4HHAB

Anti-human cytomegalovirus (hcmv) fab ke5 with epitope peptide ad-2s1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
227
structure length
226
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNHGMHWVRQAPGKRLEWVAVISYDGRHEHYADLVKGRFTISRDNSKNTLYLQMNSLRAEDRALYFCAREGLSRDNSGFTGLIDYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab KE5
total genus 47
structure length 226
sequence length 227
ec nomenclature
pdb deposition date 2012-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hhaB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hhaB01
4LHUG 3EYVA 4JY4A 2DQCL 5I66A 4EN3C 4K3GA 1JWMA 4WHCA 1MLBA 2CK0H 5JORB 1WT5A 4KMQA 5JW4M 1U95B 2X1WL 4K7PH 1J7VR 3V4VH 3Q2CA 1G7JB 3IDXL 2CGRH 2XQYK 1KEMH 5ESVA 1XGRB 1MI5E 5IMMB 2VYRE 1W8OA 3HZMB 4N0YH 2HFFB 1ZLSH 4GBXB 3EGSA 2X1QA 2BVQB 3V9FA 5DK0B 3F6LA 3QR2A 3X11A 1NJ9B 3RVTC 5T1KA 5FCUL 1IM9B 1YECL 3PJSA 4I0PC 4ZOEA 5BS0E 3UYRL 2VLKB 4F7CB 4IEFB 2ZUTA 4WO4A 5DSCA 4XMKL 4NO3A 3REVA 4GUPB 4OZHB 1Y6KR 1AP2A 2QKIA 2ZCHH 4KDVA 3S5LG 3NPSC 4UT7H 4OLUH 3MLUL 3FB5B 4IMKC 1M05A 3P9LB 2JJTC 4N0CC 2B7DT 5DUBA 2CKBB 5D9SB 1PDKA 3V6ZB 1DTUA 3QPXL 4JHBA 3O2WL 3EYFB 2YD7A 3MRHB 1D5ZB 1YJDL 2H32H 5ECJE 1IGML 3ZYZA 5TH2B 3EJZD 3HKFA 1IAKA 2E5EA 2WBJD 4G9FB 2D7MA 5A2KH 1DLFL 4I0KA 1YUHA 4ZAKB 4O2FA 4LSTH 2X4NA 1OAKL 3CXDL 3W39A 3FO9B 5DS8B 4Z7NF 2EDXA 3C6LC 4BJLA 1S9XB 1CD0A 4RRPG 4ODWB 3HUJB 3V0AC 4NN7C 2XKSA 4P5TA 1K8DA 4QWWC 1JUFB 3DO3A 4YXKL 3KPSB 3P0VH 4KUZL 5CJOL 2WINB 2BNQE 2VQTA 5B4MC 2PO6B 5IB3A 3GI8L 4NO0A 4YIQA 4L4VD 3OAUL 3IDJA 5CIPA 1BVKB 1FNLA 3VXRD 3LN4A 1PBYA 2V5SA 2A6IB 5FGCB 3IJSB 4MA3A 4OZFA 3PNWB 3BZDA 1FNAA 5DVMA 2FNBA 1E27B 5J89A 4EZMA 1UCTA 3K74B 3L7EA 5GRJL 4HQQH 4IRSB 3JSSA 2Z8WC 5D2LF 3TV3H 2BY0A 4AT6B 1BIIA 1KCRL 4O51B 2GFBB 3V4UL 3WUWB 4ZUVB 1VFUA 3DI2B 2IAMA 2WQRA 2I25N 4OGZA 3C6LA 4RMVA 5C07D 5TF0A 1T7ZA 1WZ1L 1F90H 1NMBL 3LY6A 2X4RA 4ZFFB 3QHZL 1BX2A 4GBXC 1QA9B 5GSRA 4XP9L 4X4ZA 3OMZA 2D0HA 3WFEL 5C3LD 1TPXB 3FO2B 1KN2H 2NTSP 3P4MB 4MAUH 3DTXB 1BFVL 3WJJA 4TTDC 2OR9H 4D9QD 3UPRB 5E2VH 3MO1B 1UM4L 1FJ1B 1IFHH 1RZJC 4P46C 1VCAA 3VGAB 3JTTA 4LVHC 5E24E 4RGOL 3I3DA 3MRBB 3HZYA 5MERB 1C7TA 4N9GA 1OGTA 5I17A 4L9LC 3SGJC 4LEXL 3QCVL 1QFUL 1AO7E 3VRJA 1CGYA 2WM0A 3O3BB 3BZ4A 4X4ME 3CZFA 5GJSL 2NMSA 1LO3L 4Y4HC 2BERA 4Z7VA 5GRYA 3WXVL 1NBZA 3I6KA 5FA4B 3VFGL 1U8MA 3PDOA 4OF5A 1FG2B 2DM2A 4HGWA 4PJXA 4NQTA 4ZO9A 5F1NA 5IEHB 5L2KB 3PWUA 4FQQA 1U3JA 1J0IA 2XA8H 1A7NL 1FVCB 2PUQT 2FATH 5TQ2L 4M43L 5MEPB 4QWWD 3LKNB 1U93A 3N9GH 3TIEA 2DDQH 4DUXA 5I1IH 4OBSA 1J0HA 2R2HB 2V5TA 5E5MB 2DF3A 4A6YA 3QXTA 4HUUA 5CHNA 4S10A 3KYAA 4MQ7B 3LAFA 2KQNA 3BKML 4RFNB 4XNYL 5C6TH 5IUSA 2BOCB 3HMXL 4OCYL 1HXYA 1T04A 4YHIA 3CVHA 4KUCF 3ZE0E 1AKJD 1A6WL 3X3GH 3UC0H 4P46D 2VDML 1V5JA 4JHWL 4ONFL 5DD1L 4CVUA 5D8JL 3LHPL 3QXDB 4PGBB 2G2RA 4GLRH 5HGAA 5HYSB 4AEIL 1LMKA 3MV9D 3AB0B 3RHWK 2BY3A 2NX5D 4Y4KD 1NGZA 5ERWB 3KPRA 2FZ3A 3BN3B 1R5WB 5DUML 3QUZD 2CO6B 4H0HB 1F6LL 2FO4B 2ICEA 1U91B 3F7RA 3RX5A 1CTNA 1EXUB 1YEIH 5DMGD 2VDQH 1F3DJ 2DQDL 1BIIB 3RGHA 4Z7VE 4OQTL 2KPNA 2VABB 4ZUVA 4DW2L 4TTDD 4P57A 3W9DB 1NUDA 2DI7A 3NTCH 3F7QA 2QJDA 4OI9A 1G7PA 3B4NA 1G7LA 2A6DA 4OLXL 2WBJB 4G9FD 2X44D 1S7VB 2A74A 4KTDL 4TVPD 1F3JA 5ENWB 1CDYA 2QEJA 4X0KA 5I0DA 4K7FA 5IQ7H 1HWGB 5I16A 3SE4C 3O2DH 3MJ8B 5FDWB 4M7KH 4X9IA 1Z2KA 3U46A 5C1MB 1MF2L 3SDCD 1LWRA 2BSSB 1S7UA 3K1KC 3LKSA 1N0LA 5AYQA 1BQUA 2VXSL 3MRKB 4LLQA 4X7FC 5C7XH 3HMWL 3CFCL 4MWFA 2ICWB 3ARED 3UTSD 1JNHB 1DVFB 2PCPB 1T1ZA 4PB9L 3O0RH 4KKLD 3ZYIA 3MJGX 1U8NB 3BYTA 1MHPH 3B83A 4NRXB 2PYFB 3ALPA 2Q8AL 3B9KC 1CR9H 5T5FL 3RZWA 5F1KC 2HT3C 4NSKB 1TJGH 3GUTA 4JB9H 1IKNC 4XCEB 3LKRA 2I60H 3QIUB 5SWSB 3OKOB 4WVRA 2RCSL 5E7BA 3TWCL 3SKMA 3WKMH 4U1GC 5ALCL 3L3DA 2CK0L 1A7QH 3FB8B 3GHBL 3MCLH 3RTQC 3TFKC 4PJ9B 3S36L 2J8UE 2VQUA 3B9KB 5FCUH 1K2DB 4PJIB 1MJ8H 3MA9L 4JG1L 2C1PA 4LFHG 1TETL 1I85C 1HSAA 5DJ6B 1FVDB 2BVTA 1A5FL 1SEBB 2A1WH 5FYKH 3PWLB 3I3EA 2NXZD 1ZLSL 1QACA 2ZCHL 4FQIH 5AD0A 1J10A 2B0SL 3ZSSA 5CSZB 4Z7VF 3TA3C 1EUTA 4WI5A 2K7QA 3VG0L 4AL8L 3GJFH 4KRNA 5ADOH 3LHPH 3MCKA 3MRFA 5HI5C 5CS7A 3T3ME 4R3SA 2ZUXA 4PJFF 2XTJB 3O8XA 1MRFL 1OVZA 5HYJB 1PYWA 4RNRB 3RU8L 4PGBA 4KKBC 4Y4FA 4OLWL 4JRYB 3BGFB 1D5IL 2Y9RT 4XTRD 4KY1L 2XZQH 1FP5A 3G04A 4Y16A 5GS3A 5B3NA 5FO9A 2SEBB 3R06B 5LQBL 5H37G 4NRYB 4HJGB 3D0VA 1PLGL 1R5WA 4AJ0A 1H8OA 4HLZH 4HIHA 1B2WL 7FABH 1R3KB 5TGBB 4PJAB 5FGBA 3IT8D 2IGFL 3QQ3B 3VFMB 1SM3H 5HHOD 1SJXA 4TUJB 1ZHKB 1OGAE 4RFNC 5KSBE 1IQDA 1AE6L 2CUIA 4DKEH 1FV1B 5DEFA 3T0DA 1I7UB 2AV1A 5JHLH 3NCEB 4FFVD 1G84A 5IV2B 4ODHL 4Q2ZB 3CGTA 2FJFB 3PWJB 5J1TC 4P3WA 3ARGD 4U0RC 4WO4D 4U49A 4RMSA 1JGLL 1FSKB 5L2KD 4PJBB 1NBVL 3SE9L 5TDPB 4J6RH 3QUKB 5A2LH 4NGHH 4DKDC 1WVZA 3UXFA 3ULVD 3LKOB 4L3AA 1YQ2A 5FYJD 4KZDL 2ZUSA 4P46B 2IQ9H 3B9DA 1TQCC 4NDMB 1HK6A 2RAMA 2X1XR 1VGKA 1PY4A 3S4SA 1CFNA 4P2OD 5SX4H 1JE6A 1IEBB 2AK4A 4P2RB 1RZKC 1QEWA 3ULUF 5I2IB 1FYTD 2XN9A 3EDJA 5CZXC 4WFGE 5MEQA 1PX3A 5CILH 4HK0A 5JHDB 1Z6JT 2V7NA 3CDGB 1H3UA 1ZT7A 3D69B 3KPNA 