3HZKA

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKSIAVKWKIDGSERQNGVLNSWTDQDKKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkA01
2DDQH 4G6JH 3LKPB 2C7UA 1VPOL 2P5ED 1HQRA 4HT1H 3CXHK 4P2QD 4F7PA 1FRGH 4LARH 4JFEB 1SYVA 2DWDA 1DUZB 4OD3L 1RZJH 1XGUA 3TIEB 1OAKL 3QT2A 2W0FA 1CICC 4PLKC 4A6YB 1IQDA 3CFCL 5A16B 1LE5B 3IJYB 5EO0A 3M1BA 3O45A 3UYRH 3FFCA 2G60H 4X6DB 3UTTB 2ID5A 4F57H 5F9AC 4KY1H 2YPVH 3EO0A 3VFUA 2HT4D 5FAAA 1RUPL 1A4JB 2EH8L 1BMGA 3MLYL 1IT9H 1A6AB 3W11C 2KPNA 3O6FD 4I48A 5DQ9A 5IROA 1R3JB 4Y4FD 3P0VH 4U4BA 1DQMH 2I9TB 1KCUH 1TQBB 3SDAA 3MRLB 5FF6A 1QSEB 2CK0L 4PJAE 5IJKC 1I3RA 1L6XA 4ZS7L 4OD1H 4K2UH 5GS0C 2X09A 1NGZB 5HHOA 2FWOA 2NTSP 3MRRA 1YEEL 5DURD 4M62L 1ZA3A 1SEQH 3PGCA 2GYSA 3PIQA 4HF5H 4F58H 1IAKB 4PJ7F 4MCZA 2GJJA 4IOSD 1RIHH 3FB6B 2VAJA 4MD4A 3BRDA 5FYJD 4ZDHA 1DQJA 1H8SA 1I7TB 1J0IA 4M5ZL 4W4NA 1MCKA 1VDGA 2NXYD 1MCOL 4R96A 1U8NA 1QFUH 2V9TA 2XQBL 5GS1A 2WWKT 2DOCA 1FQ9C 1RZIA 1HEZA 3PV6A 2XPGA 3U0PA 3LZFL 1CT8B 3BIBX 1UWEL 1MFAL 1PX4A 3BUTA 1TXKA 3BO8B 3V0WH 5C07A 3X14A 2VQUA 2P8LB 3VRJB 5KVFH 2JK5B 3QCTH 1CE1H 4PP1C 2YC1A 5DHVH 5F7MC 5F7DA 3P9LB 4LRIC 5KN5B 4RGNB 4U49A 4DWHA 5A2JH 2A9NL 2YBRA 2V7HA 3V0AC 3FO9B 4LVNC 5DMIH 1U8IB 5LAXB 3NVQA 4UB0L 4QRQB 1IBGL 1CN4A 1VFOA 5C0ND 3BYYA 4JRXD 3P4LA 3GSWB 2W07A 4G6FB 1TCRA 1ZA6A 3VWKC 1U0QA 4NWUL 3LKNA 4OD3H 1VADA 1BVLA 1T1WB 1XFPA 4WWKC 1OAKH 3DYOA 4GAFB 5ADPL 4K71B 4UV7L 3HC4L 4Z7OE 3CFCH 2R1YB 3CPLA 2NY3D 4FQXD 1T7WA 3MA7A 4PTTB 5EN2B 3CDGA 1EFXD 1FFRA 3FQRB 2W59A 1U91B 5TF0A 3QG6B 3QFJB 3GBLA 1AP2A 4N5UA 4Y1AD 2D0GA 2EH8H 2IADB 3MLYH 2UY7A 2XKNA 1HYRC 2X4QB 3FN3A 5I9QC 3HE6C 1AGDB 4DN3L 4JGUA 1QLFA 3LKQB 4OLYL 2DB8A 5GQBA 1V5JA 4NRYA 2R2HA 1AGBB 2CK0H 5BQ7B 3ZL4L 4P23C 4JFEA 1DUZA 1AGEB 2P24A 4ZS7H 3LV3A 4QO1A 3TIEA 2IAND 5HTSA 1YEEH 1N64L 4M62H 1G7LA 5FM5M 5KSAB 4JFFB 4A6YA 4FFVD 4MLIA 2BXYA 3HC0B 4JQIL 3BKJL 3IJYA 3SDYL 4KJQC 2NXZC 3NZHL 2JKXA 4X6DA 5GHWL 3UTTA 3TYFA 5F89A 4QT5B 4M5ZH 2KQMA 1HYSD 1FYTD 4YHOL 1MCOH 4G7VL 2XQBH 5I8CB 3MA9H 3WS3A 1A4JA 3D85B 3PXHA 2D2OA 4HIJB 1SBBA 1F3JB 1R3JA 1UVQA 3D39A 3LZFH 1G0YR 1UWEH 1MFAH 1PLGL 2I9TA 2ILLA 5DWUH 4HWZB 3WYRA 2W0KA 4DN4L 3WJJA 2V5TA 1U8PB 3IDUA 3WIIL 4N9GB 4PJ5B 5DJ6B 1S7TA 4WU5A 4TNWF 1ZSDB 4OI8A 4G8IB 2UZXB 3B43A 3FB8A 1MUJB 3OAYK 1PAMA 4NBYB 4OF6A 4ZXBD 3BEVA 1BFOA 2UV3A 5JXED 3B4NA 5FGRA 2A9NH 1E6OL 1IAKA 3MRFB 4ORZC 3FB6A 5EU4B 1JBJA 3FONB 3WUWG 4LKXA 5E94A 1I7TA 1Y6MR 5F44A 4UB0H 3KJ4B 1IBGH 5ACMA 3HAEG 5DDHA 4MJ6A 2NLJB 2FJFB 5TDOB 3ZKMD 3HTLX 2BNRB 4NWUH 1NMCC 1JRHI 3QO1A 2G5BB 4N0UE 3RA7L 2VLJA 2MTPA 1CT8A 3LEVL 3EYQC 4N0CC 1QQDB 5D1QD 4UV7H 3HC4H 4NN7C 2EDJA 4WUKL 1DZBA 3BO8A 4CN6A 3VXUD 4KZDL 4F33B 3L3GB 1V3JA 4UAOB 3ZDZE 2AAVA 2P8LA 3AFLA 3HMWL 2JK5A 4LAQL 3KYNB 5E9DE 5KANG 5BVJB 3D0LA 3P9LA 1CZ8H 2OK0L 3BH9B 3ULUF 2PYEE 3FAWA 2F54B 1FN4B 2CLRA 5D96B 4NZRL 4Y4HB 1KXVC 4DN3H 1WWWX 3LDBC 5LAXA 4Q9QL 4OLYH 4QRQA 2BJML 4XX1E 4ELKB 3NCYS 5FO9A 3GSWA 3ZL4H 2VR4A 3ARDB 5ESVB 2HMIC 5ENWA 3KPPB 4ZFGL 4TVPL 1N64H 1IZKA 2IQAB 1KYOK 2O93L 2EDNA 5ID1B 4JQIH 3BKJH 5B8CC 2GJ6E 4G8EB 3SDYH 1CI5A 4PTTA 1L0XA 3NZHH 2R23A 2XICA 1MJ8L 5GHWH 2FR4B 3D6GA 1OL0A 1AD0B 1U91A 3QDGA 3QG6A 4KKBC 5C0RH 4PJEE 1NBQA 3QFJA 4YHOH 4NKDB 4G7VH 4PJFB 3T1FB 4G6KL 1FNLA 1HCFX 4DKAA 2NY5L 4OCNC 3QBTB 3KPRE 2RCSL 3OG6B 3MNZA 3MRJB 3LKQA 1E27B 5F9JB 1PLGH 3EKCA 4OUUB 1UZ8B 4DN4H 1AGBA 3MBED 5BQ7A 4HBCL 4IIQB 3WIIH 1ULVA 3M45A 3O8XB 3ZKSD 3QQ3B 4O4YL 3VD3A 5JW4N 4F9LA 3BN3B 5H35B 5CJBA 4GAJH 4QWWC 4XC3L 1E6OH 3ZLQC 4UIMB 3HC0A 1QPXA 3OKMA 4U1IB 3O0RL 1MFBH 1QNZL 2JJVA 3PWPE 5D93C 1JZ7A 4XRCB 3S6CA 3V6OA 2EE2A 1U8QA 4NKIL 4PJ8D 4A6YL 3MUZ1 3WHXA 1RJLA 1RK0A 4KUZL 1ZTXL 3T0WA 3FOLA 2VLRE 3GMLB 3PQYB 5IMLB 3D85A 2VIRB 3GNML 1K3ZA 3RA7H 2OTUB 1F3JA 3OBAA 3LEVH 2AERT 1SMOA 2XZZA 4OLZH 1K4CB 4KKCC 5HSFA 2DLEA 3VXSB 5I17B 4KZDH 3WO4C 2DIJA 4N9GA 4PJ5A 4NN5C 5DJ6A 3QI9C 2XNAB 2VR5A 3G5VB 3T0EB 3GSUB 1KLFA 3HMWH 3QXAB 1YUHB 3TN0B 1IKFL 1ZSDA 4LAQH 2H32H 4G8IA 4WHYH 5IB4A 4RBPK 2K7QA 1BZ9B 1K6QL 2C3HA 2X42A 4O2EB 1KLUB 2CMRL 1S9VA 3MRFA 5CP3A 3NCCB 4X7DC 1KPVB 3C08L 5DD3L 6CGTA 5DK0A 1Q9KA 3FONA 4NO5A 2XZCL 4NZRH 1P5VA 4JG1L 4POZC 4YPGB 5KOMC 3K8KA 4ZOEA 2BJMH 4CDGC 5SWSD 4JKWA 4KU1A 2NLJA 4J4PC 2Q6WA 2FJFA 5TDOA 2OI9B 5EZJA 3WLBB 2IJ0C 3QIUC 3OAZK 2G5BA 2J88L 1OWWA 3S8WA 4ZFGH 1WZKA 4TVPH 5D6CB 1AHWA 2Q87A 3MO1B 4P2QB 3HR6A 3FB5A 5JW3L 3IJHB 2ZPKL 3L3GA 1KT2B 2E9WA 4K94L 4QGTA 1MJ8H 1MFEL 3KYNA 3VW3L 1J5OH 5BVJA 3NIFF 1QRKA 4G6KH 1A3QA 4LHJB 1U36A 3ZSSA 4HIIB 4K9EC 1M6OA 2D7NA 1JHLH 2NY5H 5KOVC 3BN9C 4WV1B 4Z7UF 3UJIL 5F6IC 2RCSH 1R5IB 4Y4HA 3BZEA 3JWNC 3SDXF 5E8NB 1I4FB 4B0MM 3QUZC 5F7EL 1IEBB 3INUL 4ELKA 1EA9C 4G43B 2Z91B 3HMXL 1CWVA 3ARDA 4O4YH 2G5RA 3O6FB 4MJIE 2V2WB 3WJLA 4Y4FB 3CCHB 5DQJB 4ZUSA 3KPPA 4OIAA 3VXQB 2WBJD 1XCTA 1EMTL 1A7RL 2Y72A 5EC2B 5C0GA 1GZPA 4XC3H 3T8XA 3ARRA 4XPTL 3O0RH 1H3TA 1QNZH 4JN1H 4J3UA 4ZAKA 2FR4A 3C87A 4GRLD 5DURB 1AD0A 4NKIH 4X7FC 3VGHA 