1Z9OA

1.9 angstrom crystal structure of the rat vap-a msp homology domain in complex with the rat orp1 ffat motif
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
119
Chain Sequence
EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVWKEAKPDELMDSKLRCVFEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/lipid binding protein
molecule keywords Vesicle-associated membrane protein-associated protein A
publication title Structural basis of FFAT motif-mediated ER targeting
pubmed doi rcsb
source organism Rattus norvegicus
total genus 20
structure length 119
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z9oA00
2EXWD 3X12B 4KXZI 1OGAA 2R0LL 3O6LL 3L3JA 4FQHB 3MV9B 1A9BB 3F5WA 1U8MB 4N8VA 1AI1L 1WICA 1MFAH 1T22A 1VA9A 4NHCL 2J8OA 2UZIL 1KIPB 3GMLA 4OD1L 2W07A 1MQKH 3H9HB 3WFCH 4O9HL 1BQLL 1IZKA 4AG4L 2EDRA 4CW1A 4N0RA 1S9YB 4KKNA 2W65A 1KEMH 4YX2L 5FO9B 1P9MA 3O8XC 1CE6A 1PG7X 5KVEH 2XRAL 5GGVY 2VLRA 4LARH 1MCNA 4MD5A 5HY9A 3O4LD 1DN0B 4RISH 4C83A 4OZGB 4UIKL 3ULVH 3LQZA 4L3CB 5MI0C 4OCWL 3SDDC 4U1LA 4R8WL 1R3IH 1KBGH 3BZDA 4WI7A 1VFAA 1UVQB 4MAYC 2DI8A 4LHUA 5E03A 7CGTA 1QBLL 1N4XH 2BNRE 2GAZA 1G7QA 2Z8RA 2I9LB 1AO7D 1FV1A 1XGYL 2LV4A 3UC0L 7FABL 1P7HL 4JM4H 4PR5B 4LSQH 1F3JB 1P7QA 2J2ZA 4NO0A 3WHXA 3QDMB 4XP9H 4U2YA 4ODXA 2DQJL 5ESAA 5IEKA 1T5WB 4NM4L 1RUPL 4KKBC 2CO7B 4LCYA 3MRCB 3EO1A 3KPLB 4X0KB 3MV7A 4JFYB 1A6PA 5GSRB 4W4NA 3MGTB 3SDXA 2XV6B 3QUZB 3VE0A 1C5DB 4XCEA 3T0EA 2FB4H 1G0XA 5EIQA 3NIDF 5BQ7B 1ZOXA 1R0AL 1QO3A 4LLUB 5DA4A 5HVHC 3ARFB 4YPJA 2EICA 5K9QI 1MIEH 3MLTB 4JAMA 4Q97A 2VR9A 1S7XB 5HHMD 2MJWA 4L9LA 2HFGL 1IBGL 3RY6C 4QKXB 4DW2H 4PJ5E 3KR3H 3TA3D 1T2JA 1ZGLB 3T2OA 2FO4B 4TULH 1YUHA 5EORL 2A77L 3UTSB 2R0WH 4HJJL 3STZB 5BCAA 4HKBA 4JKWA 1DQML 1JUFB 4KK6D 1FZOA 1ZGLM 4N68A 2I9TA 4AMKL 3X14B 5C0GA 2XY1A 5J3HD 1NGWA 4WEMB 1ES0A 5C86A 2CIKA 1JHTB 3REWB 5KN5A 5IHUL 4G7YH 2BOBB 4RA0C 4NO5A 5TE7H 4DQOH 3MNZA 4KJYA 1A02N 1RJLA 1I1AA 5KSUA 4MB5A 4RGMC 3R4DA 1OF2A 4GKZA 3RHWK 3N1QC 4KDVA 3O6FA 1UQSA 3RVTC 4Z7UF 5J57B 2QQNL 1Z9MA 3C2AL 1LEKB 3TVMA 1A3RL 1UXSA 4U6HB 4L3EE 2NCMA 3TT1H 4EJ1C 1DLFL 5IMLA 1RZIB 4IRSC 3PWPD 1KGCD 4OLZL 1F3DJ 4Y4KD 2RFXB 5C0IB 3QDJA 1QFPA 3GRWH 3GUTA 2CLVA 3BH8A 2YC1A 5KAQF 4JY4A 2HKFL 1RZKC 2AV7A 3U1SL 2CDEB 2OTUA 4FQPA 5BS0E 1HXMA 1VADB 4U1HB 5L0QC 3L5IA 2V7HA 5IVNA 2APFA 2X4OA 4ENEC 3H7LA 3QIUB 3UJTL 5AD0A 2NXZD 2HG5A 1FVDB 2ZUSA 4NQDA 5TGBA 1U95B 4R96A 5FHAL 1HH6A 4N1HB 3AVEA 3HNTH 4PRID 1ZLSL 3VGGA 3AS0A 3V0AC 2ZSWA 3NA9H 5DWUL 2OXGA 4U7SA 3WFBL 1P5VA 2DOCA 4NGHL 2NZ9C 4MQXC 3DO7B 4U1JA 1ZS8B 1T4KB 3UTPE 1OSPL 4L4VA 4B50A 4IOFD 4JJHA 3RU8L 2XYCA 3MLVL 1XAUA 4MX7B 3VDCA 4MCYA 5CEZD 3NACH 1CDYA 5C0BD 5E5MB 1MCIA 3P30L 1T04B 3ARGB 4NUGL 4GMSL 4HFUL 3SBWA 2PUQT 5E4IA 1A9EB 1MCWM 2P5WA 1DP0A 4F7PA 4P4KA 2OR9L 2VWEC 4ZFFA 4XVTL 5IM7A 2DIJA 2WQRA 2YZ1A 3BP6A 4GRMB 2FX8L 3BKYL 4M4RA 5IFHL 4PBWD 2VDRL 3BGAA 4HDIB 1T7YA 1MHCB 5C09D 1DL7L 5EBWB 1WFUA 4H20H 1HINL 1JGLL 4FG6C 3UPRB 3DRQA 4YZFF 5HYQA 5I66A 2B1HL 1KCSH 1VB9A 1QRND 2YPLD 4GS7C 1PAMA 2PF6A 1EEYA 3T0VA 4YDKH 3JXAA 3H3BC 4J3XA 3QUXD 4ZUUA 5FGBA 3KPRA 5ICYA 1ZT7A 2MNUA 3IXTA 4M9PA 3C60B 1J5OH 5HPMA 5T1KB 3UTTA 1ZA6B 2BHUA 4PG2C 1H9VA 1EFXA 4KXZH 5EU3A 4PV8A 4PB0L 4BK4A 3BGMA 4JR9L 1HCFX 4LF3B 1ADQA 3K7UA 4R7NA 3X3GH 4FZEH 5MEND 1WISA 5DEGB 4P46A 4O2FB 4S10A 1A6VH 5J13C 4CVXB 4LU5H 4KQ3L 4PY7B 2YRLA 2FBOJ 1IGCL 1YECH 2VQ1B 3V5DA 3VGAC 1X5GA 2VKWA 4I4WB 3KVQA 5IP4A 4MNHB 4Q6IB 5H37H 3IDNA 1JGEB 4HX1B 5GS3A 3VFVA 1GZPA 5DRXA 3NCJH 3O9WA 1LHZA 2IALA 3OWEA 3GRWA 4D0BA 4BK5A 1R3KB 2IADB 3D3VD 1K8DA 1GAFH 3SDXE 4C58B 1V8HA 3QXDB 4IIQA 4KY1H 4MS8D 5TDPA 1SM3H 3T0EE 2A6DA 4J1UA 5AZEH 4NSKA 1A14H 4O2CA 2ITDB 5EIIB 4M03A 3CMOH 1CICB 2ARJB 3S88L 1H15B 3UYRH 1UCBL 4JFDB 2VN4A 4Z5RB 5TPWL 4K94H 5JLZA 3PDOA 1SBBA 3MRDB 4N8VG 1HI6A 2GITA 5IBUG 2VAJA 1FDLL 4NKIL 1MY5A 1NCAL 3BVNA 2HVKB 2P5EB 5A2FA 2FBJH 5KANI 3LOWA 1NMBH 1UEYA 1AR1D 4BH8A 2A9NL 3D6GA 2P8MB 1UA6H 5AUMA 5GS0D 4KAQH 4WI5A 2QL1A 4LEOB 3L3HB 4TNWK 2DMBA 1A5FL 1KCUL 1RUAL 4QLRA 3OQ3B 5JXAL 3O2WH 3SE3A 4OD3L 1FL6A 4LHUG 2EDLA 2XQBL 3MBEB 4LKXB 5F7DB 2VE6A 3JV6B 4NCC1 4C59B 3RGVB 3TH4T 2X4TB 4P9HC 4ACPA 1U8QA 2JELL 1QSFB 2EO9A 5M95B 1E27B 5JW4N 4N0CC 4Z0BH 5C07E 4TSAH 1PYWA 4PJ8B 1OCWH 3ZDZE 1OTUD 2PXYA 1E0OB 4KRMB 4RFEB 4DN4H 5HVGB 1JV5A 3QCTL 4BFEA 2WUCL 5MEPA 1S7TA 5EUKB 1P9MC 3QO0B 3IB4A 4HUXA 1F90H 3O2VL 3O6KH 2LTQB 2DMCA 4K3DL 2D7PA 3VG9B 3C5JB 2ZCKL 1QSVA 3CSPA 2AKRB 2WSKA 1REIA 3MRGA 1CGUA 1BZ7B 2X5PA 3H7BB 2CLZB 3D0LB 1JPFA 1TENA 4NO3B 4JO4H 3ULVE 4O02H 5FOJA 5CEZH 1LDPH 3MACH 5I8OL 1AO7A 5F9WC 4FQXA 1CLOL 1TITA 5T1DL 1YJDC 4OZIA 3RWIA 1F97A 3D39A 4ZO7A 5FYJL 4EUPH 5HGBA 1FO0A 4L4TD 5GRVL 1ORSA 3GJEA 1MCOH 5J6GB 3G5ZB 4ZFZB 3ZE1F 1MAML 1JGUH 4U3HA 4TSBH 2K1MA 5H35A 3DXAD 3OX8A 3KXFD 4P3WA 3ALXA 3L3DA 3PXHA 2FYYB 3T0EC 3GJFB 5BJTB 3LSOB 1L0XA 1J05A 4X7FC 4YHMH 4RDQF 1KLUB 1MCEA 3P73B 3NFSL 4LLAA 1H3UA 5DHXB 4IMLB 4L9LC 4OF7A 4GG6F 3TA3A 2HTLC 4POZC 1YQVL 3I3BA 3BRDA 3GMPA 4P99A 3I6LE 3UBXB 