1Z9OA

1.9 angstrom crystal structure of the rat vap-a msp homology domain in complex with the rat orp1 ffat motif
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
119
Chain Sequence
EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVWKEAKPDELMDSKLRCVFEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of FFAT motif-mediated ER targeting
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding/lipid binding protein
molecule keywords Vesicle-associated membrane protein-associated protein A
total genus 20
structure length 119
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z9oA00
4FFYH 4TTDC 1GOGA 3RVWD 4PGDA 1Q1JL 1IGTB 2BSRA 3BEVB 5A2KH 3MXVL 1CLOH 3WJJC 4NWTL 4FQQB 1FQ9C 1DUYB 1S9XB 1L4IA 4XH2A 4IRJD 1INEL 5GGTH 5IVZA 3H9HA 4XP6H 3G5VB 1HHJB 4ZD3H 4O2FB 1F2QA 1MCCA 4G8FA 5LAXB 3GUTB 3LQAH 3DSFH 3FMGH 3ZKMD 2YK1H 2DLEA 1P2CA 2P4AB 4PV8B 4PRID 4R9HA 5IG7B 3V4UH 3QZWB 1UCBH 3DUUA 4P23C 2DQDH 4NRYA 2K3TA 4OKVB 1GZPA 5D7KE 1N7ML 1P7QA 3QXDA 2H32A 3SGDH 2W59A 2OS7A 1RV6X 2OJZL 1EPFA 4YX2L 5FO7B 4NQUA 4M5ZL 1AI1H 3SGDI 3DBXA 1QR1A 3MRBA 5B38B 3MYJB 3DO7B 2QL1A 1QEWB 1NANI 3BP7B 2CLVA 2FNBA 4OAWA 3PGCB 2CUIA 4GW4B 5MHSD 1E4JA 4JM2F 2EXWC 4XBPA 4RAVA 1Q9KB 3D85B 4RMQA 1I7UB 4PJ9B 4QOKA 1QBMH 3ZKMC 3ZMRA 1FL3A 1FVDB 1W72A 3C9NA 1ZMYA 4J23A 4R96A 2YBRA 4NO0D 3NIFE 1GC1L 5E9DE 3HRPA 4DKFL 1U8MA 1XIWD 3VMOA 3WLWD 1KB9J 4OI7A 4ZD3L 1AKJB 4JPVH 5DUBA 2OXGA 3MOAL 1EEYA 2GTZA 1G9ML 3NIDE 3WHXA 5IVXB 2ICWA 2JIXA 4ZNCD 2FD6H 1UM6H 4H1LH 2F74B 1QZ1A 3OB0K 2OZ4A 4P59L 4J3UA 2WANA 4YDLB 4CNIA 4Z76B 4QNPE 4POZD 1NMCB 3I6GA 4JFDA 3CDGB 2UYLA 5DJCB 4ONFH 1I7RB 4NQEA 2XYCA 1PQZA 4PG9B 4R2GB 5D5ME 4OQ1A 1I3GH 1KGCE 2Q3AA 2VAJA 3BWAB 3WYRA 4F7MA 4NNPH 3RKDD 1JFQL 5A1AA 3IFNL 1T22A 3SCMB 3T2NH 2FCBA 5B3JF 5I71B 3KHOA 3REVA 3QP3A 5KZCD 3IJSA 1IKFL 1DEEA 4PJIA 2W9EL 5AYQA 1S9YA 4MSWB 4UILH 1Q9OA 3KYKH 3HR5A 4QYOA 3UJJL 2NXZB 4M4PA 5TE4H 1YEDB 1JHKH 4ETQA 3GJFH 2GJZA 3OAYK 5CEXB 3MLXL 1VGEL 5I6XC 5E94A 2V7HB 4MVBD 4OLZH 2XPGA 4FQPA 2ERJC 1H3VA 4Z0BL 4LLYB 1QLFB 4K3GA 3ARFD 4N8PA 5CFHA 2J2ZA 3QSKB 4M93B 4G42A 2X4RA 4YHPB 5I8CA 4P2RE 4PRHD 5F71A 5ILTH 3PDOB 2VLJE 3MRHB 1X6NA 3BSZH 4LCWB 1GYAA 1CDJA 1WBXA 32C2B 3HS0B 4D9QD 2GITA 3NPSC 5HVGB 2XFXB 4FFVD 1CG9A 3H9YA 5E6IB 5BS0E 5JW4R 2VLJD 4ODHL 3QIUB 3WNLA 5I76A 2HVKB 5IW1A 5HGAB 1ZVSA 4C56B 4JREC 3BO8B 2VR4A 4DZ8B 2OK0H 1EHNA 1U91A 2Y07H 4YDVB 5FYJU 1OGAE 1ZA3A 1OF2B 1A7PH 4M48H 3D69A 4PYHA 5DMGC 4C83A 4R26H 2F53D 2LU7A 4JR9L 1S5HA 2ZNXA 3U7YH 1YYMH 1OGAD 1RZ8B 4FQCL 1HOCA 1KYOJ 5D7IA 4LLUB 5I1CH 4PJCA 3O4OC 5FHBH 1PY4A 5E2VL 4MNQD 1CQKA 4NFDA 4U1KB 3WFBH 3FQXB 1AR1C 1XFPA 3LB6D 3MUHL 1MFAH 5ELIA 3QG6A 1OAQH 4YAQB 4NQDA 5FB8A 2V2WB 2XZAH 4MNQE 4EOWH 1G7HB 2HJKA 3S36X 1CFSB 4PRHE 1DN0A 2ZSWB 1KCKA 1FE8L 5IEKB 1HEZA 1RJLB 2N7BA 1ITCA 4I8DA 2EXWD 5A40E 1V7NL 4MA3A 4QOKE 2FLBT 1HZHL 3C8HA 4PJXB 5DJ2B 5JO5A 2X4UB 4M61B 3DECA 2IH3B 5FDYA 1A7RH 3DTXA 5D7LA 3EYUL 5E5MB 2XG5A 3UAJD 3BH9B 4FFZL 2DOCA 3JWNC 3T4YB 4UTBH 4UZGA 1Q9LB 3VFWB 2GCYA 3L3IA 3MRJB 3UDWC 4YHMH 3GMQB 2R23B 3TBVA 5IQ7H 4HK3J 3HPJA 5IB4B 4Z95L 1TJGH 3X14A 1MI5E 2R2EB 1MCKA 4JFFD 4PY7B 3IDJA 4LPVA 3H0TB 3QZWG 3LIZL 3VG9B 4U0QB 3DGGB 4LQ1A 3U9PL 2HKFL 5JIKA 4UOW0 1AGCA 4BFGA 5F7HA 1YY8A 2BNRD 2VLRA 4GBXC 3RL2A 3KYMB 4HXAH 3AFLA 1VCAA 5D2NE 4M62L 5MI0B 1FBIH 5JHLL 1J8HB 4J4PA 5IIEA 3AU1A 4P46D 4NZRH 1B0RA 2V7NB 2WWKT 3VFUB 2VZUA 3TPKA 2YSSA 2I60H 5CJ5A 4L1DA 2DI7A 1FRGL 1T1XB 4L4VA 1OVZA 3WL9B 4PGEA 4EBQH 1NCCH 2AK4A 5INCA 3FRUA 2WUCL 4L8SA 5F1KC 1C12A 4TSAL 3ECBB 3C6LC 3NFNB 3HC3H 2ADGA 1T03L 4IOIB 3I02A 3KPRD 5ESAB 1FCCA 1L6ZA 4UTBL 3TZVA 5TQ0H 1BOYA 3ZE2E 3HUJB 5D2LB 3C5SB 5DD6B 1JI2A 2E9WA 3EOYG 4D9LL 4I0PD 4YC2B 4OFDA 1FFPB 3U9UB 4TPRL 4PJ8A 1GRWA 4JFFA 5C08B 3MJ7A 2QQLL 4LSQH 2WNGA 3BWAA 3D2UB 5FO9B 4GUPA 1CR9L 3ARXA 3QDMA 3STBA 2XZCH 1TZHB 1T0PB 3ABZA 4WWKA 2DQTH 5IB2B 5DJ8B 4K7PL 2H2PC 4ZOAA 4ZMAT 1DLFH 3DX6B 5DVOA 3RGVC 3B5GA 3U48A 1FZOA 2HWZH 4X6CF 5E08H 2CIKB 1P5UA 4L1HA 3OKDA 4UT6L 2PXYB 4PRPB 3G6DH 1BPVA 3PP3K 5EPMB 2P5WB 1LO5A 4KI5D 2K9UA 3SE3A 3LQZA 4LDLB 4HGKC 5CLTA 1TJGL 4DKEH 2D4FA 3QXAA 2CXGA 3ARBD 4XPGH 2VRAA 5C0BB 4U1SA 5MENA 2EDYA 3FB7B 4M43L 4PJEF 4NCC1 3HRZA 5T1KB 2Q76A 5J13B 2YC1A 2Z35B 3H2WA 2YUVA 4K7PX 3VGBA 1IGIL 3K80A 3C08H 2Q8AH 3QFJB 3FN0L 2P47B 3N1PC 2B39A 5E8OA 3S37X 3ILPB 1JHLL 1MEXH 4JZJA 1Q8MA 2EC9T 1A7RL 4AJ0A 4Q97A 3WN5C 32C2A 1DQMH 5MP6H 1A47A 4JQXC 5I1AA 1SEQL 3AAZA 4TRPH 4Z7NE 2BK8A 3TNMA 1ORSB 3HI5H 1S7SB 4N5UA 3QIWA 1UXSA 3SE9L 4UINH 4M3KB 5KTEH 4XRCA 3VG0L 4CL7A 4PJHE 4XPTL 1XR9B 1JZ7A 5FGCB 3V2AR 4JKPH 2ORBH 4Z9KB 3GJFK 1F02I 5J6HA 2HLAB 4K9EC 4Y7MA 1CD8A 1CGSL 4ENEC 1IAIL 2LABA 3QNYB 3DI3B 2A38A 3NCYS 4NWUH 2AK4D 5BJTB 1N5AB 4JM2C 1A4JB 4LLMA 3GHBH 3TA3C 3QUZD 3RDTC 5HYJA 2Z92B 3QHZH 1A6WH 3I50H 4RSVA 4ZODA 1I4FA 1Q0XH 4IS6B 4FFWC 5IT2L 4P2QB 4ODXA 4R26L 2COQA 4L4VE 4KK8C 1N0LA 1ZGLA 2CDGB 1JTOA 4ZUWB 3RVTC 2NXYD 2J88L 1A0QL 4ZAKB 5C0EA 1ZK9A 4LPYA 4R0LC 2HJKB 4HH9B 4KJQC 4MAYC 1U8PB 3QWOB 1BFOA 