2VKXA

Human ncam, fn3 domains 1 and 2, m610r mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
198
structure length
198
Chain Sequence
ADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQRGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE
publication title Structure of the Tandem Fibronectin Type 3 Domains of Neural Cell Adhesion Molecule
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 198
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vkxA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vkxA02
5EWIH 1BLNA 2J88H 3CFEB 4TUKL 5JOPE 3RTQB 5CSBA 4PRIE 1RZKC 4M7ZC 2V9TA 5BV7B 4Y4KA 3QUZA 3CAFA 3FB5B 3IFPA 2UWEF 1U91A 4ERSL 4Z9KB 1UGNA 3ETBF 3NCFB 5BVPL 5JOPD 3BPCA 4OAWB 4PRID 2ATKA 5D2NA 3WYRA 1IAKB 4Q6IA 1DBAH 4LGPB 4A6YB 2APWA 4BZ2H 2PXYD 1OGAE 2HKFL 3OPZH 4PJCF 4NZRL 2YD4A 1ZLVK 2QSQA 2AJYH 4LQ1A 4ELMB 3ILPA 3O3AB 2FRGP 4TVPE 4Y4HD 2XPGA 2PO6A 3LQAH 3VD7A 1T3FA 3PJSA 1KC5L 4GSDL 3HAEA 1D9KC 4RRPG 5A16B 4DN3L 1AR1D 4KKAD 3OB0H 1CE6A 1TJGH 3IU3A 3QPXL 4O58L 1JPGA 4ZMAT 2VDOL 1X5IA 5C0JA 3AS2A 1KGCE 4X7TA 4Y1AB 1OGTB 1JTOA 2RB8A 2YN3A 1KIQA 3OZ9L 4I48B 5HHPA 4LLMA 4DAGH 4FABL 4NP4H 3CLEL 4XCNB 1A3LL 2IANE 1NCUA 4DK3A 2EKSB 4MAYD 1AGEB 3D39A 1WF5A 4Z76B 4YXLH 5A2KH 1A21A 3I6KA 3ZSTA 3O45B 1OQXA 2L7UA 3SCMA 2IAND 1I9IL 1CT8B 4Y16B 1I1AD 1U3HD 4ZSOA 5IEKB 2QQNH 1DE4A 4G8FA 1C16B 5HPOA 3GMLA 1KCSL 2OZ4H 2VLLA 1TVBB 5E8DH 5L2JA 1OPGL 2AK4B 1N2RB 4NQEB 3ZL4H 2NPLX 1F6LL 3D85A 4N8CH 2BVYA 1MCQA 4IMKA 4L9LC 4XVSH 1YN6B 4NWUL 4OM0H 4LSRL 4U0QB 4Y5XA 5IHUH 1ZVSB 7FABH 1T5XA 4GOSA 3MRNB 4X8JB 4MNHB 3VFSA 4U1LB 5T5NF 2V9QA 3QNZB 2DQHH 4LARL 3O0RL 4POUB 4FQHB 2VH5H 3ARGB 3O6LH 5FYLE 5HDQL 1BZ7A 4OFPA 3W9EA 5AUMA 3TM6A 2GFBA 1EO8H 1R24B 1T1YA 4H8WC 3O3EB 3QDMB 2XKNB 2D31B 5BS0D 2V7HB 4JFED 2DYPA 1GZPA 1AGBA 1ZLWH 5FECB 1WWCA 3K0WA 4NNPH 4Y88A 4EI5C 4HGWA 3EJJX 2Y5TA 4UILL 1N59A 1GAFH 2EEDA 4RGMB 5FYLD 3WHE1 1INQB 4XP5H 5AAWA 1S7WA 5E2VH 4PRPB 5T1LB 1H15A 1FL5B 1VHPA 2EZ0C 4U6HB 1EUTA 4NQDD 3UPRB 2Y06L 1NBVH 1RVFH 4JRXA 2GTZA 2NXYB 2IBGA 2J8UB 4N1HB 5K9OA 3I2CH 3MRCA 3GMOA 3MRKB 3SBWC 1EZVY 1XF5A 4N5EC 3W2DL 4KJQD 4MJ6A 5C0GA 3R1GL 3H42H 4OZIA 1UJ3C 4OSUH 4JGMA 3VA2C 1PAMA 3P4MA 1ZT1A 1JUFB 3IJYB 1BREA 3UCRA 3WN5B 4H88H 1CD1A 2ICWB 1KLGA 3BP4A 2KL6A 1UCTA 3GBNH 1YEGH 2BSED 4XH2B 4PJGA 1R5WA 3OKNA 4WTXA 1VESA 4RFOL 5C92A 5IFAL 1SBSL 1IGYB 4LVEA 1NCCL 1J87A 3VG9B 4G8EA 2X2YA 3RNKB 1MHPH 2WINB 2AEQH 3ROOA 4FG6C 2C4FU 3R0NA 5C0AB 1WFNA 5ID1A 5LGHH 3BP5B 4OZFB 3V6OA 4EUPG 1UVQB 1HHKA 1CK0L 1T0PB 2AEPL 4EDWH 5AWNH 5ICYB 3MRLB 5B39B 1KB5H 1BQHA 2CUIA 1KPVA 4YEEA 3ARDB 5DQJB 1QSEB 2AJSH 4GQ9L 4LOUD 3WBDA 1RMFH 3O6FC 5F70A 4GXUM 3TVMA 3ZKSD 1I9JH 1OSPL 5JOFA 4MQ7A 3E1F1 4TSBL 5BVJB 5IMOB 4NQUA 1ZS8A 3ZE2E 3ECBB 3OHXA 5HHNA 3CC5A 4P2QE 4AH2B 1RUAL 1Q94B 4ZFOL 4UQ3B 1V7NH 2VDLH 2E9JA 3AS1A 2OJEB 3C5JB 1EHNA 1KNOB 1A1NA 2PR4L 3GJFH 2A74B 2YA1A 1D3CA 2NY4C 3C5ZB 4I9WE 4P4KB 1W0VB 2ZG1A 2Q3AA 5CSGA 4ODTH 2OZ4A 3UBXB 4Y5VB 2G60L 4L8DA 1R3KB 3OJMB 2R29H 3KPOB 3CCHA 2J12B 3DROA 1MCOH 2JJTA 4RGNB 4W70A 1CXHA 1INDL 4X6FA 3PL6B 4I9WD 4LASL 3SKNA 4M1GH 4BZ1L 5F9JB 4M5ZL 4LVHB 4HAFA 1OTSD 4APQD 3U4AA 3D2UD 4R2GD 5I18L 4XAWL 2J6EH 4YWGH 1G9NC 4UQ2A 5IFJB 1X5JA 4UDTA 4FMKA 4HK3N 3VFUB 1SMOA 5AAMA 2HTKD 5HYIA 4DKFL 5I1CH 1LE9B 5CSZA 1QRNE 4D94A 1T7YA 3E6HB 3LY6A 1AHWB 2FBJL 1GOHA 4LLUB 4LEOB 2X05A 1TQBB 1S7XA 4HV8A 3IS1X 3DX6A 5I8CA 3BGAA 1EHLH 2XZQH 4L1HA 3SOBL 1J1PL 3AVEA 1UCBL 5KSUA 5KSAA 4RISH 4HXAH 2IGFL 4XP1L 