4Y4HB 1NMCB 2YSSA 5ID1B 4E41D 1KXVC 5A2IH 3PHOB 3OKEB 4WCYL 1A1NA 5F7EH 3MUHL 3UTTE 4P4RA 2YKLH 2GJ6E 4Z7VE 5BZDA 1LD9B 1BIHA 1FZKA 2NLJA 2ZUYA 5D70H 3PABB 5D6CB 4WTWA 3IVKB 2JF1A 1JZ3A 1HCVA 2DM4A 4MNGE 4JLRB 4MA7L 1I1AC 5E8EA 4LQFL 2H2SD 2HRPL 1RUMH 3MV8E 4HFWB 3VFMB 3LKPB 4NRZB 3OG6B 5DA0B 3O6FC 3RNKB 4Y5VB 2NPLX 3QDAA 3TVMC 1OOAA 3RPIB 4NHCH 1S9KC 4LVEA 4OD1H 3MMEB 1WZMA 2IWGA 4FQLH 4CMMB 4Y4KA 4O9HH 3QULB 4YEFA 1BQLH 2XN9B 4X9HA 4NBXB 3MRRB 3O2DL 1AD0A 2OR7A 4PTUB 3NZHL 1K5NB 4ZAKC 1EJOL 1CD1B 4JREC 5IFJA 1NBZA 5HDQH 4CRPA 4OGZA 4P5TB 4E42A 1BPVA 4UIKH 3GKWH 4V1DE 2V6HA 1A6AA 3SDAD 3BFOA 3BPLB 3FB8B 1P7KB 1T2XA 1H3WM 4QHNA 4PRIA 1A4JA 2X09A 1MVUA 5EU4A 1YMME 4XPFL 1KFAL 5D8JL 4WHTA 1Q9LA 5LGHH 1I7ZB 4QRRB 4PREB 1IGJA 5MHSD 2IFFH 3LQAL 1UACL 3TJHD 4D0CA 1U8NB 2XKSA 3C8DA 5TF1H 2XTJC 4NM4H 5C9JB 4DZBA 3CFDA 5TDOA 3EFFB 5GS0H 5C0BA 3IF1B 1SMAA 3REVA 3MYJB 1SYVA 1I85A 4OQTH 3SBWC 5FUZL 1CQKA 3EYOA 3IDGA 2F8VA 4EUPA 2AJYL 4HS6B 3WMSA 4P4KC 3RIFK 2HTKC 3G9AB 1PZUB 3MROA 2AQ3A 5DJYA 3OKOB 2OJZL 1V7NH 2EYTA 1E4XL 2A77H 3HCVA 5GQBA 5C08B 2PTTB 5F3BA 3T65A 3U48A 4MSWA 5F6HJ 4JG1L 2OJEA 4GQ9L 4KPHH 4JRXA 3BDYL 3ZT6A 4P23B 1WAAA 4LNRA 3QUXA 1H8OA 3CCHB 1AXTH 5BRZD 2H6PA 2D0FA 5I75C 5FGBC 4P3DB 1J12A 1D5ZB 2DQEL 1NQBA 2ZUQC 3CXDH 2AXFB 3K8MA 3B5GA 4E5XA 2BSED 5J4MA 3CXHK 1OSZB 5DUPL 4NNYA 5CZXC 1F4XL 5AAWA 2QQNH 1XFPA 4OB5H 4JKLA 1GOHA 3O4LE 5F1IA 2B1AH 2D4FA 5FKAB 5ITBH 1YEHL 2F15A 4P46C 1SJVA 4L29A 4QRUB 1JVKA 5IF0A 1J8HA 2HKFH 1F4YL 2V7NB 4IOIB 2FZ3A 4KK8D 3RBGA 1G7PA 4U6YB 4F3FA 1AHWB 3G5YA 8FABA 1NCBH 2Q87A 3IKCB 5F9OL 3WFEH 4GW5A 3GMRB 3DYMA 1H3GA 4PRDB 3MRJB 5F89B 2BZDA 4I2XE 3ARUA 3MRMA 4U2ZA 1P5UA 4Y8AA 1NFIA 5I0ZA 4AEFA 2FJFB 3O9WC 4DGYH 5I8CA 2J8UB 3DX7B 4HKXB 5CBAB 2VQUA 4KVCL 5GJTL 5JO5B 3D3VA 1ZLSH 3QPQD 4LHQB 1MAKA 2HVJA 4MCZB 1R5VA 2X1WL 1NAMB 3H0TB 1PKQE 4NQSB 4FXGB 4PD4J 3DSNA 4P57B 3G6AB 4GKSA 4NGHH 3B9AA 5I71C 4HMCA 1LK2B 3DJ9A 4M7KL 5D7IB 5HHME 3S5LB 2CXKA 4FQJH 5CIPB 5DJ0B 5B21A 1AQDB 4M7LL 1MLCA 4WU5A 4LPYA 2IANE 5FCSH 5MEOB 4XMKL 4BSJA 3P30H 1SEBB 4GMSH 2FH6A 3LEXB 2CRIA 4PJDB 3SDYH 1UWGH 2DYPD 5DD0L 3CX5J 1W0VA 3GGWA 5IVXF 2DJUA 4XVTH 3DV6A 3RAJL 4XVUD 2EH8H 2R56H 3MJ7A 1CTNA 4LSVL 1CFSB 2NY0C 5BV7L 2VDRH 3MOAH 1FAKT 4I3GA 5L2KE 1I9EA 1PSKH 5DRWA 1U8JA 3MR9B 4OQTA 4J2XA 4NQVB 3MGOA 1WFNA 1WZLA 1X7QA 3HE7D 4WEBH 3Q6FB 2H32H 3KYMB 4ONHA 3TIEB 5D1QB 2AK4B 2DQGL 3W82A 4HZLA 2EXWC 4WI6A 1A7RH 1Y18A 5INDB 3SE3C 1I7UA 3PWPE 4HKJB 4JPKH 1KGCE 1MRCL 3VD4A 5I9QC 4TNVF 5GGSA 3ZKXC 2XICA 2D7QA 4NZDA 5IEHB 5FECB 5I1CH 5D7SL 3P0GB 1MCQA 1ZV5A 2YEZB 5E08L 4NDMB 2P4AB 5EU6B 2P7TA 4PB0H 2P8PB 5HYJB 5GIRB 4DKFH 1S7VA 5H37G 4JR9H 4G9FB 4FFVD 2OSLB 2PXYC 2IPKA 3STLB 4P2OB 2X4PA 3EO0A 1AY1L 2R2CA 5F88A 1SJEB 1I8IB 5KS9F 4R7DA 2CH8A 1EUTA 5LWYH 5CJXA 1KENH 1WIPA 3ARSA 1IC1A 5L88L 1MWAB 3NCFB 1NGPL 3H2WA 1EUUA 3EDFA 3W2DL 1I8MB 1XGUB 5D7LD 3D0VA 2EDQA 1HHGB 1JZ5A 2ORBH 1KV3A 3QEGL 1FIGL 2PO6B 2NY3C 3ILPA 2J3SA 5ALBH 3VDBA 1EO5A 3VFGH 3V52H 4PUBH 1CGXA 3BQUC 3NPSB 4KGJA 2ICEA 3LKOB 1QLRB 3FAWA 1MHEA 1NBQA 2IBBA 4FQXC 3V5KB 4R97C 5C0BE 3MFFA 1BWMA 3IGAA 4DCQA 4LVNC 3T1FA 2YN3A 1EIBA 3S96A 2DQUH 2Y06L 3VFNB 4HCRL 1S7RB 5CKAA 1SYSB 1X5AA 4BZ1L 3KXFA 5E8PB 3BAEH 4EDWH 5K9QG 5EBGA 2I60L 3SQOL 4MQSB 5C09E 4XCCL 5TPWH 5GZOD 1MRDL 1H3PH 1VACB 2UZXB 3T8XB 3DX6B 5D93B 1IM3B 1CGTA 5DVMA 3LKRA 1E4XI 1KLFA 3O3EB 3QEQE 1IAIL 4LCCB 1PLGL 4HBCL 2HYMA 5LGJB 3VXPB 3TA3C 3O6ML 1NCAH 2YPLE 1QRNE 1TZHA 2C3VA 3FQRA 3V4PH 1SJHB 4ESKA 3K2UL 2Z4QA 3S35H 2QHLA 2A9NH 3BE1L 4KK6C 1LGVA 4NQUA 1E6JL 1P2CA 1LWRA 3M8OL 5DMYA 4K94C 1DBAH 4J7RA 5LCVH 2AK1H 5EWIH 5E7FA 4YXKH 1WSST 3DROA 1B6DA 3LB6C 3U0TB 3NVQA 1UKQA 2OYPA 4F2MB 4JZOA 4OD3H 1IFHL 5FO8A 4LDEB 5MENE 2M26A 4GSDH 2OP4L 4XP5H 3F7QA 2R15A 4GUPA 1I3RB 4P2RD 3WNMA 1CG9B 1M7IA 1QNZH 6CGTA 5IVZB 1CVSC 2E6JA 2VERN 1NLDL 2H32A 2RCSH 2BNUB 4PY8J 2P24A 3K1KC 3QJHB 1B90A 4Y4KC 2HJKB 4LASL 1OAYH 2F5BL 3BIBX 5ENWB 5F1NB 5I1IL 4LVHC 4ONOA 3MLZH 2X05A 1CFQB 4KHTL 5E8OB 1U9KA 3QCTH 1GGYA 2WUCH 3OSKA 4G7VL 4TQEL 4HJGB 1KG0A 3D3VE 2EIEA 4KH2A 4EUPG 1OL0A 1URLA 3WSQL 3ARDB 3SDAA 3LRSA 5IJVA 5J56B 2VB5A 2NXZC 1HOCA 1QOKA 1N6UA 4JZNA 1ACYL 3AAZA 3P11L 4OGXH 2A6KA 1MREH 3QO1B 3GK8L 2NXYB 4LLWA 1ZSDA 3UROR 2F74A 5JPNA 4MMXC 5EBMB 2HT2C 4ELMA 4LAQL 2VL5B 5FYJH 3KYKL 5FOBA 3BN9D 4HGWB 4MJIA 4WV1A 3HAEA 1DANU 3UJJH 2DDQL 2D03H 3SY0A 3BEWA 4TPRH 3VI4E 2BJML 3I02A 2V9QA 3B8SA 1I85C 2QSCL 1MH5A 3FB5B 2NY6D 3MX0A 5T1LA 4MD4B 1BQHA 1U8HB 4HLJA 3BGFB 3U6RA 2WLZA 3RWDA 4ISVB 1GOFA 4X6BB 1YQVH 2QADB 2Z31D 5J89A 5FV2A 1UM4H 4J3OC 1UJ3B 1SHMA 3QG7H 4WTZA 1JPTH 1A4KA 4B7LA 3RIAF 1KTDA 1MCSA 3KWWA 4ZTPL 1NEUA 2OMBA 4TUKH 1B4RA 1U0QA 3GMQB 3VW3L 3QUML 2NY5L 3AB0B 1Y6KR 3VFRA 2AI0H 4WCYH 1QHOA 1YN7A 2IAMD 4MQTB 4JFEB 4LIQE 4BZ2H 3BWAB 3QUXC 5KZCB 4ZDHA 1R5WB 5EUOA 1K8IB 4X9GA 3V6FB 3MREB 4PJCA 4LQFH 5C7XL 4M6NL 1ZANL 3LS4L 4DOHE 5JHDD 3RWHB 3MCLL 3E3QE 5LAXA 4R0LA 3WUWB 1LP9B 3HMWL 3DVNB 1YN6B 3GDBA 4BKLB 1T5XB 2AV1A 3O3AB 4OZFB 2XOTA 5ID0A 1DQTA 