3HZKA

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKSIAVKWKIDGSERQNGVLNSWTDQDKKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkA01
2H8PB 1MQKL 1JYWA 2JJTC 2ADFL 3IDYC 5I9QC 3H7BA 1E27B 1X5FA 3NABH 3MV7D 1FH5H 4OB5H 3RHWF 1QBBA 4P2QB 3IETA 1QLFB 1C5BL 2HJFB 1F45A 3G5YA 5MEPB 1MCCA 3PP4H 4L4TB 5EZOL 2R2BA 3BMWA 3PV6A 3SDDA 5ID1A 2EC8A 3C9NB 1MCOH 3BPLC 1S9VB 4YR6B 3DVNA 2XTJD 2HTLD 2YA1A 4NZTH 5HHVL 4AZ8A 3CZFA 2AJXH 4FNLL 4GRLB 1V3JA 3SBWA 3HC3H 1J7VR 1S9KC 4R3SB 5HGDB 3WYRA 3FN3A 1FSKB 1YPZF 2NY3D 2Q7YA 3BEVB 1U8QA 2PTVA 1FO0B 4FFWD 3IAGC 2E7LA 5SWZE 3EOTH 3MUGB 4N9GA 1H5BB 4AG4H 5I1LB 2VDMH 1TVBA 3UTTE 2BVYA 3S88H 2O93L 32C2B 2D7PA 4Z7VF 2DM4A 4NBYB 3CLEL 1E4WL 3PWVB 5GS0H 1DEEA 1JMXA 4XH2A 1F4AA 4QCIA 1NGXA 5IT2L 1E4KC 4XVTH 1MHHB 2R69H 2BSED 4RZCA 3W9DA 3FFCE 4JRWA 2ZNWA 3VMOA 4JG1H 3VXSE 4KJQC 5ICXA 2ATPB 5F44A 3N1MC 4YFLF 3BZ4A 5DURD 5F9OL 3F62A 5C0JA 1U92B 3H3KA 5SX4H 2F54B 4OQTA 4S1QH 1OF2B 4ONFL 4RMSA 3GBML 3JBG7 4Y16D 1MWAL 3CXHJ 2PYEE 4PRHE 3P4OB 3VA2C 1NC2D 1C1EL 2EC9U 2EYRB 4XPFH 5SWQA 2Y07L 4XRCB 3U9UA 5KSAD 4M8QB 2H2SD 1UA6L 3VXRB 5IBLD 1EVTC 4OD3H 1VPOH 2QKIB 1NCBL 2A83B 3OV6A 1JI1A 3SDAB 4Q0XL 4Z7OF 1EEYB 3S37L 4DAGL 2FEDC 4HKJB 1A6TA 4K2UL 2M2DA 4UQ3B 1YNKH 3TH2T 1H5BC 1CVSC 2BMKB 3NIFE 3K8MA 4MXVF 2BOBB 4HX1B 5HGBA 4NQUA 4PJXF 3ZDXF 1CDGA 4M62H 4GAJH 5CLTA 3LKNA 1JPGB 2G2RB 5IMOB 3PWNA 1MCLA 1U8PA 2RQ8A 4NM8L 2D7QA 1N5AB 4AMKH 2APBA 1LQSR 5DQ9B 1EBAA 1EEUA 1MHCB 2HVJA 4PGEB 1NPUA 3MV7B 4IRSB 2UUDK 4X6DA 4AJ0A 5J89A 2QSVA 5DJAB 1JWUB 3U82B 2IALB 4G42A 4ODUB 4RNRA 3ARRA 4YBLB 4U7MA 4JZOA 5HGGS 1GHFH 4BH7B 2JELH 4MXQD 5I0DA 4FTVD 2Z8WC 4JGMA 3NGBC 5ID0B 2ORBH 1A4JB 5GGVH 1DBBL 2XTJB 1QOKA 4NZRH 3KPRE 1PEZA 3SGKC 3X3GH 1UZ8B 3EYVA 1T21B 2HTKC 3OJMB 2BJMH 2NY3B 2DWDA 3GIVB 4OZIE 5FO9B 1I3GH 5C0FA 2CDGB 2VXSL 3ARBB 1BAFL 4U33A 1DZBA 4F7TB 4P2OD 4GLRI 1CFQA 4IDJH 4WJ5B 1WK0A 3T8XA 5TE7H 4XP1H 2E7LC 3NA9L 5KVMC 5JIHA 1N64H 2FLRT 1EGJL 3QFJA 3ULUC 3MGOA 5T1KB 3TWCL 2IAMB 4ZPTB 3R06B 2D4DA 2BNRB 5EOTA 1U8MB 1OB1B 3MTRA 2JJSA 1U42A 1P6FA 4NT6A 4D9QE 5L0QB 3BD5A 2MHAB 5HYSG 4OLVL 3DRQA 1OARL 5DURB 4FTVA 1BZ9A 4N0RA 3RWGB 2X40A 4Q9QH 3O6FD 4DZBB 1VENA 3DUHA 2Y23A 3LN9A 3SGEI 4M1CD 4CVWA 2P5WA 4LLYB 3Q6FB 1SQ2N 3CSYB 2A77L 2HTLC 3K2UL 3MLSH 3TJHD 3IDMB 5KSAB 1G9ML 2R2HB 3F8UB 1JGEB 5DD0L 5JZ7C 2NY3C 2HFFB 3GI8L 3BPNC 5FYLE 5ITFB 3HAEB 2IQ9H 4FFWC 1LO5A 4NKIL 4HW6A 1C08B 1CCZA 2CKBA 3B6SB 1I7RB 2UVFA 2VKWA 4NC0B 3CPLB 3ARZA 3HPLB 4Z78B 3OGCB 3KNBB 4AENA 4D9LH 4S1SH 5TFSH 3BJ91 3IVKB 2CMRH 1FJ1A 1BF8A 5E9DE 2IQAB 4F15B 4JRYA 1AGFB 2W9DL 4Y8DC 1ZLWK 1NBVL 1JUFB 1RURH 5F9WB 3O2WL 4I3GA 1N3NB 4PP1D 3ZYOA 5L0QC 3RPIA 4EUPG 2JIXD 2LTQC 3A6CL 4G8GB 2G5RA 4CW1A 4LU5L 3SDXE 1HINH 3KPMB 3T77A 3IJSA 1A3LL 4Y16C 2PW1A 4GUPB 5DUPL 4G6KH 1A7PL 3QUZA 4XXCC 1FVDA 4LEXL 2VLRA 3PGFH 1EIBA 1F3DJ 4NRXA 4YAQA 3QDGA 1W0YT 2FGZA 3QEGL 4MCZB 2H2SC 3LKPB 1IKFH 5IBLC 2VXUH 5AAWA 1DANT 1CDYA 2A6JB 4X80L 1FIEA 3MQIA 2X44D 4M7ZC 1JF5A 3RTQD 4QHNA 4L4VD 4RGND 5F9JA 2Y06L 3OR7B 3RU8L 2OCFD 4ISVA 4NPYB 1UM5L 5CMAB 2BCKA 3T09A 1BJ8A 5EBWB 1T04A 4LEOB 4LNVA 1WZMA 2VDRL 3RGVD 3MO1A 4HIXH 3MNWA 5I8OL 3FJTA 1OAKL 1X5XA 1FNEB 3ILPA 2CXGA 4UIMB 4XPGL 3B83A 4KPHL 5F7MC 5J8OA 1X5LA 2GJJA 1OSPL 4OIIH 1A6AB 3LRSA 1OSZB 4NHCL 4QHMA 1TPXB 3NCYS 3Q3GB 2OP4L 1IKNC 2NY4B 2P24A 3C5SB 4YQXL 2VISA 5EZJB 1SEQL 4MXQC 5I1AB 3SKNB 1P53A 1FAIL 3N85H 3OPZL 3QJFA 3ULVF 1XF2B 1UJ3A 5I1CH 3WFDH 2B1AL 3KJ6L 2ZUVA 5CZVL 1NUGA 3C6LA 3KHQA 3BSZL 4RFEA 2GSGA 1HILB 3OKDA 1E28B 4RMTA 4Z7WF 4P57B 2OQJB 3BPCA 4QRRE 2I25N 3T3PE 2L7JA 4OJFL 4HUKB 1LEKA 1JTPA 3RX5A 4P2OC 2YUVA 5EUOB 1NMBH 3QDJE 4NNXA 2FIKB 5DUMH 2NLJB 3ALPA 3QDAA 5FO7B 3HRZA 5DSCA 1HSAA 2AJSH 1QRNE 4XC3L 1Q38A 4ZFFA 2B1HL 4PIRF 1TDQA 5IWLA 1Z3GH 4F58H 1GGUA 2DQUH 3L3JB 4UINH 5TPWL 1KIQA 4K7FA 3IFOA 1HNGA 2OM5A 4JZNA 3MUJA 1QLRA 4YGAB 1TQCB 2JIXB 1JHTA 3MXWH 1U3JA 3O6FC 1RFDL 1CU4H 4M1CC 3PJSA 1GGIH 1AGDA 1ADQA 4X6CF 4UDUB 1JNHA 1JF6A 1BOGB 3NIGE 4QRUB 5A16B 3B8YA 5GJTH 1IILE 4U6TA 3TJHC 4P9MH 2EDQA 1H3PH 1KB5L 2EO1A 2ZG3A 3IKCA 4EEEA 4MD4B 4Y5XA 3SO3B 3BP6A 5DD3L 5T5FH 4UIKL 1GH7A 4NQVA 5EORH 3SPVB 3BEWA 2R56L 1RU9L 4CDGC 4XCCH 4YPJA 4OF7A 1IE5A 4F9LA 4X98A 5EU6A 3CFKA 5LGJA 4XTRD 3QCUL 1BVLA 3BVNA 3C8KA 3SGDI 1ORSB 1ZA3B 5D1QD 2X6MA 4POUB 1I1AA 2B4CH 1RUQH 1IT9L 1JWSA 2IWGA 2YS4A 5D5MF 3VFNB 3RGVB 1UVQB 4G8FA 4OBRA 5IEKB 2WLYA 1SJXA 3BGMB 3T2NL 1WFUA 3NACH 3K1KC 4G9FA 3QDHA 4PV8A 2FNBA 2HG5A 2KKQA 2NX5A 1M7DB 2OS7A 3B2UD 1FNGA 3MYJB 4JG0H 4ZDHB 3WHE1 3RQ3A 4WHTA 3U0WH 3HS0A 4L9LB 3QH3A 2XXMB 5DGQA 1QO3A 2PXYD 2RFXA 3DX6B 3WFBH 4YO0B 1PKQB 5EFIA 3BT2L 1E4JA 4MHHG 4A6YA 4YHKH 1GAFL 5I1IH 2F58H 2HN7B 2WINA 2YBRA 3H9SB 4KVNH 1NMAH 1UEYA 1N4XL 1MWAA 4EUPA 3RTQC 1NFDB 4RGNC 5I18H 4HBQA 1OPGH 4MB3A 1UJ3C 4PY7A 3RWDA 1JNNH 3VXOB 4V1DD 4Y5YB 4PY8J 1VGKB 3HUJF 3VJ6A 1RZGB 5M7QA 4MSWA 3LN4B 4LVNB 2ZUSA 4D8PA 3NCFB 1SJEA 5HY9B 3TT3H 1INDH 2X7LA 2WW8A 3IGAB 5FECA 1NGQL 3UBXB 