4XP4H 5DJ2B 4BFEA 4X99A 1F58H 4PGEB 5GSVA 3PABB 1NEUA 1IGTA 5E08L 4W68A 2EYSA 1AR1C 1DSFH 1U8QB 4HPYL 3MXVL 3G6JE 4JN1H 1YN7B 1OT2A 3RZCB 1QSZA 3NZ8B 4EI6B 2ZWLT 4J3OC 3OAYK 4L8BB 4XBPA 4UTAL 2WV3A 4YHKH 5D5ME 4PV9B 1AHWA 1TQBB 5JLZB 2D9CA 5FYKD 3UBXA 2H9GB 3ULUE 4TQEH 3N1PC 4IJ3B 3DARA 3ULUL 4HIIA 5LGJB 3QNXB 4G6KL 4C54A 3VD5A 4XP1L 5JQ6L 2BNQA 4L8SA 3GSWB 3TBYA 3MNZB 2B4CH 1D5IH 5T1MB 3G9VA 2QQKL 3HUJA 1NFDE 4PFEA 4WU5B 4ELME 3BH8B 2W0KA 4HZLA 3RX7A 4PJ8C 3C60D 5L8JB 5I74C 1X5HA 2NXYB 5DF0A 4ZAKC 4LIQE 1JPGA 5MENA 3IDJB 5CIPB 2Q87A 1W72B 4EXPX 3D0VB 3RGVC 4AZ8A 1WEJL 4D0BB 2OM5A 32C2A 5IVXF 1D5XA 2GJ6B 2OMBA 1QSED 4OZFB 3T4AA 4Z77B 1TVBA 3H0TB 2V2WA 3RP1A 4M1GH 4OKVA 5J11C 4RDQG 3SCMA 2Q7YA 1I7TB 4IRSC 2AJUH 3GSQB 1NGQL 1KLUA 5F7UA 1QNZH 3Q3GB 2AXHA 5HI4C 1CXKA 2XWBB 2ESVA 1ZA3B 3VGDA 3FN0H 1JWUB 1KTDA 4X6DA 4ELKB 3G6JF 4TUOB 1MFAH 3TVMB 2YD2A 1YNKL 2R0ZH 4E41E 2J12B 4L3EB 4LK4A 4PYHA 3OWEA 4TVPH 2VR4A 4I9WD 2WWMC 3HTLX 2YXFA 3O45B 5C0GB 3H7BA 3MNWB 3L9RA 5CEZL 1IGCH 1UVQB 1JYXA 4JPWL 3DTXA 2N7BA 1EIBA 1RZ8B 2V2TB 3MBEB 3S34L 4NQED 4OLXH 1YEFH 3EIFA 1HH6A 4DGIH 3GSUA 1FPTH 5KSUB 1HHGB 1UEMA 5ISZA 2N1KA 1F13A 3BPNC 2VLME 2UYLB 3KJ6L 1XZ0B 3KXFD 4XXDB 3LQZB 3RWDB 3AXLA 1GXEA 4XGZA 3FT4B 5AWNL 3GJFA 5EWIL 4LLAA 3IU3B 3OXRA 4OF3A 3QFDB 5CKGA 4PJGF 3WD5L 2BFVH 2BHUA 2A9MH 4MNHA 4ZS7L 1VGEL 5FOBA 1KNOB 5I76B 2F58L 3KPMA 4G6MH 1U8QA 3FO0H 1WGOA 4G8EA 4JFQB 3P11H 4Y1AE 3OF6A 5K9KB 2PTTB 5F9JB 2QR0B 5T1LB 4QXGH 3SE8L 3ULUH 4OZ4A 1QD0A 1NAKL 5E7FA 4XVTH 4XMLL 3SDDD 1NEZB 3IDNA 4ZYKA 1WIPA 2AK4D 1Z3GL 1BWWA 4Z9KB 4NUJB 3DROA 5C7XL 3ALXA 4Z0XB 4P2OA 2OJZL 4H20L 4RMQA 3OGOE 4QT5A 5IR1B 4OAWB 3DIFB 4PJ9D 3EOBB 3DVNB 1S78C 4MCYB 4R97B 4TPRH 1KIRB 3IDIB 3MXWL 4HUMB 4G8GB 1TETH 1RJZB 5ETUB 3DSNA 4X7SH 5B39B 4WCYH 2H8PA 2PW2B 2Y06L 3ARYA 4U1NA 1MCPH 5EUKB 5ABDE 5CMAA 3KLSA 1D5BA 3JV6A 3IDGB 5HGAB 1XR9A 1A1MB 1UADC 3FONB 3P9MB 4JFEE 4GS7C 3GMQB 3TO2B 2YWZA 4Z5RB 1NGZB 1NKRA 3FQWB 3MLXH 4YR6B 3KYOB 5J3HC 1HHKA 4A6YL 3DVFA 1MSPA 1X9QA 2QADC 3BD5A 4LSPH 3GGWA 3CDFA 1RIVL 3EFDL 3KR3L 5KZCB 3EYOB 3MREB 4K55A 4KH2A 4QLRA 3BX7C 5IHUL 2FX9H 2R1XB 5EH1A 4Q9BA 3QFJA 5E8EB 1WZMA 1RUKL 3A0OA 3X12A 1A1OA 1SJVA 1LD9A 1LO0L 2HA1A 2X4QA 3AY4C 3VG0H 4JKLA 4AL8H 4S1RL 3D1MC 4WUUD 4H26B 3SKNB 3EO1B 2GCYA 5KW9L 5JNYB 5DMKA 2XTLA 3VXSA 2H3NB 3P0GB 5SWZD 1KLFA 5T1DL 3WFDH 5H37H 1ZXQA 1T0NA 5EO9A 3MA7B 3EUUA 4U1GB 3KPSD 4XNZC 3S3SA 5L2JA 3GK8H 4DAGH 3QUXA 5I1KL 1WK0A 4MHHG 4RIRA 5H35B 5DC0A 4UT6H 1A7BA 5FECA 1P7KB 1JTPA 3VWJC 3WNNA 2P46B 4FS0A 4LSRH 3ZKMC 3VDAA 1EVTC 1QO3B 2UUDK 1WFNA 1PY9A 3ARFD 4WFGD 4LSSH 4KJYA 4FFYH 4OLYL 1R5IB 4ZPVA 4D0CB 1RHHA 3D39A 4XPTL 4WGWB 1Q8MA 1RIHH 3BKYL 3U9UB 9CGTA 2ADJB 4I18B 5IMLA 2X4UB 3CAFA 1F4YL 3NFPB 3U7WL 4LSUH 1KJ2A 1IZKA 3NABH 4EIZC 4HUKB 2YBRB 2ZPKH 3NVQA 1Q1JH 4PJGA 5MI0B 4R7DA 4NHCH 2CRZA 4WW2F 2HT3D 1DCLA 3N1QC 1T5XB 3PHOB 3F7VB 2C3VA 1NQBA 1X5JA 3A6CH 3KPLA 4FG6C 5EBGA 4YUEL 2HJLA 3ZT5A 3ARXA 3H9YA 3QWOB 2R4RH 3QUXC 2CDFB 4M7JL 5CZKA 4X5XA 1KV3A 4GW1A 2P5EB 3RDTA 2QQNH 4H20H 1OTUD 4K7PL 2OYPA 3T0EA 3BW9A 3KXFB 1XGYL 2I9TA 3O4LE 5GHWL 2OL3B 2H1PL 3IGAB 3RUGE 1I9JH 4CADA 3VRIB 3RDTD 5E8DL 4YGVA 5E9DD 1PEZA 3CPLA 3MLSL 4X7TB 1K4CA 4K2UH 4GAYB 2D31B 4NQEB 5KSAA 1A3RL 3ARDA 4Y5YA 1PZUB 2MMXA 2HMID 1OAXH 1Z9SA 1LE9A 3UTZB 4EDWH 1KG0A 5CCKH 1XGQB 4HUVA 2VL5B 3B6SA 1KJMB 1OL0A 5E2WL 2NW2B 4DN3L 3IDMA 2AXFB 1QSEE 1I9RH 1ZS8B 3UBXI 3QQ4A 5FV1L 1MJ7L 2OBGA 4O02L 3FB7B 2VLRE 3Q6FA 1U8LA 1UWXH 3F12A 4XVJL 1UWEH 4B5EA 3GBLA 1OP9A 1NCBL 3AAZA 4YHLH 5B3JF 3V52L 3D39D 4EN3A 1IC5H 1OSPL 1RSFA 1IVLA 4OSUL 4PS4H 2VE6A 4GW5B 5C07B 1IL1B 1WT5C 3WIHL 5BV7C 1ZHLA 5GIRA 1CFTB 2ZCKH 5CBEB 5IKCA 5E6IA 3UTTA 2R2CA 3OGCB 3CFBA 1XFPA 1A1OB 4X5LA 1ZMYA 5IW6A 2AK1L 3C8DA 3T0BA 2A6JA 4H26A 3QUXD 5F9OH 4Z8FL 4JAMB 4XHQA 4OM1L 4FHBD 5HGGS 1WTLA 2GT9A 1UFUA 3QDJE 2AXJA 5C70A 1S7TA 3CC5A 1NFKA 5C2BL 5DT1L 3S96B 4RWYH 2DQEL 4U1MA 4M8QA 1I9EA 2VB5A 4PJ5A 2R0WH 3DUUB 4GSDH 3VFSB 4U6VH 3C09B 3DETD 2GTWA 4YZFF 3A6BL 1RJLA 7CGTA 4YDIL 5I1GL 3WO4C 5CEXA 4PJCB 4IHOA 5J6HB 1ROWA 1S7QB 2CXGA 2OK0H 2DS4A 1OW0C 4W6WB 2XKUA 4M1GL 2YA1A 4HGMA 1YZZA 2WIIA 1WZ1H 3AS3A 2RJMA 4WWID 1ERNA 2YMXH 3VXPA 3HNSH 2X09A 2IPTL 1MIEL 4F33A 1EBAA 4TULL 1JRHI 2XN9B 3VH8A 2JIXB 3OTTA 4FFZL 3VXOA 3QDAA 4FP8L 3CXHJ 4HK0B 1F6AB 4R8WH 3L3JA 3NMEA 4ZNEA 2J2ZA 4QRSA 3P0YH 3PHOA 4DGIL 3KWWA 1DQDL 1U2CA 2EDFA 4MNQA 1BQHG 5D2NC 4O58H 1HH9B 3IU4H 4DUWA 2AK4E 1SY6L 5BQ7B 1AKJB 2NY5C 2R15A 4MX7A 2F54B 3DUSB 4MJ5A 1I1YB 3ES6B 1FIGL 1QP1A 4BELD 1CF8H 1HQRB 4P3CH 3HC4H 3QIBD 4R90L 4BK5A 5CZVH 3STZA 4LKXB 5C0IA 4I48A 5HSFA 2F5AL 1SYVB 1CBVH 1JZ5A 4MSWB 1HILA 2OTUB 4JQXC 1IC7L 2IH1A 5FKAA 3QZWB 2V9TA 3LV3B 2C1OB 4JZNA 2GITB 4C59B 1CT8A 4LCIH 1LE9B 4GKZB 4Y4KB 2Q86B 1EFXD 1NC2B 4UUJB 4N8VB 4GG6B 1ZGLB 2PO6C 2R9HC 5JPNB 2ZSVB 4IS6B 2X41A 4N0FB 4JLRA 4ENEC 3P11L 3INUL 4JM2A 3PIQA 4YHOL 3F12B 1MVUA 3PWPD 1A9BB 1IT9H 3QNYA 4LNRA 4ZXBA 2LAAA 3MX0A 4XAWH 4J3WA 1E4JA 5IROC 1Q94A 4GRLA 1C08A 3NCYP 3RJDA 2EDHA 3MUY1 