3HZKA

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKSIAVKWKIDGSERQNGVLNSWTDQDKKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkA01
3LZFH 3CFEA 4OM1H 4Z77B 4UOJA 3QUMB 4X8JB 4RZCB 1CICC 4Q9QL 1CK0L 2YBRB 4Q9CA 1NCWH 4ZAKD 4LHUB 3TESA 2HJFA 4R97C 4C58B 5I73B 2FR4A 5JORA 4P3DB 3B3IA 4PP1D 4NQSB 4YPJA 4QRTA 5A2FA 4ODVH 1IKFH 4M9PA 5CILL 2XOTA 5E2TL 1ZK9A 4M1DH 5E8DL 2E3VA 2H26B 5J8OA 1VGKB 1BM3L 4HGWB 1NANI 1WZ1H 1CL7I 1OSPL 3BOVA 5FOJA 3QCVL 4MJ5B 3UTQB 3ZKSD 3RIAF 3GMOB 3QIUA 2I5YL 2XPGB 1AGBB 3K2UH 3QEQE 2PW2B 1I7UA 1QSZA 1I4FA 2HYMA 3RZCB 3VGAB 1A6VL 1YPZA 3JTTB 1RHHB 3G6JE 2QQLH 3DTXA 3MSPA 4EEEA 4CVXA 4QXUH 3MACH 1UXSB 3DX6A 3RWIB 5GGRY 2ZWLT 1J86A 1QHPA 1TLKA 1MHPL 2K9UA 4H1LG 1RIHL 2OTWA 4M1DL 2IJ0C 5CKGA 3CC5B 4MNGB 5EU6A 4UTAL 1A7OH 4R26H 4BZ1L 5IT2H 2V5SA 1I3RB 1KPRB 1R3KA 4XCFH 5JIIA 1NMCB 4P2QD 1MFCL 1A6VH 4AH2B 2I60L 2E7LC 1KG0A 4L8DB 3PDOA 3SBWA 4KV5E 4CRPA 3BZEB 1OAYL 1CLYL 1RK0A 5C07D 4HGMA 5JPMA 1YY8B 5IVXE 3TV3L 3IETA 3FAXA 3BZ4A 3V6BR 3UTSB 5FECA 5L2JA 1SMOA 1MH5B 1XH3A 1YPZB 3JTTA 1PYWB 4RMVA 1A7OL 4R26L 4S1QL 4CVXB 4DUWA 3IFLL 1CE6A 4EIZC 3RA7H 5D72L 5F93C 2B2XH 3ZSTA 2KQNA 1A02N 1OT2A 3T0EB 2BVUA 3U30B 1TTUA 4Y16A 3S3SA 1NMBH 1F45A 3HR6A 5GS0L 4HGWA 3WSQH 4AJ0A 4U05A 3C60C 4U33A 3KPSB 4PV9B 4EUPH 2P8MA 1FRGH 1RUQL 4OF3A 1MVFA 2DTML 3HUJF 2AGJH 3N1FC 3O45A 2F53B 1LNUA 1N7MH 4YHIA 1T5XA 3MRJB 5F7UA 1Z6JT 1U8NA 3RWIA 3X3GH 1EIBA 1LO5A 1RJCA 3C09C 3EBAA 4E9LA 5DS8B 1DUZA 1G7LA 4CW1B 4Q9BA 4S1DC 4XVSH 3U7WL 1C12B 5EOQL 4JFFB 1V7NH 2D31A 3ZTJH 1OARL 4HJ0D 1MHCB 1T0PB 1SEBB 1M6OB 2AKRA 1H3TA 2H9GA 1A7QL 5EZIL 4L8BB 1R0AH 1PG7X 2DQHL 4FQXA 3MXWL 1KB5H 2P43B 1RMFH 4B41A 1TENA 1KENL 1TPXC 1KELH 2EDDA 4WW2B 3ZE1F 1DCLA 4P9HC 4HCRH 5I18H 5EU5B 1MI5A 1BJ8A 2R56H 3FTGB 3U82B 1V7MH 2DQIH 3QNXB 2EDYA 1FDLL 4PJCB 3HNSH 1MHEA 4WUKH 1X9QA 5MEOA 4XPTL 1BD2E 5EZIH 1R0AL 1GZPA 2J4WL 4WJ5A 3V4UL 1T22B 4KGJA 5E1AA 12E8H 3L3JB 3ZE1E 3IFNH 5IIEA 1N2RA 3ILPB 5B3JE 3DVFA 1ZANH 3V5KA 4TVPL 2NLJB 1X4ZA 1C08A 4I9WD 3AUVA 4FQQB 3SKNB 1W0WA 2FYYA 2UZIL 4IIQB 5EG6C 1LO0L 4PUBH 4LSVL 2BMKB 4TYUA 1I7RB 4WI6A 2WBJA 2DYPA 1FC1A 5C6TH 3BXNB 5BO1H 3IFNL 4M7KH 4X6DF 4GAGL 3UTZA 3VWKD 5ICXA 4M1GL 2J8UB 3JUZA 5TGBB 2X89A 4ENED 1RIVL 4G9FA 1HSAA 1QTYT 3Q6GL 4FQLH 4Z7VA 2VDOH 1MCKA 5IBTL 4NJ9H 4TTDC 4MGXA 5DMGC 2BNRA 1OD9A 3H3PL 5KG9A 2DQCH 1G7HB 5FA3B 5AD0A 2AAVA 2VL5A 1EEZA 4DGYL 4EN3C 1W0VB 4HWEH 4GAGH 4NN5B 3O2DH 1RD6A 2BERA 3AS0A 4OCYH 1U58B 2JELH 2SEBA 4MJIB 2CLRB 3ULSA 3VXUD 2P42B 4HWZB 1R5WB 2HMID 1JCKA 1A22B 4KJYA 3OBAA 5AZ2H 3DGGB 4UINH 4Y5YB 3T3PE 2MJWA 2EECA 1UYWL 2W0PA 3HE6A 1E6OL 1JNNH 3VMPA 1MCBA 3O2WH 4ZDHB 3GMLB 3U0PA 3C2AL 3DX9A 1Q9WA 4FFVC 4M6NH 4WEUD 5CZVH 2FDBP 5EBLA 4A6YL 1RK1A 2X70A 5DMKA 2V9QA 4ZDHA 3U0PB 5KAQF 3RVUD 5J11C 2HKFH 3MLTA 1F4HA 3F58H 3HKFA 4R0LC 4ZXBD 1MJUL 2W9EL 4OCWL 1T89A 4RZCA 2V2TB 1DFBL 3O8XC 2Z8RA 5GS1A 3QXTA 5HPMA 4HK3N 1JNNL 3HMXA 5ECJE 1JMZA 5DQDH 5I1DA 4XVTH 1SVZA 5FGCE 3AAZA 4PGBB 4ZQKA 3QXDA 1TQCB 5EORH 5BZWB 3PGDA 2YXMA 1F6AA 1MIEH 3BT2H 4GQ9H 5MENB 2P24B 5DJAB 5B8CB 2A1WH 2OCFD 3KYOA 1G7HA 3HI1A 2BNRE 1T20B 2DRUA 4PBXA 1JZ5A 3LQZA 2CPCA 1MCEA 1G0YR 4XVJL 5BS0E 5EA0L 1QLRB 4PG2C 3UTOA 5T3ZD 1U93B 1N0XH 2ADIB 4Z6AT 4PJ9B 1QRND 2B1HH 4CNIA 1FQ9C 3WNOA 3KPPB 3PWNB 5JW4N 4U1NB 1L6ZA 1UWEL 4LMQI 3JV6B 4RWYL 5HJ3A 1K3IA 3X12B 1WAAE 5FDYA 3EO9L 3WFHA 3MV9D 5GISL 4EKXA 5HXMA 4HKXB 1ED3A 1VB9A 3BN9C 3NVQA 5ADPL 4HG4K 3NIGE 2MCPH 2O5YH 1MNUL 3GFUA 2XA8H 4X0KB 4HBCH 1N6QL 3U7YH 1R3LA 2UWEA 1N5AA 5LJYH 1A2YB 2VSDA 1GZPB 3QDMD 4H26B 1JGDB 5E8NB 3BKYL 5DUPL 3GSQB 4JRXE 4MDJA 5TQ2H 1OP5K 4BELD 1LO4L 3KPPA 4H5SA 4LARH 4YXKL 3G6JB 3S5LG 5T3ZL 1J8HD 1T1ZA 1Q9LA 1MNUH 3AVEA 1TETH 3MFGB 3O4OC 3EOAA 2J1KA 4UZGA 5TE6L 3GSWB 5C0CD 4XPAH 1BZ7B 2R4RH 3FO9B 4AIXA 3W2DH 1Y18A 3ULVL 5F9JA 5AUMB 1JPFB 1TJIL 3OZ9H 5JIPA 4HFUH 4OFKA 5E00A 3V4PL 3LEXA 3QFJB 1OAZL 5HHOB 2FX9H 3VFWB 1HSBA 1NC4A 4LK4A 1Q9KB 4DW2H 1S7RB 2NZIA 4K94L 4LU5H 4X4MA 4LSDA 1UA6H 3KNBB 1FYTE 5I1IH 3GIZH 5FO7A 3VWJA 1I8IA 4QEGA 1FH5H 4LKXA 2VRAA 3QG6A 4EXKA 1FL6A 2JCCF 2GITB 1ZXQA 4IMLA 2RAMA 4G5ZL 2CLVB 2QSQA 4N8PA 1JNLL 4WHCA 1JWMA 1XGQA 3DI2B 5DMIH 1BIIB 4IJ3B 5C0BE 1RZFL 4C56A 1UJ3C 2X4RA 3LQAH 3RHWF 5I1IL 1D7FA 1PG7W 1QACA 4UU9A 3S96B 2HFEB 3UMTA 5GS0C 3WXWH 5AYUH 4LSUH 4WWID 1FG2B 1AGCA 2FCBA 1SYSA 3ZDZE 3QULB 1XF3A 4X5LA 3VI3F 1XMWA 3VRIA 1T21A 3BEWB 3QIWA 4NM8H 1A6PA 3GI8H 4L3CA 4NQDE 3QYCA 4PRAB 1Q0XL 3Q5YA 4XP4L 4JAMA 3VXMD 5DD1L 5C0JA 2OL3B 2IANA 3H6JA 4APQB 4G6JH 4MNGE 3OR7A 4U1SB 1AGBA 2DTMH 4HUXB 4PJDB 1IT9H 3TN0B 2EYRB 4DTGH 2A38A 4IBLT 1KLFA 4NSKB 1VGEL 2FYYB 2ZKHH 5ALCH 5JW4R 5F88A 2CIKB 1H0DB 5J3HC 5MHSD 3CFKB 4JFDE 2JIXD 2ZP0T 3G5ZB 1AHWC 1ZKAA 3E1F1 4MZ3A 1QFUL 1OTSD 5CMAB 1YEEL 1CT8A 5T3XL 3ARTA 1YPZE 1J12A 4PGDB 1SYSB 3RY5A 3OKDA 2NY0C 4JFFE 3VWKC 5FHBH 3C60B 3DTXB 3K81A 4QTHA 3G5VA 1M7DA 5KANG 1XF4B 3MYJB 2P8LB 1C8PA 1XCTA 4TPRL 5C86A 2O5ZH 32C2B 1XGUB 2AK4D 3MRFB 1XF1A 4X6BB 