1Z9OA

1.9 angstrom crystal structure of the rat vap-a msp homology domain in complex with the rat orp1 ffat motif
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
119
Chain Sequence
b'EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVWKEAKPDELMDSKLRCVFEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein-associated protein A
publication title Structural basis of FFAT motif-mediated ER targeting
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding/lipid binding protein
total genus 20
structure length 119
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z9oA00
1P7HL 4OT1H 3BH9A 3VRJA 1A5FH 1TZGL 3V6FB 3RBGA 3HR6A 4MD4A 5GIRA 5JXED 4FNLH 4JFZH 1XGPA 1YEGL 4G9FA 4KRMB 3ORJA 1JPTL 3QHFL 3NA9H 4A6YL 1AY1L 4FHBD 2F74A 1QEWB 4OF7A 5DJYB 3WFZA 4LCIH 3WNMA 2UWEA 5DD3L 1CVRA 1TENA 3EYUH 2W92A 1JN6A 1GZQA 2DBJA 1UYWH 3WNLA 4JB9L 5T5FH 3D5OF 2OSLA 3OAUL 4P4KD 3U9PH 4JVUA 4GKZA 1MREH 3O2DL 2DIJA 1FPTL 5DUPH 3T2PA 2DMCA 4X5XB 1G6VK 3MYJB 2OK0L 5HYEA 4HH9B 1A6VL 4NUGL 4U1JB 1BLNB 3WFDH 5E08H 2AEQL 3J8F7 1AD9A 3MRFA 5C9KA 2IPTH 2WWMC 3LIZL 5D2LA 1CLZH 1IM3A 4JRXA 1ES0B 5DJAA 3AM8C 4X99A 5B3NA 3W2DL 3QXVA 2V5RA 2UY7A 2Z8VC 5I1JH 3TA3D 3C6SB 2BP3A 2DDQH 5GGVL 4ZOCA 5KSUA 1NMBH 3IFLL 4QRSA 3TIDB 3EYVB 4RFOH 3A67H 2P8PB 3I50L 3NFNB 3KPNB 4PJEA 5T3XH 4M6OL 2ESVD 1FFRA 4WENB 5TDPA 5KG9A 1TZIB 3TBVA 3U6RA 1DQDH 3NH7H 2QBWA 2VB5A 3IS0X 5EWIL 5CBAA 2DBLH 3QWOA 2QQKL 1CZ8L 5I6XB 2BSSB 2X2YA 5SWSE 3QEQD 1T5XA 3VJ6B 4MA1B 1IQDB 5CINL 3TVMB 1AD0A 2HJFA 3DGCR 3PQYD 2ATKA 3DXAE 5HGDB 3NBNA 2ICCA 3QNYA 4GOSA 1W0WB 4CN6A 3LN5B 5EO0B 4HCRA 2NW2A 3PNWB 4FQHA 1Q0XL 3VI4E 5C0DB 1NDGA 4F58L 4JANA 3OKEA 2H45A 2P45B 3OX8B 4HFWA 5EO1B 2Q7YA 1SM3H 3BP6B 1EIBA 2LU3A 1A2YA 1Q9LB 3P0YH 3UYRH 4XMLH 1Q72H 2ENSA 5D1QB 2A6DA 3VGHA 3H3BC 4NFDA 1FNGA 1AO7E 3HRPA 1JHTA 1HIMH 4JQIL 2NTFB 1II4E 3W0WD 2HKFH 2NR6C 3RTQC 1P1ZA 2HVKB 1HI6B 1NL0L 1X5IA 5AZEL 2XXMB 1Q94A 1HQRB 3SJVD 2ADJA 4L3EA 3B3IB 4KTDH 1ONQB 3NIDE 2F58H 4K07A 3RZCB 4F7CA 3JV6A 4QRRA 3NTCH 3IF1A 1T22B 4OUUB 4Z76A 3L7EB 3Q48A 4W6YB 3RIFK 1FBIL 1T3FB 4O4YH 3DV4A 4HQQL 4Y7MA 3BDYH 3GBNH 2OX5A 3OG4B 4TSAH 1NAML 4X7TB 3O6MH 1ZAGA 2CKNA 2XTJE 3RWJA 2Z4QA 5T3ZH 3LPWA 4YXLH 3CSBA 1QVOA 1MWAA 5DD1L 1MHCA 5GS1A 4NZJA 3RU8L 2XRAH 2A77H 4W6WB 1XIWD 5CSZB 5FF6B 3H42L 1HHGB 2VDKH 5SWZE 4HLZH 5IBUG 4P9MH 3ZZ1A 3AROA 3TM6A 2CLVB 4OSUL 3RVVC 4FG6D 3ARZA 3FKUS 4HF5L 3F7VA 2HFFA 5C7XL 4WVRA 1DVFD 1T1ZA 4XNQA 5EU5A 4XC3L 1P84J 3B2UC 3VI3E 3FCTA 4LLMA 4DVBA 4J1UA 3MLUH 4UUJA 3TH2T 4P5MB 3KPQB 1JWMB 5IB2B 2J5LC 4RRPA 3W9DB 4HJ0D 4L8CB 1TITA 3MROB 4G7VL 4NO2B 4XAKE 1QBAA 1V7ML 2VXUL 4I0PC 4P4KB 3QIUC 2WINB 1INDH 2E27L 1A3QA 3O0RL 3CUPB 2P43B 3RGVC 4HKJB 3HE7A 1TQBB 5CZXD 5BZDB 1YN7A 2B1AL 3F62A 4FFZH 3T65A 5CCKH 1NC4A 1DBAH 3RWFA 1QQDA 2VMFA 1NBVL 3QNZA 1RIVL 5I15H 4NNXA 3O9WC 2R56H 3L7FB 1IGYA 4Z7UB 1G7PA 1AE6H 3C5ZD 3DTXB 3G6JF 5DMKA 5K9JL 4UMGA 5LCVH 1CFVL 2XFXB 3TA3B 1AFVH 1N2RB 3P40A 4F2MB 5JW4N 2V2TA 3ZDZF 4N9GA 5E2UH 4TVPD 5I1AA 2X09A 1IZJA 1IAOA 2ESVB 3BT2H 5FYKE 1NBYA 5JHDD 2BK8A 4ODUB 3OKYA 4K23L 2IAMD 1RI8A 5DK0B 3MV01 2Z9TA 3RPKA 3KPRE 1IC5H 3S36X 5I66A 4ZOBA 1I1AC 2R0ZH 3HAEB 2FLRT 3QEQB 5IVOA 4YDIH 4FQ2H 5D96B 1I3VA 1O7SA 3QHZH 4WJ5B 3PQYB 4P2QD 4KJWD 3V2AR 3EDDA 3TCLB 3EDEA 3SE8L 5FIEA 1XF5A 3VG0L 2Q1EA 1W72H 2HLFD 3E3QC 4PJBE 1JTOA 5T1DH 4NZRH 32C2B 2EDKA 4OB5L 4NT6B 1NCWL 1DLFH 3QDJE 3MLTA 3O6FD 5EB9A 2YD7A 1IQWL 3BDXA 1FJ1A 4YX2L 3SDXF 3ULVH 1FG2A 4J4PC 2VH5L 2AAVA 3EBAA 3VFPA 1I85A 4ELKA 3PDOB 3SDAD 5H94A 4YHNB 1XH3B 4WW1A 5A2LH 3W0WB 2WBKA 2NZ9C 2XQYG 1CXLA 1QACA 3D1MC 1P7QD 3S5LA 2BNRA 3IU4H 2VDLH 2F54E 3SJVB 4U1LA 2CK0L 5EU3A 3RP1A 4XHQA 4NWUL 3ZTNH 3PL6A 3WUWB 4MB4A 3BW9A 2A2QT 1OTUD 5D7IF 3KGRA 5F89B 4J3TA 1QOKA 2P5EE 4XVJL 1JNJA 3AFLA 4D9RD 5DMIL 4GW1A 1CFNA 4OCMC 3KAAA 5C92A 2ZOKB 1SY6H 1Z3GL 3F7QA 3ZMRA 4HPOH 1KCKA 3EIFA 2VDPL 4NQED 3D0VA 1CXIA 1RZFL 4P23D 3HMWH 5DD6B 3TT1L 4MAYA 2X89D 4M1CC 1HXMA 1F4WL 3MRNB 3CLEL 3HI1B 3KPTA 1XIWB 4I2XB 2YK1H 2CO6B 1RHHA 1HHHA 2HT2D 3DUSA 2RIKA 3THMH 5J11C 1Y6MR 5E70A 1ZT7B 5F21B 4UOW1 1IGTA 5DJ8A 1X6NA 3MZGB 3DGGB 2EDYA 2YPLE 1MCPL 2AJSL 2NYYC 4Y5XA 3RVTC 4E9LA 4BKLA 1DVFB 4BFEA 4PPTA 4S1RL 4Y8AA 5C09E 1RK0B 4CAGA 5JA9A 4ZXBC 1S78C 4H25A 1MRDL 1UH3A 3QWQB 5D1ZD 2EDTA 1JRHH 1VHPA 3VFNB 3V0WH 1KN4L 1DLHB 3OPZH 3RY4A 2CDEB 3PHOB 5I1HH 4KFZC 2IGFL 4LIQL 1WQVT 1NUFA 1H3PH 2ZG2A 1CLYH 5IW1B 2EZ0D 4K94H 4RFEB 4UDUB 5KSAA 3SY0A 4RFNB 5E9DD 4M62H 3RJDA 2RFXB 4GXVH 4HXAH 3QUZD 1GHFH 1LP9E 1F8TL 4L4TA 3U0PA 3V4UH 1ZANH 4X7EC 3VXOB 5JUEL 4KUCF 2FL5A 2KH2B 2PYEA 3MRPB 4MNGE 3HCVB 3HUJE 1NSNL 1TNMA 3C5ZB 5DS8A 3N1PC 4DZBA 3QUKA 4KJPC 4DTGL 5IJVB 3BVNB 3O2VH 3RFZC 2LVCA 4OZHB 3FFCA 2WP3T 5C0JB 2OR8A 4ZUVB 2HTKC 3UCRA 5I1KH 2V7NB 2AQ2A 2BX5A 5JHDB 4CNIB 4MAUH 2IAMB 1K8IA 3MLYH 3HPLA 4KHTH 4N8VG 4Y4KD 3BZEA 3X12B 4PGDA 4YDVB 1BMGA 2FCBA 4UNVA 4S1DC 4WTZG 5CGYC 4P2QB 1FZKB 4F57H 1Q9KB 3IGAA 3U7YH 5DRZB 4OCWH 5H2BB 3U0WL 4G9DB 2Z91B 3L3GB 4LASL 2R15A 4HIHB 1EJOH 3UAJD 3HZVB 