3PL6B 1MRDL 4JKKA 3PP4L 1IEAA 5L6YH 1NAKH 2J7LA 1IGFH 4RAHA 4KROB 1B88A 1MAMH 4OZFG 4MXWL 5GIRB 1P9MA 2AGJH 4KGLA 4LGRB 5DYOA 1ZTXL 5EPMB 5JQHC 4TN9A 2ED9A 1IAIM 5DT1H 4F9LC 4XCCL 1LEIB 5IBUB 1KJ3L 4LNVA 1RZFL 2APVA 2APFA 1KFAL 3MV8E 3TCLA 1XGPA 2WW8A 3RWEB 1MCJA 3BP6A 4RFOL 5I1DA 1BREA 3QHTC 4XNQA 1A6TA 4QHNA 2B8OT 1P6FA 1DFBH 2EDBA 3HPJB 2ZSWA 3LQMA 3HI5H 2GTWB 4OIIH 3HE7B 1S9KC 3O6FC 4I77L 1RZ7H 1ZHBA 4ZXBC 4U6XB 2EDDA 3MUGA 2XA3A 3RI5F 4UU9A 3X13A 4GQ9H 3MBEA 1BQLH 4UIKL 4FQXC 2P7TA 4N68A 5HHMD 4XWGH 1NC4B 3DRQB 4EOWL 5JZ7C 5D7LB 4E41A 4DOHE 4G8FB 1MCNA 1KPUB 1KLGA 3HFMH 5D1XC 1P69B 1RUMH 3U79A 1CTOA 3A67L 3CH1B 2CO7B 3RWCA 3SKUD 4O2EB 2CLRB 2HG5B 2DQJL 3O6LL 3HNTL 5B8CA 3T4YB 2WSKA 3ALWA 3OB8A 4P9HC 4HSQA 4UAOC 3OSKA 3PQYB 4ZQKA 4IBLT 1OP3H 5J4MA 5IVXE 3RY6C 3HZVB 5CBAB 4JHAH 4GXUN 4OZHA 1FIGH 4AENB 2C3XA 4P2YA 3FJTA 5ALBL 4S2SA 1REIA 2VH5L 3OXSA 3FN3A 3LS4L 3S3PA 3RUGA 3MQIA 3BPOC 5DJDA 1N5YL 4PJEB 4KTDH 4ZTPH 1A0QH 2RGSA 2WBKA 1MLCB 5T1KD 4NQVA 3MRMA 5FCSH 3WXWL 1KBGH 2MPAL 1E28A 4M62L 1NFDF 4IIQA 3L3KA 2NY3D 4LLMA 3KLHC 3F7PC 5IOPA 4WI8A 4NYLB 4C58B 1JNNL 5AAWA 1ADQL 3RWGA 1JP5A 4JY6B 1XCTB 4H5SA 3T08A 3BPOB 1YEHL 3CFDB 1II4E 3VWJB 5M94B 4JO1H 3ARFA 2DWEB 2Y1VA 1KIRA 3VFRA 1OAUL 3NIGF 3NABL 1CIDA 2CR3A 4K8RL 4LVNC 1UM5H 4ZOCA 5C08E 1HSBB 3S35X 1I9IL 1WWBX 4X6FB 5F70A 4QRPE 1NCWH 4OF8A 1KCSL 3E8UH 4R96B 5ADPL 5I19L 3WCYA 5FEBA 5C0DB 3LD8B 3NIDF 5EZJB 4ODUB 1FYTA 2XN9D 4HFWA 2HJKB 3L3IA 3R8QA 3ZHKA 2ICES 4ODBD 4QXWA 4K3EH 3MRJB 2QQLL 1HHKB 3GBMH 4DGYH 3RPKA 3IYLW 3GGWB 4JJ5A 3W9EB 1FG9C 2Q76B 4LCWE 3L5WB 5GGVL 2A77H 2K3TA 4WI9A 3BKCH 3RAJL 2YPVL 5IJVB 2JB6A 1RZFH 4C83A 5IBLD 1MOEA 1JZ6A 1QBML 3ZTNL 3U36A 4PIRF 5TE4L 5IT2L 1LEIA 4NC1C 3FMGL 4ORGA 1JF6A 4YHLL 3JWOH 2A73A 3QG7H 4XCYA 3V52H 4HFUL 4NWTH 1EFQA 4HWZA 3V6OC 1ZVYA 4PS4L 1P1ZB 5GS0C 4R4BB 4Y89A 1BGXH 1RZ7L 4JCLA 3FHAA 2BNUB 4LARL 3LEXB 2Y25A 3C5SB 1JPFB 2C3GA 4BFBD 3QUXB 3EJYC 4DCQA 4O02H 5F9OL 1VACB 4C56E 5MHSE 4XPBH 1QBAA 2WLYA 4UTBH 3FAXA 5AG8A 4ONGL 1LVEA 2DQTH 2VLJD 4HIXL 2FYYB 1W8NA 5JHLL 1H3PH 5HYEA 4QNPF 3S6CA 1KCUH 3BESR 5GS1A 2DBJA 1FL6B 1SMOA 1H15A 3WNPA 4YK4C 1A64A 4G42A 2APWA 5F7MC 5BJTB 2B5IB 4G6JH 4EN3D 1J86A 5EUOB 4UT9L 3QISA 2UZIH 4L5FL 3I02B 4JVPA 2FSEB 5BS0D 1N5YH 2J6EA 4QOKE 2D7TL 1AQDB 1KJVA 3RL2A 1OLLA 5JHDD 2A0LC 1AD9B 2XRAL 3MSPA 2JK5A 2V5RA 4FQCH 4PY7B 3RVVC 3KDMA 2GTZB 4OCLC 1MFEH 4JKPH 5E94A 2XWTB 4DFIA 1PX4A 1UH4A 5GRVK 3LMJL 1XF2B 1E28B 3QEUA 5C9JA 3H3KA 3O3AA 4M1DL 4OD2A 4QHKI 5HHQB 3BFOA 5ESAA 4K94C 1N6UA 2AJ3A 1FAIL 1W0YT 2K7PA 3GIVB 4JY6A 5TJWK 4KRPC 2IMMA 3BGMA 4Y5VA 1SY6H 4K3JL 4Z7OF 3RWJB 1JZ8A 3CSPA 4PRHB 2YPLA 4OB5H 5EOTA 3O41B 2GAZA 3OKKA 4YQXL 3B2VL 2ID5A 3CXHK 2AEPL 3QIWD 1AD0A 1J8HE 5J11B 5INCA 2V2XB 2VXVL 1P2CA 4JRWA 1DUYB 1U3HB 1YPZA 4JZJC 3FOLB 1GH7A 5A2JH 2XPGB 2DLGA 4KKCC 5F8QC 2X4SA 3QDMB 1T2JA 3C60B 4XP4L 3KS0H 3O3EB 1KGCE 2VIRB 4H8WC 3ZMRA 4KPHL 1HCFX 2LTQB 2PXYA 4OFPA 4QRRE 5A40E 1IGYA 2HN7B 4LIQH 5HHPA 1E4XH 1E4XI 2COQA 3L5WA 5E4EC 4EUPG 3QNZA 2NY0C 2JLLA 3NA9L 4MJIB 2B20A 5IB4A 4HHAA 1HWHB 3TPUA 4PRPD 5DFVC 1MAJA 5HHVL 3HRZA 3WV0A 3X11B 3D18A 3V6FA 5C6PB 3FOMB 3U9PL 2H2SD 5DO2D 5AYUL 3LEYL 1MRDH 4E0RA 3BN9C 3TLRA 3W0WD 4NHUB 1TJHH 4HXBH 5FF6A 3T1WA 2ESVE 1OTSD 4AYFA 4QY8B 3GRWH 3VXRA 3MOBL 2ILLA 3E6HA 1YEKL 2DD8H 1LK2B 4F3FB 3VE0B 1OT1A 5EG6C 1XF1A 3MJ9L 3D85B 3CUPB 3PWVA 5IVNA 1A7OL 1YDPB 3MV8A 3HE6D 1YQVH 5ID1B 3RWHA 3QRGL 1AR1D 1Q72H 4LLYA 1SEQH 5D9SA 4S1SH 4HZAA 3QP3A 2CIKA 1DQTA 1YMMA 3MFFA 3MOAL 1U8PA 4WUUA 3WFCL 3H6JA 3I3BA 3T0WA 1D5ZA 3LKSB 4KHXL 4QF1A 4YXKH 4I8DA 1YJDC 1QSEA 1QKZH 2OR8A 2VC2H 5KS9E 1C7SA 2OL3H 1B4JL 4MD4B 5ICYA 1T1ZB 1N4XL 4DTGH 1XT5A 3VD9A 5JR1H 1U8NA 4HH8A 1YPZE 1TVDA 1UA6L 5HHMB 1NGQH 3SDDC 4NBYB 3BUTA 1AO7D 1KFAH 3QUYA 4YHZL 1G7IB 5CEZD 5E8OA 2CQVA 1WIOA 1IAOB 1UXSB 3QSKB 4X4XB 2ED8A 3PDGA 1HNFA 3E2HB 4BFIB 1RURH 2L4OA 1M6OA 1QRND 4BSJA 1T21A 3HAEB 4ZO8A 4P5KB 2IPUK 5E2VL 1V05A 2DM4A 1RVFL 1G1YA 4EUPA 1KXTB 3DBXA 1KIPB 3L3OA 4LU5H 4Z76A 3KYNA 3PGFL 2H2PD 4HX1B 3VD4A 3GSNL 2P8LA 5ESAB 5GJTL 2P1YA 1IARB 1ZA6B 2FHFA 1IEHA 4JPIA 4OGXL 5JIHA 3ULVF 2VDRL 5JXED 3RGVA 1FLTX 1ES0B 1AQKH 4MDJA 4Y4HD 4E42A 5IFHL 3A67H 1I8KB 2Y07H 1WCQA 5IIEB 5EU5A 3C2AL 4QTIH 4R3SB 5IBUG 4Z18A 3FFCA 2WAHA 3DX8B 15C8L 1EK3A 3GMPB 3MROA 3QBTB 4M62H 3QCUL 5D7IA 1EHLH 1K6QL 4YBLC 4EUPH 4GMSH 4K3DH 1OGAB 3WLBB 1BZ7A 4QRUA 4U33A 3UROR 1I3UA 1QHOA 1OOAA 2OQJB 4RGOH 4JRYA 2F15A 3D3VE 4JDTH 2AJVL 2DBLL 3P4MA 5EBMB 1QFUH 5DGQA 1CVSC 3BXNB 4FMKA 5D7JA 5BRZE 2FB4H 2R4SH 3QPQD 5EC2B 1MVUB 4PRBA 1EZVX 1VGEH 3BP4A 4I2XA 4EI5D 4L8CB 5JA9A 1RMFH 1U58B 3MV9E 2YD6A 1IGYB 3N9GL 3LN5A 5I1IL 2F5BL 3D25A 3IFNL 4OKDA 3MYJB 3ZE2E 5C92A 5EC1A 3JTTB 1AGFB 4MNQE 1MUJA 5E1HB 3FT3B 2DWDB 5CJQL 5D1QD 5ISZD 3SE8H 1CLOH 3VI4E 5FYLD 2E27L 3DXAA 2A9NL 4QCIB 5CSBA 1X5AA 4HXBL 5AZEH 1TCRA 1MCPL 4JFFD 5DK0A 1YMME 1AXSB 2FEEL 3VRJB 1IMHC 3WMSA 2QQLH 3GBML 3QA3A 3GSOA 3VH8G 3I6GB 2EDRA 4PLKC 1GGTA 1M71B 2AP2A 4D8PB 4PLNC 3BISA 1OAUH 3HC0B 1GOFA 1LK2A 