5KSAB 2QQLL 5DSCB 4IMKA 4EUPG 1MRCL 1SYVB 1RULH 4FG6C 2IGFH 5DFVD 3D5OF 1EAPA 3VRLE 3UYRL 1T7ZA 3TN0A 3SCMC 1UZ6F 1INQA 1H3PH 4P99A 2ESVA 4BA8A 1LE5B 4UV7H 1C7SA 5C0EA 2BJML 3PWPB 1P4IH 4K7FA 3HA0A 1NBZA 1OHQA 4BM7A 3ULUE 4G8FB 3RDTC 1Q72H 1MCCA 3WHE0 1AGFA 2AERT 4XNZC 2E7CA 1ES0B 1WFUA 5E6IC 3LN5B 1CGWA 5DC9B 1CCZA 3VFTB 1WITA 3O41A 3SDAA 3UTPD 5EUOA 3HZKB 2ILLA 3ZHKA 5DVMA 2ADJA 1MWAB 5HI5D 3QFJD 5HHOD 1QRNE 3RWHA 2IH1A 1JPGA 4X98B 5IESL 4HF5L 3M8OL 4ODSH 2OSLB 4G8GB 4PJIA 2B2XL 1I75A 3GK8H 3K8MA 5JXED 4N1HB 1GHFH 4HDIA 1IGFH 1BGXH 2ITCA 2VXVH 3RZCC 3EOAB 4ODVL 5BW7A 1AR1C 3QEHA 2VLKD 5FV2A 5FO7B 5MEPB 2KL6A 2XZQL 3HI6L 3I85A 5FKAB 3VXME 4HLZH 3G5VB 3FB7A 5KVEH 1HH9B 3BKCH 2V2WB 1KCVH 3HC4H 1FVDB 4U31A 4ALAH 3WDJA 1A7RL 5HVGB 3MLPA 3MZGB 1G7MB 5IM7A 5I1AB 4WO4C 4Z5RB 4JHZA 2FJGB 2XACC 3BKJH 5SX5K 3P3YA 4ELMA 1R5VB 5HHVL 3S3PA 1Y6KR 3IDMA 2PYFA 4NC1C 4ZPTA 2CRMA 1PGRB 3SQOL 3VA2C 1T89C 3IFOB 4HK3J 3S4SG 2PYFB 1JWSA 1FE8L 1FFOA 2A6DB 3MV7E 3NAAH 4HX1A 3MBED 4JDVA 4N9OB 1AP2A 1T22A 2P8LA 4ZNEE 3JV6A 2D9CA 2EIZB 4APQC 5F89A 4X6BA 3BKJL 3O81A 1A1OA 2ZPKH 4U1GB 4Z7UB 15C8H 1ZA6A 2D2OA 5C0JB 1FNGA 2DN7A 1P7HL 2EIZA 3EHBC 5D1QB 1A5FH 1UQSB 3PNWB 4UBDD 1MCOH 2PF6A 4Z76B 1NEZA 4HGKC 4PJHA 3LRGA 5IB5A 5DD0L 3IRZA 3UBXB 5IK3A 2BNUA 3PIQA 4W68A 3DARA 3QDJA 3TWCL 5C0IB 2J88L 5D2LE 5ILTH 1FFRA 2R0KH 2GKIA 3QUXB 1IAII 1HHGB 4HIXL 15C8L 4RNRA 4YNYA 1J0ZA 3IXAB 3FFCD 1OPGL 3BVNA 2IANB 2XKSA 3VFPB 4YFLF 4YXLH 1I1AC 4RBPH 5J06A 4X8XA 3OWEA 4RMRA 3W5MA 5DJ0A 3W39A 4Z95H 1T7WA 2DLFH 3CFBA 4OSUL 2AQ3A 2DTSA 4JQVC 4ZS7H 1MRDH 1QG3A 4CU8A 2Z8VC 4PJEE 5EUKA 2NW2B 1FO0H 1HSBB 3C6LA 4LLWA 1LE5A 3MUGB 1IGTA 4XPGL 1UVQA 3QSKB 3B9DA 4BH7B 1M6OA 2NX5E 1CFQA 2AKRB 1IAIL 4WI8A 2CSPA 1C5CL 4FQLL 4Y4HA 5BRZA 2G9HB 2VQTA 2R0LL 4LLWB 2UVFA 4ZYKA 1RZJL 4MB4A 3H7LA 4NPYA 5HHME 1QA9B 1G7MA 3H3PH 1PVHA 4IRZL 2AABH 3BIKB 3IU3A 1NJ9B 2HVKB 3LV3A 4LLUB 1K4DB 1SM3H 3LHPL 3BWUC 3FCTB 1RMFL 3LEYH 4XCCL 4LKCA 2ERJB 4XRCB 1Q9OA 1RURL 4TSBL 4TRPH 1J0HA 4R7NA 1KTDA 3D87B 5F9WC 2OLDA 3S37X 1U8IB 3MLTB 4KUZL 2EDTA 4PJBA 5GGVH 4EDXA 2XXMB 4JKPL 3V5DB 4O2EA 5D1XB 2AABL 2ZJSH 3IB4A 2P7TA 4KKCC 3FRPA 4NGHL 4XMLH 1CU4L 3EOYG 1H8NA 3LD8C 1BFOB 3SEPA 3MTRA 3N1QC 4WHYG 5JOPE 1BD2D 3U4EB 3GHBH 3HZKA 3RU8H 3LPFA 5C09B 3ZL4H 3NIFF 1I1RA 3EJYD 4H0IA 3D2UB 5CZVL 1OM3L 5C7XL 2HH0H 4AIZA 5HI5C 4LAQL 1MEXH 4UAOB 4N8CH 2JLLA 2Q7YB 4JREC 2AEQH 5DJ2A 1X7QA 4E5XB 2VAAA 2HT2C 3LKQA 4GMTL 1YEGH 4LQFL 2WQRA 1VKXB 4U1JB 1T66D 2HJKA 4ONGL 1I7TB 5DMYA 4KPHH 4CU7A 5DQ9A 2Y6SC 3GMOA 3QIUB 4BFEA 3LH2H 4FXGB 3G5ZA 5EZOH 2HLAA 3CMGA 3PGCB 5B39G 2VZSA 1PEWA 3DWTA 4NQXB 3D18A 2QHRL 4FQIH 4Y5XB 2HLAB 2APVA 1DN2A 1GGCH 2IPTL 4JDTL 1ED3B 3C60A 4MAYA 5D1QD 5T3XD 3FB6A 1NANH 2Z31C 5CD3A 2EC8A 3CD4A 4OCSH 4BFGA 3EW3B 1NFDA 1WIUA 4C59B 1HOCB 2J3SA 1H8SA 4D8PB 1HZHL 3KPRE 3Q5TA 3VXUA 5L2KB 2BZDA 3FB6B 4KQ4L 3HPLB 3L95B 1AKJA 1WFNA 5E9DA 3TH2T 4JY6B 1KJMA 2XQYK 5KZCD 2QHRH 2YUXA 1F5WA 3CVHB 3BZEA 2J8UE 2GT9B 2EXYC 4Q58C 1KIQB 2HRPH 3HUJB 4J3XA 2OZ4A 4JPWH 4ORGA 2X2YA 4BFIB 3HC3H 4Y4KB 1XF2B 4YO0A 4HEME 3ARFB 3WNNA 3MJ8B 3O2VH 4UIKL 2NY5L 5ADPH 4KGLA 5B21A 3MRBB 3E6FB 3B2UC 3BJ91 1O7VA 3U9UB 4LCIL 4GRLB 4ONHA 1AR2A 4GKZA 4PP2B 5DRWA 3GSUB 2VMFA 1TQCC 3OL2A 1UJ3B 2VSCA 2QSCL 2B0SL 1G7IB 1JF5A 4M02A 2WANA 2P8MB 1JI1A 1FP5A 4POUB 3BGMB 1CZ8L 4CU6A 1DBBH 3D48R 3ARZA 5D2NC 1T0NB 1L6XA 4O00A 1DTUA 4YC2B 4O2FB 2GSGB 3MO1B 1PQZA 5JW3L 4J6RL 1H8OA 3BGMA 1WT5C 2D3VA 3TYFA 4KI5D 1D6EB 5IGXH 1VHPA 2NXZD 4LPYA 3MRQB 4Q9QH 2A1WL 3V4VH 4IDJL 2BRRL 3EYQC 4XWGL 2B0SH 2JK5B 3KPLB 2KH2B 5EC1A 2I9LB 1NCAL 4IRSD 1Q9OB 5DHYA 4F57L 1A6TB 1II4E 1YN6A 3LB6D 3LKNA 5GGQH 5B4MD 1DBJH 4YE4H 4GRLA 4YHPA 4LVHC 1XEDA 1JGEB 1N0XL 1MOEA 1NBZB 2Y06H 4R96B 1P7QA 4NJAL 4WU7B 2VO5A 3U30C 4CMMB 2XTJE 2VXQL 5T3ZE 1LD9B 2VUYA 5FHAL 1HILA 3FFDB 4X4XA 4L4TA 5K33A 1LK3L 4FTVB 3PDOB 3GEWB 4D9LL 2YEZB 4AK1A 4RWYH 3ARXA 1CD9B 4W6YB 5K93A 1GGIH 4UTBL 4YHMH 1MY7A 3ARGD 2IH3B 2AXHA 3H0TA 3AMLA 1EFXB 3MC0A 2OTWB 2D03H 4WVRA 2NTFB 5D7KE 1YEFL 4A2MA 5DMIL 1EK3A 3RWJA 1B0RB 2ZG1A 4UTAH 3HI5L 4JFZH 4BZ1H 5IT2L 1IBGH 3EJZD 1BVLA 2JKXA 2D0FA 1B0RA 4I2XE 4Y4FC 4PJAF 1U8MB 4PRPB 3L5WB 4LNVA 3HZVB 2PETA 5SWSB 1X5ZA 2QQKH 4XBPB 3AB0C 4D9QE 1TXKA 2OXGA 4TSAH 3TBSB 5IEKB 5F71A 4PS4H 2YK1H 4HUXA 4I18B 5T3ZH 3MLRH 5I8EA 3PWPE 2WINB 5I1GL 3LZFL 1KCVL 4OM1L 4Q74A 3VD5A 3RY4A 5K9QG 4S1RH 2H1PH 4OI8A 1CS6A 3RKPA 1A1NB 2QSTA 1R3JA 1T66C 4JZNB 2BSTA 4PREA 2QQKL 5HYEA 3F8UB 3IGAA 4KJPC 5HHMD 1MJ7L 1NGWB 2R1XA 5E2TH 1AP2B 3IT8D 4BUHA 1QZ1A 5D7IE 4K3DL 5KAQG 3MLRL 1QVOA 1MPAL 1I1FA 4JQXA 3LKOB 4AG4H 1HK6A 4ZFZB 5IFHH 3IJHB 1AXSB 4RX4A 5EC2B 5CJQL 4PD4J 4XNXL 5IQ7H 3FQUA 3HPJA 2W9DH 4KK8C 3BKML 3L5XH 2NY5C 1ZSDA 3ARQA 5IEKA 3MGAA 5F1SA 2J6EL 5FXCH 2B5IC 5EC2A 3GIVA 2ZUSA 3N85L 3RGVD 3E2HB 2OJEB 5DC0A 4ZS6C 3T0EA 1J10A 3RNQB 4KJYB 1IVLA 4DEPB 2X4QB 3EJYC 4Y0GA 4GOSA 1VA9A 4Y5YA 4ZUUA 2FEEI 2QR0A 2HG5B 1CG9B 1RUMH 3MV9B 2X42A 3E8UL 2V5TA 5CUSH 4OQ1A 