4P46A

J809.b5 y31a tcr bound to iab3k
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
199
structure length
199
Chain Sequence
QVRQSPQSLTVWEGETAILNCSYENSAFDAFPWYQQFPGEGPALLIAIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASKGADRLTFGKGTQLIIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
publication title Effect of CDR3 Sequences and Distal V Gene Residues in Regulating TCR-MHC Contacts and Ligand Specificity.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2014-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p46A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p46A02
1E6OH 4JPVL 1CBVL 4U2ZA 4F9LA 5I1DA 2OJZL 2EIZB 1LWRA 1A02N 5IT2L 2ZOLB 4UNVA 1YNLL 3HC0B 4C57C 4OBSA 1OAXL 3IDGA 2IPTH 3UTTE 4P9HH 4X7TA 1DBJL 5CEZE 2VISB 3NFNB 3O9WB 1G6RL 2W9DH 4QRSB 3C8HA 4MCZA 4P5MB 4KH2A 1BMGA 4HV8A 2R9HD 3FB7B 5C9JB 3VG0H 1F58H 5T1MA 1QEWB 4RX4D 4NNPL 3QNXA 2BMKB 3LDBB 1SEQL 3NGBB 5C0RH 3HE6A 4Y16A 1H3PH 2P1YA 3MQIA 4QTIH 2YC1B 3QCTH 4I2XE 2B20A 5ISZD 4N0FA 1RU9H 1V3KA 4NUGL 4HKBB 4F58H 4CMHB 2OZ4H 2EYTA 5FGBA 3CJJA 2QJDA 4DOHB 3U1SH 1YMMD 3GIZL 4XNZB 2XPGA 3TO4B 2WWMD 5E2TH 3TV3H 1Y6KR 4JQVC 4QOKB 4L8BA 3S7GA 4ODHH 2A73B 4MJ5B 3TZVC 1OQXA 2CR6A 1S9VA 1JL8A 1HI6A 4JHWH 2BOCB 4RNRB 4JDVA 4XZUB 3KLSA 4PP2B 2Q86B 1U3HC 4JRXD 5E8EA 2YD6A 12E8L 2X9XA 4PRPA 5ALBH 5L0QB 1FZMA 5KSUA 1GAFH 5IFAH 4W6XB 2PW2B 4HWZB 3IDMA 4LLUA 4LLWB 2D03H 3S6CA 3CH1B 3MV9D 4MDIB 1RZJL 1LMKA 3VFOA 5KS9E 1N0XL 1UT9A 2VABA 4HUUA 3V0WH 2N7BA 1F4AA 4GG6A 5FYLL 2GJ6E 3HZVA 1FVEA 5CKGA 1U8PB 4K3GA 5D1XA 3NH7L 4QXUH 3VMOA 5MEOA 1YEEH 1MHCB 3BEWA 2IQAA 4HPOH 4KVNH 5FO7B 5IHUH 2EE2A 5EO9A 1FG2A 3H9ZA 4G3YL 4U05A 2N1KA 1KCRL 4FTVD 5DYOB 5MENB 5BS0D 4MJ2A 1U92B 3S37H 4FFYH 3CFDB 1A7RH 1NBYA 3SDYH 1AIFB 3OAZK 4J3OC 3TWCH 4WY7H 3WNLA 1TJHL 4X5XB 3RI5K 1BQUA 4WO4B 3FT3B 2AK4B 1KTKE 2GITA 2FX9H 2WWMC 4U7MA 4CN1A 2ED8A 5HBBA 3QFDB 1AD9A 1T22B 2YUZA 2AXHA 3IU3B 4ERSL 1KEMH 5HHME 3TN0D 5J12C 4PLJD 2JJTA 1TNMA 4R90L 1ZLWH 2VSCA 4E42B 3Q6FB 4U0QB 1MFEL 5DVOA 3DHMA 5C0BA 4JZOA 7CGTA 1G7IA 4XBEL 2A9MH 3SQOH 4OCWH 1FPTH 5D7SL 4KKLD 4I3GA 1R5WB 1N6QL 4ZO6A 4XCCH 4XWOD 5C0CB 4HIIB 4OQ1A 4BZ1L 3ELAT 1RIVH 5LXGL 3KYOA 4MVBD 1G7JA 1NCWL 5FO8B 1S7XA 4G8GE 1YDPB 5D1QA 4JQXA 1MWAH 4HKXB 5C0AA 4Z7WA 4G8EA 4PTUA 4PY7A 3GSWB 3HZMA 3KPRB 3VRJA 1OHQA 5DD5L 2PETA 4ZDHA 3F58L 1MJJA 1N0LA 3WSQH 4D9RE 4LLYA 3MLYH 2G2RB 1NC4A 3QPXH 4ORZC 1K4CA 1DVFA 1IJ9A 1RUQL 1T0NA 3HAEG 4YHMH 1HWGB 5GS1C 3DVFA 3O0RH 4YFEA 5C2BL 1YEKH 5D5MF 3NBNA 5I1IL 1YYML 3HPLA 1O7SA 2UUDK 3DTXA 3QO1B 4FABH 3ARBD 4POUB 1ZVSA 2H3NA 1MHEB 4Q74A 2E7MA 1WT5A 4W6YB 1EH9A 3OMZA 2XA8H 4B7IA 2YUXA 3LQZA 4WJ5A 1KGCE 5D6DC 1GOHA 1QR1B 2OS7A 4L29A 4OD3L 2YD8A 5D5MB 4Y1AE 1RHHA 1S9YA 3RU8H 4N5ED 3WIHH 4R3SA 4Z7VB 2F5BL 1ZSDA 3WFBH 3IDIB 2Q3ZA 1PKQA 1LK2A 4XWOC 3PWLB 1A1OB 5CZXD 3VFMA 2YHGA 3JZ7A 4HAFA 4L3AA 1UXWA 4FQIH 3T0BA 3VFGH 2QL1A 2FX8H 4OF6A 4LARL 1QSFE 3SDXF 5EG6C 4QHNA 5J4MA 2XWJB 1Q8MA 2AVGA 3JTSB 1OP3K 3MNVB 4X6BA 4ZS7H 1A4KA 1J1OH 5EOTA 3UYRH 1BJ1J 4S1SL 4JAMB 2XG4A 4AIZA 1E27B 3VXPA 1KPUA 4WI9A 1QLFA 3OXRA 4K9EL 5FFLA 2W91A 5H94B 4RIRB 2DD8H 4E41D 5IROA 4BH8B 4H0HB 4U6XA 2DI7A 2HTKC 5GSRA 4FHBD 1I8LA 3QIUD 5E7BA 2IMNA 2APXA 2IPKB 3LH2H 3UBXB 1YEFH 3P11L 2VE6B 3NIGF 1NFDF 4NO3A 2CDGA 2F53E 2VXVL 3A6BH 1JV5B 4H8WC 2O5XH 3MV7D 1X5JA 1MHPH 3QXAA 1WIOA 4FXLA 3MLXH 3OGCA 2YPKB 5LAXA 2IWGA 3ARBC 4CMMB 3U0WL 5E8NA 1ED3B 3GMNB 4EEEA 4MMXC 3CFJB 1U2HA 5F21B 5CJOL 4Y19A 5BRZE 1FJ1B 3VRLF 5BVJB 4Z7QE 2H32H 1LE9A 3HZYA 1CR9H 2CDEB 4HC1H 3SE3A 5HYIA 4FMKA 2P5ED 1G7LB 1EVTC 1UACH 1KJ3H 1SEBA 1BEYL 5T3ZD 1Q94A 3SPVA 4PUBL 1D6EA 1BECA 4I0PD 2J88H 4MD5A 4NDMB 3BZDA 3KXFA 3SO5A 4NO0D 3E3QC 1S7TB 4FQXA 4Z7UB 1RULH 3O6ML 1OTUC 2GCYA 4G9FE 2V5SA 5BXFA 2ARJA 2AP2A 3REVB 1W72A 3FQWB 4OSUH 3U9PL 3OX8A 1VCAA 2IJ0C 1CGSL 2XA3A 3QIUC 4OAWB 1OTTD 3MR9A 3TYGL 4MZ3A 3WIHA 4C56A 2VWEE 5JO5B 5JMRA 1U8HA 4PJDF 1FN4A 2V9TA 4OD1L 1XGRA 2PO6A 4EVNB 3OAZH 3VI4E 4XC3L 3WBDA 4AM0A 5EUOE 4L4VD 4Q9CA 3ULUH 2R8SH 3FT4B 5KN5B 3GGWB 4HIJA 3UJJL 4WU7B 2BVEA 3RX8A 4DN3H 2NY3B 5MP6L 1T5XB 2FR4A 1E6JL 1Z9MA 5ICXB 1WUNT 1F11B 1OGTB 2DDQH 3L3OB 2A6IB 2BNRA 4HIXL 2JB6B 1SVCP 3FB8B 3M17B 3M1BA 1EPFA 3L3IA 4HF5L 3VXMA 2X4TA 3VRIA 3V4VL 4PJ7F 2HT4D 3NA9H 1N8ZA 3TPUA 2L4OA 4KQ3L 1OQOA 5JIIA 4RFOH 4I0PC 3QRFM 1GGTA 3OKMB 1CFNB 2GAZA 1KCSL 3DJ9A 1FC2D 4OZIF 1HSBA 1M05A 4Z9KB 1RUAL 1E4XH 5D93B 4W68A 2RCSL 3QDMB 3K4ZA 3AU1A 1YN7A 2X42A 3PL6A 3BZEA 5IQ7L 3CPLB 1SYVA 3DWTA 2PCPA 2BCKB 5TE6L 1XR9A 3BXNB 3MV8D 4QO1A 3UC0L 3QUYC 5DWUH 4UIKL 2GFBA 4IRJC 4MA3B 3U9UB 5C7XL 1IGJA 4OZFH 3BUYA 1A0QL 1JGUL 5MERB 1JGEB 2H32A 4AL8H 1A6WH 4HC1A 4IMLA 1OAZL 4LGSB 1NBVL 3V52H 4N8CL 2UY7A 1LO3H 3L3HB 3S36X 1FO0B 4U1JB 4WIQA 2E7LA 4O58H 4PJHF 3VMPA 3ZKSD 5BZDA 4IHOB 2DQFA 4LMQI 2G5BA 5A2JH 3TYFB 1SYSA 1RZ8B 4JZJB 1U8IA 3WJJA 4GRLA 4RMVA 2WIIA 3ARPA 2IG2H 4MCYB 3ROLA 1XR8A 3ZTNL 3HMXA 1R6VA 3L5XH 3AFLA 5CBAA 1S3KL 2UUDH 3QJFA 3QUZA 5JIHA 1KPVA 4M6OL 2B2XH 3VXRE 1UB6B 3D3VE 5K9KB 3BP5B 2XT1B 