1S7WB 5C86A 3T77A 3GMRB 4LEOB 5C8JA 3V5HA 5I1LA 2IEPA 3DNKA 3WFCH 4HV8B 1BQSA 2VDPL 3RWHB 1GGIL 2F53B 5DI8B 5GS0H 4QRTB 3QULB 2R0LH 2EYTB 1X44A 1FNSL 3GRWA 2FX9L 1L7TH 3MFFB 3QIUD 5C0AE 1DN2A 3MUGB 4NQXB 1D6VH 2EH7H 1WC7B 3MRRA 5A16A 4FG6D 2R2HA 3T8XA 2NX5E 1U2HA 4JEGB 4DN4L 1W0WB 3AU1A 1JGUH 2CIIB 5LAXB 2PYEB 4M1CD 4ZUUA 1KPRA 5L0QC 1IEBA 5K33A 2V9RA 5T3ZH 1KELH 3IXAA 4LRNL 1FCGA 4PJ7A 2BOCA 4XNXL 5DUMH 4JFDA 4NQDD 5E8OB 1MEXH 4F58H 3CXDH 1TZIA 1XGTB 1JUFA 4ZQKB 4JRXD 3PV6A 4LP4A 4FABL 2MWCA 1KB9K 3LRSA 1NFDB 1V7NL 1T89C 1EHAA 4ELMB 1TQBC 3BKYH 2J8OA 2VKWA 1MLCA 2P8LB 4N1EA 4H88L 5JLZA 5I8CA 1F4YH 2DJ4A 1OSZB 3VI4F 3GNMH 4ZUWA 5DJYA 1AR2A 4PRIB 3O2DL 1CR9L 1RV6X 2GFBA 4XP5L 4GMSL 4DJMA 4FXKA 1YY9D 3NH7L 4UMGA 3LH2L 1B0RA 1EAJA 4JR9H 1MCOL 1RUPH 3MJ6A 4Z7UB 5IB5A 4C55A 5D7IB 5DMYA 3M1BB 1S7VA 1G6RB 3L7FA 4JE4B 2CK2A 3LZFH 4XP6L 1RMFL 5KSVA 5CJXC 2MNUA 4JO2L 4Q58C 4JPKH 4QRRD 3TGXA 5J13B 3QIWA 3U0PA 4FQ2H 1EO7A 2GKIA 3C60C 1Q1JL 1WWWX 2YUWA 3MLVH 1E6OL 4L3EE 2P8MB 5IB2B 1K3ZA 4OD1L 3UTSA 5DEGA 2GW5A 4JFYB 4KWUA 4WFFD 4YE4L 4XBEL 5JOPE 2V2WB 4PP2A 1EZVY 1MFCH 3DMMD 1GOGA 1G9NC 4KDTC 4C83B 3SDYL 3SDAB 3U0TA 5CGYC 3FZUC 2XG4A 1X5FA 3BAEH 2HT2D 3TO4B 3TIDA 4RQQB 4NSKA 1P4LA 4PBXA 1WAAF 4OF0A 5GS0L 4XNUH 1BFTA 1CXHA 3QIBC 4NJ9H 4YBQD 2YUXA 1PZ5A 3V5HB 4P2OC 4YHPA 1OSPH 4HV8A 4OZGF 5DRZB 1XH3A 3QIWC 4X5WB 3TJHD 2XXMB 3ECBA 3QFJE 3MJ9A 4NQDA 4HT1L 3CFKB 1S7SB 4UILH 4OFYD 4AEEA 1FFQA 2YZ1A 4X7EC 2RFXB 4O2CB 3VCLA 5FYJE 5LVEA 3QIBB 3TIEB 1SM3L 4HMCA 1AGCB 4LRNH 2X05A 1IC4H 2H32B 2DYPB 3L5XL 5LAXA 4I3SH 3OV6A 1UACH 4FTVB 5GS1B 3VXQB 1T3FB 4KY1H 5FFLA 2KL6A 3MMEA 3MV7D 1KB5B 1V3JA 1BOYA 4ENED 2WLZA 5JA8B 4M48L 2XY1A 3QXUA 1NJ9A 2J8HA 5D7IF 4NZUH 5DD6A 3JUYA 4K94L 4Z7UF 5EUOA 2WBJC 4KJQD 4N8CH 3HZKB 4HKXB 1DJSA 5BV7B 1MNUH 4WY7H 2XFXB 2FIKB 1J18A 8FABA 3D0LB 4MB4A 1OPGH 5DQDL 5JIKA 1VB9A 4AQOA 1ZHNB 3S88L 3G04B 2I5YH 3LRHA 4J2XA 5H94A 3VFVA 1EHNA 3MPCA 5E2UH 4OZGE 3O8XD 3J7HA 5GS2D 4OCRH 5INDB 5GS2H 1UM6L 4KI5E 3UPAA 2NXZC 1SEQL 3VXMD 2LTQC 4HIHB 2R0WL 1VFAB 2IPTH 5H8DA 5IW1B 1XCQA 4TSCH 4QHKJ 1XF4A 3M17B 5F7DA 1QVOB 4P2RD 2MSPA 5D1QA 3ROLA 4D2NA 2OS7A 5FYLH 4YDIH 5GGSA 3DROB 4PJXE 2R1WB 3SE9H 5D7LD 5EIIA 1MHEA 2Q3ZA 2EC9T 1MCQA 1F42A 4Z6AT 3RZCD 4LKCA 2VDQL 5DEFB 1HHIA 5JR1L 1BBDH 2XQBH 3D3VD 1NBQA 5HHXH 2WIMA 3VFTB 1WBYA 4KROC 3DHJA 2ENSA 1O7VA 4I2XE 4L8DA 4S1QH 2H6PA 1LO4H 1FN4A 4FXGB 5F6HJ 4R4ND 3HG1E 3VFWB 1S9YA 3ARGB 5IB3B 1D5BB 5CD3A 4K7FB 1X5GA 4JVWA 4JANB 5FYJH 3CFJA 3WEXB 2XKNB 4JFYA 2R0KL 1HZHL 3FQUB 5IVZB 4PP2B 5TF1L 1S5IL 2DRUA 3JV4B 1D6EB 4G6KH 3TBSB 4ORZC 2NY3B 1YYLH 5LWYH 2ERJC 2R39A 1PAMA 4LASH 4R90H 4X6CE 2VXTH 3TPUB 3VJ6A 4AIZA 1Q0YH 3HAEH 3CFCH 4I18C 4OF6A 3RDTC 3DI3B 4N9OB 4U7MA 5HGHB 4U1SA 3D18B 4P5TB 3MLUH 3GUTB 1T6VN 2W91A 4ZUTB 5KSBA 4LVEA 4NO5A 4UILL 5F3HA 4L4VB 4TYUA 3DX7A 4HBQA 2E27H 3EHBD 4RGNE 5HVWA 4CUCA 1FBIL 1ZGLM 2R1YA 2EE3A 5KSAC 1OWWA 2DM7A 5KVEH 4KV5F 4LLYB 1C1EL 1P84K 4PUBH 1AIFA 2VLKD 5EN2A 4R7NB 2YS4A 3C8HA 1LO2L 2AJZB 3INUH 3C8KA 5DJ6A 5CLTA 2CLVB 4PJXF 2MOVA 1HKLL 1MHCA 1R5IA 1YY9C 5GRXG 3UDWA 3WNKA 4MD5A 5ID0A 3AFLA 5D70H 5I8KL 3X14A 1H3WM 2D3VA 5T3ZD 2OCFD 2IADB 4WNQA 4OCSL 5ACMA 4L8SB 4V1DE 4I18A 3GI9L 3ARWA 3SGDH 3BP5B 3KXFE 1WEJH 4HK3N 4W70A 1FORH 1T4KA 1JFQL 1ND0B 3NA4A 2NNAB 4GFTB 2AQ2A 2YBRA 3GMMB 1T5WB 1T80A 2DQFA 2DI8A 2NYYD 2QSCL 1FRGH 3SKOB 4XC1L 5E56A 2P43B 2ATPB 1AGBA 4WFEE 1DL7H 3NCFB 1DBAH 3ZTJG 4OZIF 4HJ0C 2KDGA 1A6UH 4Y1AD 12E8H 2HLFD 2ZZUT 2HFEA 4F9PC 4X5XB 5FYLL 2LU4A 5I8OH 4JKMA 4NJAH 2XZQL 3MRPB 1XCQB 2Q7NA 3QB7C 1OTSC 3I2CH 4PPTA 1U93B 1KOAA 5JMRA 4HS6B 3F58L 5DJXA 1OGTB 2KKQA 4GKNB 4N8PA 5IMOA 4LKCB 1IGCL 3DMMC 4S1QL 5DLMH 4G80A 3GSXA 4APQB 4GRWB 5KZCD 1Y6MR 3EDKA 3WFEH 2F19L 1FVEB 2A9ML 5H2BB 3D87B 1T04B 4YHIB 2HLAB 1TVHB 5HYQA 1A4KB 3KPRE 3BPCB 2BJMH 1T7WA 4IOSD 5SX5K 5IEHA 2NY0B 5FYJL 4JDVB 3VA6A 3CSBA 4ODHH 3AROA 4U7SA 3C5JA 4LPCA 4RZCA 4JFHD 3STLB 4NQCA 1RUPL 3UPCA 4C4KO 2LU7A 3MV11 2FJGB 1Q0YL 4W81A 5DJCB 2XZAH 3EYQD 3UZEA 3V6BR 3IFLL 5DJ0A 4X6EB 1A4JB 3TNMA 5JW4Q 5DVOA 3MLVL 3C87A 4OBRA 3MFGB 1T2QH 5MEQB 3DX9B 4CW1A 1MCRA 2IALA 3ARVA 2YEZA 4WWKA 2EKSA 3P77B 5F7KC 1FGVH 2WUBH 1QSVA 5LCVL 2C5DC 1Z3GH 1A9EA 3CH8A 4P4KD 2Z93B 5D1XB 3EOTL 1BD2D 4JQXA 2AQ1A 4JPKL 5BOPA 5KOVC 1I1FB 4WI3A 3KLAA 5C0RL 4JN2B 5ESQA 1FNEB 4O5LL 1Z9OA 2YD5A 5KANI 4FQXB 2CDGB 5D70L 5I8KH 1ZLUH 1XIWD 5ADPH 3WFBH 3H3PL 5DRNB 4MNGE 1MY5A 3TYFB 1CS6A 3MRKA 1N6VA 3WKNA 4NWTL 1IGIH 2RIKA 4Y2OA 2DB8A 3L5JA 2F54E 2O26U 3VXMB 1YUHB 5F7EH 5BVPL 3T2PA 4MQSB 5B38G 3QPQC 5DD1H 3V5DB 2OP4H 4LDOB 1D9KB 1QLFB 1RJYA 4P5TC 2YPVH 1O0VA 1A1NA 4L4TB 1AJ7L 3FQNB 4Z78A 1IGJB 1DL7L 3CU1A 1YY8B 3V8OA 3WDIA 4XPBL 4XRCB 5HY9A 1HXMB 5L88L 4F7MB 2VLLB 1UACL 4Y4FC 1WZLA 1S9VA 4F2MB 4P59L 4P5TD 1TFHA 1BGXL 1JL8A 1M7DA 3ARFC 3V4PL 3K8MA 3QDJA 2EIBA 2VN7A 4NFDA 3PL6C 5CJ5A 3O6FD 4DZBA 4V2BA 1RUQL 1XR8A 5CP7B 2AEQH 1HYSD 3O9WA 1L6XA 5SWQB 2BSTB 2DQTL 1QLRB 5LBSL 5K9OB 2AJUL 4YPGB 4AH2A 5C6WH 1HE7A 2NTFA 4TUOA 4IRZH 5E70A 3B5GA 4YDLB 1BFOB 