4A6YH 1G1CA 1HDMB 4KUZH 4PJFA 1FGNL 1ZTXH 1MVFA 1N8ZB 5IFHL 2WNGA 3GKWL 5HHME 3MCKB 4JREC 5I8OL 4OD2B 3GNMH 4HUNB 4UZGA 1B4JL 5D7LE 4BQ9A 3ARGD 1UWXK 2G75B 1E27A 5F9JA 5HI4D 4MJ4A 5EORL 3L1OL 4H0GA 1ZHKB 3M17B 5J9PA 2ARWA 3O8XA 3ZDXF 32C2B 1J0KA 3DIFB 5BV7C 1IKFH 3VGDA 4JZJB 5H35A 3MRQA 4R4BB 1LEIB 5FDWB 1CDHA 4V2BA 5TJWK 2IAMA 1K6QH 2CMRH 2FX9L 2R2BB 4UIMA 4ZG1A 1N7ML 3B9VA 3C08H 4U1IA 5DD3H 2R8SL 1DANU 2OSLB 2XZCH 2NY6C 4YNYA 5M95B 3TT1L 4JG1H 4XRCA 1NFDB 4P4RB 4YEEA 1FNEB 1PKQE 4OZ4B 2Z31C 3UO1L 4LDOB 2OXHA 5KS9F 3HLAA 1XZ0B 2OS7A 4WW2F 2NY0C 4JZOB 2X1QA 4Z9KB 5D2LF 4QXGL 2J88H 4NQED 1H3GA 1NC2B 4NPYB 1HILA 2P5WB 3VJ6A 4JRXB 3C8KA 1F8TL 1K4CA 2V17L 2IFFL 3VXSA 3FRPA 1VA9A 2PYFA 2ZPKH 3VMNA 4K94H 2PW1B 2XNAA 1EVTC 2Y06L 5DS8A 3T0EA 1B90A 3I6GB 2VZTA 3TN0A 1I9JL 1D9KC 3VW3H 2LQRA 1RZJC 2EEDA 4DVRL 4S10A 5HYQB 2XN9E 4FZEH 3RBGA 2GUOB 3OTTA 4Z76B 1KLUA 4AZ8A 4CW1A 1A0QL 4RMVA 1C5CL 4FQXB 3ZKNC 1J86A 5C0BE 1KPVA 4N90D 4Q6YA 3R0NA 3UJIH 4YPGA 4QLRA 3DROB 2DD8L 4MNGE 1AIFB 4X98B 1B9ZA 3LB6C 3O9WB 3UZVB 2E6QA 2XZQH 3FO0H 3H7LA 3QDJE 3INUH 3BDXA 1QSFD 1XF1A 1I1CA 1F4HA 3HMXH 4JDZB 5DRNA 3MJGX 5BVPH 1QPPA 4J3SA 5JW4Q 3KHOA 3LN5B 4PGEB 1I1FA 1A7RH 5D6CA 4ZSOE 4HKZB 3MO1A 4AEIL 1BQSA 1INEL 4P2QA 5D7IA 5F9DC 1U6AL 5JHDE 5CKGA 2CKNA 4QRUB 5KVDL 2PTTB 2X4OB 2BVOB 1AD9B 3AS0A 2ZNXA 4KRPD 5IB5B 2JJSC 3QUXC 1WCBB 4XAKD 4NNYB 3BQUD 3AMKA 3B9KC 5IFHH 4NQUA 3GKWH 2F5AL 1IEAB 2X41A 4HS6B 4LCIH 5I8OH 5J1AB 4CU8A 4ODTL 3ZE0F 2AKRB 1R5IA 1KELL 2R1XB 3T0DA 2YA1A 3BYTA 5E8NA 3VFPB 4X6EB 5BRZB 1JUFA 3RI5K 4BFGA 3QHTC 3IDMA 4PRHD 2Z91A 5E6IA 2YSSB 1T83A 3L3KB 2NZ9C 5D6DA 3CCHA 3FRUB 3QEQE 1OSPL 1E28B 4L3EA 2L4OA 1FLTX 5EC2A 3CDYA 4NGHL 3CVHA 1HXMA 2FX9H 4DUXA 1N7MH 2WIIB 2R8SH 4FQPA 3SJVD 3TT1H 1WAAA 3UTSA 4HJGB 1M7DB 3UO1H 1XIWD 4L8CA 4ONGL 4UINL 3NABL 1KULA 3HZVA 3P11L 2QKIB 4ZUUB 3UP1A 3NA9L 4WDIB 4RDQF 5CBAA 1Q9WA 4MHHI 2G75A 4HAFA 4JM2C 3RJQB 2P1YA 2O5ZH 1F8TH 1ZHKA 1AO7A 3TLRA 1MCSA 1E4XL 2H2SC 1JN6A 1P4IL 2IFFH 2X1WL 4O5LL 4PY8J 3SE3A 4U1KB 1DQQB 2Y06H 1CFQB 32C2A 3DIFA 3OSKA 2HFEB 4DVRH 4YHNA 5C0CD 2D7QA 5D1QB 1G0DA 1UZ6E 2YHGA 4GMTH 3ZHKA 5ETUB 3VXUB 1A0QH 2R2BA 1C5CH 4YC2C 5J6HB 3DECA 5KVGH 1EEQA 2OSLA 5DEFB 3MLTB 4JPVL 1JF5A 4IRJD 5F9WC 1NFDA 4P4RA 1XGRA 2X4PB 5T5NF 3FQWB 2DD8H 1FGVL 5EIQA 5HDLA 4HUUB 2Z8VC 3H0TB 4MMZC 5C71A 1XZ0A 5FYKD 1F6AB 5JDJA 4NQDE 4RGMB 5T3ZD 3U9UB 2Z92A 5I8KH 3U30C 4R26L 1NC2A 1ZT1B 2P5WA 4RZCB 3V5HB 4AEIH 1ED3B 1U6AH 2DIAA 3LQAL 3LVEA 3O6KL 3TBTB 1U8OA 4CVZB 2PW1A 5IHZA 4U1JA 1Q9LA 3I6GA 1HNGA 3OQ3B 5IBUB 2XI9A 1RULL 5J13C 1H3VA 4Y8DC 5TPWL 2GUOA 1BQLL 4YIQB 3IDYB 4FQXA 4PS4L 1AQKL 1T4KB 2ZJSL 4ODTH 1KELH 3DROA 2WIMA 3SEPA 1AIFA 2VXSL 4X98A 5TE4L 3VI3F 3O9WA 2HG5B 3QHFL 4I3GA 4TULL 5DC4B 1YNLL 2BNQD 1LVEA 2R1WA 2CSPA 2WUCL 1NSNL 4LLWA 4XVUC 1OSPH 3LN5A 4PGEA 5I1HL 5AEAA 1JPFB 4HKZA 3T3PE 4NGHH 4IOIA 4XI5C 1VACB 3MBEB 4LL9A 4QRUA 5E8EB 4MQXC 4YBLB 3F62A 1A5FL 5LXGL 4OGAD 2BVOA 3KPOB 1AD9A 4OIBA 3FT4A 1WISA 4NNYA 4ONGH 1L7IL 5TH2B 4UINH 1DFBL 3NABH 3F65A 4YO0A 4CMHC 3P11H 1FCGA 3LMJL 2D7OA 3I6LE 1CF8L 3NA9H 2AKRA 4P2OC 2R1XA 2R29H 1Z3GL 2X1PA 4PJ8B 5E6ZA 3VFPA 1LQSR 4X6EA 1XMWA 4MA3B 2YWZA 5BRZA 5M94B 4D0BA 1I8LC 3MV9D 5IW6B 3HS0B 1E4XH 3B9EA 1P4IH 4O5LH 1T0MB 4RX4A 4WHCA 2VWEE 4HS3A 1T2QL 3L3KA 3L95B 3PWJA 1HQ4B 2DLGA 5JO5B 2V2TA 3P4MB 4RQQA 4XPFL 1UM5L 5E8PA 4HS8L 4MDJA 1E28A 1JPGA 5C08D 4AENA 3QIWC 4FMFA 4JPVH 1NGXA 1FGVH 2VWEC 1CL7L 1BZQK 1KCVH 2ERJC 2WWMD 3BP5B 1M7DA 3CVHL 4KGJA 2JCCB 5FHBH 5ID0B 5JPMB 2RAMA 1FC2D 1A6TA 2QKIA 3G5YB 3WLWC 3FQXA 2DJUA 1CGUA 4ZUUA 4JFYA 1QTYT 3VFMB 4XPAH 4R4NC 3NCMA 2WQ8A 4R26H 2JLLA 2AI0L 2EEBA 5SWSB 1OCWL 3LQAH 3O6KH 5MEND 1MCHA 3PHSA 2BVQA 3IDJB 3G6JB 1DQQA 2R9HC 4U1KA 2H3NA 4BK5A 2C1OB 4O58L 2HFEA 3MCG1 3MOAL 1RULH 4W6XB 3FFCE 5LG1A 5TPWH 1TCMA 5ETUA 1BQLH 1FNAA 1A64A 1B4RA 4PS4H 1AQKH 4AIXA 5I1DA 2ZJSH 5DEFA 1O7SA 3RWIB 1DR9A 4IS6A 2X4PA 2VXSH 5TE4H 5CLWA 2ZOLB 3QHFH 5I73B 4LHUB 3MRHA 4TULH 4WW1B 1GGTA 3BIKA 5CCKL 3RTQA 4TNVF 1JTPA 4YK4B 5K9QI 4JZNB 3NCBB 1LEGA 1F6AA 1IJ9A 4ODHL 4OCXL 2M8XA 3U7AA 2WUCH 2CRMA 1FLRH 2XRAL 3BE1L 3DRQB 1NSNH 2FX8L 5I1HH 2X89D 4EUPB 2N7AA 2AXFB 1LD9B 4NKOA 5DD6B 3TBTA 5HHOE 2VSCA 4CVZA 5F1KC 2YUVA 1A5FH 3SDDA 5LXGH 5IROC 5HVFB 1G7PB 2X5PA 3P0GB 4TUJB 3SDAC 1OWRM 1DFBH 2MCG1 2ICCA 2H6PB 4YIQA 4NYLB 4Z7UA 3LMJH 1V8HA 4L1HA 1CLCA 1YEJL 1T4KA 1CE6B 1CF8H 1NMAH 2QLVB 4GRLB 1KPUB 2MPAL 1RJZB 1Z3GH 2MMXA 4Y16B 5TE7H 5EOQL 4CVXB 4K3HA 5IW1A 1NCDL 4LLQB 5E1HB 4ZNCD 1T2QH 5CGTA 2NY4C 3JUZA 3ARFD 2XIDA 4OQ1A 3ARGB 2JE8A 5JW5B 5C07E 4XPFH 1UM5H 4HS8H 3RY4A 4PV9B 1JPFA 1A7NL 5ISZE 4K8RL 4P9ML 5GS1C 3MBEA 3B5GA 4ODXA 3TEUA 4KQ3H 3IGAB 3D18B 5DJZB 1XGPA 5E8EA 3VI4E 2JTDA 8FABB 3D3VD 3KPOA 1CL7H 1RJYB 1G7MB 3P30H 2CIKA 5TH2A 3FAXA 5LBSL 3DRTB 4LNVA 1OHQA 4N8CL 4MJ2A 1X4XA 5E7FA 5L2KA 3ZE2E 3ZSTA 3UDWC 4TVSa 5F7KC 1WEJL 4GT7A 2AI0H 1OCWH 5IW6A 3HS0A 4FA8A 1T0MA 2MKLC 1MCEA 4TQEL 3L95A 1ORQA 3F5WA 1HQ4A 5JO5A 5C0AD 1I8MA 