1YYLH 1ZE3C 4XCFL 2Q86B 1AGEB 4LEOA 4JPKL 2F53A 3TYGL 2AVGA 4NO2A 1KBGL 2H2SC 2B4CH 4YO0B 3QISA 3QAZB 5D4QA 4UIMA 1P9MC 4I0PD 2F15A 3TJHC 3MPCA 2WINA 1T04A 4OLXL 3N1PC 3GHEL 2IH1B 4N0YL 5D7LE 4JKMA 3A0OA 4Y5XC 4HT1L 5F7FA 4HPYH 1EFXD 3EYVA 4GXVH 1JVKA 3HC0A 3LEVL 2CRZA 1FAKT 4JPVH 5D1ZB 2JF1A 4F7MB 1A0QH 3CC5A 4OBSA 4XP9H 5DMGD 1UH4A 5HHMB 2BVEA 1W72L 2J8UA 4MJ6A 1FJ1B 4O02H 1B90A 2VXVL 4Y4KD 4O5LL 3TA3B 2EO1A 2VZUA 4OLXH 1RHHA 5TH2A 4X5WB 5FGRA 1J11A 1Z0MA 2X5PA 1ROWA 1YUHA 3GKWH 4N9GA 2KPNA 4ZUVA 3CVIL 2IH3A 1A7PH 5IROA 2AJVL 4XP9L 1YMHA 2H45A 3R1GH 5IR1A 5EPMA 5A2JH 1KPVB 5BJTB 5C2BL 5KW9H 3V0VA 3ROOA 1JZ8A 4LSQL 4HLJA 4TNWK 4WHDA 4XX1G 2HA1A 3UTTA 1B3JA 4WUUD 1NEZB 2EDLA 3V6ZA 5HJ3B 3B43A 4LCCA 2YRZA 2NY6C 5JORB 4F7PA 3KDMA 1OY3B 3BP6A 3X3FL 4QHLA 2R2BA 2NW3B 5CBEA 5F89B 4YZFF 2NYYD 1DUYB 1KF9B 2MPAH 4GKSB 4PRHE 3ZT7A 5HD8C 4OZ4A 3CSBA 1A6ZA 3CVIH 3RVUC 2FBOJ 4XT1C 4ZUTB 5KSVA 2NXYC 3UP1A 1K4CB 1IM9B 1X5KA 4OB5L 3O45B 1P2CA 3NN8B 4UB0H 3CFCH 4FFVD 4HWEL 1KULA 4LNRB 4WI9A 3RUGA 4OCYL 4YFLI 2NX5B 3V0WL 2EE2A 1P5VA 1PEZA 4NN7B 1TVBB 1AXIB 4NOFA 4Y16B 3JV0A 5GS1C 6FABH 3ETBF 3K80A 4FQHB 2OR7A 5JXEA 2BVOA 5DRWB 2BHYA 3I50L 4WTZA 1Q9LB 4M62L 5L88H 1GAFH 2VLKA 2DQEH 5EZOL 3GK8L 3VFOA 5DO2C 1ZANL 4YIQB 3VFSA 1OW0A 1T5XB 2NTSP 1UG9A 2GCYB 4OLYH 2WW8A 5ERWB 1JFQH 3PQYE 5JDSA 1A7NL 1MJUH 1DFBH 3QUYA 3CDGB 4U1IB 4JFEA 3MBXH 3TH3T 2WUCL 3NTCL 4OTXL 4OLWH 2V17L 1DL7L 1IGCL 2HAZA 2GQHA 2NX5A 1IGTB 2EH7L 2EDNA 4YFDB 1GAFL 1RZGA 1E28B 2GI7A 3W9DA 5JMOC 3ZTNH 1PY4A 4GXUM 1RIVH 4MCZB 5DJXA 3HE7A 5GRWA 4OLYL 3ULVD 4KTEL 1HNGA 4PJGE 2BNQD 3FHAA 3SHSA 1G6VK 1HOCA 1A47A 3CH1A 1B88A 3T0VA 4QLRA 4ZTPL 3NCYS 4GG6F 4PY7A 1MJJB 4PRNA 4Y19D 1DL7H 1IGCH 2V17H 4I5BA 4QGTA 4LSSH 3NPSB 3Q48A 1MCLA 3IDXH 2BSRA 2VXUL 4JFXB 5A16A 3DNKA 2XWTA 1FGVL 2P45B 1YN7A 4OD3L 5E8PA 4R8WL 3RUGE 1Q94B 3QDJB 3BE1H 3FQTB 3WXVL 5K9OB 2PW1B 5IEHB 2FEDC 5TGBA 2AXGB 1RIUH 3EJJX 5EZJB 3ULVF 5I71C 1PDKA 2PTTA 3FFCA 2VDRH 3C6SA 1XGRA 3O9WA 1CLCA 4JVWA 4YAQB 3GHBL 2VLMD 3GSRB 1FVCA 3VU2A 3UCRA 4OQTA 2V6HA 1FYHB 1I7UB 3ZT5A 3VXSE 5C0BD 4G43A 1YY9D 3FFCE 1DLHB 2HT4D 5D9SB 5IROC 3MUZ1 4ZNEA 5IR1B 5AWNH 3FRUB 2RHEA 3DVNA 3HNTL 3UO1L 2V9TA 1NMCC 3IDIA 1ZHLA 5L0QB 4O2FA 5KSAC 3GGWA 3BD5A 1NGZA 4XVTL 1G7QB 4G7VH 3DXAD 2X10A 4OZFB 2YC1A 4LF3A 1GIGH 1F8TH 1MAJA 3P40A 4XBEL 4JGJA 3STLB 3TCLA 3GRWL 3G9AB 3S35H 4MQTB 1MHHB 3QUMA 4FFYH 1NCDH 3RWGB 3UZQA 4NQVB 3BPCB 5FYKH 2CLRA 4KK9D 5EA0H 3U46A 4PJGA 4HWNA 4QRQA 2XKUA 5CHNB 4C56B 4H20L 4X7SH 2VLRB 3V2AR 3QUXA 3MRHA 2JJUA 1KNOB 4EDWH 3M1BB 3TIEA 4I13B 3MRDB 2VLJE 3NMEA 3EIFA 4MXQD 4JCLA 4LVOC 2VDOL 4XBPA 2XG5A 5HVHB 2Q1EA 4QNPF 4X5XB 3GO1H 2VLKB 3GM8A 4ONFH 4PJCE 3I75B 4U1LA 4XNQA 3PQYA 3DSFH 4RGOL 4OFYA 4Y2DD 4RFOL 1U3HD 3TNMB 2V7HB 2B8OT 4JM2C 2O5YL 4ETYA 1RZFH 2DLHA 3VDCA 1W0VA 3C5ZC 4PJFE 4ELMF 1TVBA 2KQMA 3DETC 1HEZA 3M17A 2AV7A 4TVSa 3CDFA 4I0PC 3SO3B 4QKXB 1S8DA 2VITA 4F15B 3DV4A 4O58L 4GMTH 1AGDB 2GUOA 1HYSC 2HT4C 3RQ3A 2FX7H 2ESVE 4RGOH 5T1KD 1CDJA 3TO2B 4PJ8D 1INDL 5GIRA 2HP4A 1FJ1A 3BZFA 1VACA 2FIKA 4JRWA 3O3EB 2NZ9D 3HCVA 3CH1B 2EDJA 4ZUWB 3DJ9A 4JHWH 5ALCL 3UJTL 3GSNH 3RGVC 1ZOXA 3K2MC 4PRPE 4MA1C 1CD8A 2IBBA 5F7EH 4JDZB 5IBUG 2XZZA 4L8CB 2DMBA 4X83A 4HIJA 3AC0A 3SDCB 5E8PB 3CLEH 1EXUB 5I2IA 3TJEL 5MENE 2R4SL 2PW1A 1HNFA 4Y4KC 3UYOD 2FGWH 4F2MA 2VITB 1PZUB 1T5WA 3D39D 5I0ZA 1TZIA 2IFFL 5A1AA 5BZWA 4U0RB 4ZOCA 1LQSR 1UACH 5J1AA 3IDGB 2ZUQC 3MOAH 1A7BA 4LDOB 4RAUA 4YHML 5J12B 4J1UA 4TUJB 3U1SL 4JFYB 3RJQB 3MODL 2JCCB 3KPNA 1DUZB 1G7LB 4CW1A 2F74B 5FGBC 4WEBH 1HIMH 1VFUA 5A40E 5CJOL 5L2KE 3QIBD 4JKKA 3L3IA 4FQPA 4M3KB 4UQ2B 4G9DB 4P4KD 2H26A 2IFFH 3ALWA 1XCQB 4XGZB 2XQBL 3TEUA 1JWUA 2VZTA 1JZ2A 1F4AA 3DX9B 5E8OA 5CBAB 5IUSA 1N64H 3OKEB 4L8BA 3GSVB 1UACL 4R4FH 5I74C 1X5YA 4JB9H 3TZVC 3WFZA 4XXCA 2P24A 4J8RB 3KYKL 4JFQB 4JQIL 1NGQH 4NZUL 2ZNXA 4O02L 4ORZC 3EOTH 3MNWA 2HKHL 2XZAL 1MWAA 3NPZB 2MCPL 3TBYA 4PLNC 5CJOH 5AAMA 1JHKL 5ENWA 4ZAKB 3VH8B 3SE3C 1S9KC 3ILQD 4QWWC 2QTEA 5SV3A 3FTGA 3GKWL 5IKCB 5CGYD 4QRPD 3GMPB 2HT3C 2YD8A 3C6LC 3WCYA 4I8DA 4RA3A 1FZMB 2EIEA 4KHXH 2V5RA 2DL9A 3VMNA 2OQJA 2GEEA 1NCAH 5DUBA 1P7QD 3F7VB 4OUUB 3QDMB 1ZHKA 5FYLH 3HRZB 1KNOA 4YQXH 5JHLH 2HT2D 1QBLH 4LPVA 3SE8L 1RFDH 4N8VB 4KROC 1P2CB 1A3RH 1PFCA 1L7TL 2UY6A 1YYMH 3MUJA 4U1SA 3MLXL 1M71A 1MFEH 1NFIA 5EBGA 3JWDC 3HZYB 2GHWB 3OZ9L 4UB0L 4UQ3A 5GJSL 5C0DA 4KKLC 5CEYA 1H15B 2MCG1 5FOBA 3N85H 2Q7YA 1YQVH 3KDMB 1A1MA 1HXMA 4H26A 4MAUL 1XF3B 1S9XA 4CJ0A 3ZE0E 2X4UB 4RISH 5IVZA 4PGEA 5E70A 2FL5A 5CMAA 4JRXA 1M7XA 3RWCA 2A83A 2IADB 2XTJB 1OSPH 4RMQA 3GSXB 1DVFA 1UH2A 4K8RH 4PB0H 2BXYA 3RX8A 3TC9A 4QYOB 3BEVA 3I9GL 3IF1B 4JREB 1L0YA 1ZVSA 4PJFA 2VIRB 2QKIA 1N4XL 4NQXA 3KXFE 2A83B 2DQEL 4PB9L 5LAXB 3PP4L 4QYOA 3GMRB 4QHUB 2AJSL 1L0XA 1JNLH 3IDMB 2NXYB 1DVFC 2EC9T 4FXKA 3FN0H 4U1JA 3S3JA 1DQMH 1DBKH 3MLVL 4ENEC 1UXSA 5FYKE 1QSVA 3LPGA 1W0YT 4IOIB 1CGXA 2EYTB 4MXQC 4YDLC 1S7SA 1NFDE 4FXKB 5ILTL 2F5AH 3S9DB 2M26A 5DJCB 