2ADIA 3K80A 1QFHA 1L6ZA 2B4CC 2QQQA 5DHYA 1MNUL 4WY7L 2BK8A 1L9MA 2LE9A 4UT9H 1VHPA 3L9RB 3HLAA 3LKQA 4YK4B 1IBGH 3MR9B 4WI4A 1H3GA 1FAIH 3TN0B 2X4OA 4P2QB 3NAAH 1J9CT 4ZDHB 4LPTA 3PL6A 3UTSB 2ZKHL 1NMBH 4LAQH 5IMMA 2XRAH 4WO4C 4PJAA 1CK0H 5GZNC 1RD6A 1T2QL 1KN2L 5JOEA 4YQXH 1C16B 5T5NG 1P4BH 3HG1A 1S5HA 4K2UL 1XZ0A 3D6GA 2GYSA 1FGVL 3RWDA 3TM6A 3WKML 1DANT 3DGCR 3SDCB 3ROOA 4U1JA 1YN6A 4G6FD 5B3JE 1KJ2B 4H0GA 4XH2A 1QR1A 2Z35A 2HRPH 2E6JA 1P4LB 4WIQA 1D5MB 2GY5A 4M5YH 4UI2A 5IHZB 4ALAH 1EMTH 1VADB 1MCEA 4WFHE 2L0DA 2Z0BA 4G3YH 3W0WB 3FB5A 2VAJA 3CJJA 3ZKQD 4HF5H 2BXYA 4PD4J 5GJSH 3K8LA 2ADFH 3G5VB 3V6ZA 5DQJB 5IVXB 4Q9RH 5JO5B 3L3GA 2NY4C 2RFXA 2YD9A 4QOKA 1K4DA 3SO3B 1F2QA 1NGYA 4PJGE 4XMPH 4PRPB 4PRDB 4TOYH 4F57H 2E9BA 1S5IH 4BKLA 1XGUB 1EEUA 2ZUQB 1WTGT 5CEYA 4PJEE 1MCLA 4YGVB 4QT5B 3ETBF 4MXQC 3AM8C 4OQTA 1Q38A 2R23B 3JWDH 5JHDA 1JGVL 2V7NB 3CDGA 3D69A 4F80A 3MV9A 1TJIL 4J8RA 3GM8A 4IOIA 2YK1L 4JFDD 2AJYL 2I9LB 5E0QA 5IQ9A 3BGAA 2DQUL 1YN7A 4U2YA 3QQ4B 3S35H 4YX2L 1EAPB 3NBNA 4R97C 3DECA 2AEQL 4PJEA 1G7HB 2Q8BH 3WIFA 4PV9A 5DD0H 4KVNL 2HFTA 3MREA 4QRPB 5HGBA 2FX7H 3WNOA 1AY1L 4XC1H 3RIFK 2PN5A 4B7LA 3D5OF 1JYVA 4DZ8B 3M8OH 2WNGA 4NKDA 3MOAH 3TH4T 1HDMB 2XWJA 1Y18B 1T66C 4NPYA 3H9SD 4LLDA 4MJ2A 2WANA 1BOGA 4FFWD 4U6VL 5IG7A 1LD9B 3ZKXB 2A6JB 1Q9WB 1RU9L 1IAIH 3E1F1 3GI9H 5DMKB 3OKEA 4NKQB 4JM2D 1KTLB 4RAVB 3GM0A 5GSRB 1R3HA 1UA6H 4HKJA 1UJ3C 3UCRA 4ZG1A 1VDGA 4FQPA 3Q0HA 3BPLC 3DRTA 4L9LA 3RIAK 3HHRB 1MWAA 1N7ML 2VDLL 4PRAB 3BVNB 2FHCA 2ORBH 4ZSOA 2F19H 2JTDA 3JUZA 2B1AH 3ZE0F 2AEWA 1YEJL 4IHOB 3WLWC 1T7YA 2BJML 5JW4N 5FDYA 4CAGA 1OAQL 4EQ3A 1RVFH 2Y07L 4AEFA 4P99A 2VZSA 3HC3L 3HRPA 2EECA 1IC7H 4G9DB 4C56B 1KLUB 1G7MA 5C0EB 4ZAKD 5EUOF 3STBA 2E8ZA 3MBXL 5CWSA 4YHYC 5ITFA 4XH2B 2FDBP 4NZRL 4WU5A 1I8LC 2P49B 1UZ6E 3FFCD 4R4BA 2AQ3A 1DBJL 1DN0A 2YRPA 5CD5C 2YA0A 2F5BH 3B9EA 4WUKL 4DK3A 3MLWL 2MTPA 3OKMB 1JGDB 1GGCH 2Q8AH 1WIUA 2VDOL 4PJIF 3WN5A 4P3DB 3MJ7B 5L6YL 3QYCA 3C6LD 4Z77A 2NLJB 1RZIA 1KIQB 1EPFA 4QOKB 5F88A 1Y0LB 4KQ4H 4JM2F 4KFZC 3GJEA 3BMVA 2QQNL 1JPST 4ODXA 4CADB 4ETQB 1CE6A 4JM4L 4YAQA 4MD5B 5ID0B 3BQUB 3QJFB 3O6FB 2EEBA 3TJEL 3P4OB 4GAYA 4NQEA 4JG1H 3O8XC 5FUZL 5E8DH 4OFDA 1I8LA 5GQBA 4MVBD 2BC4A 3AGVA 5HYJA 3MBED 2GJZA 3Q1SH 1NC2D 1S3KH 4LL9A 1AO7A 1IGIL 3QXDA 2I9LA 1M4KA 3BP7A 2OI9B 4PRHE 4LSVL 3F5WB 3MV8D 1Z9LA 3QO0A 5CLWA 4OCWL 5E6ZA 3U7YH 4WHTA 3ZKNC 5DHVH 4XWGL 3QEGL 2VMFA 1ZEAL 1J8HB 2HFGL 4XCNB 3SDXB 3VWKD 2BCKA 3RX8A 3C5ZA 2ICEB 5F1SA 1FNHA 4XVUD 1QG3A 1IAIL 2FL5B 1FNSH 4ODSH 5IKCB 2AJ3B 1UQSB 3QUMA 5D7JC 4GT7A 4B0MM 5LXGH 3ZYOA 4WW2A 2OP4L 4GXUM 2FR4A 3HNTH 2CLZA 3H9HA 4YDJA 3M07A 5IVOA 1G7PB 1K5NA 1CLYL 2J4WL 4ZFOL 1IQWH 4MJIE 2DLFH 1MRFH 3DURA 4M6AA 2IGFH 2VDLH 1PKQB 3B9AA 5T3ZL 1UB6A 1MJJA 4KTEH 5FO8B 5INCB 3UJTH 2J1KA 2QR0A 3IJYB 1K3IA 1EH9A 1SVZA 1MWAL 3MRIB 2NW3B 5LBSH 5C09B 3IRZA 1T22A 4IRJC 5LQBH 3GNML 4KJPD 2VLMD 3SDAD 4LMQE 3LEVL 1DQQB 2VTFA 2HAZA 1IKNA 1EDQA 4YNYA 1BM3H 1CFNB 4MA7H 2ICWA 3CLEL 5JW5B 4ZSOE 4PD4K 3NCCB 4G6ML 4O2EA 2R2BB 3NAAL 3L6FB 3IAPA 3SKNA 3F65A 5ETUA 1SYSB 3B9VA 5DVNA 5E4EB 2FEEI 1ZT7B 3U1SH 2MPAH 4E5XA 4TSAL 5C0CA 3RTQD 1V3MA 3CVIL 3B3IA 1EFXA 3G5ZB 3KWWB 1XR9B 4FFZH 3ZO0A 2P24A 4G8GD 3FCTB 4LCYB 3GMQA 1JGDA 5TDOA 2W9EL 3UBXG 1R6VA 1RJCA 3MACH 3R0MA 4NKIH 2W92A 4P3DA 1V3KA 2YC1B 4XZUB 5MHSD 5AUMB 4WUUB 5HHNA 1ZT1B 4HWBL 4CL7A 1EMTL 1R3LA 4ZPVB 1CI5A 3PF2A 4F8QA 1I1CA 3QZWA 4UTAH 5F89B 3EO1A 4RRPA 2QADD 4KK8C 4R4FH 1J0YA 2HJFA 3Q5OA 4YDVB 4Z7WF 1QSFB 1G7IA 1HSBA 2WQ8A 1YJDH 3WHXB 2DL9A 4POYA 4WJ5A 2J88H 3BJLA 1WBZA 3RVTD 3IKCA 4QTHB 4HFWB 4S0TD 4X98A 4UTBL 1FZJB 1JI2A 4JZOA 4XHJC 3UEZA 5EIQA 2EIEA 5GGTA 1GL4B 1TVBB 4HUNB 3D3VB 4KJYB 4S1RH 4JFEA 3LOWA 3GSRB 4Y2DB 1T2XA 3PHQA 4AM0A 5C0BD 3IS1X 1KEGH 5BRZB 4UDTA 3P0VL 4X80L 2BRRL 3N06B 4WW2B 2FR4B 3CZFB 2D7PA 1BQHA 5DQDH 1JGEA 2FEDD 2FH8A 2WK2A 5EU5B 1NBZB 3DURB 4ZFOB 2Y36H 5FA3B 3VXUA 2C3VB 1FGNH 1P1ZA 2FJFA 4LCWA 4GJTB 4HLZG 4P48A 1NGXA 5C0GA 4CVZA 2BNUA 2YPKB 5I71B 2XOTA 4PR5A 2HKHL 5GISL 5FIEA 4ELMF 1ORSA 3OKLA 1RAMA 3MR9A 3RDTB 2ARWA 1HIML 1DQQA 2VR9A 2WBWB 3DSFH 4ISVA 3GSNA 3X13B 3MOQA 1J1OH 2ZCLL 1ULVA 4LHUB 1OM3L 4BSVA 1ZHLB 1MQKH 4O9HH 3KPPA 1S78D 3FB6B 4F7EA 3CFBB 2IG2H 2VNCA 1EEZA 2OZ4A 5F72S 2XQYG 4GKOA 5C0AB 3AXLB 4PLJD 4WV1B 5EU6A 1WFOA 2CKNA 4ZFZB 3S34H 3MRNB 5I73C 3IF1B 4MAUL 4POZD 3HFML 3LMJH 3DUHA 3MNVA 2NX5B 3T4YA 2W9EH 3T0ED 1J5OL 1ZWIA 5HYJD 1QBLH 2PYEE 4NO3B 3JV5A 5IHZA 1B0GB 3HC3H 1S7WA 4U1MB 3DO7B 1FIEA 2Y5TB 2VQ1A 43CAA 1U8LB 4KK8D 3MRQB 2VJXA 3TEUA 1FZMA 1I8MB 5JTWA 2OSLB 4NWUL 3OR7B 1E4XL 3WD5H 5HPMB 4G7VH 3UTQB 4LASL 1JZ3A 2BNRE 5C9JB 5E9DB 2M8XA 3FO0L 1YEFL 2VZ3A 3OGCA 5BO1H 4PYGA 3DVGA 1CXEA 4P4RA 4Q9CA 5HGDA 3WLWD 2IQAA 5C09D 3GIVA 3QHFH 4ZAKA 4Y8AA 5IHBA 3KLHD 1A6AB 2E6QA 1OWRM 3W39B 4MD0A 4PRHA 4L29A 4LFHD 2NPLX 1AFVH 3HR5B 4GRMA 1GGBL 1JHTA 2QHLA 3L3HB 2BHYA 4NZRH 1KC5L 3VGAC 4PJHB 4UOW1 1EO5A 1UWEL 5IP4A 1P84J 4M43H 4PGZA 3NA9H 2PO6A 3PUCA 5IEKA 4D9LH 1IC5L 1U8IA 2VAAA 4H8WH 5EU6D 3BT2L 1LNUA 