1DQDL 1I9IH 3OKLB 4G7YL 3VXNB 3D18B 3CK0H 3GK8H 2RCSL 4WGVB 3OKMB 4HZAA 3FQRB 1YNTB 3WL9A 4HUMB 3QUMH 5IWLC 3V0AC 3EO0A 1J8KA 1A1MA 1YYLH 3IDNB 4N0YH 3RWFA 2I60L 2YEZB 4R0LC 2EDXA 5IOPB 2BERA 4LCIH 4W68A 1YY8A 1BIIA 3RVUC 7FABH 3PWUA 1CD1B 3V0WH 2VLME 5KW9H 4HT1H 1P84J 4YDVA 3SCMD 4HQQL 4PG9B 2D9CA 3WNOA 3P0GB 4YHML 3EKCA 3JSSA 4X99B 4JO2H 1CE1H 2NY6D 5ANMA 1I8IA 3L3GB 3P4MA 4OZGE 5DHVA 1CFNB 1IQDA 2FECL 3DI3B 1NAMH 1ULVA 3UTSD 5SWSD 5JNYB 4AY0A 5E2TL 5FO8A 2EE6A 4WY7H 5DF0A 2VJXA 4MJ2A 4Y5XC 2CK2A 2OTPA 4HG4J 2CSPA 2GAZB 3E6HA 5DMIL 1D6EB 3MR9B 3MJ7A 4Z0XA 1HXYB 3QR2A 1CR9L 2BC4A 5D1QB 5LCVL 3QQ9C 3V4UH 4F9LC 1AIFB 5C0AD 4DQOL 1QNZL 2EDFA 3F6LA 4GKZB 3W2DH 1PZUB 1FZMB 4Z7NE 5MEND 1IGML 3EHBD 1KENH 2WWMD 2NY2D 2HMID 5T1LD 4JR9L 1JTTA 5F7YC 4PPTA 4IS6B 1KIPB 3RBGA 1TQBB 3FT3A 2X4QA 4PUBL 3MNZA 3QG7H 2VZ3A 4BSWB 1XGUB 3QUKA 3BGFB 1KTDB 3SQBA 2ZUQC 1I4FB 3EZ8A 1XH3A 1KCSH 4P5MB 4KJWD 3AUVA 3DSFL 4FQIH 4QXWA 1TFHA 1AD9B 4HCRH 4OLEA 4ODVL 1LILA 2ED8A 1MEXL 4MMZC 5CP7A 2ADIA 1G6RL 4YIQB 3CH8A 3MLTB 5KG9B 3L9RA 1KGCD 1KELH 1T1YA 3LS4L 5GZND 1YA5A 1O5DT 3D85D 1ZOXA 1JGLL 1MFBH 2V2WB 5JDJA 4V1DB 4XTRC 1SHMA 1UXSA 2BY3A 4OKVA 5E7BA 2APFA 5MENA 4LRIC 5D1QC 1AQKH 2F8OA 5D96B 2YD6A 1Y6NR 5INCA 4H20L 4P5TD 2X41A 5GGSB 4RCAA 5LVEA 4EDWL 3NN8B 3BRDA 2ICWA 4CN6A 1K3IA 2F19L 5D7SL 1TQBC 3RY5A 2N7AA 3K4DA 1EO8H 3BUYA 3V7AE 3B2UC 5DJ2A 3ZDYE 1H3TA 4MNGB 1XCQA 4L8SB 1CICB 5GGUB 4O02L 2PXYC 1R3IH 2BSTA 2ITCA 1H8NA 5ADOH 4KTEL 3IDGB 35C8L 1MLCA 3SCMB 1MFCH 1FVCB 1KXTB 3CFDB 4KMLB 3OX8A 4O9HL 4RMQA 1HCVA 3QIWA 3DBXA 3VFTA 3VCLA 2NY6B 4F33A 3FHQA 3D85A 5IG7A 1XGTB 1D6VL 4FQCL 1Q0XL 5AYQA 2VN4A 4HPOL 5SWSB 2DQIH 3K74B 3CFEB 3WIIL 5IHBA 4O00A 1T1XA 1AFVL 2JK5B 3CC5B 1OD7A 5DWUL 3RIFK 1KXQE 3RBSA 3DMMA 4PD4K 1TENA 4IHOA 4DVRL 2CDFB 4DOHB 3NPSB 1KCVH 2FZ3A 1YN6A 4QRPE 2ZPKL 3GHBH 4JANB 2FWOB 4NNPL 1D5ZB 4H26A 1T6WA 2NY2B 4LDOB 5DFVC 4LLWA 4GH7B 4X8XA 3UYRH 3BRGC 2FLBT 4L8SC 3RL1A 3UTTD 3VG0H 3EO9L 3TBWA 4ZOBA 1R5IA 4HIIA 3U83A 4KKCD 3TO2B 5IHUH 5IJKA 4FQ1L 1U8LB 1WJ3A 1JRHI 4K3EL 1JF1A 4Z76A 1BFOA 4KC3B 3EFFB 3MV9E 4U1KA 5I1JL 2XZAH 1Z9MA 1IGYB 2BRRH 3FFCD 2PR4L 3GMPA 4G7VL 3VXSD 4MD5B 1DBAL 3C09C 3MRIA 5EO0A 4GW5A 3LV3B 1T2XA 2A6DA 5D7IF 3FQUB 2EE2A 2J8UE 1NGWB 3QULA 5DD1L 5IFJA 4PJ5E 2LV4A 2NY7L 2PYED 4PRHD 2RB8A 5E94A 1WITA 5DZOA 1MCPH 4LSPH 5E99L 3L5XH 1TVHB 4G6JH 2NR6D 3QPXL 5IB1B 4NDMA 5DS8B 3SOBL 1BPVA 3QCTL 2IPKB 5HGHA 3D0VB 4MVBC 2NY2C 2WK2A 4N8CH 2HMIC 1IC1A 2X4RB 4KRLB 3D25B 2XWTB 4OCYL 5I30H 5GQBA 3U4BL 4A2MA 2VXTH 4LCUA 5IMLA 3BIKB 4ZUWA 5I15H 4AH2A 4YXLL 2OJEA 4TUKH 5I1DA 1KJ2L 3P11L 5GGSY 1AJ7L 2AQ1A 5I19L 3MLRL 1DUZA 1JNJA 2DM7A 1YUHB 3B9KD 1A9EB 2GHWB 3G5VB 4NGHL 1IZKA 4HFWB 5E00A 1AE6L 5H8DA 5IJVA 1K4CA 1NLBL 1WIOA 2BY2A 4X4XB 2ZCHL 3TN0D 1L7IH 1IC7L 3UC0L 4FQQB 5GZNC 2EEBA 1G7QB 3FO1B 2Q87A 1MFAL 1CZ8H 1TIUA 3F12A 4TNWK 1S7QA 3FFDB 4LCYA 3LN5A 4KV5F 4F3FA 4JVPA 4PV9B 4QNPF 2DQFB 3KPRD 4HWBL 4NOBA 4Y5VC 2C3VB 2VXQL 4QT5A 1KFAH 4MDIB 1J1OH 4P5TC 4P4KD 1MH5B 1QSFE 4QXTA 1NAMB 4LSTL 1QBLH 1XR9B 1P4LA 1HHKB 5D70H 2NTSP 3Q1SH 3I6KB 3ILQD 1JK8A 3PGDA 4WUUE 5SWZB 1YQVH 4GG6E 2EYSA 5L6YL 4HGWA 1KT2A 2J5LB 4R2GB 1NCUA 5DRZB 4LNRA 3S3PA 4ZNEA 1T0MA 3L95B 4NO3B 1CTOA 3JWDH 3SQOH 2GTWB 3QRGH 3UEZA 5IQ7H 1FRGL 2G5BA 2X4UA 4IIQA 3GZKA 3ZO0A 3QEUA 5IJKC 4DN3H 3FFCB 1A02N 3VXSB 4D9QD 2Y9RT 4JHAL 2C7UA 5H37G 4WW2B 2BOCA 1ZVSB 3LQAL 1EJOH 4U0RC 4EVNB 4G6FD 2B2XL 1UC6A 1KNOA 1VFUA 4KUCD 1ZSDB 3QIUA 2PYEB 3WV0A 4PRHB 1PG7W 4P4KA 2XQYK 4KQ3H 3RZCD 2EKJA 3WS6A 3MCLL 1I7TA 4ZTOH 3HZKB 1WBZB 2YKLL 5E08L 2XA8H 4ZFZB 5EU5A 2GJZA 4HPYL 4CUCA 3IRZA 1DBMH 1A7OL 8FABB 5DDHA 3BH8A 2X4PB 2H9GA 5JO5A 3TO4A 5FYLD 2BY0A 3EJYD 5HD8D 4PG2A 1CI5A 3VRLF 1IL1B 1A6ZB 4QHUB 1FBIH 2CPCA 2Y36L 1GC1C 3QDME 1KTLB 3DGCR 5J1SC 3ZTNH 3QO1B 4LLQB 5IMMB 3GO1H 2CQVA 2P47B 1BZQK 1DQLH 1II4E 2QHLA 3ZKXC 1AY1L 5KVDL 4MXWH 4QYOB 5HDBF 1P4IH 3VFVA 2WLZA 5EPMA 4HH9A 5JPNB 3GMMA 5E9DD 1SYSA 4FQHA 4OQTH 4XAWL 4W4OA 1GVIA 5LGHL 4PJHF 5GS2H 4L29A 5TDPB 3CNKA 1JHKH 5JHLH 1G1CA 2J6EL 1R3HB 4JM2D 1FG2B 4M93B 5SX4I 3TA3D 4LRNL 1NEUA 1S3KH 4MQXD 5C7XH 1GZPA 4EN3B 1EHAA 4OFPA 4JGUA 1N6UA 1NLDH 5ESVB 2GK0B 3MJ8B 5BOZG 4LKXB 1XGYH 1W0WA 4Z7VE 1MCJA 25C8L 4HJJL 4MZ2A 1GOFA 3JZ7A 3CDFA 3FONB 1JE6A 4I9WE 2CKNA 4JFFE 2NR6C 3KPRB 1NCCH 4NKOA 1W72L 1JFQL 4F7EB 4OQ1A 3IDUA 5JDSA 1PAMA 4R96B 4JO3H 1BVKB 1CXEA 3W9EA 2HAZA 4OZIB 4M6MH 1T80A 3K1DA 4XMLH 5FYJU 1S7TA 4WENB 1K2DA 4MLSA 4LQFL 2PO6D 4JDVA 4K8RL 5MEOA 3O6KH 1BIHA 2YWZA 1C7TA 3O3UN 1ORQB 2EE9A 4FQXB 5AYUL 4ZUVB 4Z7OE 1I7ZB 3B9KC 5J6HB 3G6DL 2OI9B 5HGAB 1P9MC 2N7BA 5EC2B 3L7EA 3D6GA 1HDMA 4HF5H 4JN2B 3TN0C 4IIQC 4MXVE 4OCRL 4Z7UA 4JPVL 3G5XA 4MJ6B 2DYPA 5EUKA 3MCKB 5EC1B 2HH0L 5E4EB 1SJHA 4G6FB 3MRGB 4O5LL 4PJAE 5IFAH 1JV5B 2GJ6B 2UY6A 3H7LA 1Y6MR 3IFPB 3GBNL 4M5YL 5SX5H 1YYMH 1OAZL 3RZCB 3TT1L 4ELMA 4LFHG 1G6RA 2B5IB 1GJIA 5FV1L 2X70A 2E9IA 4P4KC 3MLUL 1DLHB 4PREB 1P7HL 1KN4L 4TSCL 5HI3D 4DKEL 5FM8A 1DCLA 1V7NL 