1FFNB 2QL1A 4XX1E 2G2RB 5J6GB 3PP4H 3GJFA 4Y2DC 1UENA 1FAIH 2C4FU 2AJSH 4QT5A 2G9HA 2O93L 3QFJE 5HHOE 3VRLF 3K46A 3RTQB 1W72A 1C5BL 3QJFB 4K3DH 1JUFB 1MCWM 3B8SA 1NKOA 4I5BB 4NRYA 4P3CH 1HI6B 3T1FA 4F3FA 3NCMA 2VZVA 1NUDA 4LHUA 1C5DB 1A7PL 4MXVF 4YWGL 3PG2A 4OF5A 5KW9L 4M5YH 3UPRB 3VFUA 2HJLA 5SWZB 4L3AA 2KZ1B 1QFOA 3HE7B 4KTDL 1I8IB 3ELAT 4OZHF 4X4YB 4HIEB 4AYFA 1QRKA 3OKNB 4YGVA 1FBIL 4ZYKB 4YFEA 5JIHA 1RUQH 4XBGB 2ICWB 1N3NA 3MRGA 4XNMA 4NUGH 3IAQA 4QXGL 3A6BL 5I15L 5D2LF 3BN3B 2DLEA 4XP6H 2H3NA 3JWOL 1T0MA 4WI5A 6CGTA 4P46A 4OGYH 1BZ7A 5GHWL 3QWRA 4MSWB 1QHOA 1FIGL 3AS3A 5DSCA 3BSZL 5EOQH 4WWKD 5GGVL 3DXAE 3GMPA 4JY5H 1WC7B 2J6EA 3VI3E 3T2NL 3T0XA 4JFHE 1AXTH 2R0KL 1KB5L 7FABH 5IP4A 1Q72L 3V0AC 1FLTX 1ND0A 1GPOL 1ULVA 1I1YB 3IU4L 4D3CH 4FMFA 2VL5B 3OKOB 1KTLA 5FF6A 1U93A 1WBZA 2JJSC 3OB0H 3U36B 1YNKH 1HWHB 2AV1A 3QIBC 3UAJD 3G5XB 3QO0B 3NFNA 3FRUA 1JFQL 1YUHB 3LCYA 4N9GB 1WBZB 5DTFB 3RWEB 4PTTA 4PJHB 2BXZA 4JRYE 1YEGL 1FGNH 1QSFE 3UTTD 3EGSA 1GL4B 3P9MA 3ES6A 3Q2CA 4ZS7L 4BH8A 5HYFA 1HCVA 3DROB 2X4TA 3DYMA 1NGXA 4GUPA 4IRJB 5JIKA 4FXLA 4NNPH 4MQXC 2HWZH 1FL3A 4HC1H 1MJ8L 4Z7UA 5FO8A 3IXAA 3UZEA 2PTUA 2VLRE 5BRZE 4WFFE 4WCYH 3X3FH 1D9KD 3SKUD 43C9A 1ZVSB 4PJFB 5CJXA 5DMKB 5L7XH 4AEEA 5C0CA 1JF1A 1BF8A 3IDNA 3DI3B 4CVZB 4KRPC 1W0WB 4PUBL 4ZXBB 1HQRA 5I1KH 2FR4B 1R3IL 1KCRH 3V52L 1OAKH 43C9B 1KJ3H 4ZSOB 2ZNWA 5DVOA 2VXTL 4PRIB 4DKFH 2VLKE 4ZMAT 43CAB 1G7PA 3VXSA 5D7LD 3TBTB 2Z93B 3H42H 1UXWA 1ZWIA 4UUJA 4HFWA 5JW5B 4OLVH 2IAMC 4BH8B 3L3DA 2JTDA 4LKXB 1KLUA 2DQGL 1E4JA 2C4FT 1U8NB 3F7RA 3PHOA 4HG4J 4S2SB 4MXVE 1L7IL 3SE9L 1INDH 3FL7A 5L88L 2ADFL 3OJ2C 4QF1B 3ARBB 3RDTD 3W11D 1JUFA 3KR3H 1UZ6E 2A6IB 1S8DB 1YJDH 4QY8B 4KK8D 4PRID 2H9GB 5HYJB 3ARYA 2QQQA 5DD0H 4UILH 5TDPB 5I19H 4OFPA 4ODBD 4U1IA 4WO4A 5AZ2L 4GG6B 1RZKL 4YHYC 4G8IB 3THML 2HFGL 5AWNL 3TP4A 4NM4H 1R5WA 1NGWA 2A0LD 3TZVA 3H3BC 4WI4A 4GKOA 2PKDA 3O11B 1A6ZB 3SE9H 3LH2L 3QUZA 3BIKA 3UTTE 5IMKB 3EFFA 5HGAA 5JW5A 4HUVB 2J5LC 3DX8B 3DETD 1KCUL 5I6XB 3MRBA 4RNRB 5IB2A 2I24N 4Y1AD 4NRYB 2IAND 3BO8A 1U91A 3P0YH 2GTZA 8FABA 4P59H 3VA6A 5CSGA 1JHTA 2W9EH 4Q2ZA 1OTSC 1BPVA 4N1EA 3QRGH 4GSDH 3N1MC 2VLRA 4X7DC 1E4XH 4YE4L 5F9WB 1I85C 4OZIB 4LL9A 1A4JB 5C0BB 2G60H 1TZHB 4JM2B 4DWHA 5EORL 3V6FB 5D1XC 1A1OB 4TNVK 2BSSA 2FLBT 5JUEL 1K5NB 2F5BH 2X9XA 1LE9B 3K8LA 4GXUN 3VFPA 1J1PH 1A14H 2F54B 3MRIB 5D7KD 5IJKC 4JJ5A 4KHTH 3ZDZF 4NOBA 1A6WH 1I4FB 5KN5B 2A6KA 3T0WA 1J88A 2YD6A 3U4BL 5ANME 8CGTA 5D1ZA 4F7MA 3MUY1 3MV8B 3FMGH 1JHKH 3L3HA 3KAAA 2OL3L 2Y1VA 4RQQA 5DD6A 3ROOB 1DJSA 5TQ0L 1X6LA 3MXVH 2YR3A 4HAFA 5CEZD 2VQ1A 3CX5J 3KLSA 3R4DA 4NFCA 4X4XB 5M95B 1MLCA 1KJVB 3PDDA 3TO4A 1JK8B 3L3GA 4APQD 4DN3H 5ICYA 3NFSH 3DXAA 2GITA 3PHSA 2VWEC 4KK6C 1RZIA 3HG1D 4XWOC 5E99H 4HWBA 1QFPA 1NUNB 2WM0A 4XAKD 4FQ1H 3FQXA 1IKFL 4X8JA 4JFOA 1BOGB 1E27A 5E2UL 2DMCA 1FSKB 4HX1B 4XNUL 3MLWH 4LSTH 2ARJQ 4KJQD 1SEQL 4KWUA 5EFIA 5I1EH 2XA8L 4NO5A 3MCKB 3NFNB 3QNZB 3QCVH 2MFNA 3QCTL 2X4RB 4M4PA 3MLXH 3RUGF 3SOBH 1JPGB 2CIIA 3BP5A 5ETUA 3IXTA 2FD6H 2O5XH 4XCEB 5EU7E 1NDMB 4ONGH 1PKQA 2PO6D 5E2UH 4R0LA 4JAMB 3RZCD 4YGVB 3CSPA 3IDUA 4PJGF 2VDPL 1T6WA 2C7UB 5C0DB 1TCMA 4R0LB 5MP6H 1UJTA 4I3RH 1KIPA 5J7CC 1U3HA 4NKIL 4UDTA 3BN9D 2VTFA 4J3UA 3DHMA 4DGIH 4DQOL 5K9JH 2XZCH 1H3GA 2IQAB 4BZ2H 1Q0YL 3IJSB 1IGYA 4MD5A 3VXPA 4XNYL 1WEJH 3CX5K 5F9DC 3SQBA 2Q7NA 5LVEA 3C9NA 3KPMA 5IV2B 1HINH 2DL2A 1FNHA 1FH5L 5EUKB 1TNMA 5T1KA 3CVHA 3OKDB 4PJFF 5DJ8A 2B4CL 2QBWA 4X6CF 3BYYA 2F53E 4Y8AA 4KQ3L 3FOMB 3W9EA 5JA9A 2WUBL 4YHIB 4F37F 4ZAKA 3VH8A 4YUEL 4IOIA 4X7FC 3QXUA 5J13C 4HS3A 1SJHB 1N5AB 3QUKB 3BH8B 3K8KA 4JG1L 2OJZL 5EBWA 1K2DA 3PP3K 4LCYB 1PZ5A 1IQDB 2YPKA 4I4WA 1JWSB 3OG6B 5LXGH 4KVNL 3TBVB 4TTGA 4DKAA 4GLRH 4M8QB 4KHXL 2E6JA 2X1WL 5KVDH 3DRQB 4GW5A 5DHVB 4XP5L 3VCLA 5DD1H 3TLRA 2F54D 4OIAA 4U6VL 1K5NA 2NCMA 3SKMA 4Z76A 5FO8B 1NFDB 1L9NA 4UQ3B 1IKNA 3KYNB 2FNBA 4F7TB 3RKDD 1KYOJ 1LEIA 1OAUH 4LFHG 3U4EA 3NOIA 3QNXA 3QO1B 1J18A 2K7PA 3IAPA 2BRRH 4TN9A 4QHUA 1BJ1J 5F1IA 4XWGH 3V6OC 4OZIA 4PYGA 1BFSA 3DO7B 3QIBA 1GGUA 4OCNC 4X6CB 3HB3D 3W81A 1CLOH 1AGDA 2GUOB 4G8GE 4YDJB 2XTJD 1U3YA 1ZAGA 5T3XH 1DVFB 3C8KA 5TF0A 3WBDA 4M7JH 5JLZA 4NKDB 5B8CA 2P5WD 3O6FC 1IFHH 1VDGA 4NO3B 2YN5A 1T83A 2ORBL 5FF6B 4JJ5B 3LKOA 3SDAD 4KMTH 1HILB 3V4UH 4P0DA 3BP4B 1OB1B 5EU3A 4DZBA 3R8QA 2C3WA 4DZ8B 3G6JF 4GW1B 3WS3B 1MRCH 2GFBA 2NXZB 2E9JA 3TBYB 3LRSA 4TVPH 4YR6A 3E6HA 1C1EL 3AREB 5FA4B 2XY1A 1WC7A 5I1LA 4Z7WB 4F33B 3S96A 3HG1E 4CN4A 4O2CB 4NQDA 4GXVL 1ZT1B 4ELKA 4Z8FH 4ODWB 5F72S 5BRZB 5TDPA 3VGBA 5BS0A 3MRHB 2YPLA 4AEFA 1W72H 3CU1A 4OUUA 4ZFZA 4ELKB 4YBLC 5T1LB 2ID5A 1M05A 4PFEA 4WV1B 3VXUE 4L9LB 4MQ7B 4R4NC 2Y7QA 1NSNH 1HN1A 4JJHA 4NO2B 1F00I 3HUJA 4FQJL 1QUNA 4U6XB 3BMWA 3WHE1 1I3GH 4HUWA 4HUVA 5ACZA 2C7UA 4J3TA 3U46B 3IYLW 5IBTH 5JR1H 3E3QE 3LDBC 1R3HB 3FAWA 5CLWA 4YHZL 2NY6B 2SEBB 1OB1A 5EU3B 1OAXH 4YHKH 4GW1A 2WUCH 1G7PB 3RWJB 4HK0A 4Z18A 2A9MH 2DJUA 1J7VR 3MGTB 1YDPA 3O8XD 2XTJC 5FYLD 3QT2A 3FQNB 