5FYJH 3KLDA 3WNMA 1OHQA 3IFNH 5DZNA 2ZCHH 1QBBA 4R7NA 4NNPL 1Q94B 1OPGL 3WIFB 4Y5YC 4X6EA 2Y7QA 2OXHA 4OTXH 3B43A 3U2SA 3SEPA 3TM6A 3NPZB 4LIQE 3CPLA 1CD1A 1AHWB 1ZOXA 3CCHB 3DRTA 2BNQE 2I27N 3MLUL 4HFUL 3QQ4B 3VXNA 4AQ1B 2R0ZH 2YEZB 2E7LC 4PJDE 1KCLA 3OHXB 4K2UH 1NUGA 1M7DA 3MV9D 4WDIA 4X9BA 2OM5A 3O41B 2BNRA 5C0CA 4G9DB 1LP9E 3O6FA 1FFQA 2Q87A 1P9MC 3MV9B 3FCTB 3S96A 2NXZD 4BZYA 4GAGH 1A6TB 4EUPB 4ALAH 4Q9CA 4PLOB 4XXCA 5LGHH 3TFKC 1JNHB 2CR3A 4NO2A 4C4KO 4BZ2L 4IIQC 2XTJE 3U82B 4GG8A 5HHMB 3QUYA 1IEBA 4OBRA 2R39A 1K3ZA 3JUZA 1NANH 3OZ9H 3ZE0E 3CAFA 1U8QA 1Y0LA 1X9QA 1A6ZA 5FUOL 2R4RH 5HD8D 3FOMA 3WIIH 1FYTB 4XAKE 1OP3H 3WJJA 5FCUL 1CQYA 2XKSA 4H0IA 5IVZB 3VU2A 3HUJA 5D2LA 3V4UL 2QBWA 3NGBB 4FZ8L 4AT6A 2BHUA 4HMCA 3SCMC 3GUTA 4K8RD 1MUJA 4RMWA 4EN3C 5I19H 2BRRL 2IPTH 4MD0B 4L4VD 4KRPD 3BZ4B 4U1IB 1QBML 2PKDA 2GEEA 1X4XA 3FFCE 3VE0A 4NKIL 1NH6A 1LO4H 1Z9MA 1YNKH 5EZIL 1IT9H 1JNLH 4Y5XA 5C8JB 5IUSA 2YOCA 3GSXB 2YA1A 5H2BB 3VWKA 5SWQA 3RWGA 4P2OC 3STLB 4WEBH 3OKDB 2HLFC 5SWSA 2VZOA 1N3NA 4NOBA 4PRPA 4G6FD 5F70A 5A2FA 1OPGH 1MQKL 4EZMA 3LY6A 3P4MB 5HDLA 4XAWL 4F15C 3MYZA 4M7ZB 2CH8A 1QLRA 1KTLA 2IAND 4I5BB 3PL6B 4RGNE 2X4PB 5DS8A 1RY7B 2YC1B 3ARPA 1F3DJ 3SJVB 1G9MC 5BMFL 4GXUM 4MGXA 3L3KA 5FV2A 2PO6B 4NPYA 1JIBA 5GJSH 4GT7A 4RA3A 1MH5A 5DJYB 2PTUA 3W5NA 1F6AA 2IANE 1RUPH 2XG4A 4Y1AB 3W9DA 1KFAL 4JFPA 1I8IB 1NJ9A 4AYFA 1PZUB 4DQOL 1PZ5A 3ARVA 1JNNH 5EO1A 3VXRA 3FQTA 1G84A 4X9GA 3A6CH 4A6YA 1G0XA 4CRPA 3P9LB 2F74A 3QQNA 1JPSL 5L8LB 5D72H 4J8RB 4KRNA 4JM2D 2ZOLA 3G5YB 4KTEH 2NY0D 3JZ7A 2HT4D 4X7TA 1NSNL 3BQUA 5T5NF 3MJ6A 4PLNC 4EIZC 2FJFB 4WFEE 4L5FH 1L7TH 1S8DA 2YN3A 4DTGH 1HCFX 1HSAB 3NZ8A 1UZ8B 3ARDC 4Y8DC 5KTEL 1QA9A 3P4NA 1QUNA 3S98A 5FOJA 5TGBB 5DT1H 4GKSA 3RWIB 1LDPL 4WI4A 3C60C 4ISVB 1YEEL 3VD9A 1MNUH 1XT5A 2AXJA 4Q6IB 2I25N 4IS6A 3QUZA 3GSVB 5I18L 3TIEA 1EUTA 4Z77B 1H0DB 3CZFA 2FX9H 5E99L 3REWA 5A16B 4LASH 1IGYB 3VGAB 1PVHA 4RDQG 4KMLB 1BBDH 1QPPA 3I50L 5C6WH 5EU7E 5D1XA 4OLEA 5IB3A 2F5BL 4Q9BA 4AENB 2BX5A 1M6OA 2IQ9L 4BQ6A 3FO0L 2IC2A 4YHZL 3LQMA 5HYQB 1C5DA 1PFCA 4XI5D 4FQ1H 5JMOC 3QA3A 3DVGA 4IRZH 3PP3H 5AYUH 1FO0A 4MJ6B 2FSEB 4S1DC 1QNZH 5LQBL 3V8OA 4MQSB 1ZHNB 2O61B 1EFXB 5C0RH 4DW2H 4FFWD 2J8UE 4NHUA 2F54D 3MGAA 5TH2A 3D87B 3JVGC 2O5XH 4WY7H 5DO2C 4IHOA 2YD8A 1NGQH 3RA7H 4HUKB 5AZEH 1UWGH 4L3AA 1DQML 5B39G 3MNVB 3QO1A 3EYOB 4TQEL 1UQSA 1G7LB 3L5IA 2G9HB 3BRGC 3OKMB 3SDAD 3V4VH 3V5HB 3MV8B 4YE4L 4LCCA 3HNVL 4HSQA 5F96L 4JDVA 5HVFB 4XPGL 3SGEI 5SX5K 3V0VA 3MOQA 2I60L 1TCRA 1Y6NR 1FNEB 3HI6L 3TYFB 4TULL 3LN9A 3K8MA 3PV6A 1NGYA 2VN7A 3BIAX 2XRAL 1XH3A 5K9KB 4X6FA 3QUMH 3VFPA 3MR9A 2BXZA 4BYHA 1CFSA 2D7OA 2HRPL 3BXNB 5I17A 1G7PA 3PWVA 3LH2L 2YHGA 3ULUH 5IFHL 5EU4A 3QIBB 3CDCA 4Y16B 4PG2A 1MIEL 3WBDA 1LVEA 1EO5A 4PRAA 43C9A 5C0NC 3HE7B 3S35L 3K4AA 4D0DB 4YDKH 5JA9A 5IMMB 1NEZG 4JFYB 4IRSA 4ZXBB 3C2SA 5JZ7C 4G7VL 1U8NA 1MCHA 3UPRB 1RJCA 3IFPB 2OTUA 3WDIA 1LE5A 4HPOH 5T1MA 2BNUA 1RJYB 1IRAY 4OZGA 3KPMA 3I6GB 1ORQB 4YC2C 5B22A 2QR0A 1HHHB 5CEYA 5GISH 5D4QA 2HT4C 4R6UA 2PO6C 1I75A 1PLGL 1KTKE 3SHSA 5D5MA 5IK3A 5TQ2L 5SWZD 5DRNB 4P4KA 4HXAL 1NLBH 4HBCH 1MY7A 3IJSB 4L8DB 1JHTB 3W2DL 3GI8H 5DS8B 4YZFF 5TQ2H 1INDL 3GMMB 5KW9L 3BWUC 4XGZA 1QTYT 4J4PC 2VE6B 2Z31B 3E1F1 3KPRA 4OF3A 3M07A 1GIGL 2APFA 1F3JB 4GMSL 4K7FA 4LHUG 3WUWG 4WHYH 3CFCL 3H42L 1BJ8A 3G04A 5ACZA 4S1QL 3U36A 1OWWA 4TVPL 2VR5A 4P48A 1PG7X 1AGFB 2E6JA 3RUGB 1HXYB 1E4XL 1HCVA 4XVSH 4OGAD 2NW2A 3C6LA 2OR8A 2RAMA 5FK9B 1WQVT 2Y1VA 5BOZG 5C07E 3OKEA 1E6JH 2X4RB 4IOIA 4YHPA 4HJJL 1A3RL 4Z7VA 3OB0H 5BQ7B 2R2BB 5DD1L 5FECB 5HI5D 5IQ9A 1EEZB 4LLAA 2Y07L 1KB5B 3MJ9H 1VEPA 4QRTA 1EZVX 5CD3A 1U2CA 3HAEB 1TQCC 4NZDA 1MVUB 5ADPL 5BO1L 1AXTL 4D9QE 2Z93B 2WIMA 4J1UA 2H1PL 3MROA 3RWIA 1RFDH 1FFNB 4E5XA 2UUDK 3RY6A 3OJMB 4D8PA 5DRZB 3SOBH 2B20A 3W9EA 1A02N 2HYMA 2KPNA 4YHNA 4LCYB 4X5WA 3HI6H 1R3JB 5LXGH 1IGYA 3WFBL 1XGUA 3O9WD 3VGFA 5ADOH 3DUHA 3MUY1 4QXWA 5JPMB 3HB3D 2EEAA 3CH8A 5EZJA 4PJCB 4NKDB 3U0PA 1HYRC 4JR9H 5DQJB 5EZOL 3EZ8A 3M1BA 5DHYB 1T5XA 2BOCA 4Y4KA 3QIBD 3L3GA 2EKSB 3TBSB 2C4XA 2VLJA 1IC1A 4U1JB 3UBXG 3MNWB 5HYQA 1DBAL 2V2WA 1E6OL 5DD3H 5JQ6H 1SBSL 5TE7L 4WO4D 2QQNH 2J1KA 5ESQA 5C0AB 4YHYB 5LCVL 3E8UH 4NHUB 5C92A 3JV4A 3UTQA 4DVRL 3IU3A 1UXSB 1RJLA 1TJHL 3AREA 3QCTL 2L4OA 3C5ZA 4CN4A 2XWBA 3HCVB 3WS6C 5LQBH 3UTPD 1M4KA 3ILQD 5A2LH 1T1ZB 4ZTPL 5T3XH 1LEGB 4QOKD 3ARRA 4HWBA 2VISB 4D0CA 1NCNA 3VXMA 4M7KL 3MLTB 4O2EB 8CGTA 4R2GD 4TUJB 4M9OA 5D8JH 3C8KA 4QF1A 4OCXH 4ZFGL 1FNHA 5KSBF 4MLIA 5FDWA 4UT7L 3TBVB 5CGYC 5J06A 1UJ3C 3BKYL 4MNQB 4C56D 4NN6B 1HQRB 4LRNH 4XTRC 5C7XL 2AJYH 1UWEL 1U8OB 3CC5A 5F88A 4QT5A 2MPAL 5DK2A 2JJWA 2Y6SC 4M6OL 5IFAH 1OM3L 3SGKC 2R29H 4HJGB 4AMKL 3RZWA 4PR5A 2D0HA 3T2PA 2ZWLT 1VEMA 5DFVD 2ARWA 1N5YL 4Y5YA 1ULVA 1FC2D 4S1SH 4D0DA 1KCSH 4NUJB 5EIQA 4XMKL 3U79A 1S9VA 3MA9L 1EAJA 4TNVF 1ZHBA 5E9DD 3GRWH 5GGQH 1OWRM 2X40A 4PJDF 3UTSA 4FQQA 4LCWD 5DHVH 4WEBL 4YWGH 2DQDL 1LK3L 4N0YL 1NMAL 4H1LA 3ILQC 4LCIH 2BC4B 5D7IF 1CD0A 3QQ4A 3MRLA 5ACMA 3RIAK 3VXNB 4Z7UB 