1IGYA 1GGBL 5FEBA 2UV3A 5IOPA 3DETC 2FGWL 1J10A 3B9KA 5EC2B 5TJWK 3VXUD 3I3EA 3TBWA 4JKKA 2ICWB 1X9QA 2OL3L 2RGSA 3FQNA 5TQ2H 4C56D 2R9HD 5D7IF 5DK2B 1KB9J 4W6YB 5K93A 4D3CH 2VR4A 4L4TE 1R3HB 3QDGD 4KU1A 4WO4B 1TLKA 5F9AC 4D0DB 3T77A 2ADJB 4H0IA 3DXAE 4F57H 3MJGX 3TCLA 1G6RB 3KXFE 4XMLH 4AIOA 2NY2C 3GMMA 4NWTL 4XTRD 3LS5H 4MS8C 5GGTL 3IAQA 5EZJB 4K3JH 2H3NB 4PP1D 2AJXH 1QFUL 5BZWA 3GSQB 3O8XB 5H94B 2EDNA 5DK0B 2NR6C 4IHOA 1N6QL 5K9KA 5GSVB 5MI0B 3SDDB 1KJVA 3D18B 2VC2H 1CBVL 5ILTL 3MXWL 3CVHB 2A74A 3LKQB 4WENB 1F42A 4K8RD 4PJAB 3DTXB 3NOIA 4E41E 4HLZH 2PYFB 4ALAL 3DVIA 1I3VA 1TJGH 2EEDA 3EDKA 4PJ9B 3RVWC 1X6NA 1H3VA 2NNAB 3B8YA 1J11A 4LVOB 1AR1C 1FAIH 2VLJD 5LG1A 5GS0C 1HZHL 1VFOA 1NFDF 1AP2A 3GHEL 4XNQB 5J06A 1JHLL 5DFWH 4EBQL 3MV11 4QTHB 5B3JF 1JYVA 3MXVH 2YD3A 3F12B 5I1HL 4DUVA 3VFPB 3FFCB 4UNVA 5ETUA 1EFQA 5CJQL 4XB8A 4KC3B 5EDXA 3EZJB 4XAWH 2WK2A 4HK0A 1FG2A 1RFDH 3UPCA 4V2CB 4LCWD 4XNZC 3ZYZA 4HV8B 3B9VA 5DUPH 2XZCH 4AL8L 3I6GA 3DIFB 1E4KA 4MD0A 2HN7B 3BJ91 3BJLA 3B3IB 1UH3A 3RX5A 3OJMB 3QYCA 1MAJA 4XGZB 5DGRA 1OTUC 1J0IA 1T1ZA 4D8PA 1S78D 4OF6A 5B8CA 3E3QC 1S8DB 2ESVD 2AW2A 2X70B 1H5BB 2NYYD 4AY0A 5CJXC 5D7LA 2CDGB 4ELME 1GRWA 2Y5TA 3ALPA 4OZHB 3RY5A 4GBXB 5MHSE 5C0CD 1JF1B 1TCRB 1YNKL 2IPTH 2ZSVB 4GKNB 1CDIA 4RSVA 2CKBL 4LIQL 3ZYOA 3EFDL 1KIUA 4OIIH 4CVZB 4M5YL 1DANT 4AM0A 4JZJA 1GCFA 4RWHA 4WHCA 1RK1B 5DJXB 5DMKB 4LSRL 3CFKB 4YDVA 3KYNA 1VFUA 1FFOB 4U1SA 1ZHLA 3OJDB 1NGZA 4J3UA 3QUYA 3AS2A 1X5ZA 3QRGH 4LLVB 4U6VL 4JDVB 4RMRA 1ZLVK 2GT9B 3TV3H 1S9WA 4M7LH 4ZUVB 5KSVB 3CVIH 4AENB 4Z78B 5J6HB 2ADFL 4XMKH 4L8SA 1J18A 1NGYB 2V5TA 1BP3B 1ZVSA 1VCAA 3BD4A 2E9WA 4Q2ZB 4RAUB 1IM9D 4DUWA 3BPCB 3U82B 4S1DD 4X6FA 4HUMB 1FVCA 1IEBA 1XF1A 1CL7L 4OLUH 2HLAB 3LQMA 2V9TA 4NZTH 2A6JB 4LSVH 2JB6B 4KROC 5BRZE 5I0DA 2DKUA 4LDOB 5EUOE 4S1RL 3G04B 2BNRB 5KSAD 1J0HA 1ZXQA 5HTSA 3Q48A 4YXLH 4PJCE 3ZDYE 3BD5A 4NCC2 4L8BA 1OB1B 4ONFL 5ADOL 3F6LA 5DDHA 3LKNB 3KPNB 3RTQD 5IWLA 3L6FB 2GSGA 2BP3A 2X9XA 3WEXA 4XBPA 4RWYL 3WIHL 3DSFH 1JP5A 1L7IH 2H2SC 3IDIA 4QTIH 5GGQH 1MRCH 4QRPE 4UTBL 4DGVL 5ISZD 1EAPB 5FO7B 5C0ND 3QFDB 2H8PA 1FJ1B 4I18A 2N7BA 1VGKB 2BSRA 3T0XA 1DBML 1UM5H 5I2IA 4PJ5B 1KT2A 1XR8B 4GS7B 4W68A 1N8ZA 4LK4A 1F02I 1T1WA 4X6CF 4XC1H 2VJXA 3T2QA 1AY1H 2BC4A 4IBLT 4G42A 4TVPD 4FXKB 3DMMB 5IMKA 4ETQB 2Z93B 2FLBT 3W11D 5I8EA 1NC2B 5FAAA 1QKZL 1BZ9A 3NBNA 4ZFOL 2F5AH 4YHPB 5JMOC 1BQHG 4M4PA 4XCYB 4X98A 3NAAL 4YK4B 3SDAC 3CFBB 3O0RL 3BXNB 4GRLA 4FFZH 4EXKA 1XF4A 1BJMA 4OCNC 1PG7L 2FJHA 4WTZG 1G7LA 4K8RH 3RX8A 3AREB 4XWGL 5JZ7C 1D9KD 3KLAB 1QSED 5J13B 4S1QL 4D9QD 5IJKA 2DQFA 2CUMA 3MRLB 5K33A 3UTOA 4AT6A 1FNSL 1P1ZA 5CCKH 1X5JA 4L3EB 4WV1C 3LEYH 5DD6A 1VSCA 1FLRL 2EYSA 2DF3A 4F7EA 2IBZY 1T0NA 5IHZA 4OAWA 3MLYH 1KSRA 3BPNB 2MWCA 5DT1L 4W6WB 5BS0B 4X7TA 4QWWD 1CFNB 3BIAX 3PGCB 4DN3L 4ORGA 5FIEA 3N06B 3WIFA 2FJGB 2XPGA 1QEWB 2B2XH 3QJFB 4HBCH 3ORJA 2W9EH 3O6MH 3AU1B 5C0JA 5EOTA 3QDHA 4WHYH 1PW3A 1EMTL 1NDMB 2K9UA 4KTDL 1DUYA 3PWLB 1CD9B 4PLKD 3EJZD 2WWKT 4G5ZL 1ED3A 4YGAB 3BE1H 1LP9F 4M1CC 1BVLB 3NA4A 1E6JH 1BIIB 4ZPVA 3S3SA 2CK0L 2IAMA 1CK0H 4BQ6A 4M6OL 5KTEH 2Y07H 4QRTB 4LSUH 2R2BA 2VAAA 5M94B 3HZVA 2EDDA 4EI5B 1BAFH 5HHOA 2X4SB 4PG9B 1RHHB 4ZO9A 3HI1A 1TVHB 4L8DB 5D1XD 4H1LH 3N1FC 4WW2B 2DQHH 2OP4H 2MQCA 1AIFB 2JE8A 4XX1E 2QR0A 3S34H 3ZKND 2R2EA 4R0LC 2OM5A 4I8DA 1QA9A 1KN4L 3IFNL 5LXGH 3RA7L 3CMGA 3MODL 2Y7QB 1I8KA 3VXUA 3TJEL 3RJDA 3B9KC 1BEYH 3FONA 4NOBA 5A16B 4KHTH 4KZEH 3GSUA 4C56A 3PL6D 4U1MA 3ZO0A 4G7VH 4K07A 4Z95L 3VGHA 4ETYA 5E2WH 1JPGA 3KPMB 2MPAL 1T21B 2GKIA 1ZKAA 2ZCHH 4F33B 2RJMA 2VITB 4M93B 3QDGA 4FMFA 3THML 3PJSA 1TQBB 5TF0A 5F44A 1GZQB 4KVNL 4RMWA 4PJAF 1ODAA 3GMLB 3OZ9L 1P84J 3M1BB 2MFNA 4J3VA 4KRNA 1E28A 5FA3A 4WFED 4YZFE 4I1NB 3S4SA 4CW1B 1YEIH 4KI5D 3BPOB 4PYHA 5DQJB 3PWUB 3VWKD 1DVFB 5ADPL 3WE6B 1T6WA 2MHAB 3VXSE 3ZYJA 2X4QB 3GMOB 1F8TH 3ARYA 1CE6B 1C7TA 1DDHB 2R1XA 5HY9B 2HFTA 5I1JH 4WI4A 1DR9A 1FYTD 4U1LB 4JFZH 5MP6H 4AIZA 3B2VL 12E8L 3HPLB 3K4DA 3LHPH 1TPXB 1QLFB 4LHUB 4GRWF 2EXYD 1CL7I 2JB5L 4OCYH 2GAZB 4KQ4L 1G7QB 5ICZA 5F7FA 1W8NA 4KJWD 2MCPL 3TO4A 3FO2A 2VLJA 1JPST 3S3PA 2X44D 3WHXB 1HKLH 1NBYA 4ZO6A 1JWSA 4ODXB 5ESAB 4GW1A 1K6QL 3RZCB 5HGGS 1V7MH 5IEKB 4LCYB 4YDIH 4ZFGL 3FOMA 4JFPB 2DRUA 2G5BB 1J1XL 2X4NB 5D7JB 1PFCA 1QHPA 3SDXB 3VW3H 5AYUL 3QUMH 4P2RE 3T0EB 5FK9A 5C2UB 4MA8L 3QPXL 4UDUA 1GHFL 3F7YA 1F4WH 2BY0A 4R2GD 4M7JL 3D9AL 3RDTC 3BD3A 4RCAA 1JNHB 4I0CC 4TVPH 5KOVC 3K81A 1JWUA 4F7TA 5C7XH 1HHHB 1VEPA 1YUHB 4M6NH 4OZHF 2PYED 1LNUA 3EYVB 5IK3A 4HKBB 3ESUF 3FFDB 2R0KL 4RAVA 1E4KC 1JGDB 1FZOB 3JTTA 1GGCL 4QHMA 4X83A 1MUJB 1ZA3A 3W39A 1GGBH 1ES0B 4HIJA 4LOUD 1QR1B 4GG8A 2CIKB 2QLVB 2FGWH 4TN9A 2ESVA 5J1AA 3D87B 1CIUA 5B8CC 4NO5B 1EBPA 2B7DT 4H1LA 3TN0D 5I30H 3P4NA 2FSEA 4JQXA 1RJLB 1I1AB 5KSUB 3ECBA 3C5SA 5HGAB 1OF2B 4Y1AD 1M7DA 4QHLA 4CADA 1C12B 1DQLL 1IQDA 3Q5YA 1CGSL 2BMKA 2RBLA 2LAAA 3TVMB 1UXSB 1AGEB 4K71C 3EHBC 3P77B 1DBJH 2IH1B 4DKAA 5D1ZD 3GHBH 3VFUB 4JZJC 3LN9A 1WTGT 3GUTB 2CLVB 5IMOA 1WC7B 4HLZG 2AV7B 4DUXA 5C07B 