3CU1A 3WIIH 4B53A 2NY7H 5TF1H 1R3IL 2C4FT 2MCG1 4JHAL 1CVSC 2BVPA 3SDYH 1FV1B 1WC7A 5GRUH 1QKZL 2B4CC 4HULB 3GFUA 4J8RA 5F3BB 4KKCC 1T5WA 1IJ9A 4NM8L 1AD0A 4GW4A 3HE6A 2VDKH 3PDOB 4ZOCA 4PJFE 1FBIH 4WU5B 2MNUA 3CMOL 5KVFL 4K8RH 3BPOB 4OZ4A 3SDDC 1G7MA 4QRUA 2I9LB 3FB7B 1IC4L 2NY5L 4GJTB 3VXTA 4XXDA 4OV6F 5GPRA 1BECA 4KPHL 4PRBB 2Z91A 2F8VA 2F54A 2WLZA 3MBEA 4OCYH 5GSVB 3SY0B 1DN0A 4YXHL 5AZ2L 1AY1L 1BM3L 4IHOB 5D1ZA 3QEGH 3QYCA 3SKMA 4WWKB 25C8H 5CILL 1PGRB 1MJ7H 1HSAB 3DGCR 5J57B 1ODAA 3MYJB 4WJ5B 1Q9LA 3IKCB 3MQIA 2GIYA 5L88H 3BKCH 1TZHB 2AXFA 2J5LB 1RULL 5BRZD 1EHAA 4L3CB 5IM7A 3GHBL 4G8IB 1U8LA 4QRRB 1SEQH 3LEVL 1G0YR 4BKLB 3DXAB 1UZ6E 3PXHA 3P3YA 3QUYB 3ZDXF 4HUMB 5T1KB 2CO6B 1XGUA 4PJ5E 4ZAKD 1JVKA 3NFNB 3IDGB 3ULUH 1HQ4B 1F3RB 1QFUH 5DJCA 5D7IE 4PTUB 4N0FB 3BYYA 5CJQH 5FYJH 2AXHA 3K4AA 1RIVH 3G6JE 3K2MC 3GJFA 2Z92A 3P9MB 2J4WH 2JCCA 1U8OB 1BD2D 1KEML 4K7FB 4M6AA 3WXWL 3MOQA 4XVJH 5KSBB 4YFLI 4KRNA 5ACZB 4F80A 3HPLA 2IC2A 1EBAA 3WFZA 2H2SC 3GUTB 2VMFA 4KKLC 1J8HD 1A64A 2H3NA 1DSFL 1FSKC 1K8IB 2JK5B 4JFDE 1RI8A 3CFCL 4ORZC 1OAXL 2X1XR 1FZOB 1UWXH 4G9FD 1FH5L 1DVFB 3CX2A 1OM3H 2NLJA 5J1SC 2J6EA 3QIUD 1BFOA 1CDCA 2HFTA 4MQXD 5K9QI 5L8JB 4ZTPL 4KRLB 4OFVA 4NN7B 3JTSB 4LLWA 2A6JA 3K4ZA 4LPYA 4XCEB 1TNNA 1XR9A 2DRUA 4WI6A 2HKHH 1CICC 2EDRA 3MLUL 4BK5A 4DVBA 3EOTL 5D6DA 4PJAB 3LZFH 6FABL 1MH5B 5BV7C 1JRHH 4NQCD 5IHBA 4RA3A 3RIFF 4FTVA 2FHFA 2VERN 1FE8H 1S3KL 2BOBA 3ESUF 3CFJB 3T1FB 5HYJA 1JV5B 4DQOL 2B0SH 2CIKB 4GRWH 4ZUVB 1OVZA 1GIGH 4I0PD 4HWZB 2GI7A 1I4FA 5ESAB 3VRIB 4G6JH 1KG0B 1WBYB 5ESQA 4K9EC 3TBWB 3TBYA 5I76A 5IB4A 1OB1B 1NMAL 2MWCA 3NFSL 3HI5L 4GKNA 4IIQB 4KK6D 4LSTH 4YC2B 3V2AR 5ITBH 4OLEA 3QEUB 5C2UB 1A7QL 1QHPA 3MACL 4X4MA 1WZ1L 3L3HA 3GEWB 3H9SE 1HHHB 1WCQA 3HC0A 1P9MC 3NCJL 1IQWH 1M6OA 1B9ZA 1IEBA 1YEEL 5GIRB 5ERWA 3UTSB 3QDHA 4XTRC 5K33A 4I3RH 1OY3B 2DJ4A 3TO4B 4WENB 1T7WA 4JHBA 4V1DB 1OP3K 2OQJB 4R26H 3UTQA 5IVNA 3FT3A 3P40A 4JFOB 4ODUA 4MNQA 5IHZB 4Q7DA 5C0DA 1M05B 1MCWM 3O2VL 2DLFH 4XAKE 3S5LB 5E8PB 1XZ0B 5EU3A 4NHCL 4KMLB 3B9VA 1AD9B 3ZDZF 1VSCA 1KJ3H 2VYRE 4Z18A 3DUUB 5HI3D 3CX5J 5GGTH 4YBQC 4XAKD 1F8TL 5D8JL 1XGRB 3DX7A 3UJTL 5E8NA 1SYVB 3CUPB 4X4YA 5BQ7B 4X7SL 1YJDH 2R1XB 3AREB 1UH4A 5CP7B 3BGFB 1QVOB 5DDHA 4PGDA 3L5IA 4Y19E 3OR7B 4F3FA 2HMIC 4U6YB 2F53A 3JTTB 3P0YH 4PJAF 2Q76B 4TOYL 5I2IA 1ZSDA 2YK1L 2DWEB 3PQYB 4LEXH 3VE0A 1UEYA 4FXKB 4I4WB 4Y19D 4G7VL 5C07A 3MRHB 4MWFA 4KROD 2EC8A 1PYWA 4P5TA 1CDUA 4R7DA 2PNDA 4GRLA 1YMHA 2P7TA 1GCFA 1A9BB 3W81A 4PR5A 4ACPA 1IAOB 2XN9E 2ADGB 3D3VB 4JVPA 2XOTA 3PXJA 2I07A 3C60A 1P4IL 3JV4A 3I9GL 2WIIB 4PD4K 1HHGB 1WJ3A 1LEGA 2ZOLA 1BZQK 3ORJA 3ZYIA 2DLEA 2YXFA 3W11D 3ARGC 4PGBB 5E6IB 5ACMA 1CD8A 1VACB 2VQ1A 1HZHL 5JHLL 1JFQH 2X4TA 3NTCH 1JZ5A 3QDJB 4WO4C 4BH8B 1MFEH 4LKCA 3LKQA 2EIEA 1J86A 3WUZA 4RWHA 1JZ7A 2VISB 1EZVX 1WAAA 4NO0B 5DF0A 1HH6B 4RGMC 2Q7YA 3KPQB 2ORBH 3RDTD 5FGCB 5E2TL 4M1CD 2ARJQ 1PJ9A 3MJGX 2YPKA 4FQQB 2CUMA 3DV4B 4IMLA 4WI5A 5F96H 3C8KA 3RVUD 2B1AL 1S7UA 1XCTB 4JN2A 5I8OH 3UTTE 3M1BB 4Z7UA 1BZ9B 5IROC 1G7LB 1JPSL 1UWGL 2C1OB 4HAGA 2OSLB 5DT1L 5C8JA 3NH7H 5E94A 3VWKD 1U8PA 2BSRA 3TH2T 1XF1A 1CWVA 4IOFD 3UJIH 2ITCB 3MGOB 5E70A 2K9UA 1F4YH 1HXYB 2EDEA 3V5HA 1FVEA 4NHUB 3LDBB 4XBEH 4B7IA 4OCRH 3GI9H 5JDJA 2DKUA 3EDKA 2CPCA 3T0WA 2FEEL 4RWYH 1JGVH 1MJUL 4XPAL 3U7WL 3RU8H 3VG9C 4BM7A 4LCYA 3ARRA 2P8MB 8CGTA 1JRHI 1VCAA 1T1XB 3TT3L 4HT1L 3NA9H 3F7YA 4YPJA 5LGJB 3TYFB 3MFGB 4HCRH 2BX5A 2FH6A 1HDMB 3H9HA 3CZFB 4QRPE 4FQLL 5HYQB 2W9DH 4GW5B 