2AVGA 4EI5D 4I5BB 2ADGA 4QRRD 1BREA 2DTML 2Q8AH 4HKZB 4X4ZA 4F7MA 1G84A 2PO6A 3RDTA 2O5ZL 1ZLUH 3ILQC 4OD1H 3X12B 3QDJD 2CLZB 4YGVB 1EFXA 3S36L 2Z92B 3VGBA 1DBJL 4OGXH 4H25A 1QRND 4PG2C 3BZEA 1F3JB 3HR5A 4R6UA 4TYUA 1FL5B 4ZPVA 4ZNCD 3AXLA 1U8HB 1VFMA 3QJHB 4Y19A 3LKSA 2OI9C 1U8IA 1T7ZA 3WO4B 1BBJA 2E27H 5F71A 3BGAA 4O4YH 1G7HB 1VKXB 4ZTPH 2FYYB 3M17A 2YPKB 5A43C 1YMHB 2W9EL 4EDXB 3MZGB 4NC1E 4TSBH 4HS3A 3IS0X 1XR8B 4MJIB 3O8XB 3ZT5A 3P2TA 5I1EL 4N68A 3DO3A 4NN7C 3SDXB 1R24A 1A6WH 5HVWA 3KPQB 4P3CL 2EICA 4QWWD 3MBXH 2X5PA 3STZA 1MFDL 5J11B 3O0RL 5BO1H 4MX7B 2Y6SC 4OZFG 5HJ3A 1YMMD 2B5IC 2DI7A 2VDLL 1EVUA 5DEGB 5C2BL 1E6JL 1KCRH 2CKBH 3O2DL 2I5YL 4QGTA 5D2LE 1S7UB 5EWIH 4LLMB 4AT6B 2WSKA 1MJ7H 1N8ZA 1G7PA 5HHNA 5FHBL 2P5EE 1ZTXH 5HD8C 2DAVA 2VZ1A 2R1WB 2PYFA 2WV3A 4JFEE 3RWEA 3MV8E 3DI2B 2EDBA 3CXDL 2ZCKL 1F4XH 5T3XH 5F7EL 4HIEB 5E2JA 4RWHA 4OGYH 3ULUF 3ORJA 4M8VA 3OXSA 4OM0L 3OAZH 2EDHA 4O2EB 4G5ZH 3BWAA 5KOMC 2C4FT 1PD6A 4PJGA 5BZDA 1A64A 3B2VH 5KS9F 3ZE1F 3V4VL 2Z4QB 4JM2C 4XGZB 3TA3C 2FRGP 4K94C 4MQXC 5FYKH 5B38G 4OZHE 1MAMH 1WCQA 3AM8A 3GSNB 5D9SB 5K59E 2VLKA 1YMMA 3CVIH 3OR6B 2BY1A 3CSBA 5J11C 3IETB 4JFOB 2OZ4A 5ACMA 2EIEA 5BVPL 4N1EA 5GGTL 4YWGL 4NIKB 1BX2A 1VDGA 2F5AH 4JAMA 2JLLA 4POZC 5AZ2L 3SKJH 3BESR 1U36A 4U6HA 4BFIA 2QEJA 5DEFA 4DFIA 1X6LA 3OZ9L 3PV6B 3SDDB 3V7AG 3P9WB 4OCXL 3DVNB 4JKPH 4G8EA 5E2WH 3MUY1 4NNYA 5DD5H 2MOVA 2R2EA 4XNXH 2DL2A 3SDCD 2GITA 1NGZB 4TVPL 5EIIA 1QRNB 1ZAGA 2PO6C 4MB5A 3WLBA 4KGJA 4RDQG 4L3ED 4JB9L 1LO3H 3ZKMD 5HVFB 2CLVA 1Q0YH 3MJ6A 4Y2DD 5KVGL 4R97B 4PJFE 3IXTA 4LFHD 1HWGB 3CD4A 4L9DA 1RK1A 5JIKA 4ZO8A 1GL4B 1DEEB 2HJLB 2A1WL 4PS4L 1KJ2A 2OJZL 3W9DB 5ISZE 2Q7NA 3O9WA 1IC5L 5EOQH 1D7FA 5E2VH 4LVOC 4P49A 2DLGA 5C0JB 4MWFA 5MP6L 1HZHH 2VLMD 3WUWA 5J4MA 3WDHA 3HI6H 1E6OL 1IAKA 3WE6B 1H3UA 2P44B 4WCYH 4GMTL 3ZMRA 2R23B 1JWMB 5MEQB 1XIWD 1FL6B 3VFSB 4TPRH 2AJVL 5F7DA 2G75A 4U6VH 4G43A 2F53E 4D94A 5HI3C 1I9RL 4HUUA 4EI5C 2A73B 4U1SB 3THMH 1D9KD 2OR8A 1EHNA 2VDOH 1A9BB 3MOBH 4L3EA 3WN5C 4M43L 4HWBA 1MCWW 1HI6A 1YEEH 4JFXA 1QFOA 4HJGB 3NIDE 5T33H 4QRTB 4N0CD 3TBSA 3FB5A 1RJLA 1I3RB 4JJ5A 4AEHL 3BIAX 1B2WL 2ESVA 4KMTL 3VGFA 2AK4E 3HC4L 1OQOA 4R97C 2YN5A 2CXKA 1WVZA 2ADFH 4GS7B 1EXUB 3DVGA 3VGEA 4WTZG 1ADQH 3OKEA 4HD9A 2IMNA 5JW5B 4XPBL 2GI7A 1XMWA 5EBLA 5DD6B 2ZOLA 5B39G 4X5XB 1C5BH 3MACL 5TF1L 2HVJB 5C70A 4HUVA 3RIFF 1JGUL 2YD7A 4N8VB 3MRFB 3PGCA 2ERJB 2OL3L 3BW9B 4RNRB 5AZEL 4D0DB 3SDYL 5IK3A 1T5XA 4JZOB 4OLYL 5HHVH 3LEYL 5ENWA 3N9GL 3LDBB 2YUXA 3RUGF 2OR9L 4PGDA 1GOGA 3EYVB 1I3VA 1JRHL 3SEPA 4JQXA 3MGTA 1HHGB 3QXDA 3SDCB 1R5WA 3H2WA 5C0FB 1MCIA 4OZFA 3S35X 1VCAA 4OUOA 1D5IH 3U46A 1CFQB 3CLEH 1DQQB 3KPSE 3T8XB 3MA7A 3L3DB 1NBZB 2DQEL 1P5VA 2VYRE 3QFJB 1WIPA 4OCSL 4Y2DB 3RWJA 5IT2H 1OT1A 5I1HL 4Q74A 1WTLA 4DUVA 4A6YH 2O5XL 5CINH 4WEUD 4ONFH 5E8DH 2GK2A 5ACZB 1MWAH 5ESAB 4EUPH 3DRQB 2J6EA 3FMGL 1BZ9B 1AXSA 2X4NB 3O9WC 3UO1H 1C1EH 5KOVC 2Y07H 1RZJC 1UA6H 1XIWB 1S7WA 2D7MA 3P0VL 3VXUE 5DMGD 4OF5A 2DD8H 3PWLB 4MAYD 4Q0XH 4XVJL 4K71B 4Z7QF 5B38A 5IVOA 5EUOF 2IANE 4GW1B 3V6FA 1D9KB 3BP4A 3OB0H 5FGCE 4K2UH 4U0QB 2M26A 4JRXD 2I9TB 4W6YB 2UWEE 4QTIH 3ZKMC 1CDUA 4IEFB 4ZUSA 3AU1A 3EDKA 5BRZE 1F6LL 1VHPA 1EUTA 2N1KA 5CGYD 4ZFOA 1HKLL 1Q9WA 2Q20A 4NM8H 4R7NB 4PJCE 4PRIE 5C86A 2H1PH 2VNCA 3CX5K 1YECL 4LGSB 3HLAA 1U3HD 4PJIA 3U1SH 3T3MF 4RGMC 3DURB 1CBVL 4S0SD 3H9HA 3HUJE 3X3FL 4JRYB 4NQDE 1EMTL 5HYQB 1FFRA 3CJJA 4I0PD 1S9XA 4R90L 2GFBB 3FCTA 5DHVH 4TNWF 4IM8A 5IFHH 3MV9D 5GISL 3IU4L 1U8KB 3QIBA 3T77B 5HHPA 2UY7A 2PW1B 5AWNL 5EN2A 3L5HA 1IZJA 1DBBH 2IBZX 3QUZB 1FVDB 4CKVX 2VLRB 4K71C 1AKJA 3PQYA 3QDGB 3CLFL 3Q0HA 4JRXA 3BZDA 1J0JA 3B9VA 5INDA 3ECBA 3CGTA 2A6IA 1JN6A 1SY6A 2VXSH 3G6JA 2ADJA 1G7MA 1ZLVH 3MLVH 5FDWB 1AHWA 4OB5L 4N0CC 5DO2C 3BXNA 3H3BC 5CD5D 5TE6L 4LCCB 5CBEA 3NA9H 4YDLB 5DYOA 1CDBA 5BV7B 3CX2A 3TWCH 3VI4E 4ISVB 1QFWM 3KXFA 1S5HA 5DFTA 1T04B 2DIAA 2DLIA 3RL2A 1C12A 3J7HA 3FO9A 3UYOD 3G04A 3QQ3A 5HPMB 1I1RA 2GT9A 2NY0D 5GSRA 1F8TH 3ZKNC 3WHXA 1CLZH 5I66B 3WIHA 3ILPB 4KKLD 2AJXL 4NN5B 4OLVH 5HYJE 1OARH 3T1FA 2XN9D 4PRDA 1JPST 1H8SA 3LRSB 4LLVA 2B20A 2VLKE 1SVCP 2NY1B 4P4RB 3G6AA 1JZ6A 2P24B 3BP7A 3JUZA 4WI8A 3HMXA 2A77H 3G08A 5D2NA 2VDML 3S36X 3DYPA 3VXME 1NFDF 4WTZA 2VRAA 5LG1A 1HQ4B 1CGYA 2RHEA 5K9KA 3T65B 4JFZL 2WZPD 4MAYB 1KB9K 2DS4A 1N6QH 2H32B 4NKIH 4XVTL 3LEXB 2R69L 3C6LB 2QR0A 2XICA 4RFEB 4JG1L 4U1NB 2DTSA 4P5KA 5IF0A 1N59A 3BPCB 3TH3T 1ZGLM 1J1PH 4P23B 2F8VA 1I8KB 3I75A 3IU3B 1NCAL 1LEKB 4X4ME 5E8NB 5JA8B 3OXRB 1QSFD 3NAAL 5J0BA 4XNYL 4BK5A 5C0IA 4QRPB 2BVPB 1BJ1J 4KDTC 3ARDA 2CH8A 2W9DH 4WUUD 3QFDB 2XN9A 1ZV5A 3O2WH 4EIZC 5CJXA 1KIQB 1U3HB 4K7FB 3IFOB 4OD3L 4W6WB 1RSFA 3A6CH 3VFGH 4J6RL 3P9LA 1BMGA 4MQTB 4TSAL 1A3LH 4M1GL 1F5WA 1JHTB 1DP0A 3FB8A 4YFDB 3I6LE 5E6ID 2EH8L 1A7PH 4NQCA 1YNKL 4J23A 4YDJA 3MV9B 4QOKE 3B9EA 1HSBA 1J10A 3DX7B 1VEOA 2AEQL 2FEEI 1AGDB 1JNHB 1FC2D 5DMGC 2FBJL 1L6ZA 2E9BA 4X80H 3QHZH 3GMQA 4M62L 4GAJL 2J8UB 4YNYB 5LJYH 