3OKMB 1ND0A 3QUYC 2OTUB 1A7QL 2VXUL 3W0WA 3FQXB 3OPZH 1N6QH 3QEHA 1D5IH 3U4EA 3L3KA 5AD0B 4Y4FD 1CXEA 1HQRA 4YXHH 5ILTH 4R96B 2G60H 3WYRA 4Z7OF 1HH6B 4L8SC 4X8XA 1FZJA 4NN6C 4HS8L 4K9EH 5FGCE 4HPYH 4KMLB 3LN4A 2KL6A 5DC4B 3UYOD 2ZSWB 3MBXL 1FQ9C 1RU9L 3FB6A 4S1SL 4I3RL 3KJ6L 4U1JB 4MXVF 5KSBA 1IAKA 5KSAA 1QFHA 1I9IH 4MGXA 3DX8A 4JY5L 5HD8D 3BX7C 1WBZA 3GHEH 3HMXL 4YLQT 1ZT4A 2VDLH 3RY4A 1G7MA 2XWTB 1F5WA 5JHLL 5JHDE 3QWQB 3RTQA 4QCIA 4XNYH 3TFKD 3AS1A 3V0WH 2VXVH 4NC1E 5IWLC 5DHVH 2D7TL 5CJQH 1D7FA 3IJHB 5IM7B 2ENSA 2OR8A 4GXUN 5ISZA 3OV6A 3DVGA 5EFIA 3S37L 3VXUE 1S3KH 5DO2D 4F7CB 3G6JA 1BD2D 4HWZA 4OM1L 3ROLA 4I18C 3QUMA 4C56E 3CSBA 1F11B 4MQ7B 1JFQH 1AE6H 5A3ID 4ZOAA 4R90L 3HA0A 5I66B 2R0ZH 4F7MA 2X40A 2DJ4A 3QDGE 3FO0H 5BMFL 1EEYB 3B5HA 1GGUA 4YUEH 1RURL 1CE1L 4K3GA 1HHKB 4ZUUB 3QH3B 2CR6A 1ZT7B 5ICYB 1DCLA 3IXTB 3HNSL 5T5NG 2ZUQB 4MYWB 4HC1L 1JF6A 4GG6E 4MAUH 1GGTA 5IR1A 5HPMB 4PJXA 3RWCA 5F7YC 3UTTB 1CDGA 2GJ6B 4Z7VB 5E1AA 1EFXB 4FFYL 4OM0H 3PDDA 4GRLC 1FL3A 3U0WL 3JWOH 1F3RB 3SCMD 4MNGB 3HFML 2ZG2A 4ZSOA 3O45A 1QSEA 1ZEAH 1FPTH 4WTXA 3MV8B 2K7QA 4YC2C 2F54D 3R0NA 1NCTA 5IJKC 1RD6A 3VXMD 3BN9C 2UY6A 1W72L 1LO3L 1R24B 3SOBL 4X6DE 4M48H 1Q72H 3TM6A 3O4OB 4HUNB 5F70A 3IDNB 4EN3D 4QYOB 4WNQB 3R06A 3S36H 2DQCL 1GZPB 4NOFA 3FQUA 2ADFH 2NY6C 4LPUA 4D0BB 1Z2KA 1ORQB 1K8DB 2O5YH 3ESVF 1MCPL 3RZWA 2J12B 4IIQB 1N5AA 4V1DB 5TDPB 4OD2B 2DAVA 4WW2F 4MLSA 4LRNL 3JTSA 1WBYB 4YIQB 3C08H 5GJSH 5E8NB 1F6FB 4J1UB 4CU6A 2R2HA 2W60B 4IEFB 4MHHI 3ZTNH 2ERJC 4IDJL 4ZMAT 2XIDA 2IAMC 4LCWE 3BRFA 1DBKL 4EIZC 1ZK9A 1VEOA 4XWOD 5JLZB 1XGQA 4YAQA 2GITB 4YQXH 5FYKE 4XVJH 3P9WB 4LHJB 3SHSA 3CSYB 4N1CA 3FHAA 3F7VB 4KRPC 4AEHL 5D1XA 1AGBA 3RVUD 4JHWH 1OW0A 3QI9D 4JDZA 4UTBH 2BCKB 3HRPA 3B6SB 1S9XB 3ULUD 1A6WH 2ID5A 3S4SG 4BH8B 5K9JH 2WZPD 2GTWA 1QBML 5AUMB 1F58L 2V5SA 2RHEA 4FTVA 3SO3C 4NN5C 1IGTA 4D9LL 3E2HC 3FL7A 1Z6JT 1XF3A 5C0CE 5DHVA 3SKMB 5E5UB 1MY7A 5KW9L 4Y2DC 1YYMH 2O26U 1SMOA 2UWEE 3PL6A 1JRHL 5I6XB 2IFGA 5CUSH 3GBNL 2R9HC 1FSKC 1NCDL 3MRFA 5I9QB 4YGVA 3D2UD 3F8UB 5DTFB 1I75A 1NGQH 1U8QB 3NAAH 3LV3A 5F7NC 5GGRB 3P0VH 3EJYC 1FL5B 2EDHA 3QB7C 1XMWA 1PG7H 4ZUWA 5DVNA 4PYGA 1VKXA 3U7YL 4XTRC 4HUKB 1XCQA 3VWKA 4G8GD 4S1QH 5INCB 4I5BA 3MLWL 2R29L 4HK3N 3X13B 4DWHA 4POUB 4XPBL 1S7TB 3BP7A 3HS0A 3VA6A 4HUXB 1FNSH 3DARA 3W5NA 1MNUH 3O4LB 1DN2A 4HEPG 4FMKA 3QWRD 4WHYG 2W38A 3DVFA 4NHUA 3MRQA 3SDXF 1SEQL 2Y6SD 4K8RC 1ZLWK 1AO7B 4XXDA 3UJIL 2B5IC 2DBLH 3HTLX 4PTTA 1U3HA 3RWIB 3V6OA 1A3LH 4YHZH 4I2XB 1WEJL 3NFNA 4N8PA 3TBVA 3WFHA 3GO1H 3TO4C 1JTPA 5HGBB 1MFCH 3SJVA 5HDBF 4XNMB 1ORSB 3GJEB 1C16A 4WWKC 4JO3L 2GTZB 3PWVA 3B9EA 5CBEB 4WJ5A 5DUBB 4H1LG 4BQBA 4MXQD 5LQBL 5ANMA 5ISZE 2BHYA 2CK0H 1PKQB 3ES6A 4L1HA 4YHIA 5TE4L 3D48R 4JKPH 4M6OH 4I9WD 4DFIA 3KJ4C 1MF2H 2FEDD 4UILL 5EC1B 1J05B 5EZLA 4OLWL 1MVFA 3PF2A 5KVFH 5DD5L 5HHMB 2I24N 2AQ2A 3LN5A 4Z0XB 3KAAA 1BFOB 1U36A 3SGEH 4NRXA 1R3LA 2IANB 4JQIH 4QGTA 2A6IB 4TVPE 3QBTB 1NKRA 5FA4B 3I85A 4FS0A 2YSSB 3FCTA 3IFNH 1INDL 4K3EH 3C9NB 5AAMA 1MCLA 4WI8A 3OAZK 2V2TB 3C2SA 4AEEA 3RA7H 1A1NB 1GC1L 1S7QA 1UGNA 4P4RB 4N90E 5IW1A 3TN0A 1IGFL 2A2QT 2NYYC 5L2KB 1RZ8A 5J9PB 3ZL4L 5IVXE 4JQXC 1D5MA 1OGTB 4ZSOE 1EEQA 4Y1AA 3WFZA 5DJAA 1DBBL 4D9QE 3C5ZB 3KNBA 3ZDZF 1KCRL 2Q1EA 5T3ZD 2CLRA 3ULSA 4RNRB 5HHPB 4NC0B 2YPVH 1AJ7H 2BVTA 4JHZA 5SWQA 1FE8L 4KVNH 3OKNA 3PWPB 5C0FA 4XPTL 4NO2B 5IT2H 1UWXK 1AD0B 2JJVA 5A2KH 5T3XL 1F6AB 4ZFOA 3ZHLA 3CXHJ 3ULVF 4DKDC 3NFPA 1ITCA 1TZIA 2G2RB 2P49B 1CDCA 3RKDD 2EE3A 2NXZB 2EIZA 4MJ5A 5TDNA 1A6AB 3UTQB 5LBSL 4U7KA 5MERB 4NNPL 4XP4H 1A7NH 1A4JB 3BKMH 5EU4B 1JN6A 2V17H 3AS3A 2JB5H 4D9RD 5I1EH 4R3SB 2JCCA 3GMNA 4M6AA 3BHBB 3L3IB 2F19H 4Q0XH 1KB5H 1YC8A 3WCYA 4XCNA 1X4YA 4OFIA 3EDEA 3CX2A 3RPKA 5KS9E 3G6DH 5CJ8A 4W4OA 2OK0L 2APBA 4YJZL 3ULUH 3RP1A 1V3JA 2EDXA 2YD4A 4ZFGH 4DZBB 1MPAL 4P49A 3CFDB 2J7LA 1J1XH 3A6BH 3OF6D 2FD6L 5C0BB 1SQ2N 4BQ9A 5D9SA 1AD9A 4Q9RL 2F58L 2LE9A 1BQSA 3L95A 3RTQC 1IARB 3IDGB 3L9RA 4EUPB 3SDCD 1GHFH 5EN2A 3RVVC 2KH2B 1A6UH 1T03H 1HILB 4Z7WA 4N9GA 3IFPB 3HC0A 3V7AG 2OQJA 3MROB 5C0NC 3M17B 5GPRA 3QQ3A 4NNXB 1BD2A 5DYOA 1C5BH 3MV9D 4NJAH 5EO1B 4UOW1 1LO0L 1RIHL 3HCVB 5C09B 4EVNB 3T65B 3ZTJH 1KJ3L 3EKCA 4DZ8A 2AS5M 3BISA 2OJEB 3CD4A 3ZE0F 4G43A 1GGCH 2YPLB 1HQ4B 1QRNB 35C8L 1LK3L 1CLCA 1LILA 1EGJL 3UDWA 4WUUD 2GSIA 4LNRB 5L2JA 2NQCA 3W11C 1G9NH 4UOW0 2H6PB 3DRTB 1TNNA 1U8KB 1DSFL 3HPJA 4IRZH 2W92A 2C3HA 4WFEE 4KKBD 4KI5E 4S11A 4UTAH 4E5XB 4K23L 3WXVH 1QACA 3C87A 4NKMA 1A1MA 1HNGA 4YR6A 4NNYB 1DQLH 5BO1L 4CMHC 3SCMA 4NQED 1ZE3C 5MENB 1KC5L 2HJLB 1MQ8A 3H9SD 1FYTE 4OI9A 1P4BL 3WLWD 2IGFL 1U8IB 2F54A 4L9DA 1YY9D 4OFVA 4LDLB 3VXMA 1XZ0A 4PRPD 5IF0B 4J3TA 2KPNA 4PP2A 3CFIC 2JK5B 2JKXA 1IGIL 3QDMD 4F3FB 3FT4A 3G5YB 1FNHA 3GIVB 2WIIA 4NPYA 2OTWA 4P3CH 4ZO8A 1S7WA 3VH8G 4EN3A 3V6OE 3CPLA 4E9LA 1T2QH 3MRMB 5HGHA 1JF5A 1BBJA 1X5IA 4HEME 2W9LA 3EYFA 4JDTH 4QWWC 1E6OL 4HS8H 5F1OB 3D3VB 4NQCA 4N0YL 1TJHH 2PW1B 1R5VB 4YHOH 3KDMB 1YPZA 5DS8B 1BOYA 3I2CL 1MHPH 4S1SH 4I3RH 3WV0A 1N64L 3V2AR 5SWZE 3EJZC 