4P46A

J809.b5 y31a tcr bound to iab3k
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
199
structure length
199
Chain Sequence
QVRQSPQSLTVWEGETAILNCSYENSAFDAFPWYQQFPGEGPALLIAIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASKGADRLTFGKGTQLIIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
publication title Effect of CDR3 Sequences and Distal V Gene Residues in Regulating TCR-MHC Contacts and Ligand Specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2014-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p46A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p46A02
4H20H 2DYPD 5DK0B 4ZO9A 3TV3L 3X12B 1OSZA 3JWOL 4DTGL 1WZMA 2WV3A 4WFGE 2IALB 4PJIE 1HCVA 1XGPA 4G8FA 3P9LB 5JOFB 3TGXA 4YHPB 1A3LL 2VDKH 3W81A 2R1XA 4LLWA 3ZKNC 4GRWF 1IC5H 2CK0L 4YHKH 1KCVH 3MGAA 3LOWA 1W8OA 3SJVD 4EDXA 4JG0L 3LMJL 1V3KA 3MUHL 3NGBB 3EYFA 4NDMB 1QNZL 3TT3L 2XNAB 4OM1H 1NGZA 2FB4H 3EZ8A 4WU7B 4I5BB 1GGBL 4PG2A 1E4JA 4RFEA 5DMGC 2QEJA 4X7SH 2GHWB 4LVNB 1J5OL 3RJQB 3BDBA 5JXEA 1MJ7H 5T3XD 3TBSB 1MVUA 4NNXB 2BOBB 4UIKH 5ERWA 2E6JA 4G8GA 4JFFD 3LQAL 2HTLD 2GCYA 5BMFL 4ZXBC 1F90H 4OBSA 5D5MF 5C0BE 1CWVA 1T0NA 2MHAA 1B9ZA 2CRMA 1XGYL 5CJ5A 4J8RA 5E00A 4HJGB 1KPVB 1I4FB 3GBLA 3UDWA 5B3JF 5KBNC 4A6YH 2GJZB 4Y5YA 3BEVB 3S7GA 4NN5B 4QY8A 1G7QA 2VDQH 1NFKA 4FQCH 2DWEA 4FTVE 3WO4B 1TMCB 2VERN 9CGTA 1R3JB 1ZT1B 3IETB 1ZVSB 1KN4L 2FYYA 3C09B 3QEQD 2EICA 3ZT5A 4OZGF 4PJBE 3PP3K 2ESVD 1LP9B 5IT2H 4U1GC 3A6BL 3MOBH 1TZHB 5FGBA 2P5WB 1Z9OA 4KKAD 2CIIA 4ELME 1J10A 2WBKA 3FTGB 3PP3H 2P4AB 1YEJL 2GSGA 3DSNA 2AJXL 4ZUSA 3KLHD 3T3PF 4LLYB 1SY6H 4TPRH 4PGJA 2XQYK 1IAIM 2D9QB 2WWKO 4Z8FL 2DI8A 1I9RL 2W60B 5KSBA 1KCSH 2NY3C 2EE6A 3RGVD 1DVFB 3O4OC 3RY5A 3BUYA 3BN9C 4I0PD 4XAWL 3C8DA 3MBEC 3ZE1F 4NRZB 1V8HA 3MA7A 2R0ZL 3TP4A 1UQSB 4BSVA 1BLNB 1BQHB 4IMKC 4OCYH 2EDYA 3RPIA 1A6ZB 3FZUD 3O45B 4HUUB 4NO2B 4LFHG 4WFFD 5E4EC 5DJCB 4XBGA 5CZXC 5J9PA 4L8CA 4YK4B 2IEPA 1L4IA 3G6JE 1RIUL 3T09A 4CJ1A 2GT9B 2AJUH 3IS1X 2D7TH 2NX5E 3EYUL 1PY9A 4KK9C 4LKXA 1TZIB 3DRQB 3I85A 1Y0LB 4U6YA 4G8FB 5E4IA 5C3TA 1OQXA 1R3KA 3ZKND 2R1XB 4H1LB 3BO8A 1FNGB 2ZUSA 2C3GA 5IQ7L 3CFKA 4HLZG 1T3FA 2DLEA 4UNTA 1T7WA 4HKXA 1RU9H 3EYFB 3D39A 1AQKH 1C8PA 2D2OA 4L3EE 4RFEB 3U2SA 5E9DD 1W72B 1EBPA 3C6LC 2B0SH 1MVUB 5ERWB 3QUZC 4KI5E 4JY5L 5L6YL 1VPOH 4G8GB 1D3CA 4V1DE 3L9RB 2XRAL 3FO2B 2NXZC 4ZXBD 1TJIL 2MHAB 5E1AA 3GMPA 4LSVL 3V5HA 4J8RB 5E00B 3EJYC 4MXWL 5T5NF 4Y5YB 4DCQA 2I9LA 1T89C 2P42B 3FRPA 3WFCL 4QY8B 1YY8A 1G7QB 4KUCF 3SE9H 3V0WH 4UI2A 2DWEB 4XNUL 2CR3A 5J06A 1ROWA 2VLLB 1S5HA 1C08A 4JRXD 4G7VL 3NA9H 5E2WL 1YMME 5HDQH 2JB6A 2FYYB 1RUAL 1EX0A 1KIRA 2DQGH 5BS0B 1CLCA 1TJHH 4LL9A 2VDLL 1S7XA 4X6DE 3ES6A 3IFPA 2X10A 3SEPA 4D0BB 3S35L 2CIIB 7CGTA 3B83A 1PW3A 2BNUA 5IESH 4PJXF 5F9WB 1H3WM 1J1OH 1I1AC 3W9EA 3QQ3A 4R4FL 3D25B 5F3BA 3NCMA 4AT6A 3NFPA 5H94A 3PDDA 2DOCA 3W2DL 2HWZH 3O2WL 2HKHH 4IDLA 5EB9A 4GG6E 5E6IA 2HJLA 2VXUH 3VI4E 3DOSA 2NY3D 4XCYA 5KSBB 4MXQC 5I15H 5JOPE 3BN9D 5GGQL 2IAMD 3E6FB 1CXEA 1JRHI 4K3JH 3SN6N 3QHTC 4GW1A 5CCKH 3MBED 1R5VA 3N0PB 4P9HH 4KKBC 4PJIF 3UMTA 4XWOC 3UO1H 3M1BB 3WJLC 4N0RA 4LPXA 4BSVB 4LHUA 4XHJC 5IFHH 4G6KL 5E8NA 5F7WC 5HHOE 4JFQB 1KLFA 4TNVF 2P24A 3CDGA 1CLOH 2VITB 1QSED 4WJ5A 5MENB 2D4FA 1D5BA 1P5UA 3OKOA 4XBGB 2NR6C 2H1PL 4ONFH 4QF1A 4Q9QL 3IDJA 4JPKL 4E9LA 1YEKH 5C8JA 4KY1H 2C4FU 4XNZB 4GAGL 4AL8L 3FONB 4KK9D 1SM3H 4HZLA 3WXVH 4LKXB 4JFFA 4U6YB 4XRCB 5CJBA 4QRTA 5KS9A 5JPMA 5K9QI 5JUEH 3V9FA 4Z7UF 3BO8B 3IB4A 1LVEA 3CFKB 1MRCL 2EO1A 4IIQA 1HWHB 4MDJB 4OCWH 4PJEE 4HKXB 4L4VA 3D39B 4BK5A 3EOAB 1LDSA 4PGBB 5F96H 4I0KA 3MRHA 4LSUH 5J6HA 3C6LD 1NCWL 2FH6A 2Z93A 3U6RB 2DQIL 1BFTA 5EO9A 1YNLL 2NXZD 1F3DH 2OZ4H 5E6ZA 4PJBF 2FGWL 4I77L 3V5HB 5E1AB 3GMPB 1YNTA 3EJYD 3P4NA 3G6DH 3G5ZA 2FR4A 4ONGH 2A6KB 3PV7A 2VDPH 4JG1L 5IMKB 1MPAL 5ESQB 3MRBA 4DCQB 2I9LB 5GRXG 5LXGL 4K9EH 4PTUA 2O5YH 1AXTL 1YJDL 1KJVA 3D9AL 3QAZB 3ARTA 43CAB 3DX9B 4HWBA 5TDNA 2XXCB 4JPVL 2ERJB 1FSKB 3BP5A 1S5HB 1FAIL 4UINL 4XCNB 4CVZB 4NKMA 1HH9B 3ZTNH 5EN2A 3T3ME 5I17A 1RZGA 2VMFA 3P0VH 1AD0A 2JB6B 3OGOE 3BZFB 1KG0A 1YYLL 1A1OA 4K3EH 4P46D 3B2VH 1S7XB 3ES6B 3IFPB 1TQBB 5KJRL 5MEOA 4FQXA 4DGIH 2VL5A 4FFYH 1OAYL 4X4YA 2BNUB 3LZFL 1I1AD 5FUCC 3BEWA 4FXGB 3W9EB 1W0VA 4XPFH 3BP4A 3QQ3B 3MNWA 4NM4L 5L2KE 5F3BB 2A2QT 4OUUA 3EO9H 4LVHB 1KC5L 2EKJA 4DOHE 4JFDB 2AK4D 1RZ7H 2F58H 1QKZH 1JWSB 4LRIC 3ZE0F 5JHLL 2HJLB 4AZ8A 3LY6A 4MXQD 4FQJH 2JLLA 3S3PA 5IFJB 4IMLA 4CN6A 5DK3A 3P11L 3PF2A 4W81A 5FM5O 4GW1B 4KKBD 1R5VB 4FS0A 4XWOD 1I75A 1JF6A 5HSFA 3JWDC 3BDYL 4MA7H 4XHJD 4LHUB 3HAEG 4WI2A 5E8NB 2P24B 2PYEE 1LD9A 4J23A 3CDGB 5DJ2A 4WJ5B 2YN3A 5DFTA 2RCSH 1D5BB 2IFGA 2NR6D 3OKLA 3P0YH 4QF1B 3SJVB 1CBVH 2RFXA 3WUWG 3GK8L 3HI5H 3IDJB 2ARJA 4Y2DC 3F65A 5C8JB 1EFXA 1UB6B 3U36A 5CJXA 1WC7B 4KI5F 1B4RA 3WIFA 3H3BC 3NCBB 4FQ1L 1I7UA 4AEIH 2NY6B 1ADQH 2AEQL 2RJMA 3HLAB 2BVYA 4JFFB 5KVDL 2YD3A 4LSTH 4LVOC 4QRTB 5KS9B 5T1KA 4ZO6A 5JPMB 4UIMB 4OLUL 3BI9X 3CH8A 4XPHH 3SDDC 2BNRE 4OD1H 2NQCA 3FAWA 1B6UA 2LU3A 4IIQB 2AJZA 