4XWOD 3KYAA 4O58H 3VMPA 3MOAH 3TM6A 3O2DA 2XWTB 3PWLB 5I1EL 2X70B 3KPQB 5KVEL 4KRNA 3BWAB 3WFHA 4NNXB 4ZFFA 5JHLL 1T6WA 3BP5A 1U3ZA 5JPMA 2FO4B 5FUCE 2JCCA 5ID0A 2IFGA 5CCKH 4WW2A 3H3KA 5DZOA 2ZG2A 3U4BL 5D2LA 2DI9A 3G5YA 3WEXB 4BQ6A 3QIBA 4ODHH 4KV5F 4OCXH 5E5RB 4JFOB 4FN0A 4NHCL 2NY5C 3VFMA 4ZQKB 2XRAH 3HPJB 3BE1H 5I16A 1QKZH 2FX8H 4PTUB 4RA3A 3VXME 4L4VD 1T66D 1DE4B 1QSFB 3PP3H 1KPRB 4LEXL 2ZUQB 5FUCC 3G6JA 1YEGL 3C9NB 1FL3A 1CFSB 1ACYL 1FG2B 2EIDA 5ICYB 3DXAD 1QYGL 4F7TA 4MS8C 3WNPA 3P4NA 3GRWA 4LCWD 4QOKE 4X6DE 3DX7A 3UTTE 3V9FA 1XR8A 4YHMH 1P7QB 1K85A 4Y5VB 3K4AA 1YEJH 2A6KB 1BIIB 5HHVL 3HB3C 2MPAH 2XT1B 4KRPB 1G7JB 2XG4A 5FB8B 5EOQH 1OAZL 2YD8A 2ZOLA 3ZZ1A 4PJXE 4LHUA 4WW1A 5B38A 3BQUB 1NCDH 4X99B 3S96A 3RZCB 3D39E 1T1ZB 5IG7B 1QVOA 4MXVE 3DRQA 4YR6B 2C4FT 3PF2A 4O51A 2F5BL 1FNGB 1A7NH 1A14L 1WIPA 1XCQB 4C56D 2AK4E 4K8RH 4P9MH 5CEZL 4CVWA 4CNIB 5DD6A 2XQYK 5DEGA 4M8VA 1A1MA 1LMKA 1IEHA 3RHWK 2P45B 3T08A 1QR4A 3KHQA 3FKUS 4MZ3A 3AREB 1WFUA 1TQBC 2M26A 4TUJA 5LBSH 2VKXA 3WJJC 1T03L 1TVHB 4NYLA 4U1MB 4N8CH 5C1MB 4ZODA 3SJVB 4ALAL 3RVTC 4YZFF 1RJZA 1XF4A 2HJLB 1ZLSL 3C2AL 4Y16A 5EG6C 3JXAA 1XIWB 1WEJH 4YHIB 3HI1B 1OLLA 4XNQB 4P48A 2VLJE 4OV5B 1WF5A 3QH3B 4X4YB 1C5DA 4TQEH 3CD4A 2EO1A 4PRNA 5EZLB 4HCRL 3BHBB 5IR1B 4JHBA 3B2UD 3OJDB 4Z7NE 3S5LG 5JQ6L 2HKFH 5I1EH 4A2LA 1JV5B 3IGAA 4M7KL 1A1NB 1A6PA 4K94C 4R0LB 2DM7A 3DRTA 3U4BH 2DKUA 4F7EB 5B38G 2V7NA 3N50A 4JVUA 4X6CE 1CICD 4QCIA 4JR9L 1FZJA 1UGNA 4P2RB 5JOPE 4G9FB 5FV1L 2ZCHL 4RGNC 4LEXH 1C16B 1II4E 3GIZH 5DGRA 1YEGH 1OAYL 1ACYH 1NCBL 5DD0L 1QYGH 3SN6N 3W11D 1I1AA 2XWTA 4ZMAT 2DQTL 3RWCB 4V1DB 3D9AL 3BGAA 1GGBL 3KPQA 3QDGE 3U0TB 5DXWA 5DJXA 3QFJE 5TE6L 1MAML 5HHVH 1O0VA 4HX1A 5CWSB 4OIIL 1OAZH 3O2DL 2FO4A 3WFBH 5GISL 3L5XL 3VXRA 3ZHLA 3ARZA 4K71C 5HGBB 4OGYH 5GS0D 3QWRD 4WU7B 3WEXA 1F6LL 1U9KA 4QRSA 1M05B 3HUJA 4ZQKA 3FCTA 1BVKB 4PTUA 2F5BH 1A14H 4ACPA 3TZVB 2BSRB 1I8KA 5CEZH 1DE4A 1KPRA 3HPLA 4C4KO 5MEQB 4M8QA 5MHSD 4M3KB 2VN4A 3HI6L 1QBLL 4O02L 5ICYA 1X7QB 2C3VA 4PRIB 4ELMB 3AS3A 5SX5K 3U46B 1IE5A 2CUHA 4KK6C 4P5TA 3OWEA 4HULB 2R0WL 4PJDF 1T03H 5I1JL 3V6OE 1P7QA 5D5MF 4MA8L 1ZLUK 4ZUTB 4Y5VA 3QNXB 2AW2A 2A6KA 5GJSL 4ALAH 5FYLL 5ACZB 4F9LC 1G7JA 1ZLSH 3C2AH 5FB8A 1G7HB 1NCCL 3GRWL 3NACL 2QHRL 2HTLC 4KUCF 4PBWD 5ECJE 4X99A 3I9GL 3RZCA 1UXSA 1I7ZB 1EEZB 4EI6B 3MV7A 5IBLC 4RFNC 1T1ZA 4M1CC 4HCRH 4AIOA 4ZTOL 4WHTA 2OX5A 1Q0XL 1F3RB 5T33H 2HT3C 1XCQA 3O3UN 3MV9B 5IESL 2Q7NA 3DSFL 4CNIA 5DMGD 2QSCL 1ZT4B 5JQ6H 4EDWL 4M7KH 4OZGF 1F58H 5F8RC 4QHLB 4R4FL 2JJUA 5F7HA 3VWKD 3AREA 2FEEL 1K5NB 5C08B 3IYLW 4FFWC 1TVHA 3VE0A 4U6VL 4WWKD 2MKWA 3MV8A 1ZLWH 2FGWL 3CNKA 4XBEL 3D2UB 3DV4B 1W72B 5HHNA 4MD5B 3P40A 4OFPA 5C8JB 2HJLA 2HVJA 4J6RL 4JR9H 1RZ8A 1Z0MA 4YHIA 1GOHA 1R5WA 1P9MA 4XNQA 3T77A 1J0YA 2ZCHH 5CJ5A 4OV5A 4LKCB 3QH3A 2QQNH 5F7YC 3DUSB 4I0PA 3EDDA 1OAYH 5EZLA 4C57C 1W0WB 1NCBH 4XNZB 1ZHNB 2VN7A 5DD0H 2IQ9L 4PJIF 3U1SL 3KJ4C 3BHBA 2J5LB 4PJCF 4D3CL 1WV7T 4LSRH 3HE6D 3HZMA 3OJDA 1BLNA 2DQTH 2UUDK 4OZIB 3D9AH 1GGBH 3BUYB 5TE6H 1A1NA 1MAMH 5T1KB 4R0LA 2V6HA 4DVBA 4OIIH 1ZVHA 3O2DH 1AHWC 4P23D 1J8KA 5GISH 2AJSH 1PKOA 3V79C 2ESVB 1L9MA 3DURB 4RAUB 4U2YA 4LSUL 1VCAA 2DL2A 4LLVB 3QCVL 4UAOC 3IVKB 2ADFL 4X4XB 2Z0BA 4P2RA 1D5ZB 1A47A 4KJQD 4G9FA 2NXZD 2ZWLT 5D7KE 1NCAL 35C8L 3W0WB 1C16A 1XF3B 3TIDB 4KVCL 4G8GA 2VDKL 4KXZI 1CFNA 3SKJH 5D96C 3HI6H 3R06B 4Y4HC 2NR6C 4G80A 1U8KB 4TTDC 3V5DB 2X9WA 5T1LD 2KH2B 3U2SB 3TPKA 1NGQL 4ZFZB 1KUMA 1OGAB 3C5SA 2E6JA 2R0WH 5I1JH 2P8MB 3PWVA 3U7YL 2NCMA 1EAPB 4V1DA 3UROR 4MA8H 3U0TA 3ARDC 2ENYA 2GK0A 5GJSH 2ITCA 1CGSL 3PABB 1W0VB 4PJFE 3WJLC 3V4PL 4N1CA 5CWSA 4GRWB 4AT6B 3NACH 3GRWH 2VLKD 1NCCH 5E0QA 4UT6L 2DS4A 2QHRH 5T1MA 5DMKA 4W81A 3OKKA 3NFPB 3I9GH 3VWJB 3EDJA 2IMNA 5BJTB 5CEXB 1EJOL 2A38A 2ZG3A 4MGXA 3L3IA 2VXQL 3MMEB 4XCEA 1M05A 1S7SA 5CZVL 4ZAKC 4S1QL 2EDOA 2MHAB 2P7TB 4ZTOH 1BVKA 4LLYB 5EOCJ 1ONQA 5FECB 4WENB 1EHAA 3TZVA 5IESH 2BSRA 3PDGA 3LRGA 1SJHB 3DSFH 2QSCH 4Q6IB 2V2XB 1XF5A 5MEQA 4EDWH 2AJ3A 4R4FH 1S78C 3STZB 3KPSE 1DBJL 4EUPH 4P99A 1X7QA 1X5JA 4PRIA 4ELMA 3U46A 2KZ1B 4FZ8L 4E41B 4U6VH 4IIQC 3UMTA 4OCWL 4Q74A 1DCLA 2FGWH 3EYQD 3O8XC 4XBEH 4N0CD 5FGCB 3QNXA 4ZUTA 3RVXC 2ZCLH 2KUTA 2M1KA 3D3VB 3NGBC 4D0CB 5ACZA 1QZ1A 3E0GA 1G7HA 2GSGB 3C09B 2ICWJ 4JY6B 2K7PA 1H9VA 3QRGL 1IGIL 3ZE1F 5EULV 4Q2ZB 4EBQL 1G1YA 5GZOC 5HHQA 1JYXA 4GXUM 2IQ9H 1F5WA 3TGXA 3T0EE 4D3CH 4G5ZL 4I9WE 2I25N 3UPCA 3LQAC 2N56A 4LASL 3RWGA 3P77B 5MI0B 1MCQA 5E9DD 5EBMB 4BFIB 4GJTB 3OGCB 2EECA 1IL1B 4UMGA 2HMID 2PYED 3UTZB 4MXQC 2WZPD 4LSUH 1MJUL 3QCVH 4LSQH 3D2UA 3DV4A 2ADFH 4PLNC 4MD5A 3T0EC 3MX0A 3TN0C 4E5XA 3BT2L 5C8JA 1LNUA 1A22B 1KJVA 1D5IL 1H3PL 1ES0B 35C8H 3VFWB 4BKLB 3DUSA 3CUPB 4KKBD 4KVCH 2VDKH 3S34L 1V7NH 2B1HL 4X4ZA 5DA0B 4EQ3A 5D7IE 4DKFL 1W0WA 4ODBD 5F1OB 1ZHNA 4NUJB 1NGQH 1MEXL 3LHPH 5T1DL 5FKAB 4MVBC 3U7YH 2OI9C 1HZHH 2GJ6D 3DMMA 1CGSH 1VENA 5T1KA 2VL5A 3SY0B 3DXAB 4LCWB 4QHMB 3RGHA 2ESVA 3DURA 1EJOH 4RAUA 4MHHG 