5EO0B 3UTSD 4APQD 4K2UL 2YUZA 4RGND 3RVTD 4E0RB 5C9KA 3OGCB 2HWZH 2DWEA 5E6YA 3CFEB 3MJ9H 3PWJB 1RZ7H 1FFNB 2E27L 3N50A 5FCUH 4LLDA 3HMXH 1MLCB 5IGXL 2PYEE 4IRSD 3U46A 4I77L 2HA1A 1JK8B 1Q0YL 4B0MM 5JIIA 1RULL 3O3BB 1H0DB 3I75A 3MRIB 4RGOL 1KB5A 3GGWB 2D7TH 4N0FB 3T08A 1U8OA 1QVOA 1IJ9A 3O11B 5D1XC 1ZT1B 1N3NA 1OW0C 2ZWLT 4ENED 4YO0B 3MJ7B 3ZKNC 2D7OA 4HG4K 1JNNL 5CD3A 1D6EA 5C08E 3WS3A 1BOGA 2ZNXA 5IG7A 4M5ZL 4X7EC 1BWWA 1U8JB 3MUGB 2GY5A 1GOGA 1WWWX 3BKJL 1FNFA 4Y1AE 1FRGL 1X7QB 3P3YA 3QAZC 2C7UB 2FRGP 5BMFH 2E6PA 2IH3A 4PBVC 4HZLB 3PL6C 2VKXA 1Z3GH 4OT1L 5D5MA 5FHBL 3D2UA 3SKNA 3HNSH 4H5SA 5GGSB 1NAKH 3MRNA 1ZTXL 4M61A 1XF2B 5DEFA 4MXWH 1BGXH 2GHWB 3QIUD 4NP4H 4FFYH 4HAFA 5D2NE 3QIBD 1R5IB 1S9VA 4R26L 1MCJA 4ERSH 3U0WH 3GSWA 4UIMB 25C8L 3GSNH 3QZWA 3IDYB 4G8GA 2WLYA 4JANA 2XFXB 3VWKC 4HUWA 2X4PB 3HNVH 4OTXH 5E2UL 2H9GA 1A7PL 5F88B 3WL9A 3FTGA 4A6YB 1RZGB 3DBXA 3D85D 5J11C 3SKJH 2XACC 3SOBH 4IMKA 2XWBB 5CEXA 3QWRA 3K4ZA 3DGGB 4YHLL 4FG6D 1EEZA 3D0VB 3JWOC 4F15C 1WZ1H 2JJSA 4XI5C 1TCMA 5EO9B 5IESL 4FN0A 2EXYC 1WJ3A 2C3XA 1V3MA 2ZZUT 2Q86A 3SKOA 1YDPB 4Q9QL 1WUNT 3ZSSA 3KPQA 4HIEA 2DJSA 2ICEB 1MHEB 1OQXA 4X4YB 3E1F1 4Q9BA 1U3HC 1EHNA 2OZ4L 3HC3L 1BFTA 4L4TB 2UVFA 3CK0L 3VDAA 5B38A 3OKLB 4LRNH 1DEDA 5JR1L 2MTPA 4UB0H 5EOCH 3DXAB 4WDIA 3CUPA 4P48A 3JUZA 3MTRA 4U0QB 5JMRA 3KXFB 4Y88A 1AGFB 1MJ8L 4X5WA 2L4OA 2X7LA 3BSZL 1ZLVH 4RZCB 1RIVH 4JY6A 2QV2A 4YBHA 4R2GC 5A2JH 4M43L 5L8JB 3LKRB 2BVUA 3MRKB 2X1PA 1ZHBB 4RMVA 4LLYA 2YR3A 2G75A 2C3VB 3CFJB 2XQYK 3MJ9A 4QOKD 4UQ3A 5IB1B 3GI8L 2Z4QB 3HMXA 4JCMA 4NZUH 4E41B 4IM8A 2D0GA 5EH1A 4G6JL 3WUZA 3QCUL 1P2CB 2CJUL 3E6HB 3FRPA 4OFKA 2GK0B 2DM2A 4D9LH 5F3HA 4EIGB 4LOUC 1U8PA 5DHYB 4JEGB 3DROB 3RI5F 4X4MA 1X5KA 4AH2A 4P2YA 3TN0C 4H26A 5CZVH 3GBNH 4KFZC 1B4JL 1AKJA 3QHFL 1NCDH 1P4IL 4ZS7L 5E6IA 2EEAA 1YEGH 5I1AB 3UPAA 1CZ8L 4QXUH 3TBYB 2ZJSH 3P0YL 2H32B 2DLTA 4XHQA 3O81A 2UY7A 1NFDE 4G6ML 3T4YA 4HZAA 3BUYA 5H2BA 3W9DA 5E9DD 1I3GH 2CDFB 4HIXH 2JTDA 4PGEA 1S5HA 1MCWW 5FDWA 4XPBH 5L9DL 5JORB 4JFOB 5JTWA 4CN6A 5F8QC 5KG9B 1A1OA 1WWBX 4ZQKA 1G1YA 5F7LB 4WI3A 5CSGA 5IJVB 3LRSB 1BFSA 4JZNB 3AAZB 1BX2A 1MCHA 1JCKA 2AEPH 3GSNA 3TO2B 3P4OA 1OM3H 4LLWB 4TOYH 4U1KB 1ITBB 5DFTA 3SQBA 5JPNB 1B0GA 1AQKL 4U1NA 2AJ3A 4ELMB 2QSVA 4JJ5A 4FFWC 1D5BB 2CIIA 1OGAD 4M6MH 2VDQH 5CJBA 5FOBB 1D5XA 3QIWA 2W0FB 4JN2A 4W4OC 4YWGL 5HD8C 4N0CD 2NY7H 3SY0B 2LAGB 3BEWB 3OF6A 2EH7L 4OI7A 4PGZA 3VG0L 1FGNL 4YNYA 5EBLB 5C0RH 1HSAA 4TRPL 3ULUE 1DQQB 1PDKA 4HBQA 3TFKC 4ELKB 2DQDL 5F9JA 4JGUA 3SDCA 1WAAF 4G6KL 4WW1B 3X12A 5E94B 2P8LB 3SGDH 1I9RL 2XWJA 4FQHA 2VLRD 4G3YL 3MV9A 1EX0A 1U8MA 5F9DC 1H8SA 2WINB 4P9ML 3T2NL 3VXRD 5HYSA 2J5LB 4L5FH 3QG6A 5HHQA 5A3IC 1KIPA 1MJJA 1INDH 4PRNA 1OAXH 1JE6A 2YXMA 4LPCA 4PS4H 2O5ZH 1N7ML 2FECI 1NCCL 4QXTA 4L4JA 5C0EB 3PDGA 5BRZB 3I6KB 1MIML 1NAML 1P7QD 4ZDHB 4NO0D 5EUOB 1RJCA 1YEJL 3U7AA 4PJCB 3UAJD 4OZGA 4L3CA 1CI5A 2FATH 4O00A 5LAXB 4NQEA 1LE5B 1FIEA 3VWJD 2COQA 2APTA 1J0ZA 3SCMC 2CRZA 1NL0L 2AV1B 4X7SL 2I9LA 4QXWA 3HZMB 4YFEA 4X4ZA 4QRPB 2XXCB 2NW2B 1OAUH 4PRPA 4PR5A 5E00A 5T3XH 3TBWB 2J4WL 3MUZ1 4POZD 3QDMA 1CVRA 3UBXI 1DJSA 3FQNB 3NIGF 3RL1B 2B20A 1T5WA 4M3KB 3OAUH 3MRCA 2W9DL 3DUSA 3F58L 3TBSA 4MDJA 3INUL 5GSRA 2VXSL 4WY7H 5JQHC 5F96L 4PRHD 5C70A 4LLUA 3D69B 3EJJX 5AZ2L 3TCLB 3NCMA 3N1MC 1S7XA 1T1XA 3TWCH 3V0VB 5I74B 1MJUL 4OF3A 4X6CE 1IEAB 3UTSA 3MRPB 4LSSH 4APQA 3STZA 5BZWB 3OL2A 3O6FD 3V95A 4GXUM 1UH4A 1JUFA 1PZ5A 2AJVL 1MCBA 1MPAH 1O5DT 2PETA 1KPVB 5D72H 3ZTJG 4XWOC 3S97C 3UP1A 1IC7H 4XP1L 4PV9B 1JHTA 3MLRL 2F58H 2DYPB 3N9GL 3QDJD 2BOBA 5EOCJ 1NCNA 4ZAKD 3UXFA 4Z6AT 1HHIA 1D6VH 4QHKJ 3PWNB 1IQWH 1FFPB 3RVUC 4Z7QF 3IJSB 3NCBB 2X1QA 1RUQL 4FQIL 3NGBC 1WITA 3QZWG 3ULUC 4XNUL 2H41A 1RIHH 1RMFL 1YEKL 4X4ME 1OY3B 1NBVL 1LEKA 1KJ3H 4U6HA 4NQDD 1JZ4A 5CILL 5HVFB 3HE7B 4GOSA 1J1OL 1RZIA 2X89A 2VDOL 2APWA 5L7XL 35C8H 5C0IA 5T3ZE 4HT1H 5GRWA 5ETUB 4C4KO 2CDEA 2YA2A 5BVPH 1DSFH 1VADA 4U1HA 3VFOA 2HT4D 2OCFD 1G9ML 2XTJD 3FN0H 4HK0B 3CLFH 2BHZA 2ITCB 3QIUA 5C6WH 5HHNA 3TH2T 1YMHB 3QIBA 4GAJL 4EDXB 3FRUB 3I6GB 4MD0B 4K7PL 1LEIA 5C0DB 5B38G 3P2TA 2AVGA 5ITFA 1T1ZB 5FUOH 4D8PB 3QA3B 3TGXA 3DUUA 3D85A 4Z18A 5B8CB 5IQ7H 4QRRD 4MNQD 3DO7A 4WFFD 2LABA 1ZS8A 1T4KA 3V6ZA 1QBAA 4NM8L 1I9JL 1DUZB 4IMKC 1NKOA 2YD6A 5D7LB 1DQDH 5I8KL 1SY6L 4RX4D 4JO1H 1LQSR 1TQCC 4MX7A 4WFGE 3ISWA 3CDGB 4NT6B 1T04A 4XCFH 1AGCB 4HXAH 4K71B 2AABH 1A9EA 3CLEL 1MRFH 3JV4B 4RMUA 5C6TL 3ZHKA 1E6OH 1BHGA 1T6VN 4NKOB 2LU3A 4AM0B 4P2QE 4N0YH 4EOWL 2EE2A 3FRPG 4MVBD 1NPUA 2ZKHH 4GRMA 1N64H 4U1SB 1ZHLB 5AG8A 1NGZB 1MHCA 6FABL 4HUUB 5JQ6L 2R8SL 4MXQC 2DTML 3UO1H 3UPRA 1S9WB 5GRVK 3U30C 4Y19D 4PJIE 5IGXH 1OTTC 5FUCC 3ZT5A 2FEDC 4B5EA 4P46D 3VXSB 1RULH 1K3ZA 3K1DA 1ZVSB 1N5YH 2XI9A 4RGOH 1F00I 3C60A 4X6FB 4M7LT 2W0LA 1UM6H 4ODVH 4WUUE 3GEWB 2VLMD 1O0VA 1ZA6A 5T1KA 4D2NA 2IMNA 1JNNH 4OZ4A 1Q0XL 2ZPKL 4S0SD 1U2CA 1HH9A 1OLZA 4LF3A 3TC9A 3HR6A 2FEEL 1TIUA 4BFGA 5DEGA 4O2FA 1NANH 3CGTA 4NQEE 4GRWE 5CJOH 2X4RB 5E2VH 3EDDA 4ODHH 3WEXB 4XBPB 4BUGA 2VQ1A 2V5MA 