2Q1EA 1ZLWK 3RKPA 4LQ1A 4MA1C 4JFXB 5GGRB 5KS9F 1NCWL 2VIRA 4TUKH 1NGWA 5I9QC 1HN1A 4AY0A 2YSSA 3G6DL 3BSZL 2FD6H 2JCCF 1CGVA 3ZDXE 4ZNEE 3GRWL 4LKXA 4HIEA 5D1ZD 2GHWB 2PCPA 4GAGL 4Q6IB 4M9OA 1C1EH 4PUBL 3X3GL 3OJ2C 4DGYL 3DETC 3MJ9H 1YC7A 4NKDB 2OTUA 3WL9A 3CDYA 2EDNA 2QSCH 3OL2A 4P5MA 3FRPA 1G0XA 1Q9WA 3QIUA 2GCYB 3GMOB 4F7PB 5HYFA 5JMOC 2JJUA 3OKDB 4FFWC 4Y4KA 3VWKB 1IJ9A 3K46A 1BEYH 1YEGL 4WW1B 1J1PH 5EO9B 4XNMB 3BD3A 1J0ZA 4CKVX 3PGCA 3C5SA 5SV3A 4K9EC 1T1YB 3DUSA 4LPWA 4MJ5B 3ZKSD 3UC0L 1QFWH 2W07A 6FABL 1LK3L 3E3QE 2W60A 4Y2DD 2GK0B 4DW2H 1KF9B 3FQTB 1I8IA 4KXZI 4LSPL 2X1OA 1SEBA 3KR3H 3VFPA 4NT6A 2NY4B 1TNMA 2X40A 1FYTE 4NOFA 4OGXH 4GBXA 1J8KA 3IFOA 1EEZB 4TVSa 3D48R 3HZYB 3EO0A 2A83A 2N4IA 1NAMB 4GXVL 4PGJA 3LPFA 5I17B 3I50L 1QYGL 1U8HA 2DMBA 3VG9B 3PJSB 3T2OA 3PWPB 2RHEA 4M7KL 2YKLH 3KYKL 3HE7D 2HT2C 1IAOA 5CJBA 1BVZA 5E99L 4KTEL 3G08B 3TNNA 1WWAX 3R06A 3EYSH 4LLUA 4P5KA 1D9KC 4TRPL 5J8OA 2C7UA 2D03L 4MDIB 2FRGP 2EICA 2UWEA 4HJJH 4F37K 5JXEA 3IDNB 1CFQB 4JKPL 5TDNB 3N0PB 5E5MA 1TJGL 2O5YH 1HINH 4K23L 4JJHA 4GKSB 1XIWB 4LSSL 4CVXA 4LDLB 3TWCH 4BQCA 4OAWA 4NKOB 5C9KA 4PJHF 1A7QL 3HCVB 2G9HB 4MNQD 4HDIA 2G5BA 3IFLH 5ISZE 1VPOH 4KU1A 3HI6L 4M3KB 2B39A 4K3JH 2ZG1A 4U1NB 1CLZL 1KJMA 4NHCL 4PJBA 3C2SA 2WINA 2ZUQC 4JFFE 5ANME 3D0LA 3K4DA 2JB5L 5FOJA 2FD6L 2IBBA 3Q6FB 5I1AB 4GH7B 1MH5B 3MACL 4Y8DC 4Q0XL 4I2XB 4L8CA 1U42A 3QG6A 1UGNA 1X5KA 4Y19A 3TYGH 1BVLA 1G1CA 2EC8A 2GSGA 4OQ1A 1FO0H 5C0RH 4K7PX 4NNYB 3VXTA 3P4NB 3C5ZB 2V17L 1UYWH 4KPHH 3WNLA 5E6IB 3UTTB 3HA0A 4E41D 1UQSA 3I6LE 3QUMB 2CLRA 4P5MB 4QHLA 4I9WE 2YN3A 3VWJA 2ICWI 4FQIL 5IF0B 5JNYA 3VWKA 4FQHB 3JXAA 5DRWA 4JRXB 5IJKC 5CGMA 4OT1L 4U1IB 4X6CB 1MJUH 1EO8L 5LG1A 3Q5YA 5FO7B 4IDJH 1NFIB 4G6FB 3VXNB 5C0JB 4X80H 1IZJA 3VXUD 5I16B 2RB8A 2VL4A 1RUQH 1T1XB 3TPKA 1L7IH 3MOBH 3T3MF 3V7AG 3BWUC 2LVCA 1S9WB 4JY5L 2YPLE 5HDBF 1VFBB 3UBXB 1DANU 1S7QA 4L4VE 5C2BH 2DM3A 2N7AA 2EXWD 4RGNB 3FFDA 4KKAD 5KVFH 1D6EA 2VDNL 3T8XB 3ARGC 5D2LE 2BMKA 4D0DB 4OLEA 3RPIA 4J3UA 3E6FB 4FXLA 4CMMB 1CGSH 1QPPA 4N9GB 4CU8A 3H42L 1U8KB 2ADJA 5ANMA 4AIZB 5A2FA 2UWEE 2OL3L 3ARBA 3L6FA 1PSKH 4XTRC 4YC2B 4RWYL 5I1JL 3TNNB 4V1DB 3IJHA 4I4WA 1JPSL 5DZLA 2X5PA 1QQDB 4LQFH 2BNQD 4GSDL 2UY6A 5A43C 1A21A 2ITCA 3VXRE 4JR9L 2P5EA 1HHJA 1HIMH 3ARDC 2NY5H 3ES6A 1FC2D 5D4QA 4MMZC 4MMXC 3U0WL 4W4OC 5KJRL 3PP3H 1XIWA 4GO6B 3AREA 3TA3B 4JO1L 4D9QE 2BDNL 5D5MF 5D2NB 1YEDB 4DVRH 1A14L 1X5ZA 1IAMA 3SY0B 1ZLUK 3LB6D 5TQ0H 3MTRA 3QEQA 1I3GL 2CKBH 2QTEA 2XNAB 3FT2B 2IADA 4WNQB 4G7YH 2A73B 2ZG3A 5ACZB 1E4KA 4Y19E 3MCKB 3MRFB 1KEML 4P4KA 4Z7WB 1IM3A 2KUTA 1H5BA 5FUCC 3ARBC 4HKBA 3UTZA 1OAZH 1A7RL 1MAKA 1WISA 2NY2B 3REWB 4JKWA 3K4AA 4YHMH 1JRHH 2JCCB 2FECI 5JORA 3G5YB 2IFFL 1QFWI 1WWCA 4QTHA 4P2CG 1MREL 3KPRB 5EC2A 4MQXC 3CD4A 4C4KT 5K59E 2P8PB 1XF2A 4EN3B 2DYPD 3MYJA 4L3CB 4DGVH 2W1NA 4NJ9L 5GGRY 1XIWC 4HFUH 3DX6B 4H1LB 1RQ5A 3C9NB 2FJHA 2BVQA 2Q6WB 2EIDA 1A6ZA 1NANH 5DK2B 3IXTA 3W9DA 4KJQC 5AZ2L 4TQEL 2HTLC 4WV1C 4CU6A 3GSXB 4APQA 2XXCB 2VDKH 4NN7B 3U48A 5BVJA 3REVB 1Q9LA 5JW4R 1ZT4A 1GGBH 1L7IL 5I1DB 1KJVB 1PFCA 3SO3C 2W59A 2BP3A 3U4BH 3GBNL 1L0YA 2X9WA 3QXWA 3M45A 5C8JB 2FLRT 2CD0A 4JDVA 3JWDL 4PRNB 3UTOA 3LKPB 4PJ9C 1VKXB 3CCHA 4OZ4B 3QEQE 2R56H 1IT9L 2HVKB 1SBBA 5HVHC 4KZEL 3OJMB 2EDEA 4PJCA 1IAKB 4RFOH 5LKNA 3MV7A 5KN5B 1KT2B 4PP1C 5BZDA 3SE3C 2BMKB 3LSOB 1DQLH 4CMHB 4P23C 2C4FT 1ZK9A 3U4EA 3DV4B 1RZGA 4HPOL 1KB5A 3CSYA 3TNMB 4M61A 4MCZB 4RFEA 3MZTA 3TF7C 2HG5A 4OCRL 4WENB 1UM6H 1KJ3H 5B39A 5EULV 1FYHB 3MRCB 2IF7A 1LO4L 2EZ0D 3OKOA 3RBSA 1I1RA 1MI5B 1EEYB 3SQBA 2B1AL 4Y5XB 5FK9A 3BRDA 1LDPL 4XNXH 2EYSB 1ACYH 4JO4L 1A6VH 2R8SL 1FNGB 5J13C 4QEGA 2VZUA 3AM8A 1RUML 2JJTA 3U2SB 2Y5EA 4M1DH 1R5VA 1H3XA 3OXSB 4K3HA 4TVPL 5I1EL 1QYGH 4PJ9A 4X8JA 2DN7A 1E27A 2W0PA 3S98A 5F3BB 3OAZK 4IIQC 2YKLL 4CJ1A 1F90L 2VLKE 2YD8A 1IC1A 1LDSA 5KTEL 3I84A 5ALBH 3WHE0 5IFJA 3WJLA 1RK0B 4OZHE 5CGTA 1P6AB 4LVOB 1MFDH 5J9PB 4JM2C 2OR9L 3MLRH 5IM7A 2C1OA 4JZNB 3ZHLA 1HQ4B 3KJ4B 4EVNB 3ZYJA 1FPTL 4YO0A 3ULUC 2MQ3A 1BFSA 1LGVA 1GGCL 1QRNB 3QZWG 2XACC 3T09A 4XCFL 1BX2B 2VWEE 5E2TL 3E6HB 4X6BA 5KVGL 2QBWA 1JNNH 3RVWC 3IDYC 4G9FE 1ZSDB 3FHQA 3GIZL 3D39E 5E99H 4XI5D 4YHNB 5DR5L 3BEVB 2XZCL 3DLQR 4HJGA 2Y23A 1M7DB 4JM4H 1WLHA 4Z76B 1P7QB 2D0FA 3HUJE 4BSWB 4RGND 4OD3L 5IVZA 3WXWH 4PJ8A 5EBWB 4UV7L 4QXGL 4TPRL 2I07A 3NN8B 4U0RB 1UJ3A 2NXYC 3MXWH 3SGKA 3S8WA 4MLSA 4D9RE 2V6HA 4XNZB 2HT4C 4NNPL 4XBEH 3O9WD 1YNTA 1RUAL 5GRUH 4P2QE 1YC8A 2X4UA 5T33H 1CDGA 1VEMA 3UTSE 1S8DB 1P53A 4MAYC 5DJAB 1GZQB 3SCMD 2FGZA 3QUYB 4NUGL 5HGHA 3V6OA 5FGCE 4HUWA 4PGCA 1JV5B 2PW1A 1FG2A 3UTPE 5I66B 5T3ZE 1JWMB 4WW1A 3T0VA 3RNQA 4EI5B 2HFGH 5DHYB 4AEHL 1DBBL 5GRVL 4HS8H 1LP9F 1CICB 4EKXA 4DCQB 5IHUH 4OCNC 3TN0A 3AS2A 1PD6A 3B8YA 4P46A 5DHXB 2PTUA 3H9SA 1NAMH 2A38A 5EOCJ 5D8JH 2WWKO 1AGCA 2RQ8A 3RY6A 2V17H 1FO0B 4IDJL 5CEZE 5GZOC 5I6XB 3T2QA 3IVKB 2GEEA 2FBJL 4XPGH 4ZNCD 1OAYH 1A6UL 5IIEA 2ICWJ 3GK8L 3QA3B 4DAGL 2DQHL 5HHOE 5GRZA 4HIXH 2VR5A 4WO4B 1OGAD 3SJVD 2CJUL 1KJ2L 3RY5A 1IGTB 