3GI9L 2YKLL 1YECH 1JGVH 3IVKB 4PGCB 1GGYA 1MELA 1MJ7H 2DOCA 3SE4C 3D18B 1F58L 1JPSH 2B7DT 5FB8B 4PRBA 3IDNB 2Q87A 3EDFA 2YD9A 3BKCL 1SHMA 2FSEA 2XFXA 4GRMB 4I0CC 1DQQA 3QO1A 1F3JA 2BFVH 4YPGA 4LRIA 3QFDB 4O51B 2Z35B 3OPZH 5LGJA 1IGJB 2Q76B 2D7PA 3BKMH 1P69B 4BKLA 3GJEB 5GRVL 3HLAB 5ABDE 3D25B 5DZLA 3GBML 4JZNA 4OD2B 5HYQB 1QR1B 4PRHD 5MEQB 4NYLA 3MOBH 4PTTB 3SGJC 2DM3A 4PBVC 4XZUB 4XB7A 2XNAA 1N26A 4XMPH 4K3HA 3C08H 4U2YA 4TVPE 2R2CA 3TO2A 3E8UH 3SDCD 3BD4A 3WYRA 5HYJE 2RFXA 3I50H 1BBDL 4Y4FD 1RI8A 2AJZA 1WZKA 3E2HC 2VE6B 1Z9MA 3V5KB 3T0DA 4HAGA 5KJRH 3KXFB 3EJZC 5TE7H 2DM4A 1ODAA 2CUHA 4HKZA 4XXCC 2GJ6A 3D2UD 3MMEA 4PJCA 3P0YL 5E9DE 3SJVB 1CTNA 3ARDA 3VWJC 4X99A 3BIBX 4HPYL 2OP4H 3EDKA 1NAMA 2X89D 2UUDH 5CZXD 5F3BB 2IWGA 2J88H 3ARGC 4OLWL 4MX7A 2XXCB 3QG7L 4KJWD 5DGRA 4UT6L 2ZUQB 4F15C 4LPUA 3T65A 1B6DA 2G5RA 5D1XD 5IQ9B 2VDQH 2G5BB 3CDCA 1TQBB 1LDPL 3MNVB 3A6CH 1S5IH 5DJ6B 3ZYJA 2FWOA 4O5LH 3D0VA 1PQZB 4GBXB 2BC4B 5EO1B 4XBGA 4KJQC 1HHJB 3L5JA 4QRSA 3FN9A 3CVHL 3MRGB 4EOWH 2FJGA 4JHBA 4NQCB 4O4YH 5GISH 4QXWA 3CDYA 3MFFB 1OAKL 1GGBL 4YR6B 4MA1B 1YN6B 3LKNB 4YBQC 1KENH 3CUPA 1DDHA 2ZOKA 5HGHB 1XIWB 5JNYB 3K4AA 1ZLWH 4X99B 1LO2H 2DQDL 1FIGH 4OD3H 4XPGH 1GZQB 1IC7H 1X5FA 1CL7H 4HW6A 3AGVA 4K7FB 5IV2A 1RZJH 5DXWA 4OZGB 1F42A 3QXAB 3U9PL 3MNWB 3O6LH 4XPBH 5H94B 1MF2L 1LO4H 3FO9A 2LE9A 3MNVA 1I8KB 3BJLA 1QSEA 4WEMB 3JWOC 1FFPA 1KN4L 4TRPL 1H5BA 4U4BA 5EUOB 1C12A 1CGUA 3ZE2F 4LHJB 4CVWA 3BDYH 1UADC 5KANI 5H2BB 3VXNB 4IRJD 4JKLA 3L95A 2W65B 3PP3H 1P1ZA 4UILL 3DXAB 2PCPA 4RWHA 2R9HD 5HY9B 1FN4A 4K3EH 1OWRM 1JF6A 1VFMA 3DROA 2MQ3A 3N06B 5FUCC 4LLQB 5EZJA 2ENSA 1TZHA 3EYUH 3OV6A 4JM2A 4S10A 1TITA 5IHZA 4M6OL 3VRJB 3G9VA 5IMOA 1KFAH 2W60A 3T0AA 4PJ9C 3J7HA 4J12A 4Y4FB 3NCJH 4LAQH 1FORL 3LQZB 5JTWA 4KK5C 5BVJA 1IAMA 3BGFB 3DOSA 3QQ4B 2AEWA 2AV7B 1FNAA 5JPNA 2WZPD 1KEGL 5D7IF 1YNLH 5DD5H 4XH2B 4PRHB 5K9JL 4LVOB 3FN3A 2VERN 5JXEC 2WIMA 2NW3A 3QXDB 5CBEB 3QULA 4OD2A 3VXNA 1CD1A 4ZTOH 2PYEB 1MCWW 3CZFB 1NAMH 4ONOA 1NGPH 5BMFL 4GRWE 5C0AB 4JZOB 5IVXA 2YN3A 3W9DB 3VGFA 5BOPA 4FQIL 3P4MA 4I2XB 4JFEE 3MJGX 3ZYIA 2C5DC 4JDVB 1EUUA 1F6FB 4WY7L 3DX7A 4PJDE 4RX4D 3BQUC 1QLRA 4YK4B 3OKMB 4NM8L 3KHQA 2DQJH 3O6MH 3S37L 4EI5D 4LPXA 5C92A 3VG9B 5K9KB 1HIML 4J3OC 3O2WL 4G9DA 3O8XB 5L9DH 1GZQA 3VFRA 2BOCA 4E0RA 3FT3B 3V7MA 4P48A 4DOHB 4G8EA 5FUOH 4QGYA 5CEYB 3I3DA 2HG5A 1M4KA 3BE1L 3NACH 5EB9A 1KTKE 4I1NB 3FOLB 2R1WB 3FCTA 4TNWF 3QDGE 3BKYH 5J1AB 4KKBD 4WGVB 2F53D 3S88H 3O0RL 5DJYA 3P9LB 1EHAA 5T1LA 1U8JA 1CXFA 4F9LC 2GJJA 3HZMB 3MBEC 4XNMB 3CDGA 4UOW1 1RK1B 2X70B 1AD0B 4G8GD 1DQDL 3EZJB 3ZYZA 1NPUA 4LOUD 1JPFA 4FNLH 4DK3A 5CGTA 3OKMA 4UQ2A 3WL9A 1NCTA 2EDOA 4Q97A 3OKNA 3ULVH 4N0FB 4X4YA 3S34L 4MX7B 4FN0A 1ADQL 1DEEA 3CPLA 1DDHB 1T1ZB 3L7FB 3BRGC 1OAZH 1ITCA 3JVGC 1J9CT 3G6JA 4QHMA 3O0RH 5C0AA 4NZTL 1MCPL 2FB4H 2YPVL 3MCLH 3TT3H 3QEQA 4PJBF 4WNQA 3P0VL 1IQWL 2XT1B 4LCWB 4K3JH 2ORBH 5GRYA 1L7TH 2ITDA 2WWKO 2YC1B 5IF0A 3DECA 4F80A 1IARB 3T77B 5D1ZD 4H1LB 1YMHB 2PTVA 2AV1B 3ESVF 4PJIE 4PJEF 4ODUB 1X5JA 1JN6A 2EE6A 2ATPB 2VLJB 4MAUH 3REVB 3C09B 3TT3L 4FQCL 2RCSL 3EDEA 3QA3B 2OTUA 3O3AB 4WWKC 2W0FB 3TA3A 2OL3H 4P5MA 2X4TB 3VXMA 5E7FA 2CXKA 2DD8H 4K9EC 4TOYL 3QA3A 5GGUB 1RK0B 4L3CB 3GMRA 4UTBH 4YH6A 5FYKD 3RWEA 1KYOK 5TQ2L 3SGDH 1I3VA 3V0VB 4PJ9A 3G5XA 4V1DE 5DA4A 3P2TA 4XVUC 4B7LA 4POZC 1QQDA 2JIXA 3DPBA 3RGVB 4ZPTB 5D5MF 1ZT7A 4M8QA 3MGTA 1S7XB 3OAZH 3B2VL 3UROR 3ULUC 2JJTA 3LS5L 4E5XA 4M4RA 3RBSA 4TOYH 3X12A 1PKOA 3RA7L 3Q1SH 3QZWB 3SDCC 1T4KB 3LQAC 1REIA 2OMNA 3UAJC 5JOFA 1AGEA 5HHVH 4YX2H 2ICWI 3FONA 1OWWA 3S8WA 1S9VB 1H9VA 5HHQA 1R3HA 1DQQB 3GMMB 4K94H 4Z7OE 3UTQA 5ESQB 1S9YB 2MOVA 3EYOB 4JZJC 4NT6B 1T2QL 4YHYB 4EI5B 1I7ZB 1C16A 1IZJA 3P11H 5EBMB 3EDJA 2ESVD 3S5LB 4X6EB 4CADB 4JFED 1EAPB 3EYSH 4MDIB 2FH6A 1XGYL 3UJJH 3OKEA 1KLUB 3DGGA 2IGFL 1UKTA 2RB8A 2OI9B 2Q6WA 4OFVA 1GRWA 1NUFA 3MYJA 1MPAH 2IANE 3L9RB 1IFHL 4PRPD 3AFLA 3MRJA 5HDOA 5CIPA 3MX0A 2DQTL 4P2OA 4RFEB 3TVMA 1DN0B 4EUPA 1FZJA 5I76B 3UBXG 5E6IA 3WEXB 1MVUB 4AT6B 4YHOL 5GXBB 5IHLB 4WFHD 5TE7L 5DGQA 1INQB 5BZDB 1XF5A 1J0KA 1XGYH 4GRWH 1CFSB 4JPIA 1S7RA 1JYWA 3NCYP 4HCRL 4ZD3L 1CQKA 4A6YA 1HQRB 1YN7B 1DQML 1SY6H 3T4AB 4Y1AE 3SDXE 4S1SH 5ADOL 5CUSL 2BCKB 4S1QH 5GGUA 1KIQA 4FP8H 2R1WA 1VGEH 2F58L 4JRXB 4L4VA 1JPTH 1N64L 4ZO9A 5C07E 4D3CL 2EDHA 1ZWIB 4UUJB 5CEXB 2W91A 4JQIH 4YDKL 3I84A 3U9UA 2FJHA 1YNKL 2VN7A 4IIQA 3QIWC 1YNTB 2BOBA 4P2OC 3C87A 3VD9A 4ZFOB 1RZ8B 1ZT7B 1IGML 2UZIH 1T80A 2E27L 5C0BA 1RHFA 3KPMB 3LHPH 3CFKA 4TNVF 1N2RB 1SYVA 2XRAL 3OGOE 5DD6B 2O5ZL 3QIBB 2IADA 1KCSH 1MAMH 3R8BB 3BUTA 1BX2B 2JJSA 3GI9H 4NWTL 4M1GH 3DVIA 2DQDH 3KYOB 3WO4B 2Y6SD 4BSVA 3PWLA 5E94B 1IC7L 4XNZB 2ZG3A 1CWVA 1OARH 1CE1L 2M8XA 1GCFA 3DX6B 1F4XL 2FX8L 3VI4F 2CDGB 1E4XI 2NY1B 2NXZC 3SGDI 1I7RA 4AIZB 2DQCL 1FYTA 3HNVH 3SDDC 1C7TA 2VC2L 3V52H 3R1GL 3KPLA 5C2BH 3G6DL 1KXQE 2VXTH 2NY4C 4DGYH 4E42A 5GGRB 3SY0B 3ZL4L 4NWTH 1IEAA 3RWDA 4KVCH 1MCOL 1AH1A 3IXTB 4JN1H 1ZHNA 