4NC2B 3T4AA 3H9SE 3IDIB 3JWDL 2D4DA 5EZIL 2VZ1A 5HPOA 5E6IC 4P2RB 5CZKA 4Q6IA 1JGEA 1ZTXH 4PRPE 4M62H 4HX1A 2A1WL 1DLHB 1K4DB 3N1PC 4R26H 4XBGB 2BSRB 1RI8A 4KKLD 2FIKB 1Z5LA 3EYQD 5E9DA 1W72B 2ZUWA 1LMKA 5C8JB 1CT8B 1A6ZB 4HIHB 4ELMF 3QXDA 1N8ZB 4YDLB 1T89A 5DEZA 5EOQL 4AIXA 4QXGL 1MJ7L 4QF1A 2BC4B 3ZKMC 4H8WL 2E7HA 4G42B 4GT7A 4YHKL 3CZJA 2NY0D 4ODTL 4YBLC 5I8EB 4ZOBA 2ITDA 3RKDC 1CICA 2ARJA 4D94A 1H15A 4X98B 2H1PL 4OZHE 4JFDA 3FO9B 2GFBA 3A6CH 5DD3L 4Z5RA 4RGNE 3MRDA 4NZRH 5GRYA 3NH7L 2YK1L 5CLWA 2FJHB 3RBSA 3I84A 5ICXB 1RQ5A 4U6XB 4Q9QH 5HYSG 3PQYE 4QRSA 3PE9A 3LDBC 2P5EA 2VYRE 2DQFB 3CK0H 5IB4A 3NTCL 5C0AE 2GYSA 3L7EA 3QIWC 1M6OB 1JTTA 3L5XL 3LIZL 1GPOH 1QFWH 4LEOA 3WHE1 1T0MB 3DWTA 3LPFA 1MJ8H 1T0NB 1EJ6A 4OAWB 2PXYD 3DHMA 2NY6B 5D1QD 3SDCC 5C3LD 2NX5D 4O51A 1F6LL 4M43H 5DXWA 3OJVC 5HJ3A 4ORGB 2ATKA 5EUOF 4X99B 4LKXA 2ZG3A 3MBEA 5I18L 1CDJA 1CGVA 5F7DA 2ZOLB 3S8WA 4PJCF 3ZDYF 2Z31B 1S7SB 4QEGA 2E7CA 4N9OB 3RGVA 3VXRA 3EIFA 1QSFA 3J8F7 1JPSH 1DUYB 1JNLH 1QP1A 3GI8H 2XT1B 1ED3B 1A21A 3C09B 2KKQA 5FGCB 1MFEH 2NY3D 2Z91B 3QCUH 2CJUH 4LQ1A 1ZGLP 4ZPVB 1U93B 4DTGL 2X4UA 4PJ8A 4XP6L 3BQUD 3IXAB 4KDWA 1JJUA 3O41A 4FQXD 2E7LA 1G6RL 1JTOA 1UB6B 3D39D 4LGPB 3V4UL 4Z7OE 5EUKA 4OUOA 1KJMA 1MLBA 1B4JH 2VWEE 3DLQR 3VXOB 3HI1B 1PVHA 2DLFL 3QHFH 1EO8L 3C5JA 3H9YA 3IETA 3MJ6A 2AKRA 5JHDB 4XPHL 3I50H 1BZ7A 2B0SH 3H7BA 2CLZA 4QY8A 4MXVE 3VWJA 4NO3A 2R2EB 3B83A 1T1YA 4OSUH 1M4KA 1QA9B 2PO6D 4S2SA 1GGIH 2AJSL 3EO9L 5JIKA 4TSCL 3TNNA 1QUNA 4HF5L 1CCZA 3CVHL 3WLWC 1VPOH 4XBEH 1YY9C 3NPZB 4MWFA 4Y0GA 1I8KB 3VXUB 1JGVL 3DV4B 1KXTB 4OGAD 1KCVH 4XPAL 4PJ7A 5E5RB 3WXWL 4C56B 4ZFZA 4OCSH 1G0YR 4OF5A 1FSKB 3TYGL 1JPGB 1I1FA 2UUDH 5FM5M 2DQIL 1N26A 3LRGA 2PR4L 4G80B 3T0WA 4F80A 3QDGB 3D1MC 4PRHA 3QUZC 5DZLA 2FYYA 1C5CH 3PJSB 4NKDA 5I1GL 2Q7YA 4ZD3H 4UI2A 1ADQH 2XNAA 2BOCA 3LB6D 2PTUA 1UC6A 2EDFA 5FA3B 4GG6B 2Q3AA 2AEQL 3S4SB 5DD1L 4JM2D 1NSNL 1PGRB 1XIWB 4Z7NE 4APQC 1CDUA 4PJGA 4RGNC 5JOFB 2MOVA 1WTLA 4Y4HA 2R1XB 5ID1A 3GZKA 5ESQA 2Y72A 4ZTOL 1U6AH 1LO4L 3LMJL 1TTFA 3TT3L 3D25B 4QOKE 4CJ1A 4AIZB 1FGNH 1M71B 4HH9B 3QQ9D 4ZAKA 3PABA 4X6DB 2CR3A 3LH2L 3IVKA 5F72S 3EOTL 3MNVB 4JLRA 4CJ0A 4DVBB 4KHXH 1ZLWH 1XF5B 4FZ8H 3FO2B 1X44A 1IZJA 4R4FL 2YD8A 2Y36H 2VRAA 2OBGA 4KZDH 2FEEI 1JWSB 3RNKA 3T2NH 4Y5VA 4GW1B 5T5FL 1IAOA 2A9MH 1QLEL 4KWUA 1CU4L 4LSTL 5FYLL 3P4MB 3MMEA 1Y6NR 2I5YL 4HWNA 1L7TH 3HG1E 3QULA 4KMTL 4KTEH 3PP4H 2HLFD 3KHQA 2HT2D 1XCTA 1QQDB 1NCCH 5IV2A 1YNLL 1BFVH 4FNLL 4HQQL 4UDUB 4FP8L 3TBTB 2GJZA 1NAMH 4U33A 1I8LA 2ZOKB 3AROA 3ZKQD 4P5TA 3BW9B 2ARWA 5E9DE 32C2A 3H8NA 4BM7A 4LCWB 3PGFL 1MCFA 1F2XK 2HJFB 2X1OA 3QIUC 1LNUB 4GAGH 4Q9CA 3TPUB 1IC4H 3ARDD 3QIBC 3FB8A 5FM4A 5C92A 3EDJA 4LRIA 3JVGA 2Q8BL 1NCWL 4GLRI 1RJZA 4QRQA 1NLBL 3EYUL 3PHQA 4X7SH 3JTTB 1KLGA 15C8L 3W39B 4JFFD 3OTTA 1I7ZA 4QRRA 1IKFL 1J88A 4MNQA 3RQ3A 2ESVB 5J1AB 3OAZH 4FQQA 2J4WH 4H1LB 4XMPL 3R1GH 1U8NA 3WD5L 2FSEB 3QP3A 4RX4A 2VDNL 5DR5L 3MA9L 5C9JA 1FBIL 3C5SB 3O3DB 4OKVB 2W9DH 1OGAE 3F58H 4RFOL 5I19H 5C0CB 3Q3GA 3U9UB 3INUH 2FX7H 2VXSH 4JRYD 1IQDB 2BMKB 2UWEB 3U9PH 2DL2A 2D2OA 4JRXD 3WIIL 4GMTL 4HS6A 3MLXL 3IU3B 4NWUH 2BVPA 4PB9H 2AXJA 2BY1A 3OKOA 5IMOB 2VIRB 1OPGL 2PTTA 1UWXH 1OAQH 4J12A 3LD8C 3EOAA 3W81A 5CAYB 2X6MA 2P43B 2VLRE 4UQ2B 4Y19A 2AJVH 1GIGL 1KELL 5FKPB 3OR7A 4HWBH 3VXRE 2ICWI 43CAA 1BECA 4BJLA 3DETD 5HHVH 4C4KT 2J6EL 3MLRH 2ADGA 1FZJB 3CCHA 5I1KH 3AY4A 1K2DB 1J8HD 1IM9B 2YPKB 5KZCD 5CGTA 4P3DA 1FO0H 3MRHA 4HMDA 3SEPA 5FM8A 3C60C 2AXFA 4P59L 4FQIH 1JHKH 2H2PD 1VESA 4I0PB 5E95B 1OSZA 1TJIL 4P5MB 1WK0A 2E6QA 1MWAH 4M9OA 5KSBB 1IAKB 4MMZC 5KSAB 1NBVH 2QQLL 4TUOA 4YHYB 2DD8H 3DX8B 1IC5L 1CR9L 3E8UH 3HZYB 1A7OL 1EZVX 1B2WH 3FT3B 1N59A 5FKAA 3H3PH 1G7MB 3MV7E 3BKCH 4GW4A 2YMXL 2NY2D 3PNWA 4UINH 2A83B 3OKDA 5I76B 4HGKC 2EDWA 4QRUA 2OI9B 3QRFM 5D2LA 2VDPL 1K4CB 4IOIA 2V7NA 4BA8A 2JIXD 2KUTA 2WM0A 2EE9A 3HI5H 4U6YA 5DQDH 1OWRM 4O58L 3Q2CA 3IKCA 4YDJA 3GMRA 5ISZB 3MRJA 5F89A 2NR6D 1G9MH 3DPBA 3DVGB 5EFIB 4Q6IC 4LLMA 5HDBE 5DLML 1GVIA 2XZQL 2FJFA 3RNQB 1UFUA 1FVEB 4WO4D 2J8UA 3QCVH 3DX7A 2BERA 4UT6L 4PGCA 4ONGL 3MCG1 2R4SL 2WMPA 4MCZA 1A47A 3RVWD 2QHRH 1NAMA 4ZNEA 4NQSA 5KVDH 4FXGA 4NBZB 1AGDA 1T89C 3HLAA 3GBLA 3MOQA 1Q38A 5T33H 5CIPA 3FN3A 3ZKSD 5I8KH 1AQDA 3CDYA 1CICC 3CFCL 3H42L 5GHWL 2OX5A 3BESR 4LMQE 1FC2D 3ELAT 5EG6C 3RHWF 3S37X 4CMHB 1NMAL 4PJGE 4IS6B 1SEBA 1FL3B 1TTGA 1BM3H 3Q5TA 4PJDA 5DJ2B 2AXHA 5IVXB 5T5NF 5C6TH 4ZSOB 3VMOA 1D9KB 1KIRA 5E99H 1UB5B 4HJ0C 3U83A 1UENA 4KMQA 4PJ9D 2V2WB 5IQ9B 5IKCB 4OGYH 3A67L 2B4CH 5IW3A 4M1DL 3BOVA 3QDJE 1MCRA 2VH5L 2QSQA 1CFSA 3UTZB 1W2KT 1VGEL 3GFUA 1LO2H 4FABL 2R8SH 2P48B 3AXLB 3DI3B 3ARRA 3MR9A 4GQPH 2FIRT 4WVRA 2EC8A 1L0YA 4NQVA 1I1YB 3EBAA 4OKDA 3R06B 3Q6FA 3V4VL 2PKDA 5D1QA 2NX5A 3FQUB 3WO4B 4NQDE 1BLNB 4XNXL 5F7WC 3LEVH 1FCGA 3KPOA 3MBEC 4OLVL 1N5AB 1IKNA 3RGVC 2AJUH 1RK0B 4O5LH 5FECA 3JTSB 4OCXH 3VRIA 1T7ZA 1HIML 3EYSL 2D3VA 4P9HL 2YEZA 4Y89A 3N85H 1Q0XH 2VSDA 4HWBA 4NDMA 2ZUTA 1YEEH 2P8PA 4L4VE 5DVKA 1MELA 2XTJE 5HYJA 1Z0NA 3BQUA 