2YRZA 3F58H 3BPNB 2DQDH 4DK6A 3W2DH 4N1HB 4MLIA 5F21B 3VW3L 3PXHA 2PKDA 3TT1H 1IAII 4LCCC 5H94B 3VFVB 5CUSL 4BZ2H 4MA7L 1OARH 4FZEL 3BKJH 4J1UB 4UZGA 3GI8H 2YN5A 5I18L 2FO4A 1MCKA 2V5YA 3SKJH 1J88A 1UCBH 3MRDB 2EDWA 2X70A 1U91A 3MLRL 1H3PL 4OGAC 4U1KB 2X1PA 1PG7W 5DJXB 1M7IB 5C0BB 1JPSH 3FKUS 4OFKA 1HOCA 3L1OH 3CVIH 1VFMA 1UZ8B 1M1SA 5IMOB 1F6FB 4H1LH 1LE5B 5JPMA 1FHGA 2AJVH 3T3PE 4MXQD 1GVIA 1M7XA 3O41A 5LCVH 3BZFB 1DQJB 2VXSH 1FLRL 4WU7A 4L8DB 4X0KB 3MCLL 2D7TH 2D7OA 4A2MA 4PB9H 1F2XK 4HKZA 1ED3A 2IH3A 3RWIB 5IQ9B 4G7YL 4IDLA 2PXYC 5GPRA 1R3IH 3RI5K 1S7UB 3A6CL 1FE8H 2I60L 1DLHA 3DGGB 1X5YA 4L4TD 3S37H 4OLZH 4QRPA 4YDKL 4BFGA 3VGHA 2WIIB 4OZGA 1KTKE 1IM9D 4EDWL 4NM4H 1HEZB 1KXQE 1YNTB 3LD8C 2FEDC 4G43A 1NUNB 3E3QC 2IANB 2Z31A 1S8DA 1WCBB 4RMTA 3LQAL 1K8IA 2XIDA 3MA9H 4MZ2A 4ETYA 4ZOAA 4U1SB 2ZOKB 2BSRB 1JNLH 4DGVL 5L88H 4XAKE 3V0WH 5JW3L 4HUXA 1OQOA 3FB8A 5GZND 1MHHB 4P59H 4NN6C 4PG2C 1A6PA 4Z95H 1MPAL 5D1XD 3VXNA 4I3RH 3ZKXC 5CCKL 2R1YB 4MA3B 4DN4H 1K2DA 4PJIA 3MO1A 5HVHB 3PGDA 25C8L 5C3TA 1TJHL 1MQ8A 3L7EB 1NGPL 4QHMB 4GG8B 1F8TH 1BBJB 4BZ1L 5E8PA 4W4NA 5B21A 4O51A 1MHCB 4NQCE 1CFVH 1CG9A 2BVYA 5ICYB 3O6KH 4TTGA 4WTZG 2FHBA 4U6YA 2WZPD 3QUML 1Q72L 3FT4A 2M26A 4Y16D 3WIHH 2X89A 4Z7UA 5IB5B 5C71A 1N0XL 2GJ6D 3VD7A 3K81A 3TIDB 1B2WH 4NOBA 1ZVSA 3K7UA 5DC4B 3OJDA 1PQZB 1J12A 1MLBB 5FUOH 3OAYH 5D6DC 4GAFB 3FO2A 3SBWC 1BAFL 4XPFH 4OM1H 5HDOA 1HCVA 2ZNWA 3OG6B 2Y7QA 4J6RL 4KK6C 4NGHL 1N4XH 3JVGC 1MRCL 1S7XB 2PTTA 3ILQC 2ATPA 3RNKA 5J1AB 4Y5VC 2Q20A 4R4NC 3HNVL 3KDMB 2XV6B 1S7SA 5J56B 4LHUD 1G6RH 3SOBL 2ADGB 5F7WC 5TGBA 3WSQL 3MRHA 3BH9B 1KIQA 5F9DC 5JOFB 3BW9B 5TH2A 1RK1B 12E8L 3CIQA 1GIGH 3CFEB 1LDPH 1QKZL 1SJHA 4OCXH 3DSFL 5BXFB 3P30H 4PTUB 4NQSA 4IRSD 3SY0A 3RGVB 3TO4A 3EOBA 2CMRL 2HT4D 1RULL 4ZXBD 4QRPD 5M7QA 2EXYC 4PJIE 3U6RA 5DJ8A 4GUPA 2YMXL 1DDHA 1AP2B 1AXIB 3T3PF 1R3IL 4DQOH 2ZSWB 3NPSB 5HYSA 3BP7B 2YD3A 5DUBB 3RZCC 3QUKA 1EJ6A 4M3JA 5F1IA 5IMKA 2DKSA 5DMIL 2ZJSL 5SX4I 3EYFA 1ACZA 3FQWA 4YR6A 4U7KA 2FZ3B 3BP4B 1LO5A 5IK3A 1DLHB 3QCTH 1PKQE 1TTFA 3O4OB 2EE2A 3EYOA 3UJIL 2HRPL 2HN7A 4F57L 3PGFH 2XTJE 5HYIA 3BEWA 1DZBA 1DE4A 3KPQA 1XF4B 2OTPA 4LCIL 1K85A 1MUJB 5EBLA 1QEWB 5GGSB 1B9ZA 1G7QB 2ZOLA 4JRYE 2NY3C 3HUJF 4KTYA 3HMWH 1S9XA 4HF5L 1TCRB 4HXAL 2QQKH 5DD6B 1MCDA 2CR6A 1T0PB 3H9SE 1CQYA 3V7AE 1M71A 4UNTA 5F7LB 3QHFL 1OCWL 1U41A 3GSVB 2FIKA 4KHTH 1UH3A 2AJYH 4XMPL 1PKQA 3S97C 1NDMB 2YD4A 1CVRA 1JYWA 5T33L 5FB8B 4MJ6B 4X83A 4EI6A 4JG0H 4L8BA 4PRNA 5JQ6H 3RZCA 5DI8A 5I1HL 1OF2B 5ALCH 2IPUG 2XZCH 3KJ4C 4WHDA 3CFJB 1L0XA 2XTJC 4IMLA 1C5DB 5J6HA 1MIML 2LABA 2VXUL 3MV7B 5A16B 4I0CC 4XAWL 4AEHH 3MRLA 1CLOL 2VLJA 3EO9L 1IGFL 3DV4A 3C6LB 5IFAH 1MFAL 2E7LA 3IXAB 1UXWB 5DDHB 1CXFA 1YMHA 1T20B 4U3CA 1MRCH 5EB9A 3I75A 1W0VB 1QA9A 2C4FU 4E5XB 4EBQL 3LPGA 3PDOB 5L9DL 1H9VA 5DD5H 1JZ7A 1JK8B 1X3DA 5BW7C 5KVDH 5CGYD 5BS0B 2FBJH 3BUYA 4LAJH 4FQQB 4MQTB 4I3GA 4QHUB 3RU8H 1GGIH 4P2RE 1BEYL 1YEGH 1NCDH 3JWOC 3KNBB 5D6CB 3U30C 4JQVC 3VFUB 1WZKA 4EUPB 4OCXL 4M5ZH 3ZL4L 1QFOA 4GXVH 4FRWA 1LP9A 4OTXH 4OIIL 3NCYS 3CFEA 1PLGH 4Q74A 1B6UA 5E95B 1UWXK 4WEUD 1CD1A 3E2HC 3MLZH 5D1ZA 4X9GA 1U8OA 4I48B 5J12C 1Z5LB 3U36B 3JTSA 5LGKA 4BH8A 3QQNA 4FZ8H 2CUHA 4O00A 3G6JB 2O5ZL 1BF2A 1OP5H 1MCWW 4XCYB 1BOGB 1N7MH 4E42B 1J8HD 3IETA 3ZT7A 3DMMA 4ZTOL 3TVMA 1UKQA 4XCEA 5IM7B 4DQOL 1J05B 1R0AL 4ELKA 1VESA 3U6RB 5HPOA 5JZ7D 1INQB 5D5MB 4QRQA 1MEXL 3EAKA 1BFOA 1TIUA 2JJSC 2X42A 4ODVL 1U95A 1FCCA 2FECL 2J6EH 4WUKH 4J3TA 4U3XA 3SKOA 1EX0A 5SWZE 4EI5C 1YYMH 1SBSL 3QIWB 3NIGE 4Y16B 5D96B 3HE6B 3C09C 2YD1A 3O3DB 3SGDI 2SEBA 3QWRD 4RISL 3DRTB 2BVPB 3FQXA 1LO5B 5IK3B 4XPHL 1XGRA 3KPSE 4JHAL 3AAZB 4HGKC 5GGQL 3TFKD 3SGEI 1G9MC 5DEGB 1YYLL 5HI3C 5LWYL 3BN9D 2FO1A 2VH5H 2CLVA 4S1DD 5AD0B 4P9MH 1U92A 1HH6B 5C07A 1U6AH 1N8ZB 4XC3L 5DQ9A 4GMTH 1IQDB 2B2XH 2P5ED 3O4LD 3IU3A 3OXRB 4JAMA 4JFOA 5IROA 3SDCA 4X7SL 3NH7H 4ZOBA 4OF7A 4CDGC 3GSOB 2W0FB 5FM8A 1FDLH 4UV4L 5I1HH 4OJFH 3NPZB 2WMPA 5TQ2H 4I13B 2AKRB 5DTFB 3SDYH 4NFCA 3P9LA 3HPLA 5CJ8A 2HFEB 3QH3A 1JF1B 3MJ8A 2M1KA 1RIVH 3EFDH 5KANG 2UUDH 2NXZB 1ZAGA 1PG7X 4XNUL 3EO9H 2R69H 1T0MB 4WCYL 5D7LA 4CRPA 4E41B 3BHBB 3GJEB 4MB3A 1JFQH 1JNHA 3EFFA 2CIIA 3MCG1 3KPPB 4ETQA 3WUZA 4PV8A 1A4JA 5C0AA 3O6FA 4NRXA 3QQ9C 1F02I 1FO0L 1NMAL 3DYOA 4GLRI 2GAZB 2BNRB 3OKKB 3U7YL 5E9DE 2WBJA 1K8DB 3UYRH 3I75B 5MEOB 2VSDA 4TSBH 4BZ1H 3KPSA 5GSVB 4PGEA 2GJZB 2LQRA 2AERT 1A1MA 2X10A 1AO7B 3JWOL 3QG7L 2W65B 1CFVL 5D1XA 3NFNA 1GRWA 4HLJA 4RMRA 2VQ1B 4RZCB 43CAB 4WI6A 3DV6A 3KYOA 1YEIL 3VXSD 1AKJA 4MX7B 4I3RL 2OXHA 3NIFF 4NZUL 2PXYB 1I1YA 4B7IA 4Y4KC 2VLRD 3ET9F 2EZ0C 3OR7A 4LARH 4O4YH 5IBLC 1HQRA 5DA4A 2OJEB 4OLYH 4PB0H 5DLML 4YBLB 2X7LB 4KK9D 2X70B 3B2UC 4P9HH 3NOIA 1Z5LA 5F93C 4C57C 1TPXC 5D1QB 5DJ0B 3L5XH 2RBLA 4HIIB 2H26B 5DJYB 2PYFA 3O6KL 1Z0MA 3GSWA 4UT6L 3FOMA 3RVVD 5I1JH 2D7NA 1LE5A 2ICCA 5JIPA 3SOBH 1CT8B 3WSQH 3VFTA 4LSRL 2JKXA 3GB7B 4LVNB 5C0FB 3GZKA 2F9BT 1SHMA 4FNLH 3VE0A 4LP5A 1V3LA 4Y4FB 5D7JD 5J6GB 4ZODA 1YNKH 1U8JA 4JLRB 4KDTA 4XWOD 1FNEA 3BI9X 