3LSOA 5CZVH 3RP1A 3QZWA 5CKAA 4S1QH 1X5GA 4QWWD 3KPRD 2OMNA 2DRUA 3LPGA 1EZVY 4DZ8A 1EHXA 2APXA 5I8EB 1NBVL 1D5ZA 2GCYB 3DGGB 3RPIB 3RKPA 3W0WA 1EZVX 4XAWL 1XF3A 3VXTB 4L3EE 3TIDA 3R06A 4WTXA 1DBJH 1U8KA 4XTRC 3V5DA 2ED8A 3DX9B 1OGAA 1WAAE 2BCKB 1HH9B 3UTSE 3RJDA 2P8MA 5E6IC 3GBNH 1EAPA 4OCWH 2YXMA 1T83C 1ZWIA 3QHZL 2D7TL 5IBTL 5B39B 2FH8A 1W0VA 3PABA 3PWPD 5D6DC 4YAQA 4JPKL 4PD4K 4GG6B 3QI9D 1NEZA 3NFPA 3VWJA 4ZOBA 4YDLC 5CEXA 2VLRD 3ZMRA 4M1DL 1VKXA 1IGIH 2AQ3A 5HY9A 3VD4A 4EBQH 1EUTA 1WFNA 1AO7E 1BIHA 1ZK9A 2MHAA 2P7TA 2XXCB 3ARUA 4LLYA 3V4VL 3BIAX 4G5ZH 3W39A 4XCFL 3NIDF 4POZD 4Q6IA 2DI8A 4NC2B 4Y4KB 5FM4A 5F88B 4LASH 1K3IA 1E4WL 3U82B 3STZA 2EDFA 3E6HB 1I9RL 1S7VB 1T21A 3TFKD 4J4PD 4JRYA 1NJ9B 5JQHC 3QIUD 4E41A 3OL2A 2UVEA 4B7IA 1P84J 1MJUH 2A73A 2YN3A 3SE3C 3CAFA 1P4BL 4Y5YB 3D3VA 3G6DL 1P5UA 4D0CA 3QZWG 2GSGA 3QNYA 3SE8L 2MQ0A 2CXGA 1A9EB 1BGXL 3VMOA 1D5IH 1H3PH 3EFFB 2D7PA 3RL1B 4JY6A 1RV6X 3I85A 3ZKXC 3FN9A 4J8RB 3WNLA 2UWEB 3S34H 1GRWA 3MREB 3TO4D 4OFYD 4DKFH 3DX8B 3GSVB 2PETA 4J3VA 5T1DH 2VISB 3PV7A 3BN9D 1CXEA 3VFGL 4AG4L 2EYTA 3MRKB 2HA1A 3ULUE 1FZOB 3QUZD 3P77A 5IF0A 4NQVB 2ADIA 4RWYL 2AABL 5C0NC 3OGCA 4HZLA 4PJGF 1IL1A 1X44A 1D6EB 2C1PA 3G5ZA 3UTZA 3QJHB 3T0AA 1NEZG 3MUY1 3S3SA 1MHHA 4KRLB 1MH5A 1EERB 3FQNB 2AJXL 5CILL 3ULUC 1NBVH 2VZUA 4KDVA 5L9DH 2DIBA 4LLUB 1ES0A 3S36L 4FQXC 2CDFA 4XAWH 3VFWA 5ABDE 4JO2L 5BXFA 5DFTA 2BOBB 5ILTL 2OCFD 3MRDA 1X4YA 4X7EC 5INCB 3MGOB 1H8NA 2HWZH 1KLGB 4YFLF 5TQ2L 4NUJA 3O9WC 4JKMA 5HGHB 5J7CC 1GIGL 4PJAB 5DVOA 5T3ZH 4K8RC 1YEIL 4H26A 4Y8AA 3SGDI 1RIVL 3QHZH 4FQCH 3S4SB 3ZYZA 5IBTH 4B50A 3ULVF 4JPKH 1RI8A 2Q1EA 5DD1L 2A6JB 2XZAL 4XP4L 3U0WL 4RMQA 1A7BA 2DQUH 4YWGL 1AC6A 5HHMD 4M1DH 4TNWK 5BRZE 3HC3L 4S1RL 1MLBB 2Y25A 1FBIH 1RMFL 4JDTH 4XNMB 5EPMA 2YXFA 5D7LD 5I8EA 2CIIB 4WI7A 4BA8A 1DSFL 1X5KA 1A2YA 1IGFL 5C0DA 3V4VH 3CXDL 1XT5A 2NY6D 1ZHBB 4XCFH 1KOAA 3F58H 1SEBB 4QRRE 1AQDB 3RPIA 2F9BT 2Z31D 5L8JB 2HLAB 1E4WH 1SHMA 7FABL 3T4AB 2GITB 1I9RH 3MJ7A 3DVIA 2NY0D 3BGMB 2H26A 5HHXL 1Z0NA 1LE9A 4OLXH 2BCKA 3PGDB 5EBGA 1YN7B 3RWFB 4JQVA 5CBEA 1P4BH 2E9BA 3G6DH 4XP5L 5K9QG 2OZ4A 3SE8H 1NGWB 1A9BB 3HNVL 1BGXH 1DDHB 1KCLA 4MWFB 5C2UB 1ETZB 1F4XL 5D1XB 3SGEI 1D9KD 5GGRB 1JI1A 3WO3B 3GMMB 3W5NA 1FPTH 4DW2L 4NFBA 3ROLB 5KSBF 1TETH 3ECBB 3ZKND 3O4LB 1GL4B 4KH2A 3VD5A 1PG7X 1MY7A 1PZ5B 4OM1L 3VFGH 4AG4H 1DTUA 4Y4KA 2O5YL 5J57B 3SBWA 5EO1B 3IDXL 1T0NB 2RFXA 3E6HA 2AABH 1NJ9A 1CGTA 2A74B 2E3VA 2C4XA 3HE6B 4JKKA 3FO2A 4LPXA 5C0BD 2KZWA 3NIGF 2VITB 4L4TA 2DQFA 2YD9A 4P23B 5CEZE 2FECL 5CILH 1JNHB 2ORBL 5GZNC 2ATPB 1A9EA 4D8PB 3QDJD 1F13A 4OT1L 2LE9A 3HZKB 1BM3L 2UWEA 3EOAB 4JO2H 3RUGA 4ZYKB 4AM0B 2PN5A 3MREA 3VXNB 4PJIA 2XACC 2ZSVB 3DX8A 3B9KD 5EUKB 4I0CC 3WS6A 2VXTL 5C6TL 3IFLL 2NXZB 5CD3B 3RTQC 1A1OB 5E08L 5ALBL 1S7UB 3NIFE 1YEIH 4PRDB 3N85L 3SKMB 1RIVH 5JHDD 4WFHD 5IM7B 1MCNA 4RGMC 3GFUA 4IMLB 3MRPB 5ESQB 2R0KH 4Z7UE 5DD1H 1AR1C 2NZ9D 2XZAH 3MROB 2IH1A 5ICXB 3SDXE 5IHBA 5GS3A 4XP4H 3U0WH 3BEWB 5ITBL 5C3TA 2Y36H 3PGFL 4DUWA 4YWGH 3QJHA 4WFGE 1P7HL 3HG1A 3VG0L 3BJLA 4HEME 2VDOL 3HC3H 1FVDB 3SDDC 2D7MA 1RMFH 3FQNA 4L3AA 4LDLB 1ZGLP 1DN0A 1DSFH 2Y7QB 3THML 5F6HJ 4K7PX 5DJYA 3CXDH 1M1SA 4NUGL 4LLUA 3DI2B 3I02B 1YNTB 4J1UB 4OM0L 3QEGL 4G8FA 1OP3H 3TCXA 5INCA 3MGOA 4LPUA 7FABH 3QEQD 1KLGA 4HIHB 1OB1B 3BP6B 3FB7A 5HHXH 3U36B 3SKOB 4PJAA 2JB5L 15C8L 4JM2D 1MIEL 4Z77A 3S4SA 4HJ0C 5J11B 3DUHA 5JIPA 1P7KA 4XP5H 2H2SD 1NMCB 5DFWH 5CHNB 3HNVH 5L2KE 3MBEC 3KDMB 2NX5A 4WNQB 2B2XL 1NQBA 4MQ7B 4GRWH 4DW2H 3MLVL 4YBLC 1MLBA 2CD0A 1CQYA 5EDXA 3O3EB 1QA9B 3QXTA 2CIIA 4FQ1L 3ZDXE 3UTQB 2XXMB 1GC1L 4OM1H 4PRAB 1R3HB 1VESA 3NFSL 3VDAA 4JFDE 4D9QE 2O5YH 4NO0B 5IOPA 4CGTA 1FIGL 1FIEA 5J6GB 4N0UB 2BDNL 2HLAA 4P0DA 3IDXH 3T1WA 4UTAL 1LO4H 3T4AA 1KBGL 5CS7A 1S8DB 4PJ8C 4ZPTA 4WCYH 3MRCA 3QXVA 3BGMA 1UB5B 1VEMA 1BECA 3T2NL 4CU7A 4BSVB 2JCCE 3U4EB 4PY8I 1YQ2A 1CXFA 5JA9A 5D2LE 3BSZL 3EO9H 3EJYD 4UIKL 5BZDA 2ORBH 1DDHA 4OT1H 4MWFA 4LGPB 1ETZA 5D1XA 1QO3A 4ZPVA 3QDMB 1BM3H 4BSJA 1RZKL 1K9TA 4MJ5B 2DTSA 1YECL 4NQDD 2OZ4L 4Q9BA 3ECBA 2W9LA 2VXTH 4LQFL 3O4LA 5C6TH 3UCRA 3G6JE 1GVIA 3IFLH 2IALB 4WW2C 1U93B 1PZ5A 1DBBL 1CCZA 5ALBH 3N85H 3QIBC 5FYLE 5IHLB 4AYFA 5K33A 1XEDA 2J2ZA 1L0QA 1T0NA 3S4SG 4N0YL 1OTUC 2A74A 1HXYA 4UUJA 4U0RB 1H0DB 5ITBH 3ARTA 3PGFH 1EUUA 4EDXB 4J3OC 4Z0XB 4XVUD 2GJ6B 3ES6B 4OZHF 3E6FA 3VG0H 4F9PA 4X7CC 4P3WA 4XI5D 1IGML 2BSED 4DUVA 2Z93A 5IQ9A 1J1OH 1P1ZA 4PJEB 3THMH 3ARBA 4MQXD 2CLZB 3O41A 4HUWB 4NUGH 3HFML 2AXGA 1X5LA 2UZIH 4FXKB 5DRZB 3EOAA 4UQ2B 4OM0H 3QEGH 2CRYA 5DJ2B 3VXNA 2ZSVA 3HCVA 5EU3B 5IVXB 5I73C 4KJPC 4QHUB 5CD3A 1WK0A 1F2QA 2N4IA 1C7SA 4P2OD 1INDL 1S7UA 2CR6A 3GKZA 3ALXA 3SKMA 15C8H 1MIEH 1HKFA 4ISVA 5IM7A 4PFEA 3NBNA 1IAMA 2YZ8A 4IMLA 4Y2OA 3UJJL 3MRPA 2RJMA 5ESQA 3HRZB 3KPLA 3OKEB 2AS5M 4M02A 4JANB 5AAMA 2HN7B 2B2XH 2WLYA 4M6AA 3I6LD 3QFDB 3VRLE 3MLVH 3PWPB 3AGVA 2BVPB 4KK5C 5EBWB 1MAKA 1DBKL 2FBJL 1MY5A 5E1AA 3K7UA 3A67L 1GC1H 4PGCB 1G9NL 2VLRB 4LU5H 