4LFHG 1DN0A 4TTDC 3CIAA 3CFTA 3SGJC 3PWVB 4UQAA 4CKQA 1W0YT 2IC2A 1R3IL 3GUFA 4FG6D 3TN0A 3RVWC 3C8DA 2JJVA 3HR6A 3NH7H 4D7BA 1EMTL 3WKQA 5FA3A 4ZXBB 4L0ZA 3QHFH 2ZCZA 2BNRE 1EANA 3SE8L 4XNBA 2CJTA 4PVNA 5EEUA 4KZ0A 1IM9B 1VACA 4ZPVB 3HVNA 4DW2L 1K6QH 4CVZA 2CUAA 2HVJA 2EDTA 4GSUA 1TJMA 4OD1L 3MODL 5AVUB 4OLVL 3GXDA 4K23H 1INEL 3HR5A 5C9JB 4MXVF 2FECL 1Q1JL 3GZQA 3WTWA 3ULVE 4DK5A 3GSNL 2AANA 3O0LA 4JQVC 4X6DF 2G75A 2G3ZA 3ZN6A 3GK8L 2Y1YA 3UP1A 2ZOWA 1WFIA 4RLDA 1CICD 3F5WA 2R4RL 3FCGA 2L7UA 2A9MH 4O2FA 1DVFD 4YSQA 1RIUL 4NO2B 5JDSA 5AOLA 2Z3FA 3BP5A 2GCYB 2CLRA 4EZJA 1QLEH 4Q6YA 2J88L 4QD2E 2YRLA 4A7QA 2RH0A 2EZ0C 2NYKA 1C7TA 4YDIH 3BT2H 1HCFX 2F8OA 3GBML 3MGOA 2A77H 1CYGA 4PG9B 4R9HA 1NC4B 3LJ3A 3VXPB 5EMYA 3LH2L 3N0AA 5CP7A 5C6WH 5JIKA 4DKTA 4YBQD 5FUCC 4RSYA 3WE6A 1BEYL 4PLOB 2RCSH 4JY6B 1WEJL 5INDB 1QRND 1TZHA 4LCWB 5D4IA 4HCFA 3HN8A