1JV5A 4ZXBC 4ZFFA 2R8SL 2N56A 2A2QT 1F02I 4O9HL 4R9HA 2D4DA 1QBML 3WD5L 4P2YA 5E4EB 4LQFH 3T65B 1DN0A 4EUPB 2I25N 2PO6C 3VXOB 4LQ1A 3B2UD 4KPHL 1RJLA 3BQUA 12E8L 2ADFH 4CUCA 5KSBF 2EDQA 3PQYD 3HZYA 3ZDXF 2LU4A 1YJDL 3UPRA 3KPRB 3D3VA 4L3EE 4GS7C 3LIZL 1MCNA 5IBLD 2OP4L 4Z95L 3S5LA 1A6AB 1EJ6A 1QLFA 1OQOA 1NCBH 3TBWB 5B3NA 1T83C 5D5MB 3MJ7B 1Y6NR 4UI2A 5DJ6A 1HZHH 3MUGA 1R24B 4I3GA 3QAZC 2E7HA 3TBSA 4JG0L 3S6CA 2YD4A 1JWUB 1J05A 5E0QA 1U3HB 3GMMA 1U92B 4GQPH 4L3EA 4LRNH 4NO0B 3SQOH 3WS6A 2PYEE 4OGXL 1IAIH 1RZIB 4CAGA 4OBRA 4JFHD 4ONHB 5I8CB 2EXYD 1IILE 2QJDA 4CL7A 4IRZH 4WW1B 3EO1A 1UFUA 2GSIB 5F1NB 3VXTA 5I75C 1K6QH 1P6AB 4WUUB 2GJ6E 4Y4HB 1J0JA 1JN6B 3IF1A 4K7PL 4ZOAA 5DEGB 3OXRB 2VIRA 3ZHDA 5C0IA 3HMXH 4Y2OA 1BD2A 1MFAL 2AQ1A 4HKXA 4UV4H 1KC5L 1H5BC 4M7ZB 4X80L 3JVGA 4FTVA 3D39A 4KHTL 4YHNA 4YBLB 2ZOLA 3UTSE 2X44D 4YXHH 4RCAA 5J11B 1MH5A 2CH8A 5IHUL 2N7BA 5L2KD 4D0DB 5BV7C 4JFYA 5H2BA 1KCKA 3D2UA 4B0MM 1AQDA 3M45A 4OIIL 2FZ3A 4YHPB 1RZJC 3O6FB 1VPOH 4NQEE 4GAYA 3CAFA 3MXVL 3EYVB 5FUZL 2DMKA 4GT7A 3PWUB 4JY4A 2PXYD 2XWTB 4JY5L 2GJZB 1XT5A 4X80H 3BRFA 1HH6B 1RIUL 2BVPA 2E9IA 3DHJA 4OCWH 2DLFL 4FTVE 3QP3A 1R24A 5IFJA 5IHUH 3GDBA 4EI6A 1BQHA 2A6KB 4UT6H 3PGDB 1E6JL 2BDNH 3KJ6H 3V7AE 1X5AA 4Z7VE 1NMBL 2P48B 3Q6FB 2ZSWA 2VLLA 3QEUB 2IG2H 4MA7H 5FM5O 1OGAA 4K55A 1NFDF 2ADGB 3HS0A 2GFBB 2IPTH 5CP7B 4QRPA 5T5NF 2O5XL 4I3SL 2HFTA 5CKAA 3H9SB 4LLVB 1SM3L 2F8XC 4HCRA 1BOYA 3PWPD 4CADA 1GGBH 4RRPA 3LEYL 1G9ML 4HZLB 4EN3A 4TSBH 3B4NA 1S7TA 2XN9D 3MA9L 1Q8MA 3I02B 5ERWA 4XPHH 1OSZA 1I1FB 3VGHA 1XR8A 4XAWL 4UDTB 1IRAY 1UKSA 4KH2A 4E41E 3VD4A 2NY3C 2PR4L 4NN6C 4Z7WA 1J1OH 1KLGA 5F7DB 1A9BB 2DQFA 5DJYB 5AZEH 1UCBL 1A6WL 3R0MA 2ICEB 4N0UB 4DGIL 4UNUA 1T1WB 2HTKD 3P4LA 2ED8A 1R3IH 1PG7H 4HIIA 3OAUH 1EFQA 2D0GA 3MRRA 4HS8L 3O2VL 4UIKH 1KN4H 3CSYA 1DBML 2ICEA 4N0UA 1XAUA 1OGAB 5HTSA 4LCWE 3RU8L 4QHLB 3D0LA 5DZNA 1N6QH 5I18L 1KT2A 3KGRA 4N8CL 3RPIB 4D0BB 1LK2B 3QQNA 5GZOC 1TZIB 3GUTA 1JGLH 4UINL 2NLJA 4HZLA 3C8KB 3ARVA 1UYWH 1AY1H 1Q1JH 2DWEB 5H37H 3EYOA 1Q0XH 4XP4H 5FYLE 5A16B 3DUUA 4KKCD 1DBMH 1OP9A 1KFAL 1MI5D 4KJWC 4OCMC 5AAWA 3CK0H 3VFGL 1LEIB 4GAYB 3I6KB 2JCCE 3V5HB 1AE6H 3RVTD 1UM5L 4JO2L 2VDNH 2EYTA 3VH8G 2VAAB 2CDEB 2R29H 3RFZC 4G6KH 5DVLA 4U3XA 3V4VL 1BQLL 3MV9E 1ACZA 3TO4C 4DKEL 4Z7VF 3B8YA 1AFVL 4UBDC 5DHVA 1ADQH 3WKMH 5I1JL 3RP1A 5GSVB 4OV5A 4RFNC 4G80B 4NZTH 4LGPB 2K7QA 2C4XA 4ZSOE 4NSKA 2Q20A 1RUML 3ORJA 2VNCA 2CIKA 1MSPA 4JO2H 2DKUA 2X7LA 1WZMA 3D85B 3ESUF 1CXEA 1CFSA 4JPIB 4NJ9L 3ALPA 1A9EB 3OHXB 2HRLA 1JGEA 2DYPD 5CSZB 2GSIA 4PRNB 4U1NA 4R96A 1FZMA 5MERA 3O3BB 1FN4B 4IS6B 5MI0B 4BZ2L 1I1CA 2MWCA 2R69H 3F65A 1DANU 4NRZB 2AEPL 1MLBA 4OM0L 1BQSA 4DFHA 2HFEA 4RSVA 5KSUA 3LEVH 4XHJC 4GG8B 3RNKB 4PTUB 2JELL 5LWYH 2YD1A 1U6AH 4MJ5A 1F11B 3CFJB 1J1PL 1U91B 2BC4A 5CHNA 3SDXA 3P9LA 4KRPB 4QTIH 2BSRB 2AK4E 5HGDA 2DLTA 2GTWB 5KVFL 2W07A 5DO2D 4J4PD 2F19L 3QZWG 2CRIA 1VFBA 2WWKT 5I8KH 4HIEA 1WV7T 1KJMB 1AC6A 3MV01 3QWRD 3QQ9D 1BIHA 4Z8FL 1OGTA 1CR9L 4X9GA 1AGFB 2H1PL 5F96H 1S7WB 4HF5H 4X5XA 3GB7B 1VERA 2R2BB 4AL8L 5CEZH 2E7BA 3FONB 3IAGC 4M1CD 4JB9L 1WISA 2DIAA 4MJ4A 5KVDL 3OKLA 2PNDA 4AM0A 3QDGB 1G7QA 4X6FA 2ZUYA 1HHJA 3JV5A 4QRSB 1QA9A 2AEIT 4K23L 4L29B 4UNTA 5D96B 4YXKH 2HVJB 4AEIL 4F58L 1PKQE 1MCPH 1AI1L 2VE6A 4H25A 3LSOB 4KC3B 2EC9U 2OZ4L 4Y19E 5SX5H 1MHCA 1NGYB 3F62A 3IKCB 3MLYH 4G43B 4GW4B 4LCUB 4BQ8A 3BPCA 2NW2A 3KLDA 5EULV 5I17B 4RGNC 1EEYB 3EUUA 3MLUH 4NYLB 3ARDB 1AD9B 1J87A 1JGVL 4OZFA 4DCQA 3STZB 5ITFA 1TPXB 4DW2L 2E7LA 4S11A 1EHXA 5IG7B 5I6XC 3RHWK 3FT2B 1ADQA 3X13A 1QP1A 1YY8A 5FEBA 1WLHA 5HI3C 1FFPB 5C0CB 4KKAD 1UWEH 4PJ9D 1GC1H 4MMXC 4PJDA 1EFXA 5DUML 1KB5B 2VR4A 3EOBB 1KIRB 5GJSH 1ZEAL 1T04B 3EO9H 2APFA 3JZ7A 5CCKH 4JLRA 2R39A 2GTZB 2R2EA 3LKQB 4ZD3H 5ANMA 2M1KA 3T3PF 4OKVA 3KJ4B 4NFBA 2EDKA 4PJXA 1S9WB 1HXMB 3C08L 4MCZA 5IWLA 1EEYA 1MREL 5HGHA 5JNYA 2PXYC 4S1SL 5ADOH 3N1GC 4PJ8B 4TUOB 3NFPB 5KSBB 3B2VH 2R23B 4PGJA 1WVZA 1FNGB 3SGKA 1LHZA 5C08D 4MXWL 5DD3H 2Z35A 3ZLQC 4C4KO 3H8NA 1H0DA 4FQJH 1CFNA 3MRMA 4ERSL 4KAQL 1SJXA 4NWUL 4QHKI 1WWBX 2DJSA 3B3IB 3RL1B 1UEMA 1VEPA 1LVEA 5A3ID 1I7TA 1I8LC 4YHZH 1EGJH 4JM4L 4JO3L 5ICZA 1EAJA 1RU9L 2FRGP 3V7AG 5DUBB 4JKWA 3P11L 2E6PA 1IL1B 3MGOA 4PGBA 3BW9B 1PSKH 1Z5LB 2VDKH 2MHAB 1VSCA 4FZ8L 3KYAA 3VWJB 4IMKC 5GS0H 1S7VB 4JRYD 1QKZL 3QJHB 5E2VH 1FNFA 3GJFK 5EIQA 4N0CD 4P46C 2BY0A 3ULVE 2IALA 3HN3A 2CK0L 4KY1H 4JM4H 2L7UA 3EYQD 5DRXB 3T04D 3SPVB 3HNVL 4Q2ZB 3FB8A 1S3KL 3OPZL 2RR3A 3CFDB 4KI5C 4HV8B 1ZA3B 3BUYA 4OAWB 3O3DB 3LD8B 4ODWA 5B3JF 5KVMC 2NPLX 2BX5A 1QD0A 2VLRD 1A4KA 4LLMB 4LPWA 4R90L 4POZD 2R1XB 5IK3B 5C2UB 1DE4B 1V5JA 4KDWA 4HH9B 2NY0D 4GG6E 1R6VA 1FL3B 3T3ME 2AJXH 4ETQA 4L4VD 3FQWB 4M7JL 1FO0A 1KXVC 1AO7A 3O4LE 4X6DE 1DR9A 1EHLH 2ZZUT 2FLRT 4CJ1A 4FP8L 4JO1H 3AS1A 4M3JA 4QOKA 5FGCB 5IW6B 3IDGA 5KS9F 4RFNB 4X9BA 3MNZA 2ZSWB 2GTWA 4Z7WE 1CICD 1KELL 3PABA 3SCMB 1OTTC 3MR9B 1WBXB 5FKPB 1ZT4B 3GSNB 2HH0L 3HAEG 1NL0H 4TVPD 3NABH 1HH6A 4XGZA 