4PJ5B 3VXPA 1ZT1B 4AMKL 2CIKA 4BZ2H 3BP6B 5E5MB 5C0EB 4NQVB 3SJVA 4NO5A 5TDNA 3BEWB 3FAXA 3SKOA 2XT1B 5B39B 1BLNA 1RZIA 5EU6B 3CFKB 4CVXB 3P3YA 3CU7A 1AHWC 3KVQA 2VDRH 3C8KB 1YEKH 2GSIB 5CGYC 3GUTB 1GHFL 3O4OB 1OAKH 1I1AB 4N9OB 5F6HJ 1JWSB 1RPQA 1QA9B 2JELL 3QDMD 5CEXA 4JM4H 4KPHH 1L0YA 2YD9A 5BW7A 2ORBL 4JVUA 4OF8A 1K85A 1HEZA 4X6FA 5GGVL 4NZRL 3ALXA 3BPOC 4IRZH 4NHCH 1VADA 3LPGA 4I0PC 4G9FB 4I0KA 4PV8B 4BFBD 2BJML 4YQXH 5IVXE 4HUNB 1I3GL 1SEQH 4KAQH 4RFNB 2PW2A 4WHTB 1OT2A 2NZIA 3ARTA 3PL6A 1FAIH 4ESKA 4HLZH 1LE9A 2RFXB 2EDLA 4IDJL 3MRDA 3MRNA 3NZ8A 3TVMD 4M6NH 2B1AH 1N64L 2D0FA 5CZVH 1AO7D 1QFWL 5D2NC 1GIGL 3W11D 5CGTA 2WINB 1R5VA 1S7VA 3MLZH 4I9WD 1IGJA 1JZ4A 5GGRY 4NP4L 5CD5C 1RZKC 4U1HA 4XC3H 4UUJA 2FHFA 5IVZB 3VJ6B 3V0VB 4Q9QL 2JTDA 1QSFB 3O4OC 4HK0B 4U1GB 1I1CA 5D7IE 4KKBD 2YPLD 5IKCA 2NY0C 5FECB 5IESH 1UZ6F 1J0YA 4DW2H 7CGTA 2AXFA 4WUUB 3MLSL 1DBKL 5LAXB 4KKLC 5AD0A 5IMKB 4GG6B 1YPZA 1WBXA 4C54A 4JREB 1HH6A 1RFDH 2VZVA 2IQ9L 1FDLL 3L3OB 2KQNA 1XF4A 3L3HA 1HN1A 1AO7A 1YY8B 1BIIB 2X4OB 3WO3B 1P2CB 3GEWB 5MHSE 3QYCA 3DX8A 1MI5A 1J05B 4D9LL 4S1SL 4RMUA 4JJHA 2OL3A 4Z9KB 5DD3H 4HHAA 3PWPA 5DHVB 2R56H 1IQDB 1RU9H 5C6PB 2V7NA 4FXKB 4Y1AE 3ARSA 2ICCA 4U6YB 4HIJA 3LSOA 5F7WC 5FGBA 1P7KA 3AY4C 5GPRA 2YD1A 4XPHH 1DVFA 3QWRD 2V2XB 1S7SB 2BC4B 4PJ7A 1BD2E 5DZLA 4ZD3L 5GRWA 3PGFL 3T2NH 4QHKI 1IMHC 5H94A 3QDMB 3MRPB 5JW4N 1R3JA 4ZOEA 2APTA 2W0FA 4JREC 4WHYG 5EIVA 1FG9C 4ALAL 4M03A 2X4QB 4Y4HD 3MNZB 3U7WH 5E6IC 1LDPL 3K7UA 4NQEE 3R1GH 1ED3A 4O2CB 4Z95H 1ZLUK 1IEBA 4PJXA 5JR1L 1ZHNA 4JY5H 3U9PL 3KLSA 1XH3B 4HWZA 4M02A 1SJVA 4CGTA 1N4XH 3PDDA 4J4PD 4WI2A 4HIXL 2BX5A 2D4FA 5CP7B 4UNVA 3ARFD 3T2OA 5EB9A 1J86A 1T1YB 5IQ9B 4BQ6A 1FFOA 4E41E 2JCCE 4OIIL 4KK5D 2V6HA 3MRBA 4JFFB 2ZOKB 2QQKH 4OKVB 2VDKH 3P9MA 2YHGA 3MFFA 3QEHA 1J8HE 1E0OB 4JFED 5KSBE 1F3RB 3MV8D 1DE4A 4Q6IA 3DGGB 4PJ9D 3N85L 5JOPE 3WUZA 3MXVH 4E0RB 3PDOB 5TJWK 1JZ2A 4QRSA 4MS8C 3DIFA 2I60H 4MAUH 2IBBA 4PLNC 3ARED 5I1CL 3WFDL 1VFAA 3VMNA 2ZJSH 4ZQKB 3MJ9A 2Q76B 1J11A 4ZG1A 3NCYP 5EOCH 4DCQA 1OAUL 4YHOH 4HQQH 1NMBL 4YHMH 3DV4A 3B43A 1EEZA 3TVMC 4GRWE 2EC9T 3GGWA 5C0CA 2OYPA 1Z3GL 3VFRA 4F58L 5CIPA 1HYSD 3QIWB 3DBXB 4JVWA 4DUXA 1X5JA 3B4NA 4F33B 1A1NA 3OAZK 1CXKA 4M00A 5HDBE 5IG7B 2A9NL 4TNVF 2X42A 4PJAB 5ICZA 4QXUL 4GXUN 1F2QA 1RJZA 4CU6A 3IDJA 5F89A 1UH2A 2A2QT 1T1XB 1G9MC 4ZUTA 1CR9H 2NXYB 1XAUA 4EI6A 4JHZA 3EYSH 5F1IB 3DMMB 4HIHA 2NXZD 1GGIL 4KKBC 3N50A 3NFSH 4GW4B 4KHXH 2HJKB 1LNUB 2FZ3B 5GJTL 1YN6B 5GRJL 3U6RA 1AI1L 4P9ML 4H1LA 3B3IA 4YBQD 1H3PL 4H26B 1GGTA 5DJ0A 1YEIH 4OI7A 4PFEA 6FABH 3HG1E 1AGEB 3HTLX 4ONHA 2DJUA 5D1XA 5L88H 5T5FL 3RL1B 2UYLA 3F7VA 3BAEL 3O4LD 5EORL 5ALCL 3ZSSA 1WWAX 4XCCL 1X44A 2BXYA 4K7PY 3WSQH 4UT7L 1S8DB 3DSFH 5CZXD 4Z76B 4ODVH 5FA3A 1MEXH 5C0BE 2APVA 5LWYL 5ISZD 2B4CL 1RUQL 4X9BA 3WFCL 3CFJB 1G6RH 1G7JA 4D3CH 3U0TA 3LS4H 1T7YA 3NACL 4YHPA 4RGOH 3QULB 3ARFB 1YDPB 5IFJB 1FZJA 2WNGA 4LMQI 5IB4B 3E2HC 4P2QE 4U1MA 1R3KA 1P5UA 5D2LB 4DVBA 2F53D 4LCWE 2N4IA 1QLEH 2BFVL 2P5EB 2J2ZA 4L4TE 4Y4KA 3V6OC 4EDWH 5FUZL 3E3QE 3NIFF 4OFVA 3KLHD 4JFEB 4LLUA 1PX4A 5HSFA 4G8IB 4NDMB 5EU7E 3MV8B 1TJGL 2F19H 4PJ9B 1I7UB 1ES0B 2H3NA 3O4LA 3ULSB 2F58L 2C1OB 4TVPE 3NFNA 1QSED 1NMAL 5B8CC 1P7QD 3MODH 4LCUB 5IMLB 1F90L 4FN0A 4M7LH 4ZUWB 4AH2B 4K9EC 1EPFA 2AK4D 4Y4HC 1OPGL 4WWID 1JNNL 4ZOCA 4TQEL 4KTEH 4JZJA 1X7QA 3QUXA 1Q9OA 2UV3A 3DROB 1J12A 4X6BB 4XNMA 4C55A 2OSLB 2KZ1B 4M48H 1RUAH 3GB7A 4OZHB 4DGVH 1XCTA 4GQ9L 2ZUYA 2YXMA 2DMBA 1D6VH 4J4PC 1I9IL 4FQCH 1Q0XH 5CBAA 1K4CB 3NOIA 3CK0L 3GK8L 5H2BA 4YUEL 1CE6A 1AFVH 3IYLW 3QUML 1C5DB 5DWUH 1YYLL 3S5LA 4O51A 4OCLC 1SEBA 1GGCH 4NBZB 1KB5B 1S7QB 3QG6A 4LCIL 3LN5B 5IEHB 5JLZA 1YN7B 4OZIF 7FABL 3QXAB 1PGRB 4F37K 2NXZB 2IEPA 5GS1A 1QSEA 3MRJB 4PJ9C 4Q97A 2GUOB 3PIQB 3UTQB 1A6UL 4YDIH 3OWEA 2OXGA 1KPVA 4JO2L 5IHZB 3AREC 5D7KE 5CUSH 1P4LB 3VXRE 3C60D 3EO9H 1XGQA 3D39E 4Z7WA 3ISWA 5DHYA 4P9HC 4MA3B 5DJYA 1WWBX 2P7TA 2VLJE 3KPSD 4FQ1H 1I8MB 4GG8A 1HOCB 4K3EH 2EYSB 1KT2B 5JXEA 3D69B 4Z8FH 4ZAKB 2FSEA 3TZVA 4LNRB 4E42A 5I1JH 1T0MB 3EO1A 1DN0A 4U1JA 2OZ4H 4APQD 1OAQH 2FJGB 5CEYA 4C56D 5KSUB 3DHJA 2G5BB 2H6PB 3TIEB 3F5WA 3JV6A 2AS5M 3W2DL 2WUBH 1HYSC 2ARJA 3DXAA 4D9RE 4KUCF 4BSJA 3NA4A 1ZKAA 2C7UB 3L3IA 2UVEA 3CDCA 4XPAH 3UPAA 1T5WA 1TVDA 2YRPA 2BOCB 5C0ND 2YPVL 2IH3B 4ZSOE 1D5BB 4LDEB 3PWPE 1KNOB 5C07E 2P49B 3QG7L 3QIUB 3FT2A 5DUBA 5E99H 3VXUD 5BVJB 2BVQA 3QWQB 2F53B 4X6CA 3SOBH 1U8JA 3QCTH 3QZWG 2XZQL 4EQ3A 2IAND 2GJZB 4NHUA 5BZWA 4ORGB 3C60A 3D9AL 4Z5RA 3GMRA 5DDHB 3BH8B 4OCYH 2CRMA 5JO5B 3NH7H 4B0MM 4YBQC 1B90A 4FQIL 4Y4KC 4HCRL 4YXLH 1OGAA 1OWRM 5D8JH 4G9DA 4UOW0 4JFDA 4XP5H 1KJ2H 1I9JH 1REIA 2QSQA 1KELL 4LSVH 1INQB 1AJ7H 5C09A 5I19H 4C56A 3MLRH 2X9YA 4LF3A 3OKOB 2FH8A 3QA3A 3OB0K 3OKKB 4HKBB 4RA0C 2IADA 3Q5TA 5CZXC 3UAJC 1RZJH 4TTDD 1AQKL 4YHLL 2XTLA 4FQHB 5D5MA 1AE6H 3SDXF 1OD9A 2EKSA 3TYGH 3UYPA 4M1DH 4JZJC 4C59B 3FOLA 3MV01 4BSVA 5K9QG 3F6IA 3QUXC 1IC7H 4JPWL 1ZWIA 5HVHC 1MJUL 1FNHA 2YR3A 