3PGDA 2NNAB 2E7LA 2QR0B 7CGTA 5FYLD 4GS7B 4JO4H 5DHVB 4PGCA 4JFFB 4YHOH 1NMAH 3CLEH 2E5EA 3A6BL 5DC9B 3MBEA 3VI4E 1ZTXL 1P9MA 2WP3T 2YPLB 2A6IB 3D39D 1FC1A 2ZSVA 4CVXB 5CJ8A 2VC2H 3L3HB 1I1FB 1YY9C 4G43B 1KCSL 1B0GA 4PGDB 5J1TC 3UPCA 1BQHA 3NAAL 4XGZB 3VGHA 7FABH 3GBML 3E3QE 1V3KA 4XWGL 3NZHL 5B38A 5BS0D 1G7JA 4NNXA 3GMLB 5JA8B 2EC9U 4PV9B 5HTSA 1CFQB 5C3TA 4OSUH 5D2NA 3HUJE 5D2LE 2BVPB 3RUGA 2R69L 2Q8BH 2R0WL 1EK3A 3ARTA 1JI1A 3GSNH 4OLUH 5T3XE 4RIRA 5LWYL 4MDJB 3RBSA 3PHSA 4Y8AA 2FL5B 3D18B 4OCRH 1TQBB 1BQHG 4OKVA 3BMWA 3SKNB 1EGJA 3VJ6A 4POYA 3MTRA 4OM1H 3KJ4B 3IT8D 2VH5H 4ONOA 4QY8B 5HY9B 4F7EA 1NC4A 3RVWC 3DBXB 5EG6C 1DSFL 4YFLI 5CEZD 3HAEA 1WCBA 4UQ3A 2VDLL 3BQUD 3KR3H 5ISZA 1P5VA 5FKAA 3LSOA 4MWFA 3HTLX 4Z76A 5I1JL 4EN3D 3C6SB 3K7UA 1WJ3A 4JG1L 4ELMB 2BNRE 5ICZA 1NGZA 3SBWC 3R4DA 3ETBF 4F9PC 1AJ7H 4H88L 3LOWA 5FYKU 3L9RA 3P0VL 2OTPA 5IJKC 1N5AA 3K4ZA 4YO0B 3O3BB 4WI6A 3FL7A 3WXWH 3HZMB 5JOEA 2ESVD 4Y5VA 2WBJD 3MSPA 1AXSB 1SMAA 4XC3L 3ZKQD 1MHEB 1JJUA 4HDIA 5DEGB 2DQGH 5DQJA 5HPMA 3HC0A 3TVMB 5I15L 5IF0B 5CEXA 3DO3A 3NACH 4L4TB 2JJSA 4Y4HA 3NN8B 4CBPA 5FUZL 4GQPH 3U0WL 5C09B 1HWGB 1QFUL 1BQUA 2XPGB 2LFGA 5CIPA 4MQXC 3TVMC 3UJTH 3MRIB 3MRKB 1UWXK 1SJHA 4WFFE 5D1ZC 2NXZC 3L6FA 3UTQB 3TZVD 1BQLL 3ES6B 5BZDA 3GKWH 5C07D 3X13A 3D39E 5T1KD 5TE6L 3QUXD 5EUOA 2VDKH 3ARSA 1C16A 1ETZB 4HWEL 4JQVA 5EULV 2EDRA 5J1AA 4HWZB 3EOBA 1UZ8A 1U8JB 3DGCR 4LIQH 3VXQB 4JZNA 5E6IA 1TJHH 4P2QE 3VA6A 2DTSA 5K9QI 5TDPB 3K4DA 2MHAA 3RBGA 3MJ9L 1PSKL 5CSZB 2VN4A 2WLYA 5T3ZL 1C5BL 2FO4B 4Q2ZA 1I7TB 1I85C 2HT2C 3RPIA 4XCEA 4CU7A 4I2XE 1E4KA 1CBVH 5JHDD 5A2IH 2VL5A 4ZUTB 4EDXA 4F7TB 3BRDA 5F7WC 1YJDL 4TUKL 5TJWK 1JTPA 2ZP0T 1CLZL 1OAUL 4OLXL 5AD0B 2V2XA 1LILA 3T3PE 3T0WA 2ZJSL 5IMLA 4XNUH 5D1XB 3FB8B 5D1XC 1VA9A 3IVKB 3DRQB 1G1CA 4X7EC 3NCEB 3WNOA 1J8HD 1FLRL 5MEOA 1FL6A 4LARH 3ULSB 1HXMA 2NXYC 2Z91B 4CDHA 2CUMA 4OLYL 4PPTA 4WU5A 2HFFA 1U93A 3E6HA 1U8QB 4KHXH 3QIWD 1FNGB 3OAYH 5L2JB 3BPOC 1N4XL 1R5IB 4DGIH 4MNHB 1OF2A 3L5HA 5BVJA 4K71C 3DMMC 1JYNA 1G9NH 2ZSWA 3J7HA 3UAJC 4K3EL 4NN5C 2BVTA 3DVFA 2MQ0A 3KG5A 1R24B 4LLUA 4JANB 2JTDA 4OLVL 1DJSA 1XF4A 4RMTA 2HLFD 1IM9D 1I8LC 1OSPH 3O6KL 4L9LA 2B7DT 1BF2A 2EDNA 2DQJH 3LRGA 3BPCA 1JUFA 3VRJA 3I85A 1FCGA 3QG6B 4YHKH 4LCCC 1KLGA 4AH2B 4OUUA 1E4XH 4G7YH 2VIRA 1Y18B 3QDME 4URTB 2WBJC 3P9MB 1DQTA 3MJ8B 3FO9B 1FYTE 4OCMC 3DX8B 1KEML 3WE6A 4I3RH 2I07B 5C3LD 1EGJL 1G7JB 2BY1A 3B3IB 4FHBD 4CMHB 3E2HB 1OTSD 5IJVA 3KLAA 1A7QH 1G6RH 4GKNA 4Z7NF 1JPST 1FYTD 1HKLH 3M45A 3T8XA 5GS0C 3T4YA 1NLBL 3BXNA 3LHPL 2DD8H 1DFBL 4JFZL 4PBXA 1BVKB 1YMMD 1AIFA 4WI9A 5I1JH 1JVKA 4LCUB 4NZJA 4YNYB 2N56A 1D3CA 2Y06H 4PG2C 5JW4Q 4ZFFA 2ZCLL 1RZ7H 2HFTA 2BNQD 4MCYB 3MRJA 1DSFH 3GMQA 3LS5L 2P44B 4POUB 4I9WD 3VXRB 4PY7A 1G7QA 1I1YB 5K9JL 3IKKA 1YECH 1BVLA 4X7DC 1N6QL 4KK5D 2DI8A 1HQ4B 3NCCB 2OJEB 1D5IH 2Q6WB 1NC2A 3LZFL 5FKAB 3EFDH 4KUCD 5GS1C 2C3GA 4LSRL 3L5JA 2MCPH 3KYMA 3FONA 1XGPB 1J05B 3TBWA 3VXUA 4UUJB 1NGZB 5EU7C 4PP2B 5AZEL 4JFHD 1NGQL 3L9RB 1RMFH 2D7QA 1KJ3L 5F7YC 2X7LB 3BMVA 5H94A 3WFZA 5BV7C 2IH1B 5IB2A 3DX6A 4Z7OF 3B8YA 2YUZA 2VDQH 1DBML 4WEMB 3VWJA 1QNZL 3BZDA 1MCRA 4DCQA 5HPMB 4R0LB 1OQOA 43CAA 5DMKA 4YHYC 3KPRB 4LSUH 4R4NC 4TSBH 5CZXD 3QNXA 5ESAA 4ESKA 1AP2B 4TSCL 3E6FB 1OAYL 1P7QD 4S2SB 4K8RH 4P5TD 4R7DB 3QUXC 3C2AL 4JFXB 4ZFOA 1JGEA 2DIAA 2VXUL 2N1KA 5IOPB 5C0BA 2BXYA 1M05A 5DJ0B 3WN5B 1FGNH 3JTTA 3ZTNH 4JVUA 1KPRB 4XXDB 4PJAA 1A8JH 5EBLB 1B90A 3RNKA 4PJBE 5CMAA 4KZDL 1M6OB 4JM2B 5DC0A 4GUPB 4JVWA 1HSBA 4PJGB 4HV8A 5DEFB 3QFJA 3I2CL 5FECA 5GRYA 4DAGL 2H3NA 3QDMD 2A1WH 4XP1H 2X4NA 4ZO7A 1RZFL 5A3ID 1V5JA 4HW6A 5SV4A 1P7HL 4LGRB 4V2BA 2DYPD 3DO7A 4KKNA 1SBBA 4IHOB 3QEUB 1NGXB 3SDYL 2WWKO 4YDIH 4G6KL 3MNVA 5KBNC 4U1SB 5D1XD 4J12A 4MA1B 4RAVB 1T66D 4YBLB 2P43B 1DTUA 2XOTA 4KY1H 1X44A 2XV6B 2AV7A 4QRQB 5IFAL 3MRFB 2E7MA 2VABB 4F80A 1REIA 5HDQL 4M02A 5FKPA 1DE4B 4CAGA 3FQWB 3B83A 2IEPA 3VFOB 4X0KA 4P2QA 1MHPH 2JIXB 3RQ3A 5CIPH 5F6IB 5JPNB 2A6DB 2P8PB 4NHCL 2BVUA 3UJJH 4L9DA 1HYSC 4FXKB 5EZLA 2W65B 1MOEA 1YN7B 5F6IC 3MR9B 1G7IB 4OZIE 4B53A 5DT1L 4EVNB 1A1MA 3LDBB 3QDJE 1VENA 2B5IC 4OCYH 1IEAA 1II4E 1V7MH 4OV5A 3IDXH 4XAKD 1I9RH 3I75B 4JY6A 4XHJD 2NY4C 1DANT 2OQJB 1OARL 1L7TL 2FBJH 4N0RA 1JPFB 5HVWA 1WLHA 1WK0A 4MSWA 5L7XL 2VLRE 1NGWA 2J8OA 5EZIH 2ZG3A 4NRYB 1A9BA 5HYIA 4IJ3C 4P3CL 4K94L 1QVOB 1NBYA 3HZKB 1YEFL 2Y5TA 1A3QA 1F4XL 2H32B 3VFGH 5B3NA 1U3HB 4ORZC 4HH9A 4WI7A 1MCWW 3V0WH 3LKQB 4HKBB 4HGMA 2XQYG 3MREB 4ENED 1O7VA 1LO3H 2IPKB 5CKAA 4HCRL 2Z8WC 4O5LH 4ZSOB 1D5XB 2KDGA 4L3EB 4MXQD 4Y16C 5LWYH 3KPSD 2WP3O 1JGLH 4CN6A 4U1LB 4S10A 5F7MC 4QHNA 1EIBA 3SDXE 3MV11 4CW1A 2LTQB 3L5XL 1FNAA 4WIQA 1ZWIB 1QFHA 3WFHA 2V9TA 4C56A 3C87A 2PYFA 5F7DA 5CBAA 5JORA 3G04B 3CSBA 1N6VA 1MFBL 5AZ2H 3RWDB 4OZIA 2D03L 4ZOCA 1A1OB 5GSRA 4CUCA 2CR6A 3EOAA 4YDVA 2GAZA 2YRLA 1SJXA 1D5MA 5DJDB 2YXMA 5IVXA 2AK4E 5ETUA 4XCNA 4K8RC 2PNDA 3EJYC 3O6FB 4HIXH 1WITA 3I9GL 4F58L 3PWUB 4FQXA 5KAQG 4YHOL 2C3VA 2BHZA 1U95B 1JF6A 1YEIL 4JO4L 4BK5A 3MGOB 5IBTL 2EC8A 2UYLB 