4HHAB

Anti-human cytomegalovirus (hcmv) fab ke5 with epitope peptide ad-2s1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
227
structure length
226
Chain Sequence
b'QVQLVESGGGVVQPGRSLRLSCAASGFTFSNHGMHWVRQAPGKRLEWVAVISYDGRHEHYADLVKGRFTISRDNSKNTLYLQMNSLRAEDRALYFCAREGLSRDNSGFTGLIDYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab KE5
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 226
sequence length 227
ec nomenclature
pdb deposition date 2012-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hhaB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hhaB01
4MXQD 5F1NA 5FM4A 4UBDC 3H9SA 1FE8L 5TE7L 4AT6B 4BKLA 4NFBA 3U9PH 2R0WL 2W07A 4ZPTA 4U0RB 1Y0LB 5EOCL 5F7HA 4D0BA 4NUJA 4Y4HD 3C6LC 2VISB 4IRSC 1ZT1A 1VADB 4J3VA 2CLZB 4YR6A 4Z7UF 3H9SB 3V4PL 3CFJA 2NXZC 3L3DA 4OZIA 5FYJU 2EE3A 4MXWH 2HTKD 3VFGH 4NUJB 1A0QL 2VR5A 1J9CT 4JZJC 3U0PA 1ZT1B 3EOTH 4HJ0D 2R56L 4Z8FH 1AXTL 1X5GA 1V3KA 4LDEB 4YR6B 2FX8H 3HAEA 3HI5H 3CFJB 4XCFH 2B0SL 4C4KO 1FAKT 3L3DB 4OZIB 4YHPA 5MP6L 3DARA 2JELL 4TTDD 3VDBA 3WFEL 3BIKA 1IC7H 3G9VA 1D9KD 3U0PB 3QPQD 4LNVA 3RWIA 4PJCA 4ERSH 1G1CA 4G7VH 3HAEB 3NIDE 3MA9H 4CVWA 3DYPA 1KXQE 3KVQA 3BIKB 3RUGE 3W9DB 1FAIH 2QADD 7FABL 2D3VA 4UV4H 2ARJQ 3RWIB 4PJCB 2XZCL 5JIPA 2B7DT 4FA8A 4XMPH 1S7XA 4LSUL 4UTAH 1I7ZA 1ZHNA 2FX9L 3Q48A 3VRJB 1S7SA 1NGQL 3PP4L 5I1CL 2YUWA 1MFEH 4PJIA 3VXQB 4DZ8A 3BGFC 4IRZL 5FO9B 1I7ZB 3TLRA 1ZHNB 4PV8A 3UC0L 1S7SB 4QHUA 3I75A 4LPXA 2GJ6D 4U4BA 4JM2A 4HWEH 1DE4A 1Z3GH 4ISVA 1DLHA 4ODTL 1X5AA 5IVOA 4WUUD 4PJIB 2HAZA 4DZ8B 4ENEC 4PGDA 2WINA 3A6BL 4PV8B 5BVJB 2YUVA 4QHUB 3I75B 2EH8H 4JM2B 3CMOH 5J12B 1DE4B 3REWA 4ISVB 3VGFA 3B9KA 4YHMH 2MKWA 2WIIA 1AFVH 5CGTA 3OJMB 5HYJA 1N5AA 5T3ZH 5I1EH 3CFIC 1T1YA 1F97A 1WFUA 3LEVL 3REWB 3B9KB 3VXMD 2WIIB 4YAQB 3DX8B 1NDMA 5EZJA 4YEEA 2D7TH 1FIGL 2E7CA 5HYJB 4HXAL 4Z7QF 1N5AB 4GKOA 4PJBF 5KZCB 1T1YB 2MMXA 5EOQL 3S34H 1RY7B 4UOW0 3RTQB 3PHSA 4FQ2H 1NDMB 1DBML 2H2SC 5EZJB 3EO1A 4L5FL 4FS0A 3N06B 1UKSA 4HWBA 3V4VL 4N8VA 4PRHB 4MD5A 1BAFL 2D4DA 3GMMA 2DI9A 5F7FA 5I74B 2FEEL 3MUGA 1CFBA 3EO1B 1OD7A 4P5TD 4O5LL 2AI0H 1Q9OA 1U42A 3ILQD 4N8VB 3C8HA 4MD5B 4G9FA 4PB9H 3GJFH 5F7EH 1MCPH 1S9XA 5E2WL 3T2NL 3CD4A 2DMKA 5DLML 4A6YL 3H42H 5DVOA 1B90A 4XTRC 3MRJA 5DD0L 1A6WL 4N9GB 1Q9OB 1A6ZA 4WGVB 4G9FB 3ARFD 2JB6A 3SDYL 1CL7I 1B88A 3QFJA 5AEAA 2X1XR 3RVWD 5C07A 1PJ9A 3QDGA 4G6AD 2C4FT 3MRJB 3Q6GL 1A6ZB 4XNXL 1J0HA 4KQ4L 3QFJB 5C07B 2G2RA 3QDJA 3OZ9H 3QDGB 4J3SA 5F3HA 3BGMA 4IOSD 1MCJA 3CFCH 2DKSA 3H2WA 4XNZC 5F7KC 5C08E 3TA3A 2NY3C 1XF5A 4LP5A 5IIEB 1KBGH 3ZMRA 3KPTA 4P23D 2PR4L 1MI5A 1H3VA 2G2RB 3QDJB 4PJEE 4MQ7A 5CKGA 5F3HB 3BGMB 3UBXI 2YD1A 3SGKA 4HQQH 4QOKA 4UINH 5J4MA 2C3WA 4TSBL 3TA3B 3C5ZD 4M02A 4FFWD 1XF5B 5TJWK 5ADPL 4JPIA 2MSPA 3QUZD 1MI5B 5JHDD 1Y6MR 1MQKH 2NYYD 4MQ7B 3VG0H 2Y06H 1OWWA 4QOKB 4S2SA 5H8DA 4N8PA 1NCUA 2BSTA 4FQLL 2Q6WA 4JPIB 5LAXA 3TVMA 2XI9A 5EBGA 2F8OA 4PJHA 4JFEB 4HUXA 4C59B 2NR6C 1H8SA 1YPZF 1NGYB 4XVSL 1T89A 4S2SB 5EU4A 1MQ8A 1BHGA 3ARED 1ZXQA 4M4RA 5SWQA 5T3XE 3BPOB 1Z0MA 2BSTB 1J0JA 4XX1E 2Q6WB 1AO7E 2N7AA 1BZ7A 5LAXB 4JQXC 4HULB 4PJGA 4PJHB 3V5KA 4HUXB 1BIIA 1CDBA 1VERA 3MNZA 5EU4B 1G9EA 2A74A 1JPFA 3ARUA 3ARQA 1MCCA 2EC9U 1PG7W 1QG3A 4UT9H 1QLEL 1NCTA 5HYSA 3KXFA 3NTCL 4PJGB 4U7SA 3D5OF 5EZOH 3V5KB 1EHLH 5ESVA 4LEXL 3UBXG 4AQOA 1BIIB 5E4EB 3MNZB 3QEGH 1TPXB 2A74B 1JPFB 5DC0A 3ZHKA 5DHYA 1EEZA 1IC4H 1A7OL 1CLOL 5GGTH 3QXAA 3K2UL 4CL7A 4JDTH 5HYSB 3KXFB 4XMLH 3I9GL 3RDTD 4LCUA 5D71H 5ESVB 4M61A 6FABH 1JRHH 1J1XL 5DHYB 1EEZB 4KV5F 5IB5A 2DM7A 1H3PH 1K4DA 4HWZA 3HUJF 2QHRL 3QXAB 3UROR 3EBAA 4GQPH 3WN5A 5JW3H 4LCUB 4OZIE 1FNSH 4M61B 1DLFH 5BOZG 4BZYA 4U0RC 4JPKL 5IB5B 4HWZB 2GHWB 5EZLA 3WN5B 2ZUQC 3P9LA 1RUAH 3MXVH 2QKIA 5C3TA 3ZTNH 4CN1A 3EJJX 5HVGB 4V1DE 3B5HA 4XNMA 4Y5VA 5EZLB 4XNYH 4LCIL 2H45A 4CADA 4P2CG 4WTXA 3O4LD 1JGDB 5FO8A 3P9LB 4JG1H 1C16A 3WJJA 1CF8L 4RWYL 1I3GL 3WV0A 3WIHA 4FG6C 3ET9F 3BUTA 1I1AC 2QSCL 3MRMA 1JF6A 3U7YL 5JUEH 4K8RD 1E4KC 5FKAA 3WE6A 5E24E 4KXZH 4NQEA 4Y5VB 4CADB 4KZDL 2WWMC 2JIXA 3PJSA 4N1HB 5FO8B 1YEGH 5FYJL 4LHQB 1AR2A 1C16B 5GGUB 3WFBL 1UZ6F 5JW4M 4Y88A 1MWAA 2Z8SA 1SEQH 2EXWC 4M1GL 3JV4A 4YDKL 3BP5A 1S5HA 2YWZA 3MRMB 1IGTA 1CGSH 3P4LA 5FKAB 3WE6B 3RWHB 4NQEB 3QI9D 1HYSC 5IV2A 2AEIT 2JIXB 5HI3D 1ROWA 5DQDL 1TETL 5DUML 5HHNA 5T5NG 4LP4A 5D1QA 2PTTB 3MBXH 5IBUG 3RVVC 3JV4B 4HK3J 3BP5B 1S5HB 4Z76A 1IGTB 3GK8H 2AEPL 3SGJA 4HJJH 3H9ZA 5IV2B 4Z7OE 1KCVH 2OI9B 3RIAK 3QA3A 5HBBA 2R9HC 5HHNB 4IJ3B 2XRAL 1MFNA 3R4DA 5D1QB 4XMKL 4Y16A 5ESAB 4KJYA 5B8CB 5GZNC 4Z76B 5FYKD 5GRUH 2BDNH 3A6OA 5CWSA 4PP1C 3P77A 5JMOC 2BVUA 3SQBA 1NCBL 1RUML 1ORSA 1MAMH 3GZKA 4Y2OA 4HLJA 3VXSD 3ARDC 4GFTB 2FX7H 4OIBA 4U6TA 4Y16B 3FFCE 4KJYB 1JNNH 3QQ4B 4HS8H 4LHUD 3P77B 5DS8A 1ORSB 4XC3L 3QWRD 1MH5A 2VDPL 3MNWA 3LN9A 1Y18A 1ZT7A 3UO1L 3L3HA 3O81A 1NEZG 1LEKA 5DS8B 1YY8B 5KVDL 1CK0H 3F12A 1CFTB 5CJQL 4OCRL 1DUYB 1Y18B 3D2UA 1ZT7B 5CBEA 3VD9A 4KPHL 4AG4L 2W65A 2LTQC 5DEZA 1LEKB 5IWLA 4G5ZL 3RTQC 4P2YA 5D93B 3F12B 3DX6A 3MLPA 3HKFA 4BH8A 