1URLA 5L6YL 5ANMB 1YNTA 3P3YA 4J1UA 1FIGH 1VGEL 2BDNH 4OCLC 4UTAH 2Q76B 3EHBC 3D25B 1KBGH 4Y16C 3WLWD 2WUBL 1OB1A 3BP6A 3OZ9L 3RAJL 1UACL 1YJDC 4BH8B 3SKOA 1PG7L 1MIML 3T2NH 2X4UB 3W9DB 1XAUA 5C0JB 1CD0A 3OKLB 1QSZA 3BSZH 2HP4A 3QIUB 4KDWA 5CHNA 2R9HD 1TTUA 2BC4B 3X3FL 4AEEA 1RAMA 3ARWA 2FHFA 3KDMA 1V7ML 2WAHA 2W38A 1RZKH 4MQ7A 4Y5XA 1QFWI 3U4AA 1YECH 2IBZX 2OZ4H 4R90L 4MNQE 3VA6A 3KNBB 4PJBF 1HK6A 3DJ9A 2DQIH 3GM0A 3T2OA 1DBBH 1R6VA 2HLFC 2G9HA 4NO0A 3TO4B 1JGEA 2XWJB 4Y2DA 3EFDL 4N0YH 1S8DA 3VFTB 1P2CB 3MZTA 4HH9A 3OR7A 1M7IB 2YPKB 1XGQB 3FFCD 5F6IB 4P3CL 3EO1B 4KK8C 4WI9A 5JUEL 3SCMB 4BSVA 2I26N 4OZIF 3VXRE 3QUZB 4X0KB 1IILE 3FQUA 1IGMH 2YMXL 5A43C 2CDGA 3V6FB 4AH2B 3HUJE 5HD8C 1EGJA 3DTXB 3HFMH 2YA2A 3PWNB 3SO5A 3RIAF 1CR9L 3QDMA 1AGCB 1VSCA 1Z9LA 3GMNA 5JA8B 2DLTA 3SDAD 5GIRB 5JR1L 4GW5B 1FG9C 3Q1SL 2DF3A 1KC5L 4YHLL 3IF1A 1FAKT 1MFDL 3MV01 4HC1H 1U3YA 2IALA 4XMLL 2QTEA 1N59A 2K1MA 2ZUYA 2B20A 1INDH 4JPIA 5FCUH 2EZ0D 5HHOD 1SBSL 2X1OA 4OFDA 5F7WC 4MJIB 3GGWB 2X4SB 3UJJH 5L7XL 1U41A 5JMRA 3LN9A 2QSQA 2NY4D 3SGKA 4U7KA 4XPBL 3CFKA 1H0DA 3RU8L 3EDEA 2ZUQC 3ES6A 5KBNC 3QUYA 4W6WB 2ZOKA 3ZTJH 1DLFL 3CIQA 4TN9A 5T3XL 1J9CT 4AK1A 3ZT6A 3V0VB 2FBJH 3WSQL 3MV7E 1BVZA 5DK2B 5BW7A 3PJSB 4P5TC 2CLZA 3A67H 1D6VL 5TF1L 1UEYA 1G9NH 5HHMB 5L6YH 1I75A 3IDNA 4FXKA 5DRZA 3TBVB 4Y5VC 1VGEH 5B3JF 5DJ2A 2J12B 4KRPC 1GGCL 2ICWB 5C07D 5EU3A 1FSKB 2WUBH 4GKNB 5IVXA 3OZ9H 4XCCL 2ADJA 4QHUA 3RAJH 2NY6B 2IPUK 1FZMA 4Z7VF 3FFDA 1PG7H 1MIMH 1RUML 3RZCC 4HJJL 4N9OB 2AEIT 2K9UA 3DVNB 3REWB 2GT9A 3DO7B 1DLHB 3OXSB 2NY0B 3MJ6A 4RMTA 4AL8L 2H2PD 3MV8E 3CX2A 5KZCB 1SVCP 1CDBA 3RGVA 1EFQA 3X3FH 1V7MH 2HN7A 4X9HA 1Y18B 3QFDA 5EC1B 4OF0A 3TT3L 4R90H 4TVPD 1BQHA 1KIRB 3F7QA 1PKQB 3VG9C 3OF6A 3AREC 2XOTA 5CZXC 5HDOA 1WBYB 3GSOB 3LIZL 5ANMA 2B1AL 3EFDH 1MHPL 2GTWB 4NQCA 1PFCA 1ZANL 5GGSB 3TWCL 1YYLL 1P9MC 4U1LB 1SY6L 4BH8A 2Y5EA 1BFTA 4P3CH 4EEEA 4DK6A 2X4UA 3W9DA 5JUEH 2FGZA 4JDVB 4I0PC 5E03A 5C0JA 2FL5A 5H2BB 2YMXH 3OKLA 3ZYOA 2DQGH 4NQSB 3TNNA 1YA5A 2XN9B 5C09A 3CFJB 2C5DC 2BC4A 5GSRA 5CEYB 4J3WA 4PB9L 1A7OL 5C6PB 2R69H 1CR9H 1U8HB 5C0BB 4P2RE 1FL5A 3F7YB 4MB5A 4MS8D 3VD9A 4K55A 4G9FE 1JPSH 5JR1H 4R0LC 3Q1SH 1KC5H 1TVBB 3F12B 4YHLH 1MFDH 1CD1A 3OAYH 4G8GE 3QDJB 4JFED 1YMMA 5KSUA 3VXMD 4XMLH 4K7PH 1QACA 3HB3D 4JRWA 4E42B 2WP3O 1SBSH 2XY2A 4YHPB 3B9KB 5L7XH 1KCKA 5GS2D 2FHCA 3VFTA 1P2CA 2EDTA 4RMSA 1M7IA 5DUML 2YPKA 3P0YL 2VSDA 3L3OB 4XPBH 4XGZA 3RU8H 3UTTD 3GMRA 5JHDB 3BXNB 3SCMA 2VTFA 3L5HA 1DLFH 4X0KA 5T3XH 2ZUUA 3TH4T 5E00A 2AJYL 3WSQH 1BQHG 4LPYA 1DEDA 1OP5K 5D7SL 4MSWB 1D6VH 5TF1H 3PWNA 3K74B 3D39D 5IUSA 4QNPF 3D48R 3B3IB 2FIRT 3IFOB 4LPTA 1CGYA 3NCJL 2A9ML 5EA0L 2W60A 1GGCH 1J05A 1ZS8B 4GW5A 3L5JA 1EGJL 3DVFA 4LF3A 3AS2A 4XCCH 2AK4D 3RVTD 1RUMH 2X6MA 1BD2A 4HJJH 5FUOL 4PRIE 1OAQH 1ZEAL 3BPNB 4MJIA 3GGWA 1EJ6A 3UBXI 4NCDA 4QF1B 3QEQB 4AL8H 2WP3T 5D2NB 3TZVC 3RWJA 1S7QB 4NO3B 5F70A 3QXDA 1I9EA 3TT3H 4QRPE 1U8LB 4QYOB 5HYJA 1BF2A 3V0VA 1X5IA 2FEDC 1KFAL 5DK2A 3PJSA 4ORGB 2FYYB 1JPTL 4YBHA 2VLJD 2WSKA 4BYHA 3LIZH 5GRYA 4NCC1 2NNAA 3HA0A 1ZE3C 3TBVA 2B1AH 2Y5TA 4K3EL 4H1LG 3W2DL 1MHPH 4YC2B 5AG9A 1ZANH 3RDTA 4GKNA 4I3SH 4U7MA 1YYLH 3BDBA 4HXBL 3TWCH 1SY6H 5IGXL 5F9WB 4GLRH 2F8OA 4G42B 5IQ7L 4HFWB 4J7RA 1C12B 2O61B 3REWA 1DLHA 3EYOB 4RGND 1BEYH 4D9RE 2WW8A 4GXUN 3AVEA 4GSDH 1TNMA 2CO7B 3NOIA 4XCNB 4PB9H 5CSBA 1RZGA 1A7OH 3ULVL 3FN0L 3C6SB 5EC1A 1XGTB 3QPQC 2PW2B 5HPMA 5I1GL 1HSAB 4EZMA 1PKQA 5IKCA 2AV1B 3KYMB 4NWTL 3A6BL 3VU2A 5DF0A 4RFEB 4LQ1A 4I3RL 1WBYA 3RX5A 1G9ML 2I9LB 2VQ1B 4NQDB 4N5EC 1ZAGA 1H3XA 2QHLA 1T22A 43CAB 3BVNB 1RSFA 1SJXA 1HH6B 1JZ5A 4TNVK 4U1LA 2X1XR 3P0YH 6FABL 1VHPA 2FX7H 3V5KA 4ONFL 1NFIB 2OTPA 4JDVA 2OTWB 3QDGD 3QFJD 3DYMA 4XNZC 2AJYH 4NQSA 2Q8AL 2L7JA 2XN9A 2J5LC 5C9JB 3CFJA 5D7SH 4M7LT 3N9GH 5CEYA 5KW9L 4O9HH 1HKLH 2NY7L 4H25B 4LK4A 5C0BA 4I77L 3OJVC 1R5VB 2OJEA 1BOGA 3DMMC 3F7YA 3R8BB 4KK6D 5SV3A 3NCJH 2A9MH 4JO4L 5EA0H 3C6LA 5LGKA 2NTFB 1EGJH 1TVBA 5TGBA 3U7WL 4P4KA 3U79A 4RBPH 3QEUB 4I8DA 5FUOH 4BZ1L 2AQ2A 1OGAE 2HTLD 5HHPA 4CMHB 2R2EA 4KI5F 2XWBB 2ICES 4F80A 4GBXA 5IBLD 1AI1L 5F72S 4GAGL 4OZHA 2I60L 1I1YB 3GK8H 4P2OB 4M1CD 4GRWE 5F3BA 3MACL 2HT3D 3BISA 3OAZH 1V3KA 2ARJB 1H5BA 1U8JB 3D85D 1KGCE 4CMMB 1KFAH 4F7CB 1JPTH 3U6RA 4BUGA 1D5BA 2EDHA 2RBLA 4DKEL 3BZFB 4K3EH 3IFOA 5J56B 3W2DH 3LH2L 4FFWD 1ZS8A 4HUXB 4PJ5D 2PNDA 4HXBH 4U31A 3MCLL 2BY1A 3VXPA 3K81A 4NC1E 3VWJC 4CVUA 5IQ7H 2GI7A 4JRYE 3KLHC 4OF8A 4POYA 4PREB 1UADC 4WI6A 2AJVL 4X6FA 4QF1A 1CGWA 4E41E 3IJSB 5D2NA 1ZLVK 1N3NB 3JV6B 1X5XA 4FTVE 5DI8A 3MXWH 2F8VA 4Q6IC 5GGTA 5IEKB 3FN0H 2QEJA 5DD5L 1HHKB 1D3CA 1U8LA 4MLSA 2DQEL 3CU1A 5I1GH 1IKNA 4NWTH 3A6BH 5GPRA 2A83A 4ORGA 4I3RH 1G9MH 4M43L 1OAUL 1D5MB 2DMKA 2CPCA 3OKDA 1F90H 1EEYB 3F6IA 2DWDB 1LK2B 6FABH 3F7PC 1MFNA 4HXAL 4ONFH 4G42A 4M4PA 4HFWA 2YD2A 1C12A 2O61A 3DWTA 5IFJB 2FCBA 1QRNA 3EYOA 4Q9RH 5D7JB 4UOJA 2Q8AH 3O45B 1UWXH 3FFCB 4XCNA 3MLWL 4OV6F 4LNRB 5KW9H 4Y4HD 2BMKB 2NY7H 