3V4VL 4PP1D 4U3CA 4Q0XL 4UV4L 5J3HD 2VZ3A 1D5BA 1E6JL 4JO4H 5DJXB 1X5HA 3OJDB 3FTGA 5EU7E 5GGTA 4QRPD 3VFGL 1PSKL 4WTZG 3VFTA 3SQOL 5DFWH 3E2HB 1E28A 4Q97A 1L7TL 4MS8C 3F65A 4TRPL 2CSPA 3QR2A 4HFUH 5FF6A 3V95A 2Y9RT 3V8OA 1RJYA 2Z31A 3IDNB 3P4NA 1E27A 2I5YH 3KDMB 4R4BB 4MX7A 5HGAB 5B4MD 1HILA 3WUWA 1PY9A 4CDHA 5DA0B 2ARJA 4UBDC 4OLYH 5CWSB 3CSYB 1U8MA 5INCA 5IWLC 3SHSA 2IFFH 3C5ZC 2NNAA 2KBGA 2QSVA 3D0LB 4RNRB 1V5JA 4NGHH 2Z35A 3P4LA 5LGKA 1YDPA 4U1JB 2FX7H 1MI5D 4RGNC 4E41B 3GRWL 1SVCP 2Z93B 2PCPA 4K3EH 4XNMB 4FQ2H 5GZOC 2JB6A 4LVHC 1SJXA 2DOCA 3QWQB 3ZTNH 4NT6B 2XKSA 1EMTH 1K2DB 4PGEA 2QQLH 2FSEB 3IFOB 4ZOAA 1ZA3B 1UKTA 4JQIH 1YMMB 2P5WD 4N9GA 3TYGL 1N5AB 5C86A 4G5ZL 3GSNB 3INUL 3S6CA 3SGDH 2NY1B 1MRDL 1FYTA 4QY8A 3OAZK 4J4PC 3GDBA 5SWZE 5EOQL 3DYPA 3PP3H 2GY5A 1CGXA 1FJ1B 3HFMH 4X6EA 1PVHA 5EO9A 5EIVA 4W81A 1G6RH 1KB9J 4JFZH 5E2WH 5SWZD 4P3CL 4L29A 5TPWH 3ET9F 2BC4A 1ZTXL 4F7PB 4HUKB 1YNTB 3MLWH 4L3ED 5HDBF 5DYOA 3VXUA 5DS8B 2Q87A 2MQ3A 2ZUYA 3B5TA 2EO1A 4JZJA 4NZJA 1CTNA 2BVQA 4WFEE 2EEAA 4QOKA 3UTOA 1OAQH 3ARBC 4YX2L 1LEKA 3QIBB 5IFHL 3BEWB 3OKKB 4E5XB 1F3JA 4UINL 1CGUA 5ENWB 1FFOA 3NZ8A 5C0CB 3TBVA 1V3MA 4HKBB 4J23A 2C5DC 2VWEC 3AY4C 4NO5B 2JIXA 4WW2A 4RSVA 4WFED 2ZZUT 4XB7A 1T20A 2HLAA 5J6HB 4HG4K 4MD4B 3FOMA 1AJ7L 1T1WA 1ZGLB 4CMHB 5JR1L 2R8SL 3DPBA 3BPOC 2WWKT 3CMGA 1PLGH 4TVPH 3WJJC 4ZUSB 2Y07H 1GXEA 3KYOA 2NTSP 7CGTA 2HYMA 2B39A 1NBYA 1PKQE 1MQKH 2IMMA 5KS9F 3DO3A 3IETA 4PB0L 2WUBH 2DI8A 1A6AA 4ZS7L 1FFPB 4JG1H 3RVXD 1CLYL 2DQIH 3V52H 3WFEL 1AP2B 1WFOA 3ARUA 4HCRA 4WWKC 4P49A 3ULVF 5CD5D 5KTEL 3HZYA 4MSWB 5C0IA 3U9PH 3IDJB 4OCWH 3GJEB 4Q6YA 1NC2D 2EIBA 3C6LC 1MHEA 2NTFB 1DUZB 3L5HA 3RAJL 2V7NA 4JLRB 1RZ7L 2J5LC 1F6AB 5EU6B 1SYSA 4J1UA 4OD1H 4EBQH 1EEYA 2W65B 3VI3F 4BFBD 1S7SA 5DLMH 5IKCA 1NGQL 3QUYC 4NRZA 3DX8A 5DMYA 1VDGA 4M48H 3JWDH 2DQTL 3STZA 2W9LA 4M5YL 4PJ7A 4WEMB 5IJVB 5F7MC 3DUSA 2CIIA 3B9KB 2OS7A 4Z7WB 4D9RE 1MCPH 4UIMA 2XA8H 3FFCE 2O61A 1KN4L 1S8DA 5EULV 2W0KA 5I1KH 4E9LA 2G5BB 4M7LL 4G8GB 5DTFA 4PRHA 2Z9TA 3GI8L 3GKZA 4D9RD 4ZD3L 3VXSA 4JFFA 2X4NA 1LO0H 1P7QD 3KYNB 4M6OL 1BFTA 1V3JA 2W9EL 4PJHB 5D2LB 5E00A 1U92B 3BJLA 1D5XA 4GKZA 3OGOE 3LSOB 2VLJA 2X4PB 4HUWB 4Z77B 5EOCL 1SJVA 1EV2E 2R1YB 1AO7E 4WFHD 2AXJA 4YHMH 4H0HB 5GGVL 1IRAY 2NZIA 2FD6H 5ICXA 2YUVA 4TPRL 1IC5L 3PWVA 4MA7H 1A4KB 2HJLA 4KHXH 4W6XB 1LMKA 4X80L 5IBLD 2ITDA 1IEAA 4OCXL 3JUYA 1K4CA 2I60L 3AXLB 1G6RA 3QWOA 4CN6A 2DKMA 1QBML 2WBJB 5ANME 3QQ4B 3HG1E 3VXNA 3CK0H 4JKKA 4QF1B 3G5XB 4WUUA 3DMMD 3DTXA 4R96B 5EB9A 4M6NL 1KEGH 4PJEE 5ELIA 3KS0H 4IIQC 1R5IB 2X7LA 2YD7A 4H5SA 4PYHA 1ZLUH 4MA8H 3SGDI 4JM2B 2XXMB 2VR4A 3L3JA 1AKJA 1FG2B 4TQEL 1NBZB 1NH6A 1KCRH 3HG1D 1WIOA 5E5UB 4I8DA 5FKPA 2JE8A 1F02I 4YE4H 1UZ8B 4QNPE 2HG5B 4Z7WF 5T1DH 3TO4C 3HAEG 1KULA 5A1AA 5HY9B 1OGAA 3B3IB 1CE1H 2OX5A 1PZUB 2EDQA 4HD9A 3U46B 5DJAA 3CXDL 4L5FH 4C57C 3PIQB 2XWBB 1L0QA 1ZA6B 3PWNB 2CXGA 1ETZA 3NIDF 4GG6E 1YUHB 3JWOL 5IVXB 5EPMB 5FXCH 3V9FA 3VMPA 1A7RH 4PJHF 5D2LF 4NYLA 3QPQD 1NUFA 3ULSA 1IGTA 4X6CB 3RZCA 2VLRE 5L7XH 4B5EA 4JPWH 5EU5A 1P4LB 5EZOL 4PRAA 2UWEE 2FJGB 3L7FB 3OGCB 1CZ8H 3VWJB 1JTTA 2NXZD 3MLRL 1RZIB 5DJYA 4XCYA 2R0KH 4KI5C 4K94H 3L3KB 5H37G 3S34L 5D70H 4I13B 5EORL 3C08H 1QFHA 3HZKB 1WQVT 4UU9A 3JV0A 3ALPA 4BSJA 3BFOA 5MENB 1MHHB 1XIWB 4QHUB 4PJCE 2DF3A 1J1OL 1NCDL 4KUZL 5HHXL 5CIPH 5CBEB 1R3JA 3GSNL 3JV6B 5C6PB 3RUGA 1SJEB 2FGZA 3OR6B 3L3DA 2WBKA 1QOKA 5ADPH 4JO2L 1M71A 4Z95H 2EYTB 5CJ5A 5CBAA 5DD3H 4JM2F 2DMBA 3UMTA 1XF4B 1CL7H 