2JCCA 3Q5OA 1OF2A 1RI8A 3D2UB 1YEIL 3VGBA 5CBEB 1UVQB 1YEJH 5I74C 3CH8A 4JRWA 2C4FU 3GMOA 2B4CL 3SBWC 3DX6B 3WIIL 4RISL 4QRTA 4BH8B 2JCCB 1YYML 1OF2B 4EVNA 5C07E 2ZKHL 4JFDA 2EKJA 3CLFL 1JZ7A 2QQQA 4R3SA 4DKFH 4JEGB 3BESR 5DMIL 1DQDH 3C5SB 5TQ0L 4QRTB 3D39A 3GRWH 1J8HA 1H3TA 4EVNB 3UCRA 4ONFH 1I8IA 4JFDB 2RR3A 3HPJA 3ULUL 3GO1L 4X9BA 4IDJH 4P9ML 5ILTL 1NUFA 5KS9F 5INCA 2MPAH 5GRXG 1ZK9A 1J8HB 2VQTA 2HFEB 1BBDH 4OCNC 1I8IB 2OL3L 1MI5E 2VAAB 3HPJB 1VACA 5C0AA 4GMTH 2P46B 4PBVC 2CKBB 2XPGA 5GZOC 3MACH 4QXTA 4Z7UA 4XPFH 5INCB 2NX5D 4JO2L 4QOKE 2LAGB 3ZT7A 4J3TA 4BH7A 1B2WH 5A1AA 4F58H 1VACB 5C0AB 2A6KA 1AXSA 1TZGH 3LRHA 3PWNA 1TMCB 1X5LA 2XPGB 3PHOA 4MD0A 5IVXF 2FSEA 4QXTB 4Z7UB 5GJTH 4XVUC 4DKDC 1FFPA 1JNJA 4ZNEA 2V2WA 1A7NH 2R0ZH 4BH7B 1ZLWK 5F9DC 5SWSD 4PJHE 1AXSB 1EEYA 3HNTH 3E1F1 4WWKA 3PHOB 4MD0B 4UB0L 4ZO8A 2E7LA 2FSEB 3INUH 4OFYA 4LDLB 1QKZL 2HTLD 4JJHA 4W4OA 1FFPB 2D9QB 4KVNL 4I0CC 2V2WB 1P6FA 1FZOA 2G9HB 3QIBA 1JGVH 3IF1A 4OGAD 1UJ3A 3OF6A 3OAYK 4PJGE 1AI1H 4NN6B 1EEYB 4KHXL 4O58H 4M7JH 4WWKB 1OLLA 3OGOE 3ULVD 5IFJA 1XF1A 1UADC 2XTJE 5B39G 2G75A 1KENL 2HN7A 4DGVH 1KOAA 1EJOH 5D72L 1FZOB 2X2YA 3QIBB 3R1GL 4UZGA 3TIEA 4Z7NF 3IF1B 4PRIA 1UJ3B 1KACB 3BPOC 3KXFE 1NLDH 2FNBA 1ZLUK 4N90E 4WNQA 1U6AL 5IFJB 5HDLA 4MJIE 3UPRA 5F71A 1FZMA 5TDNA 2PYEB 2G75B 2HN7B 2IANB 1KJ3L 1JYVA 4MQTB 1OT2A 3TIEB 1IFHL 2ATPB 4L9LA 4PRIB 2XACC 1MOEA 5JXED 3L3OA 4ZYKA 3DV6A 2C9AA 1FVDA 4WNQB 1RMFL 1KYOJ 1NCDL 1KN2L 1HHJB 3UPRB 3H9HB 3O2WH 5TDNB 1UWXH 1WCQA 3NCJH 3DXAA 4IS6A 2OQJB 1WITA 4L9LB 5GGRB 4PIRF 5IQ9A 4KC3B 4YLQT 4TUKH 1HDMA 1NCAL 4ZYKB 3DV6B 1FVDB 4ZXBD 1T80A 1CLCA 4M1CC 4RFOL 1I7TA 4YO0B 3TCLA 1SMOA 4XRCA 5D7SL 3DXAB 1YMMA 4IS6B 1IE5A 1LMKA 3SKJL 3FT3A 2R1XA 1HZHL 1CLZH 2E7HA 5BW7A 5IQ9B 1C08A 1OWRM 1HDMB 5C0DA 4ZUTA 3EW3B 4LRIA 1I7TB 4X6BA 1I4FA 1F00I 4KRNA 5C9JA 5CJ5A 4Y19D 1GC1L 1YMMB 4PJBA 3HRPA 2R1XB 4HFUL 4S1QH 1X4YA 1C08B 2VH5L 4RGNE 1YEFL 5C0DB 5DVNA 4ZUTB 5D1XD 3WN5C 1I4FB 3L95B 3LKPA 3PABA 5EUOF 5C9JB 3BUYA 3VFRA 3RWFA 1HKLL 3OSKA 5GISL 4PJBB 1G0XA 4NQEE 5FA3A 1JRHI 4F7MA 2SEBB 4EI5C 3DVFA 4OF3A 3VD5A 4POZD 3LKPB 1GPOH 1EFQA 3BUYB 4R6UA 3BQUA 3VFRB 3RWFB 1NCCL 5D1ZA 1R3LA 2BY0A 5FA3B 1BQLH 4H8WL 4F7MB 2ZZUT 4HZLB 5I1LA 4J3XA 3BQUB 3VI3F 5BRZA 5F9OL 4WI2A 3U4EA 5D1ZB 5E5RB 1PZUB 1DVFC 1INEH 2A83B 5I1LB 1EGJH 1ITCA 3OTTA 35C8H 2R2EB 2FH8A 2VDLL 5D7KE 3KPRA 4OI7A 2ZP0T 5BRZB 5DMGC 3U4EB 2W0LA 1MF2H 3KYKL 4PY7A 5DJ8A 4CN6A 5T5FL 2OZ4L 4FTVB 4G6JH 2MCPH 2OI9C 4XP1L 1JFQH 4KXZI 4JRYE 4FMKA 4K3DL 3KPRB 4O4YL 3E6HA 1K9TA 4Y4FA 5FM5O 5HHQA 3HC3H 3QCUH 4XXCA 4IJ3C 4OT1L 3W9EA 4F7CA 5B8CC 3FOMA 4PY7B 5DJ8B 1T83A 1YEDA 2E7BA 3PE9A 2A1WL 3TBVB 4W6YB 3OG6B 1JN6A 4GBXC 2YN5A 1ZMYA 5HHQB 5D4QA 3E6HB 4Y4FB 4Q6IA 1UQSB 4ODVL 5DC4B 3W9EB 1G9NC 1HILA 3FN0H 1PG7X 1T04A 3AS3A 4PJ8A 5HHXH 3FOMB 1YEDB 3CMGA 5AWNL 5TF1H 1HHIA 1JHTB 5KOMC 3RWEA 4EN3A 1JN6B 2DTML 1CDYA 2PXYC 2ZJSH 4KKAD 1KB5A 3B43A 3I2CL 4Q6IB 4X7SH 5CEZE 4U49A 5CBAA 1G84A 1RZKC 5I71B 1T04B 4PJ8B 4QRPA 2DQJL 4XVJH 2EXYD 3G6DL 4TVPE 3V6BR 1DN0A 4YDVA 1HHIB 2WM0A 2X4QA 3RWEB 4EN3B 2CK0L 3N50A 1XT5A 2JCCE 3LB6D 1YPZA 4TNVF 4YHNA 3TH3T 5CBAB 1JGEA 4K9EC 1BQUA 1BFVH 1G9NH 4F9LC 2WBKA 4XAKD 1AP2A 5IP4A 3UZQA 1DN0B 4YDVB 2CGRH 4N5ED 1WGOA 2X4QB 5EU7E 3WXVL 3KLAA 1QRKA 1CZ8H 2H1PL 1E28B 5M95B 1I8LC 3BW9A 3GIZL 1CVRA 1YPZB 4RSVA 3D87B 4YHNB 2QLVB 2ZUWA 1JGEB 4CRPA 4UILH 1NAML 4XCCH 2V5TA 1RZKH 2FRGP 4P9HC 1AP2B 4ALAL 3SKNA 1PW3A 1CQYA 1OTTD 1N0LA 2IAMD 3TYGL 4AEIH 3RP1A 1CTNA 5IWLC 5LGHH 4G8GD 3D39E 1K6QL 1NCWL 3BW9B 1T2QL 2YHGA 5D7JD 5CSBA 4K9EH 5GGQL 4LGSB 4KZEH 4IMKA 1FP5A 3SKNB 2DQDL 2Y5EA 3PXHA 3DBXA 3DUSB 1WZKA 5BJTB 1BM3H 3L6FA 3W0WD 3TT1L 4GG6F 1MY5A 3MJ6A 2H26A 1ERNA 2FIRT 4LPVA 4M4PA 5C92A 3BSZH 4P9HH 3HUJA 2DQHH 5T1LA 5FYLH 4G6KH 4MDIA 2NY0B 4HPYH 5C6WH 4U7KA 5I1HL 3P30H 3DBXB 4E9LA 2FZ3B 1OW0A 1IKFL 3L6FB 1FYTA 5KW9L 2CUIA 5A3IC 1GAFH 2H26B 3LKSA 4XBGA 4F80A 5FUZH 2QQNH 3HUJB 2V2TA 5T1LB 2CLVA 4AM0A 2NTFA 4MDIB 3U30B 2NY4D 4MA8L 4FQIL 1I3RA 5L2JA 5C9KA 4QTHA 4HBCH 1V3JA 1B4RA 1FYTB 4NC2B 4MS8D 1N7MH 5CIPH 1YEKH 4D3CL 4R26L 3LKSB 4XBGB 2OK0L 3OKDA 4AL8H 4GW1A 1F8TL 2V2TB 2VLJB 4AM0B 2NTFB 1F6LL 4DFHA 4PRPE 1I3RB 5L2JB 4MA1B 4QTHB 5E9DD 3JUZA 4U6XA 3O3DA 1QFPA 5DA4A 1Q0YH 4DUVA 5DHXB 1J0YA 3OKDB 4MX7A 3SDAB 3MLXH 3NPZB 4GW1B 4UTBH 5CILL 4NC0B 25C8L 1E27B 1G7QA 4KVCL 2E6PA 3O3BA 3O8XC 3WDJA 2WP3T 4U6XB 1RZJC 4M5ZL 3O3DB 2CKBH 3RJDA 4PRIE 1X5ZA 1G6RA 1MIEH 4MX7B 4GQ9L 4N1CA 1PDKA 4DEPB 2WBJC 1G7QB 4MHHI 4NN6C 3O3BB 4LASL 3MLWL 2HLFD 2WNGA 2X4RA 3D18A 3J8F7 4G7YL 1G6RB 1O5DT 3MODL 4OF8A 4IEFB 4YC2B 3O6ML 5IMLA 4KKLD 3FQXA 1NFDF 4YHKH 5TDOA 5HHMB 1RZJH 1ZE3C 5JW5A 3LPFA 4JY5H 4MCYA 1U93A 2HT2D 3D18B 1V5JA 1CXFA 3FAXA 4TTGA 3HZKA 1WAAE 1S78C 1PZ5B 1CICD 5T3XL 3FQXB 3H0TA 1Q72H 1CGTA 1YMME 5TDOB 2BMKB 1FL6A 4I0PA 5D7LA 5JW5B 4CMMA 4MCYB 1U93B 1J0KA 4MA7H 1D6VH 3WLWD 5C70A 3HZKB 2BZDA 4YDIL 5JQ6H 3QZWA 1GOGA 3H0TB 4Z7QE 2EC8A 2EO1A 3GBMH 5D7LB 3UTTD 5JOPD 4MXVF 4CMMB 2ZCLH 3NVQA 4R8WH 2E8YA 3PDDA 