1BQLH 3MBEB 3MREB 1ZGLA 1LP9E 2BNRE 4ETQA 3WIFA 3NBNA 4FZ8L 3MA9H 4KQ4H 3VI3E 4GKSA 4DK3A 5HDOA 1W0WB 3DUUA 4HWBH 5EO1A 3DX9B 2VXQH 5DJZB 3NFPA 1RZ8A 1R3IL 2BNQA 5EU4B 3KLHC 1M6OA 4NKOB 4YPGA 2VC2L 1RMFH 1U8OA 1MFCL 3ULVC 1ZHKA 4RQQB 1C5CL 5GS1C 1FHGA 1HHIB 3O45A 2FEEL 1CYGA 4KWUA 4NN6B 2WM0A 1UB6A 1S7TB 1K2DB 3KPSB 2ZUWA 2HVKA 1AP2A 1WEJH 4ODWA 5MEOB 4R7DA 1RV6X 4OF6A 5F3HA 4NKMB 4DEPB 3OGOE 4JKLA 1ZLVK 4UNUA 4APQB 4GBXD 3S35H 3RWIB 5JXEC 3NPZB 5HYJD 4QXGH 1QTYT 3R8QA 1KCVL 1PEWA 1TNNA 3T0VA 3TF7C 2IC2A 3FQWB 2A6KB 3G5XB 4E5XB 1DQMH 5A2FA 2DYPB 1NFIB 4ZXBA 3MCLH 3GRWL 1SJHB 2BVTA 3I6GA 3RY6A 1TITA 3VG0L 4G8GE 4BK4A 2XWBA 3VXUB 3VH8G 1A7OH 3KYNA 4U3XA 1S9YB 3O11A 4ELMB 5E8PA 1G6RB 2DQGL 4OZFH 5E5UB 1BQHB 3PABA 2X70B 4NJAH 1IAMA 5JHDA 4NRYA 4WFFE 2EZ0C 3QQNA 5BJTB 1E4XH 5D6DA 1HXMA 2ADGB 2VN7A 1J9CT 2Y5TB 4P59L 4QY8B 3C60C 4F7MB 1B0RB 3RDTB 4NN6C 5JOFA 2R1YB 4WRLA 2VE6B 4NQTA 2IBGA 1AY1H 1T89A 5KVDH 3O3EA 5BRZB 3INUH 4H25B 4BFGA 1TZIA 4M7KH 3HR5B 4XAWH 4MB4A 3S96A 2BVOB 5HHQB 5F3BA 4PJCB 3RIAK 4PRIB 5DJXA 3MRHA 3O41A 1MCPL 2J6EH 4LP5A 3QSKB 3LKSB 2VLLB 1T03H 3HC0A 4G6JL 4NQDB 2COQA 3M17B 3BDXA 4PB9L 4N8CL 1A7QL 3I6LD 4CMHB 5EZLA 3O3DB 1Q72H 25C8H 4QOKD 3IJHB 5E03A 1G9NC 5I30L 3EYFB 1S5IL 3FB6B 5C0NC 1Z9SA 2VXTL 2I07B 4HEPG 5I15L 2IF7A 4ZODA 5BCAA 3STZB 1IM9A 2SEBB 5HJ3B 4KI5E 4JQVA 1I75A 3TNNB 5DHXB 1I1YA 1T20B 3S4SG 4L8BB 3FHAA 1G7PB 4PTTB 3QEQE 3RNKB 4JY4A 4C57C 4M6OL 1LEIA 2VQ1A 2HFEA 4LQFH 4IMKC 1URLA 4XNZC 4K8RH 2KBGA 5C9KA 15C8H 2YK1L 1T83A 1P1ZA 5AYUH 3CDGA 1KIRA 5FYJH 2DMCA 3TV3L 4X7CC 1PLGH 1CFSA 3G6DH 2AJZB 3QZWA 4BQCA 2X89A 4Q6YA 4TTDC 5J6GA 4RRPA 3C08L 5I74C 4UV7H 2W65A 3BWAB 4PJEA 4Q9RL 4TOYH 3TNMA 5BZDB 2W60B 4OCRH 5IIEB 4JPVH 1QBLL 4XX1E 1MAKA 2HH0H 1IFHL 3ZT7A 2VLKB 2ZSVA 3Q1SL 3T0BA 5E1AA 4KZEH 1ZANL 1NEZG 4AL8L 4NFCA 1MJJA 3TT1H 4NJ9L 1SY6H 3U0PA 4N8PA 4WHCA 3T0ED 3VXMB 5CHNB 2ITDB 3MLUH 1BX2B 2EE3A 5J9PA 3QUYA 4JAMB 2DI9A 1V7NH 2EYTA 3HNSH 3RY6C 5IQ7L 4LHUG 1HQRA 1LO2L 1F3DH 2AI0H 2DTMH 4JY6B 4N1HB 2P8MB 4MA7H 3KPPA 3WXWL 3TCXA 1ZT4A 4F57L 1M4KA 5D7LE 5IW6B 4NQXA 4KROD 4NNYB 1LD9A 3S36H 2OMNA 5HHOE 3LY6A 3GMLA 4X7TB 3GSWA 3MC0A 4I4WA 4U1LA 1J0ZA 5D6DC 3WIHH 1RULH 4NQSA 2IG2L 3AROA 4XC1H 1NGYB 3WLBB 1EX0A 1DANU 4WU7A 4UT9H 3DLQR 4EBQH 2I26N 4KQ3L 4WI4A 4HDIA 2CLVB 5T3ZL 3WKNA 4KMQA 4YK4B 5DVLA 1EFQA 2XA8L 4GBXC 2W9EH 1A8JH 3MLXL 3ULUL 5I73C 3HMXH 2XACC 3AB0C 5I1EH 3QISA 1S7XA 2DL9A 1RK1B 2R0KH 2R0ZL 5JW3H 1JNLH 2J8OA 2O5YL 1KJ2B 3TFKC 2PF6A 3T0EA 4PRNA 1FBIL 3ARQA 2QV2A 2GKIA 1MFDH 3ARGB 4QOKB 4KXZH 3W0WE 4DTGL 5MHSD 4OLXH 4MCYA 2VDLH 4MWFB 3LHPL 1CL7H 3CFBB 3GO1L 2I5YH 2YC1A 1IAKB 1DQLL 2X4TA 5MERA 3O3BA 1JPFA 3EDFA 2X05A 1NGPH 1NC4D 5FHBH 5F7DB 4BQ8A 2G75B 1ONQB 2W59A 1PKQE 1TZHA 2ICWI 3CXDH 4KVCH 4HUUB 1JHKL 4Y1AD 5C6TH 2C1PB 3KPLA 5FUOH 4EZMA 4N0FA 3H9SE 2LABA 5C9JB 4Z7NF 5IW1A 3MRMB 4OM0H 3WDIA 1BD2D 1XGYL 3VH8A 1RJLB 3BQUA 1ZHBB 3EAKA 3SHSA 1LK2A 5EZIH 4PGCA 4QTHB 3LQZA 5I0ZA 3VFUA 1JZ3A 5C6WH 3STLB 1NQBA 4Z0BL 3LKQA 2QSTA 2XYCA 4IMLB 4YHIB 5BXFA 1U6AL 4NQED 2ZOLB 3HPJA 4M6ML 5C08D 3DO7B 5ICYA 1ACZA 1LE5B 4WWKA 4YWGH 2V5SA 1H3GA 3IJYB 3C5ZD 1BQUA 4PJ8D 1ETZB 2DBLH 3PHSA 3OZ9H 3CZJA 3O6KL 4P3DA 1W8OA 2D7TH 5IK3B 2BP3A 3L5JA 4LIQL 2LU7A 2CDEA 3IF1A 4X7EC 3VE0A 3BI9X 1AD0A 3LKOB 4DN4H 5DRWA 1BFVL 3QUYC 1F6FB 4S10A 2Q8BH 4E41D 5I75C 4PGDB 1A6VL 2EEAA 4KROB 1UQSB 2AXGA 2R15A 1T2QL 3HCVB 4XCYA 4RFOH 3VXQA 2VAAB 2HT2D 3D3VA 3QXDB 3Q5YA 3V6ZA 4YX2H 1J8HD 1XGPB 1K3ZA 1LK3H 4HS8H 3QNZA 5IFAL 1FYTA 2V5TA 5JOPD 2ENYA 3ZDYF 3MA7B 5JQ6L 2A1WH 3CMOH 4PS4H 1ZA6B 4UAOB 3RWJB 8CGTA 4LPWA 4J1UA 4LHUD 5KVEL 3FT4A 3QAZB 1IC5H 4D0CA 1WGOA 2J12B 1RK0B 1CFTA 2Q8AL 1RIHH 2L4OA 4XBGA 5MP6H 5TH2B 5IM7B 1GOHA 4UQ2B 4OD1L 1Z5LB 4NFBA 1JYNA 4RDQF 3T0EC 1IARB 2PNDA 2QHRH 4XZUB 2P42B 3VRIA 1NJ9A 1NDMB 4DK6A 1BJMA 1WZLA 3IFNL 2YOCA 4I2XA 4I18C 5MI0C 2E27L 1MHPH 4O4YL 3T2QA 5FM4A 1G6VK 4HV8B 1VFOA 4Y1AB 1NCWL 3TBTA 2XXCB 1AQDB 3BP4B 1NEZA 3VFMB 3OMZA 4AEHH 1UKQA 1LGVA 4EJ1C 1A6WL 1W72B 4S2SA 3GJEB 3MUZ1 3VWKA 3MBXL 3WEXA 4FOMA 5BO1L 1IEAB 4FQLH 1KCRL 4UAOC 4XXDB 2XY1A 2CKBL 1B4JL 1J0KA 1Q9WB 4MA1B 4XPBH 3HG1D 3MLYL 5H35A 2HT4D 5JOEA 1KB9J 1MJ7L 5FA4B 3HLAB 3MACH 4PJIB 3IDIB 3LRHA 3L7FA 4JFPB 4NQEB 2P8LB 3WLWD 2XZCH 2OL3H 2FO4B 2AJUH 2A74B 3LVEA 4OLYH 4B7LA 3C5ZB 5C0BD 3LEYH 2J8UF 4OGYL 4PRPE 4MNGE 1DR9A 3QIBB 2JJTA 3U2SB 4WWKC 3FB7A 5HYFA 4WV1A 3H3PH 4PJHA 3BHBA 1G0XA 4K3DH 4PR5B 3KJ4B 4W6XB 2IFFL 4G5ZL 5DI8B 3GRWA 3HA0A 1WFNA 3TPUA 5L2KE 5B22A 3W82A 4RAUB 4P2RE 1QPPA 5INDB 4E41B 2JCCB 5FYKL 4P2QD 4KFZC 3M07A 1JN6B 4LCWD 4MD0A 4KUZL 1G7MB 3T4AA 3CVIL 3BXNB 4MNQE 3TIDB 3PWJA 3JWNC 4L4TD 2B39A 5LKNA 5CBEB 2XNAA 5DYOB 5KSBB 3CSGA 3GSOA 4UI2A 1RUPL 2LE9A 1JIBA 3KXFB 4X0KA 5CJQL 1S5HB 4Y4FB 4G3YH 5AG8A 5A3IC 1T1WB 2O5XH 4DKAA 3WHXB 4ELKA 1KG0B 2Z31B 5E2WL 2VXVL 3VWJD 1U95A 1ZS8A 5DD5L 3ROLB 5LQBH 4P46A 1C8PA 3TGXA 3FMGH 2YSSA 3T1FB 4F80A 1KPUB 3N1GC 4XNXL 3D2UA 4PRDB 3EOBB 3C5ZC 1QHOA 1PX3A 