5JDSB 4JR9L 1T04A 5GS0C 1MIEL 4PB9H 5JA8B 1QLFA 2E9BA 5DVMA 5E6IC 1T7XA 3CLFL 1KJMB 1HK6A 2P5EB 5FO9B 1AGCB 1HI6A 4LCWE 1EFXD 3GIVB 4N1EA 1H3TA 5GGSY 1VFBA 4NNXA 5IMLA 1MCIA 3KPRB 4M6ML 1N64H 4PRDA 1F58L 5C08A 4JJHA 3MV7E 5EOCJ 3BW9A 4GW1B 5E9DE 4LCWD 5B8CC 4ODHH 1E4JA 3RWIA 3KPSB 4LBEA 2NY0C 4GKSB 1UJTA 2FEDD 5IVXF 3RA7L 2E6PA 2YEZB 4U2YA 1D6VL 1DEDA 3MV7D 5DA4A 5FUCC 4X6CF 1ONQB 2CGRL 3CXHK 1KV3A 4KRMB 1X7QA 5FA3B 5I1JH 5E9DD 4X5WA 5HYSA 4QLRA 1CXKA 4HIJB 2AV1A 1T4KA 1GHFL 5DQDH 5HVWA 4DKEH 1H0DA 1JIBA 5C2BH 1XFPA 4N0YH 5E2UH 4Y5YB 4BQ9A 4F15B 1I8LA 4AEHL 2VLMD 5GISH 1D6EB 3TIEB 1J1XH 1XH3A 4IRZH 1IAIM 4JPIB 1S78D 5E4IA 4DN4L 1KFAH 1JHKL 1FO0H 5EO1A 2MOVA 3WKMH 2A6DA 1G9MH 4U6TA 1FPTL 4EN3D 2FZ3A 2WZPD 2UY6A 3NCCB 2ESVA 3MA9L 3L3IB 3M17B 2VSCA 3BQUD 4I18C 3FO9A 2DQUL 3BGMA 4WI2A 1CQKA 2VDPL 1IBGL 4OT1H 4JFQB 1MLBB 4F9PC 5DJ6B 2X1PA 4MXVF 3DV6B 5FUZL 4GRMA 3RWDA 1T83A 1QUNA 4RMRA 1HYSC 2IFGA 4YO0A 5E8EA 1GZQB 4U7MA 5JHDB 1JP5A 1QG3A 1BQHG 1WEJL 4EQ3A 3WSQH 3WDIA 4MAUL 4Y1AE 1AH1A 4C83A 2ICEA 3CFDA 5I66A 3G5ZA 4R4FL 1JK8B 4MXWL 3E2HC 1WGOA 3I6GB 5KJRL 4JQXC 5GGRB 2DM2A 5HJ3B 3MLZL 3BZ4A 4HKZB 4Y1AD 1MEXH 1HOCA 3L95B 4HUVB 2A9ML 4Y4KC 4DCQA 2LU4A 4R4ND 3TO2B 3QFJB 4LK4A 3G6DH 1NL0H 2EH7L 1X5YA 2EDXA 1WT5C 3IDXH 5ITFA 5CEXA 5E5MB 3SDCB 2N56A 3KXFB 5F7EH 2VKXA 2B20A 3TESA 5D2NC 1WBXA 4JFPA 2AK4E 3FRPA 4NQEE 1NCBH 5GRYA 2IAMA 3H0TA 4P2QA 4HIXH 1QHOA 5C71A 3OKOB 4Y16D 5CIPA 3MSPA 1DQQA 4K3HA 4E0RA 4H0GA 3GMPA 5SX4H 3CDGA 2H32B 4O5LL 4L4TB 1TJIL 3H3PH 1G7JA 4XWGH 1ZLVH 4OFYD 5FM4A 1UQSA 1D5ZB 3ULVC 3KJ6H 3CH1B 1P69B 2DJUA 3DBXA 1QFWL 1KPRB 1A2YB 1CG9B 3QDME 3TBSA 2QLVB 3Q5TA 4KKBD 4BSWB 4YHIA 4ZS6D 4MQTB 1IGIL 1MCFA 3QEHA 3ZKNC 4I3GA 2DTMH 4G6FD 2CRMA 1TCMA 2X1QA 4ZUWA 1UYWL 5FGRA 1CL7I 4U1IB 1QRNA 2W59A 1A6WL 3OBAA 1U36A 1W72H 1J5OL 4JHWH 2WP3T 2E5EA 2NXYD 3QIBC 2Q8BL 4CW1A 5JNYB 5KN5B 3L3OB 4LAQH 5CUSH 3W5NA 1KTLA 1KLFA 3GSQA 4F7MB 2R9HD 2OP4L 1RV6X 3N85H 4OUUA 4NUJA 2E7HA 2NCMA 4Y5XC 1FO0A 2XZAL 4OKVA 3PG2A 4KVNL 4JDZB 3S37H 1KIPA 3HN3A 4YHLH 1ADQH 2V5MA 4PREA 1XGYL 3U1SH 1ED3B 2MTPA 5DEFA 4NC2B 1G7QA 3TFKD 4PJFA 3FN0H 5AZEL 3RVWD 4P23B 4X5LA 3GHEL 4O51A 1GC1C 3FAWA 2IBZY 4YHNB 4YBLB 3FQWB 1YNLL 5SV4A 3RWCB 2Z8VC 3IXTA 3QZWA 5GS1B 1HSBA 3QQ3B 3IU4H 4QYOB 5I1DA 2W91A 4UB0H 4Q9RH 2A1WL 5T3ZE 1QSEE 2NZ9D 4LLQA 4G42A 2X40A 3BZEB 1N0XH 5MEQB 4OI7A 3HZVB 3DX9B 4JQVC 4X8XA 4L8SB 2NMSA 4HH9B 5FEBA 3E8UL 3TJHD 4NO2A 3QIWA 3VG0H 1DDHB 4LPUA 4OV5B 2CQVA 5CINH 3C2AH 3OKEB 1ZVYA 2VUOA 3MA7A 1T2QL 3MRGA 4HGMA 3O3DA 1AGFA 5FDWB 4MZ3A 3D48R 1IKNC 3B9KC 3BEVB 3VDAA 3MRQA 2BNQD 2ZSVB 2VKWA 4Z8FL 1RURH 5GJTH 1CGSL 3O81A 2LV4A 1MPAL 2EXYD 5GHWH 4DTGL 1FNGA 4HX1A 4JRYD 4PJ5A 1CLOL 2HLFC 1RZJL 3MRFB 2AJVH 3PP4H 5D7IA 5IR1B 3VH8A 4FFWD 4P4KD 5KVGH 1NGZB 4KDVA 4YNYB 2QL1A 2DWDB 1B88A 3U4EA 5JXAL 3RWJB 2BRRL 5AG9A 4WRLA 2EH8H 1F90H 1BJ1H 4NN5C 3STLB 3PL6D 2KDGA 4XP4L 3MUY1 3REWB 5BXFA 2ZJSH 3WXVL 4UT6H 1DQLL 3MR9A 4JFDA 5BO1L 2R4SL 3SE4C 2VXTH 3IB4A 5I30L 4AM0B 1Z5LB 1QSFB 5ID0B 1HYRC 3V4UH 4XVTL 4OCLC 4MD5A 1CR9L 4FQXC 5MERA 5T3XL 1TITA 5I15H 5C1MB 4LF3B 3O9WB 3SGJA 4JN1H 3BWAA 1A5FL 1U9KA 5SX4I 2PTTA 1JHLL 1CIUA 1NMBH 2FJFA 3ZDXE 3ARSA 1DQJB 4UAOB 4JB9L 3ALWA 2WBJC 1F4XL 1GGBL 1X6LA 1TCRB 5DR5L 3QJFB 4ZNEA 4QHNA 1KTDB 1Y6NR 2HT2C 1C5DA 4X9FA 4HS8H 1W72A 5TDNA 3F5WA 1VFAB 2HH0L 1NBQA 1K5NB 1VPOH 3BIAX 1R6VA 1NLBH 2AKRB 1BBJA 4I2XB 3WNLA 3MLTA 3FQNB 5KSVB 1MFNA 3ESVF 1X5AA 3K1KC 4X4ZA 2VLKB 4YHZH 3HNTL 4OZHF 1I7ZA 3RKDD 4I0KA 1KOAA 