4CADB 1IQDB 2BHYA 2QQQA 5ICYA 4FZ8H 3GJEA 4KXZI 4R4ND 4NQVA 4UMGA 4XCFL 2F19L 3ZDZF 4P2OD 4WNQB 3MBEC 4X80L 3UPAA 3WEXA 2AI0H 5LBSH 3BDYH 3PXHA 5F7EH 3SDAB 3RIFF 1TVHB 3HZYB 2WINB 1G7HA 2R4SL 3AS3A 2BSSB 4GRWF 4JKLA 5DUMH 1U8HA 3V5DA 3HNSL 1KIRA 1QSEB 1AO7A 4MA3B 1MI5D 3C9NB 2BMKA 5M7QA 2P45B 3KXFA 5SV3A 2H8PA 2XWTB 4PV9A 3THML 2Q86B 1PLGH 1OGTB 2J8UF 1F8TH 4PJ7A 5D2NC 2FGZA 1MCLA 1M05B 5DJ0A 4H5SB 4L3CB 4OZFH 4AG4L 1RZJC 4R8WH 2JK5A 4M1GH 2ICWB 1MAJA 4MJIA 5E00B 2DQCH 1YC7A 4UIKH 3SKNA 3N1GC 5D7JC 3M8OL 4X6CB 2FEEI 1Q9LA 4PJBA 2P42B 5F1IA 2ZUXA 2NY6C 1P4IH 5KSBA 3GMNB 5C8JA 3CVHB 3QEQD 5JDSB 5F97E 3P11L 3LQAL 1OAZH 2GJJA 4LCWA 2UWEF 1FNFA 2ADJA 2E7CA 1R3KB 3QHZL 5C0AA 3PF2A 3MJGX 2BOBB 2XXCB 1CDCA 1B0WA 2A0LD 2VDNL 1RHHA 1WZ1H 4NWTH 3MLVH 5ISZB 1CVSC 3C5ZB 4GRLC 4M7KH 2KQMA 3BP4A 1ZT4B 4PJ5E 4PJEB 3EDFA 4KJYB 4N1EA 3BOVA 3CH1A 1LK2B 4R4FL 2Y9RT 5IP4A 1F11B 3SBWA 2AEWA 4ELKA 3OX8B 2AV7B 4PLKD 4CU6A 2CK0H 4G6JH 4X6DF 2VKXA 5KJRL 5EU3A 2AEIT 3MRPA 3E8UL 4KDWA 1FJ1B 1SY6H 2Z4QA 3SO3B 3FRUB 5CP3H 1B3JA 3DV6B 1FLRH 1MHEA 1NMCC 5I8OH 3VFOA 5C0DA 2VXTL 5A3IC 2DQEL 4UV4H 1ERNA 3GSVA 2A77H 3LN4B 4MB3A 2HFEB 3MACH 4KHTL 2BERA 4KZDH 3NN8A 2VXSH 1H3UA 4PRIE 2GFBA 1KJVB 1U58B 5HHNB 1KCUH 5CEZL 4MA8H 4TNWK 2GSIA 4PS4L 3FKUS 4ODSH 4TUOA 1C5BH 3C2AH 3J8F7 2P7TA 5CJBA 1FZKB 5GGVH 3I75A 2W0KA 1IM3B 3PL6D 3UO1H 4F7PA 3O3AA 4Y5YB 1TNMA 3QI9B 3C09B 3T0VA 1VACA 3NIGF 4OGYL 3JV6A 1D9KA 1WFNA 1LEIB 3ROOA 1A9BB 1MWAA 3CNKA 2XZCL 1XGRB 4C83B 2NY3B 3GMOB 1IILE 3AMKA 4BQBA 1SEQH 4JFEE 3DURA 1I9EA 3TN0B 5I2IB 2WBKA 3HMXL 4W6YB 2FO4A 3EJYD 3PGDB 4LPTA 1JL8A 1I85A 2R2EA 3HRZB 5T1KA 3H3PH 3SDCA 4K3DH 4OBSA 1FNSL 3P11H 3DX9A 2DLIA 2HMID 4ZSOA 3S8WA 3T0EA 2VLKB 3LMJH 3QA3B 2D3VA 2YPVH 4KHTH 4A6YL 1YY8B 2VLRB 1U6AH 2J6EA 5J9PA 4P4RB 5F3BB 2O61A 4LSVH 1MNUL 4S1QH 1CXFA 4PREA 1ORSA 4WHDA 4DK3A 2YSSB 1WICA 3QULA 3F7VA 3QCVH 1OGAA 3THMH 3QDGB 1AE6L 4FXGA 2YWZA 1JF1A 4OF5A 5K9KA 2B2XH 3TJEH 4ODBD 4MNHA 3AUVA 5BRZA 4ZXBD 2DQTL 1FVEB 1MCOH 3DMMA 3N9GL 3QNYA 3T77A 3T1WA 3VH8A 2HP4A 3JV5A 2DICA 4LCCB 4NBZB 2R0LL 1K85A 1MWAL 3IJHB 3GSOB 4F2MA 1KEMH 4JFDD 2PW1A 4DWHA 2FJGA 4G9FD 2WBJB 4KKAC 3GSUB 3AB0B 5IB4A 1FFPA 3U9UA 5ICYB 5IMMA 5DJXB 4YHML 1I8LA 4UOW1 1QYGH 1P53A 3D2UA 2DKUA 5ID1B 1NCBL 4FN0A 1FH5H 4MX7A 4WNQA 4AM0A 1WCBB 2YPLD 4P46A 3U6RA 4JVPA 4ZS6D 1KF9B 3F58H 4KKCC 3B9EA 4Y4FD 2C26A 4RNRA 2BRQA 1NDGB 3LN5B 1JMZA 4EBQL 5I17B 2ICEA 2NY7H 1JPTH 3BZFB 3V5DB 1D6VL 2ICES 4QRRB 4PJ8C 1A6VH 1X5AA 3BI9X 1HZHH 5F1NB 2V7NA 4K3EH 4KKBD 5C07B 3BAEL 4PJ9D 4OAWB 4KJPC 4NQCE 3MODL 4XPHH 4WWKC 2CIIA 4OJFH 4NN7B 35C8L 2Y7QB 4M1CD 3HNSH 4LFHD 4IRSB 2XZAL 3M17B 5DUML 1BD2E 2HKFH 4E9LA 3V6ZA 3UC0H 1L9NA 3WLBB 5DZOA 2UVEA 4N8CH 2DIBA 3SE3C 5F1IB 5DVKA 3H3KA 5KS9B 3G9AB 2AJ3A 2IPUG 4X80H 1ADQH 4LARL 5BXFB 3PL6C 1V3MA 5LAXA 4JRXB 1ZA6A 2RFXA 5CD5D 3BPLB 3JV0A 1P2CB 2XXMB 1BJ1J 3QZWA 4FQCH 5FK9A 4DN3H 4YXKL 5DD5H 1UADC 1MCSA 5KVMC 4LLVA 1VFMA 2X70A 3ZKXC 5D5MB 3O4LE 3KDMB 2Q6WA 3HNTL 1IM9A 1VFBB 4PJ7E 1WEJL 4PJEA 3DXAE 3TN0D 2XZQL 1AQKL 1S7TA 2QSTA 4QKXB 4EN3B 1FIGH 2LE9A 4QHKJ 1CK0H 2CIKA 5F7KC 1DCLA 3ARFA 2Q1EA 4HWZA 3SY0B 3RFZC 5L6YL 5D6DC 4HIIA 3RA7L 1DBKH 2UZXB 4WY7L 1CXEA 4ODHH 5J6GB 2YMXL 4KFZC 5EU6A 5I6XB 3BP7A 5K59F 4MZ2A 5TDPA 4FNLL 3PGCA 1U0QA 3QEGH 3DOSA 2E6PA 1LEKB 3F8UB 3FOMB 1DEEB 2IBZX 3DARA 4DCQB 2ED9A 2AEPL 4ZPVA 5AYUL 3TO4A 3PUCA 5C0DB 3F12B 2Q76B 4U6VH 3ZZ1A 2DLGA 5ISZE 3FT4A 4H26A 4GG6B 1MFAL 3HG1B 2QJDA 1TQCB 4KMTL 2DBJA 2RR3A 1MELA 2EIBA 4R4BB 4RGNC 3MXWL 3FT2A 3WJLA 1J87A 3DRQA 4X99B 1ZLSL 3AAZB 4M7JL 4Y2DB 4Y4KB 5DJAB 5AG9A 5EUOE 2Z91A 4FABL 3ME0A 3AY4C 5GRVK 3GMPA 3RTQD 2H6PB 1J8HE 5I9QC 4HZLB 4QCIB 4O9HH 1MIMH 5DXWA 2GITB 3QEQE 2VZ1A 4OCSL 2ARJA 1F58H 2ZUWA 5HGAA 3IDUA 2JB6B 3T2QA 4M1DL 4F57H 4M6AA 4DVRH 4HC1L 1DQQB 4HUXB 1X5HA 1NSNH 3GHEH 5DQDL 4PFEA 4LRIC 5DD3L 2CDGA 3MLWH 1NL0L 3PWJA 1XR8B 1GZPB 3FT3B 1VDGA 1OTUC 3EJZD 2VQTA 3T2OA 2YRPA 4DN3L 2B0SL 4UB0L 3VGEA 5L2KA 1A3LH 5J12B 1KLUB 2DMKA 5FM5M 5IVOA 3KHQA 4JZOA 1QR1B 5CEZE 1BFTA 1KV3A 3G5YA 5ID0A 1OY3B 4W4OC 1XF2B 5SWSE 3QDAA 5LXGL 4O4YL 3S36H 1GGBH 1EO8L 4J3XA 4UDUA 3CXDH 2VISA 4BQCA 2DKSA 2OI9B 4IRJB 3KLSA 3LKPA 1CN4A 4HK3N 4OZFB 3SPVA 1KC5L 4P2QD 3P40A 2MCG1 1AI1L 3KPQA 4DFIA 1X5IA 2IH3A 5IMOB 1QHPA 3VDAA 4DZ8A 4KXZH 4JKKA 2ESVE 5L6YH 2H45A 4D0BB 4ZYKA 1FIEA 1NGWB 1Z6JT 2XN9A 3IAQA 1H3PL 4RMVA 1YPZF 5DYOA 3T1FB 1RU9H 4DAGH 3B9AA 3RDTD 1NAMH 3WLWC 1E0OB 5C0CB 3PXJA 1TETL 3F58L 5KVDH 4NDMA 2X1PA 2EDOA 1S9WA 1D5ZB 1YEHH 4QHLB 3X3FL 5JW3H 3HG1D 5FYLH 3BIBX 2RJMA 2YK1L 2GQHA 4NQCA 4LOUD 4MCZB 1J0IA 2L7JA 1WT5A 2MTPA 2QEJA 2GY7B 3BVNA 2J6EH 4YIQB 2NX5A 1B4JL 4OI8A 4PRPE 3EYVB 4L3EA 1FORH 3SDXF 5D7JB 4KU1A 3HE6D 4TSCH 4GMSH 3Q5OA 1J1OH 4LK4A 1A6ZB 1QLRB 4ONHB 4HUWB 2XY2A 1MJUL 2R4RL 3MFFA 3QUKB 3L5WB 5BW7C 2G75A 1BOGB 2GK2A 4IBLT 2ZPKH 3VI4F 3ZT5A 3IXAB 1SJVA 3BZEA 1YN6A 5F1OB 1PDKA 5DD0L 3ZDZE 4BZ2H 4BSJA 5LGHL 4YHLH 1WIPA 4DZBB 1PZ5B 1ZHKB 2B8OT 4QRRE 4LSDA 3SKMB 1JPTL 3NFNA 4Z18A 1GGIL 2OZ4L 4LCWE 4QXUL 1RUMH 4LQFL 