1CFQA 3LV3A 2NNAA 1YPZF 2NX5E 2WUCH 3TVMD 3CFKB 4TTDC 4P57B 1NGQH 3FONA 4P2QB 4HXBH 5DQDH 3VWJA 2HT4C 2A38A 1I75A 2FEEL 4OLWL 4YNYA 2DRUA 2H8PA 5E0QA 4HUVB 4U1HB 4KV5E 4LCYB 1MCWW 3IGAB 1EA9C 2F15A 1YYLL 3E2HB 5IOPB 5I15L 1YPZB 2ZG2A 5IVNA 2Z8RA 3DMMD 3MNWB 3LZFL 4YX2L 3I6LD 3IDXL 1FC1A 3C6SA 4LSDA 3CU1A 5CILL 5C86A 2N56A 2FD6L 3EO1A 1F6LL 3EFFB 4YC2B 4UDTA 4MSWA 5DT1H 3V6OC 5HI5D 4J2XA 1CLOL 3GHEL 1LO5A 4PJ8C 5FB8B 2EKJA 5DHVB 2BC4A 5ESVB 3ARGC 3RX7A 5KG9B 1AQDB 3LIZL 1C1EH 1ZLSL 4LFHG 1P5UA 5F96L 3LHPL 5BJTB 1KELL 1EO8H 1I9RH 4U6VH 1FZOB 4LPCA 1S9WA 3U46A 3T2QA 4NKDB 1KUMA 2VN7A 1R3KA 4N9OB 1OAYL 3TJEL 5HYSA 3QEQB 4GAYB 1U93A 2GQHA 4X4MA 4HAGA 4WUKH 1JNHA 4ONFL 3ARDD 5CGTA 2G60L 4WFFE 3ZKMC 3AM8C 3FFCE 2PN5A 4G6KH 4JFFA 4HT1H 4KI5C 4Q97A 5L8LB 5FYJL 3IFLH 2Y07L 4BZYA 3WXWH 5K33A 1T21A 2DYPD 2OP4H 3LMJH 5C0ND 2XV6B 4YZFE 3MJ6A 5HGAA 1ZHBB 4LCWE 3S35L 1D9KC 2DJSA 2D4FA 2R0KH 1D5ZA 2VXUH 3HG1D 1RAMA 1KULA 5ANMB 5F71A 5I76A 1NH6A 3ES6A 4GKZB 4OLUH 4NP4L 3BZ4B 1G6VK 1BD2B 4AEHH 1H8SA 1MCQA 25C8H 3LEXA 2IH1B 1TTFA 4NM4H 2XN9A 3SCMA 2D9QB 1ZT1B 5I16A 1NGXB 4MA1C 4PBXA 5F9DC 4QLRA 4X99A 5CLTA 3CSBA 4RGND 2ZNWA 5H8DA 4D0CB 4DAGH 4D0BA 4XNUH 3BJLA 2DL2A 4KDWA 3GMPA 4OLVL 4BA8A 3MRHB 1CE1L 4GXUN 3EO9H 3FO1B 5FUCE 3DO3A 3OBAA 3CLFH 3QQ9D 3NABL 2XG5A 3T1FB 3X12A 1F4HA 5HHOB 2FCBA 3Q3GA 1A3LH 4U1IA 4LSRL 4UINH 5GGQH 3ARDC 2PTVA 4G42A 1ND0B 3GKZA 1Q9KA 1R3IH 1U8LB 2FZ3B 4HPYH 5DD1H 2HT2D 1JWSA 3KJ6L 1J8HD 4ZTOH 2D31B 3OJ2C 2GK0B 4OGZA 3B2VL 4JY6B 5C0NC 1AGFB 1K5NB 2OSLB 3ZKQD 2PTTA 4HQQH 4ZUTA 4YHKL 4OCRL 5FHAL 2PW1B 3LRSA 1D5XB 1LD9B 4M7KL 1P6FA 3L7EB 2MFNA 5HGDB 2AEPH 3W9EA 5KTEL 1BX2B 1YEDA 2W65A 3I3BA 4Q9QH 2X4QB 1CDJA 3MBEA 2D7OA 5ESQA 1AC0A 1T2QH 4G8IA 4LSTH 1FGNH 2YKLH 3SKMA 1LEIA 4NZRH 4ODSH 1F6AA 3PG2A 3HNSL 5FHBL 4EOWL 4U6TA 3ULVD 2QSQA 3PGDA 3CK0L 5KVDH 2VLME 4AH2A 4R0LC 3RPIA 1DBBL 5ITBH 1TVBA 2OM5A 5EOCH 3DX9B 2MPAH 1G0DA 4ODVH 4EN3C 1EHLL 1AFVL 1KN2H 3BAEL 4CNIB 3ULSB 1NUNB 3F5WA 1KXTB 5IVOA 1I7ZA 2RIKA 3WHXA 2WP3T 3VFWB 5C3LD 2BSRA 3OKKB 4XHJD 5HYJA 2HVJA 3EJZD 1JNNH 4LF3A 4MNQD 1QSED 5D6CB 1L9MA 1EGJH 4W81A 1TZIB 5C09B 4GH7B 4PJHE 3I02B 3DHJA 3OAUL 3I6GB 4XP4H 3SQBA 3JVGA 2OL3L 1ROWA 2BNUA 1S5IL 3GSNB 3INUL 3RL1B 1DE4B 2GK2A 4WI4A 1ITCA 1Q1JL 1O5DT 1RQ5A 3IJYB 4RAUB 4XNQA 4IRZH 1WAAE 5F7EH 5GGTL 2UWEE 4WWKD 5CINL 2FATH 1CI5A 2Y5TB 4LLDB 4PJIF 1LE5B 1IFHL 5K59E 1FL5A 5DEGA 1N59B 2EDHA 3TZVB 1YMHB 2X10A 2XY2A 3QUMB 5F70A 2W59A 3W11C 3VXNA 4H88L 1DL7H 1FQ9C 5BZWB 1KIPA 1MCJA 5CUSL 4L1DA 5TFSL 4HS8L 4AZ8A 1UB5A 1U3HB 2MQ0A 2VLKB 3BDYH 3GMLB 3VW3H 1BFSA 3PXJA 3ULVC 1EXUA 2F5AL 1H3WM 5J89A 4WEUD 4L3EA 3RWIB 1XGUA 1BZQK 4XAKD 2ERJC 5DJDA 1U95A 2I5YL 5JZ7D 4JFHD 2W9EL 3OKLA 3P4NB 3QHTC 4NO2A 5DD0H 3KYKH 4OB5L 4XCYA 2X09A 4E0RA 4TUJA 4OF3A 1QBAA 4PB0L 4PJEE 1ZT7B 3QFJA 4PRID 5GHWH 5AAMA 5JTWA 4JZNA 3HNTL 5DJCB 5FK9B 2JELH 3KS0H 2CRZA 5ACMA 1VFBA 2GTWA 4ALAL 4O2EB 3HZKA 1CDIA 5J6HA 4X6DE 2I26N 5GJTL 4NQCD 4WDIA 1MFAL 5L9DH 1P4BL 2YA1A 1MAKA 1UJ3A 4JO1L 3PV6B 1Q9LB 3SE9H 1A7QL 5JW4M 1KFAL 5TDOB 1WFNA 4HHAB 4OCSL 5DSCA 2DKMA 2KQNA 3KPPA 5KJRH 1FAKT 2OTWA 5D2LE 3NTCH 5CP3H 4X9BA 4FMFA 5T1DL 2WMPA 1A1MA 4TQEH 1WK0A 1MCFA 5J12B 3KPNA 2A77H 4JG1L 1U3ZA 3O2VL 5E8DH 2AV1A 2EYSB 3SDCA 2Y36H 5F1NB 2XZCL 3O4LE 1R0AL 2HWZH 5GRVK 4JRXB 1UM6L 2EDTA 1XIWD 4U0RC 4XCEB 5E8PA 2XQBH 4GMSL 1I9IH 2PR4L 3MV9B 4FZ8H 2UVFA 3FO0L 3G6DL 3C60D 3EGSA 2AEQH 4JVWA 2JJVA 1YECH 2H1PL 4OF7A 3R8BB 4XP6H 2DQGH 4MXWH 2D0HA 1UKQA 2B8OT 1UGNA 5GRUL 5I8KH 3HI5H 2P5WD 1PG7X 2GSIA 4OCMC 2A83B 3IVKA 3EDJA 1QOKA 5FYLD 1CGXA 3KPTA 1IAIL 5BS0B 5HDLA 1IKNA 5DO2D 3GHBL 1L0YA 3HR5B 3SEPA 5GS1B 3BI9X 4A6YL 3BQUA 3DX6B 5EU6E 2EICA 3BKMH 3QP3A 4Z0BH 3TCLB 5INCA 3S96B 2FL5A 2P24A 4G6FB 3ZDXE 3JTTA 4NQDA 4HUWA 3V5HB 3MBXH 5FCUH 3RGVA 4JN1H 3UTTA 2V5MA 2I07B 3DX8B 5GRZA 3QIWB 3A0OA 4OBRA 3DV4B 5IHLB 5DMGD 4HMCA 3LRGA 2ADIB 1KYOJ 1FLRL 2V2TA 1AXTH 5DS8B 1F3JA 4LBEA 4MQ7A 5FKAB 4GFTB 2HLAB 1J05A 1YJDC 3HE6D 1WSST 4H1LH 1U8OB 2MJWA 4EUPG 2XFXA 4CADB 1JF6A 5DD3H 1KB9J 5BO1H 2RR3A 3WNOA 5HVHB 2CGRL 4WUUB 5TH2A 4FFZH 2O5ZH 3C60C 5JPNB 4JHBA 1MIEH 3FHAA 1GIGH 4OZGA 5E6ZA 4R4FL 3UTPE 1FCGA 1XF3A 3CH8A 4I0KA 1AXSA 1G9NC 5KSAA 1UEMA 4XVJH 5CP3A 1MFBL 4K3DL 1QFHA 1H3TA 3REWA 4YWGL 3BE1L 4HWBA 1LK3H 1CDUA 5ITFB 1MJ7L 5E95B 1P4IL 1RJLB 4ZUVA 1IE5A 1ZEAH 3C08L 4RMSA 5SX4I 3AY4C 3EYVA 3HRZB 4F9LC 3D69B 2B1HH 5DO2C 2CLVB 3OXSA 1MAMH 2R2HB 3VFUB 2V7HA 4G6MH 2UYLB 2FBJL 1RUKH 4PRPD 5K93A 5J1TC 3T4YB 1A6TB 3MGTB 5HYQA 4K7PH 5J11C 4BK5A 3MODH 1F42A 4Y4FB 1J1PL 1PQZA 1EBPA 5TDNA 2CIIA 1K8IB 5LG1A 1UWEH 3S35X 3BW9A 5IHZA 1NGWA 1NAKH 3QO0B 5GGVH 1T6WA 3RX5A 2X1XR 4POZC 2XWTB 4N0RA 3MLRH 2HYMA 4JR9L 1G7HB 3HE6C 5DUMH 2Y5EA 1N6UA 1RIHL 4Y16C 1VACB 1A9BB 1HINH 3O11B 1AP2A 3SY0B 2APFA 2E27H 5BV7C 2HJFB 2AJZB 2VDOH 1IZKA 1MQKH 5FGBC 5FM5M 3EIFA 3LAFA 5DJ0B 3WKML 2FJHB 1BWWA 4NPYA 1CL7H 5TPWH 2APWA 3M07A 2YPVL 1HXYB 3QXDA 3AS1A 3WNKA 4HS6A 3B3IB 4G8FB 4HGKC 3WE6A 4L4JA 1GOFA 5IHBA 1EFXD 3K2UL 4Y8DC 1B9ZA 1ZMYA 4YXLH 3BKJL 