2OQJA 5IB1B 1LE5A 1MY7A 1TCRA 4NQVB 1JZ6A 4N8CH 4X6DE 4P59H 2CLZB 2NY6D 1R5WA 1NBZA 3LEXB 3O6FB 5F9WC 4DKDC 4JRYE 2AI0H 5DXWA 5HGHB 1B6DA 3MRRB 4DAGL 1L7TL 3S6CA 5GZOC 5I8OL 3DVGB 5IFHH 4XXDB 3K4DA 1Z5LA 5H37H 2XWBA 5EIQA 3NIDF 4Z95H 3BJLA 4PJ5D 3R8QA 1MCFA 2RB8A 5ANMA 3NPZB 3QH3B 3LMJH 4XNMB 1P7QB 3HMXL 2A1WL 2ILLA 2DWDB 4MQ7B 3ALPA 4Q9CA 1P7KA 4Q9QL 4R0LA 2EDNA 2CQVA 1EK3A 1E4WH 4WNQB 1CI5A 4LSPL 1FO0A 2ZKHL 1QLRA 2AJXH 3QFDB 1ZK9A 5BMFH 3SQOH 4PJAA 4KK6C 3EOTH 3U46A 4ZO7A 2C4FT 1DSFH 5BJTA 1B6UA 1CG9A 4JPVL 2F8OA 4CW1A 3WE6B 5CUSL 3VFRB 3GK8L 4M93B 3RX8A 5HGBA 1WJ3A 3UJIH 3FQUB 4NQEB 3LZFL 4PFEA 4V1DD 2AXGB 2CDFB 5DUMH 4P23B 1FVEA 1C08A 1SBSL 3OGCB 3WS3B 4YFEA 4POYA 3VWKC 5IMLA 1U41A 2Y25A 1EO8L 1QFUH 2IQ9L 3IJYA 3VI3F 1JMZA 3MGAA 3NCCB 5BRZE 2NY4C 4IHOA 3TH4T 4Q0XL 1FFOB 4GG6E 3TYGH 4XPHL 4WI4A 2FHBA 4HWZB 4L9LB 4G8EA 1MCBA 3MRDB 3MMEA 4AM0A 2EE2A 4JDTH 4HWBH 4X4XB 2EDFA 4PJ9C 4H20L 3IKCB 5IHZB 1U6AH 4K55A 4LOUC 5D1ZB 2Q86B 4N0UA 2PKDA 1U91A 3ULUH 4H88L 1T2JA 2GEEA 4UINH 1S7RB 1KGCE 1U8OB 2Y23A 1CL7I 3MV9E 2VZSA 1FC2D 2W1NA 5E9DB 3RVWD 4PGJA 5ID1B 4NN5B 4PJDB 3U48A 1DQML 4YEEA 5E2VH 2CKBH 4HIJB 4QRQA 5CILL 4WHTB 4AEHL 2IALB 3L95B 3QUZB 4NQXB 3VWJA 1JPGB 4MJ5B 4Q6YA 4YHIB 2YBRA 4NDMA 5DLML 2HKHH 4U7KA 4LGPB 4X0KB 1YA5A 3ISWA 4PP2B 7CGTA 4X83A 4PD4K 3BXNA 2DQTL 3GIVB 4WDIB 3BH8A 5I75B 4K8RH 4K3EL 3V0AC 3QUXD 5C1MB 1ZWIB 3BZFA 4H8WH 3NGBC 4F7TA 4FQIL 4OI9A 3IRZA 2R1YB 1U8LB 3MXWL 4LCWD 1QRNA 4KXZH 1J1PH 4U0RB 4LLUA 5CGTA 4Y4KB 1I1RA 5FGRA 4HAFA 1M6OA 3QQ9D 1EFXA 1QPPA 5BVPH 2AJUL 5JLZA 4PJBF 1P4LB 2DMBA 1QR1B 4X7DC 1OVZA 2WIIA 2YR3A 1SMOA 3WJJC 3GMPA 2HJLB 2DQGL 5ITBH 5DGQA 4ELMB 1FNAA 3QI9A 1I4FA 4KTEH 4R2GC 3UZEA 1NGQL 4JKPH 5TF1L 2W60A 5DQJB 2WP3O 1JNNH 3SO3C 4YAQA 3PF2A 1WT5C 3GSRA 2NY6B 3SQBA 1FYTA 5ICZB 2PTVA 2AV1A 1QSVA 3GSUA 3UYPA 4JCMA 4BQ6A 4NNYA 2DLHA 5TQ0H 4MXWH 2P8MB 5A3IC 4K7FA 1JTPA 3R8BB 3O4LA 1I7UB 4PRAA 4Y16A 4PJ5B 2DQEL 1KJ3L 1AI1H 1JFQL 5EOTB 5J1AA 1HINL 1KCSL 5D71L 4UT6L 3OWEA 1S9YA 3PWLA 3P9MB 1VGEL 1L9MA 3DRTA 4UB0L 1CFQA 5FYKL 2WM0A 3G9AB 4CVZA 3RL2B 4Q97A 4QNPE 3REWA 4KRPC 1MHHA 1S8DA 2BNQA 4MDJB 5K9KA 3C8KA 5IMMB 4PJ7E 1NGXB 1OT2A 4XGZB 4M8QA 2I9LA 2PO6D 5DHVB 5E5MB 4HS8L 2VL5B 2GHWB 1GGYA 4OV6F 4M1DL 4BM7A 1N0XH 5CEZH 1U8IA 4UOW0 1VEMA 2FECI 3DETC 5IP4A 2CD0A 1R24A 2Q3ZA 4EDXB 3P9LB 4V1DB 4OIIH 2YUXA 4MJIE 3RZWA 3VXUE 2DTML 3BPNB 5IUSA 1UM6L 2H41A 4MD0A 1UA6L 3OF6D 4NBYB 4XCEB 3L9RB 2XI9A 4KI5C 2R2CA 4RX4A 3QUMH 3P2TA 2AJ3B 2Q8BL 1GGUA 3UO1L 1BGXH 4NM8H 2E7HA 2UWEB 4HUVA 2YD8A 5IVXE 3WLBB 4MMXC 5IK3A 2Q3AA 4Q6IB 4DEPB 4R7NB 4Y1AD 5LBSL 3QG7L 1LP9F 3KWWA 4ZODA 4PGCB 1BD2E 1FN4B 5B39B 1KPUB 3WN5A 3K2MC 4NGHL 2YPKA 4JN2B 3HUJF 4OFYD 4GAYA 3ES6A 4MNQE 2MJWA 2GFBB 1JF5A 4BUGA 3CGTA 2XNAA 4LARH 5HYJE 2YC1B 3ZT7A 4G6MH 35C8L 2GSIB 4KVCL 4NZUL 4RIRA 1TVDA 4S10A 4KTYA 5MHSE 1RJCA 2ZJSH 3BIKA 1ZHBA 3Q6GL 4KAQH 2AQ3A 4OCRL 1C1EL 5IG7A 5D72H 1U8JA 3V6OC 2W9LA 4U6HB 5DVNA 3MV8A 4DQOH 2OL3L 4UV4H 3F7PC 1OAUL 2MFNA 1G9NC 3QUXB 4J12A 4OZGB 4EBQL 2NY7L 3QDME 5TDPB 3T8XA 5D9SB 1VFOA 2EDOA 4LLWB 2M8XA 3VXNA 5I73C 4MA7L 5TDOA 3S7GA 5E5UB 4JFQB 2IAND 3WLWC 4LCWB 1JPST 5FHBH 1AGEA 3GMRB 2AJVL 1T4KB 2DQIL 4RA3A 4HV8B 2BJMH 4PJFE 3EYOB 4UU9A 5DD1H 1U42A 1AD0B 2F5AH 3FQNB 1WFOA 2P8LA 1BF8A 5DGRA 2ICWA 2MQ0A 3MV7E 4JDZB 2OTUB 3RWHA 3P73B 3TEUA 1MVUA 5DRXB 4U1KA 3CXDL 2NW2B 5EZLB 5I30H 3QYCA 4EI5C 4KDTC 1OSZA 3NOIA 4B53A 1QFHA 1RMFH 1AQDB 5FHAH 3S3PA 5ISZD 1VEOA 2ZSWA 3BPLC 1CF8H 2QSQA 3FOLB 5IT2H 2AJZA 2BY3A 3ZL4L 1G7IA 1M05A 4Z7VB 3WNOA 4EUPA 1W0VA 1YECL 2Q6WA 3GKZA 4GRMB 3P4OA 4D8PA 4NQDD 4IMKA 5L2KA 1F6LL 4JDVB 1B2WL 2UZXB 5JW3H 4G6KH 3MRIA 1LO4H 2BMKB 1RUAH 2NR6D 4F9PA 4TSBL 3RTQD 4N0RA 1AXSB 1F90L 2BZDA 4KU1A 1EHNA 2E3VA 2VERN 3IF1B 1YQ2A 1XT5A 1TVHA 5ICXA 5J8OA 4ZO6A 4NUJA 4AJ0A 5CIPA 3SDYH 3L3DA 3O8XD 5CLTA 4RGOL 5LAXA 3LEYL 1ZE3C 2WUBH 2NX5A 2B5IB 3MPCA 5FAAA 5HD8C 1I3RA 2PO6B 3D39D 4HMEA 5JNYB 1IKFH 1V3JA 2LTQB 5EC2A 2NY5H 1NUGA 1G6RB 4XP4H 4MVBC 4NSKA 1OM3H 2UYLB 5CMAB 2V2XA 3D85D 4ONHB 4GG6F 1F6AA 2NNAA 1VKXA 3GSNA 4OGXH 3V4VL 3SGJA 3I6LD 3U0TB 2AVGA 1BQHG 3DO7A 4GMSL 4EOWH 3VXPB 5EOQL 3C60C 1WBYB 5HHOA 2X4UA 1RZ7L 3MCLH 1H8OA 2G5BB 2W59A 3BX7C 4LSVH 3TBSA 3IDGB 4XNQB 2B4CL 1WWCA 3KDMB 1NGPL 3RVVD 3QPXH 5I17A 1D6VL 1KJ2A 3FQTA 4DVBB 4J1UB 4PGEB 3SKMA 3B2UD 2HT3C 1WFTA 4PRBB 2MWCA 5IHUH 5ACLA 3JZ7A 4I9WD 1ZS8B 4TULH 3QRGH 3TGXA 4HMCA 4Y1AB 4NWTL 1U3HA 4I3RH 2G9HA 3O6KH 4I0PD 1X5KA 4OLVH 1IAKB 3ARFA 4RGMB 3Q6FA 4QEGA 3CPLB 2LU7A 2XZAH 3T65B 1FORH 3RGVD 3TC9A 3WO4B 5D8JL 1NFDB 2AEIT 2JELL 2ENYA 5DTFA 1A6UL 3JWDL 5GZNC 4NNXB 5B22A 2CUHA 2CIKA 4ZO8A 3GUTA 4OLYL 1G7PB 3QJHA 2VXTL 1RJYA 3QZWG 1S7QB 3SDCC 1D5MA 5F7YC 4OQTA 3HN3A 1R3JA 2XTJC 3O9WD 4Y19D 1ZLUK 4MLIA 2ICWI 4WHYH 3FO2A 1PZ5B 3NCMA 3SGKA 2N7BA 1UWXH 3ARQA 4XHJC 1AGDB 4BH8B 5IOPA 3EOAA 4WTZA 4U1HB 2VXSH 5C0AD 1J8HD 1NBYB 3U4BH 4WUKL 5J6HA 2ZCLL 3QCUH 1FLRL 4QF1B 5JIHA 4A2MA 2CLRA 5DSCA 2K7PA 4ZFOA 1HK6A 3KPMB 3INUH 1MNUH 4OBRA 2R4RL 5MEND 2PW2A 2IANB 2YN5A 4MA3B 