4I48A 4PJ8C 4G9FA 4JKMA 1GYAA 4OJFH 2OSLA 3STLA 2E7LC 4M1GL 3FJTA 5KS9B 1WVZA 1I8IA 5ELIA 4J3WA 3ROOA 3VH8B 1CLZH 1PEZA 2P5WE 4N8CL 3AFLA 4PD4K 2LTQC 3MLUL 3UAJC 1MWAA 3C6SA 1KJ2H 2AXGB 5EZIH 3VG9C 5I1LB 4X4XA 2H45A 4MNQE 4WFFE 4GBXD 4ZUSB 5BVJB 3X11A 4KUCF 2PO6A 3VWJC 4X9FA 2GTWB 5JW5A 2VQTA 1IILE 5EZOL 4TUJB 1XGTB 4QGYA 3GI9H 3EGSB 3LKOA 3V5KA 3HC4L 1KTLB 1UWEL 1XF3B 2YRPA 3OB0K 3DOSA 1IEHA 4LL9A 5E8DL 2V2XA 1HWHB 3QHZL 4GLRH 4BUHA 3CX5K 5ACLA 3WKNA 1YJDL 2ENYA 3PL6B 1MJ7H 4HD9A 4U3XA 5LJYH 4KROD 1OLLA 3VFNA 1M05B 1S7RA 1U8LB 2J88L 3KPRE 4LEXH 1M1SA 2E8ZA 1RVFL 4AZ8A 2LVCA 3Q6GL 8CGTA 3RWJB 3U4BH 2MKWA 2W1NA 3DX6A 1IM3A 4UV7L 4X6DF 4ZUWB 2FHBA 3O3EA 4URTB 1VKXB 4Y19E 4JM2A 3ZE0E 2R0LH 3O6LH 3VXPA 3VWKB 3SGKA 5FF6A 2XTLA 1NDGB 1SJHA 1AI1H 3X3FL 5J11B 4Y4HC 1NMCC 4Z8FL 2UZIH 4X80L 2BNRD 3OKKA 1FYTB 2XKNA 2LVEA 4NQXA 4H0HB 4BZYA 4NHUB 4F15B 2EDYA 2VLME 3JSSA 2X41A 4AG4H 5EU7E 1H3XA 4RQQA 1XH3A 3VXQA 3ZDXE 4J6RL 1ACZA 1WBXB 3J7HA 4YX2H 4BH7A 4F2MA 2ED9A 4XXDB 4QT5B 2ZCLL 5E4EC 2XRAH 2O5XL 4PTTB 4NN7B 4FRWA 1KACB 3BMWA 4ZPTB 3U2SB 1I3UA 1I3RA 1C16B 3QNZA 4OCWH 4R8WH 1MCCA 4U0RB 5D2LE 3PWVB 5IVZA 4Y5VC 4EI6A 5EA0L 4DVRL 1QBLH 2BNUA 3ARXA 4DTGH 1FP5A 1XGYH 3UC0H 3VFWA 5K9OA 2WQ8A 7FABH 5JZ7D 3BO8B 5F1NA 5SWZB 5EZLB 1CFQA 4B53A 4KKCD 5E8OA 2MCG1 3LN5B 4K7FA 2DQJH 4HJGA 2HT4C 5DURD 1I8LC 3HZKB 1JZ6A 1RUPH 3ZZ1A 4MJID 4NRXB 4P5TC 2PYEB 4QO1A 3WS6C 3ARDA 4XPHH 1CD8A 2P47B 3PIQB 4KK5D 5D4QA 3BPLC 5GRZA 3QO1A 4LRIC 2UWEF 1R0AH 3JVGC 5CHNA 5C6PB 2VABB 1MQKL 3EO9H 3WFCL 1FFRA 5T1LD 4JFFA 3CVHH 5EBMA 1ZHNA 4TNWF 2HFGH 1IBGH 1QFOA 3ARED 4MB4A 4NIKB 2KQMA 1JGVH 4R9HA 2VLLB 1KEML 3TN0B 5EORH 1KJ2A 4HJJH 1RZ8B 2NW3A 4F37K 1S7UB 5KVEL 2XZAL 2YWYA 4LARL 1DQMH 2QTEA 4L3ED 3TYGH 4RISL 1TZGL 4M1CD 4Y1AB 4Z77A 2DQIH 3ULVL 5DJAB 2DMKA 4AMKH 2E9IA 3KNBB 4JRYA 4MA3B 3WLBA 1R3IL 1KBGL 1TETL 5DI8A 3V8CA 5I1GH 5SWQB 5D1ZB 4L1DA 5IHUH 3LCYA 4MD4A 5B39B 1U8HA 5BS0D 4JM4L 4MVBC 2GCYA 1OHQA 3STBA 5SX5K 3VJ6A 4X6BA 3WNPA 4XP9L 5D2NB 3BH9B 2UVEA 5MEQB 5KSBF 3C2AH 5D71L 1A3RH 2Y4SA 3GMQA 4NJ9L 5L8KB 1DLFH 1LO4H 4Y4FB 4WU7B 4MJ5B 2IF7A 2FB4L 4OLZH 3BWAA 3B9KD 1A2YB 1MIEL 4M8QB 3AY4C 4NFBA 3LH2H 3U1SH 1AO7E 1K8IA 3V6FA 3OR6A 3MREA 2SEBB 3ZT7A 2NY1D 1Q9OB 2QEJA 3KR3L 4TULL 1OP3K 4OZIE 3D39E 2R0WL 3TCXA 5EU7C 2VISB 3UJTH 1T66C 2BSTB 2IG2L 4KRLB 1F13A 3WUWA 1CFBA 1LP9A 5T5FH 2XZZA 5FHAH 4BKLA 1QLEH 1T5XA 2WIMA 1INEL 3O3AA 4OBSA 1XGRA 2VSCA 3QNYB 3IDJA 4BSVB 2BVOB 4KMTH 2Q6WA 2Y25A 5DWUH 5D9SB 3WFBH 5DJCB 3FAXA 4G7YL 4XRCA 1U92A 1UXWA 5TE7L 2ICWA 2JIXA 4HQQH 4DQOL 5I17B 5EN2B 3FMGL 1OSPH 5EU5A 3RU8H 2OQJB 3NCYP 1BJ8A 3QQ3B 4WWID 3CH1A 3MLVH 5SWSD 4WO4A 3DO3A 4D0DA 4NUGH 4JRWA 2ADJA 4HFUH 2LFGA 4KKLC 4RFNC 3TT1L 5IBLD 4HKZB 3TZVD 4POYA 1G6RA 2OR9H 3EYQC 5FYJD 4G43B 2EDBA 1JIBA 2I26N 5EZJA 3GRWL 3KPTA 1JWMA 1IKFH 1EXUB 2GSIB 1KYOK 1OT2A 5DJZA 5F97E 5GGUB 2FX8H 3BKYH 1HKFA 5IFHH 5H94A 4GXVL 1IVLA 1DL7H 1PQZB 3HPJB 5DK0A 3WD5H 1HINH 5DR5H 3FB7B 1JGLH 3DYOA 4PRBA 5GSVA 5KVGL 4NKMB 1A1MB 3D18A 4JB9L 4YR6B 2B1HH 2EKSB 1XR9A 3CVHA 3P40A 1KCLA 4PJAA 3HNTL 4IJ3B 3S98A 2N1KA 5SV3A 2PYFA 2E3VA 3MLXH 3RDTD 1YA5A 5FDYA 4PJ9A 1WZKA 2NNAA 3WO3B 4UAOB 9CGTA 1XZ0B 4RMSA 3QFJD 3UYPA 1OPGH 1ROWA 3VI3E 4LKCB 4G6FD 1A3QA 3FT4B 1NFDB 2DN7A 4DAGL 2VLKD 3K8LA 3RZCD 2OTWB 4XNQA 4PJFA 4EN3B 3IU4L 3OXRB 1KELH 3NACL 5K59E 3F12A 4KK9D 5I16B 5IW6B 2NY4D 5D1QC 3VFPA 3EYFB 4KQ3H 4AYFA 4PRIE 1ZLUK 4NYLB 1IGCH 2OLDA 1EHAA 1FYHB 1OQOA 1IKNC 3WN5B 1NFKA 1X4XA 3P4LA 3GSXB 3HAEH 3GSVB 4HV8A 3IDXL 2Q3ZA 2CD0A 1KB9K 3DIFA 2HN7A 4H20L 2DWEB 1LEGA 2WANA 1A7OH 3EHBD 4XGZA 4PJHA 4EQ2A 1KCSL 3U46B 5CEZE 2BVQA 4BELD 3QQ4A 4P2OC 4BSWA 4M7ZB 1S8DA 2X70A 3OKYA 4F8TA 5EB9A 3E6FB 1H5BA 1KB5B 2FGZA 1AR2A 3T1WA 3QUYD 3QI9B 3RIFF 1J5OL 4JFFE 3G08B 2CDGA 2C1PA 3HRZB 4GBXA 3S88H 1JF1A 1UCBH 5DLMH 2ZSVA 2HFFB 5CD3B 2PO6C 2XZQH 4GKNA 4PGDA 3BDBA 4N1EA 2R1YB 3TPKA 4ONGH 2VL4A 3NPSC 4FZEL 1FDLH 3X3GL 4NKIH 2A73B 5DJ8A 4JRYE 4KI5F 4FOMA 5DJ6B 4OGAC 2RQ8A 5F7KC 1LE9A 1RK1A 4HHAA 2QQKL 4LU5L 5CP7B 5DJXA 4JRXE 5DMKA 3VXNB 3CFKA 3R8BB 1FFOA 1WAAE 2G9HB 3IJYB 1G9MC 2YBRB 1FNEA 5C07D 4EQ3A 5JOPD 3D2UB 3SKNB 4H5SB 3MRNB 1FNGA 4M61B 4ZUVA 1A5FH 1KCUH 1RUAH 1HDMB 5J6HA 1NMAH 1CFVL 1H8NA 5JXAH 5D93C 3MV01 5J12B 1I7RB 4WI2A 4UT9L 4Q2ZA 4RAUA 1GAFL 2XQBH 4JM2C 4KY1L 3BPCA 4JANB 1SM3L 3SGKC 3MA7B 4KGLA 2H9GB 3FTGB 1SVZA 3P9MB 5IIEB 2JELH 3DURB 1J8HE 5AZEL 5C2BL 4LSDA 5CEXB 2WWKO 3G04A 2BNRA 4FABH 2EEBA 3CMOL 4CN1A 1TQCB 3UYRL 4JPIA 1OB1A 3SN6N 4K94L 3QQ9C 3V4VH 3KPNA 1NCUA 4U1IB 4XNXH 4BFIB 3HE6D 4I3SL 3KPQB 4HIEB 2B4CC 3O2VH 4K3DH 2FBJL 4WHDA 5D96B 2ZCKH 3KYOA 1EAPA 1NMBL 5F8RC 5B38B 1T7VA 3QFDA 2IJ0C 5GS1B 1FJ1A 1HIMH 3NIGE 1UA6L 2YHGA 4KAQL 4GRLD 4IRJD 2CSPA 5I8OH 1OTSD 3LPWA 3U30B 3OAYK 2HLFC 2EDJA 1CLOH 4PJ5A 4X5WB 5T1DH 4X6CB 3KHOA 5DQ9B 2X7LB 1MFNA 4F8QA 4JY6B 1FNLA 3O2WL 3AUVA 4FXKA 3DMMA 4J4PA 2Z93A 1MAMH 3QXAB 2BXZA 4N8CH 1HNFA 1HHJB 3MLUH 3U0PA 4LLQA 3B9DA 4XCYA 1UCTA 3KPPB 5CEYB 1F3DH 3ARDC 3CFBA 4CN4A 3BXNA 2GJ6D 3FHQA 5JUEL 5LGKA 1G7IB 