3H7LA 2XTJD 2IH3B 4U4BA 2F53D 4XBPB 3RWIA 3UJJL 2DOCA 2PETA 1KB5H 1A02N 2VKXA 4U1HA 4ZXBB 5DVKA 3JZ7A 5EU4A 5CAYB 1UB5A 2IC2A 1D9KD 4LF3B 1X5XA 1N3NB 5F8RC 4G8GE 2DI9A 4QXTA 1F97A 4YNYB 1GIGL 3VA2C 1QBBA 1RHHB 1ZHKA 2NY5L 4XVSH 3BQUC 3EJJX 1D9KA 4KROD 5DMIH 2ZJSH 1QLRA 2GUOB 3LCYA 1UM4H 3BZ4B 4KXZH 5KJRH 1UG9A 3KJ6H 4BH7A 1RULH 4F7PA 1BD2B 4OV6F 3GFUA 4Z7VB 3MBXH 1BJ1J 1E4WL 2DTMH 2G75B 2H1PH 5L2KA 1I9JL 1M6OB 3RKDD 3LEXA 4YBQC 3F8UB 3PGCB 1KCKA 4U6TA 4M4RA 32C2B 5TE7L 4PLJC 2DIAA 3DXAE 3NACL 4OSUH 1OAXL 3MLWH 4XZUA 5F44A 5ADOL 3KXFA 5CP7A 3D2UB 5E2WH 4GW4A 2VDKL 3GSUB 4GBXD 4XVTL 4FTVA 4OIAA 2H45A 1C5BL 4BQ9A 1I7UA 1S5HB 3MYZA 4XGZB 1JNJA 1OP5K 2O61B 2VLRA 2BNRA 3UZVB 1U0QA 4Y5YB 2VXTL 2WWMD 2CRYA 3P73B 3ARDB 3RVXD 1INDL 1JMZA 3EOAA 3QFDA 1XGQA 2BX5A 5D2LA 1MIMH 2NNAA 2ADIB 2P5WD 3S37X 2DQEH 1QSFA 3TN0D 3AREC 5JDSA 5CKAA 3O45A 3QUYD 5I74B 1U3YA 4M6NL 2NW2A 2W65A 3RL2B 5D1QC 1FNFA 5E03A 2W9DL 4CN6A 2Y06H 3FB7A 5ERWA 5SWSE 3WDJA 2VC2L 1YEKH 4KDWA 4YBHA 1EVUA 2VDMH 4JHWH 4NQVB 4ONFH 1A7OH 1P7QD 2OTWA 3MLXL 4GW5A 1NGYB 5DHVA 1RK1A 4LLMB 4G8IA 2R56L 4S1SL 2VSCA 3RBGA 4Z0XA 4YHZH 5IW6B 1ZEAH 4J4PC 5KG9B 1DBAL 5BXFA 1YEEL 3JV0A 1DEDA 3ELAT 3ROOB 1I1AC 2NY1C 4NKOA 2VLKA 3CX2A 5I1GH 4R8WL 1WBXB 5T1MA 2A74B 3GMLB 1D5MA 2C3WA 1J1OL 1LO0H 1XF5A 2LU3A 3UTTE 4GOSA 5HJ3B 4Y88A 5I1LB 4G6AD 3VWJD 1T66D 1NGXB 3MUJA 2XPGA 2YPKA 1TNNA 2BY2A 2CXKA 2HTKC 5D96C 5KVDL 1MIEH 3VFOA 3MRGA 4TULH 1EGJL 5EU4B 2ZP0T 5HYJE 3QXVA 5EU6E 1SJEB 4D0BA 1KPVA 1S7RA 5CZVL 3GSNB 2Z31D 5EU7E 3T4AB 3UYPA 1INEH 2PR4H 4UQ3A 4OKVB 4OTXL 5DJCA 5E6IC 4RDQF 5IQ7L 4JZJA 4LU5L 3T04D 1CYGA 4F33B 5EA0H 1CICC 3IFPA 4PTTA 1KTDB 5KVGH 3CX5J 4BA8A 5GJTH 3FN9A 1I1AA 4EXKA 3OAZH 1ZLWH 4WWKC 2DQGL 5SWSA 5HD8C 2UVEA 4ESKA 3BH8A 3TBTA 3WFHA 4HAGA 1P7HL 2XZAL 5DRWB 4P23A 5KSBB 4CMHC 3MA7A 1NL0H 5J3HD 1F4XL 2BZDA 1A7PH 5MENB 1W2KT 3BDXA 4N0UE 2UWEF 1OF2A 2O5XL 3S9DB 5E1AA 2A9NH 2CIKB 2AW2A 1CD8A 2WUBL 5EO1A 4K7PY 1ZT1A 3HAEG 3D9AL 2KZWA 4LOUD 4OGYL 5L8LB 4UOJA 1HDMA 1FL6A 5C0CE 4LLDB 2DLEA 1XGYH 3BT2H 4YXLH 2O61A 2GITA 2VLJB 4KKAC 5HDBE 4O5LH 2CRIA 5DWUH 1TJIH 2WUCL 4OD3H 5F89A 3OKNA 3EYVB 3QEHA 4M4PA 1T6WA 3S35L 3DVIA 3TBVA 4Z78B 4MNHB 5JPNA 1W0VA 5EZLB 2ATKB 1G9NH 2Q8BL 2VLLA 1DN0B 4ERSL 1L4IA 3O3UN 5FHBL 1G7JA 3WHXA 4LNRB 3UO1L 4L9LB 1WBZB 5JHDE 1A3QA 2JK5B 3GHBH 4JM2B 4QXUH 2CDFA 4QHUA 4EEEA 4OI8A 2EIZA 3LIZH 3G6AA 5CINL 3ORJA 1WQVT 3HZMA 1KIPA 3L3OB 1HHJB 2GY7B 2NY7H 2XN9E 2VITB 1AXTH 2VUYA 4JVUA 3WFBL 4LLWA 5JXAL 3VU2A 5LGHL 4G9DA 1J1PL 5J12B 4Y2DA 4Q6IA 5CD5D 4Q6YA 1FV1A 3CLFL 4GAJH 3FO1B 4I77H 4MDJB 3O6LH 3ZDZE 2MQCA 3UYOD 1TZHA 2AV1B 5ACZA 1I8KA 1NMAH 1XMWA 4FQJH 1Z9MA 3EOYG 2FX8H 3GMOA 5FAAA 2YR3A 1XF5B 3ZTJH 3FFCB 4HMDA 3SE3A 8CGTA 4Z8FH 3WIIL 4TSBL 1BZ7B 4QRUB 4NBZB 1P4IL 5K9KA 2DIJA 1SMAA 4ZTPL 3MRGB 1QLEL 3LDBC 4HWEH 3BXNA 2D03H 5IW3A 1AHWC 2P7TB 2G5RA 2IAND 5EFIB 5I8EB 4FABH 1Y0LA 4HCRL 4UDUA 2DYPA 3SDXA 4LRIA 4P49A 3SHSA 2J5LC 3VXQA 1LQSR 4JZJB 1FFOB 1RIUH 4UBDD 2O93L 1FL3A 5BMFH 4PBVC 3HS0B 4ZPTB 1FLRH 3EHBC 3RWCB 2HH0H 2APBA 4XB7A 1KB5L 1GZPB 2X4QB 3TN0C 3CVHB 4XX1E 2Z4QA 1BJMA 2NQCA 4FQ2L 4JFOB 2FWOA 4HWBA 4CGTA 1NLDH 1U3HD 4XP5H 1R24A 3RRQA 4PJDF 3X3FL 3S96A 5BOZG 1UB6B 1GSMA 3FRPG 1A9EB 3ARUA 4AENA 2OZ4L 4F37F 5F97E 4KQ4L 4BQ8A 2AJXL 3QULA 1V7MH 3NCBB 3MLPA 2OSLA 4N0CD 4XCNA 3GHEH 5K9JL 2IAMD 4FQXA 4EDXB 3T0AA 4IRSA 4PJ7E 1YECH 3BQUD 1I9IH 2WUCH 4OZHF 4RWHA 3QJHB 4M03A 1DSFL 4HPYH 3MXVH 4AT6A 4NWUH 3RWGB 2AS5M 1MCIA 5HGDB 3QO1B 2PYEA 2P5WE 3ILQD 4MJ4A 4LCCA 5TE4H 5IT2H 4YWGL 3U4EB 3TJHC 4S0SD 4PV8B 1MCSA 3ZKND 3R4DA 1G9NL 3ARFB 2DL2A 3NFPA 1GC1L 5TFSL 5CILL 3N1FC 4HDIB 2J8UA 4S1DC 2MCPH 1WJ3A 3OB0K 5HY9B 1H3TA 1JPGB 4LDEB 3SDXF 4KK5D 1BJ1H 4ALAL 4KRLB 5FDWA 2ZUUA 3FZUD 4F8TA 1J11A 2VN4A 3HAEA 1W72A 1UH2A 3N50A 1QRNE 2BSSA 2GJ6A 6CGTA 2D0GA 3H0TA 3QUMH 4HIJB 5SWZA 1X7QA 3GSQA 1KGCD 3HR6A 4N90E 5DURD 3D39B 4R0LC 4YFDB 4JFZH 1ZA3A 3THMH 1OY3B 4MSWA 4OV5A 1I3VA 5EOQH 3G9AB 1RK0A 1CDIA 4ZFGL 4IRJD 2BSTA 3RA7L 2I27N 2R2BA 4NCC2 4OCMC 1P4IH 3LKRB 1OD9A 3RIFF 1TZGL 5CSGA 4NP4H 3B9KD 4Y19D 1JGVH 3GB7A 1CDJA 1F4AA 2W9LA 3B3IB 3G5ZA 3K2UH 5C0FA 3N85H 3B6SB 1ZGLA 2FGWL 4L1DA 2C4XA 1CU4H 2VDNH 1LP9E 3GO1H 4X6CA 1JPFA 2F54A 4HQQL 1FVCA 2W9DH 1A9BA 3QNYB 5EN2B 1GGYA 4APQD 4HS3A 4WDIA 2H2SC 4NN5C 2GK0A 5DO2C 4JFFA 3STZB 2YZ8A 4HC1H 3KLDA 3D25B 4LF3A 2AJSL 4QKXB 4YEEA 4HUUB 2BDNH 3QI9B 4DVRL 4JFEB 3X14B 1CFTA 2DWDA 3EGSB 2ZPKL 3IS0X 1XF3B 4U31A 4OB5L 4Y0GA 3PHSA 3P3YA 5BJTA 1A22B 3V2AR 2DQIL 1RU9H 4D3CL 3ILPA 1MFBL 2FSEA 3OPZH 5DUPL 4YH6A 1ONQA 4DEPB 2G2RB 4KJWD 4H25A 4X6DF 3TP4A 2L7UA 1FC1A 3VFNB 4LCWB 2P42B 2AI0L 1BBDL 2XQBL 5F9JA 3IKCB 5AWNH 4HWBH 4M8VA 5D93C 1CIUA 1D7FA 3ULUD 3QHZH 4NQDB 4JZOB 4DWHA 1MVFA 1GGUA 4Q9QH 5C0CD 4UU9B 1R3KA 4YWGH 2YOCA 4HXAH 2F58H 3QIBA 3WFZA 2Z8SA 1NL0L 4YHML 1OAQH 4BSVB 4CNIB 1VEOA 1XEDA 3SE4A 4DKAA 2R0KH 4TNVK 1T3FA 3ULSB 2IFFH 1JWSB 2XNAA 1HINL 3VH8B 2YXMA 4MCYA 3VMOA 4Z7WA 3CC5B 1AD0B 1FH5L 4WTXA 2PW2A 2NXYD 3D9AH 4M8QB 1CCZA 5EORH 3I9GL 3R0NA 1VENA