1T66C 1E6OH 1Q38A 3VD4A 3LRSA 4NQVB 1DN2A 5I18H 4MHHG 2Q3AA 1OARL 1YC8A 3QZWB 4HK3N 3VMNA 5E2VH 4P59L 3KJ6L 4HBQA 3K4AA 3KPSD 5F96H 4FFYH 5DZLA 1HWHB 3IU4L 4ODSH 2FDBP 2GEEA 4D9QE 4ZOBA 4EXKA 1AD9A 2CDEA 5I1DA 1L6ZA 3V2AR 4GAJH 2FLRT 1MNUL 3LRSB 4UNTA 1OAKH 2EDXA 1QP1A 1KCSL 2GFBB 1SQ2N 3ISWA 1KGCE 5DWUL 1XR9A 1KJ2L 2CDEB 2WK2A 5GS2D 5I8CA 4Y4KB 2IQAA 1EVTC 5KSAC 3ULVL 5E99H 4HF5H 4HH9A 5BRZE 5MEOA 5IB4A 3V8OA 3KR3L 4R4FL 1R3HA 1XR9B 2FBOJ 2ZSWA 5I8CB 2IQAB 2F5BL 2OXHA 3KPRE 4HH9B 4LCYA 5MEOB 4I5BA 5EC1A 5IB4B 2D31A 1ACYL 5F6HJ 3B6SA 1R3HB 4YK4C 3EYSH 2EE6A 1K8IA 4APQD 5D1ZC 1LHZA 3PWJA 1W72L 2DBLL 4WEUD 5J06A 2J4WL 4LCYB 3BZDA 4I5BB 5EC1B 5KS9A 4X5LA 2D31B 4XI5C 2H32A 3DETC 3BMWA 3D3VD 3ARBD 3B6SB 5GPRA 4B7LA 3P40A 4LSTH 3G04B 4PLKC 1M7XA 3HR5A 4GXVH 1HH6A 1OAXH 1BIHA 1K8IB 3VA6A 5DD6A 1CQKA 5T3ZE 3GMPA 5EU6D 4UT6L 5ACLA 2IFFH 3MCLL 4KDWA 3LCYA 4B0MM 3BJLA 2YWYA 2H32B 1N6QH 3VGEA 1N8ZA 3O6LL 3HR5B 5F93C 5LWYL 2D4FA 2Q7NA 1XEDA 5CINL 1HH6B 1KCRH 5DD6B 3GMPB 2P5EA 3MNVA 4LAQL 3HNVH 4DZBA 1QBML 1OY3B 4WI4A 5BO1L 4NBZB 5IVXA 1NEUA 1LO2H 4LFHG 3EO9H 5TE4H 5J3HC 3QXUA 2F58L 3LKQA 3GKWL 4QRPE 5C86A 1LO4L 3BKML 3DPBA 1P4BL 1AHWC 3MNVB 2P5EB 1RIHH 3K46A 4DZBB 3O0RL 1RUPH 3RI5K 4F9PA 4X6EA 3V0WL 5C0EA 5DTFB 3RVTC 5IVXB 3TWCH 5C0ND 3VGAC 4M1DL 3LKQB 4YHLH 4Q6IC 3B8YA 4E41A 5I71C 3BZFA 2VLLA 2JF1A 4R4NC 5D70L 3UTPD 2YPLA 5DJYA 2WUCL 4H26A 4X6EB 5C0EB 4JR9L 1RQ5A 5E56A 5K9KA 3RA7L 4MJ5A 4M7KL 4MZ3A 4C56A 3ZDXF 3EKCA 2YD6A 5E2JA 1ZANH 4E41B 3MLZL 1PEZA 2VLLB 4RGOH 3JWOL 1TJHH 4DW2H 5DJYB 4H26B 1ZLVK 1OCWL 2EDFA 5K9KB 1MREL 4YBLC 2P42B 4KK5C 5JPMA 5I8KH 4C56B 3U4BH 3GGWA 1J05A 2DS4A 2YK1L 4S1RH 2CDGA 3DSFH 2G5RA 2YMXL 4ZTPL 5C09A 3QEQA 1WWAX 1X5KA 1IM9B 3ZKMD 5GRJL 4N8CH 5L2KD 4U6VL 3BWUC 1J05B 2Y36L 3HUJE 2Y07L 2I9LA 3TP4A 3E3QC 3M45A 3HI1B 1RFDH 5EWIL 3FQNB 3MBEA 3QEQB 2AK1L 4K55A 4Y2DD 3GI8H 1FO0A 1RURH 3GMRA 3KS0H 2GI7A 1UKQA 2IBZX 3DECA 3MPCA 3MLYH 3QQNA 5IHUH 5DRXA 2HP4A 2I9LB 2A6DA 1MFCH 1V7NL 5TF0A 4P2RA 5TFSL 3X13A 2FEDC 2XKUA 3TV3H 5E03A 3MBEB 5M7QA 2P47B 3NCYP 3HR6A 3PDGA 4S1SL 1FO0B 3F8UB 2YZ8A 4HC1L 3GMRB 4NBYB 4JQIH 5DRXB 3FCTA 2B1AL 3KS0J 4CVUA 2A6DB 3RZCA 4P2RB 3X13B 1FC1A 2OXGA 4XNUH 5KVGH 1HK6A 1BQHA 5GJSL 3FTGA 5EUOA 3ZT6A 2J5LC 1XGTA 1OW0C 4ACPA 2AQ2A 3TN0D 3QO1B 3FCTB 1YY9C 4XH2A 3V52H 4YWGL 1XFPA 3RZCB 1WEJH 1JWSA 2A9MH 2R0KH 4OIAA 5JW4Q 3LS4L 1BQHB 5T1DH 3FTGB 5E08L 5EUOB 4GMSH 1XGTB 4KTDL 4LSPL 4GKZA 1UWEL 1A7QH 3FRPG 1MIML 4XH2B 3MROB 1V8HA 4PTUA 3SO5A 1JWSB 3GNML 3T04D 3SDAC 2Q8AH 4JFHD 2EEDA 1AE6H 4TQEH 4UBDD 2NY7L 4OZFB 4H1LG 4GKZB 2VLMD 3LKOB 5ALBL 5F6IB 2Z8VC 4JO4L 1RK0A 4PTUB 2Y25A 1U8JA 1AGBA 4Q7DA 1I9JL 3C6LD 2VDNH 5C0BA 3MXWL 1Z0NA 4M62H 5LXGH 2NXZD 4YX2L 1RK0B 5DMYA 2PO6A 4YC2C 4HKXA 5F7DA 1AGBB 1Q1JH 4M6NL 5C0BB 3MV8D 4NWUH 4LCCA 1B3JA 1MCHA 4M9OA 1KG0A 3RX5A 1GHFH 3BEWA 3M1BA 1JE6A 2PO6B 1KFAL 2JE8A 4HKXB 5F7DB 4PJ9C 3A0OA 3ZDZF 5LQBL 5DMKA 5DQ9A 1T03L 3HPLA 3L3GA 4FNLL 3DHJA 3PWPA 5C0CD 4PUBL 5I16A 2F53A 4OLZL 3BEWB 1MELA 2AJVL 3M1BB 3C08L 4KRPB 3O9WA 3SKMA 2QSVA 3UPAA 4HW6A 5DMKB 5DQ9B 4L4VA 4NZTH 3HPLB 3I3DA 3L3GB 2VB5A 4PGJA 4KKCC 2E6QA 3PWPB 1OB1A 2RIKA 5TQ2L 5I16B 2F53B 1BOYA 3ME0A 5E8DH 5C2BH 3IFNH 2PKDA 3WNOA 3O9WB 4HIHA 3SKMB 3WHE1 1JHKH 4L4VB 3UYRL 4YE4H 4OLYL 1XIWC 2ZPKL 2B20A 4N0FA 1EVUA 1OB1B 4NO0A 4MYWB 1ZEAH 2YA2A 5L88H 4J2XA 4LLYA 3TM6A 4H20L 2X40A 4KI1A 5FV2A 3UYPA 1UEMA 4Q0XH 4YQXH 3C60C 3TBYA 5EU3A 3AMLA 3FQUA 4OIIL 2P8MA 3QJFB 5F1IA 2Z93B 4YHYB 4NO0B 4U1IA 3PP3H 4ENED 4OSUH 1JNLL 1Z2KA 2W92A 5E6IC 1XGUB 5IW6A 1MFBL 3WHXA 4Y4KC 5EU3B 2BVYA 1R5IB 3FQUB 2QQLL 3IDJA 2BC4A 5F1IB 5IFHH 4U1IB 5E7FA 3BN9C 5IW6B 3AY4A 1WTLA 3IGAA 4NP4H 3RY6A 1MRDH 5KS9E 1CLYH 3LIZH 4OCYH 4RQQA 3IDJB 5KSBE 2BC4B 1P7QD 1CGUA 2HTKC 1U8LA 1DEEB 4HGWA 3MV01 3V5DA 3CPLA 4HJ0C 4GG6A 4KK6C 2HJFA 4CNIA 1IGCH 3BZ4A 5MEQA 4L4TD 1FNEB 3TH4T 3RNQA 2ADGA 2RJMA 5H37G 4RQQB 3BKYH 5F6HI 1XH3A 1BJ8A 4HGWB 3V5DB 4F7PA 5E2TL 3CPLB 4MD4A 2WWKO 4YDJA 3QPQC 4GG6B 1J5OH 1SJVA 2HJFB 1Q9KA 4D2NA 2VUOA 4CNIB 3BZ4B 4XP6L 5MEQB 1VGEH 3RNQB 2ADGB 4LF3A 1JHLH 1YNTA 3VRIA 3DO3A 2MQ0A 4F7PB 2I5YH 2QADC 4YDJB 4XC1L 1P7KA 1EIBA 1FBIL 2LAAA 2FH6A 6CGTA 5E4IA 1KXTB 5E94A 3RX7A 2IPUG 3S3JA 1YNTB 3VRIB 3EUUA 4LK4A 4MJ6A 4NQCD 4Z95H 1P7KB 1Q9WA 2YPLE 4NNYA 4ODHL 2XOTA 2VO5A 3G6JE 5E94B 3O3AA 3BAEL 1IQWH 4K94L 1H15B 1ZLSH 4Z7NE 4MJ6B 5K9JL 2H32H 4QHMA 3CDFA 4H1LA 2X4PA 3NFSH 1MJ7H 1Q9WB 3LV3A 2R2HB 4Q9QL 1U3HA 2VDKL 1MEXL 3O3AB 3P11H 3JV6A 1CL7L 2VN7A 2CH8A 3GSNL 3O3UN 1IT9H 3NAAL 3SDXE 5CLWA 1EH9A 1XR8A 4CU7A 2AKRB 2NY3D 3LV3B 1UH2A 5C09E 5DC9B 1U3HB 4JPWL 1NFDA 5IGXH 2N7BA 3JV6B 3UDWA 3W2DH 3D85A 1CR9H 2UZYB 1CBVH 3CVIL 4HWNA 5L7XL 12E8H 4LSQH 1XR8B 2BNUA 1KELL 4PB0H 2XWJA 2HJLB 1RIUL 2OR8A 1NFDB 4X9HA 3DNKA 3V5HA 1SY6L 1TLKA 5ISZA 4MB4A 2EYSA 3C09C 3HNSL 4L8BA 5BMFH 1AKJD 2CUHA 3DURA 2BNUB 1DQJA 2K9UA 4I3SH 2XWJB 4YBQC 3T3PF 1GOHA 2FJFA 3V5HB 5ISZB 5HSFA 5E5UB 4LIQE 1NCNA 4OLXL 3QG7H 2EYSB 3VXRD 1EV2E 1F4YH 2VERN 4L8BB 3DURB 2VXQL 1KNOA 1BP3B 1UM4L 2CPCA 