5FKAA 2ILLA 4L4VB 2C3WA 4OLWH 5KG9A 1FG2A 4OD3H 5HI4C 3MLRH 4X9HA 5CZKA 3RU8H 3MRHB 3V4UH 2FNBA 5J6HB 3S36X 3T04D 3PWJA 2Z93B 5BO1H 4GUPA 1B90A 5EO9B 3LN9A 5GRUH 2A77H 1C5DA 3LKNA 2VUOA 4WDIA 5EOCJ 4FP8L 1JFQH 1ZHNA 4O51B 4ODTL 4RGNE 4X6DF 3G5ZB 3QEQB 2FR4B 1FGVH 4QHMA 4NN6B 4WUUE 4Y7MA 4JKKA 4AENA 3QRGH 3VWJC 1WJ3A 1M7IB 3MRBB 5DJYB 1QSFD 4J12A 4MCYA 4JQXA 3L3KA 2NY0B 3HMWH 4MNGE 5CJQH 2EYTB 4P2CG 3BP5B 2UWEA 4O02L 4GG6F 3QIWC 4NKMB 5DEGB 5EN2B 4JDTH 1AD0B 5IB3B 1NLDL 4X6BA 1KG0B 2JIXA 1A8JH 1GOGA 3BESR 1FRGL 3RGVB 4CDGC 2F5BL 4DQOL 5MEOB 4MX7A 1ZS8A 1ZK9A 2VL5B 5GSVA 3IFOA 1JF1A 4LMQI 3KJ6H 2JCCE 3U9UB 4JHWL 2Y07L 5F1NB 1W0VB 1HCFX 1YEIL 3BP4B 3MNWB 1QRNE 3SDYH 4XBEH 3WFEL 4O58L 1H3GA 2XT1B 4XI5C 2R9HC 4U1LA 2QHRL 4LSPL 4Z7VF 1U8MB 1N64H 4XP1L 4DKAA 3RWEA 4P2OA 3RWDB 1A7OH 4IMLB 3IU4H 5DJ6B 2XTJD 1MCQA 4HUWA 3UPAA 5DHVA 3VGAC 3FO9A 1KN2L 3JUZA 3O0RL 3MJ6A 3BE1L 1P2CB 3WS6A 3V4PL 3DROA 1LD9B 3MBXL 3MR9B 5DJ2B 3EJZD 5EWIL 2UZIL 4PJEF 1C7TA 3K81A 3GJFB 4LCCC 2RFXB 5CHNA 3K3QA 5FDYA 4WCYH 3E6HA 4Y2DD 1MRFL 3H8NA 2XN9D 1EFXB 4JN2A 3VXNA 3U36B 5GS1A 3WIFB 3KPOA 1I7UB 1FO0A 4LQ1A 4E41D 3QUZA 3LVEA 1UM5L 3OR6A 4P23A 2PW2A 4ZXBB 5T1KB 3SDDD 1KCUH 3ULVH 3OPZH 3ZYIA 1EUUA 4QTIH 2HVJA 4NZUH 3ULSA 3CH1A 4X80L 4AIZA 1BQSA 2AJZB 1RAMA 5FKAB 5KG9B 4O00A 1KTLA 1LO4L 3WDJA 2D03H 1RY7B 5LG1A 4JREC 4S1RH 3SGKA 4GUPB 5F9OH 4EQ2A 2UY7A 4JO3H 4XCFH 1C5DB 1I8LC 4WDIB 4BQBA 5I1EH 2I27N 4Y89A 1ZHNB 5FCUH 3VFNA 4KRNA 1MFDH 1N7ML 3PQYD 4N0CC 4ZSOA 4LEXL 4QHMB 4UILL 3TVMA 4U1GB 1A6PA 5IEHA 1XGUA 3OF6D 3UTPD 1EO8L 3R1GL 3WIIL 3GSNH 2H32A 4U7KA 1CR9L 1I1AA 3L3KB 4K94H 3EJJX 5MEPB 3VFGH 4DJMA 4DN3H 3NCJL 3KYKL 4OB5H 3QIWD 1EEUA 4JKLA 4NKDA 4F8TA 1HINL 4QWWC 1I7RA 4PBVC 1CQKA 5GGTH 5BVPL 1CDUA 2XKNA 2YPLA 1GC1C 1LO0L 1BD2E 2R56H 4X6BB 1FZMA 2JIXB 1K4CA 3B43A 2NY3B 4DVBB 35C8L 4ISVB 3MV8A 3X3FH 4LSQL 4MX7B 1ONQA 3U48A 1IARB 3IFOB 1JF1B 3MBEB 12E8L 3SKMA 3WJLA 4PB9L 2KUTA 5E2TH 4AQOA 2B1HL 1ZV5A 2XWTB 3P4LA 3IS0X 1OGAA 4XI5D 4B50A 1B0RA 2R9HD 4P3WA 4U1LB 1NMAH 4M02A 2K3TA 4N1HB 1EVUA 4P2OB 4HWBL 4M00A 2W65A 1WGOA 5E6YA 1YDPA 4TVPD 2MOVA 5EA0H 1AD9B 1HWGB 3H6JA 5IB2A 1EJ6A 1LEKA 1BM3H 2F5AH 1V05A 4HUWB 1FHGA 3FAXA 5J4MA 4L3AA 3DROB 1XF5A 3CFJA 3RHWK 2R1YA 3QEHA 4P3DB 4X7TA 2P46B 1P1ZA 2WINB 4XVUC 3C08H 5ADPH 4XC1L 4FQ2L 1J88A 3GHEL 2P1YA 3PWPE 5CHNB 2E9WA 4NQDD 3E6HB 5IVXF 1O7VA 1QO3A 2VLRE 2DWDA 3NCCB 3QEGL 4TSAL 4PJAF 3VXNB 4AG4L 5GS1B 3KPOB 4BA8A 3C6LB 1P7KA 1FO0B 5HPMA 3NPZB 2V2TA 4XP6H 2X05A 3QUZB 3KHQA 4NRXA 3WNNA 3OR6B 4OZHB 5DD6B 4HUKB 5EBMA 2BDNH 3OJ2C 4P23B 1J18A 2PW2B 3D48R 1MREH 1DQQA 1Q9LA 5JMRA 3ULSB 3CH1B 1C1EH 2XOTA 3STLA 4H8WC 4AIZB 5FYJL 3HZYA 3V6ZA 1EAPA 2DQJL 3CDFA 2ZCKL 4LPCA 4EDWH 2HJFA 3S3JA 1N6UA 5D71L 2DTMH 5I1JL 3I84A 1P7QA 5I1GH 1KCRL 4EJ1C 1JV5A 5FB8A 3VW3H 1NH6A 3V6FB 2V17L 2ZUUA 3ZE2F 5JW4Q 4BUGA 5FOJA 2BSTB 2BVUA 3B2UC 5DR5H 3VFNB 4LSSL 4N0CD 2HYMA 2FJHB 2YR3A 1GHFL 1UACH 2YD8A 1N8ZA 1VFBA 3H9SD 3W5MA 1I1AB 4G42B 4PTTA 5EPMA 3KYMA 3BJLA 4ZUTA 2AV7A 3QPQC 4QWWD 1I7RB 5JA8B 1U2CA 1N5AB 2XKNB 3BOVA 2YPLB 3H42H 1GGCL 4LRIA 2R2CA 1FZMB 4GXUM 4WFEE 1Y6MR 2E6PA 4J3WA 1YA5A 4ZPTA 5K33A 2FIKA 3TV3H 1J11A 4D9RE 4ZD3L 3SKMB 1GYAA 2OS7A 1T1ZA 3I02A 5CD3B 1EXUA 3K74B 4MQTB 4DTGH 3MGTA 2EXYC 3H7BA 1HQRB 4M3KB 5HHPB 5BZWA 1DEEA 1B0RB 3CCHA 2ADFL 1ZGLA 1MWAH 4CL7A 1XEDA 3PDGA 4X6CA 3BKJL 2JKXA 1A3LH 3SGEH 2F19H 3QPXL 1NPUA 3LN4A 4Q2ZA 4ZQKA 4BQ9A 2W65B 3BZDA 1YDPB 1IC4H 3GKZA 4JG0H 4XB7A 3LMJH 4Y2DA 3TT3H 5IB2B 1QNZH 5D2NC 5KVEL 4R97C 2W91A 2FD6L 3DIFA 2I07A 2JELH 1MJUL 2XZZA 1ZTXH 1J5OH 1JPSL 5JIKA 1T80A 3RWIA 1XF5B 1MQ8A 3CFJB 3LQAH 3T4YA 2WBWB 1Z3GH 5BMFH 2R1YB 4HCRA 4X7TB 4XVUD 1P1ZB 3KHOA 1XGYH 3A6OA 3MUGB 2R0LL 2EC9T 4NP4L 5ESVA 2DWDB 4YHLL 3ARVA 1P7KB 5JO5A 1AR2A 1UM6L 2V2TB 4NNYA 4NRXB 4LSDA 1QFWL 5EBMB 3MRNB 1JNHB 4OQ1A 4L5FL 1B88A 1U3YA 2FHCA 1VCAA 1PZ5A 1DQQB 1Q9LB 1WAAF 1QBAA 2XA8L 1NKRA 2VDNL 4NRYA 2ICCA 3HZYB 4G5ZL 3A6BH 3VWJA 4MA1C 2WQ8A 4U3XA 5C7XH 5ADOH 1FE8L 1S7WB 1S9WA 4HJ0C 4Z18A 2A1WL 2EEDA 1QSFB 3ULVE 1P7QB 1JV5B 3KS0H 4ZO7A 3DXAA 4HFWA 1YEJH 5F3HA 1O7SA 1MHCB 2C5DC 1F6FB 3B2UD 3LS5H 1D9KC 5ECJE 4BQ6A 1Q0XL 3TH2T 4XPGH 1FO0L 4Z9KB 1CXFA 3ZYJA 4MZ2A 4Z8FH 2Q76A 1I9RH 5DZNA 2O61A 1VEOA 1X3DA 5E1HB 3O3DA 4X5XA 3EOTL 1N8ZB 1VFBB 2AGJL 3C6SA 4IJ3C 4N8PA 1FCGA 4K8RC 1J8HE 4AYFA 2VZTA 4PTTB 4D0DA 2R0ZH 3KYMB 3QPQD 2WLZA 4ZUTB 3TIEA 2AV7B 4DZ8A 1DR9A 3WD5L 2VKXA 1B2WL 1JYNA 5D1QA 1YPZE 1BVKA 2IQAB 1L9MA 4YE4H 3DSFL 4PJHE 4QXWA 4ZPTB 2FIKB 1OHQA 4OLXL 3OKKA 3O3AA 4F15B 1RIUH 2BX5A 4WFHD 3I02B 4S1DC 2FX8L 1WV7T 1HKFA 1EXUB 2ARJQ 4R8WL 3EYUH 3MGTB 4KUCD 4ZYKA 3HZMA 3FFCA 5BZWB 3QFJA 5JNYA 1J1XL 2EDLA 1DEEB 1UA6L 1FVDB 3CCHB 4M1CD 1IEBA 1GGTA 1N26A 4X6CB 3KPRA 4OIIL 1JTPA 2NYYC 1U8PA 3LN4B 2DICA 4Q2ZB 4ZG1A 5IQ7H 5JZ7C 5D7IE 5L8LB 4PRHE 1QFPA 4HMCA 4Y2DB 4LPTA 3ZDYE 1H15A 2XN9B 4TSBL 2FWOB 4KTDL 2VZOA 3DIFB 1HILA 5CIPH 4CUCA 3KDMA 4WHYG 3RWIB 3UTTD 5L6YH 1RMFL 4JO2L 3BISA 3MOAL 2XRAH 2GY5A 1TJIH 3RY4A 1UYWH 1TQCC 3KXFA 1AJ7L 4LSVH 2C7UA 4OGXL 