3SKJH 1IGJA 2G5RA 4O2EB 2CMRH 1ETZB 3G5XB 3UPCA 3V4PH 2QEJA 5KW9L 4MB5A 1E28B 3EDFA 1UB6B 1JNHB 1I1AD 3WSQL 4YR6B 1V5JA 4N0FA 3GO1H 3H0TA 4WWKA 1CFSA 4HX1A 1D9KC 1UT9A 3MFFB 4MZ2A 1FE8H 4PJCB 4C59B 1ZLUH 8FABA 4ZS7H 3HI6H 5JIKA 3E6HB 1A9BB 3RI5F 3KLAB 4QTHB 5DJ0A 4GW5A 4BZ2H 5IIEA 3AGVA 5E99L 5ISZB 3ARGC 3QO1A 4Z7QF 3VCLA 1Q9OB 3S36H 1XF3A 5D2NC 3PWNA 2HG5B 1INQA 4OZIB 1QO3A 3EOBA 4ALAH 2APBA 5F7WC 4FQ1L 3MRMB 2X44D 2ADIB 4ELKB 4LCUA 4J4PD 4QRUA 1OLZA 1NCUA 2HMIC 4NQDB 5DMJB 3C08L 5E2TH 4L3CA 2R0WH 2H2SD 1QFWI 3BSZH 2DI7A 2RCSL 43C9B 2C4XA 4QNPF 5GGTA 3U36A 1CGUA 3HTLX 4O2CA 4XPBL 3RTQB 1LK2B 2ZUSA 4PJ7F 1B90A 1KG0A 1M7IA 2ZNXA 4K7PH 1NEUA 5D7SL 1T83A 3ROLB 4OCNC 3O8XB 1AHWC 4GW1B 1KT2B 3L5IA 4O02L 2NTSP 4LEOB 3X3FH 5FYLH 4Q58C 1ED3B 1TIUA 2XZQL 3D39B 1MFCL 4DJMA 1RSFA 3QCVH 5CEXB 3DX6A 4J3OC 3C87A 1YY9D 4IRZH 3MJ8B 2AXFA 4DKEH 4ZSOE 3CCHA 1G9NH 3D85B 5SWSA 5ID0B 1T89C 1Z2KA 2ICEB 4HG4K 1Q0YH 3PWJA 5TF0A 4M1CD 1I7TA 3ARYA 2DIAA 4U1IB 3UMTA 5TE7H 4U2YA 5IVXF 4TSCL 4Y5XB 3RVXD 3OR6A 3WKMH 2C3VB 4I3GA 5EBWB 1BZ9B 3E2HB 4WHCA 2MTPA 3RVTD 2ESVE 1CE6A 1D5BA 4P2RA 1YMMA 3MGOA 2FB4H 5MEOB 2W07A 1QSFE 2W0FB 4LKXA 4ZXBD 1S78D 4HK3N 2J5LB 2ZUUA 5ETUB 5TE6L 5HHXL 4BZ1L 1DBJL 4I0PB 1YEDB 4LSUH 4M8VA 3C6LC 4KHXH 1Y6KR 4XVTH 2C4FU 4HUKB 4L4VE 2V2WA 1SHMA 4ORGA 1F2XK 1LHZA 1AGCB 1S7UB 3UTQA 3FO9B 4Z7WA 3BRGC 3CVHB 1J11A 2DS4A 3MRLA 4PJXE 4WI7A 1KLFA 1UACH 5AYUL 1GAFL 1MFEL 5ACZB 4PD4J 3OB0K 3BP5A 4OLWH 3RA7H 4WEBL 5HHVL 3QUKB 1OF2A 3O9WB 5DR5L 4Y19B 5A16B 1SJEB 4JEGB 1OQXA 1BQLL 1FVCB 2DQJL 2XA8L 4LSSH 4OV5A 4KV5E 2GTWB 3P77A 4LDEB 3V6BR 4YHZL 1RU9H 1I8LA 4EI6B 5FECB 5C0AB 4ODXA 1J8HB 1KLGB 1YNLH 5IKCB 4PJFF 4LSRL 2AP2A 3ARPA 1MJ7H 2CR3A 5E8OB 3WIIH 3D9AL 2X4PB 4G43B 2LV4A 4I48B 5E8DH 4E42A 5MENB 4N1CA 4BQCA 1TJHH 1MRCH 5SWZA 1C12A 3KG5A 3GB7A 3RWCB 1CIUA 4D3CL 1I1AB 4WO4A 4Y2DA 4Y89A 1B9ZA 1EO7A 1MCDA 1BVKB 2VLRE 3OB0H 4JG0H 3S3JA 3FOMA 4FQLH 2Z93A 3STLA 4I3SL 4S1DD 2ZPKL 5ADPL 1DUYB 1K5NB 4BFIA 3GSWB 3SKOB 4QHNB 3MJ7A 3WHXA 5B38B 4GAJH 1RZIA 4J6RL 1UCBL 1HWHB 2WW8A 4NZDA 5IEHA 1WICA 1HEZB 1H8SA 3QXDB 4KVNL 5JPMA 2KKQA 2O5ZL 3LKNB 1DJSA 5L88H 4HCRH 1VENA 5FK9B 4EIGB 3CFEA 1XR8B 1JV5B 4JO1H 1J86A 3X17A 2FO4A 2MPAH 3HR5A 5LXGH 5GZOD 4XXCA 3QO0A 4OGYH 4NQCE 4RISL 1C7SA 4F33B 1QFPA 2GJ6D 3KLSA 1V3LA 1T20B 3G6AA 1A4KB 1DQMH 4YFLI 4G8GD 4ODWB 1OSPH 1QLRB 4U6YA 4JO4H 4K2UL 3O3AA 3LPGA 1KB5B 4QTIL 1LNUA 4Z77B 4YHOL 1RZJH 2DM2A 1B4RA 3U46B 1OAQH 4DN3L 4B41A 5BS0A 1AXIB 1CICA 3WIFB 2C3WA 5F9JA 1SMAA 4TYUA 5JQ6H 4KK6D 1EFQA 3LKSB 5FKAB 1FNSL 3UJJH 4KUZH 4QOKE 2E7BA 2IFFH 3P4NB 4GMTL 2EXWC 2R2EA 3KPRA 3BEVA 3S97C 1NLBL 2A83A 3FT3A 1FVEB 1TQCB 2FIKB 2X7LA 4RDQG 1LEIB 1A14H 3KYNA 4QO1A 3B4NA 1FL6B 2UZYB 4U6XB 3OKLA 4KK8C 1LO0L 2DD8L 1MWAH 4HFUL 2R4SL 5TGBB 5F72S 1O0VA 3VWKD 2J8UA 5HHPA 1G7HB 4WI9A 3UTZB 3DO3A 3HLAA 2NY4D 1J0KA 4U2ZA 3KYKH 5J11B 2B4CC 3SPVA 5EU7E 3G5VA 2H1PH 3LEVH 1NGZA 1VACB 3JWOH 3A6OA 3P0VH 2R1XB 4V2CB 4OZHE 4X6EA 1C5CH 4A6YB 2AW2A 4JZJB 1CD0A 1UKTA 4U05A 3VFVA 2PXYA 4RAUB 1CDIA 3CX2A 2DQGH 4PJ9D 5FCUH 4ZXBB 1EX0A 2D7OA 4M48H 4DN4L 4LOUD 4DGVH 5HPOA 2HYMA 4JFHD 5EA0H 3HA0A 1HSBB 5GGRY 3I9GL 4RNRB 4IOIB 5EC1B 5CJ5A 2X4QB 5GGVY 4GXUM 2DKUA 3CFBA 4QRQB 3BHBB 3KJ6L 4LBEA 3TO2B 2O61A 2FO1A 3ME0A 1WZKA 4QT5A 5FGBC 3FB5B 3JWDC 3AUVA 3L3KA 4GLRI 4WGVB 1FZMA 5KVMC 5DQ9A 2Y5EA 5F96L 2LFGA 5HHQA 4F7PA 2P5EA 3K3QA 4MD5A 3DYOA 4UTBL 3BXNB 3RGHA 1DL7L 1KTDB 3BH8B 3MACH 1RULL 4WUUD 3I75B 4LVHB 1I8KB 1LVEA 4R4NC 3OJDA 1HQ4A 2MMXA 5GGRB 3NFSL 4JY4A 4GRWB 5GGUA 3P30H 2BC4B 3RUGA 4B7IA 2O5XL 3KXFA 4LGSB 4X6CA 3C5JA 4LHUD 5CJBA 3ROOB 1EEYB 3MZTA 2HRLA 5JQHC 2FSEB 4IS6A 4CMMB 3K2UH 3BEWB 4KQ4L 4ODSH 4KPHL 3PDDA 4F7MA 2VZTA 2R69L 1AQKL 3L6FB 1K9TA 1S9VB 1OQOA 1A6WH 2CH8A 2GJJA 5JORB 4I13B 3QUYC 4UQ3A 4UDTB 3KVQA 4HT1L 4JJ5A 4LMQI 3RRQA 1FSKC 1BQUA 1UZ6E 3D69A 5D7JA 5DFWH 1IFHH 4R2GD 3BKYL 1NMAH 1V7NH 3GHBH 2DQCL 1U0QA 4WTXA 1RUML 5J13C 1H5BA 3LRSB 5IF0A 5KVEL 1RJZB 1KEML 1T04A 2AV1B 4WEMB 3IDMA 2HWZL 4P3CL 3MLZH 2EH7L 3MOBH 3MRKA 4OKDA 2VDNL 5FFLA 5F9WB 2XPGB 5GGQL 2R8SH 3VMPA 4DWHA 3QEGH 2BY0A 3PWPE 1T1YB 2R1WB 5T33H 2ICWJ 3TT3H 2GJ6B 4L29A 4YGAB 3UTOA 3P9WB 5JXAL 5CJOH 3I6KA 4N0CC 3HUJA 3NA4A 5DD0L 4OKVA 4XBPA 1GIGH 3MOAL 3VWJC 4LL9A 5GS3A 4G8GB 2VLJA 5F1IB 3DRTB 1JGVH 4NHCH 4KC3B 4HWNA 3TO4C 2Y36L 1A1MA 1S8DB 1BQHA 4KJQC 3FO1B 5K9KB 3MFGB 1J1OH 4XX1G 4KVCH 3QULA 1OOAA 2I9LB 1MFAL 2VUYA 3FB7A 1OAKH 4KRPD 4GRLA 2V6HA 2BVEA 3SKNB 5EBMA 1NAMB 1OGTB 1HKLL 4XCYA 1WBXB 1R24B 4JQXC 4AMKL 4IM8A 1A0QL 2VITA 3HNVH 3S98A 3DETD 1EHXA 5C0BA 5D5MA 1R3KA 5KS9E 4M7ZC 3AC0A 2VSCA 5MERA 1WIPA 3GMOB 1G84A 4QLRA 4FZEH 1K2DA 1I9JH 3VWKB 5I8CB 1CK0H 4ODVH 4XAWL 1C16B 2VQ1A 2DQIH 2NY4B 4KI5D 3TN0A 1X5AA 3RL1A 2GTZA 5FOJA 1XF4B 3IFPA 4P5TC 5FOBA 4FTVE 2KQMA 5GJTL 1PEWA 4R97C 4XB8A 3QI9C 4G5ZH 1G0DA 3MO1B 1IGMH 1UWEH 3NN8B 5SV3A 4JRYA 4O5LL 4PJ8C 4PJ9B 5M7QA 2JE8A 4Z0BH 1U3HD 4D0BA 4PJGA 2EEBA 1RUQL 4XNXH 4K3JH 2H26B 2OJZH 43CAB 5MEQA 4PJXF 4DZ8A 1BAFH 1H15B 3BZ4B 3X3GL 2QHLA 