3HFMH 4XI5D 2H8PA 4PJ8C 2HFTA 4GRWB 1Q9LA 5FOBB 2VWEE 3WFEL 4LOUD 1QP1A 3FAWA 4XVJH 2ILLA 4G6AC 1PVHA 3KJ4C 4C4KT 4MJ5B 3VG9B 5TGBA 2J1KA 3WKML 1N5YL 3HAEG 1M05B 1AGCA 1QLFA 3FQTB 5D1ZB 3GSQA 3I2CL 4WTXA 4YHYC 1AC0A 2ICEB 5CSBA 1YJDC 3TBYA 3C9NA 3G5ZA 4K9EH 2HT2C 1S9VA 4YR6A 5EOQL 1N59B 4CRPA 3I75B 4GRLA 4HAFA 1HKLH 3MJ9H 4GG6F 3P30L 4WCYL 3ZTJG 3BEVA 1FGVH 12E8L 5D7KD 3VXRD 4Q9CA 3X3FH 1FO0A 3ARDB 3D39D 3SDAD 4U6VL 4ODSL 1IGCL 2Z35B 2D0HA 5HYEA 2DQCL 1H5BA 2X1WL 3THML 5I1LA 1L7TH 3EFDH 5C0DB 3WHE0 4IJ3C 1V3MA 3MOBL 2OTUB 32C2A 3IU4H 5CIPH 3RX8A 3PWVA 2FX8H 2WIIA 5C71A 4KRPC 5D93C 2PETA 4JKMA 1XGRB 4D9RD 2YMXH 2ATPA 4FFYL 1AGBA 3KLAB 3RP1A 3HB3D 2NY5C 5JW4R 4EXKA 2F54A 3WNKA 3KPOB 4NSKB 3T0XA 4RISL 1RHHA 4WV1C 1ADQL 3SY0A 5DJCA 2C3GA 4IRSD 1MLBB 5C07D 5FKPA 3VXPB 3PNWB 4JDZB 3P4OA 4LAQL 5TE6H 1NBYA 4P9HH 1GGBH 5CP3A 1UWXH 2EYRA 4LCWB 4H1LH 4WDIA 4GRMB 4XRCA 5ERWB 2ENSA 2QKIA 2A83A 1FC1A 4JKKA 3SGKA 1I3UA 3GMNB 4GMSH 1EEYA 3D5OF 1LMKA 1OP3H 3PHQA 4R26L 4HKJA 2MKLC 4IOFC 2HT4C 4PJBE 3JV4B 2MSPA 1RZFL 1WAAE 5GRZA 2BOBA 1IQWL 5E4IA 4HX1A 4X6FB 4LVEA 1UWGL 3N06B 3S34H 3VWJB 3ZYJA 4CADA 1N26A 3WLWC 3VFPA 1CIUA 3ARBD 1JPGA 2G2RA 1CN4A 4P46C 4HBCL 3IXAA 3SE3C 2PW2B 4L3CA 1KYOK 1D5IL 5T1KD 2IAMD 3BWUC 1B88A 3MRDB 4JFZH 3RVWD 3MV7A 4PGEA 3HMWL 3MRNB 4Y89A 5KS9A 3KS0H 4ACPA 2BNRD 1OW0A 1T22B 1EBPA 5DJAA 1JWUA 1ZVYA 5TF0A 2IALA 4ODUA 2VO5A 1FFNB 2V7HB 3R4DA 1NCAH 5D6CB 5GSVA 4A6YL 4YJZL 3LIZL 2EDKA 3FN9A 1IGJB 3NAAH 5CINL 1KLGB 2WAHA 4XNYH 5E8DL 4BFEA 1BFTA 4UUJB 4TUJA 1T21A 3UO1L 1JP5A 1T7WA 1CF8H 4J8RB 1PY9A 3K8KA 1YEFL 4HZLA 2AABH 3ZKQD 3GIVA 2IPUK 4GRLC 2XKNA 2CDGA 3QXWA 2CO6B 2DD8L 1FSKC 3D39B 4WNQB 4F7TA 3S7GA 4J6RH 2AXFB 2VLJB 4WJ5A 4OSUH 4TSAH 4M1GH 3CXHK 2NW3B 1WBXB 2EH8H 3ABZA 1KTRL 4QRQA 3RKDD 2R1XA 1CLCA 5I17B 1HH6B 4MJ4A 4WHYH 4XI5C 3DSNA 1G9EA 1A47A 3R06A 2YRZA 2AEQH 4OAWA 1QVOB 1U8MA 3AC0A 4URTB 4HSQA 1OB1A 4QTIL 2FBJH 4LOUC 1IGTA 4LSQL 3WBDA 1CDHA 2MQ3A 4PJAF 4AEIL 3DX8B 2MHAA 4WU5B 4J2XA 1MI5B 1HCFX 3WFZA 3A6BL 2H1PL 3RWGA 4DZBA 3GIZL 4WO4D 3ULVH 2OL3B 4OI8A 4HHAB 3U1SL 4ZSOB 5BQ7B 3PWPB 4Y16A 4LLYA 3Q6FA 1VERA 5C07B 4G8GD 1UXWB 4ENED 1PW3A 1X5YA 4XXCA 1NC2A 3CSYA 1BEYH 2K7PA 5EU3A 4HIJB 1EHLL 5KSAA 2R2HA 5IFHL 1HH9A 2BVUA 4WFFD 4X7DC 1DVFB 3HAEA 5GRUH 4PJ7B 1C08A 3SDAC 4I3SH 5F6IB 1KJMA 3B6SA 1I7RA 3QHTC 5H94B 3RWCB 1T3FB 1OAYL 3CPLA 4PJDE 2W0FB 3GI9L 3HPLA 4HKXB 4CU7A 4Z78A 4NWTH 2VTFA 1VACB 1RIUH 3OGCA 4J3UA 2DM2A 4X6EB 2FX9L 4HK3J 5HI5D 3IVKA 1EO5A 1F97A 3MLVL 2NW2A 2D03H 2IQAA 1B0GB 1AGFA 5F88B 4Q2ZB 1JUFA 3MRCB 2JJWA 4ZYKB 3PG2A 1IEBB 1N3NA 3E6FB 1QFWH 3HB3C 3P40A 1GIGH 3VRJB 2AP2A 3QI9D 1LP9B 1MVUB 5ESQB 3KPMA 1IKNA 1F8TL 4LPYA 4U6XB 5D2LF 4IRSC 4GUPA 1CLZL 4U3HA 1OW0C 4NP4H 2CJUH 2XWJB 2DLHA 2NY4D 2ZWLT 3JTSA 5KZCB 1PG7L 4YBLC 4YHZH 3LKPA 1RHFA 4UDTA 1FPTH 5EIQA 2Z0BA 3UBXG 5GS0D 4G80B 2A6JA 4QHLB 1IBGH 1V7MH 2GJ6E 3QEQD 1CD9B 3BKMH 2XTJC 3MRQB 3IDXL 3RUGA 1DBKH 3LKRB 3OR7A 5KTEH 4DGYL 2WBJD 5C0GB 3ZHDA 4PRAB 4P2OA 3BN9D 4QRSB 1N6QL 4NPYA 3E8UL 4WVRA 2GIYA 5CMAA 5BS0E 5EBWA 1G9NH 3ARBC 1FDLH 2W92A 4LEOA 1VFAB 3EYUH 4UILL 4OZHF 4PLOB 4X4YA 1J1PL 5F1OB 5K59F 1R3LA 1FNEA 2DOCA 4UIMA 4DCQB 3CFIC 5AG9A 5FGRA 4XCEB 4R8WH 2IAMC 1DQJB 3MNVA 1X5HA 4ONGL 1A6AA 4Y2OA 1OSZA 2VZSA 3UMTA 3Q3GA 3GGWB 5C0CB 4K23L 3O6FA 5EZJA 4WO4B 2MCG1 1A1NB 4MJIE 3SKNA 3JUYA 3VFGL 5ICZB 1XF2A 3RVXD 3IDJB 4RMVA 5F89B 5IROC 3KPTA 3OF6D 4LSUH 4ZUTB 4ZD3H 5C8JB 5JXAH 2AKRB 2QTEA 2R29L 3FQXB 3GKZA 1HILA 2NZ9D 1E28A 5D7LD 4P57A 2OQJA 5KSAC 4OLUH 5HHOD 1M7XA 5E95B 5DK0B 1G7LA 5EUOA 3QHZL 2NLJA 4ALAH 3B3IB 5FO7A 3CH1A 4XMKH 4PJFF 2E5EA 3GM0A 1LDPH 4OUUB 5DA4A 4BZ2L 4PB0L 1M71A 4GKNB 5CJ8A 3IRPX 3L3JA 4HK3N 4WI7A 5JR1H 4I77H 2DIJA 3U9PH 3MCG1 5ECJE 4LPTA 1GSMA 3BO8B 3RZWA 3KYAA 5EO9B 4CJ1A 2W07A 5K93A 5AUMB 3NVQA 1MFEH 1YEKL 3CCHB 3JWOC 4JN1L 2Z8VC 5FA3B 2JIXA 4F15C 2R9HD 5J3HD 2EH7H 3QI9B 4PGBB 4FXLA 5F9WC 2DQTH 2VUYA 2JB6B 4JM4L 2YD8A 3W0WD 1S7RB 5HPOA 2R4RH 2V5MA 4UDUA 1SVZA 2AQ2A 4IBLT 4IRZL 1DSFH 1BOGA 4YHPB 4IDLA 1T7XA 3C2SA 3DRTB 3NCJL 4XP9H 1MJ8L 1FZJB 2QL1A 2NYYD 4WEMB 1QHPA 1R3KB 4NO0D 2ZKHL 3U30B 1E4XI 4KAQL 2DDQL 5F9DC 3NIDF 1ND0B 3W39A 1KJVB 4JFHE 3QEQB 3RTQA 3VGHA 4L4VA 3SPVA 3H9SD 2VR4A 3ARPA 4IOIA 4L8CB 4M6NL 4FXGB 1S9WA 2DWEB 2WBJB 2AV1A 4X8JB 1ORSA 2YRLA 2V2TB 1GC1L 2HP4A 1NSNL 1OAUH 1MCEA 1FCGA 3MLZL 3RGVA 3N1QC 4LLDB 1T66D 5IEKA 3BGMA 4NKDA 1WC7A 1Q9OB 1ZT7A 3RA7L 2AV7A 3RNQA 1M7DA 3GB7B 3QI9C 3TYFA 4R0LA 3ZE0E 2VZUA 2A9NH 3MYJA 5DK2B 5HDQH 5IESL 5IGXL 4DW2L 4H8WH 4QXUH 5CBAB 1ODAA 1TPXC 5H2BB 1CE6B 2NY4C 4XCFH 4YO0A 4F7PA 2MFNA 3S5LB 4K3JH 3U30C 1SEBB 3EYOA 5GS3A 1FVEA 5GS0C 2HN7A 5E56A 3BKJH 4RSVA 2RJMA 3QG6B 1U41A 4JFQB 3T08A 1TTGA 3FN0H 1NFDA 5GRJH 1AI1H 5D7LB 5L7XL 2HKHH 3P73B 5HHOB 4WHDA 1JYXA 2WBJC 4Y5YA 1IEHA 1RZGA 1NAKH 3BN9C 3LN4A 2EDTA 5HYSA 4HUWB 3BAEH 5DJ6B 5ALCH 5HY9A 3MRRA 5D71L 1JHLH 5A40E 5DJYB 3UBXA 2EDJA 3OKLA 4UT7H 4GG8B 3VXNA 4WTWA 2W0KA 3OKMA 2EDYA 3FQRA 2FSEB 3TZVB 