4RFOH 2JJSC 3KPSE 5EOQL 1CG9B 4YH6A 5ESVB 3OG4B 3HC4L 3ZYOA 3RUGA 2AS5M 1CD8A 4G6AD 4CADB 4WFGD 3U0TA 5JLZA 1P53A 1CK0L 3Q2CA 1MJJA 4HX1A 4XNUH 1I8LA 4KHXL 4RAUA 1PZ5B 4G7VH 5E2WH 4G6FD 3BKYL 4CMHC 4ZODA 1C16A 1DUZA 4QXGL 1AH1A 1RUAH 1FNEB 3OKEB 1QFHA 2FLRT 4NRYB 4JRYE 5FUZH 4P2QA 5A2JH 5IROA 3V5DA 3VWJB 2EEBA 4U31A 3CVIL 2ZUXA 3WCYA 4HV8A 4EUPA 3B9KC 1CXIA 3PABA 4KI5C 4R4FH 3DXAB 4K55A 3QIWB 3QJHA 5C0BD 3W2DH 3O2WH 3MJ9A 5C0IB 4EXPX 2PNDA 1D9KD 4FQIL 3MCKB 2DAVA 4MNQE 1QBLL 5C3LD 5LJYH 2Q76B 1J0IA 3CXHJ 3T0EE 2JB5L 5TJWK 4OLZL 3VFUA 1X4YA 3O3DB 5K93A 4XMPH 1JNJA 4K8RD 2X44D 3C6SB 5DD0L 4ZTOH 1VKXA 4JHZA 3S98A 1A6VL 4J4PC 1BJ1J 1G7HA 1T1YB 4D0DB 1CE1L 3AGVA 3TIEB 4DZ8B 4Y16A 2O5XL 4G6KH 3HAEH 3SDCC 5CP3H 1YEGH 3NZ8A 4KGJA 3CFIC 5GS0C 1T03H 5D1QB 1CGYA 2YKLH 1BVKB 4NKQB 3EYSL 4YDIL 1U3HC 4BJLA 1TDQA 2H1PH 4KPHL 3TNNB 1INEL 1OP5K 4Q9QH 1D5IH 3VXRE 4JPKH 4OV5B 3OKKB 3NOIA 3O3AB 4MMZC 1QA9A 3VGAB 3D85A 4GAGH 4AL8H 4ZYKB 3HZMB 3TCXA 3QFJB 4EBQL 5JNYB 1IEBB 4G8EA 4MD5B 1KENL 3I9GL 3KPRB 3AAZB 5GGSY 1U8PB 5JZ7D 3B6SA 3D2UA 4LCCB 4KWUA 3O4LD 3LPWA 1GZQB 5T1LA 1MRCH 4NQDB 1WLHA 1OB1A 3LQMA 1HILB 1NCWH 1DTUA 1WIOA 4YBHA 4X4XA 4BQ8A 4WU5A 3HC0B 2DQIH 1PD6A 1YNLH 2X4QB 5E08L 5F6HI 1MIML 5IV2B 5IW6A 2FGWH 3KXFB 4F7TA 1UG9A 4I77H 4M6AA 1UENA 3CK0L 3K8LA 3HZVA 3O3EA 4EI5C 3SOBL 5I8OL 5J8OA 3GBNL 2XXMB 1I1YA 4N9GA 1K4DA 3ULVF 4JG1H 3NCFB 4LLQA 3O6FC 3SGEI 1Q94A 5KSVB 4HWZA 3U46A 2VN4A 5EUOA 3RUGB 2NX5D 4JREB 1AXTH 2HG5B 3U0TB 5JLZB 2VKWA 1MJJB 4HX1B 4JPVH 3VCLB 2EDOA 4RAUB 2FBJL 1FAIH 2GSIA 4UINH 4B41A 1I7ZA 3NCYS 3QUML 5TH2A 4KAQL 1VGKB 1DSFH 4NSKB 5ALCL 5HHVL 5ABDE 3GI8L 1YYLH 1MUJA 4X9GA 5KJRH 4HCRL 4L3ED 3QUKA 1OAYH 1UEYA 2CIKA 4HV8B 3B9KD 3LZFH 4KI5D 4GBXC 3UTOA 1YQVH 4NM4H 1FNFA 5B39A 5HYJE 2H2PC 2J88L 3RGHA 1KC5H 4ZAKC 1YPZF 3SCMD 3T0DA 2QR0A 3HUJE 3MRJA 4L4TE 1J12A 5DZLA 1KBGL 5D5MB 3VH8A 1AKJD 1JGUL 1VFOA 5JHLH 3QR2A 3M07A 5IB1A 2QLVB 5JQHC 3CAFA 3P11H 3QZWA 4BKLB 2MQ0A 4OJFL 1I3RA 4J4PD 1VKXB 1W2KT 5EOCH 4OZIA 1G7HB 3FT3A 4OF8A 2AJSH 3BDYH 5E8EB 4Y16B 4TVSa 1FIEA 1YMMD 5AZ2L 4U1HA 3TNMA 3WBDA 4QHKI 3NZ8B 2VWEE 1XF3A 3MRKA 4YFLI 5GS0D 4GOSA 1MH5A 3H3KA 1FV1A 4NUJA 3LKPA 4LKCB 3MMEB 2MTPA 3F7YB 5B4MD 5D2NA 2DQTL 4M9PA 4NQSB 3D3VD 3A0OA 4OCSL 4WWID 4PD4K 5C0EA 1RJYA 4FQ1H 4QHNB 4WEBL 5DC0A 2E8YA 2AEQH 1G7MA 1VA9A 2FHFA 2MKWA 3QFDB 4U6VL 5ITBL 1EHXA 5KVDH 1RZKL 4OLUH 1MJ8L 1HQ4A 3LRSA 5JOPD 5D1XA 3B6SB 3H9HA 4Y5XC 5KOVC 4NC1C 5CSBA 4GAFB 4GT7A 3IKKA 3AM8C 2GJ6A 3GMLB 1OB1B 4P4RA 3RHWF 2WK2A 5D7SH 3ELAT 4X4XB 4Q6IC 4WU5B 5I1CH 2ATPA 3JVGC 1YYML 2QHLA 1N6QL 4CMMA 1ZT7A 5IW6B 4F7TB 2Z9TA 4ODTH 5F1IB 4EI5D 3HZVB 4QOKD 3D6GA 4OF6A 3IJHB 3QULB 5FO9A 4DEPC 3CJJA 1K4DB 3QDJE 1FFNA 1XGTA 3O6FD 4WIQA 3STBA 4LLQB 4PRID 1Q94B 1DBML 4HWZB 3U46B 5EUOB 3T0WA 1T1WA 4EQ3A 5HGAA 2IMNA 2H9GB 1T21B 4O02H 2YUXA 1I7ZB 5TH2B 1B4JL 1D9KA 1ZEAL 1OD9A 1ORQA 3QWOA 1A3RL 1MCPL 4KMLB 1NLDH 5GGSB 1UJ3A 2EH8L 4JVUA 4WI9A 1FRGH 2B4CL 2F5BH 5FYKL 4HKZB 2ZWLT 1RULL 1R3IH 3DV4B 4FNLL 1S7VA 2CIKB 2JK5B 2OI9B 3HR5B 4FTVA 4JHWH 4GBXD 2Y07H 2C4FT 1YEIH 2ZNXA 5DDHA 2H2PD 5B39B 2QSQA 3WFEH 4O58H 4ZAKD 4PIRF 2OTPA 1FZKA 1TVBA 4JZJC 5TQ2L 4KXZI 2VL4A 3BN3B 4PRDA 4RGNC 2QHRH 4LSPH 1KXVC 1AO7A 1T0MA 4XP1H 3SPVA 3VH8B 4UV4L 1IEAA 5IB1B 1IM3A 3QZWB 4ELMA 4ESKA 2ADGA 5AAWA 3UPRB 3G04B 2CUIA 2Q7NA 1HXMA 3WHE0 4TN9A 1NLBL 5JHDD 3RWCB 5IB5A 4OZIB 1OAKL 3FT3B 1KN2H 3CUPA 3O0RH 3BE1H 2A6IA 4GMSL 4XP9L 3V4PH 1S3KL 2HFEA 3TNMB 3QUXC 4MJIA 4YXHL 1HHHA 4RSVA 3MBXH 4Z7WA 2FIRT 5I6XC 5EWIH 1ZA6A 2OR8A 2UZIH 5ANME 1JI1A 4DAGL 3OV6A 3NFSL 2GTWA 4OIAA 1LP9E 1E0OB 2EDHA 5DJ0A 1MRFH 3MJ9L 4NZJA 5D2NB 1GC1L 4DK3A 1OTSC 4LHQB 5E94A 1A0QL 4MWFA 5C0EB 3CSYA 1RJYB 5L2KD 5I8EA 3VDCA 1J7VR 1A7RH 1UZ6E 1G7MB 3D18A 1UM5H 4A2MA 2VIRA 4ZFFA 1DANU 5DRWA 5EORH 1HQ4B 3OGCA 3LRSB 2JJSA 3MLSH 4X80H 5LGKA 3H9HB 4KV5E 1H5BC 2YD5A 3UYOD 3G6JA 3RKPA 3DUSA 2GJ6B 1T7ZA 3FRUA 2ZCLL 1OP3K 5ICYB 2COQA 3FQUA 3PG2A 1Q1JL 3CLFL 4PJIB 1KXQE 4MZ3A 2ATPB 5D9SA 1OP3H 1FZOA 5DQDH 4CMMB 3QXWA 4P9HC 4RGOL 2VLJE 4DFHA 4G6FB 3ZKMC 4P48A 3QCUL 3SDXE 2Q3ZA 5FO9B 3ZKSD 3I50L 5I16A 4LEXH 3SDAC 4UILH 1MQKH 4I18C 1FFNB 4MA1B 5IGXL 4CVUA 4L3EA 3VE0A 2SEBA 1A2YA 1EO8H 3GZKA 3R1GH 4OT1H 3RWGA 3SE4A 3WIIH 7FABL 4DKFL 1CR9H 1P4BL 3DGCR 3HUJF 4W6XB 4Q9RL 1VFMA 4V1DA 5HGAB 4P2RD 3NCJH 4GAJL 5C0BB 1HINH 1D9KB 3BD3A 5BVPH 2HRPH 4YFLF 3MRLA 3QWOB 1OAUL 3AREC 4YC2C 4HPOH 1WUNT 2R23A 5GRJL 1SVZA 1SEQH 35C8H 3A6CH 1LHZA 4LSQH 4P49A 2W38A 3H9ZA 4IJ3B 4JO4L 12E8H 1SHMA 1S7VB 4J4PA 1DP0A 2CGRL 2Q8AL 1LEIA 4FTVB 4PB9H 1T22B 5TE6L 5J3HC 4M7LT 3T2PA 2B1HH 1FBIH 2C3XA 4WV1C 2E7HA 4B0MM 5IM7A 3SDCA 2A9ML 3VJ6A 3K4ZA 2VISA 1TVBB 2BVEA 1LO2L 3AU1B 4RGND 3QP3A 5E2JA 3BKML 2XKUA 5H2BB 4PJBB 4WUUD 1T0MB 1MCWM 4D2NA 1U3HA 4HWBH 2G60L 1CFTA 4I48A 3QCTL 4ELMB 2ADGB 2H2SC 1HXMB 1RZJL 4PGEA 1U8HB 2ICES 3G5VB 5IB5B 5C92A 4UDUA 5D6DC 4PBWD 1QG3A 3CUPB 1HXYA 1H8NA 4YZFF 3QIUC 4PY8I 1KTDB 3KLSA 3QUXD 1P9MC 1Z9SA 2HFEB 5FOBA 4RA3A 5HHNA 4PRNA 5CBAA 3C60D 1BQHG 1U42A 4FQ2H 3GHEH 