4F9LC 3HB3D 4OF8A 2G60H 4E41E 4HIEB 2E6JA 1BVLA 2WQRA 2F5BH 3ETBF 4KV5F 3VXTA 5T1MA 2IG2H 5HHNA 1J0HA 1MHPL 4M7LL 3AVEA 4ZQKA 3S88H 4GQ9L 4AL8L 3MCKB 3F7YA 2O93L 4NC2B 1IAII 4W4OA 1MLBB 1PQZA 4CMHC 5IHLB 4WUUB 1ORQA 5HY9A 4JPKH 4M1GL 1CXKA 3JXAA 1T7YA 3ZKXC 2VAAB 1I9IL 1NCBH 2XIDA 4MDIB 3AAZB 5IMOB 1UB5B 5EU6A 4KKAC 1K4CB 5CS7A 3CFJB 3T0WA 4FOMA 4NN7C 5FYJH 1C5DA 3W9EA 3MR9B 3WLWD 3WIHA 1WCBB 4NCDA 5BRZA 3HC0B 4LRNL 5IROC 3UTTA 2ICWB 4GG6A 4NRZA 3I84A 1EMTL 5IVNA 5GSVA 1TLKA 4XBEH 4MCYA 5BXFB 3NFPA 1Z0MA 1G7JA 2HT4C 3QQ3B 1OY3B 5B8CC 2GSGA 3DX7B 3B43A 1JGUL 5CZVL 4OGAC 4LU5H 1EXUB 4Z78A 1GRWA 4R2GB 4EI5D 1XAUA 4FP8L 2AJZB 5KVFL 1JGLH 3GGWB 5AAWA 1ZTXH 1ZA3A 3SO3B 1CD1A 3IAPA 1LD9A 4JR9L 4EUPB 2RAMA 5GS0L 2YSSB 4UI2A 5E2WL 1E27B 3F5WB 1XF2B 3R06A 3BWAB 4J3WA 1BJ1J 3MRBA 4BUHA 1UADC 4HGMA 2AK4A 1JGDB 1QA9A 5C2BL 1XGTB 4MNHB 4PTUB 5GRVK 1BX2A 5JW5A 1QLFA 5F1NA 1FZOB 4UIKH 1U8QA 5F70A 1CR9H 4G6AC 4KUCD 3HAEG 1YNKH 1M4KA 2AJYH 1BZ7B 1G9MH 3MJ6A 1QSEA 1HHIB 1DUZA 2D3VA 2IPKA 3OJ2C 3BGMA 4PLOB 1U95B 3G6JB 1HDMA 4ZDHB 4WTWA 3TZVA 4KRPB 1RHFA 1A4JA 1FO0H 4P46C 3UBXB 4IIQA 5HD8D 4QXTA 4ZUUB 2IEPA 1KJVB 4J7RA 4HJGB 3DV6B 4JREC 1KIQB 4MVBD 12E8H 4KH2A 4NYLA 1XGRA 2O26U 1JHLL 1SEQH 4PRPE 2VRAA 1W8OA 2IC2A 3QIBC 3ARDC 3D2UA 3DXAD 4OZHF 1LEKA 4HKBA 3JVGC 3SDDA 3TBSB 1Y0LA 3WO3B 1CBVL 3C60D 1LEGA 1MI5A 1JPFB 4APQA 2L0DA 1PBYA 4UT9H 2R23B 1BOGB 5I17B 1P9MC 1DANT 5T3ZE 2H8PB 2XWJB 2W0PA 5A40E 2W91A 2EC9T 4PJHE 2JJVA 3T77B 1RZGA 3KJ4C 3QA3A 1KXQE 4CADB 2E6PA 3EYQD 3G9VA 3WUWG 5SWQB 2AV7A 1Z9OA 2HT3D 4NJAL 2HFGL 1ZEAH 3NPSC 1U3HB 1AO7D 2BFVL 2UZIH 2GJZB 1MHEB 3FN0L 3I6GA 3B2VL 1DBMH 2ZG3A 3FONB 3RWEA 3Q6FB 2JB5H 3TPUA 3BP4A 2ORBL 5HYSA 4HGWB 3SDXB 2PN5A 4ZUTB 4F7EB 4XCCH 2R29H 3CH1A 4C56E 5TDNA 4XNYH 3LRGA 5DA0B 5KSVA 3T3PE 4JAMB 4DOHE 5FUOH 4HIIA 5F7NC 4PRIE 4OQ1A 2OP4L 5GZND 3WKNA 4HKXA 2M26A 1OCWL 1A7NL 5CD3A 5DWUH 2PR4H 3KHQA 1AR2A 3V0VB 3L3IB 4IBLT 3SDCD 5H35A 2XTJD 3D87B 3RY6A 1RY7B 1F3DH 4L8BA 3Q5TA 5D7IB 4JHWH 5DJXA 5CBEB 5J6HB 4XHJD 3S37H 2VABB 2V9RA 4LQ1A 3OMZA 3MUGB 2PW2B 5E56A 3VGFA 1KACB 4QHLA 4OLZL 4OAWA 4TQEH 5D1XC 4MGXA 3OKMB 4KKLC 5I73B 5C0RH 1LE9B 4Q9RL 4CVWA 4XH2A 1DQLH 4GRWH 5DYOA 5BW7C 4H26A 4QY8B 5DRWA 1I1YB 1UZ6F 4HK0A 2ZZUT 2BVQA 2QHRH 3GSQA 3HZKA 1MF2L 2BOBB 3ZE1E 3EO0B 2MCPH 3KPPB 1VSCA 1FGVH 1EHAA 1LDSA 4FFYL 3MYZA 1D9KD 4GW5B 3N85H 5IVXA 3CFDA 4XAKD 2VSDA 5E00A 3VCLB 4TRPH 3VD5A 4EI5B 1SBBA 1S7VA 3MA9L 1BEYH 4X7CC 5EZOL 3ARGD 1KF9B 2HLAB 4HS3B 3GEWB 1QLEH 3BPLB 4YXKL 4G80A 1INEH 4HDIA 5KVDL 5CD5D 2JTDA 3BKML 5E6IA 3U9UA 2PTTA 4JFDA 2CRZA 1FNFA 2ADFL 1OW0A 1ZV5A 1KFAL 3TV3H 4L3CB 1QKZH 5HYJA 4NC0B 2DM3A 2FX8L 4WW2A 1F4YH 1D5IL 4OFPA 4XMPH 3EYFB 1G7LB 4PRNB 3L5WB 5CEYB 3O11A 4G8IA 3C2AH 2WBJA 4KK9C 3ULVE 1CU4L 4TNWK 5DJ2A 2FZ3B 2F53A 5FYKD 5CJ8A 2X4RA 3CFIC 3SGKC 2BCKA 1MCCA 4UAOC 2D9QB 5KS9F 3L3JB 4HZLB 1NH6A 2RGSA 3MGTA 3TNMA 3KPRD 5E8PB 3M07A 1R3IL 5J1TC 1J12A 1A8JH 5I16A 2I60L 2A6JB 3S4SG 3BUYB 4PJFA 1UEMA 3RWIB 4OD2B 3UDWA 4HPYH 1KXVC 4MJ4A 4Y5VB 2R2BA 1UJ3A 3DMMC 4MSWB 1BFSA 1MH5B 1I8IB 3QIWC 1MJUL 3DXAB 1A7OH 1S7XA 1BFTA 3MLXH 3CFCH 4M6NL 3MRCA 3GSVA 1ZHLB 1T6WA 4U1NA 3C60B 5F1SA 2CRMA 2FEDC 3FTGB 4NKDB 3EGSB 3IXAB 3P11H 1R3LA 4AYFA 2NY3C 1WC7A 1IEHA 4C83A 3CJJA 3R4DA 3OGOE 3QDJD 4X9GA 1RIHH 4O2FA 1MSPA 4WCYL 5AWNL 5EUOE 1VFUA 3V6FA 3DURB 3CVIL 1NMCB 5JTWA 1A7PL 3G5YB 3O2WH 4XNUH 3LHPH 1AO7B 5JW4M 4OM0L 4L1HA 4I0KA 4FXKB 5FA4B 2YS4A 4OM1L 4V2BA 4NZTL 3CMOH 4F37F 2C1PB 4XP6L 3RNKB 1QEWA 2F54D 3C6LD 4J3UA 5DJYA 4YE4L 5TE4H 1U8MB 3HE6A 4R8WL 5A2JH 3TBYB 1IC7H 4Z0XB 3BKJL 5TH2B 2EYTB 1NFKA 4FABH 1F42A 4HHAB 1RZKH 2DLFL 4ODTH 4OZIE 4LPWA 1E4XL 3SDCB 5KN5B 4X5XA 2R2HB 2ZOLB 2XTJB 4X4ME 3MYJA 2XKNA 2FGWH 3HI5H 4HH9A 4XC1H 4U1JA 1BLNA 5FDYA 4YHPB 3OSKA 4GBXC 1U8PA 4M3KB 3KYOB 2B1HH 1CE1H 2VNCA 1NDMB 2D0FA 2XQYK 3KPSE 3RNQB 4JM2F 2ZSVB 4FZ8H 3DBXB 3ILQC 1QBLL 1DZBA 4R26L 3RBSA 5E24E 1U58B 4YPGB 1ES0A 3SCMC 3NAAH 1EUUA 2BVYA 4UILH 3F58H 4FQCL 5K9QG 4L4JA 2YPLD 4K71C 3C6SA 4GAFB 3AS2A 5IJKC 4OT1L 4UT7H 3ELAT 5C09D 1A5FL 1JZ3A 3EYVA 1EHLH 2P8PA 4YEFA 2YWZA 4L8SC 3SOBH 1D9KB 1MCRA 4FNLL 4JFZL 5F97E 1MQKH 1MIMH 3BYYA 4LEXH 3NA9L 3QXWA 1FVDB 3LS4H 1XCQB 1EO5A 2BSSA 4JJHA 3VJ6A 3ARGB 1R5IB 3SGDI 1KXTB 4Q9BA 4LCIL 3DI3B 1IQDA 5JOFB 3TVMA 4R6UA 5D2NB 1BHGA 3HR5B 5GS0C 3EYUL 1CIDA 3V8CA 1UYWL 4NO3B 5HGDA 5T5FL 2BY1A 4ZUWB 1OGAD 1W0WA 4YBLC 2C7UA 3LN5A 1UWGH 2VE6B 1QTYT 4IMLB 4U1SB 5EO0A 1MREL 3BDBA 1QYGH 3PNWA 5DUPL 2AEPH 1UXSB 3BJ91 3OX8A 4ZFZA 5FB8B 3U4EA 4O00A 5EO1A 2EO1A 2GAZA 1YC8A 3BP6A 3WFDL 5E08L 1P4BH 1ZMYA 3T4AA 1J5OH 5D1QA 2IPTL 5DVLA 5F9JB 1CLZL 3V7AE 5K93A 1AHWB 2NTFA 2F19H 5CIPH 5J3HC 1N6QH 2HVKA 1HI6A 4TUJB 1HQRA 3KPRB 2VDRH 2VIRB 2A83B 2XN9E 3FT3B 2DDQL 1BPVA 1BM3H 1NMBL 3B3IA 1ONQA 4CGTA 5I8KH 4RFOL 3QWRA 3RZCA 3A67L 2ICES 2EXWD 5HI5D 3MJ9A 1T22A 3L7EA 3U7WH 5T3XL 3AB0C 5IR1B 4NQSB 1T3FA 5F6IC 1S7TB 2AERT 3MV11 1DQDL 3NH7L 2SEBB 1QFWH 2VR5A 4KK8D 2DBLL 4LLVB 4PJHF 5IW6A 5DHXB 1X7QB 4X7TA 3G5VB 3GSNH 4PJBB 4EZMA 4PRHE 