2BZDA 3EYUH 5SWZE 2MWCA 5I19H 2Z93A 2FECI 5AZEH 5IBUG 4NYLA 3FB5A 4HULB 5E08H 5J9PA 1C16A 1PYWA 5EO0B 2VDKL 3WUWB 3RBSA 1J8KA 5TGBA 5B38G 2D4DA 3U4EA 5D1QD 1XCTA 4NHCH 1KIQA 4JDTL 3N1FC 1DEEA 2C1OA 4G8GA 5C0AD 4UQ2A 4V1DB 2P43B 5F1KC 1WZ1L 3ZYZA 3NOIA 1A6VH 5BQ7B 5D1XC 1I3RB 1INDL 2R69L 1IM3A 2P5EB 2QR0A 2CUHA 5BW7A 2DWEB 5KVEL 3TESA 1NC4D 3OKOA 1DVFD 4ZFGH 1YQ2A 4JPKL 4HMEA 4LKXA 4U1NB 4I0PB 2GUOB 3C8KB 5FKPA 4IIQA 1A4JA 4Q0XH 3F62A 4Z95H 4M1GH 4F33B 4JM2A 4ZFZA 5JOEA 4WHDA 1SJVA 2FX7L 3VJ6A 3JXAA 3MUHL 2FB4L 3QUYB 4N8VA 3RTQA 1IGIH 2ITDB 4IRJB 2XZAH 3U36A 4Q6IA 5IW1A 4YIQB 2JJTC 5LCVH 4N90D 1GGBL 3BIAX 4OKVA 4AK1A 3SJVA 4WFEE 5B22A 3JV4A 1P7QB 2X4SA 4Y1AA 3L3GA 4U1LB 3JV6A 2QADD 1H8OA 1CXHA 1G7PB 4PLKC 2CLZB 1J0KA 4U6HA 4KMQA 2Y7QA 4XX1G 1AGDA 4ZFOA 1QPPA 3MO1A 1WTGT 2IADA 1CZ8H 3UXFA 5IKCA 1CLYL 4JQXC 5D1QC 3U0TA 5IW6A 3SKJH 4P0DA 4Z18A 3C5ZD 3JWDH 4XGZB 3PE9A 5HPOA 5F8RC 4XNXL 1C5BL 1DQDL 5EWIL 4XP1L 2ZSVB 5F3BB 4OGAC 2OL3B 1XH3A 2YRPA 4YJZL 4KPHH 1F13A 1FZKA 4P2RD 1NLBL 2D7MA 3DXAB 3LEVH 4OFKA 4RWHA 4BQ6A 5DJYB 5I75C 2VC2L 1IGYB 5GRWA 4LCUB 1DVFC 4C54A 4XCFL 3OV6A 2OR9H 4RA3A 4LNRA 1OF2B 1R3HB 3CAFA 5IBLC 1M7DB 5E9DD 1ZK9A 4C59B 4NIKB 2ICWA 3T0EE 4F7CB 4GW4A 1FYTD 3Q5OA 4LPVA 5KSBB 1G9NL 2MHAA 1SBSH 1ZS8B 3HNVL 4XP5H 4MAUH 2ZZUT 4MQXD 2F53A 4MGXA 2R2CA 3MLSH 4NC2B 4J3UA 4MXVF 3MV8B 4NKOA 1WT5C 5FOBB 5T3XE 1CFSA 3T8XA 1R3LA 3WO3B 4Y19D 3BOVA 5ENWB 5H35A 1T1XA 5F3HB 4PJ8B 3UROR 3PUCA 1FV1A 1L6XA 5BRZA 3ARGB 1N2RB 3Q6GL 4WW1B 3LS4L 4R4ND 3QEUB 3EDFA 4YDJA 5IJVA 4M1DL 2QADC 2NY6D 1DBML 1BWMA 4LNVA 1MLBB 4G9DB 1O7VA 4ZQKB 3JSSA 2WM0A 3CZFB 3MACH 1HQRA 1KC5H 4GUPB 3VA6A 3CCHA 3QNYA 5DFVC 4U31A 2BVQB 2A74A 2BSED 2QHLA 3SGDI 4ZUWB 4HUKB 3TBYB 5GGRA 4LSVH 2Y06L 4QRRA 3HE7D 3P4MA 1D9KB 3S34H 4AQOA 1FFPB 1J86A 5IROC 3S4SB 5BV7L 3BP6B 1I8LC 1CTOA 4JY5H 43CAA 1CFTB 1J0JA 5C8JB 4X7DC 1XCQB 1JK8B 3P0YH 3LKNB 4TOYH 1NDGA 2FNBA 3NPZB 2ITCB 1UVQA 3KPSE 3C9NB 2FLRT 1BAFL 3CVIH 4L9LA 3RRQA 5DDHA 4IBLT 4P4RB 4DTGL 4CDHA 5FYKU 1SM3H 3QXVA 1JTOA 1NCUA 3GFUA 5I66A 4Y5XB 4KY1L 4X9GA 5KVFH 1CQYA 3LN5B 2EDQA 5IV2A 2VITB 4MA1B 4LRNH 2BNRD 1UWXK 1JZ5A 3O8XD 2VMFA 3STZA 1UKTA 3HUJF 4FRWA 3SE3C 2DQUL 3LKRB 4R4NC 4PRBA 1OWRM 2CK0L 3B9VA 4WTZA 1DLFH 3K80A 4CGTA 2XNAA 5EN2A 1BZ9B 5C3TA 5KOVC 5HHXH 4NZDA 4PJGB 4K8RL 1PG7W 1B4JL 3CIQA 3OPZH 3HUJB 5AD0B 3ARDB 1IGMH 2WBJB 3PL6D 4FQXC 2NY7H 1FNSH 1GH7A 5AZ2L 5IF0A 4GOSA 2VQ1B 5GRJL 1MUJA 4JFPA 1IEAB 4D94A 2NY1D 3WEXA 3BUTA 1E6OL 3K46A 4Q2ZB 1CT8B 1E28B 5FV1L 1W8NA 2DQEH 5DVNA 1I8MA 3HG1B 4FQ2H 4NNXB 3QDJA 3BWAB 5E1HB 2IPTL 3GRWA 4P9HL 3ZMRA 3MLVH 2OTPA 3VXUB 2DM3A 4GXVH 4OQTH 3V4PH 4GRLD 2W9DL 4WHYH 5D4QA 3VG0L 1EHXA 2KL6A 1F58L 4GRWF 4R0LB 2YMXH 1B0GB 2Z31D 4GLRH 1EV2E 2NTFA 5C0RL 3BPCA 1AD0B 3PWUB 1EUUA 3D3VA 5DC9B 4EN3B 3B5HA 3MFFA 5GZOC 1H3PL 5DK3A 4X7SH 3MJ7B 4QTIL 1OSZA 4ZD3H 3L7FA 3QCTL 5FA3B 3VWJD 1RU9L 3OKYA 4F58L 4UQ3A 2OZ4L 4TVSa 4GRWB 2VZOA 4QOKE 3U1SL 1F4XH 3QDGD 1TZHA 4RRPG 4R96A 2Q76B 3BT2H 4ZAKA 4P3WA 4ZS6D 4ZPTB 1UZ6F 4ESKA 5E2TL 1Y6MR 3DBXA 1PY9A 3TV3L 3PL6C 4EI6A 4W4OA 4ODHL 1H3GA 4F7TA 2DBJA 3N0PB 3ZT6A 1H5BA 1TQCC 1ZHLA 2BVOA 2OQJA 1CFVH 2AJ3A 1FNGB 1DUZB 5SV4A 4JHWL 3SDXA 1N26A 5TDPA 1WIUA 3GSXB 4LSSH 4UTBH 3ULVF 3N1MC 5DGQA 5EBLA 5ALBL 2EXWD 4WFGD 1Q72H 5GS0H 5BMFH 1GAFL 3EO0B 5IFAL 4FQHB 2P8MA 3X11A 2E7LC 2O26U 3VXTB 3RWEA 2EYRB 4HIHA 1CIDA 2BOBB 2D03L 3TNMA 4AQ1B 5IEKB 3G04B 2CPCA 2OJZH 4BYHA 2YD9A 3MUGB 5JHDA 4JANA 5GSVB 3WJJC 1KJ2H 4GRLC 3OZ9H 3H9SD 4RAVB 3HMWH 4PR5B 3V0WL 2Q7NA 3T3ME 1DLHA 2AJVH 4CBPA 1DQLH 1UG9A 3ECBA 3QUZC 4XXDA 1NFDA 3GMQA 5IB4A 3T2PA 2YEZB 3HPJB 3EAKA 4QXUL 2AW2A 4JFFD 3R1GH 1YEEL 1JWMB 3BGAA 2ERJB 4QYOA 3SDDA 3TCXA 4HPOL 5MENE 4KVNL 5IHUL 5B39B 1RK0A 3SKOA 3ILPA 5A40E 1JZ4A 2WV3A 1FO0H 3Q5YA 2AJYH 1KN4H 1T2XA 1OB1B 3S37L 4FFYL 1DANU 2AK4E 2YPLA 1A7RL 2O61A 3SDYL 4J6RH 1T7YA 3VWJC 4TNWK 5C71A 2YD1A 1KTDA 3FL7A 3TWCL 4WY7L 3T3PF 3VI3E 4BSVB 1S7WA 1YUHA 4KGLA 1I4FB 2LFGA 2DKSA 5DJZA 2ILLA 4ZS6C 2ID5A 3NCMA 2FX9L 2HVKB 3T0WA 3FFDB 1UZ8B 5CD3B 3T2NH 4XPBH 4KWUA 3RWCA 1KEML 5JUEH 1IAII 3OR6A 1WJ3A 4X4XA 3ZTJH 3ZT5A 4QRPA 4UV7H 5E8OB 3O4OC 1W0WB 2B5IC 4PJAF 4P2OA 4K71C 5C0CE 1HXMB 3QXWA 1WBXA 4XPTH 5T1LA 5IG7A 1LP9F 2A9ML 3SQOL 4RDQF 4OCWL 1FPTL 4ONHA 2EXWC 4R8WH 5DA4A 1HILA 4XCCL 5FM8A 1AGBB 1RIVL 2DQJH 3BRDA 1TCRB 4LHUB 3KPRE 2EH8H 4PJAB 2YOCA 2P8LB 5JW4N 1MWAL 2Z35B 3K1KC 1AGCB 5JW5B 4U0RB 1INEH 1U8NB 2LTQC 4JLRA 1NKRA 4PJDA 4FXKB 5EBWA 5DI8A 1U91B 5JLZB 1KIRA 5DHVH 4NJAH 2J5LB 5EA0H 3WSQL 3MLYL 4DUXA 4ZSOB 1EK3A 3MXVH 5FGCB 2H2PC 4C83A 4MNHA 4N0UA 3QPXL 2B4CC 1S5HB 1U42A 5J56B 3QQ3B 2KKQA 3V5DB 3EOBA 1SMOA 2X1PA 4JRYD 4U7SA 1U3YA 4NRXB 4YHML 5LQBH 2IGFH 4LIQH 2EIEA 4ZO8A 1ZANH 3ZHDA 5HYSG 5IUSA 3O0RL 4HH8A 4HUNB 1YEKL 3MRFB 3IYLW 3MBED 1MRCH 1NGYA 5HHVH 4FABL 3O3EA 1RZ7H 2EDXA 3FQUA 1I8IA 4PJ7A 3H7LA 3GJEB 4H26B 1KJ2A 1ZWIA 5I1AB 2XA8L 4PJ5A 5ACZA 3E6HB 3B9KD 4OZFG 1F97A 1WZLA 2ZUWA 4OZIA 4Z7VE 3RVUD 3SCMC 1SJHA 5KOMC 1XF1A 4XBPB 3GO1H 3RU8L 3WIHL 3WFBL 4KJYB 3P77B 4PJFF 