5JHLL 1FGNL 2FJFB 2BVPA 1HSAB 2E27H 3GJFK 4K3EL 5DURD 1C1EL 1F4AA 4LGPB 4UIMA 1EHNA 3BKJL 3PV6B 3GHBL 1KNOB 4P46A 3LEXB 5L8LB 1Z5LB 4TUJB 4YXKH 3ARFC 4CVXA 2BVPB 3RVWC 1D5MA 5FCUH 3WSQH 1A3RH 4UIMB 1J1PH 2AQ1A 3F65A 1OSPH 4YHOL 3K0WA 4ZPVA 3BIAX 4NQTA 1HINL 3JTTA 3VI3E 4C55A 4CVXB 1T20A 4EIZC 2E8ZA 5DK2A 1D5MB 4PJAF 1HSBA 4U33A 2CMRH 3OKOA 1BVKA 4ZPVB 1QSFD 5IW3A 5IW1B 5C0BE 2VXSH 4JREB 4WWID 3JTTB 2F54D 2XFXA 3V0VA 1BD2E 1T20B 4EBQL 4P2QA 4JO3L 1HSBB 4P23C 4WW2B 1IZKA 2A38A 3OKOB 2EIZB 5F6IC 1BVKB 2WBWB 1D6EA 4JKPL 4QXGH 4OD1H 3TT3L 1NGWA 3V0VB 5J8OA 1EAPB 3C5ZC 3ULUF 2FGWH 3F7PC 4P2QB 4RMSA 3QUMH 3BPLC 3H9SD 4PFEA 3TPKA 1JJUA 1CXLA 4M7LT 1KEMH 4K2UL 3RVXD 4I2XA 5BXFA 5JIKA 3PWPE 5C6TH 1WBXA 1L0YA 5D6CA 3C2AH 4GS7C 2VMFA 4P2OC 43CAA 5DJ2B 4D9LH 4NPYA 3CXDL 1OM3L 3DGGB 3OPZL 4FG6D 4OZFH 3BDXA 1JYWA 2A77H 3VGDA 3ARGA 2PO6C 4I2XB 2F8VA 2WWMD 43CAB 3HLAA 5DJCA 1NBVH 2XA3A 1GGBL 2EXWD 1H3GA 5T1KA 3F58H 3CSGA 4LPTA 4N0UE 4U1SB 2DM4A 3RRQA 4H88H 3ARGB 4KRPC 1GGCH 2GQHA 1HYSD 1NGZA 3HMXH 5DJCB 1I3UA 4ZS6C 2W38A 1QUNA 4FQ1H 3U9PL 3LN4A 3QDMA 4Y5YA 1DDHB 3SDCB 3RVVD 5T1KB 5FO7A 2CR3A 2J8OA 5JW4R 3I6LE 2AJYH 1NGZB 4BSJA 4PJFF 2VZ3A 1HN1A 1KC5H 1KTLA 5I19H 2R9HD 3LN4B 3QDMB 4Y5YB 4MXWL 1U9KA 4XWOC 3SJVE 3ZYIA 5FO7B 3RDTC 1QTYT 3UTSB 3EOTL 4ZUWA 1JTOA 4Z8FL 5LKNA 2FX8L 2KZWA 3HI5L 3PL6B 4XCFL 1P9MC 5DF0A 2LU4A 2EDOA 3ARDD 1IC7L 1KV3A 1TVBA 4ZUWB 5LVEA 3SE4C 4JM2D 2ZOKA 2WAHA 4LMQI 5D6DA 4ERSL 1PG7H 4G7VL 3DROA 1C5BH 5SWZA 5FB8B 4HMDA 2ZNXA 2CRZA 1MHHA 3QPXH 2APXA 2P5WE 5HYQA 1QSVA 1D5IH 1FAIL 5ICYA 3T2OA 3TZVB 4G8EA 1QFWH 2ZOKB 4UV4L 4Q9RH 3TFKD 4XMPL 5DJXA 4LVHC 3B9KD 3DROB 3NCCB 1R0AH 4OUOA 3N1QC 2VJXA 3DVGB 4NT6A 3KPNA 5HYJD 1MHHB 2NMSA 5HYQB 5KZCD 5ICYB 1MFEL 4WHDA 4UNUA 2L7UA 3S6CA 4AMKH 3X3FH 2YR3A 4WFFD 3RTQD 1I85C 4MAYA 4X7CC 1D7FA 3W39B 4NT6B 1NFKA 4HWEL 3KPNB 5AZ2H 5GRWA 1Z3GL 4NBXB 2X5PA 4U1JA 4PRHD 2VLKA 3IRPX 1KN4H 3HE7A 3U2SA 2M2DA 1CGXA 5BZWB 2HWZL 4MAYB 4MB5A 1KEGH 1YN7A 4N5UA 2EH8L 3QI9C 2D0HA 3CMOL 3P4MA 4F37F 5JOFA 1U41A 4U1JB 4S1DD 3FO9A 4YHML 2VLKB 2DMBA 4UQ2A 1AFVL 4OLWL 1XCQA 4WY7H 3HE7B 3U2SB 2ADIA 4P3CH 1V05A 5T3ZL 5I1EL 3BO8A 1I7RA 4F33A 3P4MB 3KWWA 4PR5A 3SGEI 3FO9B 2ILLA 4G9FD 4HIEA 1N2RA 1R3IH 2J3SA 1GH7A 1Q8MA 5GSVA 4JVWA 1XCQB 2D7TL 2HRPH 2ADIB 2VXTL 3MQIA 2AXJA 4HXBH 1TDQA 3BO8B 1I7RB 3EYQC 3B3IA 4F33B 3S34L 4A6YA 3KWWB 4PR5B 5ELIA 1T6WA 5IJKA 3FB8B 5HGHB 4NO2A 2BVQA 3D9AH 3FO0H 4FQ2L 4WO4A 1F3JA 1N2RB 1P4IH 1U58A 3QFJD 5GSVB 4OFDA 3SN6N 3ZKQD 5GZOD 1EDQA 1KCUH 4LCWA 3SOBH 3QDGD 4XPTH 1ZSDA 4NO2B 1QHOA 2BVQB 3FJTA 1NGPH 4WO4B 1OAYH 2IF7A 1F3JB 2VDOH 4ORZC 1U58B 1OTUD 2JJWA 1S5IH 2BX5A 3QDJD 3C87A 5FYKH 2AI0L 3T0DA 4LCWB 4L1HA 2M26A 4PB9L 4XVUD 5I30H 1FYHB 3RUGF 5F7EL 3K7UA 1MCPL 1ZSDB 1MCLA 1DCLA 5DUBA 3TA3D 3BVNA 3QIWA 3H42L 2VE6A 3CDGB 4LLWA 2YD2A 4BQ6A 4MXVE 1MI5D 3SE3A 4PGCA 4E42A 3UDWC 5A40E 4BQCA 4FQHA 3BD5A 5DUBB 5E8NA 3BVNB 3QIWB 2VE6B 4TSAL 4LLWB 5IESL 4E42B 5A2LH 2F8XC 4ONGH 4JFED 4HS3A 4HK0A 3CFEA 4GRWH 3RHWK 4FQHB 1NMBH 1U92B 1NUNB 5E8NB 1CDCA 4MDJB 3L7EA 3OZ9L 5L0QB 3JZ7A 1ZLUH 4E5XB 2ICEB 3CFCL 2Q8BH 4BYHA 1K3IA 4U6YB 4HS3B 4HK0B 3CFEB 3QH3A 3W11D 1KBGL 4ZFFA 1KPVA 1BFSA 4ODUB 1PFCA 3VFPA 3L7EB 5F7UA 4PJ7E 1CGYA 1Q94A 4HQQL 5A2JH 4UINL 5HHOA 2BCKA 1MCOH 3QH3B 1MY7A 3F6LA 2OTWA 1KPVB 3S36L 3VFPB 1MQKL 1K5NA 4QXWA 3VG0L 4OI9A 4TULH 1A4JB 2Y06L 4GSDH 3KPMB 3S98A 5HHOB 2BCKB 2CDFA 3V6OA 3GKZA 2D2OA 4NRZA 4TPRH 2OTWB 2E7MA 4P3DA 1K5NB 2GY7B 3MZGB 4WTWA 4JREC 4TSCH 1I9EA 2J7LA 4UOW1 3VGHA 4PY8I 4QY8A 1LP9F 2Q87A 4YDLC 3ZT5A 2CDFB 4WW2C 3RFZC 4NRZB 1WWCA 3NGBB 5EBWA 4P3DB 3OB0H 2WQRA 5F9WB 1DBBH 5FGBA 1ADQH 4KHTH 4QY8B 5KJRH 3U4AA 4UT9L 5JR1H 2V5YA 5EBWB 3WNMA 2HTLC 3Q0HA 5FECA 2YD8A 2QTEA 3AS1A 5EZOL 1ZHKB 4EI5D 1EHLL 3PWUB 4RDQG 3QEGL 5MENA 2XN9E 5CD3A 1I1RA 3GBLA 1OQXA 3NCYS 3BT2H 1XGPA 5GGTL 3QRFM 2DRUA 5FECB 4XMLL 5D71L 3C8DA 6FABL 3VXUE 1JRHL 1UFUA 2AJSH 2IPKA 4P4KB 3JV5A 5MENB 4F57H 5CD3B 1UJTA 1H3PL 3HC0A 3V9FA 1XGPB 2LQRA 4S11A 1NC2A 1DVFD 5JW3L 3ARGC 4I77H 5HDQL 1FNSL 1RJZA 2GTWA 1DLFL 2JIXD 2IPKB 2DM2A 1JZ2A 5KANI 3JVGA 3SDCC 2EDKA 3HC0B 2HMIC 3VMOA 1U36A 4PJEF 5IOPA 1PLGH 4JHAL 2BY3A 1RUAL 3BZEA 2R0WH 3MXVL 3ZTNL 3GUTA 1RJZB 2GTWB 4NIKB 4IOFC 5L9DH 3T0EA 3LKNA 1NFIA 4XNYL 2R1YA 1FLTX 5SWZE 5IOPB 4JG1L 3BZEB 5BS0B 4JFFD 4HWUA 2FJHA 5J56B 3GUTB 3PL6C 1A0QH 3HG1A 3T0EB 3LOWA 1UA6H 3UZVB 2GJZA 3ULSA 1OGAE 5HGDA 5JUEL 3LKNB 1NFIB 5EB9A 5TDPA 5ID0A 2R1YB 5DZNA 2MFNA 5AG9A 1YEGL 4W4NA 2J6EH 1RZGA 1KJMA 5DUPH 4DFIA 2FJHB 2ERJC 1C5DA 1SEQL 1ZS8A 2GJZB 1F02I 1CGSL 1CXIA 5TDPB 4FFVC 5ID0B 4NC1C 5K33A 2JLLA 3TZVC 4FABH 43C9A 1CDUA 1B0WA 1RZGB 1MPAH 3ES6B 2R2CA 1C5DB 3MBXL 1HYRC 4OD3H 1MUJB 3QHFH 1ZS8B 3N9GH 5IM7A 1LO0H 5KANG 4NJ9H 4YPGA 3GK8L 3K74B 5J11C 2DL9A 4MNGA 4POZC 1F5WA 1BGXL 4HJJL 1KCVL 4OZFG 43C9B 1XAUA 4GKNA 4Z9KB 1CG9A 5IM7B 4F8QA 4L8CB 5GRUL 4YPGB 5L8JB 2JJTC 2BDNL 4J7RA 4NHUA 4MNGB 2AK4B 4LSSH 4NOBA 4KJQD 1EXUA 5FYLD 1FNLA 3HA0A 1EFXA 1MAML 1WSST 2AJXH 2FX7L 1JCKA 1QFWI 4JGMA 1AY1H 4TVPD 