3ABZA 4X9BA 1YEEH 4N90E 5C0AE 4IRSA 3QDJB 5BOZG 3F8UB 2P46B 5D6DA 3ZHDA 3QXAB 1R5VB 3J7HA 3LN9A 3RIFF 5MENE 4PV8A 5CSZA 5FF6A 5DDHB 1X3DA 1KJ2H 4KI1A 4NOFA 1LDPH 1HHGA 2J12B 2YZ8A 1KV3A 5JXEA 3T3PF 1N0LA 4RMWA 5GJSH 3FAXA 2YA1A 5C07E 1ZT4B 1RUMH 1KN2H 2CLVA 3FN3A 3MRHB 1PYWB 4UOJA 1IZKA 1SM3L 5KSBE 2O61B 3C6LB 2F54B 5K9OB 1MIEH 1UKSA 2DJ4A 4NBZB 3P0YL 3UYRL 4XMLL 5A2KH 5EUKB 4P5MA 1BBJB 3KPQA 4X9HA 1JWMA 5IB2A 3W9DA 4L8CA 4Z7VF 3MROA 1HIML 4IOFC 4NO2A 2J6EA 3JSSA 2HKFL 1N7MH 4P4KA 3VH8B 1F3RB 1Q9WB 5SX5K 4RSVA 2WINA 3BO8B 1HQ4B 3CUPA 4I4WB 4KTDL 2F58L 4MX7B 4HUXB 4HKJA 4JY4B 4HH8A 3NTCL 5GGUB 1ZA6B 4OQTH 4R4ND 5BZDA 2OL3B 4O4YL 4EQ2A 2OZ4A 4BSWB 1A1OB 1ZXQA 3T2OA 2KL6A 3BDYL 3GBNL 2DL2A 3L7FA 4Z7UA 2JJTC 3DTXA 3ZE1F 3O6ML 2WANA 1A6ZB 5T3ZL 4YXLL 2EIZB 2VZ1A 2EKSB 2XFXA 2YPLB 3TA3A 5DD5H 1N2RA 2ADGB 3I2CH 1FNEB 2XRAL 4UQ3B 1H3XA 5IBTH 4F2MA 2A77L 3GSOB 5C09B 4JJ5B 1EEZA 5SX5H 1AXTH 3AXLB 5JPNB 1G9EA 1TVBA 5KVGH 2ESVA 3QUYD 2VDKL 5CZKA 4ODUA 5DK0A 1KGCD 2GYSA 2Z31C 3HAEA 3MV9D 3QEQA 4U3HA 5HJ3B 4H1LB 3C09C 3IJSB 3MLUL 2QSCH 2FBOJ 4WJ5A 5EBLB 3PQYA 1LP9B 3NACH 1EH9A 4R90H 3DLQR 5F44A 3TCLA 1U92A 2ZUTA 5C3TA 2IF7A 4MS8D 4MNGB 3RKDD 1INDL 5EIIB 3C5SB 1RQ5A 5J56B 4NT6A 4M6AA 1YUHB 4KK5C 4N0CD 1VADB 2XY1A 1IMHC 4FFZL 5CCKL 4P49A 1DBAL 1HHJA 5DK2B 4WHDA 1NEZB 5GGTH 2VLME 4HS6B 4I1NB 4FA8A 5I15L 3TO4D 1CXFA 4KJQD 1JJUA 1QP1A 4GQPH 1W8NA 2R56L 1AE6L 4YHNA 1XH3A 3LPFA 3W0WA 5I71C 3ULSB 4LHJB 4TUKH 5LCVL 1BBDH 3FRUB 2NW3B 3OJMB 1AFVL 2I5YH 3MLPA 4WEUD 4XPGH 1UZ8B 5E2UL 3DECA 5J12B 3WUWA 2BSRB 3GMLB 3BT2L 3GJEB 2B0SH 1KPVB 5F89A 1DDHB 4M9PA 5HBBA 2IBBA 2DIBA 2EEDA 2KPNA 2P5WE 3S9DB 3VDBA 3SO5A 5F7DA 5EUOF 1LILA 2QQNH 3TN0B 1IC5L 1OAXH 4NPYB 4KWUA 3STZB 1IARB 2ZOKA 2R0ZL 3WJLC 4M7JH 5CEZE 4FQ2L 4X6FB 3O3DB 1A6TB 3AREC 4JO2L 3QHZL 3LDBB 4KQ3H 4X6DB 3R0MA 3QCTH 2GT9B 1XZ0B 4P5TD 3LQMA 1CLOL 5JOEA 2ED9A 1UCTA 5DD6A 5DZNA 1I3UA 3JV0A 3VU2A 3ZYIA 3ZYOA 4D0BB 1XIWA 4I2XA 1W72L 5DI8B 1H5BC 4PJ8D 2X40A 3CXHJ 1OL0A 5T1DL 2X70B 4NZRL 2Z0BA 1ZT7A 2Y06H 2VLKE 1UKQA 3K81A 3BN3B 3DGGA 1DLFL 1DBKH 2PCPB 1DVFA 4LQFL 4WI5A 1RK0A 3RIAK 3ULVL 2A9NH 4OZIF 2KZWA 5C6WH 3VFNA 1EAPB 1DLHA 4P3WA 5F71A 4ZQKB 5HPMB 3ZKMC 3H3KA 2CDEA 3PHOA 4XWGH 1M71B 3IU4L 3MRQB 5J1SC 2VDLL 5IW1A 1HH6B 5MI0C 4RFEA 4UDUA 3UZVB 1DANU 3ZTNL 2RFXA 2ITCB 2ZUQC 1JTTA 5HDBF 2EC9U 2E9BA 4RRPG 1CTOA 4MJID 3VXOA 3VXUD 4IRJC 3UX9B 2V9TA 3MRPA 3HCVA 4KKAD 3QEUB 1F11B 3C5ZA 3V5DB 3TJHC 1NLDH 1SY6L 3EO9H 4HPOL 5E7FA 5DO2C 1GZPA 4HEPG 5C0CE 1YEFH 2UUDH 4WU7B 2D31B 1JPSH 3HMWL 4GLRH 5IJVA 3BVNA 4JHZA 4XMKH 1YMHB 4OZHA 5C0JA 4ZUVA 2GSGB 1GGIH 2YK1L 2JIXD 3QUYB 1DBBH 2V7NA 1SYSB 3NCYS 1KJMB 3THML 5JHDA 1IM9D 4C58B 2HT4D 4CNIA 1FSKB 2IAMA 4FQXC 1DQJB 3HNTH 4LHQB 1BD2D 1F58H 3H9ZA 1OT1A 3MV9B 4ZAKC 4HBQA 1IT9H 3MRJB 4YDVA 1HCFX 4NNPH 5J13B 4O58H 5F9AC 2JCCE 4PB9H 1JRHL 2I27N 4MNQD 1MUJB 4PG9B 3PHQB 1LO2H 3V0WL 1QA9B 3M1BA 1F6FB 3OPZL 1H9VA 4JQVC 4NJAH 4P2QA 5J57B 1FZKA 1GCFA 1Q9KA 1BX2B 4XPTL 5DRZA 5H2BA 4Y4HC 3BRDA 4JFYB 5I1HL 2Z91A 3L3GA 2YKLH 4HIHA 4EEEA 1H3PL 1VERA 3QR2A 3HZVA 5IB1A 5JA8B 3E8UH 4K94L 4OBSA 5MHSD 1JZ8A 1Q38A 4JO3H 4OLEA 4HKZB 2PUQT 4NQVA 4M62L 2EYSA 2CLZA 15C8H 1S5HB 3LEXA 3O6FA 4GXVL 4HXAL 4N68A 1GHFL 1KTKE 2I07B 2YA2A 4G6AD 1OWRM 1HOCB 5HGHA 3V4UL 1ZANL 4UTAH 5F3HB 3MRRA 3QDMD 4OIBA 4WI3A 4XXDA 5CSGA 1TTGA 3EJJX 3ZT6A 3LAFA 3TO4B 1P5VA 3IYLW 3SDAA 3BIAX 5L7XH 2NMSA 3BP7B 3QH3A 4XNMA 4KRLB 1P7QA 2DWDA 4MQ7A 2NXZC 1ROWA 4P46D 5FV1L 5F7HA 3LQZA 2WLZA 4ACPA 4NYLB 3TIEB 4BQ9A 1WEJH 3V5KB 3O2VL 1KB9K 3QFJE 4XCFH 5MEPB 4D0DB 3MV7D 2A38A 5I1IH 5I1KL 2APFA 3MODH 1U3ZA 4MAUL 2ZNWA 5IB4B 3JTSB 3QIBD 3ARDD 2D9CA 4KHTL 3S5LG 1SJVA 2DWEB 3D3VE 3WE6A 3QDGD 4X4ZA 2P49B 5KZCD 3S34H 1RD6A 3D0LB 1A7QH 3FQUA 4NQEA 5KTEH 3OHXB 2AXGA 1MCOH 4P5TB 2CDFA 4P23A 4P5KB 4R97B 3VXME 4F57L 5DHYB 3U7YL 2X89A 3OGCA 4OCWL 3WS3A 4B7LA 5KSBF 4DVRH 2MKWA 1EJOL 4PJ8B 5DMGC 1FYHB 4OF5A 1A7RH 4HC1A 2KUTA 5HYSB 1FFOA 1EPFA 5AD0A 4N8CL 4L9LA 4P59L 4JFOB 3MRDA 4DGIH 2AI0L 4X4XA 2OR9H 1KCRH 3IKCA 4MJ6B 4HUWB 5IHZA 5IFHL 5AZ2H 1WTLA 2EDBA 5D1ZA 2Q86A 3QBTB 4I5BB 5GRZA 4PJIE 4Z95L 1J9CT 3DSFH 4QWWC 3LMJL 2EDQA 1S7RA 3PWVA 1MJ8H 1U8OA 2X9YA 3LOWA 4PJ7B 3VD3A 4W81A 4NC1C 4Q2ZB 5DJXB 5E9DA 5GGSB 3O45B 4X98B 4DW2H 5ID1A 4PJDA 3E6FB 1E4WL 4HIJA 4CMHB 2WMPA 4WHTA 2AJXL 2IALA 2E7MA 3B9AA 1KC5H 3L95A 3QUZA 5BMFL 2VWEC 3SQOL 4MJIB 3VXUB 3QQNA 3EOTL 4BJLA 4J3XA 5EOCJ 4YHIA 1DSFL 4P57B 4XH2B 2NLJB 2L4OA 5D1XD 4NN7B 2FJHB 4H26B 4X0KA 1ZGLM 3KYMB 4QKXB 4HK0B 4KKLD 3DRQB 2DQHH 4PP2A 2BVQB 5CJXA 3UJIL 3GSQB 3GIVA 4WDIA 1AR1C 4WGWB 3SDDC 3ZE0E 5DUML 3T0DA 1ZWIA 4UNUA 1SJHB 5IVXB 5C8JB 3UEZA 4KMTH 1QFUL 1B4JH 2JIXB 1CDYA 1WTGT 1FV1B 5DF0A 1DN0A 1VGKB 1IM9B 1U8LA 2R1YA 1JYNA 4WV1C 1IAIH 5B8CB 1T0NA 3TYGL 3TNNB 1F5WA 1GGTA 1CS6A 2G75B 4Y4KA 4YDLC 3CFKB 3ARUA 1BD2B 4JDTL 2N56A 4ZFGH 5TJWK 3EO1B 4HWBL 1C8PA 1P4LA 1QR1A 1U6AL 4XVSH 1TJIH 1PX3A 2V5SA 3EHBD 1DFBH 4MNQB 3ULUL 4YUEH 3PDGA 2HJLA 4S11A 1MEXH 5HYJB 5HDLA 4ELMA 4UINL 1E6OH 3TF7C 5DQJA 4K3GA 