5J06A 1IGFH 4FQIL 3RBGA 4Z76B 3VFGL 2FYYB 4L4TD 2FX8L 1ZA6A 2R15A 4UUJA 1WCBA 1VENA 2EEDA 3WLBB 5J7CC 5ESAA 1TJIH 3UYRL 1J1OL 4RGNE 4PJHA 2R1WA 4F80A 4HJGB 2P49B 4DKFH 3MJ9H 3GMRA 4JFXB 4BSJA 4ZUUA 4K23H 3C6LA 5JMOC 1LNUA 3BN9C 2DD8L 4F37K 2FO4A 5GS2H 3PIQB 3NN8A 3GSUA 3FQNA 4YBQD 1FIEA 3LH2L 1YEFL 3DUSA 1F4WH 2UWEA 4M8VA 5C08D 3IAGC 3KR3H 5GGRY 3A6BL 1GC1H 2O5XL 1WTLA 4NKMB 5I8OH 1MHPL 4JCMA 5FGSA 3MBEC 3MLXL 1QRNB 1BQLH 5I1DB 1B2WH 4R2GC 1MQ8A 1UXSA 3VH8G 3T77A 4AYFA 1VGKA 4GQPH 3EZ8A 4CVWA 4JO4H 5I73C 1J12A 4NGHH 3ZSSA 3IDGB 3RVUC 3C09C 3C5JA 4L3ED 3EHBD 5JNYA 1CR9L 4X7TB 5AYQA 4HC1L 2QQLH 2ESVE 2BNQA 3AREA 1UACL 3HFMH 1KJ3L 4MCZB 4HV8B 4Y4KA 4RMTA 3W9DA 5T1MB 4Z7UE 1ZA3A 2R23A 2J88L 2B1AH 4TRPH 3QNXB 1DBKH 1OLLA 3VE0A 5HD8D 5EO1A 3HE6B 4OZHF 2R0ZH 1VESA 4Y16B 1QFOA 2C7UA 5FYKE 5DUBA 1RULL 2J12B 4DEPC 3NCJH 5MHSE 3JVGC 4N0FB 5BV7B 4GSDH 1FORH 2EYTB 4XBGA 3UTSE 1B88A 4OSUL 3P73A 2XPGB 2E6JA 3FMGH 5EBMA 3U83A 3A67H 2R29H 2AQ1A 2A1WH 4YBQC 4L8BB 3QUKA 5DJ6A 2YA0A 2PYED 3DETC 3IDJA 3V7AG 1I1YA 3ULUL 2R8SL 1MCPH 1S9VB 5HI3D 1HI6B 5JDJA 4JDVB 4UDUA 3HR6A 3GSNH 5A3ID 5E8EB 5EU7E 4DN3L 4PRPB 4HBCH 5I18H 2F9BT 2DKUA 2X1WL 1FZMB 5KSUB 1QRKA 3CSPA 2DDQL 3MRJA 3IDMB 1V3MA 4LLUB 3EHBC 3MJ9A 4Z7OE 3ZL4H 3VFOB 4WHTA 3QUMH 2VABB 4HUUB 4U1KA 2X5PA 4GG6B 2H26A 3NA9L 3HZVB 1FVEB 4FFWC 5CFHA 5MEQA 5D1XB 5MEOB 4RFOL 2VLRA 3BEWB 2IQAB 3ARFA 5EO9B 1FG2B 3KAAA 4J3SA 5GGUA 5JA9A 1E4XL 1IAOA 4J3WA 4GJTB 3QJHA 2EDOA 4Z77A 5DC4B 2J4WH 3GM0A 3WDJA 5DK0A 4PRHA 5C0FA 1AHWA 1NBYB 2FEDC 3MZGB 5DWUL 1KT2A 1IBGH 4CVXA 1MI5A 4PLOB 1UJ3C 2GITB 4R7DA 4AL8L 1A6WL 3QG7H 3JUYA 1AD9B 3S5LG 3V52L 2D7NA 3UTTD 1LO3L 5CEZD 5HY9A 4O58L 2Q8BH 2PYFA 4TUOA 4OI9A 1T0MA 1BJ8A 4KKAD 5JOFA 1BZ7A 5C0BB 4JZOB 4X9HA 3SDCC 1G7IB 1Y18A 3PWJA 2IG2L 4Z7WF 3L5XL 3E6FA 3MA9H 3UTQA 2Q7YA 5DFTA 3OJVC 2B2XL 1I7UA 4G6JH 4Z78A 5CJXA 4K07A 5FO9A 3KYOB 1G7JB 2J6EH 2DIJA 1S7XB 5D1QB 3HRPA 4L8SA 2WUCL 5L88H 4ELMF 5C0AB 1NGQL 3NCYS 4HXBL 5DQDL 4Z7WB 3WXVH 3IDYC 4G8EB 4PTUB 4PY7B 3IB4A 1MCEA 2NR6D 3ARRA 3HZMB 3SDAA 3VRJB 4KJPD 4K3HA 5KSAD 3PQYE 3ZE1F 3W5NA 4ZDHB 1JRHH 1MJJB 3GIVA 2YA2A 5EU5A 4LLYB 3B9DA 5K9OA 1NC4B 1KXVC 4OJFH 5I75B 1K4CB 1DVFB 3TM6A 4MA8H 1IKNC 4CN4A 1ZLUK 1T0NB 3RL2A 4JFEA 4R7NA 3B6SA 2I9LA 1FFOA 3NIFF 3RWGA 2C3GA 5DT1L 4W70A 1AKJD 3HPLB 4LOUD 3FRPA 3DTXB 4JRWA 5FYLE 1ZVSB 2H3NB 4ZOBA 3RGVC 1C1EL 3CVHA 2EDKA 1EO8L 3S37X 1I9RL 3LQZB 4U6VL 1LEGA 4WJ5B 1U8MA 4KK8D 5FUZH 4F9PA 2VDLH 1DDHA 2F58H 4L29B 1VKXA 1PSKH 2GJ6D 1RHHB 1S9YB 2EEAA 4PJIA 1NUGA 4PJCF 4R3SB 4ZUSA 4NKQB 4WUKL 2QADB 1CD1A 1MFCH 1LGVA 1ZSDB 4G6KL 5EDXA 3W0WE 1FYHB 1PKQB 1LK2B 4HT1L 1NPUA 3IFLL 4Z8FH 1JHKH 2J8OA 3VFMB 3WXWL 3OKEA 3UJIH 1IARB 1RUPH 4HX1A 1UXWB 1MCCA 2OP4L 3LMJL 4X98A 1N4XH 4MJIE 5HPMA 5ANME 1ZXQA 4QHNB 4PJXE 1G9MC 5FYJU 4X6BB 4RX4A 1A4KB 2R0KL 2VXUL 4KJPC 4LDEB 4NM8H 5EOTB 5KSAC 1KEGH 1BD2E 5GGSA 2LABA 4AIZB 1DQQA 1K6QH 3QHFH 4OLUL 1KPUB 3VXPB 1QLFB 3VXSE 3IKKA 4JB9H 3OXRB 3IAPA 4E5XA 1D3CA 5HHMD 4DVBA 2IH3A 1QVOA 5ISZA 4U6XB 4YHYC 4PGEA 5GSRB 4AEHL 3QPQD 4LAJH 4X8JA 4KTEH 4APQA 1YMMA 1RI8A 1S7VA 4JDZA 25C8L 1QFWI 5JW4Q 4PD4J 3Q5TA 4NO3B 4NM4L 2CDGB 1A5FH 4N8PA 3I75A 2WBWB 3QXAB 1UCTA 1MELA 2FH8A 3KPMA 4YO0A 3OGCB 5CZVH 5LAXB 5IVZA 4KU1A 5E8NB 3CGTA 3RP1A 3LPWA 1KLGA 4DAGL 3AC0A 4XNUL 1XGYH 1RY7B 4G8GD 3X13A 1HCFX 4KK8C 4UI2A 4Y19B 5HHOE 3EO9L 1LE9B 3FRUA 3RGHA 3CLFL 3HZYB 5CMAA 2F8XC 5E2JA 4H8WH 1A3LL 3RIAK 3PWNA 4UINL 1NL0H 5GGQL 1SEBB 4ZOAA 4D9RD 3F7YA 1R3IL 2HFEA 1Q94B 4HPYL 2M1KA 3SPVB 5DD1L 4EI5D 1D6EB 4ZTOL 3MGAA 3KS0J 3MLTA 4MD5B 1P1ZA 1U8KA 1LO0H 1VB9A 3IF1A 3KXFB 4HDIA 2C1PA 2X9WA 4HQQL 3L3DA 4UB0H 5IR1A 5F88A 3H9HA 4UBDD 4FQXB 1E4KC 4U6YA 4FZEH 4U1MA 2AEPL 2GCYB 4K7FA 5BXFB 2ARJB 4FTVA 1W72B 3RTQD 4Q9QL 2DAVA 2HFFA 3MRMA 2HFTA 1IQWH 2ZCHH 3OX8B 4PGBA 2DLEA 3EUUA 1T2QL 1KGCD 4LSTL 1FGNL 2YKLL 3QPQC 4NZRL 4ODSL 3MR9B 3KYAA 4C56B 3NA4A 3GNMH 5K9QG 4QNPF 1U8HB 4Y1AD 1MCHA 1A7OH 1C5CH 1FN4B 4N9GA 5KVDL 1XGRB 2PO6B 2W60A 1CD8A 4AM0B 2AV7A 4LEXH 5D96C 4ODUA 5ITBL 1IGTA 2BX5A 4HIJB 5EOCL 4ODVL 2MPAL 2X1OA 3L3KA 5JORA 3TN0A 1CD0A 1KN2L 7FABH 4TNVF 5D6DA 2OX5A 4MX7A 5C09E 2FR4B 1FLTX 4IM8A 5F9JA 1QSFD 3L1OH 5GIRA 3O45A 1XF5A 3L5WA 2BNRB 1NCNA 5DK2A 1JNNL 2ED9A 1T03H 1EGJL 5JQHC 3M1BB 3G6AA 5ADOH 4H1LG 3DYMA 5BW7C 3RVWD 3L3IB 4XP4L 3VXMB 2X4TB 5DUPH 3VRIB 1N8ZB 4HCRH 2QSTA 3TPUB 1IGCH 4IIQC 3ARYA 2GAZB 3ARTA 2CKBA 2C5DC 3AAZA 1AC6A 1K3IA 1HSBB 1M05B 2ADGA 4I3RH 4IRZL 5F7EL 3AU1B 1YN7B 2APVA 3PL6B 4JFDE 2FATL 4UBDC 3BZEB 1SYVB 2PCPB 5SX5K 5DVMA 1XR9B 1TQCB 2GFBB 3RTQC 1DL7L 2VLKE 1IGJB 2BVPA 4Q6IC 3BUYB 5T3ZH 4Z6AT 2H32B 3LQAC 5BRZD 2P8PA 5IVXE 4IMLB 4YAQA 3BDYL 2ATPA 2NZ9D 3FTGA 3VW3L 5I1GH 2NXZD 2R2BA 1NJ9A 4Y4HD 3P9LA 4IMKA 1ZLUH 5BZDB 2DQFB 2G5BB 3ARBA 1SYSB 3O2DH 1U8IB 4GRLB 3FOMA 3KYNA 5DD0L 3KYKL 2WIIB 3ROLB 1AQKH 1XR8B 4R4BA 3IFPA 2EZ0D 3K2MC 5CBAB 3QUZB 2CDFB 3QJFB 2VDNH 3DVGA 5FOJA 1KPVB 1G7MA 5GHWL 1HQ4A 4NFCA 2EDLA 2AQ3A 3LV3B 1CFQB 2JELL 5ICYA 2NNAB 5L2JA 4DQOH 4KKCC 4G9FD 2HJLA 3FAXA 4HFUH 