2CGRH 5EOQH 5E8NB 4HUUB 1A9EB 2VERN 3JBG7 3QO0B 1HSBB 2F8VA 4PJGA 5I1EH 3D85D 3SDDA 4LRNL 1CGXA 3DYPA 3EDKA 1OAKH 1EERB 1KTDB 2XFXA 5GSVB 3DX7B 1HKFA 3OJVC 3INUL 3K1DA 5JHDB 3EHBD 4WWKB 5CBEB 3SDAA 2EDHA 5IHBA 3OL2A 4HWUA 4P2RD 3E3QC 1RIHH 3MLYH 3N9GH 3RL2B 4RIRB 4ELMA 5C2BL 2AJVH 4KKBC 2P48B 3R06A 5C0BE 5LGJB 3PQYB 1QSEA 4H1LG 4NCC2 4OFKA 3RX7A 2FLRT 3IYLW 1A7QL 1GAFL 1H3WM 3L3KB 5C71A 3UO1L 3EGSB 2VABA 3QWQB 1HIML 5B8CB 4OLYH 1G9NC 1P4BL 3QFJE 1PX4A 4JY5H 2ID5A 4XNQB 5D71H 2X9WA 2BNQA 5JQ6L 2P8LA 5IROA 5T1DH 1U6AL 3UCRA 2OSLA 4NM8H 1CTOA 5FA3B 1AQDA 5F9JB 1LE5B 3BP6A 4FG6C 4NQDB 2XTJB 3GMNA 1F4YL 1MHHB 4YXHL 2PR4L 4RBPH 1QSFD 1BM3H 4M6NH 3OWEA 4IMLB 4HS3A 1QA9B 4RZCA 1OW0A 4XRCB 5EOCL 3H7LA 3O8XD 2VXVL 1BEYH 3GSWB 2ADFH 5TGBA 4GKSB 3CLFH 3RWCA 3WNNA 2AAVA 4OZ4B 5L2KE 3DTXB 5D7LB 3SOBL 1ETZA 4Q6IA 3GI9L 5D7IE 2XKNA 1BIHA 4DGYH 3HC0B 4NQSB 1A4KA 5DRWB 4LNRA 5DC4B 5DLML 1H5BA 1GL4B 2FIKB 1YEGH 3FO0H 3RGVD 1JN6B 2I26N 5JIPA 4MYWB 4YZFE 3EOTH 4JFOB 4U4BA 2HTLC 5FHBL 4GRWE 3CVHH 4NO3B 2B1AL 5GRWA 3H0TA 4WU7B 4OB5H 3OGOE 3QBTB 4ZUTA 4EDXB 1IGIH 3VXSE 1JGVL 3RY4A 1UVQB 3IB4A 1AHWC 2Z8VC 3M8OH 1EVUA 2EYSA 3TH3T 4PLJD 5F6HI 1QLEH 5ALCH 5FYJE 4NFCA 4M4RA 2OK0L 1PSKH 3LV3B 3QRFM 1B0RB 1ZWIA 1F8TL 3UBXA 2Z93A 2P1YA 4GOSA 1U93B 2VUYA 3E6HB 5JMRA 4F7PB 4KVNH 3ISWA 4P5KB 4HGWB 3EYOA 1FGVH 4D0BA 3UEZA 2VLME 3EYFB 2ZUSA 2V5YA 4OT1L 5KZCB 1GGCH 2YD6A 2HG5B 1G7MA 3U7AA 3VXPB 5T1MB 3QWRA 1OCWL 3OG4B 4GMTH 5I0ZA 1J0YA 3FFCB 4GKZA 1QSED 2XT1B 4U3CA 1HHHA 5CEYB 2MQCA 1O7SA 5F7LB 4LKCB 4RQQB 1LE9B 3SDCB 1MFEH 4H20L 4OD2A 2G2RB 1U36A 5IBTH 3LPFA 5EO9B 4KQ3H 5B4MC 1KELH 1QSEE 5HGHB 4I77L 1P7QB 4UNUA 3UJIL 4TSAH 2CMRL 4OQTA 4Y2OA 4XNYL 5KVFL 2ZUUA 2XTJD 3HE7C 1EEQA 3MJ8A 4HIJB 4HS8H 3VXSD 3P3YA 4X9HA 1NUNB 2R0WH 1IGFH 3JV4B 3RVVC 5HSFA 1KIRB 2WIIA 4AIZA 5EPMA 3KAAA 5KG9A 3MYJA 3B3IA 5IFHH 4M8VA 4V1DE 1JBJA 1AGFA 4XWGH 4DUXA 1ZHKA 5SX4H 1LEGA 4L3CA 4NYLB 3DUUB 2XN9D 3SN6N 2P8MB 3EHBC 2AXFB 4O5LL 4Q9RH 4NKMA 1IAOB 2EH7H 4WWID 4X6DA 4XPFL 1QFWI 3FHQA 3OTTA 2VH5L 4APQA 4KTDL 4LBEB 3WSQL 1RHHB 4MQ7B 5LKNA 1FL5A 4P46C 4LVNC 2P46B 5C0JA 1FFNA 3NFSL 4KZEH 2M8XA 2C4FT 3TH2T 5DDHA 4Z7WB 2Z31D 3CH1B 3WUWB 3R06B 4E0RA 1MFDH 4HLZH 1UWGL 5I1KH 1W72B 3OR7B 1FE8H 1A4JA 4JRYA 5KVEH 4XMPL 5IESL 4Q9QH 4KKCD 1IC4H 3Q5YA 3L5XH 1KIQA 4NUJA 5IFJA 15C8H 2NY2C 1EBPA 2GK0B 1BIIA 3BESR 4HIEB 1NCTA 3CXHK 3TA3D 1XIWC 2VC2L 1A14L 1ZGLB 4G80B 2NY4D 3F62A 4HT1H 1UYWL 4NJAL 5L9DH 1HWHB 1RD6A 2XN9E 5C0EB 3DROB 4HEPG 2HMIC 1KENH 2AQ3A 5IHZA 3U46B 2KZ1B 4G8GD 1T21B 2ZKHH 4QRTB 3RNKB 5F9OL 4GQ9L 2J7LA 1NEZB 1Q94A 2GUOA 1YPZB 1JWMB 1S7WA 2XWBB 3HCVA 4XVTH 4D2NA 1TETH 2OP4L 3MROB 5DVMA 4K3JH 5CP7B 2VDOH 1CL7H 2VWEC 3IKCA 1N59A 4HKJB 4N9GA 4PJIB 4XMLL 1ES0A 3GGWB 1IC5H 5HYJD 1DLHB 1VADA 4MNGE 4ZUUA 4LNRB 2R9HC 4WGWB 4NNXB 4TVPD 5EU6B 2FEDC 1NBVH 2V17H 2ADIA 3C5ZC 4AEFA 4QRPE 3V5KA 1I7ZA 4J7RA 2PXYC 1JK8A 1KTLB 4Y89A 1QLFA 2X4SA 3JTTB 1LNUB 2DJSA 2VQ1B 3A6OA 3M1BB 5DHYA 2OX5A 4LOUC 2C5DC 3Q2CA 4MXWL 4GRLB 5I8CB 2A1WL 4XP1L 4PB9L 2J88H 2PTTA 3G6JB 3VJ6B 2VLKA 4KUCF 4TOYL 1RZKC 4YR6A 4U0RC 3RWHB 3U4EA 5D7IB 5HGDA 4Z5RA 4X99A 1Q0XL 2FEEL 4P4RA 3RAJL 1RUPL 4XP5H 3BD5A 2CDFB 2JELH 3QIUD 2EDKA 3P9LA 5I76B 2YR3A 3WFEH 4P3WA 4NQEE 1NL0H 1OAYH 1FO0B 2Q7YA 2ATPA 1JF1B 4M6MH 4MJ6A 1TPXC 3ZSTA 5I75B 2CDEA 2AGJL 3W11C 4OM0L 5HI3C 3G6JF 4QHMA 2CRZA 2YD3A 4PJDB 2ZG2A 1DBMH 1ZLUK 1B2WH 4YDJA 1QSFE 3OKLA 4YDIL 4AY0A 3V95A 5I8EA 4XB8A 1RVFH 3C8KB 5ADPH 2QLVB 2VDML 5DMGD 5DQ9B 4OZHF 4ISVA 1R5VA 2EICA 1H9VA 3BH9A 4OCSH 5C0IA 4ZS7L 5DEGA 1MFDL 1FN4A 1SEBA 1WWAX 5CSBA 4EI5A 1H0DA 1KN4L 3BN3B 4LF3A 3MBEB 3ZTJH 5F88B 1DBAH 5F9AC 2GCYB 1BX2A 3L3IB 3WNPA 5H37G 3P4LA 5EC1A 3VFMB 1E6JL 2YD7A 5CIPB 4GQ9H 4U49A 3WFCL 1ZVYA 5E2WH 3SJVD 4CKVX 1KN2H 3HMWH 4ZXBC 4Q6YA 1T5WB 4PJCF 5DJ6B 5BZDB 4G8GB 3DGGA 2CJUL 1CF8L 2X4UA 4M61A 5FYKD 4GJTB 4AL8H 4X4XB 4RA0C 1QQDB 2HKHH 5MHSE 5JW5A 4U6VL 2YKLH 3TCXA 1EV2E 2IG2L 1KCVL 2A0LC 4KVCH 1CWVA 4NQED 3W2DH 1F13A 3VXQA 3MV7D 4JB9H 1IGJB 1BMGA 5DFTA 1QVOA 5HGBB 2H1PH 4OZFA 3SPVB 5DHXB 3TO2B 2VITA 4ZG1A 4HKXB 3CJJA 1DANU 3VXME 2R23A 2OJZH 5E4EB 2JIXD 3VDCA 2EDXA 5GRJL 1NC4B 3ZSSA 4CJ1A 3VA2C 1MRFL 1T83A 3CK0H 1MLBB 5JXAH 5JXEA 1ADQA 1YDPA 2VL5B 5I0DA 2X70B 2EIDA 2P5EA 3TCLB 5EBWB 5B38G 3C5SA 4FQXB 5C0JB 2A6IA 4OGAC 1ORQA 4NQCB 3G5XB 3H7BB 5FGSA 1J10A 3SY0A 1QRNB 1HYSD 4A2MA 4PJFF 2YZ1A 5CKGA 2ZUTA 3OR7A 4S0SD 2A74A 2A9NL 3GMLA 4IJ3B 1AY1L 3SJVE 4C4KT 3FZUC 5ITFB 4JFQB 5BV7B 1CLOL 4PGEB 4JM4L 1PEZA 2WAHA 4WO4A 3N50A 1NCWL 4L8SB 4I18C 1G9NL 1SY6A 4M62H 1D5MB 3LHPH 1TZGH 4X98A 2I5YL 2EYRB 1CICD 4N8VA 3EAKA 5TDOA 5EU4B 3PHQA 3CFKB 1EO7A 3H9HB 5GS1B 5ACZB 4BZ1H 4I18B 3KPPB 1X5XA 3RIAF 3PWPB 4OIAA 3VW3L 4PJ7B 3BE1L 2NLJA 4PJXF 5C08A 4NSKB 3S37L 3WDHA 2JJUA 2DN7A 3QPXL 1UC6A 1W8NA 3VCLA 1GHFH 2QV2A 1J7VR 3UJIH 2OTUB 4EXKA 3QRGL 3HNVH 2HT3D 2YPVL 2IADB 5GZOC 2JJSC 4LHUD 3F65A 2RCSL 3P9MA 3L3OA 3C09C 2ADJB 4J6RH 3SE4A 3O6KH 2AV1A 2UUDH 5T5FL 5D1QB 4D94A 4OCWL 2YPKA 5D1ZA 2X9YA 3CSYB 3N0PB 4XWOC 4KAQH 