4TTDD 4I77H 3VFUB 3IDGA 4NFDA 4JO4H 3SQBA 1HSAA 4M7ZB 1JVKA 3ARDD 5GRUL 3U7WH 2D31B 4I48B 4UOW1 5D7KD 1KNOA 4BZ1H 1UJ3B 4HWNA 3Q5YA 4NQDA 5FF6B 4EVNA 5EU6A 3Q6FB 43CAA 5IIEB 3I3DA 1I3RB 4YH6A 4PJHF 2PKDA 1AI1H 1J10A 4GAGH 1OP9A 2I60H 4ZAKD 2FWOB 3MRRB 1NFIA 5DO2C 5E6YA 4XXDA 2OTWA 3MACH 3Q2CA 1ZA3B 2Z8WC 5F7LB 3KXFB 5INDB 1G6VK 3JBG7 1I7UB 4HKJA 5C9JA 3WIHL 1DQJB 4PG9A 4DKEH 3BRGC 1R5VA 3T0BA 3CMOL 1W8NA 4R96B 1U8NB 5DVKA 3LH2H 5CAYB 4IBLT 4PRBB 5B22A 2NTFA 1NANI 3MCLH 1RZIB 3O8XD 2WV3A 2F53B 3PV6B 4DGYL 2XPGB 4WEBL 4XH2A 2ZKHL 3QEUA 1AXIB 1GC1C 2AJVH 2IAMD 5D5ME 2XWBA 4ERSL 3S35X 3A6OA 5ISZB 1QFOA 2W92A 2APVA 1I1YA 5GZOD 5FYJU 4G6ML 1HHGB 1KXTB 5DD5H 3O3DA 2OR9L 4YUEL 3CSPA 4O2CB 2ARJA 2BY0A 2V7HB 1U8JA 5GRXG 4CMMA 1NCUA 1U3HA 4R6UA 5AZ2L 4F7CA 4K3DL 2HH0H 2X2YA 1EBPA 4M43H 1GHFL 1OAUH 1RZKC 2VZ3A 2EDKA 2OM5A 1ZA6B 4MXQD 4OZGE 3VXSD 4DGVL 1KIQA 4HUXA 1AJ7H 1BVLB 3T0ED 1ZOXA 4WO4B 4UV4L 2QBWA 3TN0D 3OXRB 4IMKA 1MWAA 5J3HC 2BK8A 2IPTL 2NYYC 3IJSA 4LIQL 5DRXB 4JJHA 3MA7B 1N3NA 3GSRB 2R2CA 3CDGB 1ZV5A 3MLWH 4EXPX 4L4TE 5IEKA 4FFYL 4Y4KC 1F97A 1FO0A 3SBWC 1HHKA 5DQDH 4Z8FL 3JVGA 4WJ5B 1AP2B 4MVBD 1FYHB 3WUWB 1V3LA 4L9LA 3RUGE 5I18L 5GRUH 2P4AB 1ADQA 4PJIE 3WNKA 3HAEB 5J1TC 4NDMA 1DUYB 1I85A 4NRYB 1OOAA 2R2HB 2XA8L 1D5MA 2KKQA 4Y5YC 1EEYA 3OHXA 3VXMB 1LK2A 2P24B 5GXBB 1JTTA 3LV3B 5FXCH 2NZIA 1G7LB 4HPYL 1MRCH 4JKPL 5IFJA 2IEPA 4MQSB 5D7JA 3WS6C 3HG1E 2MJWA 2HRLA 3WD5L 1WIUA 3WIHH 4QOKB 3TYFB 4LNRA 5F89B 1WQVT 4QTIL 2BMKA 3N1GC 1FORH 4XTRD 2YD7A 3BW9A 5GGUB 2YRZA 3CMOH 2DBLL 1N0XL 4Y1AE 3WS3B 5E6ID 4HMEA 2EIZB 4PJXB 4IEFB 2D31A 4WEBH 1UVQB 3D39B 2I5YH 2ZKHH 1S7WB 3QJFB 1NCWL 1G9NC 3VA2C 1UJ3A 4L3ED 4GOSA 1RPQA 4W4OC 4HUKB 5I0DA 5I74C 43C9A 3Q6FA 5IIEA 4ERSH 5DVMA 4YGAB 4LBEB 1S7TB 4WU5B 2AK4B 3S7GA 2IANE 4HD9A 2CRZA 4XHJC 3FB8B 3UTSD 3RL2B 3BEVB 1BFOB 4YUEH 4R7NB 3KXFA 5INDA 4YFEA 5F8QC 2NX5E 4LSSL 2OP4L 1I7UA 3RWDA 1WZLA 4LKXB 5AZ2H 3MLZL 5E94B 4K3DH 3H3PL 1FYTE 4KPHL 2YUXA 4ZO6A 3FZUC 2FLRT 2HTKC 3HI5L 2F74B 1GHFH 5DDHB 4MJ6B 1AO7D 1JL8A 2IH3A 4DGVH 4PRBA 4UI2A 2PUQT 1A4KB 4HV8B 3QO1B 2F53A 1ZGLB 2VLJB 3BWUC 4UV4H 2H41A 4JAMB 3ZTNL 2FATL 2MQ3A 3UC0L 2YR3A 2IPTH 4LIQH 3LPWA 2OJZL 1ZVSA 5ISZA 1A7PL 4GKOA 4X8JA 4X9GA 5CD5D 4TSAL 4K7FA 1UYWL 5I76A 4FFYH 1HHGA 3D0LB 2LABA 3KLSA 4Z8FH 2ED7A 3LD8B 4H20L 3K4ZA 4O2CA 2Q8BL 2CLRB 4X8XA 5I18H 4CKVX 4Y19A 2QADC 5DMGC 2DMBA 1NC2D 5AAWA 1VPOH 2OL3B 3O4LE 3RVWC 4X6CB 2P5WD 5C0IB 4C58B 5HPOA 5FO9B 1BBJA 4LFHD 1BHGA 4KC3B 1UXWB 1W0YT 3LOWA 4OBSA 5ENWB 4WO4A 5D1XC 3RFZC 3FT3A 4Y0GA 5T3XE 4JJ5A 3OXRA 3MGTA 4HPYH 3ULUD 3TVMB 4JKPH 3IXAA 1LHZA 5DRXA 5JOFB 3GSRA 1Q72L 2ATKA 2R23B 3WNMA 1M4KA 3QDGB 3O9WD 3MUGB 4MCYB 4QTHB 1N0XH 4WJ5A 1RUPH 1UFUA 3WUWA 3MRMB 4K8RD 3U9PL 4OCMC 2O26U 4KKLC 3MNZB 3HAEA 4F9PC 1DUYA 1NCWH 2APFA 2CGRL 2F15A 2E7LA 2EDEA 1ADQL 4YDJB 1LP9B 3VXMA 3ARBC 5SWQB 2EDRA 4M61B 3BDYL 3LEXB 4XBPB 3MRIB 1WZMA 2J8UB 3HKFA 4LSSH 3OKMB 2OP4H 2XQYG 3S35L 4RFNB 3SE4A 3MLZH 4QOKA 2PXYB 5A2LH 3H3PH 1U8QB 5CJOL 4KPHH 1AXSB 4RAVB 5GGUA 3HI5H 5BRZD 3WHXB 4M1GL 1RJLB 1RK0B 4XVSL 4WUUA 5AWNL 3FOLB 4RX4D 2EIZA 3VH8G 4PJXA 1NLDL 3KLAA 1JWSB 3ZTNH 3N06B 2FATH 1S7WA 2A77L 3QJFA 4MDIA 5A3IC 3UC0H 1NL0L 4LBEA 3TCLB 3BOVA 1VFMA 1A7PH 4MNHB 1FFPB 2AK4A 2CLVB 5D70L 4TSAH 3ILPA 1UYWH 3IAQA 3RL2A 5IB4B 2GK2A 5HDBF 1SMAA 4R7NA 2AEPL 2NW2B 1S9VB 2Q8BH 2APBA 4XZUB 1YPZB 5DK0B 1Q9KB 1A21A 2VKWA 4NO5B 3O11B 1DQDL 1ZXQA 4YDVB 3OJ2C 1G84A 3OB0K 3NIDE 4X9FA 2F74A 3AUVA 5J11C 4GXVL 2DI7A 4QXTA 2Q6WB 2F19L 5EH1A 5EZJB 5IVOA 1A4KA 4HV8A 4UT9L 1ZGLA 4JAMA 5F1IA 1AHWB 2DLFL 3K2MC 4Y5XC 5ADPH 1L0YA 5GZND 3FB5B 3JWDL 4M7LL 3HE7B 5CGMA 4F3FA 1IC1A 4NRZA 2WANA 3O3BA 1X5HA 1JNLL 1ERNA 1Q72H 3EGSB 4WI5A 4JHWL 1L7TL 3ARQA 3P9MB 1R3LB 1SVZA 4ZD3L 3RTQD 5L8KB 1M6OB 3U9PH 3QDME 5CEZD 1L9NA 1EIBA 3BZEB 5EBLA 1EH9A 4JY4B 3MRNA 2OL3A 1Z9MA 1AR1D 2CGRH 4OI9A 1QFWL 1J8HB 4X6CA 5C0IA 2O5XL 5A2IH 4EI5A 1SQ2N 1ADQH 1CFBA 5F96L 1VERA 1UXWA 4ODVL 4ZUSB 3SDDD 5GRWA 1XCTB 5BOZG 3BDYH 2DN7A 1TVDA 4PJGE 1YEKL 2HT2C 2HVKB 5C0GB 1GZPB 3TVMA 1PVHA 3T8XB 3DI3B 5FDYA 3T65A 5JOFA 3S35H 4ZAKB 5KSVB 3GO1L 3WKML 5CJOH 4WFGD 4M1GH 4XVSH 3MUGA 4MCYA 4QTHA 5AWNH 2B0SL 3MRMA 3BX7C 3SGKC 4HJ0D 2FSEB 1NLDH 3G6AA 4U0RC 4QGYA 2A77H 2EKSA 1FHGA 4BH7A 2FB4L 2VXUL 4NBXB 3QUYC 5IVXE 1KN4L 3H9YA 3KGRA 4XP9L 2YPLA 4ONOA 1NL0H 4WTZA 5J9PB 3UBXA 3ARXA 4YDJA 1LP9A 5F97E 5BW7C 3ULVE 5SWQA 1IZJA 1NBYB 3NGBB 5D70H 5EO9B 3MRQB 2WMPA 4M61A 4HHAB 3GZKA 1OPGL 4JCLA 4I13B 3LEXA 3EZJB 3MRIA 4WEMB 2IAMB 4XBPA 3KPSB 2CXKA 1FC1A 2AEPH 4Z18A 2J8UA 5BS0A 4OF7A 3K3QA 1CXLA 1YEHL 4YNYB 4PP2A 1LILA 5L2KD 1YN6B 2PXYA 4HWEL 1DQDH 1KB9J 4RAVA 1AXSA 4XP6L 4JM2F 3ULVC 4GXVH 2XTJE 3HLAB 3MQIA 1P53A 3V6ZB 1BPVA 5ANME 3JWOL 3WXWL 4UT9H 3RGVC 3CFDB 3C60B 1JWSA 4Z7WF 4TYUA 4PGBA 4NQCE 3C8DA 1HILB 2DLFH 4XC1L 5DC9B 3VJ6B 4D9QD 3C8KB 3G08A 1TZIA 4WUKH 4MD0B 1G9MC 3JWDH 4M7LH 2PYFB 5D8JL 3TCLA 1JNLH 1IRAY 2AQ1A 4MNHA 5DS8B 1FFPA 5DTFA 4EXKA 1KJMA 2CLVA 2VDLL 