3VWJB 2HTLD 1RV6X 5F44A 5FUOH 1QLRA 4YNYB 4DKDC 2H8PB 3CFIC 4L1HA 1TLKA 5L9DL 1FH5H 1IAIM 4UT7H 4KAQH 4S1DC 3SE9L 2D0GA 1T1WA 5KJRL 2IBGA 3NTCL 1CG9A 3RZCA 4P3CH 4TQEL 3CDGA 3C6SB 2NW3A 3EO1B 3WHE1 2JE8A 2A77L 4UDTB 1BFTA 4MSWB 4D0DA 3O4OB 1X5FA 2B5IB 4E41A 5E8DL 4K71B 3MZTA 4JO2H 1LO5B 2Y36L 3QIUA 1FYTE 2BC4B 3QRGH 2HWZL 2WP3O 2NZ9C 1NLDH 2ZSWA 2NXZC 3QH3A 2DL9A 3MV7A 4NZUH 2XQBL 3CX5K 1S9WB 3TBTA 1I9IL 3U46B 4FZ8L 1AI1H 3MNZA 3SKNA 2AEQL 4X83A 1R3KB 4LCCA 5HYSB 1U93B 1YECL 4YEEA 1PAMA 2LTQB 2YSSA 5DRXA 4H0IA 2EO9A 4XP6L 1IAKA 1JNHB 2DQGL 4MXWL 4CJ1A 4Q7DA 2VL5A 1V3JA 4BKLA 4JFFB 5I8KL 3WLWC 3HI5L 2X4RA 3OSKA 2IEPA 4K3JH 3L6FA 1T21B 2APTA 4C58B 4XPFH 5KSVA 1ADQA 4OM1H 1FVCA 3D2UD 5HGAB 2NY2D 3SBWC 4HG4J 5SWQA 1VDGA 4OV5A 1PDKA 1D5ZB 3BKML 4NO0A 4Z0BL 5I76B 3ES6B 4PJBE 4HEME 2R1XA 3UPAA 5HDBF 2RGSA 4L9LC 3MBXL 5FCUL 3RVXD 3LSOA 4JN1L 4U33A 1F8TH 1QACA 4Y5VC 1CDCA 4XCNA 3LKQA 4ZO9A 3LEXB 5KBNC 4G7YH 2XN9B 1G0YR 3SCMB 1HK6A 5I16B 1AXTL 4XVSH 3MYJA 1DFBH 2OMBA 3VXRD 3V6ZA 1IT9H 4WUUE 3D3VD 4X99B 2OYPA 2V5RA 4D0BB 3GMPB 4L4VA 5DD3L 3NIDF 5BO1L 5IB1A 2NX5D 1FNHA 4FFZL 2O5ZL 2HMID 1REIA 4YQXH 2Z92A 1MIEL 5J13C 3CXDH 1GIGL 4ZAKD 3X12B 2JJSA 1OARH 3Q3GB 4U1IB 1UEYA 4F2MA 2BHZA 2EC9U 2CJUH 4G42B 2BXYA 1Q9KB 4XVJL 2R4SH 1BQHA 5CZKA 2AKRA 1JWSB 1LK3L 2DN7A 3ESUF 4PJ9A 1ZEAL 2PTTB 4ZUTB 2B1HL 4KJQD 1MAML 1T20A 5GGSY 2XOTA 3LRSB 4G6ML 4LU5H 1U9KA 3S88H 3QULA 1RUKL 4WU5A 4FQQA 3W9EB 2ZKHH 4MJ4A 3RZWA 1YEDB 2W65B 4K7PL 3MBEB 5L8KB 3BSZH 3MODL 1GYAA 5ESQB 3V0VA 1MFDH 4R2GB 3RVXC 5I0DA 4G8IB 2B7DT 3SKMB 1LEIB 4DZBA 35C8H 5FYJE 1F6AB 1UWEL 5E2WH 2CO6B 4YHIA 4BELD 1HSAA 2L7JA 1NAKL 3PGDB 3UX9B 5SX5H 1Q9WA 1CF8H 4JEGB 1P53A 5GGVL 1O0VA 3C09B 4AH2B 4U7KA 1M6OA 4KRPD 3ZKXC 4LVHC 1BREA 4WFFD 3BDBA 3FFCD 3RPIB 3MLRL 1TVBB 3TA3A 5DUML 5KZCD 2WUBH 3JWNC 1F3DJ 3F5WB 1I7ZB 1OAKH 3WHXB 1HINL 4L8CA 1A1NA 2E27L 1CK0H 2VDOL 4ZFOL 1R24A 2BSRB 4LCWD 3TBWA 5HYJB 1MQKL 2HVJB 2HMIC 3RVVC 4LF3B 3C2AH 1ORQA 4ZAKC 2KQMA 2ZP0T 4JHAH 1MCSA 1RZFH 4IOFD 1CL7L 5TPWL 5B4MD 1ETZA 1Q9OA 4DEPB 3GI8H 3AMLA 1XGQA 1JPFA 4W4OC 4AENA 4AT6A 2BNUB 3BJ91 3KYMA 3TVMA 3ARVA 1TMCB 4YXLL 2IAMA 3ZYOA 4XNQB 5T33H 1I3GH 3EYUL 1HEZA 3MOBH 4KJQC 4GRWH 5I19L 2HRLA 3RUGE 3EFDH 3TO2A 1FL5B 5DEGB 3P2TA 2PTUA 5AZEL 5IMOA 1ZV5A 5E08L 3VXNB 3DMMA 1KIPB 4V1DE 1SY6H 2J8UF 3UO1H 5LGJA 4GW5A 4NHCL 1UB5B 3F7QA 1FL6A 3GMMA 1IQDA 4NNYA 1EXUB 2R2EA 4PIRF 4WEBH 1A6VL 4YDLC 4L3EB 2JIXD 1CGUA 1XGUB 1AO7E 4UTAH 4M4PA 2Q87A 5DJDB 3SDDC 1U8JA 1U95B 2JJWA 4JG0H 5C6PB 3H3PH 3OKLB 2R0LH 1RFDH 4NO2B 1EZVX 4XCYB 4E0RB 3MFGB 4TUJB 1QP1A 3I6KA 3LN4A 4ZFGL 2HJKA 5GRVL 3QFJB 1A6AA 2VXQH 4JZNB 3RKDC 4Q0XL 2EDYA 5J6GA 1QBLH 3IDNA 4Z95L 4M1GL 5IQ9A 3ULVH 1C12A 2ZOKA 1H15A 1RZIA 4PREA 1VFBB 2GTWB 4IOFC 5FM4A 3NPSC 15C8H 3HZKB 2WAHA 3O3AA 2VB5A 5T5FH 1A3QA 5AUMA 4S1QH 2DYPA 5GXBB 5J6HB 1IGIL 1GVIA 2XZAL 4WDIB 5LCVL 1UJ3B 4NN5C 5DSCB 3GMOA 3KPPB 2OTWB 2VLMD 4FQCH 1A1MB 1RZGA 1CXLA 3QI9A 5F9WC 4O5LH 5JPMA 3KPNB 1XFPA 3R0MA 4Y2DD 3BMVA 1RPQA 2AV1B 2Q6WA 1T4KA 3SDCB 4HW6A 1CZ8L 3SKJL 5DMYA 1RJYA 4WHYG 4HH9A 4MD4A 3JWDL 3MRCA 1FBIH 3RHWF 5E8PB 3DXAE 3VWKD 1S7SA 3HLAA 3ZKND 3VDBA 1MIMH 4KPHL 3EGSB 4XB7A 3LS5H 5D72H 3P30H 3LEVL 3C6LD 1YY9D 3IDYB 2VR5A 5EC2A 4KMTH 4RSVA 5KSBE 3EOAA 2OR9L 4F7PA 3TNNA 5DRZA 2GSIB 3IVKB 1IC4H 5C0GA 4M61A 1JP5A 4J1UA 1V8HA 4YK4B 1SBSL 4XP5L 1X5LA 5JW3H 1A6PA 4MAUL 5E4EC 43C9A 5IEHB 1OCWH 5E6IA 1KCVH 3BP4A 3MLSL 4LRIA 2P48B 1J8HA 2YXFA 3NAAH 1U36A 1EIBA 1CDYA 3BQUB 5F7NC 2AEIT 3OL2A 4RGMC 1WFTA 5INCB 5D8JH 2FL5B 4IOSD 5D1ZD 1CQKA 2P24B 3FAWA 3JTTB 4NQDB 1I85A 4HUWB 2ZUSA 3RGVB 3ARED 4DN4H 4NRYA 2ICCA 2ESVA 1FZJA 2ZWLT 3EJYD 4Y4KD 5ID0A 4QY8A 1T7XA 2VH5H 4KI5E 2V2TB 3W2DH 1F3JB 3MPCA 4LBEB 4MQ7B 3MACL 1P9MA 2NY5H 1KC5L 1J05B 3S36H 5JXEA 4I77H 2DQDH 2XFXB 1P69B 2XQYK 1PLGH 4BFEA 4XT1C 4DFIA 3G08A 1QA9A 4OUUA 1SQ2N 5TH2B 5DHYA 4NUJA 3I9GH 4LSVL 2Q8AH 2HH0H 4OZGB 3C6LC 2UV3A 1XF3B 3S34L 1YY9C 2C9AA 3UTSA 1EHNA 1AXSB 1HNFA 5D7JD 1I8KA 5KSAB 4JY5L 4MNQA 1QSEA 2WZPD 3P0YL 3OB8A 1YJDH 3REWB 4TOYL 1NEZA 2JCCE 4P4KD 3CVIL 4MLIA 4ZUVB 3O3DA 5CGYD 4YHYB 3EW3B 3EYVB 1PEZA 4WTWA 3OXSB 3RVTD 1SM3L 2V7HB 5KVFL 5LBSH 5KS9F 3U7WH 3O4LD 1JCKA 3ZTJG 1QQDA 3PXHA 5HYQB 4WWKA 4LRNL 1PZ5A 4CRPA 2FJFA 1PQZB 2HP4A 1FSKC 5TDNB 3AREC 2CIIB 1MOEA 4PGDA 4PPTA 1DLFL 1PKOA 3BW9B 4PJGE 5IHZB 1NGWB 1OAUH 4Y4KC 1L7IH 4KK5D 4RFEA 3ZDYE 5CKAA 1KJMA 1HDMA 5HHXL 1NBZA 3OWEA 4BUGA 2A6JA 1LP9A 4WV1A 1T2JA 3OPZL 2BJMH 4GBXD 3ZDZE 1IGML 5F9AC 4X6FA 2P4AB 2NY7L 1FNSL 4PP1D 2PXYA 1A3RH 1AP2B 1RJZA 5C0EA 3FZUD 1CXEA 1CGWA 2KUTA 2GEEA 4HUXA 4AIOA 4PRIA 4NPYB 5EU6D 4P48A 2DQEL 1G6RA 2ZCKH 4EBQH 2DWDA 4FQ2L 32C2A 3P0VH 3RWFA 1EEZA 3H0TA 3QXDB 4ODWA 1KB5H 3VXUE 4AJ0A 2KPNA 4HS6B 3WE6B 4OM0H 3BYTA 1EO5A 5HHMB 3MLVL 1NFIA 1DR9A 4GXVL 4OQTL 3V4PL 4KROC 4UILH 2CLRA 2WSKA 4JQIH 4NQCA 2RAMA 1CIUA 3LN9A 4GXUM 2Z93B 4WI8A 1W0VA 4XVTH 4NYLB 5CSGA 3FB5B 3N1GC 2AJUH 2EE6A 4NFDA 5I6XC 5J9PB 2AABH 2YMXL 3STLA 1C16B 1PYWB 2FHCA 5D96B 1QHOA 2PYEE 3QUXD 4NHUA 5TGBB 4YHOH 3U4EB 