5EU5B 4RNRA 4W68A 2GTWB 3THMH 1NGWA 5DJ0B 1LE9A 4HEME 3QEGH 4AG4H 1DQLL 3O2DL 4KJQC 3CSYB 1XH3A 1FL3A 5I8EB 4N0FB 5HHOA 1ZLSL 3D18B 2R15A 4HG4K 1JF5A 1OTTC 2VIRB 4U3HA 1G84A 4DKEL 4ZFFB 1TQCB 4JFHE 5DRWB 2YRLA 4M43H 3OGCB 2PYFA 1MCCA 5SWZA 4FQHA 4OKDA 4H25B 5FYJH 2DQJH 2Y7QA 3G6JB 3O6FA 3GJFK 4LDEB 3DUSB 1RIHL 2CUHA 4U1JA 4H1LG 5D71H 5I1JH 2XZAL 2NX5B 4JM2F 4F57L 4IRZL 3LEXA 1KCRH 3TF7C 4K7PX 2V17H 3KLAB 1NGXA 5D9SB 4X7CC 5EG6C 2BMKA 5FXCH 1TJGH 2AK1H 3TH4T 4PJ8A 4RRPG 3ZKMD 5ID0B 4CMHB 3GSXA 1S7UA 4RMQA 3SDAD 5I16B 1SJEA 5E5UB 3BSZL 3ZZ1A 4Y19D 4GSDL 5C0DB 1CN4A 1BQUA 3E8UL 1GHFH 1F6AA 3MLUL 3MUY1 1W8NA 4L3EB 3VE0B 2SEBB 1A2YB 1KCLA 3QDMD 3RWGB 1CT8A 4NO0D 3GNML 2G75B 4V1DB 4PJ5D 4BUHA 3RTQC 4I0CC 4Y4FA 1GGCH 1U8LA 1F4YL 4XP4L 3ARED 5DVLA 3DWTA 2R23B 1MHEA 1DLFL 4TTDC 1BWMA 5J11C 1AY1L 1JHTB 1S9YA 5F89B 4ZD3H 3C5SA 3AXLB 3R0NA 1LEIB 3C5JB 3L7FA 3TJHD 5J3HD 1WWBX 1YEEL 2F53E 3IVKB 3TO4C 4PB0L 5IM7B 4N9OB 3SDCB 4A6YA 3VJ6B 1CIDA 1YMMB 2VISB 2ADFH 4XXCC 4P4KD 5MI0C 4GAYA 3BKJH 3FKUS 4JCLA 1LP9F 3MCG1 3O9WC 1BEYL 1U3HB 3KPPA 1CFTB 4I48B 2GKIA 3OHXA 2OP4L 3LHPL 1CD0A 4X6FB 3F8UB 5KAQF 4AMKL 2YXFA 2NPLX 3LDBC 4UDUB 5L2KA 3GGWA 4EIZC 1JPSH 1IEHA 3VFSB 4AM0B 1HXYB 3QIUD 4WHYH 5FOBB 4I8DA 1I9EA 2AP2A 3ILPA 4GRLA 1BD2D 2OMBA 3BWAB 4PRNB 4GG6B 1KELH 2B20A 3O11A 5DRNA 4KV5F 3REVB 3RZCC 3HB3C 2UY6A 4LAJH 5KSUA 4JY4A 2R0LH 5FECA 1D6EA 1NGWB 1LE9B 1VDGA 4KJQD 5IWLA 2VLKD 2VNCA 1E4KA 1CLZL 4YHLH 3DI3B 1XH3B 5E5MB 1FL3B 4Q6IA 1UM6H 3LKOA 4NIKB 1IVLA 3VD3A 5HHOB 1QFWH 2CJUH 1IBGL 3HG1A 1OTTD 2PYEA 4ODBD 1T2QL 2HFGL 4KMTH 2NY2D 5F1KC 4X7EC 2XA8H 5JDSA 1S7TA 5DHVH 2V7HA 5I76A 3S36L 2VDNH 2PYFB 4FQHB 4FZEH 2KBGA 1NANH 2B7DT 4D8PA 4G5ZH 2Y7QB 1MI5E 3O6FB 2X1WL 5TFSH 1FE8H 5D7JC 1NCNA 4XCCH 5CMAA 3K8MA 2APTA 1U41A 1NGXB 4PJDA 2BMKB 2R29L 3CIQA 1G0YR 4PJ8B 3ARZA 4WI7A 2BNRA 3GSXB 1Q0XH 1S7UB 4WW2A 1FO0H 1SJEB 1BBDH 4PJEB 5E8DL 4JR9L 1X5JA 2DRUA 2BSSA 5CKAA 2AGJH 4I13B 1DN0A 3VFTA 1MELA 4GBXB 3PGDA 5EH1A 5BOPA 4WUKL 3HE7C 3RVWC 1N59B 4UT9L 1RZ8A 1GIGL 4JZJA 2YSSA 3WD5H 3RTQD 1EEQA 2FZ3A 4NQCA 3VXME 3U79A 4Y4FB 5KS9E 1U8LB 1B2WH 4KK8C 4XPTL 3NIDF 5KW9L 2B8OT 4MD4A 4MAYC 1HHJB 1MHEB 1KLUB 3DSFH 5IF0A 5B38G 3FCTA 4UT6L 3AMKA 3ULVC 3V4VL 3GMQB 1S9YB 1WIPA 3L7FB 4MDIA 2FX8H 2KKQA 1UM4L 4ZUVA 1G7IA 3TO4D 4Q0XL 3KYNB 3TLRA 4A6YB 1J1XH 1UA6H 3FHQA 5E7BA 3DMMC 3VRIB 1MFCL 4GAYB 5IKCB 5FM4A 3FB8A 2H32H 4OIIH 3QIBA 3RX5A 3OHXB 4WI4A 3HMXH 4MGXA 3L6FA 2JCCA 2HFFA 4TSBH 4K07A 5DURB 4HUXA 1CVRA 1QRNA 2J4WL 5L2KB 2CH8A 3GGWB 1NUFA 3BRGC 3ILPB 4JO2H 4ETQA 3MOAH 3PE9A 2H41A 3O11B 5DRNB 3RZCD 1AJ7H 4WFED 5KSBF 1OT1A 4OGXH 4H88L 4K94C 2WQRA 5KSUB 3GSOA 3CD4A 4OKVA 4Y5XB 4JY4B 5FECB 5L2JA 4J3SA 2A83A 1D6EB 2V9QA 4D9RD 5DYOA 4F9PC 1Z0MA 3QJFA 4P5MA 3HC4H 1KIPA 3BP7A 3WKNA 3OZ9H 2W59A 4Q6IB 2C1OB 1UWXK 5KZCD 5IW3A 1CK0H 1D6VL 3BPOC 2PYEB 4OFYA 1U58A 4KHXH 5DC9B 4FQLL 1IKNC 4BFBD 4KJYB 1U8JA 5DA4A 3BKYH 1UWXH 5JDSB 2V7HB 4GXVL 5EDXA 4YQXL 5JMOC 4DEPB 2J6EL 1HYRC 1MFEH 4I18A 4PJGA 1QUNA 3RWJA 4D8PB 4HSQA 2EKSA 4G6ML 5D7JD 3CVIH 1QBBA 3C2AL 4J3UA 1AHWC 2EO9A 3MXWL 1EH9A 3EYVB 2X4NA 3QI9D 4NWTH 5FYJE 2D0HA 2MQCA 5DK2A 2NW2A 1PY4A 3BVNA 4FQIH 2BNRB 5JTWA 4KK5D 4WW2B 3GJEA 3PJSA 3ULUH 3TIDA 5EC2B 3O8XC 3L5XL 1EGJA 4FFWC 1FVCB 2WSKA 1MFBL 2JB5H 1U0QA 3IF1A 2BSSB 4LLVA 4OLZH 2RR3A 5HI5C 3S97C 1DN0B 4GMTL 5DD0H 3SO5A 1A6VH 3PGDB 3HE7D 3RVWD 2Z4QA 4ZPVA 3UTZA 1UXWA 2IPKB 1RZ8B 5BW7A 2O5XH 4JZJB 4LK4A 2YSSB 5CZVL 5DMKA 2FZ3B 4IOFD 1YEDA 4RGNB 4KK8D 1E4XI 5SX5K 4WUUB 4Y1AD 4MAYD 4MD4B 5C08E 2Z8RA 4H20L 4YDIH 4KPHH 4APQC 5HYQA 1INEH 5IF0B 3FCTB 3ULVD 2YN5A 2EDEA 1M05A 1IM9D 4AQ1B 5D6DA 4MDIB 3WDIA 5JA9A 2ORBL 4G9FE 1QR1A 1F2QA 3ROLA 3SHSA 3O6LL 4EBQH 3QUXB 4KTEL 1YECL 3DMMD 5J13C 5I6XB 3FB8B 1KENH 3I9GH 1R0AL 3QIBB 3E3QC 3T0EC 1K9TA 1DBBL 2VRAA 3L6FB 2JCCB 5KVFH 2FB4L 1P4IL 4NOBA 5C0AD 3I2CL 2QADB 1QRNB 2F8VA 43C9B 4IRJC 4UIKL 4WTZG 2J8HA 4PYGA 3FT2A 4WI5A 3LRHA 2UWEE 4ETQB 5E08H 1MIMH 2VABA 3GM0A 1UH4A 3CK0H 4HT1L 5C70A 1CI5A 3ARBC 5E99H 5I8OH 3GSOB 1KNOA 4HHAA 4OKVB 3GBNH 1H5BB 5L2JB 2A83B 1NCCL 3EDEA 2A6JB 3Q1SH 5DYOB 1A4KA 2ICWA 3QJFB 4KRPC 4P5MB 1KIPB 3MLVL 3RZWA 3BP7B 5GRWA 1XIWA 4C4KT 3E2HC 1I1FB 1F4XH 2NZIA 3SKJL 4CKVX 3P4MA 3QO0A 3QUMH 1G9NH 5TDOA 2J1KA 3WUZA 1U8JB 4KAQH 3OWEA 5D1ZD 3KPTA 3PWPA 5HHVH 3SDAB 5GGVL 4PRHD 4PUBL 4Z7OF 4I18B 1PFCA 3GI8H 4PJGB 4HIIA 5C2UB 2VLRA 5F97E 5TF1L 2EKSB 2VXVL 2X1XR 2X9YA 2DKSA 5ICZB 5KSAA 3IAQA 5MHSE 1NL0L 5CLTA 4RMSA 4HW6A 1KGCE 2ZG1A 4X83A 3U4BL 5CUSL 5KS9F 3SBWA 5FYLD 3MXVL 5F9JA 1I85C 1TZGH 5DK2B 5AZEL 1P7HL 1KBGH 3GJEB 3PJSB 3AREB 3KPSD 3O8XD 4YC2B 3IJSA 1JGUH 4FFWD 1MCLA 2C4XA 5I1KL 3IF1B 4LLVB 4XNYH 3LQAC 5DVOA 1F8TL 2JTDA 4GO6B 4OJFH 3TZVC 1NANI 4L3CB 1FNSL 4OCYL 3BMWA 4NZRH 3QISA 4WV1B 4ZPVB 3B8YA 3NCEB 5I8KL 1UJTA 3ORJA 4M9OA 1GJIA 5AZ2H 5DMKB 4F80A 2C3HA 1YEDB 2VDRL 5HI3C 4BFEA 3O9WA 4F3FB 2Q6WB 3PHOA 5C09E 4R96A 2X7LA 2EIZA 5HYQB 3VWKC 2UUDH 4WTWA 1M05B 4OCSH 1HSAA 4OD2A 5D7LE 4ZOAA 4I3GA 1QR1B 4LLDA 4RMUA 4WEBH 3ROLB 5ITBH 4U6VH 4G80A 