3NCEB 3BIKB 4OIIL 2AI0H 2ZCLL 5F7UA 2A73A 2SEBA 4LPWA 4PY8I 3PV6B 4O2FB 1DQDH 3ZT6A 5HDLA 3AROA 5FHBL 4HS3B 4KTDL 3H9SA 1KELH 3LEYL 4QTHB 3IXAA 1YEIH 1EUUA 4K3DL 5F97E 5C09B 1ADQA 2BFVH 3G5YB 1I8KB 4RFNB 4HKJB 4K07A 4F57H 5DEGB 1CFTA 3WLBB 4YGAB 1OHQA 4PLNC 3S35X 1UH3A 3RY4A 5E8OA 1KCKA 2GAZB 1T66C 2H9GB 5DFTA 1OW0A 3TA3B 4NQSB 1A1OB 1VFOA 5LQBH 1KENL 1OAKL 2FYYB 3TWCH 1UM5L 1YEJH 1NAKH 3HI1B 3RVVD 1T0MA 1QO3B 5T33L 4MCYB 1LNUB 4NBYB 1OLZA 2FO4A 4FZ8L 4KTEL 1RU9L 5J9PB 5F89B 2HN7A 3HZMB 3BH8B 2V2TB 1WBZA 1EXUB 1QEWB 4QRRE 2J7LA 3DXAE 4O9HH 1KTRL 1XIWC 2I25N 4HIHB 4CVUA 5JXEC 1AQKH 4ODXA 4PJ8C 3O4LD 1P6FA 3KNBA 5JMOC 2FJHB 5GGUA 4XPGH 1IFHH 2E8YA 4IRSD 3IFLH 1NGPH 2NW3A 2HT4D 4DFIA 2EIZA 5MEOA 5I17B 4K3JL 5LVEA 1BGXL 2J8HA 5T1KD 3BESR 3MMEA 1EAPB 3TN0A 3QO0B 3TV3H 2X4SB 4LSPL 2JB5L 2UVFA 1N6VA 2GJ6A 3OG6B 1J88A 4KK5D 5L6YH 4JPKL 1IAIH 1FFNB 3WLWD 1NDMA 2B2XH 4NWTL 1Q1JH 2BK8A 2XQYK 5BJTB 3ZDZE 3RPKA 5D9SB 2XN9A 5EIIA 2QQKL 5HGHB 3OXSB 1ZANL 4ONFH 2JF1A 5K9KB 1A14H 3HR5A 3Q5YA 3VFWA 5ILTH 4LCUB 4XCCH 3PWUA 1N4XL 4PLJD 1DVFD 4H8WH 2V2XA 2YD6A 3VMOA 4J6RL 3ARFB 1H3WM 2YKLH 1WVZA 3GKWL 4PJAE 1WISA 2NX5D 1RUPH 2IADA 4J3XA 2BSTB 4XGZB 2DN7A 4F33B 4H26A 3TCLA 3UYRL 1CLZH 4MJIE 4QRQB 5TE6H 1D5MA 1A4JA 4TSAL 3IJSA 3RGVB 1H3PH 4HBQA 2GT9A 4D0CA 3ZZ1A 3UC0L 1A6PA 3VXPA 1QFPA 5ALBH 5JQHC 4NPYB 3CVHH 4JDTL 3UTTA 4DGVH 3EYFA 4R6UA 3LN9A 4MJID 3QG7H 4Z0BH 1HN1A 2ZWLT 1P5UA 3BRDA 4P0DA 3I84A 1WCBA 3T3PF 1L9NA 4HMCA 1S9WA 4OLXH 1U8JB 3UTSE 2AEWA 1PKOA 3FMGL 3SJVA 5B3JE 2QADB 2XNAB 4MA3A 5MI0C 3WNOA 1UB6B 4NKDA 4Z6AT 2ILLA 3BH9B 4FQ1H 3MUHL 3MJ7B 4GG8A 3DLQR 3IGAA 3L1OH 5BVPH 1JYNA 4XI5C 3MNVA 2R2EB 4HIEB 3KPLB 3MXWH 3DETC 3MRRA 4PGZA 3F7VB 5GRXG 1D9KA 1ZGLP 3EYSL 3G5VB 4TSCH 2BNRB 1JPFA 1T0NA 2K7PA 3UZQA 3QHFH 3PWPB 5GRVK 3MLSL 5D6DC 3MRMA 1ORQA 4BQBA 2CK0L 5A43C 4R7NB 4PLKC 1KC5H 1LHZA 3EOAB 1YECH 4HXBH 4LCCC 3RBSA 4DN3H 3BKMH 4R3SA 1G7PB 5DRNB 5CAYB 4HIIA 4LFHD 3SDXB 4Q9QH 3ARED 3EOYG 1OWWA 1U3JA 1ND0A 2OL3B 1ZHNB 3FFDA 3RGHA 1JGEB 4RDQG 2VDOH 1Y0LB 1NEZA 2BY0A 5DK0B 3ZSSA 3PQYE 4PRIB 1CFNB 2D4DA 3DURA 4R8WL 1E4WH 1QBAA 1RZGA 2X4UB 3HRZB 4P2OB 3OKMB 2R56L 1BIHA 4U49A 1AQDA 1OD9A 2PXYB 2HRPL 2BXZA 3ALXA 1XF3B 2AS5M 2AJ3B 4EI6B 1RZFL 3PQYD 3D3VE 3WHXA 1R5VA 3T65B 3ARXA 5H2BA 3MXVH 1FGNH 5DSCB 3DGGB 2WAHA 1FNAA 1KACB 3TJEL 2VXUL 4NCC2 5FHAH 4L9LA 4K8RC 4Z7QF 3ARVA 4NJAL 5I0DA 3BDYH 2NY2D 1FAIH 2F8XC 3P77A 3QDJE 1OP3H 1MFAH 1ITCA 2N7AA 1U93B 1FIEA 1HKLH 4XCFL 2C26A 3S4SB 4TUJA 1G9NH 4LLVB 4P99A 4AIZA 2WQ8A 5ISZD 3AS3A 4NKMB 2XY1A 1CVRA 4LNRB 1BP3B 3B9AA 5FGCE 1NAMH 2CD0A 4GBXC 4JY6A 5F6IB 4M7JL 4ZFZB 5C3TA 5DD6A 43C9A 4MAYB 3U0TB 1S7VA 4XX1G 1FORH 3QNXA 4ZQKA 5EN2B 4EI5A 1VERA 3GMQA 1EVUA 1IAII 2AXGA 3LN4B 5CGMA 1K4DA 4UDUB 2A6IA 5HDQH 3V6FA 3HMWL 1I1AB 1U3HB 3QUXD 5KVEL 1ITBB 3FHAA 2NY3B 2BRQA 3UJJL 1Q9WA 4O2CB 1A22B 3CVHA 3SDXF 3SBWA 4CDGC 1UA6H 2R0LL 3NCBB 1SY6L 2OI9B 3L5WB 3U82B 1BFVL 5IMMB 5F1IA 3WIFB 4AQOA 2B4CH 4J3SA 4JM4L 4YAQB 2ICES 4MJ5A 3DARA 3EGSA 4YZFF 2EDLA 5ETUB 3DRQA 4CBPA 2HAZA 2R1WB 1AI1L 3BE1L 3BXNB 4WW1A 1SVZA 4JVUA 5KOMC 4GAYA 3H7LA 5JZ7C 1HQRB 5DJZB 1ES0A 4P23C 3RI5F 4XBGA 1DUYA 3V7AG 1TDQA 3GMNA 3LS5H 2V17L 5GS1C 1TZGH 5BS0B 4JFEB 3QUMB 2XZCL 2ZCHL 2IJ0C 5D93C 5HDBE 4WY7L 3GSRB 1J0IA 3TZVD 4X7FC 2DKSA 4OBRA 5D1XD 4LSQH 2GJZA 3QUZB 3D9AH 4NQDB 3RY5A 2A0LD 4OD2B 3T2QA 2AV7A 4PGCB 3M45A 1I7RB 1U91B 3BUYB 3C6SA 3O6KH 4O00A 3IDYB 3HNSL 1A0QH 2VDMH 3O6FA 2ZNWA 3VFOB 1XCQA 4Q6IB 1AXSB 5I16A 4HDIB 4XPFH 