4ZG1A 1JNNL 3SDDA 4Q9CA 1Z6JT 1R3KA 1BX2A 4HS8L 1CWVA 4JQVC 5D2LE 5CGMA 5E6YA 2H2PD 1C8PA 1EXUB 1R5WA 2VQ1A 4TYUA 1EFXB 3ULVF 2EDBA 3PHQA 4PJAA 3TJHC 3SDDB 4F7TB 1R3KB 1BX2B 2A0LC 3MRFB 5HGGS 5B38A 1N3NA 5D7IE 1R5WB 1CK0L 4JFDD 2NW3A 2VQ1B 5DHVA 1MFDH 1AC6A 5IB1A 4YNYA 4NQDA 1IAMA 3PHQB 2VZ1A 1L7TH 2BNRB 1YECH 1QR4A 5B38B 3LPWA 1N3NB 1J8HD 1UC6A 1D5XA 4HXAH 3L3IA 2JJUA 4KY1H 2NW3B 5DHVB 1JF1A 2F5AH 2ADFH 2GCYB 5EO1A 3FT4A 1FL5A 5IB1B 5LGKA 4YNYB 4NQDB 3OKYA 5IJKC 5C0RH 1YEJL 1FCGA 1D5XB 4IOIA 3L3IB 1YMHB 1A6UH 4KKAC 4WO4C 5DR5H 1JF1B 1QOKA 3IJYA 2OL3A 2VLRE 5C0AD 5EO1B 3FT4B 1FL5B 3RZWA 1QRNE 1J88A 4EDWH 1G7LB 3DHMA 4PRBA 1EEQA 4PV9B 4IOIB 1CXEA 3VXMA 3IJYB 1IEHA 1DQDL 2UV3A 5F1SA 2ZUTA 3GRWL 5DRZA 3WUZA 4Q97A 3QDAA 4G6MH 2FO1A 4N5EC 5EPMA 4ONFL 3QB7C 4PRBB 3H3KA 4IDJL 3IAPA 3QIWC 2WBJD 2MPAL 4X6CE 4MJ2A 4LVOB 5DRZB 4WWKD 1T1WA 3SE3C 2YD5A 9CGTA 4OFYD 5EPMB 2UY7A 1BBDL 4ZO6A 5INDA 4URTB 5DEGA 4GMTL 1EBAA 3OF6D 5CJXA 5D7JC 1P69B 3MACL 4XPFL 5L0QC 4PJFA 5HHOE 2ESVA 1T1WB 5HJ3A 3UEZA 2PYED 3AFLA 1B2WL 2IAND 3SQOH 5INDB 4F58L 3BIBX 1TZGL 1UXWA 5F3BA 2AQ3A 1S78D 3E2HB 4UIKH 1FH5H 4PBWD 4AQ1B 5GJTL 4PJFB 2OMNA 2ESVB 4KI5C 5HJ3B 1A7NL 2GK0A 4KWUA 3B9EA 1WTGT 2DIAA 1UXWB 3HNTL 5F3BB 4EI6A 3FQRA 3IT8D 3INUL 1F58H 4RRPA 4Y1AA 1GSMA 3WO4B 5DJDA 5DI8A 4Z77A 1G0DA 2GK0B 1JGVL 4I1NB 3DXAD 3QG6A 5CEXA 4JG0H 1AI1L 1T66D 5AAMA 1FGVL 5JDJA 4U1HA 4EI6B 4O58L 4M7JL 3FQRB 1T3FA 4Y1AB 1WK0A 4MS8C 4FFZH 4NFCA 5DJDB 2PTUA 2YSSA 4DGVL 1EJOL 5DI8B 4Z77B 4DVRL 5KAQF 3EFFA 5M94B 1UH4A 3MV7A 1UCBH 3QG6B 1YMMD 3V6OC 5CEXB 4J6RH 4OLUH 4HHAA 1NLDL 4RMUA 2BNQA 2IQ9H 4U1HB 3VA2C 4U2ZA 1T3FB 3QAZC 4OTXH 3P0GB 5ADOH 1LD9A 1A22B 3EFFB 3S4SA 3MV7B 4YXLH 4RGMB 3IJHA 4HHAB 4BELD 1HHHB 2BNQB 3VG9B 4LHUG 4LMQE 5KSAD 3O2WL 4NGHH 5JHDA 4HIIB 3NCJL 1I3VA 5F21B 1L4IA 2GSGA 4JRXA 3NA9H 3OKKA 4WENB 3S4SB 4L8SC 3WNLA 3IJHB 4B5EA 4KJWD 3GMLA 1QO3A 5EG6C 1TJGH 4UOJA 2ZUUA 2ITDA 4PS4H 2F19H 5GGSA 5FYJE 2GSGB 3O6FA 4JRXB 4OZHE 1U8KA 4P4KC 1CLZL 3FB7A 3GEWB 3BQUD 3OKKB 3CU1A 5MI0C 3WFZA 2V7NA 4ZD3H 3AREA 1QPXA 4WFHD 3CVHA 5D1ZD 2IH3A 4J23A 3GMLB 3WEXA 4L8DA 2HT2C 4JCLA 2ITDB 2Z4QA 5GGSB 3T0EE 3O6FB 3VXTA 3S37X 1U8KB 4ZO7A 4S1QL 4OGYH 4FQXA 3OXRA 3FB7B 5AZEH 5BRZD 4PLKD 3DGCR 4H25B 2V7NB 5HVFB 3CVHB 3U36A 2IH3B 1REIA 5CEYA 1JV5A 4Y8AA 3WEXB 4DKEH 2LVCA 4L8DB 3HG1E 3K4DA 1NDGA 4FTVD 2DKUA 2Z4QB 3N0PB 1VPOL 5I8EA 2O93L 1Z9SA 3U7WH 1RZ7H 4FQXB 3OXRB 2WANA 2GJJA 1HIMH 2AJ3A 4OF7A 1T1ZA 3F7RA 3U36B 1EO7A 5CEYB 1JV5B 3WKNA 1A9EA 1GPOL 1UEYA 4ESKA 4JFXA 2OZ4A 5I8EB 3P9WB 5J3HD 1L9NA 3TNNA 3BXNA 5E8PA 4Y4FD 3RUGA 4OFKA 2AJ3B 1LK2A 1BQLL 5I1AB 4PLJC 1G9MC 1AR1C 1T1ZB 1I3GH 3T3PE 3WDIA 2DQTL 1A9EB 4OFIA 4GW4A 1NUDA 2J8HA 3RVTD 4JFXB 1QYGH 1E0OB 3TNNB 5E8PB 3RUGB 3F7VA 1I8MA 3K81A 1LK2B 5DJZA 5E7BA 2CO7B 3G5XA 1EGJL 1PD6A 2YD9A 4PJ8D 4AY0A 4UUJA 2BOCA 3HC4H 4R4ND 4GW4B 1T5WB 3EJYC 4G6FB 4HCRA 4EN3D 1MF2L 3F7VB 5HD8C 2AEQH 5DJZB 1YZZA 1G9MH 4G6JL 2MCPL 5DUMH 5IEHA 1QBLH 4LLUA 4X5XA 2BOCB 4OFVA 5F88A 1JFQL 4QO1A 5DVKA 5GSRA 3NABL 4YIQA 3HC3L 2D7OA 3QCUL 4AEEA 1RJYA 4KK5D 3DX7A 5DVLA 3QUXA 1IJ9A 1BMGA 4L3EA 1JVKA 3LZFH 2DLFH 5IEHB 3AMKA 1GJIA 5F88B 2XRAH 4LLUB 4X5XB 3C5JB 5GSRB 4YIQB 2ICWA 4PJAE 1RJYB 3DX7B 3VI4F 3SY0B 3FN0L 1WWBX 5HHXL 3QYCA 3X12A 3QUXB 2KBGA 3M8OH 4L3EB 5TF1L 2AV1A 4EZMA 2AW2A 1NAMA 3IFLH 3PNWA 4HZAA 4LSVH 5K9OA 2ZJSL 2ICWB 4X7SL 4LPWA 5JA9A 2R4RH 3X12B 4XVJL 3PXJA 2GJ6E 2AV1B 1DTUA 3MJ9H 3QCTH 5I6XB 1EMTH 4FZ8H 2VDPH 4WUUE 2FEDD 2X6MA 3PNWB 5CP3A 4R97B 5HYFA 5K9OB 2NY0D 3ZE1E 3IKKA 1LP9A 3G6AA 5IQ7H 5DJ0A 3LDBC 1BFVL 1G9NL 2EDNA 3ZTJH 3IDNB 3IAQA 1Q0XH 1CZ8L 1U0QA 2ZWLT 4V2CB 3CC5A 3ESVF 4QXUH 3PF2A 3V95A 3WNKA 4X4XA 3G6AB 5DJ0B 4UILL 4XCCL 3U0TA 4ZMAT 1RZKL 4G5ZH 1FYTD 1DJSA 3VXME 4AEIL 1INDH 2XT1B 4R7NA 3KYMA 5LGHL 5EORH 2VLJD 2XKNA 4WJ5A 2VIRA 3CC5B 3SO3C 4NM8H 4EUPB 3ULUC 3DLQR 4X4XB 4R7DA 3U0TB 3QWRA 4K9EL 2VNCA 5SV4A 2C5DC 3G5YA 4KTEH 5D8JH 4R7NB 3D0LB 3SDAD 3KYMB 4WJ5B 1BM3L 1LK3H 1PEWA 4GLRH 1FFOA 3SKUD 5DD3H 2MOVA 3BSZL 4P9HL 3IS1X 1G1YA 2DQHL 1BEYH 3G5YB 5FYLL 4G6KL 4HPYL 3P30L 3MGOA 4JDVA 3MLSH 2BHUA 4L3CA 5DJ6A 4GAGH 4WHTA 3ULUH 1DBJH 4LKXA 1GAFL 5C08A 5FUZL 3CGTA 2QQNL 1UB5A 3AS0A 3ZKMC 3DVNA 3G9AB 4XCYA 1AGFB 1FQ9C 1OSZA 4PJEA 1E4XI 1RHHA 3MGOB 2O5XH 4HBCL 1ZT4B 4JDVB 3RL2A 2MNUA 5TGBA 5DJ6B 1N7ML 1YEKL 2C1OB 3D69A 2VDQH 4WHTB 4LKXB 5C08B 5HHMD 4XP5H 5ENWA 4LPUA 4AL8L 1UB5B 2W9EH 3DVNB 4XCYB 4Y1AE 4BFIA 1OSZB 1MJ8H 4PJEB 1RHHB 4PJ9D 1SM3H 3H3PH 5CJXC 5IF0A 1JZ8A 3L9RA 3O11A 1U91A 5TGBB 1BQSA 1Q0YL 5ENWB 4YFLI 4NN5C 4UTBL 4HPOH 4QTIH 1AQKH 1DFBH 3BGAA 3EIFA 1PX4A 4BFIB 4WFGD 3IDGA 5IF0B 4ZFOA 2CKBL 3L9RB 1U91B 4KKCD 5GGRY 1YDPA 3MV7E 4ZODA 2IBGA 3HCVA 1MIEL 5D7LD 2RCSH 1RSFA 1U3ZA 1AO7A 2BSED 5L8KB 4CKVX 3B9AA 2HT4C 2R0LL 5I1JH 3IDGB 3TN0C 4ZFOB 4LLAA 2ZUVA 1YDPB 4ZAKA 5FXCH 2V2XA 2OS7A 3HCVB 5IEKA 1GGIH 1AO7B 3GSOA 5IMKA 3CH1A 1AJ7H 1ED3A 3DX9A 3D1MC 5JHDE 3KPOA 4MJ4A 4YHKL 3QNYA 4JRXE 5ITBH 4JY5L 4YGVB 1R3JA 3IDIA 4ZAKB 4HUVA 5ITFA 2V2XB 5IEKB 1U6AH 1K85A 3GSOB 5IMKB 