2VL4A 5DJ2A 1XCTB 1KIQB 4X7SL 3HS0A 1DEEB 2C1OB 4ZD3L 1MSPA 4G8GB 4WI5A 4UQ2B 4HKZA 1FE8H 4ZXBD 4KK5C 3SDAD 3A6CH 3UTPD 4KDTA 3GKWH 1MPAH 3X3FH 1F4XL 1IM3B 3BT2L 4BQBA 4RWYH 4LPYA 2QR0B 3PQYA 1XIWA 1BFOA 3MLWH 4XPAH 1ZKAA 4ZTPH 3OKOB 1L0XA 3E8UH 4PP1C 1WICA 4PJFA 1X5AA 4LKXB 3C60A 3CFCH 3FZUC 4IIQB 1A4JB 2OBGA 5FKPB 2XZZA 1CFVL 5HDOA 4JM2B 3BHBA 4CVZA 4ZFZB 4M6MH 5EIIA 4LSSL 1BOGA 2VDMH 2P5WA 1WVZA 4UTBL 3VJ6B 4MDJA 3DI3B 1Q72L 4N8VB 1XMWA 2OJEA 5A2IH 5BMFL 3RTQB 5GS0L 3U36B 1JHTA 3MRLA 3UDWA 4Q6IB 5IW1B 1PX3A 2E5EA 3HKFA 3E1F1 4OKVB 3SJVB 1KJ2L 3OZ9L 3ET9F 3CU7A 3HMWL 1AGEA 3JV4B 3WS6C 2X4SB 4Y1AB 4PBVC 2AJVL 3L3GB 1DQLL 1K8DA 1LDPH 1ACYH 3DIFA 3JV6B 1A21A 3R1GL 4NCC2 4U6HB 1MY7A 5CJXC 2Y7QB 3W0WA 2LAGB 3ZT7A 1AGDB 4ZFOB 3MO1B 2IADB 4ORGA 4YH6A 1FO0L 5IKCB 3U0TB 4L8SC 5IW6B 2AJYL 1KN4L 3ZYJA 5IFJA 4LEOA 4J6RL 4MJIA 2ZG1A 4ZXBC 3SDAC 2RB8A 1ES0A 2DQTH 2EECA 4PJXA 4GKOA 1XH3B 1KB5A 5ACLA 4YHPA 1JPTH 1FZKB 5A2KH 4X7CC 1YQVH 3DLQR 2FSEA 3VXSA 2YZ8A 3T2NL 4XPBL 4YXKH 1RSFA 4LNRB 5JUEL 4APQD 4KKBD 2ICWB 4YXHH 5SWZD 4GW4B 4UV7L 1NFKA 4OZHA 3RY6A 3GK8H 2MHAB 4Z7QF 4XPTL 2F53B 5DLMH 2MCG1 3KPOA 2BVYA 4XC1H 3T65A 4WI3A 4TSBH 4NKOB 4R8WL 1CFSB 3T8XB 3DI2B 4PG2C 3UTOA 3ROOA 2DQJL 5K9JH 5H35B 1T1XB 1TJGH 4F9PC 1ZTXH 2EH8L 1FV1B 5BRZB 4IRSD 1G7QA 1INEL 2VJXA 2OR8A 4YDJB 5IJVB 5FGCE 4HK3J 4IEFB 2V9RA 3DVNA 4NJAL 5EA0L 4U3XA 5L2KE 3MXVL 4ZMAT 4G6AD 3BKYH 5CSBA 2A9NH 1HQRB 3QDAA 1S7QA 2R9HC 4F57H 5SX4H 2JF1A 1F4YH 3CCHB 3QNYB 2A74B 5LQBL 1JGLH 2IGFL 4LIQL 2X7LA 4O51A 4DWHA 1ZANL 1H3XA 3U30C 2XWBA 3IJSA 2G9HA 2E7HA 5GGRB 4BJLA 1MRCL 4QRRB 1Q0XH 5HHVL 2AQ2A 3VI4F 5F7HA 1RZ7L 3P4MB 1UH2A 4H20H 5EUOF 2OLDA 1DZBA 1V7MH 2RFXA 43CAB 4APQC 3S3SA 3WFCH 4WFED 2YD7A 1YN6A 5CIPH 1NDGB 1UVQB 3C87A 1OGAE 2X41A 5AYUH 2R1YA 3GO1L 4L9LB 1X3DA 3MOAH 5DDHB 4P23A 4MXQD 2XRAH 3ARSA 3QWRD 5M7QA 4O02H 4Z0XA 6FABH 2DMCA 2V2WA 2GW5A 2MMXA 1EFXA 2FBOJ 5I66B 3QCUH 5IV2B 1IGFL 4MHHG 1G1CA 1CYGA 4GRMA 1JVKA 5LWYH 2EDDA 3STBA 1QLEH 3STZB 3NCFB 4PRBB 4PYGA 1TJIL 3IS1X 2Y23A 2DTSA 2XNAB 5EN2B 4DKFL 1BJ1H 1YNKH 3MJ9L 2DF3A 3DO7A 3NCCB 1R3JA 3CNKA 2NXYD 5DQJA 4K23L 5J13B 4BUHA 4ISVA 4G6AC 1G9EA 3PJSA 2VLJE 5F72S 3T0ED 5HHNA 2F74A 2XTJE 1F4WL 1QRNE 4UMGA 4JFDA 5IF0B 3KR3L 2VLLA 1GC1L 1JUFA 5JIKA 1MUJB 4JFPB 5I8OL 4I18A 1Y0LA 3TT3H 1CL7I 3VD4A 1A6UH 3WEXB 4ELMA 1BQLL 2H6PA 5T3XD 1B2WL 4XMPH 5F89A 3UZEA 1I8MB 1PG7H 4KUCD 1LO4H 3VD5A 5IVXA 1E4WH 4JO4L 3QDJB 4NGHL 4P2CG 1I9JH 4PFEA 2CQVA 5MEPA 2QQLL 3T4AA 4XAWH 1HKLH 1YEGH 5GQBA 4MXQC 3HFML 4I0CC 4WWID 3B83A 1W72H 1J87A 3TN0C 5IESH 4OF0A 5DTFA 1IRAY 4PLJC 4M9OA 3FO2A 1QFPA 1HH9A 2BERA 3MJGX 4PYHA 3N06B 1HHJA 3ZKXB 4LVHB 1GGUA 2B1AL 4TRPL 1DBKL 4I3SH 2NTFB 3BPCB 2R0ZL 3D3VB 4KV5F 2BHUA 4KKLC 3MFFB 3T0DA 4Z7NE 3SE4A 1RIUH 1OSZB 3Q0HA 3L7FB 1WZKA 3NCJL 3D9AH 4MVBC 3W39A 4GSDL 1FORL 1K4DA 2J3SA 4UQ3B 1SJEA 2W0PA 1MH5A 1TZHB 3C5ZA 3LEYH 4R96B 4ZAKB 2VERN 3FMGL 4PJCA 5CIPA 3GSVA 3DBXB 3A67L 1MNUH 2R29L 3T2OA 2A1WL 1T1ZA 1P4LA 4EI6B 3KPSD 3RZCD 3MRDA 1F90H 4F7TB 1X5GA 5F7DA 5I0ZA 4P2RA 1H5BB 1ZHLB 2BVOB 2AXGA 2OQJB 2V9QA 2AJ3B 1MCPL 2ORBH 5KW9H 4NC0B 2Z4QA 3SDXB 1NKOA 5TDPB 2V6HA 4J3VA 4YGAB 2XYCA 3GSNL 2GT9A 5E9DA 8FABA 1YNTA 5EBLB 1FYTA 1WFUA 4HBCL 4JM4H 5TE7H 5I18L 1QKZH 4I9WE 1HN1A 3HAEA 2CMRH 2HLFD 2P8MB 3X11B 4IMKC 3RWEB 4HIHB 3TNMB 4M6AA 3BISA 4GG6E 1CU4H 3ZL4L 1GGIH 1JPSH 5JHDB 4JANB 3CDCA 2DQIH 3QUML 3S97C 1ORSA 4YZFF 1J1XH 1DLHB 3ECBB 4XXDB 1NFDB 3GMQB 5IB4B 1QBMH 1G1YA 5A16A 4L9DA 1V3LA 4QYOB 3SDDB 5DURD 3SE8H 1RK0B 3SKOB 4N5EC 1C08A 1YEIH 3ILPB 3KLAA 3QEHA 3TC9A 3AB0C 4QXWA 3WDHA 2J4WL 4ZYKA 4FA8A 2YPLB 4I5BA 5DVLA 5IB3A 5CZXC 4JKMA 2O61B 2CRIA 1S7RA 3MMEA 4Q9BA 1KTDB 3P4OA 4JFQA 4XX1E 1S7WB 1YUHB 1IBGL 3WS3A 3HMXH 5DJZB 3GSOA 2VDRH 2M8XA 3QG7L 5EU4A 2GJZA 3NPSB 3O9WD 4PJBA 3KLHD 3VDCA 3RZCC 3RWCB 5C0BE 1T5WB 2Q8BL 2VXTH 4TTGA 4YDIH 2WNGA 3OR6B 4LKCA 4X4XB 3HE7A 4QRPB 3BRFA 2BY2A 3WN5C 4NN5B 4P2OB 2R56H 1WBXB 5T1LB 5IG7B 2UZIH 4QF1A 3T0XA 4ONHB 3MA9L 3PHOA 1HILB 5F9WB 2HKHH 1X5YA 4G6JL 4JJ5A 2ZUVA 2HLFC 2K9UA 4YHLH 5D7LE 2J6EL 4LCCC 3TO4D 3SGDH 5L88L 2IF7A 3WXVL 4JLRB 4QOKD 4PJDB 5EBWB 5DI8B 3JWOC 4JO3H 4ZFFA 1KIRB 1X5ZA 2QQQA 2FWOA 3O8XA 1HKFA 1JRHL 1WWBX 3F6LA 4KVCH 2X05A 3PHQA 3WFHA 4C83B 1HYSD 4MNHB 4TULH 4N0UB 4PJ9D 4DFHA 4OJFL 5DXWA 3FB6A 2DJ4A 2VUYA 4MA8L 3WUWG 3EOBB 4QTHA 4QXGH 2YD3A 1ZT4A 2RBLA 5B3JE 4I13B 5E4EB 4LSPH 3TLRA 2NQCA 4F8TA 1NANH 1NGYB 5E2VH 1P84K 3O3EB 3O6KH 3IRZA 3FQUB 1I8IB 3VFNA 3KLHC 4PJ7B 1XGPA 4YUEH 1KJ2B 3VA2C 2KBGA 1ZWIB 5EULV 4J3TA 5ELIA 2B4CH 2BSSA 4PJ5B 5ACZB 2LU4A 4RGMB 2I24N 5FUZL 2VDLL 3JV0A 2F58L 4OZIB 1PSKL 5IW3A 2IFFH 1SJHB 1PKQE 3NGBC 4QRUA 1OTTC 4MB5A 3RWHA 4HWEH 3BDXA 3BGFC 4X0KA 3TA3D 5MEND 3I50H 5DMIH 4KFZC 3BO8A 3RNQA 1MFCL 3PDOA 1NGZA 4HD9A 4Z8FL 1JHKL 3UBXI 1MCKA 3CD4A 3UJIL 3RIFF 3MCKA 1RUPL 4WO4D 3EYSH 2AK4D 4D8PA 5DGRA 1N4XL 1ZA6B 3KWWA 5I9QC 4UUJB 1WCBB 2JJSC 4HK0A 5ESAB 2JKXA 5J8OA 3ZE2E 2Z31A 1WAAF 2UWEF 4NM8L 4PJHB 2R1WB 1KEGL 4RA0C 3VFTA 4BSWB 2L0DA 3EOYG 5K59F 3GMRB 1K6QL 1RZKH 