3MJ6A 2AEPH 5DGRA 1SEBB 5E1AA 1J0YA 1ZWIA 5KOVC 3CD4A 1YY9C 3VGFA 1I1FB 3O8XA 4LRNH 3QUKB 1UT9A 3ILPB 1EGJL 3L6FA 2PO6B 1I3GH 4GQ9H 4XVUD 4KJPD 4E41E 2FX9H 1T3FB 2O5ZH 2Q7NA 3SE8H 3PJSB 3HAEB 4GKOA 1F2XK 4Y89A 1VKXA 5BZDA 1OT1A 4ZDHA 5DHYB 5IVOA 3IU3B 3QWRD 4ODWA 4UTBL 3FFCA 4DGIL 5T5FH 5CEZE 1RUAH 5L9DH 1JPGB 3ULVE 1YMME 4HJJH 4U1NA 1YYLL 3CFKB 4HJ0D 1W0WA 3QI9C 4ONGH 1UB5A 1KIQB 3KYMA 2ENYA 3MLXL 3WEXB 1JGDA 1HNFA 3QSKB 2W60B 2LTQC 4YDLC 3P4OB 3D39B 4LQFL 3VI3E 2VTFA 1M1SA 2NY1D 4CU8A 3D18A 1BIIA 3N1GC 1MOEA 5DI8A 2BVTA 4NFBA 1AO7A 1NAMA 5KVMC 1P7KB 3PGCB 5HI5C 3G08B 1E4KC 4ZSOB 3BSZH 1XR8A 4ZO9A 43CAA 4G8FB 4XAWH 5I18H 4UTAL 2APTA 5BV7H 1SMAA 5EUKB 3RQ3A 1CD0A 5TE4L 4PJBA 4X6DB 1IM3A 3O2WL 4RQQA 2FGWH 1O7VA 4K9EH 5DZLA 1BPVA 1U3YA 4WFFD 2BJML 4U1MB 1D7FA 2IH1A 4A6YH 4PJEA 3FCTB 3VFSB 3AU1A 3M8OL 3Q3GA 3P9LA 5EFIA 4P3DA 2DBLH 4X9HA 1FDLH 3VFRA 2V6HA 3EO0A 1FLRL 4Y0GA 1BZ7B 5D96B 3V4PL 3UDWC 4P9HL 2HVJB 3D2UB 2KKQA 3P0VL 2GFBB 5D7LA 3ZHDA 4XP1H 4RFNC 1UXSA 4ORGB 1T1YB 2YWYA 5DMGC 5A2IH 2R0ZL 4M1DL 2P47B 1VFUA 1AGBB 2Q8AH 5J1AB 4FG6D 1IGJB 2CLVA 2EICA 3VFMA 5JW4N 2Y5TB 4JHAH 4LKXB 4ETQA 3SDDA 1S7WB 4NUGH 2OL3L 4KDWA 4EOWH 4H1LH 2WBWB 1M7IA 5F9WB 3NVQA 3SE3C 1BMGA 1MREL 3OAZH 4JDVA 4KVCH 2L0DA 2EE9A 3MRCB 3MLYH 5EU6E 5KVFH 2YRZA 1LK2A 4NQXA 4Y8AA 5M94B 2VLRA 4PRNB 3WL9A 4PJ9D 2F58H 5I1GH 4M02A 2H1PL 1C5CL 3BJ91 4KGJA 3W5MA 4XPTH 3BKJH 4CVZA 2A6KA 3P4MB 1ZT1B 4PJXA 2VXQL 3IJHB 5EU6D 5C0BA 5SWSA 4GMTL 3PV7A 1ZVHA 1KLGB 2W0FB 3BMVA 3J7HA 3PGFH 2XTJD 3T4AA 4BK4A 5C9KA 1W8NA 4KJWC 4PY7B 1MAML 4Z7WE 1QBLL 5CILH 4Y2DA 4DZBB 1YEHL 5CJ8A 5IJKC 4S10A 2Q6WA 1JL8A 1UG9A 4X6DF 4Z7VA 5CEYA 1TETL 1MRFL 2DQJH 4OUOA 4XRCA 2P42B 1FGVH 3NIDE 3FONA 3VRJA 5I19H 2YPLA 3PDDA 4UZGA 2ZG2A 4YPGA 3IDMA 3L9RA 4PJHE 5D2LE 5IBTH 5C0EB 2R69L 2IQ9L 4JFYB 2E7LC 4XHQA 1BQHB 4P2CG 4R0LC 5DWUH 1GGIL 2VC2H 5HI4C 3TVMB 1IGML 1OTTC 1ACYH 5JOFB 1KEMH 4LCWA 3ARFC 3THML 3DHMA 2WWKO 5CD3B 4M7KL 2DLIA 4MDJA 4PJDA 2AK1L 1FN4B 4H20L 1VFMA 1ZS8B 5EG6C 3VXMA 1FQ9C 1NCAL 3N9GL 4IRJD 4WEUD 1LEIB 1BOGB 5J13B 3EHBD 3BRFA 5J11B 2ED7A 5BRZB 5A40E 2P48B 1ZHKA 4P59H 2I9TB 1A1NB 2PW1A 3MV11 4CL7A 1UKQA 3S96A 1TPXC 1LK3L 2E3VA 3CFEA 1RHHB 4QXTA 3RTQA 3V8CA 3EYQC 3L5JA 4ZAKB 4IJ3B 3FB5A 3RPIB 2JLLA 1XGQB 4ZTPH 1IM9D 1MJJB 4L1DA 3CCHB 5FYKL 3ISWA 1LO2L 5KVDH 3OAUL 1BD2B 4OZGA 3VD4A 4D9LL 3SKNB 4HWBH 5CZVH 1IAKA 3K2UL 4S11A 2RJMA 4PJGF 4JM2D 5CCKL 1L0YA 4A6YA 5INDA 3FQXA 1A02N 2YD8A 1J8HB 1LO5B 4UQ2B 2G75A 4JREC 4ELMA 1OF2B 1A6UL 4G9FB 1T22B 3VRLF 3QIUB 4OZFH 5IVXE 4B50A 3LHPL 3QXWA 1DANT 5C0ND 3QISA 1AC6A 3MJ8B 4X6CE 5I1AB 3UZEA 2FWOB 1F4WH 1S7TA 2ZNXA 2VABB 4H1LA 4EQ2A 3C09B 1AGDB 1JNLH 4M43H 5T3ZH 1S5HA 2VL4A 2P43B 4LPXA 4I48A 4NQCB 3LAFA 5GGVY 4GXVL 3O2VH 1IC1A 2EKSA 3VW3L 1BVZA 2YPVL 4I0PB 3VWJD 1ULVA 5MENE 4Z76A 2FX8L 4NHCH 1Q9KA 1WC7B 4ZXBD 3FRPG 5E4EB 4ZTOH 3O45A 1T5WB 3W39B 2PXYC 4JKPH 3VXOB 1CT8A 1F8TH 4GW4B 3HE6B 5MEND 1Q8MA 1FZJB 4LVOB 1EAJA 4Y4HC 1TVBA 4P9MH 4MXVE 1LO4H 3JV5A 2AK4A 1N2RA 1ZT4B 4NQEA 3ZKQD 5JQ6L 3VXTB 3VGBA 2EDWA 2R4RL 1AR1C 1YN6A 4KKAC 2P5EE 1ZVSA 5HXMA 3MRNA 2OXHA 5EA0L 2NW2B 4MNHA 3RP1A 4U1LA 3QNZA 3KPRE 35C8H 4FQHA 4HQQL 3ARGA 1DTUA 3BDXA 2D7TL 2PYFA 4FXGB 4NBXB 1MCWW 5F6IC 1IARB 5C0RL 4EEEA 2ZOKB 5HD8C 1SM3L 1R24A 3KLSA 3O3EA 3QDMA 2AGJH 2D31A 2XKNA 1G7IA 2V7HA 1U8LB 4ZOEA 5FECA 1CICD 5TQ2H 3UPAA 5HVHC 2PYEA 1P4IH 2YR3A 1INQA 4WUKL 1HWHB 5D4QA 2APFA 4PRPA 5T1LA 4WHDA 2FATH 4KQ3L 4K23L 4U6HA 3UPRA 1I1AC 1U3HC 4LSUH 2D7PA 2JELH 5DJCB 