5D7LE 2NCMA 4JHBA 5FO8B 5E2VL 2YRPA 2CKBL 2C5DC 4N8PA 3EUUA 2AABH 2VZ3A 4QRPE 5ICZA 3G6DH 4XZUB 1MOEA 3U2SB 3QDMB 4KK9D 4RBPK 1N5YH 2B8OT 2P8MA 1I7UA 5LG1A 1F02I 2HKHL 4PJ5A 3H3PH 5B38G 5I16B 2P44B 1NKOA 5EOTA 1X4XA 4P46B 4JLRB 4MWFB 1TCMA 4K8RL 4PJFB 2HJKB 4RAVB 5C08E 2GKIA 3LD8C 3FQXB 3TJEH 2FEEI 1IC4H 2R2BB 3P9MA 4X7SH 4H8WL 2YEZB 4XCNA 3MV7B 4JREB 3EZJB 3RL2A 2BSED 3BPOC 3GJFB 3DMMD 3K8LA 4PG2A 4MDJA 5IMMA 1J1PL 3QIBB 3QIWD 2IBGA 2EH8H 3ARDB 1NGXA 4XGZA 5ENWA 5FYLE 5DHVA 4NRYB 5E5MA 1A64A 2VL5A 3V6OE 4IRSD 1N3NA 2FEDD 3PABB 5BVPL 3QDGB 1NGWB 1P4IH 5DRNB 4RBPH 4P2OC 2F8VA 5KZCB 4EDXA 3P9LA 3GI9H 3DROB 4V1DA 2YUWA 5ITBL 2WSKA 4POZC 3VXRD 1RUPH 1XGQB 3O3EA 3P4MB 4KTEL 4JKPL 5K9QI 4XCEA 3LKRB 3CU7A 5C0GB 3L9RA 5C3LD 5F7FA 3NPSB 2G2RB 3U7AA 3F6LA 3OBAA 1JNNL 1UH2A 2AJ3A 1ZHKB 2ID5A 3MXVH 3RDTC 1YEJH 3HE6B 3BKCH 1NUNB 4LLAA 4G9FE 3ULVC 3WLBA 3B6SA 5C0IB 5TQ0L 2E8YA 4MXWL 3GNMH 3ARVA 4Y4FC 3BMWA 2ZCHH 4Q6IA 4GUPB 4R7NA 1AI1L 3LQAH 5FO9B 5BQ7B 5TFSH 4PGCA 1FN4A 2XKNB 5B39A 1KPUA 2J88H 5CP7B 2YRLA 3HZYB 3MBXH 4JN2A 3MUY1 2E7LC 1U8PB 4TPRH 5I1LB 2GFBA 3B9KC 4BH7B 4OJFH 5BV7H 2YC1A 2FH8A 3H9SD 4GBXD 2MHAB 3WDJA 2GSIA 3T4YA 1PFCA 3ILQD 4HMDA 5D1XB 5CEZL 1N0XL 5L8JB 5HI3C 5D6CA 4KKCC 4YHYC 2J4WH 4U6HA 2ITDB 3DYPA 5D2LE 2VISB 3IDYC 4JRXE 1T03H 3VFUB 4OIIL 3QUXA 4OZGA 1HYSC 1KIUA 1HKFA 5I74C 3WIHH 2FRGP 5D9SA 3HG1D 1QSFD 4LLWA 3G04A 3I3BA 2W9EH 3L3HB 2XACC 4JFQA 2JCCF 5D70H 5LJYH 4LCWA 3QUML 4GG8B 1UQSB 1RZ8B 1JYVA 3GMRA 1T4KA 4HV8A 4PJEE 1BGXL 4NM8L 3N06B 2B20A 3QJFB 3EYOA 3LKOB 4L4VD 3FQNA 1KUMA 4JDZA 2OTUA 5T5NG 1IEAB 2ED8A 2J7LA 3P73A 4EN3C 1G1YA 2X41A 4CUCA 5GS0D 1S3KL 2C7UB 5DRXA 2KDGA 5EZLA 2DM7A 1JZ2A 3QT2A 4D9QE 1AQDA 5I2IB 4ZFZB 1P6FA 4K94C 3U4EB 5FEBA 4JGJA 3C2SA 1I9EA 2GAZB 4X8XA 1BWWA 3FOLA 3AU1B 1EA9C 1YPZB 2K1MA 3M8OH 2DRUA 5EU4B 4EXPX 3ARXA 3WNKA 1S9WB 1IL1A 3T4AB 1EVTC 4LARL 1YJDH 4Z7VA 5FXCH 4G6ML 1BQSA 4N1HB 4LKCB 2H9GB 3BD5A 4GRMA 2Z8SA 3SE3A 4EDWH 4Y5YC 4ODHH 2ZJSL 4KAQL 4JDVA 4D9LH 5D72L 1C5BH 3QISA 1E4JA 3L1OH 1LO5B 2BMKA 4UAOB 2DLIA 4DQOL 5J3HD 1DR9A 1TXKA 3KNBB 4UV4L 1AXSA 1RUKH 5GRUH 2RQ8A 3GFUA 5ITFB 5C6TH 2VLRD 5IW6B 1I8MB 4L3EE 4LCCC 4AIXA 5JZ7C 1E0OB 3QIWB 4MXQC 5FHBL 4TUOB 3V6ZB 2PO6A 5JNYA 3BAEH 1QRKA 2BJML 3U30C 3QSKB 4IRSB 1TFHA 2F5AL 1G6RA 2UYLA 5CMAA 3HKFA 3CDYA 2NXYC 4ONHA 1QHPA 4PV8B 4OF3A 3U0TA 1IJ9A 3TWCH 3VXPA 3VXRB 4OZFB 5I30L 5JHLH 1JWSB 3OF6A 1WBYA 2K3TA 1RMFL 5FHAL 4GS7C 4NQCD 2G5BA 4G42B 3IDGA 5LGHH 2LU4A 2PYFB 1CF8L 2WV3A 3KDMA 5KJRH 5IT2L 1SVCP 4YPJA 5IHBA 1T5WB 2XY2A 1R3HA 4PGEA 2HRPH 1NJ9B 1WZ1H 3VD9A 4PRBA 5E6ZA 1T7XA 5MP6H 2A6IB 1ZS8A 5JW3L 3T0EC 2DLTA 4G6KL 4IOFD 4Y1AA 1J05B 1LO4L 1OD9A 1RUAL 1XR9B 1A3RH 1J87A 1IAKA 3VFOB 5D2NE 4QOKD 2BVOB 3CPLA 2H3NB 2D03H 2FYYB 4OFYA 1NCCH 3WFCH 1U36A 4ZSOB 5J9PB 1WVZA 3SDYL 1NFDA 3LKPA 2D2OA 5FUCE 3K74B 2WUBL 5EORH 3H9SB 4GBXB 5HDQH 3MREB 5IFAH 1S9XB 1REIA 3ZE0F 4F8QA 1YN6B 4XNZB 1S7QA 1IKFL 1ADQA 4X8JB 1HSAA 3ZE2E 2NY5L 1KLUB 4XP4L 3AM8A 2X05A 1OM3L 4J3VA 5GS2H 1PZ5A 1WZMA 2JLLA 1EEZB 3K4AA 1AGDA 4BH8A 4K71B 4OGXL 4U1HA 1TVBB 1F4HA 1RFDL 2DKSA 3GRWA 3S35H 4EOWL 3HG1B 4QF1A 1DEDA 1QSFB 4P3DB 2VKXA 1YYLH 5E8NB 1CTNA 5EUOA 3KPMA 3MCLL 3IDIB 2HP4A 4L8SB 4LSVL 3ZYZA 2IANA 4MA3A 3AMKA 4O2EA 3WXVH 1ETZA 3G5XA 1U93B 4XP5H 1X5XA 2IADB 3MNVA 1T2QH 3QPXL 1E28A 4JO2H 3KLHC 1UB6A 1JNHA 2Z31D 4L4VB 4KI5F 4D0CB 4YR6A 4JGMA 1CLOH 1NCDH 5IHUL 3MFFA 3KPOA 3ULUC 1YY8B 4PJCA 1U92B 1C7TA 3KS0H 4TULL 3QRGL 3E6HA 4GH7B 3DVFA 1A9BA 3ZT5A 4PJXB 3KLAA 4QTHA 4I3RL 3O6KL 4OLVL 3FQWA 4YBLB 5ISZA 1ZHNB 3GM8A 1T21B 1Q9OA 1MPAH 4LQFH 4K7PX 1JGEB 2XZAL 4M9OA 5JR1H 1FORL 2HG5A 1HHJB 4OZIA 4KK5D 1KBGH 1OTTC 3MRMA 2ADIA 1FDLH 1X44A 5GRWA 1UG9A 1UGNA 4QXGH 2UY6A 4NQDA 3EDJA 4M4RA 3BGAA 3PGCB 3SGDH 43C9A 3RTQA 4G3YH 3FFDB 5FM5M 1LK2A 4K8RC 3DX8A 2VXSL 4AK1A 4EUPG 1J88A 3U4BL 4H8WC 3QCUL 3ROLA 2VLRB 3O8XA 4YHMH 1KT2A 3CSPA 4FN0A 3INUL 1MNUL 4LEOA 5F7DB 3SKJL 1U8HB 3TA3C 5F6IB 3CK0H 2CMRL 2GK2A 1KCVH 2YD6A 4YNYB 1X5ZA 3V4PL 1ED3A 2RJMA 1PAMA 3D39A 3NVQA 1DP0A 3GSXB 5CEXA 1NANI 1UJTA 3HRZB 3F7RA 3MJ8A 4JFFE 3GO1L 3WV0A 5DEFB 2QQLH 3ARED 3D85A 1Q1JH 1KELH 2DQFB 1FE8L 5ID0A 2AKRA 2ICEA 4YHLH 4ZS7L 4NFBA 1FCGA 3HI6L 2ED7A 3PWPD 4JFPB 2EEAA 3IDJB 4BZ2L 4U1IA 3F12B 3FB6B 4NQCB 3IAQA 5ESVB 2C3VA 3UBXG 3S36L 1BECA 3BE1H 4I18B 5EBWA 1BZ9A 4ALAL 2BDNH 3Q3GB 4R9HA 3O4OC 3UC0H 2OS7A 5MEOA 2W0FA 3RHWK 3OXRB 4XPTH 1N26A 5BZWB 1S5IH 1D5ZB 1WUNT 5TPWH 5E2TL 4F15C 5ETUA 2R0WL 3BSZL 3GI8H 3ZKMD 1JWUB 3DUUB 4I0PA 1YEDA 3ALWA 3SBWC 1NC2D 1EEQA 1FFNB 3FRPG 4QOKB 4K7PL 1AGBB 2XTLA 3RGVA 1AGCA 3VXQB 1S7UA 3IFNH 3PGDB 1OGAE 3FO9A 3CVHA 3X3FL 5DT1H 3VW3H 4X9IA 1VDGA 5D2LF 2FX7L 5ACZA 4IRJD 5FYLL 2X9WA 5FUZH 3QCVL 2ARJQ 4L4TE 1KIPA 3O9WA 1GZPB 1MAKA 4Y19A 4IRZL 5A16A 1SJEA 1MCHA 3TJHD 1FVCA 1MJJB 4DKEL 1G9NL 2GTWA 3HS0A 2Y5TB 2FD6H 4FTVD 3MLSH 5DO2D 1Q0YL 4ZOAA 4EI6A 5FECA 4YK4B 4PJEF 1J8HA 1KLGA 4KJYB 4UIMB 5C0AA 5IKCA 5TE7L 5E8OA 4G43A 2X4PA 3KHOA 3L5XH 3MBEC 4HJJH 4I48A 2EO9A 5FYJE 5MENA 1E4KC 3UTPD 4DKFH 3WKML 