5EU5B 5JDSA 4JHWH 1L7TH 5IB2B 2EIBA 5ITFA 5C09E 2AXHA 4ZD3H 2OK0H 2VQTA 1CGVA 4CW1B 3BH8B 2NW2A 1KEML 3QIBD 4XZUA 1YPZA 3G04B 3NCYP 5FK9A 3TV3L 3O11A 4Q9QH 4M9OA 4PLOB 1OTUD 4YDVA 3MBXL 1YMME 1QBML 1BWWA 1KCRL 3TFKC 4JY5L 2O5XH 4WTZG 5DHYA 5DRNB 1DVFB 4ODVH 3BKML 5DLML 3UBXG 4P2CG 1I1FB 1K8IB 5FYLD 5ERWA 1UCTA 5D7IB 4AMKL 3HE7A 4LP4A 2HJFB 3NIGE 4KJWC 4OFIA 4U1HB 3EGSA 4X5WB 4XP1L 3SDCB 3GO1H 5F7FA 3WKMH 4CN4A 1W2KT 3C8HA 3P9MA 3CFEB 4LHUD 3TO4C 1R3LA 4KJPD 3MFFA 2B0SH 4XPHL 4FRWA 4N90E 3G5XB 3MYZA 1XR9A 3WUZA 1OD7A 4JY4A 2FB4H 2VXUH 3SCMC 1XGYL 4XVTL 1JUFB 4LLDA 4KROB 1KN4H 2VOTA 1PY9A 4HAGA 1J8HA 4NCC2 4XP9H 3IDMB 2PO6A 5CJQL 3WXVL 5E6IB 4HBCH 1BD2E 1KTKE 4HWBA 2W65A 1KSRA 3HAEH 4O2FA 2DKMA 5DMYA 1QSVA 2OL3L 4KK5D 4C55A 4L3EB 4KZEL 1OPGH 2HVKA 3GJEA 3CVHB 1CDUA 1HXMB 3VFRA 4YDLB 5I6XB 2OYPA 1HWHB 3X11A 1YEHH 3UTSB 2VRAA 5KSVA 5L2JB 2YEZB 5HYJE 1G6RA 3EHBD 3UYPA 4Y16D 4IRSB 1UQSA 4XP6H 4L8CB 5LWYL 5GS2H 3CDFA 3L6FA 4OCYL 3HZVB 3LKRB 3M8OL 5HGGS 2J8HA 4PJ9A 3JWOH 1EVUA 1T1XB 2L0DA 2FSEA 5H94A 4LMQE 4AQOA 3RRQA 5CBAB 1Q9WB 4XC1H 4DFHA 2YD3A 1AO7B 5EUOF 3BI9X 1JN6B 4YHKL 4EJ1C 3UZQA 3AB0B 5D8JH 3UPRA 2EIEA 2GJZB 4KMQA 4ONHB 1NBYA 2VDLH 2X4TB 2V5YA 5EO9A 5DMJB 4YHNB 4HHAA 1NDGA 2EC8A 2KDGA 4PJ7A 4DOHE 2AV7B 1UH4A 3KPSA 3GHBL 3ZKXB 4M6OL 1MCDA 1KEMH 4PUBL 1FSKC 3RDTC 4RIRB 2HLFD 3VFSB 3TV3H 3PHOA 1YN6A 1XGRB 3MBXH 5EOTB 1M7XA 1X5FA 4GAYA 5I2IA 1QBMH 4XB8A 3K1KC 4JGMA 3GDBA 1KCRH 4JY5H 3V6ZA 2IBGA 1CVSC 1MI5E 1M71B 3QQ9C 4KK8D 1YEDA 3Q6GL 5SWZA 5SX5H 1JMZA 5LGHL 1VFAB 3BP4B 3CFDA 3BKMH 5DLMH 2Z92B 1U8MB 3BZDA 3C60A 5CSGA 4ZS6C 3V52L 3QA3B 2CK2A 3QISA 4KK9C 1ZLUH 5HD8D 4MD0A 4AMKH 2VLLA 1NDMB 1I1AD 5JW3H 1U8OB 5IHZB 4U1JB 1TZHB 1Q9LB 5EU5A 4XP1H 1MFEH 1F4WL 1A3RL 5C0CE 5D72L 5IB2A 1JGUL 3VXRD 3DSNA 2DTML 5FKPA 4XPHH 1YYML 2ZUWA 3BH8A 2N7BA 1HSBB 4A2MA 3G04A 4LVEA 5FYKU 4XVTH 2XA3A 4JG0L 5F7EH 3WXVH 5CJQH 3EOBA 2FH6A 4U05A 1BREA 4KFZC 2R1WB 1VEOA 4N68A 1DVFA 2AEQL 2OL3H 2Q20A 3DX6B 4LLWB 3QDAA 1EMTH 1K8IA 4JM4L 4IOIB 1TFHA 4YHZL 4P5TD 2BHUA 4OZHE 3C6LC 3BP7A 4XPTH 4OKVB 1P7QD 2HJFA 4YDIL 3DGCR 4MA1B 4U1HA 4XWGL 4X5WA 1FNSL 4C59B 3SDCA 3FT4B 2YS4A 1I8IA 3BJ91 5LWYH 3CFEA 4OCYH 1FGNH 4YO0B 4GG8B 4OUOA 3M8OH 3RZCD 5MERA 3G5XA 3MV7D 4GBXC 1Z9OA 4X80L 3EYFA 1QOKA 1B4JH 3KJ6L 4KGLA 4HK0B 4QXUL 3TNMB 2UUDH 5EORH 3L1OH 4D0BB 2I07A 4LIQE 1I9IL 4YHKH 4HS3B 3PWJB 4KWUA 2V2TB 4UT7L 2JF1A 4QRRB 1JYNA 4RQQB 5E8PB 2EDYA 2HJKB 4MDJB 1IM9A 5D2NE 3ARED 1JPGB 5CZXD 2DAVA 1S7RB 1ND0A 3ARVA 5J1SC 3GHBH 2E6PA 4M6OH 5HDQL 4PUBH 4AENB 3W5MA 3AAZB 3MV8D 2BNUB 1EO7A 1NGXB 3I75A 4YEFA 2E8YA 5L2JA 2YEZA 1FVEA 3AC0A 4IRSA 4S11A 3OKOA 5I1CL 3BPNC 2IG2L 3CZFA 3VI4F 3LKRA 1A6TB 5E4IA 2JB6B 3S37X 3FQXB 5D2NC 3Q6GH 4OZFB 2YD4A 2H1PL 4I0PD 4JFYB 4QXGH 1G6RL 1T1XA 5LGHH 1PZUB 1FNHA 3V52H 2C4FU 2EYRA 5HI3C 1KACB 2V17H 3FMGL 3EYVB 2DQDL 3ZE2F 1IKNC 2BVQB 2GJZA 2H3NB 3RPKA 1QRNE 4ONHA 2X4TA 1I9JH 3BMVA 3Q3GA 1F4WH 5E2UL 1A3RH 1MPAL 2CO6B 5D72H 2VXVL 1JGUH 1SM3L 1U2CA 2AV7A 2DTMH 5E2WL 1YYMH 1JTOA 4RIRA 2FBOJ 3MNWA 5I1DB 3VFSA 5HVHB 5C7XL 4PJBE 3P73B 4IS6B 1B0GA 4BQBA 4HWUA 4CRPA 3BPLC 3MRHB 5EOTA 4P2RD 3BIKB 3NZ8B 5CP3H 3RTQB 4G9FD 2CJUL 2Q86A 2APWA 2WK2A 5DEZA 1LEGB 1M71A 1OTSC 3H8NA 4G8GD 2V5MA 1VFAA 2AEQH 3BP4A 4NNPL 1U8MA 3CX5J 3QR2A 5EU6E 4BSWB 3CH1A 3MPCA 3QA3A 3IU4L 4JM4H 1HOCB 4H88L 4YHZH 4NKOB 1INEH 5MENE 1NDMA 3EJYC 4V1DD 4OLUL 1OTTD 5KVDH 1TZHA 3FO1B 3R4DA 3SDDB 8CGTA 1FNSH 3ZKQD 1IGYA 5C2BL 3NTCL 1C1EL 3ZDYF 4Z7UB 2F5AH 2VO5A 3QUKB 3MGAA 1HSBA 3ORJA 3SDXB 1K2DA 4X80H 1TJGL 3KJ6H 3WNOA 4X6DF 1F2XK 2E7CA 3B9DA 3T0XA 4QY8A 3TH3T 4KHXL 2R0ZL 3TZVD 5IW1B 3CGTA 4N1EA 1I9IH 4FG6C 3IFNL 4GRMB 3D5OF 4B53A 1MF2L 3GSNB 4NKMA 3DX6A 4UU9A 1T0PB 2MWCA 3QUXA 3ESVF 4PRID 3CXHJ 2FEDD 3QSKB 3FHQA 1TQCB 2LAAA 4HGMA 3OJMB 5HDQH 4ODXB 4HK3N 4OKVA 1XGPB 1A6WL 1BJ1H 1QFPA 4YXKL 1DBAL 4WI2A 3L5WB 2CIKB 3DUUA 5I1CH 4Y89A 2IG2H 3N1QC 4GG8A 1QFWM 2KBGA 2H1PH 2VB5A 5B3JE 3REVB 5L2KB 1T5WA 3KPNA 2NMSA 3MODL 4HK0A 3TNMA 1MQ8A 1HNFA 1E4XI 3FMGH 2DQDH 4APQA 1ORQB 3F5WB 1I8MB 3BESR 1K8DA 5IMKA 4QRRA 1PDKA 5DUPL 5E2UH 4LSDA 4L1DA 2NY1B 3QPQD 4JFDB 1MPAH 2HJKA 3L3HA 2VXVH 5DHVA 5E2WH 1WTGT 1S7RA 1U95A 3QCUL 5I71B 4D9RD 1HINL 3AAZA 1CLOL 3WFHB 5AG8A 3D2UD 4GQ9L 5C7XH 2BNUA 4N5ED 4ZFFB 4HKXA 3KPTA 4IMKC 2FJGA 4I2XA 2D9CA 4WW2B 2LAGB 4PPTA 2CJUH 3VGEA 1B0WA 5D2LB 2JB6A 3KWWB 3QIBB 2BY2A 4OZFA 3EYUL 5JPNB 3RVVC 4NNPH 3RNKA 5I16B 4RCAA 4JN2B 1PYWB 4OLVL 3V7AG 4D2NA 3IU4H 4H88H 4EIZC 3JVGC 4FQLL 5IMMA 3EYVA 4TPRL 3E2HC 4NZTL 4JQXA 4L9LC 4OLUH 5C0AE 3DMMD 3RIAK 1FL3B 5T1KD 5C2BH 3MJ8A 4DK3A 1AGFA 4F7TB 3NTCH 3S5LB 3P4NB 1IMHC 1C1EH 4WIQA 3DX7B 3P4OA 5EIVA 1XR8B 2ESVD 4JHAL 3OR6B 1IC4L 3P73A 1TTFA 1KXQE 1S5HA 4IHOB 2B4CL 1WLHA 3NZ8A 5B38B 2P44B 3S96B 1NPUA 1YNLH 5D7JC 2VLME 1RY7B 3W0WD 2ENSA 2FJHA 3IFNH 3H9SA 1MF2H 1QVOB 2ADGA 1CDJA 1CIDA 4FP8L 4BSWA 5E70A 4O51B 4PGZA 2QSVA 3HZYA 1EXUB 1HOCA 2QJDA 3B8YA 5CFHA 3OKNA 4NBZB 1OGAD 5DEGB 1B6UA 5B4MC 3K46A 