2X41A 4CMMA 1C08B 2J8UA 1MFCL 4KDTC 4XP6H 2Z92B 4O02H 2Y6SD 1H5BB 3MRKA 2FIRT 5IESL 2YZ8A 5IMKB 5IROA 3QCUH 4F2MB 2VAAB 2GITB 5HYFA 4KROB 5LBSL 1WFUA 3HPLB 4OLUH 1FRGL 2WQRA 5GS3A 5T3XD 3WDJA 5TE7L 2FIKB 3IJYA 2BDNL 2ICWA 3B6SA 4HWBA 4WCYL 1Y18B 5EWIL 1DEEB 2P49B 1ZOXA 3IRPX 1BFOB 1IGYA 1YYMH 4LSSL 4LLWB 2A6JB 4Y4FD 5JHDE 2WINA 3QZWG 1MFBH 2VITB 5C0AA 4DVBB 3BP5A 4OZFA 1UVQA 1DBAL 4GQPH 1ZHLA 1CFQB 4X7CC 3RDTB 4BZ2L 3LB6D 4PV9A 4FTVB 4U3HA 5DHVB 2ICWI 1IT9H 1MJUH 5HYJB 3LN5B 3L7EB 4XMPH 1YQVL 2AJYL 4FP8H 1I4FB 3ARDA 3IDYC 5DQJA 1QSEA 3LQAL 3TBYB 1HKFA 4KJQC 3QFJE 1IC7L 3RHWK 3G6AB 3PNWA 3DUHA 3QDGD 4GKNB 4HUUA 3KXFE 1I8LC 5EOTB 5IMOA 4PUBH 1TJGL 5BOPA 3ECBA 3EZ8A 3OJVC 4Q0XH 4QCIB 1Q94A 1ORSB 3EFDH 3S97C 2Q20A 3SDCD 2OJEA 4UOJA 1KNOA 3VXQA 2A74A 3C5ZA 3EDEA 4L4VD 4DAGL 2HRLA 4L4TE 1KXQE 3UBXA 4MNQB 1JZ6A 1KCVH 1NSNH 1R3KA 3KPOA 4YXLL 1JPTH 4K71C 5DC0A 2O26U 2DAVA 1X4YA 4L4TD 1N7MH 2DI9A 5EC1B 2MQ0A 2QQNL 4R90H 2D7MA 4FFVD 5E8NB 3EDFA 1YPZB 2OZ4L 4X4YB 5E8DL 5TFSH 2UY7A 5IFJA 4YJZL 3X14A 5F3HB 3ZL4L 4LOUC 3MFFA 4NJ9H 4PGDB 4U6XA 5J89A 1U8NA 4N8CL 4XVSL 5IT2H 4J4PA 4NSKB 3QP3A 4OM0L 4Y7MA 4YQXH 2KQNA 5F1NA 5I2IB 5JPNA 1LE9A 7FABL 5GGSB 3FN9A 1ROWA 1AHWA 1X5XA 4P57A 2X70B 3VE0B 2DQHL 5IG7B 4G5ZH 1RFDH 4LEOA 2D0HA 1MRDH 3V5DB 4MWFB 2VH5L 3O6LL 4X9BA 1A7PH 3WO3B 5CS7A 4PR5B 5I1IH 3LKRB 2X4RB 1S9YA 1QA9B 3KG5A 5IB1A 4QRTA 4GS7B 1DQTA 4MXQD 1MI5B 5FCUH 1Q0YL 4NNPL 3T2NH 3ARBA 1GAFL 3RI5K 4XP5L 1FV1A 2DQDH 5E2VL 1I8IA 3LH2H 2UYLB 1Z3GH 4X5XB 4APQC 4NN6C 3UZVB 2AABL 2X4TB 1H8SA 3AY4A 1RVFL 4R2GC 1QNZL 5A3ID 3FZUD 3WNMA 4LKCB 3LKQB 1OAYH 3PDOA 4F8QA 1PQZB 4LSDA 2P5WB 3OXRA 1T7VA 3DO7B 1MF2H 2LU3A 4MLIA 4MVBD 5D1QD 2I9LA 3H42L 5KW9H 4EKXA 2HTKC 3QCVH 3FB7A 4OSUL 5F9WC 2AQ1A 4PRBA 2YPKB 1SQ2N 4MYWB 3F6IA 4H88L 4JN2B 5GSVA 3KLDA 4Z7UB 3GBNL 1UADC 5JR1H 1YEGL 3AB0C 4XWOD 1YPZF 4WWKA 5SWZB 3W0WA 5GRJL 5E94B 1U8PB 4XNYH 2JJWA 4L3EB 4KQ4H 4IDJH 4FZEH 4WJ5A 3QT2A 3H8NA 3C6LA 3T04D 3IKCA 4EZMA 2X4OB 3LRHA 3HI6H 1MHPL 5JW4R 3V5HB 1EEZA 3T0DA 4LFHG 1FNFA 3FOLB 3WNKA 4G8IA 5LGHL 4OZHE 4QRRA 1CF8H 4AIXA 5E0QA 1WTGT 4AEFA 5KTEH 2ZCKH 4BKLA 3DXAA 1I7UB 3QUYA 3JXAA 1IMHC 1DL7H 5DUPH 4P46D 5AWNL 2OTUB 3ULUF 3T3MF 2L4OA 3IDGA 1D5IH 1HQ4A 2MJWA 5J8OA 4W4NA 4PTUA 4N0FA 1TTFA 2JKXA 1RZ7H 3LMJL 3SO3B 1RMFL 1I9JL 3F7YB 2WP3O 1U8OA 2DICA 4MMXC 4Z5RB 2BMKA 4K7FA 5K9JH 1BAFL 1NGQH 2GW5A 5GZOD 5HHMD 1J12A 3X12A 5KSBA 1C5BH 1NJ9B 5ACZA 5GS0H 1CU4H 2DQTH 3GUTA 4M5YH 1VEOA 1NMCB 5JORB 1TZIB 2JK5A 1UC6A 3KPNB 1U41A 1V7NL 2VDLL 3AM8C 1QSFE 3FTGB 3O41A 3VFTB 5FK9A 5GRWA 2FDBP 2EC9T 1WAAF 2OMBA 4Q58C 3NBNA 3FT2B 5D6CB 5FF6B 1S7QB 1NC2B 4ODTL 1JZ2A 1RJYB 3P4NB 3GI8H 3NAAL 5J11C 3B83A 1M7DA 1MCOL 4ZD3H 1HILB 4XCEA 2DQCH 2ARJB 2PUQT 3WE6A 1TVDA 1U8MB 3O9WD 4N8VG 1VB9A 4P5MA 1FVDB 4Z7UF 4M1GL 5DJDA 4PJAA 3BP7B 1INEH 2NNAB 4OGAC 1MH5A 3GB7B 2Z35B 2QV2A 2J6EL 2WWMD 1YDPB 4CKVX 4GRWF 3CFJA 4I2XE 4ZUVA 5FA4B 5L8LB 4HWZA 2F5AH 1A1MB 3TT1H 2DM4A 5F9DC 1KG0A 5FFLA 1WBYA 3TBWA 2VLKE 2JB6B 2UV3A 5L2KD 1OB1A 4X80H 1BF8A 4IIQA 5I1CL 2H41A 2GSGB 2D3VA 4QT5A 1DBMH 4PGEB 1DLHB 1U8QB 1V05A 1HHHA 2VLKD 1P7QB 5C09E 5I6XB 3UTSA 2WUCH 1EHLL 2XZQL 1L0XA 2HFFB 1UM4H 3TO4A 4V1DA 2OQJA 2QHLA 4RISL 4MQXC 2OTWA 3A67H 1JHTB 4X6EB 3WIIL 4TQEH 4JFOA 1HXMB 5EO9B 3FO1A 5IHZA 2NY7L 5TF1L 2AJXH 1M05A 3S5LA 4DJMA 1OAZH 1CXIA 4GLRH 2XG4A 3U0PA 3C09C 3SDYL 5GRUL 2W0PA 2BCKB 2LU7A 1BQLH 3LPWA 1AD9A 3BHBA 3ROLA 4D0DA 4F37F 3TA3D 4JZJB 1BWWA 1XGRA 4OQ1A 3UP1A 1U95A 3Q6GH 1FBIL 1WWBX 