3QHFL 3ARQA 4ZUUB 4JB9L 4D3CH 1HYSC 4PJ9C 3C6LB 2NW2A 1LNUB 3TBVA 4KMLB 2IAMD 1DN2A 1N5AA 2FO4B 2GKIA 3NN8B 3O3UN 4QHLA 3GSUB 3FQNB 4KTEL 1YZZA 1S7UA 1U2CA 3QDGA 3DUSB 2UWEB 5C0CD 3RUGA 1A5FL 4WI2A 4Y0GA 5E2UH 5JOPE 1R5IA 1QFUH 4YHZH 2I25N 1BBJA 5CZVL 4G7VH 3OJMB 1BQHG 1L9NA 1UXSB 3D39E 3T77B 3FKUS 3WIFA 2OTUA 2SEBA 3U7YH 1XGYL 1WEJH 4XMLH 3KPRD 1VGKB 2A0LD 4PJEF 2JK5A 3C5JB 4HMDA 5JNYB 2X4OA 4YDVA 3DOSA 1FSKB 1L6ZA 1PW3A 2BNQB 3AREB 4H8WL 1AO7A 3BPOC 4JKLA 3TA3C 1NL0L 1ZHNA 2XKSA 2OR7A 4Z5RA 2DBLH 3KXFE 4Y4KB 1DBAH 4OCLC 4JFYA 4R97C 3W9DB 1YC8A 4X5WA 2IALA 1UH4A 1ZA3B 2R23B 4WO4C 3WIIH 1BBDH 3H9SA 1LO0L 4X6DF 5TE4H 3B4NA 4NQEE 3VE0B 1JMZA 5EO1B 2JLLA 4UB0L 4EIZC 2C7UB 5DUBB 4FZEL 5D2LF 3WL9A 1KYOK 1VPOH 4XBGB 3TVMC 3QIBA 3P73B 4C56E 1IQWL 3F7RA 2ZCHL 5JDSA 4B0MM 2YD2A 5EBMB 3RAJH 2GI7A 4HEPG 2IAMC 3U48A 3FJTA 1KB9K 4P59H 3QUKB 5DJ6B 3GNML 1A7OL 4OLEA 1C5CL 5JR1H 5CP7A 3QI9D 5LGHH 3IDJB 3HI6H 1I1YB 4HJ0D 5A1AA 4LEXL 3BESR 3DMMC 1INQA 3BPNC 2IANE 4CAGA 4PRDA 4KROB 4UDUB 7FABL 3L5HA 1YC7A 5ICZA 1GGCH 1GL4B 4PRNA 3O2WH 5I6XB 2A0LC 1JE6A 3QSKB 5HI5C 4N0YH 3L1OL 1EAPA 3HTLX 3MRJB 1K2DA 3S4SG 1D5BA 1II4E 1T03L 2ENSA 3KNBA 4OGYH 4OF8A 2UVEA 5ADOL 3O41A 4P9MH 4WHTB 1AE6H 3WD5H 4U1KB 5ALCH 2X4PA 5DUPL 3G5ZA 2H26B 4MMZC 3MRBA 4HCRL 3FT2A 5MEQB 1IGCL 4RMWA 1RK1A 2VLRB 1VGEH 3KHQA 3ARFB 2EIDA 3L95A 5GGUB 4I3RL 1IAOB 3VFSA 1MF2H 5HHPA 3QJHB 4OLXH 5E6ID 4Z77B 5DK0B 4PRHB 5C0FB 1AHWB 3ZDXF 1J0ZA 4UT6H 3MRGA 5T1KA 1DSFH 1LDSA 1KT2B 2HFGH 4JY4A 5T3ZL 5GZND 4CVXB 1MI5B 4NT6A 4R7DB 4JGUA 1SHMA 4JPWH 4X80H 4JRYA 5JHLH 2EH7H 5I1GL 1ZHKA 5HY9B 2ESVD 4B53A 3QI9C 2PYFB 4TUOB 5TF1H 3DNKA 1JYNA 3ZE0E 4HJ0C 1T0MB 3EOTH 3O2DL 4YR6A 5JOFB 1BZ7B 3AXLA 1Y18B 3PWJB 4HWNA 1UM4H 1AQKL 4S1RH 3V0AC 3B9KA 3E6FB 2EDFA 4AY0A 3H7BA 4QXTA 3UTQB 5JXED 2VDNL 2Q7YB 4TUKH 1I7UB 4WEMB 4Z78B 2MQCA 5FO9B 5FYKD 3VMNA 2PNDA 4IS6A 1NQBA 2C4XA 4RGNC 2FIRT 4L8SB 5MHSD 4DQOL 2FH6A 1MRFH 4NBYB 4RQQA 1LEKA 1VA9A 1W0YT 4HFUL 3FOLA 1XEDA 4JGMA 5F93C 3UTSD 5EUKA 3GBNH 5EFIA 3D0LA 1EERB 5FUOL 3SDAB 4NBXB 4H5SA 3ULUE 4L4TA 3NZHH 3QQ9C 5HGHA 1FH5L 3GIVB 4UT7L 4KAQL 3F8UB 5EU5B 1CN4A 5K9OB 3V9FA 2MSPA 2C4FU 3BPLC 2ZUQC 5E6IC 1I1AA 2YD4A 2JCCA 4XP9H 4P3CL 3CFBA 4LRIC 3AS2A 2HT2C 5F7MC 3RL2B 4GAJH 2FHBA 4JFEB 4R7NB 1BF8A 3B6SB 2I9LB 1FFOB 3RWGB 5T5NF 4NFBA 2IPUK 4JO2L 4HGWA 4OKDA 3QRGL 3MLPA 1I85C 5C08A 4DKAA 1NLDL 3CVHB 4NZTH 1S9XA 3QG6A 1H9VA 3MUZ1 1UCBH 3U79A 1UC6A 4NZUL 1N6VA 1LEGB 1U8MB 5F7KC 2EDRA 3S3JA 4S0SD 4X4ME 3O81A 4LCIH 3SHSA 1AI1L 1DDHB 2X40A 1JJUA 1VKXB 2V7NA 4GT7A 2OCFD 4N1HB 4PJIB 3GB7A 1P9MC 2YWZA 4ZUSB 5EZIH 5JXEC 1CD1B 4M7LH 4YGVA 1RVFH 2ZJSH 4J7RA 3RWDA 2PXYD 4K3JL 3OKEB 2J8UA 4A6YA 4HX1B 2YBRA 3KPQA 4XPFL 1HIMH 2XKNA 3VCLA 5CEZH 4K3EH 3CSGA 4OM1L 4X98B 5HPMB 4O2FA 1QYGH 4LP4A 4DCQA 3CXHJ 1CXFA 2QLVB 3SOBH 4XHJC 3EJZC 3P4LA 2R39A 3U30B 5DMJB 5GGSB 4OUOA 1HHIA 2OK0H 1DQQB 2QKIA 3SO3C 2R4RH 1M71A 4KJWD 4E5XB 4DVBB 2IH3B 1QVOB 2CIKA 3BIKA 5ISZB 4HIEA 4D9QE 2XN9E 4PGEB 5B39G 1F8TL 3K74B 4X8JB 3UTZA 3QBTB 4APQB 1CICA 1YMMB 1S7VB 1OAQH 2P44B 4JDZB 4XVUD 3P40A 3K0WA 3LPGA 4G7YL 1JNJA 3F12A 1G9MH 3OR7A 3I75B 4O9HH 5EU7C 4LDLB 3G5XA 4XVSL 1QO3A 4WWKC 4WGWB 2H9GA 3KPMB 4YO0B 1DFBL 1I3VA 5IVZB 1IT9L 3GJFH 4DW2H 4P2QD 4GS7C 2PYEA 3PF2A 4HWBH 1KLGB 5KAQF 5HHQA 5DZLA 3X13B 3MV01 4YBLC 2DB8A 1OW0A 4K55A 4W4NA 3FRUB 4YQXL 3CXDL 5CMAB 5D93C 1OARL 3PQYD 4WV1C 2CR3A 2HKFH 3FN9A 3QISA 2CJUL 4ETQA 3AS0A 3F7YB 2HFEB 2R4SL 3DRTA 5FV2A 5FF6A 2PXYC 1CLCA 5JZ7C 2VYRE 4LASH 3NACH 1J5OH 2MCPH 3MLTB 1P1ZB 1U8KB 1BVLA 2I27N 3IF1B 4HDIB 2C1PB 3VD9A 1ZVHA 3L3DB 4M3JA 4OLYH 5EPMA 5IR1B 5F88B 3H9HB 4ZPVA 4U6YB 2WANA 4LLVA 4LHUG 4RGOH 3KVQA 4LU5L 3S88L 4U1MB 1BLNA 2UY6A 1AJ7H 4KZDH 4K7FB 2ZKHL 4FTVB 3GSQA 2CO7B 3P9MA 4RDQG 2HFFB 1XT5A 3MRMB 4M8QA 3BSZL 1MFDL 4PGBB 4GKSA 1CD9B 1MJUH 35C8L 4WI7A 4UV4H 1KNOA 5E2WL 1HWHB 4QHMA 4YPJA 2NY5C 1NUDA 4XVUC 2VQUA 3I85A 4MNGE 1CF8L 4N9GB 3KG5A 6CGTA 5JQ6H 2W60B 3DSNA 2AV7B 4ODUB 3W0WD 5HXMA 1EBAA 1IGTB 5EOQH 1Z0MA 3L3KB 3MC0A 1JN6A 1T3FA 2YN5A 3TN0B 1IEBA 3C5SA 5JORB 4YPGA 2WUBL 3IAQA 4MX7B 1OAKL 3BZFB 3EJJX 3QA3A 1I7TA 4J4PD 4MJID 3V7AE 5F9JB 1CK0L 3L9RA 5GIRB 3D18A 3O45B 1XF5B 3L5WB 5DK2B 3N1PC 3E2HC 3C2AL 4FQLH 4KDTC 5D7IE 4J8RA 3G5VA 1M7IA 4QGTA 2NLJA 4MA7H 4OLZH 1XIWC 3G6AB 4JHAL 3TP4A 2GSGA 1RZFL 1BD2D 4WFHE 5SWSE 1PGRB 3GI8L 1WBZA 5GJSH 4WGVB 3VXSD 3MRIA 4PV8A 4F15C 1H0DA 4LQFH 5EZOH 1AH1A 4I2XA 4NWTH 1JGVH 3DYOA 2D7TH 5E03A 5C07E 2CKBB 3PWPE 3AAZB 5T33L 4P3DA 1X7QA 1I3GL 2ADGB 3MOBL 3EFDL 3OJDA 4KUCF 4NO5A 3GJFA 1LQSR 4NBZB 5CWSA 3UDWC 4NKIH 2BVPB 5BVPH 1SY6L 4M62H 3UO1L 1JHLH 3DUUA 5HHOD 4XH2A 2P8PB 3SGJA 4YAQB 4BQCA 5ETUA 2ATPB 2GJJA 3FTGB 2R2BB 1NJ9B 2E8ZA 1GPOH 1MCDA 1UQSA 3ILQD 4WEBL 3RWJA 1AKJA 2DTMH 1A9EA 3P9LB 4GW1A 1PX4A 4UTAL 2W92A 4JN2A 4ENED 3ARBB 4JG0L 3H3PL 3QFJE 2R0LL 1RFDL 3FOMB 3KYNB 4R4BB 3IFPB 3MSPA 5L2KA 3TPKA 4V2CB 5DMGC 5KS9A 4OZ4A 3DVGB 3LQAH 5EORH 5FEBA 1G7MB 2VXQL 5E5RB 4WENB 3RJDA 4ODBD 3WHE0 1IC5H 1HQ4B 2GJ6A 1QBLL 3V6BR 3AB0B 5ICYB 1BQSA 