3SKNA 5T5FL 1CDGA 3UJTL 1A1MB 4M7ZC 2XY1A 1A6WH 4J23A 5AUMA 4YXKH 2MNUA 1DBAH 3FO1A 3GI9L 3VCLB 3KXFE 5ESAB 3SOBL 1CDIA 3W9EA 1Z9SA 1UJ3C 1L7IH 3C2SA 4QNPE 4FQ2L 3VWJD 5ADOL 3HN3A 3KLHD 3QUKA 4FOMA 1T3FB 1KGCD 3RNQB 3SDXA 5DRWA 3VGGA 3SPVB 3ULUL 1XF4B 1YY9D 4OZFG 2EZ0C 2R39A 1DEEB 5I66A 3MODH 1JZ4A 2JIXB 2F53E 5ICZA 5C0FB 1PGRB 1C5DB 4LSPL 1NANH 4PRNB 3S37L 4GRMA 4ZFOA 2XV6B 3GSNA 2LU4A 1ZGLM 4ZUVB 5HYIA 4JRYD 4C56E 4ZUWB 4R2GD 4RA0C 4KJYB 2QR0B 4E41D 3JWDC 2EXYC 4OD1L 3QPXL 1LO2L 1CL7I 3CVHH 3QEHA 5DZNA 3IU3B 3L5WA 1UB6B 4HK3J 3LQMA 4HF5L 4Y19E 2GKIA 4XBGA 1D5XB 2V7NB 3EYUH 3IETA 4NN6B 3REVA 4QCIB 4OLVH 4HMCA 2UZYB 1FZJB 4J2XA 4FQLH 4MNQB 4PYGA 4NZTH 2C9AA 2H2PC 2GFBA 3GHEL 3GIVB 4D94A 3OV6A 2RGSA 4JFDA 5FV2A 1NKOA 1JIBA 3CZJA 3R1GL 3VFOB 1RHFA 2VZOA 4FMKA 1I1AB 1ZMYA 5CZKA 1P4LA 4JHAH 2XFXB 4TUOB 4MQTB 5DJXB 4HX1B 1IC4H 3EOYG 4ZOAA 4WO4C 1AR2A 1MELA 2CR3A 1KEGL 4PRPE 4S0TD 2BY3A 5KS9A 4RWHA 3VXRB 2B4CH 4NO2B 3MLUL 3MYJB 3KWWA 4LEOB 2XTLA 4F37F 1H8OA 5DO2D 4QRSB 5JPNA 3HUJB 4I1NB 4JN2A 4FP8H 1PYWA 3FCTB 5MEOB 1I8KB 3HPLB 3UJTH 3E1F1 5T5FH 1GXEA 2PF6A 4GFTB 4M8QB 2IC2A 2LV4A 3GI9H 3SOBH 2C3VB 2BP3A 5F3HA 2VZ1A 2DJSA 1KTRL 3S5LA 4P5TB 1IFHL 2E7LC 4P3DB 2QQLL 4FQ2H 5ADOH 3VXOB 2F58L 1VFBA 3EDKA 3H2WA 3OR6A 4U6TA 4WUUE 3ULUH 2WWKO 1D7FA 2VH5L 4IHOA 3X12A 1CGXA 3CLEL 4W68A 1RURL 1UXSB 4PJFF 5AYQA 1JYVA 4LSPH 3MV7B 3S37H 4KI5E 3GMPA 3KYKL 3SE4C 1KF9B 5FOBA 3JWOC 1JWMA 1E6JL 1PG7W 4WHTB 3QB7C 1EX0A 1BWMA 1EXUA 2VJXA 2ZUVA 4UDTB 5MHSE 5DJDA 5FO8A 3QPXH 4OF3A 3VCLA 1LO2H 5ESAA 1KYOJ 5TDNA 3VG9B 4JLRA 4KUCD 3O6ML 4KI5C 1B0RA 3TA3D 3VE0B 3C5ZA 4XMKL 4L3CA 3MV8B 1PX3A 5CUSL 5HHNB 3WE6A 1T3FA 3RNQA 4F7MB 4EN3B 3HR5A 3SPVA 5J3HD 5DJCB 1MLCB 2HVJB 1KTDA 2NYYD 1DEEA 1RZ8B 1R5WB 2W1NA 2JIXA 5J8OA 4CL7A 2LVCA 3T77B 3AMLA 5C0FA 3MA9L 4KHTL 5TFSL 4I0PB 2X44D 3GHEH 4Y4KD 2FDBP 4ZUVA 2H32A 4QKXB 1FV1A 4ZUWA 5DWUL 3R1GH 1P69B 3HZMB 4KJYA 1BLNB 2QR0A 1EHLL 4ZFOL 3W82A 3GSNL 5KVEH 5HVGB 1ITCA 2BVTA 3PL6B 4JVWA 1MSPA 2ITDA 4QHKI 5JHLH 3UDWA 4DVBB 1KEGH 4L4TD 1T04A 3IU3A 1UB6A 2V9QA 5GRJL 2DLIA 2FO1A 5BCAA 3MLUH 1FH5L 5I0ZA 1YEFL 1RUKL 1CFTA 1D5XA 1K4DB 2BOCB 2X7LB 4WI8A 4NHCH 5M7QA 5IJVA 2X4NA 1BOYA 1CU4L 3TO2B 4MNQA 4OZFH 3LD8C 4ODUB 3RZWA 5K59E 4G8GB 3GIVA 3TPUB 1JRHL 1CFNB 2DYPA 3TF7C 4ODSL 4G80B 1QLEL 4OQTA 2VABB 3OB8A 3C5SB 1IFHH 3VFOA 1RUQL 1N5AB 4WRLA 2QQLH 3PWVB 4ZOCA 4EI5C 5D7IF 2W9DL 3HG1D 2XFXA 4TUOA 2F58H 2GK0B 5E95B 2ITCB 5IP4A 5C3LD 5C6WH 2Y23A 2VH5H 3JV4A 3L7EB 5T1MB 5DMKB 1CZ8L 3OKKB 3TVMC 4F2MA 3CLEH 4NO2A 1N26A 1RURH 4XHJD 3T0VA 2DICA 3DVGB 3MYJA 4LEOA 1Y6KR 3L3IB 3KYKH 1S7SB 4XCEB 2NY2D 4JFZL 2YPLE 4PJHE 3BKYL 1E6JH 4OGZA 1ONQB 3LKPA 1LP9E 3LAFA 1OQXA 5MEOA 2E7HA 3FJTA 4WHYG 1XF5B 3CFIC 1KIPB 1I3GL 3FZUD 2HTKD 2AJ3B 5I1AB 3PWUB 2J8UE 3WFDL 5BS0E 1IGCL 3O6MH 3UEZA 4P3DA 5HVWA 5A16A 2IPUG 4XMKH 2NX5D 3R0MA 1LE5A 4B7LA 5CUSH 2HRPL 3VXOA 3FOMB 1JHTB 1T7VA 2AK1L 3DLQR 4LDEB 4IJ3B 3NA4A 3K8MA 2VLKE 4RDQG 1WAAF 5C0RL 2BSTB 3TBYB 1P6AB 2EDDA 5E7BA 1T5XB 3DOSA 12E8L 2H9GB 4QRPB 2SEBB 1SYSB 4KHTH 5TFSH 1X4ZA 4E9LA 5K9OB 1A6AA 1MHCB 5HHQB 5LVEA 2PXYC 3V6OC 1OVZA 4Z7QF 2WM0A 3MRLA 3CU7A 5DJ0B 4KTEL 1QSEA 2QADD 1EHLH 4UDTA 1CDYA 3GSNH 3NN8B 3RVWD 1UH3A 3RWGB 4FQIL 3B5HA 1NGZA 3EUUA 5T5NG 4C4KT 2EDBA 3QWQB 1MCFA 1TTGA 4GAJL 1YPZE 5GRJH 2EC9T 1KENL 4IOFC 1FH5H 5D1XD 1YEFH 2BHZA 1RUKH 2EH7L 2EO9A 1MFBL 4F7MA 1N6QL 4EN3A 4MAYB 4E5XB 5DJCA 1LNUB 1MLCA 1KJVB 1CU4H 1NFDF 3O4LD 4AY0A 3QRFM 3OMZA 2D4DA 1X5ZA 1JRHH 2VR9A 1KJ2B 4AIZB 4ODSH 1QLEH 2NW3B 5FA4B 1LDSA 1YJDL 5T3XD 4OLZL 4QXWA 4HFUL 4KKLD 1RUQH 3GBML 2E7MA 2W9DH 3VRJA 3DMMB 3PL6A 2VL5B 2QV2A 4MAUL 3L5XH 5KN5A 3ARBD 5JIHA 3HE7C 1PY4A 2CRIA 3LSOB 4BUHA 3FO9A 1K4DA 2BOCA 2X7LA 3HMXA 3QZWB 1J8HE 1U8IA 4JFZH 4DZ8B 3BKYH 4Y88A 1BBDL 3TO2A 5E5MB 2A6IB 4ODUA 1R24B 2E7BA 3FT2B 1I3GH 3TPUA 1T1WA 1R3IL 4HZAA 5I1IL 1QBLH 4O02H 1F4AA 3WFDH 1IGCH 2VABA 4CU6A 4WGVB 1FP5A 4WTWA 2PO6C 1TPXC 2R1YA 1N5AA 3ULSB 1ZWIB 2HRPH 3NCFB 5EN2A 2AK1H 4LPWA 4OQTL 4YAQB 5A3ID 5FYLH 1J5OL 3FQRA 1T7YA 3MUHL 4YBQC 3L7EA 1JGDB 12E8H 1NEZB 3S36X 1WJ3A 3O6LL 3DVGA 1JHLL 2CH8A 2IADA 1VKXB 3QULB 2Z4QB 4NM8L 3LKSB 2X4QA 1AGDA 4YFDB 4K23L 1Q0XH 5FUZL 2P47B 4GKSB 3RVUC 4K07A 4GW1B 3W39B 4KTEH 4YFLI 2Y6SC 1X5YA 1KIPA 1NUGA 4PJ9C 1AGEA 4TRPL 4PJ7E 3GB7B 4FQIH 5I1AA 3NMEA 3PWUA 1T21B 4JRYB 2FEEI 4R2GB 5KSAA 4JFFA 1KENH 4PGDB 1C7TA 3CMGA 4LSTL 2EH7H 2A73B 4JN1L 3FOMA 1JHTA 1N6QH 4RFOL 1PQZB 4FTVB 4QT5A 4J6RH 3VFNB 3QNYB 2BSTA 3TBYA 5LCVL 2GQHA 1T5XA 5SWZE 3EJZD 2H9GA 2IAMC 4QRPA 2SEBA 3QAZC 5I8CA 1SYSA 3C5JB 5K9OA 1J18A 4NO0D 1MHCA 4HIJA 3IRZA 4P46B 4Y2DD 1YJDH 3VDCA 3U1SH 1GSMA 4JE4B 4OB5L 3X3GL 5DGQA 4HWZA 4Q7DA 4HFUH 5DJ0A 3GBMH 1NH6A 1U8PA 2EYTB 1TZGL 1GGYA 3NN8A 1UEMA 2CUMA 4U1NB 5IF0B 3C60C 1MUJA 3KVQA 4V2CB 1JMXA 2ADIB 4MAUH 3R8QA 1NC4B 1CD9B 4HZLB 3CJJA 2C1PB 4X83A 3G5ZB 4S1DC 1MREL 5EU4A 3QDMD 4X9BA 1RD6A 2HT2D 1MHHB 1J11A 3PHQB 1MH5B 4MAYA 1F6FB 1J87A 2VL4A 4ODWB 4OCSL 1T89A 4GS7C 1U42A