4MHHI 2X4OB 4B5EA 2V17H 4XPFH 1EGJA 4FQXD 2VR4A 3VI4F 4U31A 3RWCA 1TZHB 2Z31B 1I1AA 4ZAKD 1GC1C 3M1BB 2FB4L 3C09B 1BVKA 2Y6SC 5T1LD 4E41D 4R3SB 4L1DA 1VCAA 1A1NB 1DUYA 5SX4I 2DQDH 1I3GH 1K5NA 1W2KT 3GSWA 3F6IA 3SKOA 4QHNA 3WEXB 4Y4HD 4LSUL 5B38A 5IV2B 3OKDB 2VL4A 4KHXL 4XVTL 2OMNA 1FHGA 2AXHA 2EYSB 1HEZA 3QXDA 5I9QC 3DSNA 1ORSB 3LKNA 3OQ3B 4LPYA 4QHMB 5FK9A 1XR8A 1JV5A 3WXWL 1UACL 3SDAB 5F8QC 4J4PA 4G7YH 1YYMH 5DZOA 3Q0HA 4OLWL 3RA7L 1M7DB 4F33A 5CZXC 3LQZB 1T20A 4LSSL 5I71B 1U2CA 1A4KA 2EIDA 1B3JA 1X9QA 1RU9L 4ODWA 3EJYC 2C3HA 1KENL 4JM2D 5ANME 2VO5A 1YNLL 1KB5A 1MAJA 5D7KE 4Z77A 4MXVE 1MJ7L 3MSPA 1PG7H 1UM5H 3WIIL 5T3XD 1AJ7H 5CJQH 5E8DL 5I1CH 4JG1H 3X14B 1A6AB 3WIFA 2OR7A 1K8DB 1TJHL 3MJ9H 3BIBX 4X5LA 1ZGLP 4KROC 1MRCL 2E9WA 3LKSA 2HVJB 5FKAA 4AT6B 4LNRB 4PJAE 5L9DH 1U3YA 2B39A 3P4NA 1WBZB 1NAKH 4OD1H 2OJEB 2FIKA 3O6LH 4JG0L 1LEIA 3AREB 4FQLL 2YWYA 4JM4H 3LRHA 1FL6A 5DUBB 3DVNB 5F3BB 4U6XA 2P7TB 5M94B 1KTLB 4HIXH 4YQXH 4ONOA 4KKBC 3N9GH 3PWPB 5TGBA 3ZKQD 5AD0B 4GAJL 5INDB 1G7HA 2X4TB 1P6AB 4DFIA 3UTZA 3OXSB 3RKPA 3GKWH 3PV7A 2OM5A 1VACA 5L88L 3GHEH 2R1XA 1WFNA 4HCRL 4KJWC 4XI5C 5ACMA 3Q1SH 2XKSA 5GRJH 4A6YA 3SGEI 4JO1L 4JZJA 4YIQB 5IESH 3JTTA 2MPAL 1GJIA 4RAUA 5LXGL 4XBGB 4ZXBA 3IXTA 5FO7A 3VE0B 4OGYL 1AGFB 3PWVB 5FA3B 1PX4A 4YXHH 3OKOB 1WISA 1HSBA 4QWWD 1EJ6A 4WRLA 4XVUC 4LVNB 3ET9F 4N0UE 4RNRA 4IOIA 3BZDA 5EC1A 1NC2B 2X4QA 3R1GH 1N59B 2J6EH 3O2DA 3QG6B 3BHBA 5MI0B 1OSPL 1AIFB 3CSGA 3L3OB 4JO4L 5I18H 1DEEB 3MUHL 3TO2A 3ZE2F 1RZJL 2ZUQB 4JPWH 5EG6C 2JJSC 1OAQL 1H3GA 3FB5A 5KS9B 4PRPD 1CFTB 3U79A 2IPUG 2QQQA 3IJHB 5JQ6L 3CDCA 4LF3B 4IRJB 4LGRB 4CN4A 3ARBC 1HNFA 3UJJL 2OZ4H 4KUZL 1IGIH 2IFFL 2NY5C 1KTDA 2WAHA 2CPCA 5GHWH 4PGBB 1YEIH 4CVXB 3I75A 3AY4A 1I8KA 5T3ZD 2D0GA 1A14L 3CNKA 4FTVB 4H0HB 5GGRA 1I7ZB 1AR1D 4LRIC 2E7CA 1GXEA 1VFAB 2VZOA 4MCZB 5IB5B 1MWAL 1DN0B 4GO6B 2BC4A 1N4XH 1T0NB 3ROOA 4YWGH 4M93C 4N5UA 1EEYA 1I9RH 1UFUA 2FSEA 4PB0H 4CMMA 3TYFB 1ZSDB 3KYKL 3BEWA 5HYQB 2H1PL 3LEVL 3JWOL 3P0VL 4HUNB 3L6FA 4FQXB 1E6JH 1S9VA 1C5CL 1VESA 2XQBH 2HT2C 4QCIB 5E94B 1QRNE 4C56D 4XPAH 4ZAKB 3H9YA 4YDKH 1KULA 5JORA 1A6PA 3QZWB 3I02B 5FCUL 5FKPB 3S96B 4UDTA 4M48L 4DGVL 5I1GH 5T1LB 4E41B 1A02N 3HAEH 4PRID 5EA0L 4QRTB 2CGRH 4U1MB 4ZUSB 4OLUL 1IAMA 1FL3B 4Y4HB 4OI8A 2DI9A 1JUFB 3LV3B 5D1ZC 4E0RA 2NY2C 3LRSA 1RJZA 4GFTB 1P84K 1FIEA 3CDFA 1J1XH 5F9OH 2XPGA 1YZZA 2Q76B 3PUCA 2EZ0C 1T1YA 4LCYB 2R1WA 1RV6X 3RWGB 2DTSA 1UXWB 1FYTE 5I19H 3PP4H 1EAJA 3P4LA 5ICYA 2GJ6A 5F88B 3CDGB 3MACL 5LGJB 3U83A 4RQQB 2CUIA 2DJUA 3SE4C 4Z6AT 3FB8B 2OTWB 4G8GA 5F1IA 3O4LE 4XCNB 2YD5A 3WD5H 4JM2B 1F4XH 3CZFB 3P30L 3WS6C 2VQTA 3LH2H 3TBWB 3FO1A 3PJSB 1KPRB 3WFBH 4JFEE 5ENWB 3K2UL 4ODSL 1N3NB 4K3HA 2YD2A 3SKNA 1NAMA 1OGTA 2FLBT 2BNQE 1WBXA 3G08B 1IGCH 5CHNB 1A6WL 3UJTH 4LDLB 1WCQA 2Z35B 5DVKA 4QXWA 2GQHA 4P2OD 4U0RC 2D7TH 3BQUC 3O3EB 1RPQA 5E8EB 2FR4B 3GMOA 4POZD 3V5HB 4DUXA 1IFHL 3PV6A 1DE4B 3VWKA 5I8CA 5KAQF 1NMAL 1V7NL 3GHBL 5CSBA 1C16A 3WMSA 4MZ3A 5BVJB 2WIMA 4OF0A 3LN4B 1XF4A 3TP4A 2MNUA 3MLZL 7FABH 1GC1H 3MOBL 3B6SB 4PUBH 4YDJB 3RDTD 3MO1A 2R8SL 3A6CH 3NN8A 1IRAY 2FJFB 3QEGL 1S3KH 5E1AB 4PJ9A 3ULVD 5T33L 4UV7H 2WWKO 4XP1H 3P3YA 4Y4FD 3TT3L 3IU3B 1PSKH 4ZS6C 5F8RC 5CJOL 1L0XA 2H26A 43CAA 1GIGL 1MFNA 4I0CC 5L0QC 4LSTH 2QTEA 1JGVL 1H15A 4NHCL 3BZ4A 3ZO0A 4HEME 3O3UN 2C1OB 3TFKC 3T3ME 1T7WA 2VDMH 1J1OL 4GKSB 4HIEA 1MCLA 4NN6C 3B9KD 4S2SB 4PRPB 3BD3A 3T4YB 1OAKL 2WWMD 5JOPE 2ZUVA 2WNGA 4WU5B 5CLWA 5D6CB 3MCKA 1HILB 4CDGC 2VDQH 1R0AH 2GK0B 1L0QA 1MLBA 5HI3D 4WUUA 2CJUH 3RPIB 2BRRH 3HNVL 5GXBB 1RK1B 4PJHB 3G04B 5DEGB 4LSQH 2VAAA 1GGBH 4JCLA 3T0BA 4MDIA 1VFMA 3AAZA 5IMOA 4XWOC 5C86A 3IDXH 1UB5A 1FIGH 1HYSD 1K4CA 3MV8E 5IB3A 1JYWA 3CFJA 4FZEL 4LHUA 1I9JL 2QSTA 1CK0L 2VXQH 4ODVL 5CFHA 2R0LH 4O51A 3VH8G 3MR9A 2O5YH 4TVPH 4WV1B 2CIIA 1WCBA 3QXUA 3HC0A 4E5XB 5ALCH 3IDNB 4G5ZL 4YDLB 4NRXB 1IGML 1OLLA 4C56B 1F4AA 5F1KC 1UWEL 1WAAE 4X6DF 2VN7A 5BXFA 4DOHB 1TTUA 4Z0BL 4EN3D 3QQ3A 4PRIB 5FGCE 3DX7A 3WJJA 1RJLB 1LQSR 1EXUA 3QDGE 4XNXL 4K3JL 2OJZL 9CGTA 1L4IA 2E8ZA 1TJGH 1BAFL 1TTFA 5CP3A 3GGWA 3W5NA 1IL1B 5HHME 5T1KD 1WT5A 2G60L 3CLFH 1GYAA 2YSSA 5H8DA 3VDCA 1E27A 1WK0A 3F5WA 1XF2A 1CDCA 2F5BL 3V52H 5GRYA 3BWAA 5ADOH 2IG2L 4R4FH 1JGDA 1T1XB 1T6VN 1CGYA 1XGTA 3FQRB 4MNHA 3S88L 4PTUA 3KPSD 3ARRA 5E0QA 1FZOA 2DB8A 5D4QA 2YMXH 4MXVF 3RAJH 1GSMA 3PIQA 4JPKL 5L2KE 3QB7C 1BZ7A 4H1LG 1PG7W 5IW3A 2EXYC 4AEIH 1HHIA 1NCBL 4S1QH 1OAZH 3LD8B 4PJAF 1U95A 1JHKH 3G6JA 4U6VH 3GMMB 3LS5H 4ZDHA 1J7VR 1CL7L 5FYJL 4EJ1C 2EIEA 2DAVA 3BPOB 5FM5O 2YHGA 3UBXA 1CXEA 4LLDB 4MXQD 4L8DB 3ZLQC 2H32A 1IC1A 4ZUUA 1YEKH 1RVFH 1KJVA 2NX5E 4XBEL 1ACYH 4HJGA 3DV6A 4FS0A 1KIQA 3EJZC 1RFDH 4K3DH 1OB1B 4P2OB 5C0NC 2NXYD 2B2XH 3X11B 2VLLB 1CCZA 3QQ9C 4K9EC 5ALBH 4LU5L 4PY7B 2CRIA 1N64H 3ARTA 1W72B 4OGZA 1JPFA 4MA8H 3UPRB 5AG8A 3FRPA 4ZD3H 2R23A 3KYAA 1BOGA 3L5HA 1JGLL 4DCQB 5DK3A 1R3HB 4OI7A 1ZTXL 4PV9B 1BVZA 2H8PA 2XWJA 4RA0C 3KR3H 4HC1H 3T77A 2W0KA 3RDTB 4CADA 2EYRB 4AQ1B 2YUZA 2VXVH 4N0YL 2OTPA 1UWXK 5SWQA 3T08A 