1QFUH 1EPFA 3CH1B 1ED3B 3DX9B 3VG9C 2A2QT 3KPOB 4Y4KD 4PD4J 1Q72L 2Z35A 3QNYB 2QQKH 4L9DA 1A47A 3FZUC 5KSVA 1R3JB 3IDIB 4OAWA 4MA7L 4HUVB 5ITFB 1D6VL 5DO2C 2G60H 2XA8H 3BN9D 3LH2H 4BJLA 3HZYA 1X5IA 5JQ6L 5F1NB 5T1MA 2QSTA 3QXTA 3I85A 2KH2B 1KJ2A 2Z35B 4BKLB 2ORBH 3GBML 2O5ZH 3W5MA 1A02N 2Y72A 4ZPTB 5A2IH 5KSVB 2ZCLL 4OAWB 4R8WL 5EA0H 2R1WA 3RBSA 4D0BB 2FHBA 3MTRA 1I7UA 3HZYB 2AP2A 3PGFL 4KK6D 5JORA 3CNKA 2ZUSA 5T1MB 5I18L 1HXYA 5E2VL 1KJ2B 1BF2A 4H0IA 4X7DC 2YC1A 5F96L 4FFYL 1WZLA 3WS6C 1IILE 4ODSL 2OR9H 3O6FC 2R1WB 5DD5H 4GAJL 4V1DA 2OSLA 3B4NA 5JORB 2PYFA 4L4JA 1HXYB 1OAKL 1JZ4A 5JXEA 1HNGA 4JFQA 3VGGA 4HLZG 2YC1B 4OZGF 1W72A 4YHPB 1ACZA 3OAZK 1X6NA 1YEFH 1YEHL 4FQXC 3QIUA 1IARB 4V1DB 2OSLB 4JY6A 2PYFB 5E99L 2BHZA 3MCG1 4HF5L 1HQ4A 4JFQB 1SBSH 4ZXBA 3OXSA 1Q9LA 1DL7H 5T5NF 1BPVA 1DZBA 3BPCA 5FOBA 3DUHA 1HOCA 2YXFA 1MCWW 3QIUB 2LV4A 4JY6B 4YHZL 1PVHA 1HQ4B 1S7XB 1MCRA 2P24A 3BKCL 3CVHH 2P5ED 3B8SA 1Q9LB 5FHAH 5EFIA 3IJSA 3BPCB 3EYSL 1HOCB 2K3TA 1T7YA 4DTGH 4K23H 3HMWH 1W2KT 1O0VA 4K71B 3DMMA 5ACZA 5CZVH 3PP3K 3PQYA 3O4LE 2P24B 4JDZA 4NOFA 4OCLC 2UVEA 5D1XA 4OCWH 4LSTL 3IJSB 3QT2A 4GXVL 1OAXL 2CKNA 1DLHB 4L3EE 3H3BC 1WAAF 3DMMB 5ACZB 3RWDA 3VW3H 1FG2A 4E41D 3PQYB 4H0HB 2BJMH 4PGDB 2WINB 5FM8A 4JDZB 4G43A 1N6QL 3HS0A 5D1XB 2VDRH 3FFCA 1OPGH 1KCRL 3HI6H 3CLEH 3FAWA 3MRIA 4C56D 3OGCA 4M93B 3HNVL 3EZJB 3MLRH 3RWDB 3ZKSD 1FG2B 3JV0A 1F2QA 1NLBH 4P5KA 3R0MA 1LO2L 3B83A 3OJ2C 4G43B 3EO9L 2XIDA 5B22A 5TE4L 2XZAH 3HS0B 3QWQB 3WFDH 4LPYA 1IM9D 3FFCB 5GRZA 5IVNA 4G8IA 3MRIB 3VU2A 3QUXC 1RIHL 2GSIA 1RUPL 3GMQA 4XVTH 4OQTL 2FYYA 4P5KB 5EOTA 1EO8H 1N6UA 1NC4A 1LP9E 4YBQD 2A6JA 3TEUA 4YHLL 4FP8H 3QEQD 2P7TA 3LEYH 3BX7C 4HCRH 4X7FC 3ILPA 4KDTA 2PN5A 4ZOAA 2IMNA 3NH7H 5FYKE 3MLTA 2MJWA 4F15B 2GSIB 3GMQB 1WIPA 2FYYB 3L3KA 2K7QA 5I6XC 2X70A 1NC4B 2X05A 1G7JA 2A6JB 2VDMH 3VXSE 3TNMA 3LD8C 4OKDA 3G6DH 2P7TB 3GMMB 1EEUA 1OOAA 1ZANL 3ILPB 4GO6B 3S97C 5F7WC 1PQZA 2NXYB 2BY2A 3MLTB 4RGOL 1TJHL 4DW2L 3GM0A 3MUGB 4QRUA 5GS1C 3V4UH 2VKWA 5GHWH 3L3KB 4P2RD 5I8KL 1G7JB 3TNMB 3U4BL 4FQPA 4IIQA 3T0XA 1FN4A 5BZDA 1PQZB 1S9XB 1KLGA 4HC1A 2RFXA 3MYZA 4UQ3A 4S1RL 4XP4H 3DSFL 3KYOA 1MAKA 1ZOXA 4QRUB 2HFTA 2PETA 3KJ4B 4PG2C 3RZCD 3GM8A 4M48H 4N8CL 4OZ4A 2BVOA 1QSZA 1L9MA 2JB6B 4IIQB 4MLIA 1FN4B 5I66A 2DQIH 5BZDB 1RPQA 1KLGB 4UQ3B 5C8JA 3KYOB 1RFDL 5LBSH 1SJEA 5HHVH 3AB0C 3GI8L 4OZ4B 1RURL 2BVOB 4RAUA 3MLYL 5IHUL 1J11A 5I66B 1F42A 1WF5A 3VXNA 1MFCL 2D0GA 5C8JB 1FORH 3TV3L 1SJEB 1TQCC 4ZTOH 1P84J 1HI6A 5C0FA 3ZLQC 4U1LA 5KTEH 4U1MA 4GRLA 2BHYA 4JQIL 3I6KA 4RAUB 5EN2A 1OGTA 2DQGH 4EUPH 3VXNB 5B21A 4FN0A 1ZA3A 4GH7B 5TE6H 2UZXB 4XNUL 3ZKXB 5KVGL 1QEWA 3CDCA 5C0FB 1HI6B 2IAMA 1KULA 4TUOA 4U1LB 4U1MB 4GRLB 3U0WH 2APTA 1V7MH 2R15A 4P2OD 5EN2B 5C0BD 4G8GA 2UWEE 3BMVA 4MA8H 5FDWA 4GLRI 1LVEA 3SCMA 1WEJL 2A9ML 2R0KL 3T65A 3OKMA 5CD5C 4YUEH 1QEWB 5T1DL 2PO6D 4KROB 4TUOB 4UV7H 4C4KT 1A7QL 2NZ9C 3JWDC 5FDWB 4CJ0A 3SCMB 3TVMB 1G7HA 1KLFA 3T65B 3D0VA 3OKMB 2Q8AL 1AE6L 4KRPD 2GW5A 4TQEL 3ZTJG 3QXVA 5I15H 5SWQB 2NX5E 2IPTH 4ZS6D 4UAOC 1T0MA 1T7WA 3GDBA 4WCYH 4LQ1A 1BZ7B 2ARWA 2F53D 4Y8DC 1G7HB 5I0ZA 2VDNL 4JHBA 3SHSA 3O9WD 3O41A 3WUWG 3LHPH 4MJIA 1EX0A 1TZIA 2XTJB 4M62L 4L4VD 5LXGL 1NAKH 2GIYA 1FIEA 4LLQA 1T0MB 3O3EA 2EDYA 3JWDH 4XWOD 2UZIH 4Y5XA 2ZCHH 3RIFF 4ZSOE 1Q1JL 4NO3A 4X4ZA 5SWSE 1BLNA 5DFWH 3IDXH 1JZ5A 3O41B 2O61A 4NWUL 4MJIB 1TZIB 3DRQA 3MODH 2H3NA 4NNPL 1GHFL 2X7LA 4X6DF 4U31A 4LLQB 5A43C 4ZAKC 3O3EB 3IYLW 4Y5XB 3LMJH 4PRDA 3K80A 3NPSB 3ULVE 1CU4H 2O61B 1OHQA 2H3NB 4R0LA 2RHEA 2X7LB 4DQOH 2OJEA 5EIVA 3NCMA 1K4DB 3T0AA 1JPSH 4NUGH 3S35X 4PRDB 2C26A 4O02H 4NZTL 3V7AE 5HDBF 3S36X 4Q58C 3KLSA 3EDJA 3QULA 2DDQH 1T0NA 4R0LB 3OWEA 5E8DL 5C2BL 2OJEB 3RVXC 3IFNL 5A2KH 5KVEH 2NQCA 2KDGA 5D2NE 4J1UA 1H3XA 4HEME 5FM5M 2HJKA 1JHKL 2QJDA 4RFEA 4CN4A 3ZE2F 4YE4L 3CSYA 2QKIB 3QULB 2HKFH 1YNKH 5L88L 4P48A 4J1UB 2R69H 3QRGH 4XNMB 5I1GH 4KKNA 1A6AA 4Q0XL 4YQXL 4RGNB 2HJKB 3KJ6H 1F3DH 4C58B 4M9PA 4RFEB 4WV1A 3CSYB 1BOGA 2Y9RT 1CICA 1OAZH 4EXPX 1IGJA 3KPLA 2BVTA 4OSUL 1M71A 5C0IA 3A6CH 4HG4K 4CW1A 4R9HA 1A6AB 2PUQT 3PJSB 4MNHA 4RCAA 4WV1B 1BOGB 2D7NA 4OJFH 5DFVC 4ZQKA 2H6PA 1MWAB 4TNWF 5IFHL 2VXVH 1F3DJ 1IGJB 1JI2A 1G7IA 3KPLB 2PNDA 4Y19E 5GIRA 3T0WA 5C0IB 5I17A 3ZZ1A 2BK8A 1WFOA 4NP4L 3WS3A 3QIUC 4MNHB 3PQYE 1MRDL 2ID5A 1CLYL 3LIZL 4OCYL 2DIJA 4ZQKB 2H6PB 3HAEH 4IRJA 1G7IB 1BVZA 4U1GB 5GIRB 1JWMA 2ZSVA 3S88L 4I9WD 1HNFA 5J89A 2V17H 1QACA 3EYQD 3F5WA 1S7WA 1IGCL 3WS3B 1JUFA 3QA3B 4NQSA 5CUSH 1ACYH 3C2SA 1MFAH 4JRYA 4KMQA 3BKYL 4IRJB 1J0ZA 1MCNA 3BISA 2WW8A 1JWMB 2ZSVB 4D0CA 1BREA 4JM2C 5J12C 1J5OL 1GOFA 3F5WB 3F7QA 5CWSB 1JUFB 1VGEL 4NQSB 4K07A 1P4LA 3DMMC 1ZVHA 5ICZA 2YOCA 3PUCA 1JHLL 4JRYB 5GRVK 4EEEA 1U3HD 2I5YL 2VZOA 4D0CB 4X83A 1NSNH 1JMXA 1X5YA 5DYOA 5GGVY 4PJXA 3TFKC 3FOLA 4DWHA 3B9KC 3GSNA 1P4LB 5IHBA 5ICZB 3S5LG 1A14H 1NMAH 2Y7QA 1MH5B 3MNWB 2ADJA 4TNVK 4G80A 1RUQH 5DK0A 4CAGA 3EYUH 3L3HB 4Z95L 5DYOB 3GSNB 4KMTL 3PG2A 4APQA 5ID1A 2CRYA 2F58H 4KGJA 5TPWH 3QO0A 1IQWL 4M6AA 2Y7QB 1WT5A 1ZLSL 