2K7QA 1CZ8H 2OR9L 4ZTPL 1RZKH 1BD2B 4MNQD 1MJ8H 4HAGA 4GLRI 5C0FA 1U91A 3T0ED 5F70A 4ZSOE 5JW3L 1CS6A 1IFHH 3EYQC 4G8IB 5HVGB 5EU6E 3FQRA 5IBUB 3U82B 3RY6C 4MJ6B 1KUMA 3HZKA 2DQFA 3IAGC 1MLCB 4TUKL 5E03A 4IRJD 4RDQF 2B0SL 1XAUA 3WHE1 3FT2B 4EI6A 5KANI 5FAAA 1YYMH 1N6QH 4UUJB 3MV9A 2VABB 2YPLE 1X44A 4YR6B 3ARBD 5DD5L 5KOMC 3S6CA 5LQBL 1AFVH 3L5WB 2EZ0D 3MV8E 2HVKA 4KRPD 1BZ9A 3R8BB 2W0FA 3ILQC 1XGRA 4Y5VC 2VQUA 3HRZA 4O2EA 3NA9L 1OGAE 3P4MB 3QO0B 3OB0K 3F7VA 5TDOB 4CU8A 1B4JH 4ZFOA 2BFVL 3GSQB 1ZEAH 2VR4A 1MCPH 3PWPB 4PJ9A 5DGQA 3DI2B 2HT4C 4HIIB 2VLRB 4W4OC 3OB0H 3QNZA 2EH8H 2X4UA 2B4CH 5FYKH 3OB8A 5BVJA 3F62A 1RULH 2Y06L 4FNLH 1TCRA 4EOWH 4I3RL 1ND0A 2HJKA 1K3ZA 3S5LA 5I71B 5F9JB 2HWZL 3T1FA 3RTQB 2HKHL 4R6UA 5TQ2H 3UC0H 3LQZA 5F88A 1E6OL 2XWBA 1E4WH 3ZKXC 4UV4H 5DUML 4L9LC 1H3PL 5J11B 4DFIA 5DLML 3TN0A 5DSCA 3TZVD 4JQIL 1NLBH 4I9WE 1CDGA 1T5WA 4M7JL 3ULUE 1OAKH 3MRFA 1A4JA 3TO4B 2R2HA 4JM2C 3WLWC 3B9VA 4C59B 4RIRA 2VR5A 4GMSH 2NXYD 4XP9H 3MODL 1S3KH 1EERB 4PRPE 5IK3A 5MI0B 5HI3D 3L1OL 2F54E 1LNUA 4HK3J 4QHUB 5GGRA 5DFVD 3ZDZE 3CMOH 3L5IA 3O9WB 3AUVA 3FQWA 4EUPH 1ITBB 2AXGA 4ONFL 3PHOB 5ALBL 5EZJA 3OKYA 3NFSH 2EIZB 2EXWD 3MJ9H 3VWKD 2K1MA 1J8HA 3FQNA 3OAYK 2IH3A 2QJDA 3LDBB 1A0QH 5ETUA 3I3BA 3DUHA 1QLEL 2UWEF 1HSAB 1EGJL 4OD2B 4F7MA 2ZUWA 1V5JA 4LLDB 4MHHI 3OAYH 3MC0A 4G80B 3NA4A 1FNLA 1F4HA 5JUEL 1NEZA 2FEEL 2ZOLB 3EO1A 3GSNA 5J1SC 4S10A 1N0XL 4OAWA 1J9CT 1U91B 3EYQD 1R5WA 1HHKA 4LEOA 3UTSD 5GGTA 2X5PA 2IGFL 1FN4B 2DQFB 3HZKB 2ZCLH 3CFBB 4LSUL 4NN5C 2YD1A 4RZCA 3NH7L 3CLFH 4HLJA 2GITA 3Q5YA 4EI6B 1LO5A 1IKNA 4YDJA 3P9MA 4YNYA 4NM8L 4RGOH 4G3YL 3G6DL 5I1DA 3QCUH 1S7RA 3C09C 1JP5A 2P8MB 5D7IA 1MCKA 4X5WA 4BFIB 4PRHA 3I50H 4U6XA 2IBZX 3VGBA 3WNMA 1IAKA 1VB9A 3VFVA 5E95B 1F4WH 2HVKB 4L8SA 1FZJB 5D7JB 3ILQD 1BZ9B 1AIFB 2O5YL 2W0FB 4K9EL 4OFVA 4QYOA 1MCOL 7FABH 1WBZA 3HRZB 5B21A 3VG0L 1P4BH 4JJ5A 2V2XA 4Q9RH 1FFOA 4ONOA 3VXSD 3B5HA 1P6AB 4GAJH 1J0KA 2HLAA 3F7VB 4ZFOB 1IAII 1VESA 4PR5A 1OAUH 3WJJA 3O8XA 2HT4D 3T0XA 1JYWA 1AC6A 5GRJH 3QNZB 4HIEA 1UKTA 4MXVE 2X4UB 5J1AB 2HFTA 1IQDB 4WNQA 5EBLA 4DGIL 2YOCA 3V0VB 4PRBB 5BVJB 4JO4H 2CDGA 3HS0B 3MV7A 1TCRB 2CGRH 3AC0A 1IC7L 3GSVA 1KCKA 1ND0B 2JE8A 3TESA 2HJKB 3S5LB 5D72L 3T1FB 3VXUA 2A9MH 2ICEA 3N06B 5IEKA 3J8F7 1LO2H 1HHGA 4BZ2H 3LQZB 5F88B 3BKMH 2XWBB 6CGTA 1BZQK 4JRYA 4KH2A 4MAYB 3QDJD 1DBJL 2G60H 4APQA 2ED9A 4YK4C 3QCTH 3QNYA 3L5JA 2DM3A 1T2XA 4GKOA 5DSCB 5JORA 3F7RA 1RZJH 1T5WB 4MA7L 1F13A 3ZHLA 3MRFB 4JM2D 1A4JB 2R2HB 4HULB 4U2YA 1F2XK 3CLEL 3DMMB 3DO3A 5IK3B 1BHGA 1RV6X 5GGRB 4YJZL 5GRVL 5ILTL 3FQWB 3WDHA 2AXGB 5HHXH 2BXZA 5HPOA 3PWVA 1HDMA 5EZJB 3QO1B 1R5IA 2V9RA 1BJMA 1R3HB 3P0GB 1J8HB 1NBVL 2VZUA 3ARQA 3FQNB 1FL5A 5J6GA 1KPUB 4ZUUA 4QRQA 1AGCA 1CDJA 1DQLH 2NY1C 3MFGB 3O2DH 4PG2C 4WVRA 5BQ7A 5JQ6H 1JN6A 5HY9A 3GMOB 4JANA 4TVPL 1ZLSH 2EE9A 1M4KA 4XPHL 4DKEH 1UH3A 1NEZB 1IRAY 1DQJA 3GSNB 4PP1C 5IHZA 4OAWB 2R4RL 3ARBA 5T3ZH 1G9EA 2QL1A 4PJHB 2XFXA 1HHKB 3VXRA 4LEOB 4HH8A 3Q5OA 5AYQA 1RIHH 3T2NL 3U0WL 3V4UL 3MYJB 3RX7A 1LK3L 2XZAH 4F57H 4IRZH 1FORH 3HPJA 3UYRL 4UQ2B 1INDL 2GITB 3BPOB 4POUB 1EEYA 5D8JH 1MLBA 1MAML 1E27A 4MAUH 1ITCA 1AGDA 4NQEE 3KVQA 4P3CL 5I1DB 1FGVL 1S7RB 5D7IB 5IVOA 4OIBA 4X5WB 3TYFA 4PRHB 4U6XB 1TETL 3QRGL 1IAKB 3BSZH 5EBWA 4UU9A 3VFVB 4PJFE 3E8UH 4PYHA 5I1HL 2P5WD 4JQVC 1MWAA 3MLUH 1BFOA 4L8SB 2A6DA 1IGYA 1T7XA 2X4RA 1AHWB 1WBZB 3GNMH 3HMWL 4Z95H 3LS4H 5F9WC 3CZFA 1UT9A 3F7QA 3NABL 4DUVA 1W0WA 5DD3L 4P99A 4JJ5B 4BH7B 4JFEE 3G5XA 1I85A 3FFCE 5EUKA 2MNUA 4J3XA 2HLAB 1FCCA 5F71A 3QQ4A 4PR5B 1F4YH 4XP4H 5K59F 3O8XB 5LBSL 3BMVA 2AEIT 2XZCL 3CFDB 1DLFH 4HIEB 4HK3N 1Q9WA 5EBLB 4UDTA 1UXSA 2YUWA 5CFHA 1AY1H 5SWSE 2CDGB 3CSBA 4NGHL 3SDYL 3QXVA 1YEEH 2BHYA 5IMLB 5A3ID 3EDKA 3KPLA 5D7KD 4PB0H 3ZDZF 2L4OA 2AABL 2ICEB 4Z7NE 1F3JA 1FL6A 5IEKB 1N64L 5HD8C 5FYKE 1Y6KR 1DANT 4JRYB 4TUOA 1A7OL 1BEYH 5F7FA 4APQB 5AUMA 2P8LB 3QNYB 3U1SH 4G43A 4OCRL 2OP4H 2EDFA 4ZNCD 5C0CE 4ZFOL 2GK0A 4AMKH 2P47B 4XNZC 5HYJA 2XKSA 4XBPA 1BX2A 4L4TA 3T65A 5J13B 1A47A 2CDFA 5HHME 2DMKA 4H0IA 2VSDA 3OJDA 2FJGA 4MNQB 1YY9C 3AS2A 1T1XB 3U4EA 2O93L 4NFCA 1NCUA 1HDMB 1JWUA 4WCYL 3QWRA 3OKDA 4P2QE 3L3GA 3ZLQC 1MHHA 5J6GB 5DMYA 1FL5B 4F7CB 2NY1D 2Q7YA 1RK0A 4JPWH 1AGCB 4ZUUB 1ZHLA 1CLZH 5JXED 2C3VA 4IRJB 1JN6B 3ROOA 5HY9B 1CGSL 4G8GD 2AJ3A 1IBGH 4EIGB 1KCUL 1A7PL 1T2QH 2HFGH 4PP1D 3IDUA 4NZUL 5IHZB 3ARBB 1KJ3L 5T3XH 2N7AA 3VXRB 1SJVA 3RVXC 2QQKH 4F7EA 4D0CA 1OF2B 5K9KA 4KRPB 5DUBA 1JZ6A 1GVIA 1RURL 4PY7B 4Y5VA 2NLJB 1II4E 3HPJB 2ZSWA 4JO1L 2DI7A 4KZEL 4XCFL 3DURA 1EBAA 2CLVA 4X6CF 2R29H 1MLBB 4M62L 1DQTA 5JIHA 1E27B 4GW4B 2AV1B 1AGDB 1S9XA 4N8VG 4GH7B 3TYFB 1U3JA 4XNMA 5EBWB 4W4OA 5E8DH 4UU9B 3VGEA 4JR9H 1TQBC 1MWAB 4LRNL 1T6VN 2DQCL 2FSEA 2A6DB 1BFSA 3BUTA 3GSNL 3VRLE 4HMEA 2X4RB 3CZFB 1W0WB 4OI8A 4DN3L 4OB5L 3S4SG 2HKFL 2X4TA 4UT9H 5GGTL 5EUKB 3MYZA 4DK6A 3NBNA 4OF3A 5K9JL 2H3NA 4U33A 3DETC 5E6IC 1BP3B 4L9LA 5KW9H 4YDKL 1QFWM 1ZANH 4JHAL 2QSTA 2AEWA 2DJUA 4UDTB 3EAKA 3RL1A 4HGWA 3TZVB 4MVBC 3V4VH 2BSRA 4LPYA 3BPNC 