1MWAH 3QXAB 2HTKC 1RAMA 5FGBC 2OYPA 1PEWA 3ARUA 1S7VB 1HNFA 5HHMD 5MENB 5DRZA 3QO1B 4HBQA 3TVMD 2HRPH 3D85A 4HDIB 2HLAA 2E8YA 4JFED 1BVKA 1MJJA 4RCAA 1J18A 4MJIB 3GI9H 2DI9A 4DUWA 2HAZA 1CDUA 4KVNL 2YBRB 4P9ML 4XTRD 3ILPA 4PD4J 1T3FB 1F00I 5AD0A 2Z4QB 3NCMA 5F8QC 5MEQB 1X3DA 3O2DL 3I3BA 1R3KA 3OAUL 5DJZA 4AEHL 5FYKL 5I1AB 3S88H 3QG7H 4J4PD 4Y2DD 2WM0A 5GGTA 4R90L 3WHXB 3MRKA 3ULSA 4ODSL 3L6FB 4PLKC 5F96H 5IROC 1QFUH 4JZOB 3PJSB 4Z7VB 3QUXB 1QFOA 3QCUH 1J1XH 2CLZB 3QWRD 1YEKH 2NX5E 2UZIH 3QDJA 3FONB 4ZPTA 4NQXB 3D39A 1PQZB 3D5OF 2E8ZA 5F44A 1G7PB 3PWVB 3TJHD 3K0WA 1YA5A 3AM8C 2IAMC 3PE9A 1NFDE 4ZS7H 3UTPE 3Q1SH 2V5MA 2YXFA 2BY0A 4WTXA 2AABL 2IH1A 3REVB 2VTFA 4JHZA 4K23H 3WO4B 3ALWA 3NCJL 3UYRL 3G08B 1SM3H 2C3HA 2HJFB 4D0CB 2NZIA 2LU3A 1SYVB 1A4KB 1MVFA 2QSVA 5DRWA 4IMKA 2DWEA 3CPLB 1CGTA 2L7UA 5CCKH 3BPCB 1W0VB 5TE6H 1XGUB 1H5BC 3B9KB 1P84K 3TNNB 2IQ9H 2X1QA 4JFOA 4UT9H 4B41A 5GS0D 4KRLB 2YPLE 5I8KL 3O81A 1LP9A 4YXHH 5CJQH 3L3GB 2VLJB 5K9OA 2V9QA 3WD5L 5CJXC 1T03H 2IBBA 1UVQA 5D1QD 3R1GH 3ZE1E 1KB9K 4PBVC 5GJSL 3WIFA 5B21A 3T8XB 5CWSA 4Y2DC 3W82A 1QSZA 3HAEH 1S78C 1RHFA 4LHUB 5DUPH 3MFFB 3JV6B 1GGIH 2OZ4H 1GH7A 4G6AD 1RK0A 3MUGA 4U7KA 3DRTB 4KKLD 2E9BA 2VITB 3DSNA 1OGAB 3VG9C 4S11A 3WUZA 4BZ1L 1T6WA 5CSGA 5I2IA 3I6LE 4FTVB 3V7AE 5SX5H 5D5MF 1S9VB 1K4CB 3FTGA 5C6TL 1VKXB 2G5BB 3L7FB 1CZ8H 4KRPB 3FFDB 4GAJL 2MNUA 2R2BA 4XWOD 4FMKA 4TUJA 4ELMF 5DSCA 3ZT7A 3A0OA 2AJSL 1RZJH 4O51B 1A7BA 5J9PB 4C59B 1GGYA 1JV5A 1TMCB 5J89A 3ZYOA 1VPOH 4EDWH 4GG8B 2O26U 3BFOA 1K6QL 1KCRH 2DQFB 5ID1A 4LPXA 4JFDE 3BZ4A 5D7KD 2IFFH 1KENL 3CMOH 5GGUA 3MUZ1 4HAGA 1UA6L 5D93C 4OI9A 4PRHB 2ENSA 2EDWA 4HKZB 5EUOF 3WDJA 4XCYB 2CGRL 2ATKA 4N9OB 4K71B 2ICEB 3MA9H 5ENWA 2JJVA 4N0UE 3BE1H 4LHJB 2NY0C 1C1EL 1Q72H 3TN0C 3PABB 3OZ9L 4JY6B 2GIYA 5T1LB 2PW1B 4XAWH 5DVNA 5KSAB 4U1NA 3OKKA 2BJMH 4YPGA 2H9GB 4WI8A 5E5MA 4AQOA 4XMPH 5JUEL 3WFDH 3PWPD 4JO1H 3D0VA 3VWJC 3ZYZA 4NYLA 3PP4L 4GXUN 2BFVH 2M26A 5D7SH 1XGYL 5AWNL 4U1IA 4DVBA 1IT9L 5FO8B 4U1JA 3DVNB 1BGXH 4Y4HD 3BDYL 3VFWA 5DJYA 1BZ7A 5IGXH 3GM8A 4RWYH 2BC4A 5C2UB 1VGKB 1I9JL 3K2UL 4XI5C 3HMWL 1J05A 2YUWA 3TBWB 1S3KH 1V05A 4LPUA 3KLHC 4PGCB 2F53E 4HHAB 4JN2B 4A2LA 4KDTC 2EYTB 2YPKB 2FECI 4IOFC 4D9RD 1U8LB 5HYFA 3LKNA 4NP4H 3Q3GA 4HIXL 1DUZB 2CO6B 4I0PC 4Q9RL 5E7FA 5GGSY 4YQXH 3V6OE 1B0GB 4P23B 1T89C 3GSQB 1JRHL 5L2KD 5K59E 2GJZB 1FO0H 1N5YH 4KI5E 2PYFB 5F7DB 4Y1AD 4YGAB 3ZDXF 3MNZB 2EEDA 3PNWA 2GK0A 2H2SC 2PYED 5DA4A 5TPWH 4OZGE 3KYNB 1GGBL 2ZOLB 1KEGL 4NBXB 3KJ6H 4YFLF 4XNYH 4G9FE 5KVFH 2VMFA 3MLZH 3BUTA 1S5IH 4WFHD 3MRHA 4DK6A 4CADA 3D39B 3PGFL 5EZOH 3O11A 4XNZB 3T04D 5F7FA 1J12A 1T80A 3QUYD 1W2KT 4MS8C 1TJIL 1C5DB 1S5IL 1PY9A 5CUSH 5BS0B 3BPNC 3PHOB 1KNOB 2DMBA 2YD9A 1T04A 2O5YH 1S7QB 2X5PA 2FX8H 3BW9B 4TNWF 1ZA3B 4KUZH 2AQ1A 1CIDA 1W0WA 1UJ3B 3MA7B 4S1RL 1KT2A 3GSRA 3LQZB 2BMKB 4MDIB 4YDLC 1RFDL 3O6MH 4L3ED 3IDGA 1F58L 4I2XA 1E4WH 1KTRL 5HJ3A 5BZWA 4HUNB 2G9HA 4MB4A 1FVCA 3MGTB 3C8DA 4OM0H 4XCCH 4LLDB 3BGFB 1WSST 2P8PA 2AVGA 1RURH 3DVGB 3VFRB 1MF2H 3QAZC 1A7OH 5CWSB 1UXWA 3ZDYF 3QCUL 4IEFB 2D7TL 1EFXA 4EVNA 1LDSA 3KWWB 4U6HB 1J1PL 2OR9H 2WIIB 4AIZB 1U42A 1YMMB 3BP4B 1OAXH 1UACL 3I6KA 4RWYL 5JOPD 1A5FL 1F3DH 1C08B 1KEGH 4Z7VF 2VZVA 4F37K 3UC0L 2Y72A 4WUUE 6CGTA 4PJDA 3ROLB 5E08L 2AEPH 3E0GA 5SWSD 5BV7H 3MQIA 4GRLD 1A6UL 3OKLB 5IB5B 4RISL 4X6BA 3FRPG 3O3EB 5DTFA 5IESH 4Q9QL 3T09A 4YGVA 3DNKA 1A6PA 3BAEH 1P4LA 1Q72L 5HHQB 4J3VA 2EDJA 4JHWL 1R5WA 8FABA 4FG6D 2QQLH 4LSQL 4QWWD 1HN1A 4JFYA 3X3GL 3IFLH 4P4KD 3UYOD 4B7LA 4Z7WE 4EI5B 5F89B 1CL7L 4XMLH 1IC7H 5F9DC 2R2HB 4MQ7A 4CMHC 1KLGB 1MAML 4AH2A 3EFDL 5DR5L 1D5ZA 4HKZA 4QHLA 4FQXC 1YZZA 3W0WD 1RJYA 3SO5A 2QQKL 4RGOH 1BAFL 4JLRB 3CFDB 1HH9B 1F45A 1L6XA 3EW3B 1FAIL 3CU7A 1HK6A 2WSKA 5EOTB 3RIFK 4EEEA 3MRMA 5D71L 3PABA 1KG0B 3O45A 1NC2D 1OQXA 2V2TB 4L29B 43C9B 1XGTA 1FNGA 4X7SL 4K9EL 4LP5A 3EDDA 3G6DL 3V6BR 1T20A 3QUKA 2UY6A 4KROD 3ROOB 15C8L 3WIHH 4B50A 4QWWC 1PKQE 3QFJD 4HAFA 4WV1B 5D6CB 3RVUC 1I3RB 3QUYC 3U1SH 2BJML 1EJOL 1PX3A 1L9MA 4F15B 3KPMB 3B5HA 4FQIL 4PJGE 3B2VH 5IR1B 1HXYA 2EH8L 4XP9H 1AR2A 1AY1H 2E27H 5SX4I 4RAUB 3MRIA 2X4OA 4PV8A 5SWZE 2Z31C 1T83C 2BNRB 3DX9B 4LSRH 4G9DA 3IXTA 3PQYE 2VAAB 1HQ4A 3JWDL 3KPOA 3LPGA 4LP4A 4MAYD 5AUMB 2NCMA 5D7JA 4H8WC 3S96B 5EORH 3F5WA 1DDHB 1IEHA 2QQKH 4RGOL 1JWUB 1KB5A 4P23A 1NCDH 4P2CG 1D5BB 1F11A 1JZ8A 3NABH 3QXVA 4N5EC 4FFZH 3DX8A 2EH7L 1C5CL 5FOBA 1XF5A 2GI7A 3EUUA 4IDJL 5DMJB 1RZJL 1YY9D 2ADIB 3B2VL 5TDNA 1BQSA 3VXUD 4QTHA 4Y5XC 3QDJD 4C57C 1OSZA 3UX9B 3H3BC 3IRZA 4Q2ZB 4RFEB 3NIFF 4U2YA 3GO1L 5TDOB 2FDBP 5BQ7A 1I1AC 2EIZB 1UKTA 2YKLL 4K23L 1KLFA 1F4WH 4PJBB 3KPPA 2XNAA 4LSSL 1J1OL 2B1HH 2C4FU 3UTSE 4P2RB 2CKBL 4ZS6C 4KV5F 3L3JA 4HS8L 4NJ9L 1RZKH 1AO7D 2OR9L 2ZJSH 5DEFA 1AQDB 2VXSL 3WFCH 4KQ3L 3FQRA 4WEUD 1AO7E 1CBVL 1B9ZA 5CJQL 3W0WB 1N3NB 3SE4C 2CKBB 3WNKA 5J6HB 2AV1B 3MLRH 1NAML 3PWLB 1X5GA 1IC7L 4PP2A 4TQEH 1AFVL 1MREH 4PJHF 4AEHH 1NDMB 1YEJH 3IU3B 3DV4A 4JFHE 4U1HB 1YYLH 4Z78B 4C55A 1YEGL 3IDGB 4XPBH 2E6QA 2X10A 3RI5K 