4G80B 5DK0B 3DRTA 1A7BA 4TRPH 1PSKH 3LQAC 3NFSL 3O2DA 1T0PB 3TPUA 3V0WH 5ISZD 1SY6A 5FYKU 2W65B 2IWGA 2XTLA 4RAVA 3HFMH 4APQB 4F15C 3IAGC 5ID1B 1A6PA 3QO0B 2MTPA 3P11L 5F8RC 3RWCA 3UBXA 3MREA 4S1DC 1IT9L 3DRTB 1JGLH 3TPUB 4RAVB 2NXYC 1MVFA 3GMOB 3WO3B 5FUCE 3UJJH 5IGXL 4U1KA 3MRBA 3RWCB 2DBJA 3RGVA 3UBXB 2X10A 1CR9L 4IMLA 3MREB 4JE4B 1TZHA 1CBVL 5HVWA 1SHMA 4NWTH 3VCLA 12E8L 3K8LA 4LSQL 3LQAH 4R3SB 5CMAA 5JQHC 4HJGA 4PB0L 1V3MA 2WLYA 4U1KB 2GTZA 3MRBB 2W60A 5KSBF 3D39B 3RGVB 1NANH 4HWBH 4IMLB 2R8SH 1TZHB 4UDTA 4IIQC 3HHRB 2ZNWA 4HKZA 3GSXA 4XAKE 5BMFL 5CMAB 4HJGB 1JL8A 1DR9A 4I3SL 5EH1A 1FNHA 2AABH 5EDXA 4ZUVA 5IBTH 2GTZB 2W60B 1A6TA 4U7MA 3IKCA 2OLDA 2CXKA 1CFVH 4LLDA 4UDTB 3QG7L 2H8PA 4N0YH 1F4YL 5AAWA 1L0QA 1OTUC 5E95B 3GSXB 2P8LA 2D7MA 2LU3A 2DD8L 2ATKA 2CRIA 4NSKA 2E27L 5F7YC 1A6TB 3IKCB 2DQUH 4G8GE 4LLDB 2J8UF 3TA3C 3RAJH 3FO2A 2NY1B 3VH8G 2A6KB 4P2QD 2P8LB 3FFDA 4S1SH 3PWNB 2VR9A 2ATKB 3H7LA 2CQVA 4PRPA 4YXKL 4NSKB 3EYFA 3DIFA 4OZGA 1L7IH 1CE1H 5FV1L 3SGKC 4A2MA 5FCUL 4KUCF 1A3RL 4RMTA 4ZS7H 3W0WE 4M6MH 3JUYA 1IGMH 2YD7A 3FO2B 1OSPL 2HFGH 2EDQA 2E9WA 3QUYA 3FFDB 2J88H 3K8MA 2OJZH 1RVFH 3G6JF 4XHJC 5CP7A 4PRPB 3EYFB 2HH0H 3DIFB 3AVEA 3ECBA 3N85H 4KROC 2Q76A 3RHWF 4AJ0A 4Y2DA 3OMZA 3GSQA 1U8MA 2CMRL 5E0QA 3RVUC 3QUYB 1A6VH 3TVMC 2VXSL 3FQWA 4M7LH 2X1PA 5CP7B 1S7TA 3B2UC 5T33H 3MOQA 3ARGD 3W11C 3ECBB 5IBUB 2Q76B 1HHKA 1S7UA 1T89C 2CIIA 1B6DA 3VWJA 1S3KH 3GSQB 1U8MB 3SDXF 4F2MA 4QXGL 1NKOA 3ESUF 4OD1L 2DQCH 3S37H 3SDCD 3FQWB 5T1KD 1QSED 2NY7H 1S7TB 2CRMA 3BH8A 4HUNB 1FZMB 2FR4A 2HMID 1IBGL 5ALBH 5E9DE 1RIVH 2FGWL 5E4EC 5JW4N 1HHKB 2CIIB 3VWJB 3QUML 5E00A 4M6OH 1TPXC 4J4PA 4IOFD 2FLBT 3L3OB 1KEML 1WAAA 3QDMD 4Z18A 3IFOA 5C6TL 2FR4B 2I9TA 3BH8B 3C2AL 4JLRA 3UTSD 1W0VA 2NCMA 4D9LL 3VI4E 5E00B 4I3GA 3PL6D 4M6NH 2A77L 3QDHA 2DTSA 5E1HB 4WI7A 1NEZA 3TCLB 2I9TB 2C3HA 4JLRB 4XRCB 1NBVL 3S5LA 1W0VB 3FT3B 1WICA 2FECI 3HN3A 5AUMA 4JFYA 1H9VA 1YQVH 3F58L 4LDOB 1T03H 3OB0K 5IT2L 4H88L 4FNLH 1GGCL 1NEZB 3VDCA 4X6BB 4EUPG 5J1SC 4FFVD 4OLZH 2M8XA 3HMXL 4AIXA 3TZVD 4FQ1L 4IRSA 5MERA 5AUMB 3UX9B 3OKEA 4JFYB 2YBRA 3PWVA 1FDLH 1LO5A 5CGYC 2HT3C 5I1IH 3PABB 2AJYL 5F1KC 1KC5L 4JZJA 3NA4A 4KK8D 3TBWA 4IRSB 5I19L 5ECJE 3OKEB 2YBRB 3PWLA 3PWVB 3TJEL 1LO5B 4Y5VC 4BQBA 5CKAA 4RGNC 3WJJC 5JOEA 1VEOA 4JZJB 3TBWB 2FO4A 3UTTE 1OP3K 5JOPE 3C8KA 1R3LB 5C0CA 4MAYD 3PWLB 3S3PA 4CU8A 1T7VA 4MQXD 1PG7L 3JBG7 4GRMA 4WV1C 5CJBA 1C5BL 4RMVA 3RJQB 1N64L 2VLKD 4DN3H 2F15A 3T09A 3KPSE 3C8KB 3QPXL 4HIJA 3TJHD 1D5IL 4MLSA 2A0LD 1QFWL 1VDGA 2C1PA 3VFWA 4Q9RL 1F3RB 3CU7A 4GRMB 4MQSB 1GVIA 2EH7H 4Q2ZA 1VKXA 1A7PH 5D1QC 2I24N 1SBBA 3WIHH 3LPGA 4U1GC 1JYXA 4HIJB 3SGJC 2C1PB 3VFWB 4AMKL 3X3FL 1SEBA 1CD8A 2GYSA 1YN6A 4Q2ZB 4HDIA 4QLRA 1VKXB 3EAKA 2VC2H 2P45B 4F7CB 2X4SA 4Y16C 1MWAH 5AZ2L 4PJXE 2O5YH 4K7PX 2XY2A 1CFNA 3BGFB 5C0JA 3D48R 1KN4L 1SEBB 2KKQA 3V6ZA 1YN6B 4WO4D 1QQDA 2XNAA 3QJHA 5H35A 1KEGL 4XX1G 2X4SB 1HILB 4FXKA 3P0VH 4JFPA 5C0JB 4LCWD 2X89A 2F9BT 5I1KH 4WY7L 4P3CL 3V6ZB 1KB5B 1JPGA 1QQDB 5B39A 3ARPA 4NN7B 3QJHB 5H35B 4K8RL 3D3VE 3WBDA 4G42A 4QRPB 4FXKB 5IHLB 3N1PC 4MSWA 4JFPB 3V7MA 3P4OA 5CCKH 1MCBA 1R3IL 1ES0A 5EU6E 5D93C 2HRPL 2FHCA 3KPPA 5DGRA 1JPGB 4HXBL 4PJ5D 4Z0BH 4HX1A 5B39B 5CSGA 3QIWD 1F13A 4G42B 5SX4H 4MSWB 4KJQC 4XWGH 1DUZA 3I50H 3P4OB 1YA5A 2E9BA 3OAUH 4JN2A 3D9AL 2PW1A 3FO0L 5IR1A 3KLAB 1P4IL 1ES0B 1YQ2A 1A5FH 1LILA 2XYCA 4C54A 3Q1SL 4HX1B 5ACMA 3SOBL 1A3LH 4XPTL 3OB8A 1JBJA 1PAMA 2H2PC 3P73A 4UDUA 3BE1H 5IR1B 2OP4H 2PW1B 1OAYL 3AAZA 2VDOL 2DJ4A 5A2FA 3V6FA 5DT1L 1S5IL 5EU7C 5EC2A 3RPKA 5FYKL 1WISA 5DEFA 4XGZA 5IFAH 4X6DA 5I30L 3P73B 4KI5D 4UDUB 1J86A 3HAEG 5CEZH 2IG2H 4LNRA 1JP5A 3V6FB 1RULH 4TVPH 3UTPE 4M8VA 4B7IA 5EC2B 3D25A 8CGTA 3NIGF 2E9JA 5DEFB 4XGZB 3VRLE 3KHQA 3SGDH 1TTUA 1FNGA 4K7FA 4LNRB 5HHOD 3O2DH 3GMNA 3S8WA 4PYHA 3DYOA 1DANT 2PW2A 2FIKA 3D25B 4D9RD 1EK3A 1WVZA 1JGUH 4Z7WF 4LU5H 4ONGL 4NKDA 2B5IB 4MWFA 3T4YA 1FNGB 1NMBL 3EOAA 2CLVB 4K7FB 2DQEH 5E5MA 1VEMA 3GMNB 1EO5A 2PW2B 2FIKB 4OZGE 2NLJA 2Q8BL 3OL2A 1X3DA 4V2BA 5E1AA 1QHPA 3SPVA 4NKOA 5L2KE 4MWFB 4ONHA 3T4YB 1RK1A 3T0VA 1NANI 5IHZA 3QUKA 4O2EA 1AGDA 1PKQE 4OCSH 2NY1C 5E5MB 3PIQA 3VJ6A 1GZPA 4OF0A 3IDMA 2AGJH 3O2VH 2NZIA 4XNZB 4F7EA 3MFGB 1MRCH 4OLVH 2NLJB 2B2XH 5E1AB 3SPVB 1NBZA 2XWBA 4NKOB 1MCOL 4ONHB 1RK1B 2JB5L 3ZE0E 5IHZB 3QUKB 4O2EB 1AGDB 3IXAA 3VJ6B 1GZPB 3IDMB 2NY6B 4WWKC 3U46A 3WCYA 4F7EB 3AS2A 2E7LC 3MMEA 4JVUA 3NZ8A 4TULL 4GSDL 4XBEH 1LWRA 1KSRA 4W4OC 1WUNT 4YHOH 3PGCA 1NBZB 2A6IA 3QIBC 1UJ3C 4J12A 4P4KD 1N5YH 5FCSH 3IXAB 2W0PA 3VXRA 5MEND 2XG5A 2WSKA 1RZIA 4IM8A 3U46B 1A1MA 4TSCL 1CT8A 3MMEB 5GGTA 4NYLA 2X4RB 4I13B 5MHSD 2P8PA 3PGCB 2A6IB 3FKUS 1WFNA 4EQ3A 5IMLB 4LSRH 1B4JH 4R2GB 1RZIB 3VWKA 1DBBL 1A1MB 1CT8B 3GSWA 5DD1L 1ADQL 4NYLB 4KHTL 2P8PB 2YXMA 4RWHA 4L9LC 2X4OA 5KJRL 3ZSTA 3B2VH 5JR1L 4HUMB 4N8VG 2Y4SA 1S9YA 1H8NA 3VWKB 4JFHE 3DUUA 3GSWB 1FL6B 1FLRH 2IGFH 4I0PB 1FPTH 5BS0D 2X4OB 1EUTA 1FVEA 3T0BA 2J1KA 2VLME 3BT2L 5IKCA 1S9YB 3L5XH 4PLJD 1AR1D 3MOBH 1OTSD 3DUUB 1QSFA 