3OJDB 2AJXL 4X6CA 2OBGA 3BAEL 2H32B 4YDJA 1G9MC 4EVNB 3DRTB 5IHZB 2CLZB 2J4WH 1XGPA 2ZKHL 4HD9A 1EDQA 4WNQB 4AENB 2EH7H 4P4KC 1G9MH 5ITFB 2VB5A 4JG0H 5E6ZA 5A43C 2C1PA 1LP9F 1U3JA 4G3YL 3A6CL 5EIVA 5EOCJ 2YZ8A 4EBQH 4QO1A 1IGJA 1KPUB 5DJZB 2I9LA 4NBZB 1FYTD 4GJTB 4OGXH 5F97E 5HHNA 4U6XA 1YEKL 4RQQB 3WN5B 3AY4C 4RGND 2Q3AA 3HC4L 3O3DA 1CI5A 2HLFC 4M1CC 4WV1C 1FNLA 1PJ9A 3GSNA 3V95A 5DEGA 3D0LB 1LD9A 4HUKB 2UVEA 2VXUH 1YC8A 4D0BA 1Q38A 1JTPA 2WK2A 2XA3A 5DK0B 2F8OA 3O9WD 3EZ8A 5E95B 5LQBL 4L8SA 3WE6B 4RDQG 2HRPL 1NBYB 1OGAE 3VFTA 4Y2DB 3MRKB 4ZUSA 3O3EA 1M71B 5ESAA 1QBMH 3PHQB 3MRPB 4HPOL 3LN4B 3AM8C 1QRNB 3U0TA 4WFEE 1D6VL 4NQCD 4QCIB 5FGSA 2BY1A 1Q9KA 3MRLA 3PL6D 4P2RD 4K8RC 3CK0L 5BS0B 1V3JA 5D71L 3P77A 1EBAA 1V8HA 1UT9A 3FZUC 1J0YA 5IVOA 1URLA 4LDLB 2IMNA 4LSPL 5C71A 1S9VA 2DQGH 1K4CA 3S35X 2LQRA 1D6VH 1S7VA 1H3UA 1FYTB 4LLUA 3ARUA 2VLLB 3VFSB 5F7LB 2Z31B 5CSBA 2FJFB 4GKZB 2FGZA 3KR3L 5DT1L 5D71H 3UTSA 5FECB 4FNLL 2WBWB 3VFRB 3KPQB 4WDIB 3MV8E 3P4NA 5D1ZC 3QUXD 3MUHL 2W59A 4KV5F 4PJ5E 4BUGA 1R3LB 3N9GL 1KEGH 2ZG2A 1YMMD 4JR9H 1LWRA 2WBKA 5ACMA 4K94C 5DA0B 4WEBL 4ZTOL 3MCLL 4F7CB 1W8OA 3QJHA 4OFYD 1GJIA 1W8NA 1T3FB 5E1HB 4R8WH 2XQBH 4J1UB 4NZJA 4OZFG 3T08A 3L1OH 4XC3H 5L2JB 1LGVA 2YXFA 3MV11 4HHAA 5JHDE 3DYPA 2PTTB 5D2NE 3LY6A 4CMHB 4LVNB 4D2NA 3PWVA 4F7TA 4KMLB 5EOCL 3K74B 3HR5A 2AJYL 4HC1A 3QR2A 4OLZH 1AGCB 2CMRL 4XVUD 2D03L 3W11C 5DLMH 2YSSB 1KIRA 1U95B 1OTUD 4ZO8A 1MY5A 4UAOC 4DK6A 2X9YA 25C8L 4LLDA 1GC1C 1Q94A 3DMMC 3FQTA 4HUUB 5L0QC 1UWGL 5GRUL 3WV0A 3PWUA 4BK5A 1QLEH 2DBJA 3L5WA 2V9RA 1FZKB 4YC2C 1YEJL 2VAJA 4N5ED 4OV6F 4OFDA 1BZQK 3S36L 5GSRB 1RZ8A 1UM6H 3D9AH 3LS4L 4X5WA 1J8HE 3T2PA 1ZGLB 2CMRH 2R1YB 5SWQA 2BOBB 1KN2H 1IAOB 1CZ8H 2APWA 2VDMH 5KS9A 2FJFA 2FIKB 5HVFB 3MRIA 4MB3A 1BAFH 5F6IC 1FVDA 4B53A 1S7UB 2Y25A 1TZGH 3ZO0A 1OPGH 3L5IA 1OM3H 4NNXB 1OP3H 4M7LL 1YYML 1BQHG 5GRXG 5BXFB 5EZLA 1U8QB 4MNHA 4NQDD 5HI3D 2W1NA 4K71B 1UVQB 4EN3D 3WKML 2X1QA 2QHLA 2A9NL 1PX4A 3WUWB 4KUCD 3O4LD 3NIDF 4G6MH 3WLBA 3GJFH 3P0VH 2DAVA 1ZLVK 3WUZA 5I1EL 1MCQA 2HMIC 4XRCA 4U1KA 4IM8A 3BQUB 1KIUA 3TT1H 1E27B 4S0TD 3MRPA 4NBXB 4ZOEA 1EA9C 1BBJA 4F37K 2P46B 2W9DL 3SOBL 3L5XL 1UZ8A 1GGCL 3MRCA 1EGJA 4KK5D 5I74B 3TZVB 3EYSL 2Q8AH 4XMKL 1T4KA 3T09A 2R0ZH 4ONFL 2FX9L 1INEL 1DQJB 1ZA3A 4GRLC 4YEEA 3DSFL 5DRNB 5FK9B 5FCSH 5FGBA 3OAUL 1CGTA 1A6AA 1QLFB 2ENYA 2P5WB 4N0RA 1RURH 4Y4HD 3FZUD 3DSNA 1P4LA 5D7SL 3ECBA 3KHOA 4HXBH 5FM5M 3B83A 5IJVA 1XFPA 3HI5H 1IM9A 2UWEF 1NLBH 2NY6D 5CP3A 4PJXE 3STBA 4H88H 1U3ZA 4XCNB 4S2SA 3KPNB 3ARSA 4LGSB 3I3BA 2FIRT 5F3HB 4DQOH 4OF7A 5D6CA 4OCRL 3VGEA 3D25A 5JPNB 4M48L 3UTZB 5SWZE 3MLZH 4KAQH 1ONQB 4NWUH 1NMAH 3T1WA 1U8OA 3T0BA 3VXSB 4HT1H 2VQ1B 5T1DL 4PJXF 2I07B 4JO3H 2H2PC 4S1RL 5T5NG 2A6DA 3OQ3B 2VDNL 1AQKH 5EU6E 5H8DA 5F9OL 2VR5A 3WJLA 4JO4L 3SDCA 5I2IB 1I8MB 2VJXA 4PJIF 3QI9B 5FCUH 3MRFA 1O0VA 1CFVH 1SBBA 1XCTB 2FEEL 5EFIB 1DBBL 3OKOA 1MFBL 4AEIH 1RJYA 4NZRH 3IDYB 5IB2B 2C1PB 1KOAA 2B1AL 2OZ4H 1T2QH 3ARWA 1D9KC 4HS3B 2NXYD 4XPFH 5CJQH 2Z4QA 2P4AB 4OZFH 1H5BB 4M7ZC 4JHAH 4N90D 4JRXD 1U8KB 4UDUB 4JLRB 4P5MB 1KCSL 1VEMA 5DJXB 1DVFD 1X44A 4FS0A 5GGQL 1I9IL 3NIDE 5CWSB 2R15A 4P2QB 5D1XA 5DQJA 3H3KA 3P73A 4G7YH 4JCMA 1RY7B 3D69A 4WENB 4MVBD 5DJAA 5ID0A 2P8PB 3FB8B 3RZWA 2VN4A 2XTLA 3VD7A 3DGCR 4FABL 5IJKA 2RQ8A 3C60D 4P9ML 5EIIA 4OCXL 4DVBB 1WBXA 4MWFA 5FKPA 4TUKL 1A1MB 2Z8WC 2WSKA 4GBXC 4J4PA 4HK0B 2W38A 3NH7L 5KZCB 1WBYB 3KYKH 2WBJC 5CCKL 1D5IH 1RVFH 5E9DD 2OR9L 3SJVE 3V6FA 3JTSA 4OZHB 4JN1L 5F44A 3CFIC 1DBKL 4HDIB 4Q9RH 3BAEH 2V2XB 5C0GA 1MREH 4PRBB 9CGTA 2Y36L 3CX2A 2P1YA 3QDGD 3RVXC 5C3TA 3RVTC 3I02A 1ZT4A 3D85D 4HBQA 4YK4C 2VZ3A 3P73B 4LHUD 5C0ND 3ZKMD 2GCYA 4U1HA 3X11B 4NNPL 1QSED 4YBQD 3U48A 5E4IA 3ZE0F 1D3CA 5KOMC 4TSAL 3CLFL 1P6FA 4PJ5D 2P5EB 2DJ4A 3H9SA 3BH9B 3MCKA 3QNZA 3FT4B 3NA9L 1FFNA 3E0GA 2KBGA 1A8JH 3N0PB 5FA4A 2EDRA 4P3CL 2C1OB 4IRJA 4ZUUB 3BW9A 1OCWH 5CINL 3GM0A 3VFUB 5JZ7C 2V7NA 2Q6WB 5IESH 1IC4H 3ILQC 3K2UL 1JBJA 3UX9B 5EO0B 1G1CA 2EH8H 5HYIA 3Q1SL 4LLMA 4LSQH 2VXSL 3JWDH 4GS7B 3WIIH 2MKWA 1OSZB 1IAKB 3D69B 2YPLB 3IS0X 1G6RH 4FQXC 1JGUL 1Q9WB 2ERJC 4K3GA 3WN5A 3OF6D 3B9KA 4W4NA 2GAZB 5IFJB 3SPVA 3GSWA 2EKSA 5JR1L 1NCUA 5I9QB 1UB5A 3M07A 4AZ8A 2IQ9H 4UOW0 4QRQB 3V8CA 5ESQA 5F1IB 4WWKA 3TA3C 4Y19B 4YHKL 4PB0L 3UBXA 1NAMB 5C8JA 1IMHC 4OB5H 4HFWB 5I1CH 2M2DA 2J6EH 1OAYH 1FFQA 5GHWH 1RZKC 3VE0A 1G6RL 5SWSE 1JMXA 2MTPA 3SKMB 4ZNCD 2H32A 2CO6B 3FO1A 3LKSA 5ISZE 4Y5XA 2WMPA 1F4WL 3G04A 3ARPA 4YGAB 2H3NB 5EU7C 1EPFA 1I9RH 1TDQA 5FYJE 5CD5D 5D6DC 4JO1L 5LAXA 1KTLB 2GSGA 4JPKH 5C0CE 4PD4K 2BVTA 2WWMD 3AMKA 4LCWA 1OAQH 3B9KB 3QHFH 4MD5B 4KI1A 3SGEI 1FAIL 1SJHA 1S9XB 4LFHD 5DFWH 1NL0L 3MOBL 5C9JB 1CXLA 2R9HC 2OYPA 3LIZH 4HUNB 4HKBA 1EHNA 1XGPB 1EGJL 1MCHA 5D7IB 5IMKA 4XC1L 2AGJL 5TDOA 3REVA 4MMZC 5T1KB 2ZOLB 3QNYB 1QBBA 4WV1A 4Z0XB 2E8YA 3SO3C 1RUKH 1E28A 1JNJA 1CLZH 3QI9D 3OB8A 4S0SD 3OKKB 4JRYA 4RBPK 5C09D 4OZGE 4GW5B 1SMAA 4NQUA 1TFHA 1CDHA 5TFSL 1D6EA 