5E2TL 1MCIA 1OPGH 2AAVA 1UM4H 4L8DA 2OL3L 3GO1L 3KPLB 1U8QA 2HRLA 1TPXC 2PTTB 1F3JB 1CDIA 4O5LL 1P84J 5HD8D 1EPFA 1MFCH 3AS1A 4M7KL 5A2KH 1ZHBA 1JHLL 5ACMA 4TUOB 5AUMB 5C0JA 4PLJC 3Q48A 2IG2H 2Y6SD 1BM3L 2OR7A 2HT2C 3VWKB 2GK0B 3U9PH 1ZGLP 4M7LH 5E2VL 2ITCB 1DCLA 1HE7A 3KYOA 1SBSL 4HWUA 2PF6A 4K71B 2J4WH 5HYJB 1I8MA 1KIQA 4XBPB 3CSGA 4M4PA 5HDBE 1BX2B 1J1PL 4L4TB 3T65B 3OJVC 2CDFB 3OJDB 1YY9D 2FJGB 1GPOL 5GRYA 4NPYA 3U4EB 5F7DA 2IADB 2DJ4A 4H88H 4HIJA 1LK2B 4IIQC 1DZBA 3D39D 5J56B 3OKDB 2VYRE 3L3GB 5F6IC 1MHHB 4LU5L 2Z0BA 2Q7YB 2F53D 4NZTL 1VFAA 2WMPA 1ZLWK 5HGBB 1PJ9A 5FHAH 3ROOB 1F45A 3RJDA 4FG6D 4E0RA 5SWQA 1D6VH 3G5YA 1NKOA 3AFLA 1J05B 5DRXA 1B0GA 3F6IA 1FFPA 1QLFA 1OP9A 4GXVH 4YQXH 1HEZA 3MRGB 2J6EH 2YA1A 1ZLUK 3RVXD 3HAEA 4F7EB 5CP3A 4D0CB 3BIAX 3G6AA 4G6MH 2DQDL 1S5IL 1XGQA 4Y5VB 2XPGA 2ZSWB 2H6PB 3FOMA 4XPBH 5T3ZE 2DIJA 2ZPKL 3WUWA 4POZC 1XR8A 2G9HA 3CX2A 3FHAA 2FATL 2GTZB 3BGFC 4M4RA 5MP6L 1X6LA 3RPKA 1MAKA 4M61A 5I8CA 3L5XH 3REWA 3WXWL 1XF2A 3HE6A 1MFBH 2WLYA 4FQXC 2FSEB 2YZ8A 2OQJB 5HDLA 4GMTH 4Z7NF 4HDIA 5CGTA 4AEEA 4O4YH 2X4TB 3RVUD 2VLJA 5CZVH 1X5LA 3SDXA 1WTLA 2R8SL 4M6NL 3DETD 3OQ3B 5E6ID 5CILH 2HA1A 4U1IB 3QXDA 1XMWA 5CEXA 4L9LB 3QDJB 5D6CB 1UKSA 3BH8B 3GSUA 4NHCL 3NIFE 5H37H 3RUGF 1F97A 3RL1B 4HGWB 1NDMA 2GJ6E 1NGYA 2BSRB 1XR9A 4U0QB 3B3IA 3BP6A 3GMRA 3R06B 4JM2B 4LHUD 2ORBH 1U8QB 1CD1A 3O6LH 1MWAL 2WUBL 4M5ZL 5FCSH 4KTEH 1YECH 1MHPH 1CXLA 2F19L 1ZHBB 1R0AH 5FGCE 1IC4L 4YFDB 4PLJD 4QKXB 3F7PC 5C0JB 5IUSA 5INDB 2HT2D 1DBBH 2O26U 5DEZA 1P4IH 5CJXC 2JELL 3I2CH 3ARDC 3B9EA 1ZTXL 2NY6D 5DFWH 4ALAH 4ERSL 3TH3T 3UZEA 1F42A 3RNQA 5IG7A 4OTXL 2PR4L 1Z3GL 4X8JA 5T5NG 3W0WE 5F7DB 3PIQA 4HT1H 1CXKA 2R69L 5SV4A 1T5XA 4RMWA 1RI8A 4D94A 1QSZA 4HIJB 4XPAL 4L4VD 1NCCH 4S1SL 3ZT7A 5ENWB 1IC1A 3VD9A 3MLVH 1D5MA 3WFDL 5JIIA 3LSOA 3DVNB 4F9LC 2FL5A 2YUVA 3G5YB 4XWGH 3SKJH 3S35X 5DRXB 5J57B 1B0GB 3UBXB 1VGEL 1CICA 1QLFB 5ANMB 5JW5A 1JZ3A 3EHBC 1IGJB 4HUVA 1AO7E 2R1WA 4K7PL 4PUBH 5GGVH 4RCAA 3VRLF 3HAEB 4JQVA 4U1MA 5ADOL 5C7XL 3G6AB 5TF1H 2VXVH 1KB5H 1XGQB 4JQXC 3UROR 1NL0H 2NY0D 4O2FA 4E42A 4OV6F 3FOMB 3U4BH 5CUSH 4URTB 5T3XE 2KDGA 3MRIB 4POZD 3MXVH 5E8PA 5T1DL 3WUWB 3CGTA 3LS5L 4AIOA 4DKDC 4DGVL 3DX7B 2G9HB 4MJIE 5AZEH 3O41B 3OMZA 1A1MA 4YHML 1G0XA 1Q9KB 4XPGL 4Z7WE 4F58L 4ZUWB 4M61B 5I8CB 1VACA 4KU1A 1H3VA 3OKMA 4QRPA 4WO4A 3L3IA 5I1KH 3INUL 1XF2B 3HE6B 4FQXD 3MX0A 1F8TH 1JWMA 3MLZH 4Y4KA 5L0QC 1FNSH 4RMRA 5AD0A 2XI9A 4WEUD 5I8KH 1ZGLM 2DLIA 3IFNH 2VLJB 1EEZA 3QXUA 2BOCB 3SDXB 2PN5A 4HAFA 2VDRH 1QSVA 3H9YA 4X6EA 4P2OC 1F5WA 5BV7B 5CEXB 1X5ZA 4X9IA 4YE4L 3GSUB 5ID1A 2ESVE 3HC3L 5EUOF 2G5BA 4UOW0 1FYTA 2DLTA 4R4BA 4F7PA 1OSZB 5F9DC 1NGYB 4RFNB 3BP6B 3GMRB 1C5BH 5FYJD 3M45A 1XGPB 1CD1B 1MIEL 2FDBP 4ZFZA 3WS6C 1CDBA 4LCWA 3GB7A 2OR9H 4ZTPH 5CGYC 3MGOA 4LARL 4C55A 2E3VA 4LLWB 1T6WA 3BQUC 4FZ8L 3NVQA 3NPSC 5GZOC 3C2SA 4EDXB 1Y6NR 5JW3H 1EFXD 2XV6B 1NGZB 4K7FA 1SJXA 5DMGD 2NY1B 2F53A 3EO0A 3K46A 1BZ7A 5GS1C 3IYLW 4TUKH 1IMHC 4JFOA 3MTRA 1A7QL 4L1DA 5ESAA 3RNQB 5IG7B 3ZYZA 1WZLA 2GCYB 5T1KD 4HEPG 4P23C 1K8DA 1UYWL 4X8JB 5EIIA 4R0LA 2X09A 1P6FA 1T0NB 4GKZA 3PIQB 4AY0A 3MJ7A 4RFOL 2J8UE 5DD5H 1T5XB 5LQBH 5CKGA 4YDLB 2DMBA 3NTCH 3ARXA 4OZIF 5IP4A 4K23L 1JPTH 1D5MB 2LTQC 4G9FD 3T8XA 3LSOB 2Z35A 3L95A 2FL5B 3ARFA 3SGKC 3UZQA 1Q8MA 4RWYL 3MRDA 3QDAA 3IFLL 3JV5A 2BFVH 1CICB 4HUVB 4NO5A 1IL1A 3TVMC 4UTAL 5FUZL 1BF8A 2W9EH 4JAMA 1Z6JT 5BJTA 3U0PA 3R4DA 2CLRA 5M7QA 2Y06H 4O2FB 4E42B 1T20A 3DTXA 2LVCA 2X9XA 4I3RH 2GSGB 4ZUSB 3PP4L 3C5ZA 5E8PB 3OR7A 4LP5A 1A1MB 2X89A 4HKJA 1T83C 1E6OH 2JIXD 4JRWA 4XH2A 5DUMH 1VACB 1MI5A 3OKMB 4QRPB 3L3IB 2Y23A 3BUYB 1H3PH 4XMPL 1EHNA 5DLMH 4ZTOL 1JWMB 4JQIH 3MA7B 4M7JH 1ACYH 1OARL 3GMNA 5AD0B 3UJIL 1AGFA 3WMSA 3RPIB 2Y9RT 4KJPC 4LPVA 1EEZB 1YEGL 3MODH 3RWFA 4JRXE 2PTUA 3L1OH 1T03L 2YKLL 1CL7L 5CZXD 4P2OD 5IHLB 5J9PB 4L8CB 2BRRL 5ALBH 5SWZE 3ME0A 1QQDA 1D5IL 3OBAA 3VXOA 2G5BB 4X7FC 2L7UA 5MHSD 4R4BB 1G6RA 4NHUA 5I74C 3QH3A 1QLEH 5DJAA 1EGJH 2ZUVA 4ZFZB 4LNRA 3VXMA 4C58B 4EN3A 3GB7B 3GHBL 5CGYD 3AVEA 2V5SA 3WKML 1R3KB 5I75B 3BQUD 1N0XH 1OCWL 1RIVL 6FABL 4XZUA 1KF9B 3VGDA 1I7TA 1T3FB 2AVGA 1SQ2N 2WIIA 3QQNA 4K7FB 5F8QC 2IGFH 3SO3C 3LPGA 2F53B 1BZ7B 4DZBA 1EDQA 2KZ1B 3U2SB 3ULUC 4NQXA 5BV7L 4GKNA 3QUZD 3NH7H 1PEZA 2G5RA 5ESAB 4P23D 4TUJA 4K3DH 5FDWA 1IILE 1K8DB 3U4AA 1HYSC 5EIIB 4R0LB 4NM8H 1MF2L 4G3YH 3MJ7B 1QSEE 5D96C 4J3VA 1KB9K 4ELMF 1UCBL 3V5KA 3P77A 3X3GL 2OTUA 2CK2A 4HXAL 3QHZH 2IANA 4KQ4L 1YY8B 3T8XB 1MCOH 3CVHL 4LCYA 3L95B 2ATKA 3ARFB 3VG0H 3SY0A 4J3TA 1C08B 1DQML 4Z7WF 3MRDB 1DFBL 2AJVL 1DSFL 1WBXA 1KYOK 4OFIA 3RWHA 3TVMD 1KIRB 3MO1A 2RHEA 4JKPL 3WV0A 2X2YA 1GAFL 2FO4A 4P57A 4JAMB 1H9VA 1JJUA 5BJTB 1D5XA 1WEJL 3U0PB 1BFVL 2CLRB 5K9QG 2CMRH 1EHLL 1T20B 1YQVL 1IC7H 3CXDL 4AT6B 1MSPA 5LVEA 3NFPB 5H94B 2V5RA 5D72H 3OR7B 1FH5L 2YPLD 3VXPA 3KPMA 1L0QA 2VLME 3NACH 3DNKA 5E6IB 1TFHA 1NUNB 4XH2B 3G6JF 3ARPA 4XCYB 1MI5B 1DBJH 2CUMA 2DM4A 3MV8D 1XFPA 2DKUA 1WZ1L 3AROA 4NWUL 1CVSC 1EVTC 1JNNL 4F15C 5EOCL 3BPNB 4KDTC 1GGUA 