2EKJA 2HMIC 1OCWL 1Q94B 2DQTL 3NFSH 4MJ6A 3JZ7A 3AREA 3QISA 4MDIA 3KLAA 1KTRL 3HB3D 4DN4L 4H26B 3JWDC 1B0RB 1PKOA 3MRLA 3TF7C 1VHPA 1F90L 3O6KL 3TYFB 5DJDB 1KIQB 4L3EA 4Z7QE 2J88H 4DEPC 1HXYA 2NZIA 1RVFH 1UEMA 4O02L 3MACL 4KI1A 4CKVX 5BS0A 1NJ9B 3T4YB 2ZUXA 3PGCA 3WUWG 1Z9SA 5JOEA 5HHOD 4PJFE 3W9DB 2FJGA 4KRPD 1QEWA 2JCCF 3BGFC 3QJFA 4MA7H 2HRPH 3KLHD 3AU1A 1NH6A 1MCOL 4V1DD 1S5HB 2HFEA 3X3FH 1JGUL 1NC4D 2R1WB 4YBLB 1BIIA 3CU7A 1A1OB 1YMMD 4JFHD 3AB0C 2IPUK 4PJEA 4QRTA 5DRNB 3O2DH 4NKQB 3GSNB 2R23A 3NZHH 3P4OB 3BDXA 4Y2DD 4YHML 1EJOH 4EI5A 1K9TA 1RAMA 2X4SA 1RHHA 1J8KA 4U1NB 3UX9B 2AJ3B 1TVHA 4Y5XA 4L8DA 2W0PA 2CIIB 4PJHE 4Z7WF 2H2PC 4WW2A 2DWDB 4JFXB 3RFZC 1AIFA 1FN4B 1PD6A 2HP4A 1RJYB 3O3UN 4GJTB 2EDOA 1FORL 4JN2B 4LNVA 4KUCD 1T0PB 1K3IA 4UBDC 3CC5B 3EJYD 4P2QB 4IDLA 3MOBL 3SE4A 4ZG1A 2WBJD 3VU2A 2MQ0A 4XPFH 1KFAH 2MQ3A 1HSAB 2Y7QA 5D8JH 2YKLL 2WV3A 1UH2A 4GAFB 2LU7A 5D70L 1OARL 3LQAH 1UACH 3EOBA 2XQYG 5A16A 4J8RB 3GB7A 3WNNA 3KLSA 4UDTA 3VCLB 3KPMA 2XWJB 1T21A 4TTDC 1RUML 4X9IA 4PJIB 3ILQC 4F33A 5SWSA 2VITA 1KF9B 2Z92A 4V2BA 1IAII 4X5XB 1ONQA 4MAYB 4WO4C 5HYSB 4KDTA 1GZQA 3QG6B 3TZVA 5HHQB 4HIIB 4XZUB 1MJJB 5FUZH 1C08A 5E7BA 5KANG 4PRNB 2AJYH 4FQLL 2PCPB 3M1BA 1HEZA 3C6LD 5J7CC 4QXTB 4WUUB 4F9LA 5DSCB 5DQJA 3PWUA 1DVFA 2OJZH 3TO4D 3WE6A 2MHAA 1E4XH 3DECA 2X4QA 4WWKD 5HDQL 3GMOA 1DDHA 2XZAH 5JDSB 1U58A 4AK1A 1TZGH 3GKWL 4JG1H 4GQ9H 1TETH 4HUVA 1KNOA 3HPLA 1JL8A 4NQEB 3BDYH 4GRWB 5HVHB 1QLFA 1C7SA 1VFBB 1G1CA 4LSPL 3RDTA 1INQA 4RIRB 3H9SB 3MRBB 4UNTA 4PJ9C 5LGHL 1QR4A 2DQEH 4CAGA 3QFJA 4PRPB 5E00B 3TIDB 2IFFL 4PLOB 1YPZF 4LVOC 2VLKA 1F4XH 3RZCA 5TF1L 2VDML 5D71H 3DUSB 5IHLB 4JFPA 3TNMB 2G5BA 2X4NA 4JCLA 4NJ9H 5CGYC 4MDJB 5D7JA 3TBSB 5GS0L 2R4RL 2IBGA 1YEHH 5F6HI 1P4LB 4OQTL 3ETBF 4CVUA 5E1HB 2CKNA 2NTFA 1F4YH 2PW2B 3I9GL 3KS0H 4H25B 1JZ8A 1T1XB 1JNHA 3MCKA 4RGMB 5F9OH 3RVXC 1HHHA 2Q20A 1V7NL 5IB5B 1CF8L 3ULUF 4APQB 3EYVA 1QPXA 4GAYB 4RGNB 5AWNL 2F53D 2IAND 1AXSA 2IG2H 3FFDA 1QG3A 1DFBL 1JGDA 4MJIE 2QBWA 3O2DA 1PZ5B 1OVZA 3PQYB 3Q5OA 1INEH 4NUJB 4KVCH 4IRSB 5GJTH 1MUJA 4KPHL 1QR1A 5ALCL 2IQAB 1P84K 5C0AB 4LBEA 4OCMC 3OXSA 1AXTL 4GKOA 1H5BC 4OIBA 1HHIB 5L2KD 4M7KH 3FMGH 5L0QB 4A6YL 5D5MF 3NMEA 2DS4A 4UV4L 3CXDL 3W0WD 5HGAA 3HUJA 3ARBD 4EXPX 1T20A 4GBXC 3VFTB 1OD7A 3L3OB 1C12A 3C5ZD 1KPUB 2PNDA 4OB5L 2FH8A 3G5XB 1AGEA 3P77A 2B1AL 2IH1A 5DD0H 5ITBL 4NCDA 3VFUA 1FC1A 4U1GC 3RAJH 1EPFA 3U4AA 1WC7A 1Q9KA 5C07A 3OKMA 1AFVL 5BV7H 2I07B 1NCBL 3VFOB 4GXVH 3WFEL 2D31B 3KPSD 3FQXA 5HHNB 5JW4M 5KVGH 3U7WL 4JB9H 3QIBB 2C26A 4OFDA 1MCDA 1LEIB 4DGYL 1WIOA 4LCUA 2DQGH 1KPRB 4EKXA 1N0LA 2EIBA 4PLJC 3RVVD 4YPGB 4UUJA 5ITFB 3IYLW 4PJEE 3DUUB 3D85B 1TTUA 1MHHB 3V6ZB 3FQTB 5D7SH 3K46A 3I3DA 1HYSC 5E08H 4FQJL 4QNPE 4DAGH 3NN8B 5I15L 4LPXA 2WW8A 1ZWIA 2XWTA 3HAEG 4OCLC 3IU4H 4OF0A 3KLDA 3K4AA 5HDLA 5BXFA 3EZ8A 2VDKL 3SDYL 1UWGL 1J87A 3HE6A 4WEUD 4K7PX 3IJHA 3V5HA 3QWOB 2EH8L 5L88H 1NGPH 2R56L 3W2DH 5ECJE 1IL1A 2UYLB 2P46B 1CXIA 4F7CA 4ZXBD 43C9A 2FLRT 1L4IA 3MOAL 3IDXH 3QEGH 1FIGH 3IAGC 4IRJA 1N6VA 3LD8B 1PSKL 3MNWA 1F11A 3QEUA 2QKIB 4MQ7A 3QEQD 4WEBL 5SWSE 4CNIB 3HN3A 1XGPB 4KKCC 3WNOA 1A7RL 4J4PC 3DMMC 1HHKA 2Y06H 3VGAB 4JPKL 3QH3A 3JUYA 5FYJE 3VXTB 4HCRH 2YD2A 4JQVA 4BZ1H 4QOKB 5JNYB 5I1CL 4KK5C 1SJXA 2GJ6A 4YK4C 4Z7VA 4OV5A 3OGOE 1ERNA 2I60H 3SQOH 4Z76A 3H6JA 4OZ4B 4XCCH 3IKKA 1MRDH 2Y9RT 3ET9F 5ESVB 4DKFL 3FQWA 1HH9B 4MNGA 4DGIL 5IFAL 1RY7B 3MO1B 3AGVA 4ZYKB 1IAIH 3AREC 1PLGH 3MV8A 2Z35B 3NZ8B 1U3YA 3RX7A 4HH8A 2WP3O 1DE4A 2QQKH 3V9FA 1R24A 5LWYL 3K2UH 1EHXA 1KENL 3T4AB 4G9DB 2DM3A 3HG1B 3G5VB 4RAHA 1EVTC 3BZ4B 3M8OH 4HK3J 4N5EC 3QFJE 4QYOA 2ORBL 3MGAA 4WNQA 3EOYG 5J8OA 3CAFA 5ALBL 1G9EA 2VLKE 1CFVH 3BPNC 3VFGL 3V52L 4PUBL 3MLPA 2DICA 1Z5LB 2M1KA 2HKHL 4UT9H 5E9DB 1ORQA 1IFHH 4V1DA 4OD2A 4OCRL 3CDFA 4QF1B 2DQUL 1NC4A 2W91A 4ODSL 1WBYA 1CXFA 4YIQA 4JPVL 1EBAA 4L8CB 3NABL 5E8NA 2ADIB 5C2BH 4MJ2A 2W60A 1J86A 1NLDH 1YMMA 4NFCA 4EDWL 3BAEL 5D7LE 4FTVD 4WGWB 2FDBP 3R0MA 5HI5D 2GFBB 4LASH 1Y0LB 2F5BH 4Y2DA 1G7HA 1H3PL 5I1IH 1UJTA 1EA9C 4EI5C 1WF5A 3JBG7 3CSYA 4I3SH 4Q58C 3F7VA 4UU9A 4TQEH 2NY1C 1OGAB 4QRSB 3T04D 3IS1X 4RRPA 3L3JB 4Y5XC 3V4PL 4WW2C 3F5WB 1CTOA 4N8VB 2BCKA 4PJIF 4YFLF 3WJLA 3B6SA 3WSQH 1S9XA 5IB4B 5IBUB 3S35L 3L7EB 1ACYH 3P11H 1T22B 3KS0J 3TESA 1BREA 3GK8H 5GGRY 2WBJA 3LZFL 1DBAL 4O2EA 5LCVL 5JIHA 2AK1L 3SE4C 5EWIL 3HUJE 1PX3A 3SKMA 5TH2A 4LAQH 4PY8I 4YXKL 4PGBA 2W65B 3KYKH 5F71A 4O51B 2RB8A 5HJ3B 2ATKB 2VLRB 3FO1A 4MD5B 4GSDL 2DDQH 4C83B 4XP5L 5DTFA 3S6CA 3LQZB 4OZGF 2BJMH 3VXRB 4M93C 1QNZL 4XI5D 3FZUD 1VFAB 1TQBC 2Q76A 5GGRA 5JOPE 2RCSL 3JV5A 2X1XR 1FL5A 4KDTC 5JUEH 5IBLC 2QSCH 3TZVC 1FCCA 5F9WB 2X4UB 3C6LA 4FHBD 2DQTH 1FV1B 1OAYL 1PEWA 3O41B 2C5DC 3MSPA 1U3HD 2VO5A 3BPOC 4F9LC 3MLZL 5FFLA 5INCA 1P7QB 4HCRA 4JGMA 1DVFC 4WWKA 4NO0B 3X13A 3SJVD 2Y5EA 2WWMD 3W5MA 3DNKA 3UZVB 3W9EA 1KJMB 1MLBB 1I7TA 3O4LA 3WDIA 4ZTPH 4A2MA 3EO1B 3IETB 3MV7B 5BOPA 2NY5H 4UMGA 3VE0B 4QY8B 4OGXL 3ARTA 3ALWA 4XCEB 3VWJB 4XC3L 1MREL 3IAPA 1T1YB 1QO3B 2EDTA 5F93C 1TPXC