3TO4D 5INDB 1F2XK 1GGCL 4G6JL 1RVFL 5HXMA 4FQJL 2PW2A 1QRKA 3AVEA 4OGYH 5I1GL 1FN4B 3VFSB 4EOWL 1VFAA 2BP3A 2ZCKL 3S6CA 3ARDA 1U92B 4KHXL 1NFIB 4S2SA 1EFQA 1KPUB 4Y19E 4HUVB 5FDWB 3ARGB 1UXWB 3UYPA 2RFXB 1GGTA 5E2TH 5F3HA 3FQWA 4A6YB 4PREB 2JELL 5J12C 4J3TA 4WENB 3RUGF 2Y25A 4KWUA 3U0WH 2B0SH 5L0QB 3S4SG 3ZO0A 5IJVB 2A9ML 1NBQA 2XICA 3T0AA 3U2SB 3D25A 3KJ6L 5JNYB 4GXVH 5DQDH 2R8SH 1KIPB 4W6WB 4LCUA 2P24B 4M00A 5E0QA 5HGBA 3VXRE 3QIUA 3B9KC 5IW1B 1H5BB 2UVFA 5DK3A 1JGUH 4S1DD 3ARGC 1BZ9A 4FQ2H 4ODVH 4M1DH 3LRHA 4HGWA 1YUHB 3BX7C 2UWEE 2IANB 5GS3A 1JRHH 3SKOB 4AM0B 4HC1A 1NC2B 5EBWA 2ADFL 1CGYA 3MLVL 4EUPA 3ZL4H 5HYEA 3MV9E 5J57B 5HI4D 4NP4L 4QRRA 3DWTA 4LKCA 4RQQA 3NTCL 2LTQC 1GGUA 1RUAH 1GOHA 2IPKA 1X7QA 1BFSA 1F4YH 1OAZL 5JPNA 1MJ8H 5F1NA 2X4TA 3TA3B 1MRCL 5CJXA 1Z3GH 3MXWH 3BPNB 3MLXH 3MMEA 1W0YT 4P5KA 1JRHI 2BCKA 5I15H 5BMFH 3VMNA 5JDJA 4HT1L 3VFVA 2W07A 4HIJA 1E27B 1T7WA 2W9EH 4OLUL 5E03A 2PETA 3QIBC 3TV3L 2JB6A 3QPQC 1X5KA 3E2HC 4Z8FH 1JPFA 3OXRA 1WZMA 1ZA6B 4FNLH 4YBHA 1BLNB 3GSUA 3ZKNC 3EFFA 1LE9A 5DA0B 2R56L 4YX2H 2FL5A 2FR4B 2V9RA 3BH8B 3JWOH 1H3XA 2F19H 1JV5B 2W0PA 2X1WL 4QY8A 5HY9A 1D5BA 3CLEL 4QHKI 4F7EB 3CMOL 4X6DB 2OL3L 3RVXC 3MRGA 4NQVB 4YXKH 3KPLB 2X6MA 2WBWB 4LBEA 2DAVA 4PJFB 3MV7A 4PUBH 1KIUA 3V7MA 1GXEA 3OKOA 1A22B 1BVZA 1D5XA 5DK0A 1KB5H 3VXOA 1CFQA 1L7IL 2K7PA 1W72H 2ICCA 1I8KA 4YWGL 5KVDL 1PKQA 4OCRL 5HI4C 4K94H 4QXUH 4MDJA 4XB7A 3SGJC 2X4PA 3RY5A 2PO6D 4YBQC 4E0RB 3B4NA 4BSVB 4XMKH 3ARFC 4FZEL 2C7UB 3RPKA 5D6DA 3QB7C 2JF1A 2PO6A 4NPYB 2FBJL 3NFPB 4V1DD 4L4VB 5T1LA 5JUEH 5KSAA 12E8H 4P2RA 4Z8FL 1WBYB 2C1OA 4ZAKD 2VLKD 4OZHE 4F3FA 4ALAL 3TFKD 3KVQA 2BY2A 2AGJH 3LKRB 4HX1B 3PJSA 3VGDA 4NN7C 1XCQA 3GMPB 4AL8L 5DUPL 1IM9B 1VFBA 3CVHA 4NZUH 2P5ED 1B4JH 4Z7WA 3TESA 2X9XA 3W0WA 1FZJB 1BP3B 3UTZB 4PJ8B 4BM7A 1KN2L 3LPWA 2Y6SD 1WCQA 4FS0A 1T21A 1QYGL 1VB9A 3P4NB 4LKXA 4LCIL 5HDQH 4HJ0D 3O3BA 4ODWB 1YEFH 5INDA 3R8QA 4JDTL 4U1GB 3T65B 2BSSA 4H25B 4XCCL 4ZPVB 3TO4B 1T89A 1Z0MA 4ELKB 5L7XH 1G1YA 1NUFA 2BVQB 1ZGLP 3MBED 3SKJH 3KPSA 1I9IL 4Y4HB 3SDYH 4HS6B 5B8CC 2MHAB 2FZ3B 1D7FA 2DYPB 3DYMA 4WJ5A 2NTFB 2GJ6E 5EFIA 3HZVA 3VXTA 3IAGC 1P6FA 3Q1SL 2LU4A 4LGSB 4PLJC 5HHOE 5IM7B 2DM4A 5MP6L 1YEJL 2FX8L 1QKZL 4JHAL 1IAII 3G6JA 1WZKA 5F93C 3EJJX 3FN0H 4A6YH 2D31B 3N85L 1N0XH 2WW8A 4U1LA 3WD5H 5J1AB 1DLHA 1VADB 3O4OB 4JCLA 2NY2D 2XTLA 1RUKH 4RAHA 1C7TA 1IZKA 4M5YH 5TH2B 1FZKA 1NMBH 2FATH 2VLLA 2DJUA 5I8KH 2J8UB 2NY4B 3RP1A 1UYWH 4BSWA 4M03A 2VB5A 2CSPA 2FHFA 4JY4A 3L3DB 4KQ4L 3P9WB 1CU4L 2KKQA 3T0XA 1ZAGA 1TNNA 1W0WB 4F7CA 4IOFD 2F5AH 3RUGE 1H8SA 3TBTA 3ULVH 1SYSA 3MC0A 3QCTH 1QD0A 3GM0A 4O51A 5J1SC 1FO0L 3TC9A 3NPSB 1U3JA 2VXVH 2XWJB 2NR6C 1YYLL 1G0YR 3VRLF 1T5XB 2BOCB 2OLDA 3GJEB 5I1DB 1H3TA 1CICA 3LEXB 2ZUYA 3TA3A 1FFOB 4N90D 3PV6B 3SDXB 3BP6B 3MCLH 3NABL 5GGUB 2BCKB 2RCSH 2OR7A 4HJJH 2KZWA 2AW2A 5DD5L 5EIIB 3BEVA 5BVJB 1UZ6E 1SJEB 1E27A 1BOGA 1FGNL 3OGCA 4PJ7F 3V6OA 3BISA 2DKMA 4YFDB 2DM3A 2EH8H 4KMTH 4GG6E 2WQ8A 1BLNA 1T1ZA 4MQTB 5E8DL 4LSSH 1R3LB 4LSUL 2DL9A 2IAMB 5KS9E 5BRZB 3HAEG 2D4DA 1INDH 1FVEA 1ZANL 2DTML 3S34H 3T1FA 1WAAA 1S7UB 4UI2A 3WFDL 5IB5A 4FA8A 2WZPD 1UGNA 5DTFB 5C2BH 5IBLD 4JJ5B 4PTTB 2DRUA 2YA0A 5T33H 5H35A 3LKSB 1N6UA 2YEZA 2VLRD 2C1PB 3IGAA 3DXAB 1ZLVH 3INUH 3HLAB 4IDJH 1WFTA 2X89D 2I07A 5F89A 1I1YA 1LQSR 1YDPB 2IGFH 3U6RB 1QBAA 2CLVB 2Y23A 4J6RL 3O9WC 3T0EB 5MERA 3LKNB 5E70A 1UA6H 5DRNA 1ACZA 1Z3GL 1N6QH 3ARBC 3LKOA 5EORL 1HH9A 2GSGB 4UIKL 2WUCH 2IGFL 3L5WA 1RUML 3JWDC 4ZFOL 3F7YB 3LS5H 1CE6B 1RULL 1XF1A 2PYEA 5E95B 3GIVA 2I24N 3NFPA 4HULB 4XXCC 4PD4K 3VW3H 4MD4B 4NZRL 3O2VH 1BF8A 4G9FB 1AKJA 5DUBB 4R2GC 4Y1AE 2MJWA 1EEYB 4CMMA 2DD8L 3LH2H 4J2XA 3MV7E 5DMKB 1PGRB 4JB9L 2HFEA 3X12B 5GHWH 4EI5D 25C8L 2OJEA 3TBYA 1MJUH 3MZTA 4JPIA 3ZKND 4KGLA 2F15A 1YMHA 5HDBE 1CI5A 1Y6KR 1X5FA 4MJ4A 5E6YA 1KJVA 1U58A 5HHNA 4TNVK 4DKDC 1A7NL 1UT9A 4TULH 2OTWB 5IVNA 3KS0H 2ICWJ 4P99A 5EWIH 4APQD 1EXUA 4WW1A 4PJAB 4EXPX 3DX7A 2MKWA 5C70A 4P46B 4JFQA 3U7YL 3BGAA 3RVXD 5EBMB 1ZLWK 1YJDH 1S7TB 4EN3A 1S7RA 3VRLE 1A7OL 1LGVA 1MAKA 3MCKB 3G5ZB 2XKNB 3JTSB 1A7PL 3W9EB 1YEDA 4BJLA 3QFDA 4HIIB 1FZMA 4M1CC 2F54B 2LAGB 5D1ZB 5T3ZH 3CK0L 1H3PH 4LEOA 3U7WL 3QNZB 1GC1C 2IWGA 3X3GH 4WCYL 4NM4L 1OCWH 4U3XA 4HG4K 3PWPA 5EOCJ 2FZ3A 1MFBH 4YBQD 1UZ6F 5AZ2L 1JN6A 1IFHL 3CD4A 4OZHA 2BVPA 1AGDA 3V52H 4HLZG 4NQTA 5CCKL 1ZSDB 4Q6IC 4DGYL 5IB1B 3O0RL 4ZNEA 3SJVA 1MHCA 3WLBA 1NBZB 2IMNA 3BSZL 2VYRE 1OAQL 4KUZL 1N26A 2XNAB 5E24E 2AJ3B 5E8DH 4Y1AA 1HILA 3GK8H 1A5FH 4KK8D 1ED3A 1CT8B 5GS0L 2X09A 4HCRH 5D1QA 4X0KB 5I1CL 3CU1A 4BH8A 4ZTOL 5JW4M 2HVKA 2MKLC 2WUBL 2D7TH 3GSWA 3OJDB 2J8HA 2RIKA 4QCIA 1N0XL 4BELD 3C5JB 1QO3B 2GJ6B 3FQRB 4NN5B 4YE4H 2IBGA 5T1DL 1EAPB 3CVHL 4B7IA 3PIQB 5FUCC 5I8OL 1IKFH 1CFNA 5EBGA 1JYWA 3VH8B 2ZUQC 2B4CL 3BQUC 4Z78A 3W81A 4LSTH 3MRDB 1CE1H 1MY5A 5MEQA 2CK0L 1R5WB 1U8IB 4DW2L 4PP1D 2A73B 3BPOB 4RX4A 2F5AL 3FQXA 3N1QC 1VFAB 4S1RH 2A6DA 1LWRA 2BSTA 3VGGA 1D6EA 5HYJE 4LMQE 4U3HA 3Q6FB 4L4TA 1GSMA 3CLFL 1MSPA 3C60A 3GMRA 4ZUSB 1J0JA 4FQ1L 