4GH7B 3RVVD 4RMUA 3QXWA 4RIRB 5IMLA 4H8WH 4X6EA 1R5VA 5CIPH 1Z2KA 1YQ2A 2HFFA 3PL6B 5EOCH 5C0RL 3VXSD 4KUCF 4AG4L 3BI9X 3QUYC 2E27H 2ED9A 4U6YA 5GJTL 1F13A 1BMGA 2XN9E 2HJFB 1SBSL 4HMCA 1U8PA 4X7SL 1LP9E 3FRPG 3QIWB 25C8H 3I3EA 5TFSH 4HUWB 1DE4A 3VXOA 5E5MB 3MRKA 4ZUSB 4FQ2H 1AO7D 5GSRA 5CD5C 3AU1A 3CVHH 2R56L 3RDTA 5IJVB 3HTLX 4MNQB 3D0VB 4GBXA 3BWAA 4J4PC 4EI5C 4PRIA 4ZSOA 4Y1AB 1OLZA 3DO7A 2VDML 4I0KA 4OJFL 3WO4C 4HS8H 4LSRL 2RIKA 1T2JA 4PR5A 3FQRB 5DQ9B 2D31B 5EZLB 4OZHA 1C16B 1MQKH 1ZTXH 1LO2L 3TZVD 4OT1L 3LKSB 5KS9E 1OTTD 4RGMB 2BNQE 2AXFA 4CN6A 3LAFA 3H9HA 1FV1A 4PJCF 3TA3D 4MJ6B 5EWIH 3IRPX 3H7BB 1JYVA 1HKLH 3O4LB 4JPVL 1EEZB 4X6DB 5HDBF 2IEPA 3UJIH 3WJJC 2GK2A 2H32H 4K2UL 3RY6A 4L8DA 2Z91B 4GFTB 5I8EB 4HKZB 4G6FD 3HB3C 1V05A 2NTFA 4UT9H 5EU4A 2I26N 1MQKL 1ZTXL 3BP5B 5ETUB 2X4SA 3QO0A 3LKPA 2VDPH 1UM5H 4PG2A 3DYOA 1MEXL 4MVBC 3DV4B 4JHWL 4KRLB 3AB0B 4NQSA 4U0RC 1XF5B 1BVLB 3QNYA 4Z0XA 2Q8AL 4DOHE 5F7NC 3L3JA 5GGSY 4WJ5B 2XZCL 3RVWD 3MLSL 4PJXB 2CDGA 1KJ3L 3TF7C 4PPTA 1N0LA 2PW2A 4UT9L 2DS4A 3K1DA 4ZO6A 5JOEA 2APBA 4JANA 2NY7L 2Y23A 1KJ2B 5D7SH 1SVCP 4MJ2A 1MCFA 3ZTNL 5FKAA 5IOPB 1MI5B 5INCA 2YD2A 4FQQA 4U6TA 3SKNA 4KROD 2PUQT 3MJ9L 4R2GC 1BVKB 3KWWA 5LCVL 3ULUF 5J1SC 4E41A 4OF8A 1NFKA 2FSEB 1DQLH 2EDXA 3GIVB 1A4JA 2HVJA 3BPNB 1Y0LA 5I8OL 4QXTA 2VH5L 4L5FH 3MV8A 4P2RA 4DJMA 2IPUK 5EU6B 2FL5B 3OJVC 2UY7A 4F8TA 5IWLC 1F3RB 1XCQA 4LSSL 2X4NA 3IJYA 2DF3A 5ACLA 5BV7L 3JWNC 1YMME 3HFML 1FV1B 1FGVH 3RI5F 4N90E 2ICCA 3O3UN 4DVRH 1MFAH 4UV4L 4L3EB 3GBNL 5LGHH 4MD0B 4W4OC 1WT5A 1ORSA 4MA8H 1NGQL 4NZUH 2BSTB 4P2OD 1Q1JL 2VDRL 5F7DA 4KFZC 1BF2A 4NQEB 3QPXL 4FZEL 4AMKH 4RIRA 5IMLB 1C5DA 2A6IA 1SJVA 2O26U 5D5ME 4XNUH 5HYJA 1OQXA 1KCUH 5GGSB 1X5HA 4XXDA 3BUYB 4OAWA 1VPOL 5HYSA 4CKVX 1KUMA 4AQ1B 2ATKB 4OKDA 2YUVA 3NACL 2EE3A 5SWSD 4PJ7F 5TDOB 3ARFC 3QHZH 4HZAA 4RMSA 5CIPB 1DBAH 5F9AC 5F8RC 4NHCL 3I6LD 2Y07L 4DZBB 3CLEL 1LNUB 3NFPA 4EXPX 4S1DD 1PYWA 4WHTA 1ITBB 3WFEL 2G60L 4RDQF 2NY3B 3NIFE 3ARFA 1TMCB 2GJ6B 1JRHI 3F7QA 1A3RL 1KPVA 5BJTA 3C5JB 1ORQA 3IDJB 1EVUA 4P2RB 1WWAX 4LNRA 5SX4H 4LPCA 2PN5A 2NX5D 4RAHA 4M61B 5IQ9A 4RGMC 3ARBC 2FHFA 1YQVL 1QFWM 1TVDA 4U3CA 5DWUH 5FYJL 4XI5D 3HE7D 4MJIE 4NDMB 2VR9A 1ETZB 3FMGL 5IW6A 1RZ7L 3GMNB 5C07A 4EDWL 1CN4A 4MAYC 2V5MA 4K3JL 3WN5C 2P5EE 4HULB 1K85A 1EZVY 1HH9A 1A6UL 3WXVH 2NYYC 4YAQA 1ETZA 1SJEB 3Q6FA 3W0WE 2XFXB 3WDIA 2ZSVB 3I6GB 3I6KA 5DUMH 1GGIL 4DN3L 4YPGB 2FECL 4X6CE 4M6ML 1CDIA 3GO1L 3WNKA 1EERB 2J5LB 3D9AL 3LS4H 5C3LD 3NCCB 5I30H 4H0HB 3SDDB 2EIBA 4FQCH 2YPKB 4I4WB 5MENA 1CR9H 5TH2B 3DO3A 3HI1B 3DMMA 4Z7VB 2GYSA 4PBWD 3QXAA 2D9QB 2DD8L 2XKNB 2F54A 5B22A 2MSPA 2EH8L 2R2HA 1AO7E 3O4LA 4X6DA 2CLVA 1MFDH 4M43L 5F1KC 4LLQA 1JJUA 3B5TA 5I1AA 2DICA 2UZXB 4WHTB 3BH9A 5LGJB 5BV7B 5F7YC 3WIHA 1A9BA 2DQFB 3CXHK 1MFBH 4Y7MA 1X6NA 2AQ2A 3QPQC 1RUPL 5K59F 1AI1H 1NAKH 3OJMB 1NH6A 5I1GH 3G08B 3D3VD 5INDA 1VFBB 5L6YH 3IFOA 5J12C 1A3LH 4V2CB 4YWGH 4PGCA 2HTKC 3SBWC 1NCDL 2APXA 3VXQA 3TIEB 3BPOC 4PJDF 2CKBB 3RPIA 1AFVH 4YX2L 1XGTB 2BY2A 4QXUL 5JDJA 1CLOL 4GKNB 1N3NB 3VFNB 4NKMA 4G7YL 2IMMA 4NP4H 3TNMA 1XF4A 2H8PB 4AEHH 4KDTA 4KY1L 2FECI 5EOTA 4FABH 4NUGL 2A74A 4Z0BL 2DQHH 4DZ8A 5IFAL 4XCNA 3ZKXC 2XG4A 2BVOB 1OGTB 4LDEB 3U79A 1U2HA 1ZEAH 3VFWA 3P77B 5JLZB 2X4NB 3IJYB 3F6IA 1UB6A 5CJBA 4LVHB 5C0EB 1C1EH 1EX0A 3PE9A 4RA0C 3V6ZB 1RSFA 2ZUXA 1FL5A 2J12B 1B0WA 1GOHA 3IFPB 3FN0L 4YLQT 1XR9A 3DVNB 1R3KB 2IAMD 4MD4B 3VD3A 3FOLA 5J6GA 3OB0K 1QBAA 2W0LA 3LRSB 4PY8I 4FTVD 3WNLA 3WS3A 4D0DA 3STLA 1YEDB 3TCLB 4R2GD 4IDLA 4IRJC 1LEKA 4N5EC 5L2KA 4XTRD 4XP5H 4PLJD 1TVHB 4ERSH 4EJ1C 3O8XA 3B9KC 3F12B 3LMJL 3RAJH 5IEHA 5T5FL 2IBZX 3IDIB 3PUCA 1NKRA 4WW2F 4BSJA 1E0OB 5IHBA 1A2YA 1MRFL 1OTUC 4XPFL 3C5SA 5IIEB 3OR6B 4JHAL 4P5TC 1JHLH 4PIRF 4OD1H 4I48B 1JWMB 1XGQB 2NR6C 1D5ZB 3RDTB 4JFXA 8FABB 4ZPVA 2EDWA 4XVSL 3U7WH 2WQ8A 3G04B 1AQDB 5E2VL 3OR7B 4DGVH 5D6CB 3RPKA 5E8DH 1QEWA 1W2KT 2AJUL 4LASH 4WW2C 4Q0XL 4D94A 4PJAA 2WBJB 1U42A 3LKRA 5KS9B 2FJHB 3UTPE 2FGWL 2ZOKB 3O6LL 4XPBL 4U3HA 2NY2B 1FG2A 1MRFH 5EDXA 1OGAD 4QXGH 3ROLA 2QR0B 4MA3A 2LAGB 4ODUA 1FCGA 3DRQA 4MNQE 4XP6L 4QRRD 2WIIA 1CXHA 2CGRH 3WFCH 1XR9B 2QKIB 1X5XA 5D6DA 3BSZH 2YS4A 3V8OA 2VISA 5IF0B 3QDGA 4X6FB 1FLRL 4Q0XH 5HI4C 1FDLH 1EUTA 4NQCE 4L29A 3TIDA 5EBMA 2CKNA 4Z5RA 5IG7A 2GJ6D 2I9TB 1HKLL 1UGNA 4GO6B 3D1MC 1MCJA 3B6SA 4LIQE 4Z78B 1B2WL 2BK8A 2IALB 4PYHA 3LDBB 3RIFF 3ABZA 1N4XH 1ORSB 3MCG1 1JE6A 1SQ2N 3H9SD 4HHAB 4CGTA 5ESVB 4HKBB 4HWZA 2DDQH 4G8IA 1G9NH 4IRSC 5KVGL 1Z5LA 1MAKA 2BCKA 2D0HA 4NZDA 2XIDA 4U6YB 1PKQB 3O2DA 4UT7H 2O61B 4FQXB 3SKJL 3CCHA 4QF1A 3U0WL 3GMLA 4QRRE 5C6TL 4MXWH 5KSUB 1CDYA 1JPST 2YKLH 4X9HA 4Y16C 1UZ8B 4PLKD 5FYLL 3VXUB 3F7YA 4W81A 1FC2D 3QXVA 3ARRA 3CFBB 5SWQB 3OAYH 5DYOA 3KPOB 2QLVB 5F3BA 4E0RB 3MFFA 4BYHA 2GY5A 3GJEA 4XHQA 3ZYOA 3BXNA 5GJTH 4NKQB 4MJID 4LVEA 1AHWB 1CGYA 2H41A 4N1CA 1CFQB 5BV7H 3HRPA 3BEVB 3FJTA 3HFMH 3L6FB 5FB8A 3GSVA 4LRNL 4JFDB 3W0WD 5AG8A 4WFHE 1V7NL 2GIYA 4G6AC 5KTEL 2BP3A