3ULVL 2W0KA 4BH7A 5L2JB 4P99A 3K4AA 3ALXA 4KZEH 2HJLB 5C6TH 2VUOA 4X6CE 15C8L 5T5FL 4S1QL 3OHXA 1QLRB 4EUPA 2ARWA 5EZJA 1B3JA 4FQJH 4TVPH 4AEEA 4KI1A 3Q48A 2DQHH 3UJTH 1E4KA 3RY6C 1T1WB 1HHGA 1CG9B 4P23D 4FQCL 3RZCB 3MXWH 4AEIH 2ICEA 1OGAA 1KLFA 3CDGB 4RZCA 2NW3B 4WNQA 5A43C 4XNMA 4O5LL 4P5KA 3SGKA 1KG0A 5E00A 4D0DB 4E41B 2UZXB 2NY0D 1HCVA 3QIUB 5C09D 3U7AA 3L5JA 3F7VA 4GQ9H 1H8NA 2GY5A 5I8CA 3TEUA 4YFLI 5IB5A 4JKKA 2ZSWB 3QH3B 1FBIL 4PV9A 3MV7B 1U6AH 3VGFA 3G6JE 4NWUH 3U6RA 1L4IA 3TBTB 4G43A 1QNZH 3ZHLA 2X1QA 2J8HA 2DLIA 1MIML 3MNZB 3SKNB 3V6FA 3LS5L 4LCCB 3P30L 5D72L 1TQBC 2YSSB 5DRXB 4KMTL 1IAKB 2AJSH 2VL5B 4BKLB 2VLJA 1FL3A 4NKMA 2X4RB 4ZOCA 5LJYH 4JFDD 3L6FB 4OD2A 1IC4L 1QFWH 3ARWA 3DURA 3GDBA 5KSVB 5JW3L 2DI8A 3FQTA 3BD4A 1OCWL 3CFEA 1KCVL 1FVCB 4EI5A 1U3HD 4MJ6A 4DUVA 2EDNA 2VLKD 1Z3GH 4WRLA 5SWQB 1VEOA 3NAAL 3QWQB 4OV5B 1KCUH 4NQDE 3QQ4A 2BFVH 4LGPB 3RDTA 2DMKA 4NO0B 3OGOE 4M1CD 2R1XB 2FEEI 5D8JL 1CE6A 3LSOB 3UEZA 1VFOA 4P23C 4DN4L 5FECA 5CCKH 4XCNB 3LKQB 2E9WA 3VFRA 5DEFA 4UU9A 1MVUA 1Z5LA 3MUY1 3FO9A 1X6NA 2VH5L 3WYRA 5I8EA 2NY0C 3W2DL 3MYJB 3ZO0A 2NY5L 3BGFB 4K9EC 1FIGH 3S36L 4I77L 3V6ZB 1NUFA 4UIMA 2DQDL 3GUTA 5I2IA 4L4VB 4OZGE 1PLGL 4HFWA 5IB1B 3NMEA 4HWUA 1ERNA 3FQXA 3N85H 2Z92B 3I9GL 5I9QB 2Q8AL 1PBYA 2HH0L 4FG6D 1N3NA 5B38A 1P7KA 1UH3A 4HBQA 5TJWK 2C3WA 2IBZX 4F2MB 1QSFA 3OKDA 3N50A 4GKNA 2A6DA 3VD7A 3WFEH 1BQHB 1CGTA 1YJDL 5IIEA 2ADJA 2AKRB 4PTTA 4PJ9B 4LLAA 3CC5A 4I18C 2G75A 3GI9H 3M8OH 4LPTA 5ECJE 3B43A 5A2LH 1T20B 2WQ8A 1GJIA 2FGWH 5I1LA 5LBSL 3QULB 4QRTA 1B0RA 3U7WL 1QSVA 4WU5B 4FQQB 4NQSA 5F7UA 3T3MF 2XQYG 4ODXA 4M1CC 2ARJQ 1SMAA 3V0VB 1WBYA 5L6YH 4DZBB 1KXQE 4YHIB 3CUPA 1HSAB 4OFIA 1OAUL 4O4YH 3LRHA 1L7IL 1Q9WB 1JZ8A 4HLJA 4Q9RH 1M6OB 3PWVA 1T83A 2VZUA 3VI3F 2VIRA 1I1FA 3BPOB 3GBLA 2BJML 3TA3B 3TH2T 4Y4HA 5EZLA 4JGJA 3SE4C 3GRWH 4R97B 1A3RL 4L8CB 1A1NB 2VXSH 3PNWA 2BSTA 2DM4A 1R24B 3DV6A 3TBWB 5C1MB 4KRMB 3KPLA 1ORQB 3C5ZC 1KOAA 4FG6C 4B5EA 3QWOA 4JKPH 4RFNC 4G6FD 4U1SA 3RIFK 3MRRA 1XGTA 4FFVD 1ETZB 1Q9OB 2ZCKL 4EBQL 1KENH 1XGQB 1JPFB 3P0VL 3QIWD 4AENB 2H2SD 3DRQA 4AT6B 1KB5L 5D71H 1ZGLA 3B8SA 3U82B 3KYMB 3TVMB 3K8KA 5HI4D 4G9FA 4OM0L 4TSCH 4AEFA 3SBWA 2IAMB 3IXAA 4FQ1H 1HEZB 2FDBP 4UILL 1P2CA 4JQIL 3TO2B 1BIIA 3WFDH 5IMOB 4XVTL 4P5TA 2AJUL 4S0TD 2AABL 2DQCH 3RA7H 4WUUD 2OZ4A 2V5YA 2XI9A 3DMMB 5JA8B 4MQXC 4OCXH 3BPNB 5LGJB 2C3HA 5EUOA 4YHOL 4Y5VA 1T80A 4GW5B 1A2YA 2W9LA 5D7LA 1FL6B 4WTXA 3GMMB 2EEBA 3MJ8A 1IQDB 1JMXA 1FE8L 4FXGA 4NNYB 2R2EB 3A6CL 5FA4A 2F54E 1MCLA 3GKWL 1MPAL 3X3FL 1U8JB 4RWYL 1ZVYA 5ABDE 1WZMA 3HHRB 3O6FA 3MLWL 4KKNA 2HTKD 3TIDA 4XPAL 2NY6C 2E9JA 4ZTPL 1EMTH 2LU3A 3I6KB 3LN4B 5D2NE 2HJKB 1T7ZA 3E8UL 1A6AB 2YUWA 1T6VN 3BH8A 3CFCL 1NCDH 5J6GB 3IDNB 5KVGH 2YRLA 5IQ9B 1C12B 1FDLH 2ZOKB 1H15B 1RZIB 4Y4FD 4PREB 4M6ML 4FFVC 4Z7VF 2VDML 3DROA 2HA1A 3O3AB 3QIWC 3MROA 1BVKA 4NN6C 2H2SC 5AUMB 2DYPB 1I9EA 3HA0A 3SJVE 4TYUA 2Y4SA 4QKXB 1MCIA 5HI4C 3D2UA 3GSRA 2Y6SD 5FYJD 3HE7C 5DA0B 5DD6A 3BEVA 1EAJA 3GMOB 1OM3H 1T66D 4LVEA 2HN7A 1FVDA 1LDPL 1FNLA 1ACYL 1RZGB 1DEDA 4J12A 3QI9B 1OOAA 4PS4H 4MWFA 5HVHC 4TVPE 5JPMB 3ALPA 1DP0A 4TPRH 2Q6WB 1T4KB 4FN0A 5CAYB 1IEHA 2VDQH 3OF6A 4KUZH 1F6FB 1RJYB 4HH9B 3KHOA 1WC7A 4MD4B 1OTUD 5GISH 4M02A 3OKNA 3MRCB 1TDQA 4OV6F 1S7SB 2DQTL 4EQ2A 3HLAB 1C5DA 2COQA 3O8XC 3VXRA 1JPTL 2KZ1B 3C2SA 3AS3A 4RGNB 1ODAA 4DOHE 4GMTH 4F7EA 1MCOH 1YQVL 1J18A 2NX5A 3O3BA 5EC2B 5M95B 4MAYA 3EOAB 5E56A 4YXKL 3D25A 1JF1A 1DANT 2DM7A 4YXHL 4F7PB 3TNNB 5DRZB 2EKSA 5C0GB 4M61B 3GM8A 3GK8L 4J1UB 3UZQA 4Y4FC 3WKNA 3BPLB 4ELKA 3BP7A 43C9B 2ZUQB 5E6IB 5IMKA 2BP3A 5DLML 3BP4B 1MWAA 4XC1L 5DEZA 2ED7A 4TSBL 5F1IA 3V2AR 1D5MA 4P49A 1J8HB 5INDA 3R06A 4V1DD 4QT5A 4U3HA 4X9FA 5H2BA 2NY1C 3D39A 3MRPA 2MNUA 2FHFA 5K9JL 4L3CA 5IGXH 2Y6SC 1TJGL 2EC8A 1NSNH 1ZTXL 4HZLA 3FN0H 3Q1SH 3WNNA 4Z7UF 1T66C 1IC7H 3PGCA 4NRYB 1AO7D 1GSMA 3ARZA 2ESVB 2QHRH 3NCYP 1FZJB 4OI8A 2DIAA 4BZ2H 5ID0B 3JUZA 3VG9C 4LLQA 4QY8B 3QB7C 3QYCA 3BKYL 2A9NL 2VZVA 1T04A 1TTUA 1H3UA 4F57L 1F4YL 2YK1H 3BWUC 4NQEA 4NJ9H 3VXQA 3QUYD 2Z31C 1JGLL 4QRRE 4IRJD 5JIPA 3FFCA 2I9TA 3G08B 1QA9B 4OUUB 2EO1A 4O2CA 1FGVH 4NUJB 4XI5D 5DHYB 3QIBD 4O00A 3RJQB 1Q0XL 4V2BA 4H20L 3UTSB 1CWVA 1P7QD 3Q2CA 1V7ML 4HXAH 4LCWA 1I8KB 4DGVH 3LVEA 4S11A 3DX7A 4MNQB 1QSEB 4MD0A 3QR2A 3WFCL 5HVWA 1NEZB 4HS3A 3SO3B 5AYUL 2GY7B 2WINA 3MOAL 4RRPA 4XPHH 3O3DB 2XRAL 3K8LA 4O02L 6FABL 4YEFA 4Z7OF 5CGMA 4ZO7A 2IANA 4OTXH 3QCUL 1JFQH 1QQDB 4Y8AA 4WWKB 1PZ5B 1IZJA 4DZ8A 5LWYL 2MOVA 2FJFB 1QLEL 4KHXH 1JNLH 3DXAD 4TTDD 1KTRL 2QQNH 3IU4H 5J1AA 4GS7B 3VXOA 4F3FA 4PGDB 1Z9SA 2CRYA 2VR4A 5E5UB 4YBLB 1JTPA 2WK2A 1YNKL 3V8OA 4RFEB 4LFHD 4MQSB 3NFSH 1KJMB 1HDMB 4UNUA 2KH2B 5DZOA 2DLTA 1KBGH 1NBZB 2JTDA 2NTSP 1Z9OA 3SN6N 2ATKA 2A6JB 1LP9B 4WV1B 3KDMA 4YDKH 4X8XA 3GBMH 1KTLA 3D85A 3F7PC 3HC3H 4X6FB 2JIXA 2PXYB 3IETA 4H25A 1NDMA 1RJZB 3NVQA 3MLZH 5E5MA 5C0EB 2FECL 3LB6D 4QRQA 5T1KD 3TT3L 4CW1A 5F7LB 5ERWA 3FQRA 4PJ8D 3QNZA 4XI5C 1A6UL 2NMSA 4M5ZH 3QIBC 4HUXB 5F7YC 3ARGD 4X6EA 1MHHA 4PRIB 4UOW1 3QDJE