3O6LL 4PTUA 5LWYH 3EO1B 4YC2B 3DECA 3S9DB 1DN0B 3WFCH 3NZHH 4XPHL 1IC4L 1SM3H 2YEZA 2OLDA 4WI9A 2L7UA 3F5WB 3U36B 4PP1C 1TQCC 3W0WB 1CD1A 4ZO7A 4GXVH 3WFHB 3ZLQC 4HC1A 1MCFA 3I9GL 1TTUA 2C4FU 3RVXC 1U2HA 4HMEA 3L3GA 4X6DE 2BFVH 3U7WL 3FT2B 4RX4D 5DUBB 1CFNA 5EA0L 1MHEA 5FUZH 3R1GL 3QNXA 3HZMB 4NO0B 4YEFA 2NZ9C 4NO2B 1TJGH 4JGJA 4Z95L 5AEAA 4H88H 4JY5L 1QFUL 2UWEF 1QQDA 4HLJA 3GMRB 3RHWK 4U4BA 3SO3C 1XFPA 1F90H 1D6EA 3MR9A 5DVMA 3HI1A 4LAJH 4PJCF 1HXYA 4LRIA 5D1QA 3FZUD 2VAJA 2XI9A 4G9DB 43C9B 3V5DB 2DI8A 1AIFA 5I16B 4TQEH 2CGRL 4GKZA 2E9JA 4NZDA 1FZMA 1L6XA 4P2YA 5C09B 3OL2A 4LF3B 2NMSA 2VH5L 1DFBL 3QA3B 1SYVA 4GQ9H 2QQKL 3QRFM 4IS6A 1KIPA 3RGVC 3MOAH 2VDKL 5E7FA 4LMQE 1DEDA 3AVEA 3L6FB 1WT5A 2ZUTA 2R9HC 2EKSB 4BSWA 1XGUA 2AJYL 4KXZI 5J3HC 1PYWB 4R4BB 3ALWA 3QFJE 5CWSB 4YUEH 3ROOA 1CL7I 4IRJD 3UPRA 1ZWIB 3MXVL 5J1AA 1T4KA 5FK9B 2QQLL 5GIRB 2PXYA 4NZUL 4X83A 4TRPH 4MAUL 1ZGLB 4ETQB 2AK1H 4P5MA 4PRPD 1CICD 4J3WA 2IGFH 4R4FL 3VFWB 4L9LC 4Q7DA 4GKSB 2ZJSL 1QSZA 2NYYC 3TC9A 4MQ7B 1DUYB 4FTVE 5EOCL 2Z8RA 4YHOL 5CEZD 3MLTA 1RZ8B 5KG9A 4P2RD 3RWHB 3GSVA 1A6UH 1M6OB 2P5WE 3K3QA 3KYMB 4MNHB 1IM3A 3VI4F 3KYKL 1WUNT 2V2WA 1KTKE 3FQNB 4V1DA 4XBPA 1MOEA 5FYLL 4CJ0A 3HE6B 4MNQD 5T1DL 4NRZB 4KZDL 3L5IA 2E6JA 4Y5YC 1TETL 2R4SL 1P84K 1TCMA 4N0UA 3HNTL 4XP4L 1UB6B 4LVNC 1JZ8A 3FO2A 5GGSA 4CN4A 4CVZB 1T66C 5KJRH 3NN8A 2HVKB 1K4DA 4UOJA 4R7DB 4EQ2A 3EYSL 2R0LH 3NFSL 4L8SA 1CICA 4KHXL 4P2CG 5CS7A 5GGUA 5I1KH 1H3VA 4K94L 2YPVH 1N0XL 5T3XE 4BYHA 2XPGB 4DGIL 4JRYE 1YEIL 3IDGA 5GGVY 6FABL 2IMMA 3SCMA 5CLWA 4M3JA 1FVCA 3CFDA 3EW3B 4UBDD 5L88L 3OHXA 4ZS6D 2XZQH 4OLWL 2VMFA 3GMOB 2XWBB 4KJYA 1XGTA 4DKDC 2R2CA 3D9AH 2XQBL 3WSQL 4F2MA 4DWHA 3O11B 5E8PB 2DRUA 3WS3A 3UTSA 4CNIB 5SWSA 3CFEA 1PQZA 2VLRE 4UV4H 3CC5A 5FYKE 4XWGL 3QDGE 2F74B 1LO4H 4LVHB 5L2JA 1CDIA 4D3CL 1MRDH 2FL5B 1MPAH 4OCNC 2FIRT 2MTPA 1MUJB 4RGOL 5C0AA 1P69B 5KN5A 1U91B 4JANA 4MA8H 5TQ2L 1TZIB 2FWOA 3GSUA 4YHLH 5T1LA 4OV5B 5F3BB 2B0SL 3UROR 5DJXB 1KLUB 1PG7X 1QLEL 4JPWH 4Q9BA 1MJUH 1UACH 5JUEL 3VXTB 1RAMA 2VDQH 4OIBA 3QWOB 5F7KC 3N1PC 3TO2A 4FZ8H 1U8LA 4B7IA 4IRJB 3C8DA 1WT5C 5EZLB 2OMBA 4FRWA 4F8QA 1MRCL 3EFFA 3BGFC 3AAZA 4PRPB 1IGYA 5I2IA 1IAIM 3MODL 4K3HA 4M7LL 3DARA 2Z9TA 4L1HA 1NANH 3EJZD 1EZVY 1NFKA 3K4ZA 1IM9B 1A3RL 3LV3A 2WWKO 2W9LA 2VC2H 5L2KB 2G9HB 1FFPB 4P2RB 4M48L 1I1YB 1RUAL 1C5CH 3K4AA 4DGVL 4W70A 1GRWA 1V05A 2C3WA 4RGNE 5E24E 4JY4B 4MNQB 3FZUC 4B53A 1TVHA 1KJ3H 1F11B 2HFEB 4Y5VA 5IB1A 1A14L 2IPKA 4P5TA 5D96C 3V5HB 5KSVA 3F7PC 1UH3A 2X4RA 3CDGB 1GGCL 3D25A 2XWTA 4JEGB 5ALBH 5IVXF 4TVSa 5GXBB 4LPUA 3BIKA 5J6GB 3N1FC 1FLRL 1UWXK 3V7MA 3D0LB 2W65B 4PJEB 1OQXA 5I71B 2JB5H 4FQ2L 3TNMB 2X1PA 5L9DH 4Y0GA 1OVZA 5SWZD 1MIEL 3JV0A 4YDIL 3GRWH 5J7CC 5CUSL 1OP3K 1YUHA 1CICC 4R2GD 4L8DA 1A9EA 1FV1B 5DTFB 4HFWA 5GRVL 3UCRA 4BELD 2DQGH 4W4NA 3U0PB 4X4XA 4ODBD 3SCMC 4Z8FL 1UYWL 4FQQA 2EYTB 2OZ4L 1HQRB 1G7QA 1OAQL 2NY6C 5FUCC 3FO1A 4P59H 3KPPB 2PCPB 3FFDA 5E6ZA 2WUBL 4NQXB 1WQVT 4WUKH 2X10A 1LD9B 2DQFA 2C3VA 4KK8D 2DLFH 3EJJX 4XPAL 3JVGC 4U1LB 2XFXB 3LEVH 2DKMA 4LHJB 1OP9A 1QBML 4J3SA 1XR9A 4U31A 3AS0A 1HHKA 4WU7B 3NPSC 5EU6E 3I6KA 4I48A 2W0LA 3P4NB 5SWZA 1CG9A 5I71C 3EHBC 2WWMC 4TULH 4PB9H 5JORA 2VITB 1A7QH 3UTTA 1UM6L 2E9WA 3T1WA 4JQIL 1S7XB 1A21A 2VIRA 3L95A 1S5IH 2CIIB 4BKLB 1TCRA 3NH7L 4LARL 2GTWA 1BECA 1IAOA 2W38A 5CJOH 2DJ4A 5IB5B 4PRNB 5D8JL 4TUOB 5FKAA 3C6SB 4HXAH 4XP5L 4G9FE 4UBDC 3FFCA 1I9JL 4M5ZH 4ZS6C 3VXSA 2NX5E 4LSVL 1K6QH 3BJLA 2X4TB 5MERB 1MRFH 2EO9A 4KJWC 3O3BB 2A9ML 2PTUA 1ZVSA 3QUMB 4EVNA 1RZJL 2D9QB 3VD4A 1EERB 2PYEA 2Y4SA 4M6OH 4PRHA 4M1DL 3TYGL 3UJIH 4RIRB 4EN3D 1YY9D 2J8HA 2VB5A 3HZKA 1WBZA 2YK1H 2FO1A 1FO0H 4KKNA 4ZFZA 1VFBB 4N0FB 5CCKL 1BQLL 4ZFGH 4AIOA 1NMCB 2YUWA 8FABA 4HGMA 2X4PA 3TV3H 3MA9L 4KQ4L 3HE7B 4S0TD 3SKMA 1K8DA 2IPTL 3BQUB 3C08H 1IL1A 1A6ZA 2FJHB 4TTGA 4Q9RH 4EOWH 1A1OA 4PJBB 1KTLA 3GM8A 3BP5B 1BJ1H 3QO1A 3VFUB 4LLQA 3LKQB 1IFHH 1WBYB 1RMFL 2KH2B 4QYOA 1R0AH 1M1SA 1RVFH 1C16B 1ZANH 4J3TA 4AL8H 2V9QA 4NJ9H 3HPJB 2YN3A 5TDPA 3B9KA 3P4LA 1P9MA 2CLRA 1KN2H 1R3HA 1FG2A 4NCDA 3EJZC 4FQXD 3I3EA 3RAJL 4YHNB 5CP3H 4U1IB 1LO2H 4NFDA 4EN3A 1WEJL 4P3DB 3TN0A 2JCCF 5T1MB 3WXWH 5ESVA 2GK0A 3MJ8A 3V4PL 3LAFA 3ZKSD 2CDEB 1TJIL 5GHWL 4F57H 4LKXA 1TZGL 4PYHA 3S35L 4UTAH 1UJTA 3BRFA 4QXGL 5DVOA 4U7SA 4XHQA 5D7JD 4ZUUA 5KSBF 2BVEA 5ANME 2GY5A 2BSRB 3SE8H 3T4YB 4OGZA 2IG2H 2WUCL 5I8EB 3KPRA 3BH9B 3C87A 2AXHA 2GJ6D 3VXQB 4F7EA 3QQ4A 1I1FB 2HWZH 4ZS7L 1DQML 3SE4A 4R96A 5I76B 1BVKA 5T3ZH 1WCBB 4PGZA 2E7MA 1ZHLB 5F7LB 4OZIA 2GW5A 2K3TA 2LFGA 5EULV 3MLXH 5ADPH 1HHJA 3ULUH 2FHCA 1FZKA 1UM4H 3DUSA 2R0ZH 4NUGH 2O5YH 1KEGL 5BS0D 1KUMA 2APXA 1PFCA 1VA9A 4NJAL 1HIML 4J1UB 3FT4B 4D0CB 1E4XL 4GRWF 4DTGH 5IP4A 5DJDB 4ZUVA 4OD2A 2J5LC 3LHPH 5J6HA 4R2GC 4GAGH 5EC2A 4XNUH 4KKCC 4H5SA 1EV2E 3INUL 2VSCA 4KJPD 3KYOB 5DJ8B 4JN2A 4M7KL 1Z2KA 4FMFA 1PZ5B 3MCKA 2NTFB 3OJDA 2VL4A 5EC1A 4WW1B 1T03L 1RJYA 4MJID 3O8XD 1JV5A 1U8NA 4WFHE 5CKAA 4WW2C 1WZ1H 