2AJSL 4ZNEE 5GRVK 3GMNB 5DVNA 2BVPA 1K3IA 1OGAD 5HYSG 1AGFB 1TPXB 2XWJA 1WCQA 4KJPD 4MNHA 3HG1E 3CLEH 2NCMA 1KJMA 3V79C 3F58L 5ILTH 4OLVL 3OKOB 1IE5A 3P30H 2IPTL 1FC2D 1RFDL 1QQDB 4ENEC 1ZT4A 4YDVA 1FJ1A 3R8QA 1ZOXA 1G9NC 1NBVH 4OF5A 1KEGH 3ARDA 4NHUB 1WF5A 3QH3B 4HZLB 5DJAB 4ORGA 3PGFL 2YC1A 4EN3B 3VXMB 4TVPH 4PJDE 5E24E 2EDRA 2H8PA 4ZS7L 3C8HA 5HVHB 4I1NB 2AK4E 5C08A 2R4RH 1I7TB 4KROC 4LAQL 1BIHA 1C7SA 4HJJH 2WIIB 3K80A 5FYJU 5F6IB 3MLTA 1ACZA 2CD0A 1MOEA 2QBWA 3T2NH 3CMGA 3U0WH 4DZBB 4OFDA 5D7SL 1LK3H 4G9FA 4NQXB 2JF1A 1EUTA 4F9LA 4GKNB 2XG5A 3UYRH 5I1CL 1MFAL 4NT6A 1INDH 1BQLL 4X9BA 5I66A 4TUJB 3DVFA 4NN7C 5FDWB 4X4ME 4NJ9L 5TE7H 4PLOB 1MAMH 1FNAA 4NQCE 4OI9A 5D2LE 1YNTB 3P4NB 4P3CH 5E0QA 5GS3A 3HNSL 4U1KA 5FFLA 4M6MH 1TETH 3RFZC 5FUOH 3V5KB 5KVMC 3VFMA 3P77B 5I1HH 3MPCA 1NAKL 2OTUB 4PTUB 1P7QD 5DQ9A 4R3SA 4HS8L 1KJVB 4LCYB 4C56A 5HVFB 5TDNB 3NABH 4F2MA 5DD3H 4F33A 1DBAH 3SY0B 1ZA3A 4IHOA 3GRWA 1KACB 1Q38A 4JFXA 3VI4F 4JFZL 3UJTL 2YD9A 5I17B 1OL0A 1RZGB 3BGFB 1WBXB 5ICXA 4U05A 3RWHB 1G7PA 2QSCL 1QBML 1A1OB 2HLFC 5LBSH 3BH9A 2WUCL 5HVWA 2XZCH 2FO4B 1L0YA 2XQYG 4FQXB 3SQOL 1A14L 4GQ9H 3KPQA 1D5XB 1R3IL 2IPUK 1RZKC 4X4YB 4V2BA 5EZIL 4PJ7E 3BEWB 4NGHH 4ONHA 3SKUD 4GRWH 1NAMA 4OUUB 1BAFL 2AABH 4DVRL 1YN6A 3VXPB 1IZKA 2GAZA 3KPMB 5D1QC 2E27L 3TCLA 2ZUQC 3L3HA 4YPGA 4OCRH 5FEBA 1JCKA 4X99A 3S96A 1EFQA 2BVPB 1NEUA 2P5EA 2DKMA 3MRCA 2XWJB 2AJYL 4MNHB 1DBKL 3BQUA 3BXNA 1JL8A 1MNUL 1SBBA 3OKLB 5F1SA 4PJGE 3O6KL 2ARJB 4YDVB 2DD8L 1FJ1B 4NBZB 2X42A 3BT2H 3NIGE 1JPGA 3ARDB 1MCBA 2BC4A 1A7RL 3KAAA 3QSKB 4ORGB 1CGSH 5IBTL 2YC1B 3PGCA 1OQOA 3BPCA 1H0DA 1JPFA 2H8PB 2B4CC 4YHZH 1A7PH 3RQ3A 1G7LA 1N0LA 5EORL 3HTLX 3MJGX 2R0KL 5C08B 2XTLA 3MLSL 1KJ3H 5C09A 4DW2L 5HI4D 1FG2B 3TJEL 2XTJE 5GQBA 4Q9BA 1RURH 4G9FB 5D7LA 4KRLB 3PWJB 3PL6C 1FG9C 4JO1H 4NT6B 3T3MF 4KZEH 3LKSA 4KFZC 2EDWA 3LKNB 5DQDL 3N1FC 4M62H 2ZUYA 1G6RL 4NCC1 1X5FA 3V0AC 1OGTA 2APFA 1A1NA 3WHXA 3ZDXE 1BGXL 1MQKL 4U1KB 5EU6A 4LCUA 4AENB 4WI8A 3D5OF 3VWJD 5IROC 3VFMB 4AIXA 1IQWL 2FEEI 4LRNH 2DQCH 4OT1L 4MCYB 5DQ9B 3N50A 1OVZA 4R3SB 2ZSVA 3DXAD 4F33B 1U2HA 2YPKA 2UWEB 1ZA3B 2B5IC 4IHOB 2HKFH 3ZMRA 2IBBA 3HMXA 4HQQH 1J86A 2HRPL 1T83A 5ICXB 5SX4H 5K9JH 4HPOL 1G7PB 1F3DJ 2HLFD 1H8SA 4YXLL 2Y4SA 3IDXH 4Y4HA 1SEQL 1F11A 3BH9B 5TE4L 4YDKH 3A6CL 1MAJA 1UCTA 3BW9A 3LEVL 4JHAH 1ZS8B 5GSVB 2D4DA 3KPQB 3RAJL 3C87A 5L0QB 5EZOL 1A9EA 1O0VA 1VADA 1FBIL 2OL3H 2I26N 4QHLA 1BREA 3GO1H 4Y16C 3IDMA 1KB9J 3D69A 3MOQA 2APVA 3CPLA 5KVGL 4O5LH 2GAZB 4OF7A 2NY4C 5D1QD 3RL2A 4M7KH 1EO7A 3RWEB 1NMBL 1JHLH 1F58L 3SKOA 1JIBA 3TCLB 4QT5A 3GDBA 4X98A 3L3HB 2PO6A 3LH2L 4HIHA 5E2VH 3UTPE 5DHVB 2EDXA 2GYSA 1SBSH 3FO9B 4V2CB 4PJDF 2Q8BL 4R2GC 5ISZA 4M8QA 4FFVC 3FFCD 3QFJD 2P5EB 3MRCB 3C8KA 3MLYL 3BPLC 1J1PH 2Y5EA 3K7UA 3PXJA 4WW2F 1PVHA 3GIVA 3KPRD 3LIZH 3Q6GL 1TITA 1GPOH 3BQUB 3BXNB 3NPSB 3BZEA 3ET9F 3THML 5L9DH 2ICWI 4W6WB 4JN2B 4LU5H 1DE4A 4NZTH 2BC4B 3BHBA 1ZMYA 4PRPA 3PGCB 4KQ3L 2F54A 3BPCB 1E28A 4GKSA 5DVMA 1CFNA 1G7LB 3KXFD 5EO1A 2MPAL 4M43L 2HVJB 2RAMA 2GUOA 5CGMA 5F1OB 5C09B 3K0WA 3X11A 2VZVA 3HNTL 1AP2A 2F15A 1KTLB 3CNKA 4TVPE 2DQDH 2YD2A 3DBXA 2LTQB 1I3UA 1S5IH 4QRSA 4BELD 5D7LB 1Z9LA 5F7MC 4Z0XA 4QXTA 5IBUG 3HFML 3PWNA 3CDYA 3BAEL 2NZ9C 1TJGL 2AK1L 4PJCE 5FM5M 2ZPKH 5CEYA 2Q86A 1OGTB 1RZJC 1A1NB 2FATH 4ZSOB 5MP6H 3WHXB 1NBQA 3TVMB 5EU6B 2Y72A 4LCUB 1INQA 4P2QD 5IEHB 4YUEL 1XGUB 2JCCF 3WXWH 1J0JA 3FO1A 3VGFA 4X8XA 2H32B 1HZHL 2OI9C 2ZSVB 4R7DA 1CGUA 2XY2A 2MFNA 4NKDB 4JM4L 1XCQA 5FKPA 5M94B 1G9ML 2R8SH 4M6NH 1K4CB 5I30H 1F11B 2VDOH 3MV8B 4O9HL 1ONQB 4NHCH 2XACC 3W11C 3WEXA 4LLUA 1PLGL 2R0WL 4KDTA 1A9EB 1ZSDA 4KGLA 2VB5A 4M3JA 1OGAB 3QG6A 4Y16D 1I8KA 3HN3A 1A02N 3IDMB 4FRWA 3DVIA 3N1GC 2WUBH 5HHQA 4M5ZH 3D69B 3CPLB 3MV9E 3RL2B 4PJGF 1A7NL 4YIQA 3AMLA 1CYGA 3SKOB 2V9TA 1NC4A 2KQMA 2OJZL 4QT5B 1IGIL 3GRWL 4HLZH 4GRWE 1JNLL 1SEBA 1LEKB 1OAXL 3QUMA 1NFDA 4M5YH 4HIHB 2AI0L 5I74B 3D85D 3TWCL 4YAQA 2VH5L 4ZS6C 2DM7A 2OSLA 4M8QB 4ERSH 2PXYA 3DX8A 4K2UL 5C07A 3K4DA 3C8KB 3C9NA 4OTXH 3BDXA 2PR4H 5IVZA 1KELL 3QEHB 1CIUA 1Q9OA 2D7NA 2NW3A 3D2UD 4CNIA 5D1XC 1HK6A 1NAML 2R69H 5T1LD 4XPAH 1QO3B 2Z31A 4S1SH 4NO3A 2R4SH 1VSCA 5B3JE 3SO3B 1DE4B 3DUUA 3WFDH 5HPMB 3BHBB 4H26A 2CJUL 4UOW1 4PRPB 4D3CL 4KMTL 4OZ4A 2F54B 5I19L 2M2DA 1E28B 4YHIA 3ZSSA 4GKSB 4IRSA 1CFNB 2GUOB 1VGEH 3STLB 5D96B 5MEQA 4FZEL 1OY3B 3X11B 4K7PH 5JR1L 1AP2B 3V6ZB 1EAPB 4HF5L 4BK4A 5TFSL 1IAMA 4OZGE 2HJFB 4C4KO 3CX5K 4J2XA 3DBXB 4F37K 1O5DT 1RUQL 4XCCL 5BXFA 5FB8B 4BSWA 4Z0XB 4QXTB 4LPWA 3PWNB 3Q3GA 1RUML 3ARYA 3QEUA 2X4OA 2OTWA 1J0HA 5T1DH 2WANA 5CEYB 1C5CH 2YD4A 4DGVH 1U92A 4KRMB 4YHMH 1SMAA 3K2UL 3OTTA 2UYLA 3JUYA 4F58H 1BBDL 1UJ3C 1V7MH 3EYOA 1INQB 5E2UL 3KNBA 3Q6FA 4RA0C 3DYOA 3NZHL 4BZ1L 3INUH 1A6UL 4O2CA 4NKIL 4RX4A 1F3RB 5EPMB 4PGZA 4R7DB 3FN9A 3ZE1E 3TM6A 5JW4R 3VMPA 1XCQB 5FKPB 3QUYA 4NUGL 4H0HB 5JOFA 4NQEA 3UJJL 4YHPA 4DGYH 5IOPA 2CXKA 3BD4A 4FQQA 4XX1E 4PJFA 4QRRA 4NOFA 5C0RL 3HC3H 1OAQH 2PCPA 2C1PA 3W11D 3WEXB 1U36A 1FDLH 4LLUB 5JXAL 1T1ZB 3ECBA 1ZSDB 