1ZWIA 1WV7T 5JXAH 2AJSL 1YEEH 4DK6A 4WI6A 2C7UA 2F54A 2NY2B 4LVEA 4F57L 1FVEB 1XGRA 2QV2A 5BW7C 5IKCB 3PV7A 4HKBA 4LRIC 3ALXA 2XWTA 4I77L 1N0XH 1QSFB 1ZWIB 2CO6B 2W0FA 3MV8E 1S9KC 2YD4A 2C7UB 2EC9T 2EDDA 2F54B 3EJYD 3B9DA 1AD9B 3GIVA 5I1DB 1XGRB 2CLZA 4NCDA 4I48A 4N0RA 4HKBB 5HD8D 1PLGL 2XWTB 3C9NA 4PJ7F 1LQSR 2W0FB 5LCVH 5C0CE 5L9DL 2ZUQB 3SE9H 4KJWC 3GIVB 4HKJA 3LS5H 2VXUH 4I48B 4JB9H 3MLUH 4OB5L 4O2CA 4C83A 4U6HA 1I1AA 3C9NB 2NNAA 1DQMH 4XCNA 4MVBC 4QKXB 3FMGH 2AK4D 1E4KA 3BQUC 2UYLA 2BFVH 5FGCE 1IGIH 1UA6L 1AQDA 2IBZY 4HKJB 2ZSWB 1KTRL 2IEPA 4O2CB 4C83B 4U6HB 1I1AB 2NNAB 1E6JH 2YA1A 2J6EL 4RX4A 4XCNB 5DUPL 1K4CA 5KSBA 2UYLB 3W9DA 4XPAH 5C2UB 1EFXD 1HHGA 1AQDB 3L5HA 5FF6A 5HY9A 2YRZA 3PWJB 1IAIH 3SDDD 2AXFA 3UJTH 3VRJA 4FABL 5KS9B 1MPAL 1K4CB 3MR9A 5KSBB 5GXBB 4OD3L 3JXAA 3WYRA 5HXMA 3QHFL 4OD2A 4JM4H 3N9GL 1HHGB 1LO0L 5FF6B 4NJ9L 5HY9B 3X14A 1I9RH 4NCC2 3VXQA 5FO9A 2ZG2A 2AXFB 2BNRD 3T3MF 4MNQD 1N8ZB 3MR9B 4IBLT 4Y4FC 1ZHLA 4XXCC 4OD2B 2Q7YA 2OR7A 2J8UA 1HEZA 5I8OH 1NH6A 3X14B 1RU9H 1EUUA 4NQDD 3U1SH 1T83C 1VESA 1WCBA 1BVLA 3ARDA 1AIFA 4LSSL 5J6GA 5HI4C 5BVJA 1BFTA 1VCAA 1S9VA 2AJXL 2DQFA 1R6VA 4QHNA 1AY1L 2YZ1A 1ZHLB 3Q2CA 1S9WA 1UGNA 2Q7YB 5HYSG 2J8UB 1HEZB 3ULUD 4PJ8C 1WCBB 1BVLB 3ARDB 1AIFB 2HWZH 2N1KA 5J6GB 4WUKH 4L4TE 3H9YA 4EN3C 3G6JA 5K59E 1S9VB 3BJ91 2DQFB 4QHNB 1G6VK 1S9WB 4NN7C 1EA9C 4U3XA 4OFPA 3NCFB 4YAQA 3DX8A 3BZFB 1CIUA 4GKSA 4OLWH 4G3YH 3EHBD 4QRQA 2EO9A 2YPLB 4BSVA 4M03A 2YUXA 4EQ2A 3G6JB 4MJ5B 1BF8A 3T08A 1MFDL 1MHEA 2Y6SC 1HQRA 3RTQA 4D8PA 1L7TL 1C7TA 4H5SA 2DJUA 1YECL 3PDOA 1KIPA 4GKSB 3SDXA 3WKMH 2HVKA 3GRWA 4QRQB 4BSVB 1TTFA 3MV9D 2VXTH 4KY1L 5JPMB 3DWTA 3GI9H 4PRHA 5AYUH 2F5AL 2ADFL 3NN8A 4OM1L 1MHEB 1F90H 4X6DE 1HQRB 5C7XL 2NW2A 2LTQB 3GGWB 1KB5H 4D8PB 1YC7A 4H5SB 5I75B 2FBJH 4GJTB 4NQCE 3SBWA 3PDOB 1KIPB 2CDGB 3SDXB 2HVKB 5C0RL 1VSCA 5C09B 1A6UL 1DANU 4HIXH 4MAUH 5DR5L 3V0AC 3FRUA 1CXKA 3BDYH 3NN8B 3STZA 1I1CA 1A1OA 4I0KA 5ANME 2NW2B 4NM4H 1UXSA 4EDWL 2MQCA 2EIEA 2NY5C 4KUZH 1E4XL 3I02A 2ESVD 4IMKC 4FXGA 5HDBE 1B0GA 3QBTB 4GW5A 5SX4I 3TBSA 2NY0C 4N9GA 3FRUB 1NJ9A 3STZB 1A1OB 4BZ2H 1UXSB 4G6ML 2ZCKH 3P9MA 4QEGA 1FNAA 1TXKA 3I02B 3L7FA 2WMPA 4FXGB 3ZE2E 1B0GB 3TBSB 4GW5B 3U30C 4XPBH 5EUKA 1NJ9B 2HT4D 4Y1AD 2RBLA 3P9MB 2NY5H 3L7FB 4OCMC 2B5IC 1PKOA 4TSAH 5B3JE 5BV7L 3W5NA 5IESH 3OR7A 4I18A 5EUKB 4MA1C 2UUDH 2XXCB 4JFZH 2DLTA 5IIEA 2KQMA 4ZNCD 1CXHA 1DSFH 3NACH 5DXWA 3SQOL 2WUBH 5D2LF 2FCBA 1KUMA 3OR7B 3SGDI 1UACL 3MV7D 3EGSA 3RY5A 1I75A 4UIKL 1FH5L 4I18B 1J10A 4Z78A 4Z5RA 2BNQD 5C6PB 2AERT 4CGTA 3RPIA 3FZUD 1UM5L 2VABA 3VXRE 3BP6A 5DO2D 5MEPA 4DEPC 2HG5A 3EGSB 5D7IF 1F58L 4X6FA 4Z78B 2NY6C 4Z5RB 2YKLH 5C3LD 3S35H 1BD2A 3DTXA 4NHCH 2EKSA 3RPIB 3S36H 1FFQA 1QFOA 1A7RH 1TJIL 2VABB 4YZFE 3WJLA 2IC2A 3BP6B 1U8JB 4TVSa 4JG0L 4JRXD 4JFEA 5MEPB 3BEVA 2HG5B 2PTVA 1NGYA 4Q74A 5KVFH 4X6FB 3Q3GA 2D7PA 4FFZL 1IGFH 4PJDF 1BD2B 3DTXB 1TVDA 2ICCA 2EKSB 1FZKA 1P7HL 1UCBL 3O6FD 4J6RL 4OLUL 3BEVB 3MOAH 2IQ9L 4PLOB 3X3GH 4R2GC 3Q3GB 4LCCB 3TGXA 5EZIH 1KG0B 1NQBA 4OTXL 1FZKB 5ADOL 2VZUA 4U05A 3OAZH 4NZRH 4YXLL 3NBNA 4LKCA 1G6RH 1U3YA 1J8KA 4FQXD 2DLHA 2YA0A 3UZEA 1QSFE 4NGHL 4P57A 3QFDA 3VWKC 2F54E 4I0PC 2I07A 1RUKH 2EZ0D 1GIGH 3NA9L 4XPHH 3KPQA 4RBPH 4LKCB 4N0UA 2VITA 1P1ZA 4YH6A 2ENYA 1TJGL 4MMXC 3QFDB 4P57B 3PGDA 4PS4L 3ARZA 2F19L 1JPST 2VZVA 4X6CF 1LGVA 2I07B 2FATH 4PD4K 3KPQB 4NRYA 4DUWA 4BZ1H 3H9SE 2NY2C 1GGTA 4HIHB 4GT7A 4ZD3L 2FL5A 4N0UB 2VITB 4FQCH 4AH2A 2DMCA 1P1ZB 4S10A 1OAQH 4N0FB 3HZVA 3H8NA 3PGDB 4LLYB 3K1KC 4LARH 4OGYL 5AZEL 4NRYB 1MAJA 3SJVA 5ALCH 4G6FD 1TFHA 2FL5B 3TBYB 4X8XA 5HDQH 3EJZD 4AH2B 5F7LB 4RFNB 2P8MB 4X4YA 1PBYA 4DKEL 3F6IA 4QCIA 4PLNC 3HZVB 1YYLH 2EDRA 1EGJA 2AV7A 4EI5A 4KMLB 3U7WL 1O7VA 1RZ7L 4YFEA 2AJZA 1QBAA 1HIML 3SJVB 4L3AA 1JGDA 3IRZA 2CSPA 4JHAH 3WHXB 3O6KH 3TBTA 1IEAA 1NUGA 4X8JA 5FOJA 4X4YB 4FZEH 3QEHA 1FSKB 4QCIB 2I60H 4FRWA 3RU8L 5ERWA 1VFBA 2JJSA 2AV7B 2VQUA 4DAGH 4EI5B 2ED9A 2AJZB 4PJCE 3IGAB 3CXHJ 2P5WA 2D03H 4P0DA 5GGUA 3FB5A 3TBTB 1IEAB 4X8JB 2ICES 3QUXD 3T4AA 3QEHB 3MO1A 4WHYH 4JKMA 2EICA 4L3ED 1DVFA 1U8LB 5ERWB 1VFBB 4LOUD 2MQ3A 5JNYA 3RWHA 1QYGL 2AXHA 2P5WB 3FB5B 4POYA 3T4AB 2PTTA 3MO1B 3HC4L 3CSBA 2P1YA 3E8UH 1DVFB 1XH3B 2DN7A 3QR2A 3V8CA 2J8UE 4Z7WA 5JNYB 4GOSA 4BK5A 4MD4B 4K3HA 4PJIE 4F37K 1Q9KB 1SMAA 4DGYL 3ZL4H 2XQBH 3KGRA 1YNLH 2AEQL 2AJUH 5K9QI 2W9DH 1NL0H 1C7SA 1G9ML 1QBLL 4LF3B 4QNPF 3MJGX 5ESAA 2FB4H 4Z6AT 5SX5K 5B8CA 4KRLB 1G0YR 4Z7WB 4FQJL 1IAIM 1BGXH 4JFFA 1F4WH 3FRPA 2DLGA 4GBXA 4QRRA 4B41A 3RX8A 3LZFL 2DLFL 1RAMA 1P53A 1IAII 2XQYG 3QQ4A 3CFKA 4OZHF 4JFFB 4GBXB 3M8OL 2PXYA 4QRRB 5HYJE 5E2UH 3CCHA 4NNYB 1F6FB 2GAZA 1ZAGA 3WFCL 4F9PC 3IFLL 4PGEA 4LSVL 4WFFE 1MHPL 5CAYB 5JPNA 1XMWA 4KH2A 3RKDC 4OGXH 5HYEA 4QHMB 3R8QA 3CFKB 1XGYH 4H1LB 2R4RL 4XAWH 2DIBA 2X1OA 2X4PB 1YY8A 4R96A 1FJ1A 3W82A 2PXYB 2B8OT 3CCHB 2GAZB 3MJ9L 3OKLA 3QCTL 4KKBC 1CFTA 4PRHE 3MUZ1 4PGEB 1DUYA 1EMTL 4F9LA 4FZ8L 2CR6A 5JPNB 5IQ7L 1SYSA 4R96B 1FJ1B 1S7QA 1I8LA 5K9QG 3OKLB 3UTQA 5GS0C 1Q0XL 3RGHA 2EIDA