3RZCA 3AFLA 1OHQA 1JGVH 4ONOA 4EKXA 3K80A 3BKYH 5JPMB 1DLHA 4PREA 1Q72L 3G9AB 3AS2A 2Y25A 5C1MB 4PBVC 2ED9A 2E6PA 4X5WB 5J13B 3VWKB 2W1NA 2AQ3A 4C83B 4UMGA 1RZ7L 4Z0BH 3X12A 2CLZA 4YGVA 5MENE 2EIZB 3JTTA 2FEDD 4NWUH 4PJDB 5E8EB 3LCYA 1U6AH 5DMYA 4D0BB 1U9KA 2P8PA 2XG4A 3DHMA 3U4EB 3ETBF 4N8VG 3W5MA 4CBPA 1XF1A 4ZFOL 1U93B 3QJHA 5E9DA 2DB8A 4RWYL 5JIIA 1OTUD 4X9HA 1G7HA 1VKXA 2FYYA 15C8L 2YPKA 5K9JL 4EDXA 4JM2A 4LIQH 4LSRH 3TA3A 5I8CB 5FYJL 3O8XA 3IDYB 1PLGL 5I9QB 3V8CA 1BFVH 4GAYA 4FQJL 4M93C 3KPQA 2DBJA 1A6VH 4UV7L 5FOJA 4EN3C 1MCQA 4TOYL 3TPUB 1T2QH 3HAEH 4OLZL 3BYYA 5D7JB 1H9VA 5DEGA 3VD7A 3V52H 5ETUA 5E5RB 4MD0B 3FTGB 4AT6A 1BGXH 4JFHD 2ATKB 3MMEA 3BPLB 4KZEL 2VL5A 3PWJB 5JQ6H 2R1WA 3CVHL 4XNQA 1SY6L 2XNAB 1CGWA 2ZSWB 5DK3A 3SDDD 3U7AA 2NQCA 5BMFH 3LB6D 4AIZA 1H0DB 3SE4C 3JWOH 4JLRA 5KVEH 1V3LA 4HIEA 3HNSL 1FORH 1HHHA 3ZTJH 5BS0B 2AI0L 4LP4A 3KWWA 5DRXB 4MA7L 4Z18A 4KRMB 4OZ4A 4AM0B 5F21B 5I8KH 2N56A 1ZS8B 4X5LA 2AJ3B 3BZFB 1QFWI 4S1RH 1W0VA 3FOMB 3K8LA 3D2UB 2Z4QA 4XGZA 1F6AA 3ESVF 4FQXC 3WIHL 1RULL 2HLAA 5D4QA 4XC1L 3GSNA 3IFNH 5D9SA 1ZVHA 1Q9LB 4UT9L 1YC8A 4EBQL 4BA8A 4J7RA 5KANG 3OR6A 4YXKH 3QP3A 2UZXB 5TGBB 1NCWH 4KK9D 5TDOA 4JFOA 3OB8A 1AGCB 2EDOA 3O3AB 5FV2A 3HMXL 5HTSA 5D7JC 3GSQB 2R0KL 5JW3L 4V2BA 1JNLL 5E4EC 5HHXH 2HRPL 3QCVH 3TBYB 4N1CA 3G5ZB 5GS2D 1MF2L 3RZCC 2X1QA 1RZKL 3H9ZA 4OLXL 4EI5A 1JTOA 4QRRA 1CL7L 2LU4A 1B4JH 1KYOJ 4ODHL 3V95A 4HULB 2X4SB 5JZ7D 3HRPA 3MLYH 3WN5A 3QDJA 1NGPL 3EJYC 2LQRA 1NGZA 1QRNA 3GJFA 2NNAB 3ZSTA 3F7YB 2I9LA 1IGFL 4KVCL 5C6TL 3F7RA 1Q9KB 5FUOL 2QSCL 1RJCA 1X5GA 3SO5A 1A2YB 1K5NB 3VDBA 3RY4A 5A2JH 3BD3A 4KJPC 2HJLA 1FNAA 2WIIB 4UB0L 1N7MH 3WO4C 1A4KB 2IFFH 3I50H 2VZOA 2FB4L 5IBTH 2FGWL 5EZIL 4M61A 1AGBB 1DL7L 2J88H 3FRUB 3T2PA 3O8XC 1INEH 3WE6A 1RHHB 3H7BB 2VUOA 4KUZH 3SY0B 5DJCB 2R23A 1JWMA 5MEQA 5FKPB 1FL6A 3VFSA 1VGEL 1NBYB 1X5KA 4KDWA 4PJ7F 4WDIB 1LWRA 2A73A 4U1SA 3G5YB 4RBPH 3NGBB 2O26U 1RUPH 5CJQH 5J57B 4XMPL 1A9BA 2OBGA 3CDYA 2DBLL 2R2BB 3L3KA 4LSDA 1OCWL 5ID1B 2D7TL 4HJGA 3PHQB 1NDGA 4Y88A 4QRTA 2GTZA 4R9HA 1EHXA 2VXVH 3CZFB 3UZQA 4DN4L 1I3RA 1XT5A 1DDHA 2Q8BL 2Q7YB 2BDNH 4CADB 1U8QB 4FFZH 1BHGA 1OTUC 1RUMH 3VFPB 1EXUA 4RFOL 3WFEH 4WGWB 4N9GB 43CAA 1LP9F 5FF6A 4YX2L 5JW5A 3IXAB 3WD5L 1TVBB 3LZFH 1LK3L 4HS8L 5DD6A 3QFJD 4L3CB 3WKMH 3VI3F 1N5YH 4X5XA 4ZNEE 1ZGLP 2BHYA 5L8JB 1Z6JT 1QYGH 3I2CH 5DMKA 5KS9B 2MPAL 3CMOL 3KPNA 4XH2B 4N8VA 3MRFA 4QCIB 4G6MH 1NGXB 3REWA 4RZCB 3BW9A 4D0DA 5DQDL 3JWDC 4AEFA 5CSZA 5ICXB 1X5AA 1RIHL 5GSVB 3BZ4B 5FHAL 1FAKT 3P30H 2P5WD 2FX7H 12E8H 4OFDA 3SDDC 3LB6C 2QHRL 4TUJB 1A6PA 4U3CA 4ODSH 1IGCH 2DQCH 5SWQB 4HZLB 1HHGA 1U58A 4K7PL 1A22B 3BPNB 3SDCA 3U9UB 2XKNB 3SBWC 4ERSH 2O61A 1MHPL 3FO0L 1N6VA 2VABA 1FGNL 1V8HA 1DQQA 4MZ3A 3RX7A 2C5DC 4XBEL 3L3DA 1NBZA 5B3JE 1A6TB 4Y2DA 4QRQB 2R1XB 2FATL 2WANA 3PF2A 4OAWB 3C5JA 4FFYH 2DQJH 4CN1A 5HGBB 1IGTB 1GZQA 4RISH 4FQLL 4KK9C 3LKNB 2GCYA 5ACZA 5T3XD 3PWNB 5ESAA 3HZVA 1U8PB 2LTQB 4JRYD 2X4NA 4LAQH 3H9YA 3MOQA 4Y16B 4QWWC 4X6DB 1XIWA 4OZGA 3PWLA 1NC2B 2XZCL 5CD3A 4G42B 2AJUL 3M45A 5EU3B 1BM3L 4GW1A 3QUZD 4R26H 1D9KA 1HH9B 2VLRD 1ZEAH 5FYKD 1KV3A 5KAQF 4NYLA 3QDGD 2BK8A 4KTDL 1RZFH 4M7ZB 3H3PL 4XHJD 1IQWH 4X7SL 4K3DL 2BHZA 1UWGH 2I9TA 1KJMB 3NTCH 4OFIA 3O2VL 2DWDB 3EGSA 1MCRA 4HBCH 1OP5H 4R7NA 3CMGA 4RAVA 1UFUA 4YDKH 1MCKA 4ZMAT 3DURA 4HC1H 2NW2B 3HMWH 4GS7C 5HYQA 5K9QI 3MGOB 2GFBA 5I1GH 1AXIB 3I02A 4E9LA 4PBWD 1ACYH 1QBAA 4PP2A 4KI5F 4G3YL 5EOTB 5ITBL 2MNUA 1U8KA 3LIZH 5FB8A 3ET9F 4F8TA 3ZHKA 4M7JH 4OI9A 4NT6B 2ERJC 1WIUA 5LQBL 4Z7UE 2NY1D 3JTSB 4FTVB 4NBXB 4UDTB 3VGDA 1YEFH 3DJ9A 3HFML 4KTYA 3LDBC 1RUKH 2P5WB 2E8YA 1VEMA 2YZ1A 1CK0L 5HI4D 1KOAA 1LO0L 2XA3A 5FDWA 4ELME 4PRBA 3RUGB 4W81A 4LCCA 5DVNA 1U3ZA 3C6LD 3PP3H 5IW3A 4P2OB 3SDCC 4P23D 4MLIA 2RGSA 1LO5B 2ARJQ 2V9RA 1ZLSL 2CKBB 5HPMA 1YEGL 1NCDH 4K9EL 4KDTA 2M8XA 2ZCLH 4LSQH 4QRPD 1YNLL 4X4YB 5I66A 4AEIH 1R3LB 2JKXA 4Y2DC 1WISA 3TH4T 1Z0NA 4OT1L 2EDRA 4AENB 3MJ9L 3MNVB 3QXTA 3A6BH 3GNMH 3GIZH 1FGVL 1QUNA 4F9PA 4Y19E 3IT8D 1FJ1B 2E7BA 5HYIA 2JJSC 4P4RA 2Y7QA 3RVUD 3O6FB 1J0HA 5GGRA 3RPIB 1L7TL 3EFDL 3LMJL 1EHLH 2OTWA 2FCBA 3BX7C 1HQ4A 3QO0A 2XKSA 3T65A 4CW1B 4MAYA 3DYOA 3IJSB 3TBVA 2FX8L 1XIWC 4FP8H 1WSST 2H32A 2OX5A 2IH1A 3LEXA 1QSVA 4QO1A 5DR5L 1B0WA 1Z9OA 1OAXL 4NRXB 1ZMYA 4YAQB 3V9FA 1EJ6A 4U1NA 2YMXL 1OAYH 4P48A 1D9KC 4P23A 1I8KA 3GI9H 3IU3A 4PJ5D 1J5OH 1UGNA 5E8NA 1G7LB 3OXRA 3CVHA 2AEPH 2FX9H 3VGGA 4JPIA 3HHRB 3CH1B 4QHNB 2BVPA 4QRPA 2RAMA 3B9DA 5F9JB 4H0GA 4GAFB 3QQ9D 5LXGL 3PDGA 4OTXL 5EU6D 4P9HL 1GGBL 2Q3AA 4X9IA 1M71B 3QFDA 1MNUL 1MIML 1U3HA 1CQKA 2WMPA 5SV3A 1CVRA 5CEZH 1I1AD 2BCKB 4BQBA 4GMSL 2AXJA 4I0PA 4XVSL 3MO1B 1JZ7A 3MNWB 4BJLA 2MCPH 4PJGE 3MV9A 4G9FD 3DX7A 2Y72A 1PG7H 1FN4A 2NX5D 1JPTH 3S34L 4QHMB 1NKOA 2KQMA 2VDNH 3EOYG 2D0GA 1FZOA 3HR6A 3UTZA 1YMME 2J8UA 4LDLB 4YNYA 2VISB 3QUZC 5K9OA 4PJ5A 3IDXH 1CFVL 3VW3H 1ZT1A 2GYSA 3W39B 4DGYH 3UDWA 3QJFB 4XHJC 3RTQB 2NPLX 5E5MA 5C0EA 4L4VB 4RGNB 1XF3A 3E8UH