2EXYD 4JFEA 3H7BB 3QG6B 1JK8A 1MIEH 1ZGLB 3V2AR 5HHQB 3S3SA 4OUOA 4LARH 4MCZA 4HJGA 4JZOA 4YIQB 4FZ8H 1RSFA 4ZQKB 2J2ZA 1NC4B 1RQ5A 5SWSA 3HMXL 1SEBB 1BVLA 5SX4I 3BEVA 3QUMB 1NFDB 1NUGA 2VE6A 4JB9L 3GBML 2ED8A 3S9DB 5F7EH 3ARWA 2I07B 4LLAA 3ZKQD 4YAQB 1PDKA 4YO0A 2AXJA 2VUYA 1A7QH 1AC0A 2PXYB 3DX8B 3T4YB 2UVEA 5IVZB 3RIFK 1EZVY 3ALWA 1ZT1A 1ZVSA 1Q9OB 5D1XD 2NW3B 5FO8A 4KROB 3JTTA 2M8XA 1UC6A 5C0CA 3JV6A 2Z31B 1TZHA 2GJ6D 5I18H 4NO3B 4QRUA 5TPWL 3O2VL 1BF2A 3OZ9L 4K23H 5JO5B 3MV7E 1A21A 3PL6A 4WFHE 5I1IH 4NNYB 4H26B 3IXTA 4XC3L 3ALXA 3HPLA 4NN7B 3NCYP 4RWYH 3VXUE 4YHIB 1W0YT 2NTSP 5LCVH 3IFLH 4TQEH 4CRPA 1MFEL 5MEQB 4UTAH 3WFBH 4HPYL 5FO7A 4HJ0D 4RBPK 4TSCH 1IT9L 1S9WB 1U9KA 2V7NA 4I0PC 4MJ5A 4P0DA 3SE4C 1AE6L 5BXFB 3K1KC 4NRZA 2IH1A 2NY5L 4LDLB 1UQSA 3QDGE 1BLNA 1BQHA 1EMTL 4HFWB 5F3HB 4NWTL 5FHBH 2OK0L 3Q3GB 4RBPH 4PJXE 3PP4H 3FZUC 3HCVA 4M1DL 3ULUL 4NO2A 5CS7A 1MCEA 2UYLB 1OTUC 3EYOB 1G1CA 2O61B 3KNBB 3Q6FB 3TFKC 3I6LE 4X5XB 1E6JH 5FV1L 4O2CB 1XF4A 5F21B 3ARGA 3STZA 4FTVD 2GT9A 1FLRL 1YZZA 4FFZH 1OARH 1TZIA 3DRQA 1L6ZA 1Y0LA 3HRPA 3UJIH 3QUYB 4NQEB 3IJYA 1FVEA 5IOPB 2RBLA 2VSCA 3UP1A 3DECA 4FQQB 4MLIA 1AO7D 4H1LA 4HIXL 5JIPA 1CL7H 1FNGA 3PDOA 1FPTH 4PJFB 4QRRB 1LMKA 2BRRH 2ZUQB 4CAGA 2HAZA 2PCPB 2C1PB 3HHRB 2L7JA 1P4LA 1TVDA 2AXHA 4S1DD 4KKCC 4RRPA 2J8OA 3ECBB 1X5HA 1W72A 4JFEB 5H8DA 3FFCB 2VXQL 1JK8B 3L9RA 3FO2A 4MJID 3GHBH 1TENA 3WKMH 2NYYD 4U0RC 3MQIA 4MCZB 2YK1L 2I60L 4JZOB 3MRQA 1GSMA 1OCWH 1RIVH 2DB8A 1A6WL 4IOSD 6FABH 4Z7UE 2WP3T 5SWSB 1RUPH 1LO3L 1H15B 1BVLB 4A2LA 2DQUL 5KVFL 4Z78A 2VE6B 2ED7A 2FCBA 4H0GA 2QKIA 2CO6B 4YO0B 5BV7H 1ES0A 3KDMB 5J1TC 1JUFA 5D93C 1HSBA 2VLLA 2E7MA 2X70A 2IQ9L 5F6HJ 2IMMA 1X9QA 1QFUL 1TNNA 4MB4A 2C7UB 1MF2H 5E8OA 5E99L 1NCDH 2VOTA 5BS0A 5FO8B 3JTTB 2FEDC 4FA8A 2HP4A 4CU7A 3Q1SL 1QHOA 1UCBH 3JV6B 5C0CB 4D0BA 4X0KA 3X3GH 3EKCA 4QRUB 4HXAH 4HBCL 2DLFL 4KQ4H 4L8BA 1YEFH 3UCRA 3CVHH 3PL6B 4BM7A 3D25A 1F4XL 3IXTB 1DL7L 5DHXB 3HPLB 5HHMB 5GS2D 3PXHA 5A2LH 4D9QE 1DQMH 1G9NL 4PJ8C 3DO7A 1DFBH 2AJVH 1C16B 1DUZB 1PYWA 3FMGL 4QCIA 5AG8A 1M71A 5BRZA 2E9IA 4XMLL 4P2QB 4JKPH 3V5DB 5FO7B 4N5EC 1GAFH 3O4LE 2XA3A 3E6FA 2IAMC 2V7NB 3V7AG 4MJ5B 2B39A 1WEJH 1BFVH 3FQXA 4EUPB 1NJ9A 3M1BA 2IH1B 1EHLH 3PABB 3GMMA 4V1DD 3CXDH 4CN1A 2B5IB 3S37X 4LQFL 1WICA 1MEXH 3QJHB 2VO5A 2AQ3A 4JFQA 3V6OA 1TZGL 2PKDA 1FH5H 3KYAA 4Y4FC 2VITA 3HCVB 5MENA 3O2DA 4PJHF 1OTUD 4WGVB 3TFKD 3VFUB 2UZXB 1DN2A 3ESUF 4XNYL 3ZTJG 3ZE0E 4CVXA 2DQHH 4B7LA 1WZ1H 3QDHA 4P5TA 4NWUH 1XF4B 2YRPA 1JNNH 1J8KA 3ARGB 4UBDC 3STZB 4TNWK 3TEUA 3FONA 4NZRL 3SGJC 3T2OA 5C71A 2D0GA 4K3HA 2ADIA 3SDCD 4XRCA 4QHKJ 3IJYB 1FVEB 1EZVX 2LU7A 3KS0J 5D7IF 2NY4B 3X13A 3F58H 4OLVH 1X4ZA 3CX5J 3PDOB 4Y0GA 3ZDYF 1U3HD 5DJXA 1S8DA 2IPTH 4MDJA 1RFDH 1KULA 3EOAA 1G7JA 4GQPH 2HT3C 1P4LB 4PGBA 4KKCD 2G2RA 2DI9A 3GFUA 1QA9B 3D85B 4R2GB 1ODAA 3U6RA 3BPLB 3PGFH 1DJSA 1CZ8L 3O3BA 4G8EB 4GRLC 4ZS7H 3WNKA 3WNOA 3IDYC 5TGBA 4J6RH 3MRQB 3D2UB 1IFHL 2A6KA 5T1LB 4LAQH 5IMKA 5ESQA 4Z78B 5IWLC 1BJ8A 5GZNC 1E4KC 3KLDA 2QKIB 4HUNB 4J7RA 43CAA 3DX9A 1ES0B 4FOMA 1JUFB 5HHOD 3QHFL 1MFAH 2BXYA 1HSBB 1BQLH 2X70B 4U1SA 4XCNA 4CVZA 2X40A 1HH9A 4NJ9H 5B38A 1LDPL 5CEZL 3O3EB 3BZFA 5E8OB 5K9OA 3QCVL 1Z0NA 5SWZD 5T5FH 1AFVL 3HNSH 1K2DA 2FEDD 1I1YB 4N9GB 4P46C 2EDJA 2DF3A 5IB4A 5IVNA 5EU4A 1D7FA 4X0KB 4S0TD 1NAKH 4WHTA 4L8BB 4RMTA 3D3VE 4FXGA 4HS8H 4QNPE 2DL2A 2B2XL 4XXDA 3LKRA 3RKDC 2EDQA 2GSIB 4JFDA 3W0WA 4PJ8D 5LGHL 3DO7B 4JFZH 3UJTH 1TIUA 1JWSA 1PYWB 1TLKA 4QCIB 4WW2C 1M71B 5BRZB 2QSCH 1QBMH 1MUJB 1PG7X 5IFJA 4N5ED 2WUCH 5IMMA 2DYPA 3JXAA 1BOGA 4KUZH 3VMOA 4YEEA 3SQOH 1U3ZA 3QUKB 1A14H 4OFKA 5F7HA 3FQXB 5EZIH 4EOWL 1NJ9B 5IJKC 1IKFL 3Q5TA 3GMMB 4W6YB 25C8L 2I24N 2IJ0C 5EOTA 1BAFH 5FA3A 1AQDA 2QR0B 3OXSA 3MRJB 3UC0L 5D4QA 4Y4FD 4OZFG 1QOKA 4DVRH 4OCMC 2MCG1 2K7PA 1UFUA 2DLGA 3EUUA 2BCKA 3F6LA 1E4WL 4ODSL 1T7YA 4QOKE 2E27H 4Z7VE 3SJVA 3V8CA 5L7XH 4G6JL 4CVXB 4P5TB 2W9DL 4YLQT 2I25N 1RVFH 4UZGA 1UB6A 1I3RB 4PRIE 4UBDD 1WC7A 1V7NL 3F5WA 4G7YL 2E8ZA 1I9IL 3HLAA 2ADIB 4KKNA 5EFIA 4U1HB 4U7SA 2AJYH 3CSPA 4UIMA 1XF3B 3MRKB 2MCPL 1DBKH 3CMOL 3X13B 1MH5B 3QIBC 1FV1B 4NUJB 3LKPB 1MNUH 2YPVH 4OGYH 5DJXB 1S8DB 4IS6A 3IRZA 4BFGA 2YUZA 1HN1A 3O6KH 2HT3D 4QXUL 1G7JB 2DD8H 3HR6A 2BJML 2G2RB 5DURD 2QADC 5TQ0L 1VHPA 1BECA 5IBTH 1FNHA 3BKCL 3UBXI 4GRLD 3O3BB 4TOYL 2VLMD 3UZVB 4O51A 5HYIA 5TGBB 1GOFA 1EV2E 4MD0A 3QEQA 1JHKH 2CPCA 2R0KH 4YHOL 5D1XB 2ESVA 4DW2H 2ZCHL 5DWUL 1PSKL 3ZHDA 1UKQA 1M7IA 2CR6A 3N1QC 4HZAA 3TJEH 5DJYA 1CL7I 5GZND 2OJEA 4P4RB 3O6MH 5JHDE 1OAZL 2EYTA 3HG1D 4I3SL 2VXSL 5EZLA 3MA9L 2PYED 4U1SB 1ZT7B 5B38B 4EEEA 5DEGA 1G6RH 5FGCB 3FB5A 4NC0B 4YBLC 5IB3A 1W72L 1NFIA 5K9OB 1QP1A 3QXAA 5GJTL 1BGXH 1K2DB 1QACA 3RGVA 1XGTB 3D0VA 5IB4B 1F4WL 5EU4B 4I0PA 1IQWH 4WHTB 1QPPA 5IFAL 3U9UA 2VAJA 5F1NA 1T1WB 1GGIL 4XXDB 3RKDD 3LKRB 3W0WB 4CW1A 1KT2A 2BNRD 1U8MA 1ORQB 1VEPA 2J8UA 5GISL 1UJ3B 4K3GA 4YXLH 2D31A 3RWDA 4F37F 4LNVA 5L88L 5TE4H 4WTZA 2DYPB 5IMMB 1BOGB 4NC1E 3LEVH 3UBXG 5DJ6A 2XTJC 3RAJH 3BGMA 1KIUA 5JPNA 3LB6C