2APWA 4U33A 4YO0B 2Q87A 5C71A 3DI2B 5E7BA 2GJZA 2XZCH 4UIKL 1MHEA 4Y4FB 3QIUD 4Y8DC 3FONA 3T0ED 1HN1A 1CR9L 3ILPB 2MSPA 2V5TA 4HGWA 2QKIB 3SDXA 1YNKL 2AJYL 3S37X 5LWYH 1G9ML 2XN9D 3HNSH 4ZUTA 4F7EA 4RGNE 3LKPB 5BO1H 2HN7A 4JAMA 2VKWA 3W5MA 5AAMA 1RZJC 3DARA 1MCKA 1FRGH 4KDVA 3B9KB 4FXLA 3OAYH 1HSAB 1FO0L 1YQVH 4QGYA 1U9KA 4G6JH 1ZLSH 1YPZE 3NABH 2X1WL 3V0VA 3L3IA 4PRHD 2VZUA 1VFBB 4YHYB 5D7IA 2FATH 4N90D 3W39B 1QNZH 5GRVL 3CC5B 12E8L 4X9FA 5CBEA 4JKWA 1SEQL 3IDYB 1JL8A 4AY0A 2VABA 5EUOB 3MUGA 2WUCH 5I74B 5GS1C 1MCWW 2V5MA 3EYSH 4NBXB 2D7NA 3OKMA 4UT9L 2DYPD 3B9EA 3MNVB 5ESAB 1LE9A 1OPGH 5C07D 3CX5K 3JWOC 1PKQB 4QY8A 1J10A 1I1YA 1UM4H 3IDUA 4YHKH 3KPOB 3KLHD 2HFEB 4H0GA 2BOBA 3EO0A 1S7SB 4MYWB 3KPPA 1XGUB 1ZEAL 4EN3B 1L9NA 3ULUD 2UZIL 2YXFA 2BVUA 3FQWB 2D0HA 5HYFA 1DBML 2JB5L 4HXBH 2FECL 4P9HC 1M1SA 4A2LA 2XXCB 4EI5A 4KDTA 4XCCL 1IBGH 4AG4H 2R29L 2A6KB 2HLAA 4HS3A 3CIQA 4ONFL 4XNYL 2V7HB 3KLDA 5FUOL 3HFMH 5T1KB 3VXRE 3FL7A 5FUCC 4XB7A 1LK3H 1OTTD 3FT4B 4OFVA 4RGMC 3UBXI 3HE7C 4P0DA 3O41B 3IETB 1TETH 3REVB 3KPSB 5DWUL 2PR4L 2NZ9D 4Y5YB 3WO4C 2RBLA 1OP9A 2Y7QB 2M2DA 3DX8B 3FT2B 4OD3H 2I9TB 2BXZA 4JHWL 3NCJH 3EYFA 1G7LA 3HMXA 4PRNA 3L5WA 3LKQB 5CEYA 2X1QA 4K8RD 3S37L 5FDWB 3QEHB 2FZ3A 2MKLC 1OAYH 2FX7H 4TQEL 4I8DA 5EDXA 5C0RL 1T66C 3NZ8B 4LCCB 3L3JA 4HZLA 5INCB 1DQLL 4OUOA 4N5EC 5HVWA 3Q5OA 5E8PA 4AH2B 4X4YB 1ZVHA 2QHRL 3MLRH 3U30B 2A6JA 4ISVB 2AKRB 1ACZA 3BUYA 5DHVH 2MCPL 3RWIA 3K46A 4OD2A 4B0MM 1WIUA 3H9SE 3UROR 1FGVL 4Y5VA 2NXYB 3N85L 4MSWA 4S1SH 1MH5A 4TNWF 1I8IA 1FFPB 2ZCKH 3DXAA 2D7QA 1BIIB 3AS1A 4LLQB 2DM4A 5M95B 3IVKB 3VFWA 5I1EH 3G5ZB 4TRPL 1ZHLA 1JZ4A 3C60A 3FTGA 4NKDA 1KNOB 3EGSA 1BEYL 1KCLA 3IXAA 4GS7B 3LCYA 4HUUA 2NYYD 1QLEL 4G8FB 2Q7NA 1GPOH 1INEL 2BOCB 3EZ8A 3HG1E 5JIPA 2BVPB 2IH3B 5DC4B 2QADC 3DURA 5JIIA 4WFGD 3TV3L 1AP2B 3VA6A 2VLMD 4Z8FH 1QKZL 1ITBB 3G5YA 1AO7A 2A73A 1K6QH 3T3MF 3QIUB 4FXKA 3BGFC 4P2RE 5FA4A 1YMME 3P0GB 3T0EB 1F4YL 2Y07H 1MLCB 3ESVF 1MCIA 1I85C 3GBLA 5JW4R 4XMPL 3MRGB 2C1PA 3OKNA 4M43H 2RHEA 3VFSB 3RNKA 2XN9B 3RGVB 3IB4A 3C2AL 3LB6C 2KZ1B 1U8MA 5GRXG 3PGFH 3WXWH 1FH5H 3TBYA 4U1GC 1X6LA 4Z0XA 5TH2A 3GBMH 3U1SH 2EYTA 3PL6C 4OCXH 1KIPB 3SE9H 5HGAB 2P5WD 1S7WB 4HHAA 5HYSG 4H0IA 4Z7WE 3SDCA 3HS0B 5KN5A 2R2HA 2ZOLA 3O8XC 4KJPD 5C9JB 5CEZD 4PRHB 5LQBH 1KENH 4HPYL 4JHAH 4ZPTB 1DQQB 4YHPA 1A7OL 2HTKD 3KYOA 1XF1A 3MLXL 3CFCL 5C2UB 1NDMA 2X4SB 3RNQA 2ZSVA 3DBXA 1X5HA 1MFBH 1U58A 1WAAF 2GCYB 4MAYC 3P11L 4YPGA 5ECJE 2DYPB 5GISH 3MBED 5C0FB 5IVZB 2VLKD 4ZNEE 1HCVA 4FXGB 2ATPB 5C07B 1ZKAA 4ODBD 4PREA 5EPMB 1RIHL 3QNXB 2X1XR 2A9MH 5KSBB 3ZDXE 1QBMH 5CGYD 4Y5XC 3A6BH 4DUWA 2Y6SD 4TNVK 4K9EH 3O2WL 4XNUL 3VFMB 1D9KA 3LHPL 5EZIH 2BXYA 2VC2H 5D93C 5HI4C 1QFWM 3E2HC 4QYOB 3CMOL 1FVDA 1UVQB 1XCQA 1D6EB 1NFIB 4NO5B 3ARGA 1R5IA 1EERB 1IEBB 2LABA 1QG3A 5TE4L 2NPLX 1V3KA 3H7BB 5JOFA 3HPJB 5D2NA 2Z92B 2CKBB 2UVEA 4JVPA 5KSAC 5KOVC 3MX0A 1IC7L 1LO3H 4NO3A 4HD9A 4ZUWA 4OFDA 4FABL 2VE6A 4IMLA 1RZKL 4U1SA 4ODTL 3AMLA 1P2CB 4HWEH 4FQJH 2ARWA 2DLGA 1GOHA 1UXSA 1NUDA 2FGWL 3V95A 3HI5L 5FB8A 1BFVH 4XC1L 4F3FB 4HULB 1S9KC 5C0CD 5FV2A 1ULVA 1X5JA 4LMQE 3EJYD 1NPUA 5B21A 2B1HL 1A47A 1CE1L 2LAGB 3EAKA 5ILTH 4ETQB 4FZ8L 5CWSB 2FX9H 1SEBB 1HNGA 1AHWA 4FFVC 3HC4H 1HE7A 5EBGA 3NAAL 4UILL 3F58L 5IQ7H 1KSRA 4TUJA 1N6VA 4KROD 5C70A 2VIRA 1H3VA 4F80A 4R4BB 1XCTB 4UT7L 1AC0A 1CD9B 5BS0E 1EHLL 3WFEH 1D7FA 3PHSA 4D2NA 4NHUB 5IR1A 4NQSA 3SOBL 4ONGH 3TPKA 2COQA 1BJ8A 1G6RH 1S7TA 3QXTA 1QHOA 1T89A 1MQKL 2SEBA 5DA4A 4NO0D 1MIML 4OCSH 4LLVA 4LEXL 1CGSH 4C54A 1F2QA 1FNLA 4KKBD 1X7QA 4PJBA 3LS4L 2MCG1 4AENB 3W81A 1MCJA 3VXSE 4TOYH 3QDJA 2BNUB 2J8UE 3JTTB 5C6PB 1IGFH 4RWHA 4KMQA 4NKIH 3QXAA 4XI5D 3K0WA 1R5VA 1FL5A 1GH7A 3IXTB 5FO7B 4KGJA 3CD4A 1JK8B 3O4OB 4OLXH 1FG9C 5DDHA 1UWGL 4OLUH 1QYGL 1NANH 4P9HH 1FQ9C 2AEPL 3VFGH 4F15B 1ZT4A 3NMEA 1ZGLB 4GAGH 4LFHG 3MRHA 4XVUD 3HHRB 1PYWA 2VR9A 5I1DB 1G9MC 3C6LA 2F54A 5K9OA 4ZTOH 5FM4A 1T0MA 4LVOC 4LAQH 1P4BL 1YPZF 4M6MH 3QFJD 1J5OL 4PR5B 5EUKA 4JKKA 1BBJA 2H2SC 4RWYH 4R0LC 4BSVB 3EFFB 2N4IA 1MFDH 2ARJB 2F19L 4QHKJ 3VH8A 2LQRA 1N6QL 1Q9WA 4UQ2A 4ZTPH 1JI1A 2P5WB 2VDRL 3BO8A 1ITCA 5DMYA 3ARBD 2VUOA 3D3VD 1W0YT 1BM3L 4I4WA 1Y18B 2XV6B 3QQ4B 4MX7A 1H3TA 4HUXA 5I8KL 4KZDH 5DJDB 1ZA6A 2RR3A 3U7WL 1ADQH 3FHQA 2OL3A 5IGXH 3JBG7 4JFFA 4BSWA 1A1OA 3VXMD 1BFOB 1QFWL 1JF1A 1YY9C 3BESR 2CO7B 1BF2A 5ESQB 3C9NB 1U8KB 3GSNL 1TQCC 2FNBA 3MBEB 1A6ZA 3GRWH 1U3JA 2VLKB 4JFXA 1YEEL 3QUMB 4W4NA 25C8H 2EIZA 3RUGE 3KXFE 2EKSA 4X6CE 1LWRA 2YPLA 2ADGA 1FNEA 3TBTB 5HVFB 3GSOA 5C09A 2P48B 3AXLA 5JPNA 1FGNH 4YC2C 3PWUB 1YNTB 3RVXC 4ZO9A 1KJ2L 1G0XA 1LDPL 4L3AA 3MA7B 5GJSL 4HBCH 1KN2L 2QR0B 1ZT1B 5DJZA 4JZJC 4E0RB 1GGCH 5FCSH 4NM4H 4Z7NE 5IBLC 1A9EB 1MIEL 5HJ3A 4H1LA 4KDWA 2NY2D 3D48R 3IJSA 4JY5H 5I9QB 5EBLA 1Z0NA 2ZP0T 1LP9A 3MLWH 3WHE1 1N7ML 5A3ID 1JNLH 1FP5A 4ZFFB 1OGAA 4PRDB 5ICYB 4MNGA 3FAWA 5EIIA 3C5SA 3AS0A 1RURH 2FBJH 1YUHA 2EDHA 2YD1A 1VADA 4OQTL 5C0CB 4M7KH 3UTSD 5DK2A 3S8WA 4Z7OE 1NEZA 2XOTA 3GMQB 5SX4H 4HS6A 2FJGB 4X80H 2VLJE 4IDJH