1FNLA 4WHCA 4HPYL 4YHZH 3TNNA 3KR3L 4M6ML 5DMYA 4KAQL 2EYSB 1CXLA 5CUSL 5ANMA 4W4NA 1NDGA 3LN5A 4FTVE 5IB3B 1R3IL 3ESVF 1P1ZA 1T2QH 2J5LB 1BBDL 2J5LC 5D7LD 1E4KC 4MA8L 3RAJH 4OLZL 1P84J 5TF0A 1NLDH 3GRWA 3UBXB 4BK4A 4QEGA 1AD9A 2OCFD 5ANME 5F9WC 3PGFH 4LU5H 5E6ID 1RK1B 5TE4L 1TVDA 2A77L 3RL1B 1EHXA 2DQEH 4UV4L 2VOTA 4IDLA 1B6DA 3IDYC 1HH6A 1K2DB 2NY1B 1DBBL 1I3RA 3LB6C 4ONGH 3HE6C 2Y5TB 3QT2A 3RTQC 5JORB 2CPCA 4HWBH 4XP4L 5GRXG 1U3HA 4KDVA 1DQQA 1P69B 4HUXA 2R15A 3UTTD 2FH8A 3IDMA 4M93C 4PTUA 2X4OB 3OKMA 1PG7H 5E9DB 1QP1A 1UJTA 3HR6A 3MRNB 3FOLB 3BD3A 5SWZA 2D2OA 3SKUD 1IGCL 4RMSA 2F53A 1TVBB 3H9ZA 1U95A 3GDBA 5J56B 2A83A 2V5SA 4NO5B 4RFNB 2VR9A 4LHUA 1FL6B 4NOFA 4L9LC 3QHTC 5EIVA 3BKJH 4KTDH 1KLUA 3FMGL 1K9TA 1RJZB 4ODTH 4PGJA 5KG9B 4BUHA 2DQUH 1K8IB 3FO1B 3UZEA 3TEUA 4MD4A 1DQJA 1MAMH 3EO0A 5IFJB 4K8RL 3ZLQC 1L0YA 5EO0A 5JXAL 3H9SB 1ACYH 4QRPA 3RKDC 4JPWL 2NZ9C 3VXUE 4HJ0C 3WIIL 4IRJA 1EMTL 1EZVY 4I3SH 3QIBA 5IW6B 4P49A 4JPIB 2YA2A 4HF5H 5I8EB 1J8KA 4P2YA 1WGOA 3MO1B 3WIHA 2A6KB 4OJFL 1KC5H 5CAYB 4JGUA 3D3VA 1FAKT 3NOIA 4ZYKB 2FWOB 5IVXF 1OP3K 2AKRA 4H0HB 3ORJA 1E28A 4CVZB 4P5TA 5GIRB 1TZHA 4NDMB 1YPZA 4OUUB 4YH6A 2C9AA 4OCLC 5JHDE 3VFNB 4P9HC 1ND0A 1WISA 5C7XH 1A3LL 3JTSA 4P23D 3MRGB 4PUBL 3BRFA 3KPLA 5D7LE 4RRPG 1H15A 4YIQA 2R0ZL 1ZT1A 3U30B 2I9TB 2FJHA 4UAOC 4WUUA 3DV4B 1X5JA 3EYVA 3VXOB 1RSFA 1WTGT 3Q3GB 4UT9L 1LHZA 2DLFL 4Y4FA 1MFCL 1BWWA 4H5SA 4KK6D 3TT3L 1RU9L 2VQ1A 4YUEL 4QOKB 1BIIB 3HA0A 1UH2A 3EO9H 3IETB 2HJLB 2R56H 4GKOA 4P4KC 5IF0A 3NA9L 2H26A 5I73B 5C6TH 1XR8A 2EXYD 3QIWC 4PJBF 1KPUA 1P6AB 5JDSA 3RZCC 3U4EB 3DROA 1T1YB 1B2WL 5LJYH 3QCVL 3QXTA 2NW2B 2XA3A 5FYJL 1BZQK 4JFEA 1SJHB 1MLBA 3UTTB 5HHXH 2GY5A 1KGCD 5TE7H 4GXVL 5AG8A 5C1MB 2IAMD 4HUMB 4OIBA 5B39A 1JWMA 1S7WB 1Q0YH 1B6UA 1RUQL 1EEZA 1GZQB 2DQIL 4HXBH 3RDTA 2GSIB 2NQCA 4UUJA 3CUPB 3O8XA 2NYYD 3MOBL 3D6GA 5JIHA 2GKIA 1AGEA 4NIKB 1Q9WB 4ZTOH 4X5XB 1R3HB 3FQNB 4RX4D 2XKUA 3RVUD 1NGPL 3O2DH 3MRDA 1I7ZB 3ZL4L 1X5YA 1XMWA 4P3CH 4I1NB 4G8IB 4R0LA 1RQ5A 3RPIB 4X98B 4OTXL 5LGJA 1TFHA 1ZS8B 2BVQA 3PG2A 4H0GA 4MAYA 5ABDE 1FDLL 1KT2B 3CFKA 5C0BD 1RIVL 3O0RH 1NFDF 1UFUA 3NCFB 4XNMA 5GS2H 5B8CA 3ZHDA 4YR6B 5L88H 2J3SA 1JZ4A 1ZLWH 3LEVL 4XPBL 4MCZA 4NKDA 4TUOB 5HI3D 1O0VA 5LCVH 3RWEA 5GGVL 3ZDYE 1RIUH 1MPAL 3R0MA 1LMKA 5T3XD 4ZO9A 4K3JL 3MLRL 1QLEL 2NY6B 4NHCH 3MMEB 5L8KB 1KCUL 1T04B 3HNTH 3U4BH 5L2JA 4J3WA 2HH0L 4GW1B 4NRZA 2JJTC 3C60D 5I1IL 3OXSA 3G5VA 3NGBC 2CKBH 4WI2A 3F6IA 4LPCA 4DOHB 4UBDD 1GCFA 1SVZA 5AWNH 4BFIA 3HFML 5JIIA 1GAFH 5KSUA 4D3CH 2W60B 3TGXA 3GO1H 4UV7H 5GGSB 3FOLA 3QO0A 2I5YH 3VXPA 3MODH 4XPHL 2ITCB 4ODUB 5F6HJ 2XQBH 3K1KC 4TRPL 3WO3B 1KPVB 3TPUB 5I1KL 1UH4A 3FO9A 2VDNH 1KTDA 2G2RA 1CICB 2KQNA 3LEXA 4WU7A 3L1OL 4LAJH 2A74B 3UJTL 1AQKH 1ZLVK 4G8GA 4FP8L 2CRYA 3QDGA 4O02H 5D93B 3GEWB 2AJZA 3O3DA 4WO4B 2G60L 4X4XA 5ESVB 4NQXA 4HJGA 5ITBH 1MCNA 2HFGL 4UIMA 1I7UA 4PJ9A 3UROR 1AIFB 4UBDC 1G0DA 2UV3A 3OGCB 3LV3A 4AG4H 3QJFA 3MRMB 2JCCB 1FV1B 3MO1A 3H42H 1EFXD 5DURD 1A7NH 1OTTD 4FQIH 4WHTB 3SGEH 4WFGE 4WO4C 3LS4H 1MCOL 1QFWL 3GKZA 5GHWL 4JPKH 2R2HA 4JG1H 3B6SB 5IVXE 4PJFE 1AE6H 5JR1H 3GSXA 3LIZH 4NCDA 5H2BA 2M2DA 3O2WL 3VWKB 5MEND 4JM4H 3L3OB 2VDRH 3X14B 1OL0A 3VXUB 3H6JA 1LP9B 3FO2A 4F8TA 1FG2A 4XCFH 3CSYA 4F7MB 5I30L 3BHBB 5IEHB 4HH8A 3DMMD 4MNGB 3OSKA 3O9WA 3O6FD 5HGHA 4L29A 3RVVD 2O93L 4LPWA 1DDHA 1BAFH 4OZ4A 3EZJB 3LKOB 3PWNA 1XZ0B 3M17A 1FNSH 1Q9OB 4BKLA 1J8HA 4QXGH 5IIEB 43CAB 2Z8RA 2ICWI 4PP1C 4OFIA 5IMKA 1NCCL 1AR1D 4GAYB 3W5MA 1XF5B 1AP2A 2YZ8A 3LRSA 3PHQB 4GO6B 3VXRD 3R0NA 1F6AB 1OB1A 2VDRL 1I8MA 1JGEB 4KK9D 2SEBA 4M3JA 2GAZB 1HINH 1WTLA 1A1NB 3HZVB 1FBIL 4RFEA 4XXDA 3UTTA 5EBLA 2F9BT 2VAAA 2KUTA 2DTMH 3S34L 3HG1A 5DSCB 3U9PH 2CLZA 1PD6A 4JE4B 2IADA 1RZIB 1VHPA 4PGBB 1SQ2N 1JWUA 4ZPTB 1GPOH 4OGXH 1WBXB 3CUPA 5I74B 1FPTH 5FXCH 5J0BA 4UDTA 4MD5A 5GXBB 5IHLB 1LD9A 3CFEA 3A6BH 1CG9B 1AGEB 4QNPF 3I84A 4XP5L 4HK0B 4WHYG 2YD4A 3Q0HA 4AK1A 1FL5B 2H6PA 5E2WL 1YEKL 2O5ZH 4YEFA 3FB5A 4Y19B 2J4WH 4BH7B 1X4YA 2AJUH 2NR6D 3MACL 2YUXA 3KNBB 5B3JE 4JHAH 3CZFB 4MAUL 3S88L 1NDMA 5C0CD 4QRQA 2CD0A 1J0ZA 3LEYL 1LDPH 2HG5A 2YWYA 3TT1H 4N1HB 4YO0A 1F90H 1T66C 2H9GA 1J9CT 1N2RA 3EBAA 4F57L 2X4SB 3BT2L 2GT9A 2H32H 5GRVL 5K9QG 1QPXA 1AC6A 4D3CL 1AD0B 3ZE0F 5CGYD 3HE6B 5E1AA 1KYOK 1AGBB 1BEYL 2VDOL 3RZCB 5D72L 1OP9A 1YN7A 2OP4H 4L3EE 1OAXL 1UACH 3PDDA 4V1DB 5D1QC 5HDOA 2EYTA 1DQLL 4UB0H 5FGRA 3QH3A 3LD8C 1ZT4A 5JO5B 1P4IL 4KJWD 5KSVB 3W39A 3GB7B 2HJFA 2D7NA 3O2DA 1NFDA 4P3DA 3MLWL 1U8JA 4U6YA 2PXYD 1NC4D 3S37H 4NNYB 1CS6A 3LCYA 5BJTA 1BJMA 1KXVC 2H2SD 1RIUL 4DJMA 2UWEA 5C0FA 4XNXH 2VWEE 1FJ1A 3KPQB 3OPZH 3IJYB 2ITCA 1BZ9B 4JQVC 5JTWA 2LAAA 4MHHG 3LKSA 5DGRA 1NBVL 1NQBA 4ODXB 3MUJA 1SEBB 2F8OA 2YS4A 1CFTA 1Z9SA 3EO9L 3SKOA 3MLYL 4CGTA 5C08E 4U1MA 5C09D 1Z5LA 3GBNH 2FX7H 2BVOA 4P5MB 4P59H 5J4MA 1CCZA 1T0MB 4M8QA 5DDHB 1TTUA 3FB8A 3WUWA 1OTSC 3IVKA 3Q6GH 5E2UH 2HT2D 5FGCE 1C7SA 1RK0B 3VD5A 4E41E 2W0LA 3F7YA 1JYXA 2UY7A 1S3KL 4X4ZA 3UDWA 1XEDA 4WTWA 1U8KB 2XIDA 3DIFB 5HHPA 2DQIH