1SYVA 3CXDH 4I0PC 3P11H 5BQ7A 5JUEH 2DMCA 1MIMH 1A7NH 3AREA 5MHSE 5IUSA 2VR5A 4U7SA 1QVOA 1MNUH 1PEZA 2YMXH 3CDYA 3DMMB 1FFOB 5SX5K 3VGAC 5FOBB 3GMMB 5FYJU 4KK6C 1WLHA 4WW2B 3HA0A 1F11A 3OR7A 4YIQB 4D3CH 1WZKA 4UIKH 4LVNC 1LP9A 2HLAB 3JTTA 2Q76A 4RDQF 1BBDH 5MHSD 4OCYL 3NFPA 2DWEA 3PWJB 25C8L 3PQYA 1GYAA 2CDFB 1ZEAH 4MHHI 1MJ7L 2H26A 2OTPA 3FQUB 4KC3B 3RZWA 3MRHA 3BI9X 3GNMH 4PYGA 3S34H 3K8MA 5KAQG 1EO7A 4NKOA 3R4DA 4M8QB 4W4OC 1A9BA 5L88L 3BKCL 3BD3A 4XZUA 4W6YB 1JZ4A 3D3VA 5EZJA 3QXVA 5CEZH 1SEQL 4U0RC 5C0IB 2WIIA 3BO8B 3ULVH 4PG9A 3U6RB 2ED8A 3GSNH 5HI3C 4PGBA 5E6IA 5GGRY 1MHEB 1AXIB 1VACA 3ULUL 2QEJA 2VDQH 5CJQL 5FKAB 3QDJA 5FYJL 3V79C 3MJ9H 1RIVL 3RX5A 3NN8B 1EEYB 2J4WL 5MEPA 1CFSB 2VIRA 4NO0A 3QXDA 2ADIB 1G0DA 1HH6A 1DBKH 2BNUB 4MD0B 4ETYA 1JCKA 3S7GA 2NXZB 2CR3A 4XVJL 4AL8H 2P8PB 3CLFH 2XWTA 5DJ8B 4PJ7B 2G9HA 2VDRH 4FQQA 4OLVH 2CIIB 3DV4A 3QO1B 4OFKA 4HK3J 4KRPD 4YHOH 1A3QA 5F7HA 4M6MH 1UFUA 3QEQD 3HS0B 1BZ9A 1LWRA 4UIMB 2BSSA 3BVNB 1G7LA 3RGVD 4HW6A 5ESVA 1OM3L 2C1OA 2OSLA 4RIRB 4UOW0 2CMRH 4KROC 4MDIB 2MPAH 4P2RD 3RRQA 4UUJB 4JRWA 4WW2F 1KYOJ 4U2ZA 4Z7QE 2X4NB 2LE9A 1QR1B 1RIUH 1CCZA 4NHUA 1D5XB 4GKZB 1H9VA 3W11C 3LZFL 4JO1L 3MTRA 2VNCA 2VLJB 3DVFA 1JRHL 5D7JD 4M61B 5IOPB 4LGRB 4W6WB 5DD1H 4I18A 1EFXB 2E9WA 2QADD 2B0SL 1N3NA 1GIGL 1NFDB 5AYQA 4F9PA 2A77H 4ZFOB 4G6JL 1T1XA 4AG4H 4NZUH 2BNRE 4S1RH 4C56A 4DN4H 1R3LA 3S88H 1JHKH 3WO4C 5LGJA 2IPTH 3T0EE 2DMKA 1GC1H 3RDTC 3MRDB 1HDMA 4LSTL 1MY7A 3CZFA 1ZV5A 5CGYD 5ITBL 3HE7D 3L5XL 4AK1A 3PWPE 4DVRH 1J11A 3MA9H 3MV8D 1CFVH 1FL6B 4M1CC 3RVUC 2AJZB 2BNRD 5IIEB 1IQWL 3BWUC 3T0ED 5EUOA 3QFDA 2AW2A 5DJXA 1J7VR 3OJDA 3VXRD 3MRJB 5FUZH 4I3RL 4KY1H 3K46A 2X7LB 3SDXE 4KI5D 3VWKC 4R26L 3OKDB 4O4YH 1B0GA 4JQXA 2O5XH 1YN7A 4IOFC 2DLFL 3IDNA 1LDPH 4N90E 4PJ7F 4YDKH 3KDMA 5IW3A 4MAUH 3QA3A 4QXWA 4R4BA 5E7FA 2E27H 2L7JA 4XNZB 3RJQB 1WT5A 4YZFE 5FOJA 5CWSA 2X09A 5HGBB 4N5UA 4GLRI 5GGTL 4ZNCD 4EN3B 4IBLT 2BZDA 4JFHE 3VGHA 4AY0A 3B9DA 3D0LA 4HKXB 4N90D 4P2OD 1JWUB 3BQUB 1R0AH 5DMJB 5DJAB 3N50A 4U1JA 2HWZH 3JVGA 1YJDL 3NPSC 4E41A 3Q5OA 4PG2C 1ETZB 4O2EA 4JFHD 4XNMA 1TJHH 3ILQD 4G6MH 5DURB 3ULSB 1IGTB 3P0YL 1I1YB 4HUXB 1F42A 3S8WA 4PP1C 3IFOA 1T2XA 4PRAB 1Z9LA 3WFCH 2YRPA 1YMMA 1DFBL 4LEXL 1N5AA 3N06B 1NANH 5ADOH 1NFDF 1ZT7A 4CADB 3IT8D 5B38A 3SPVA 4O5LH 2QSTA 3MJ9A 1WIPA 3DVIA 2XFXA 3P2TA 3GSWB 4UU9B 4TNVF 5EU7C 5FM5O 1JWSB 4NO3B 5B4MC 3ZHKA 4RX4A 3TNNA 5HHOB 2GSIB 2EDFA 3MRBB 4NC0B 3TEUA 2V5TA 4E42A 1F3DH 3SDAD 3BN3B 4F7PA 4OF0A 1YNTA 3SKOB 1JFQL 5DS8A 3FQTB 3T09A 5F7NC 1Y6MR 1AIFB 4HJGB 3F58L 5CBAB 1BHGA 3B8SA 1NUGA 2PW2A 2V9RA 4RA0C 3QIBA 4YUEH 4HPYL 3BEWA 3OKKA 4NKQB 4ONHA 1GSMA 2NY3D 4E5XA 3ZT5A 3F8UB 5ENWA 2ORBL 1ZMYA 5C0CA 4HKBA 5JW5B 2LQRA 2ED9A 4LHUA 5F96L 3U36A 4MD4A 4PV8B 1IE5A 5DD5H 4YHKH 1BWMA 5FYKE 4ZUSA 1QACA 3LRSB 4N0UA 4LBEB 5BS0E 4JFEE 5F9OL 1N6QH 3UJIL 3N1FC 4XMKH 1AXTH 1F4YL 5FYKD 4G6FB 1FFPA 1AP2A 4NQDE 4L8BA 5I8KL 3WIHH 4XBEL 4OCRL 3GI9L 4MSWA 4ZUTA 1H0DB 3BKYH 4RWYL 1JGVL 4NOBA 3RU8L 4WI4A 2NTFA 1DUZA 3G9AB 1E4XH 4JLRA 3QUZD 2EDDA 2ZUUA 1XH3B 4JQVA 1TENA 4ZOBA 2W65A 4D9QE 1KCLA 3NA9L 3OV6A 1YNLH 4KUCD 4HCRL 1IEHA 1B0RA 2XA3A 3QQNA 4XHJD 3P9WB 3FO9B 3F12B 3RUGF 5D72H 3WJLC 1O5DT 1XGTB 4D9QD 1IKNA 4CGTA 2XQBH 3SO3C 3B9KA 4Z7WA 2QSCH 2CRIA 4EDXB 1EEUA 1MLCB 2PO6D 4FS0A 1HCFX 4U1GB 1T2QH 5FO7B 1MWAH 4HFUL 4YO0B 5E8EB 3U9UB 2ATPB 2G5BA 4G8GA 1NMCC 2WM0A 3NOIA 2OR7A 2DQEH 5ECJE 4PJIA 1TMCB 4U4BA 3RVXC 4C83B 2ICEB 5GGQH 3CFDB 3KYNA 4OLYL 1WIUA 4X83A 5KG9B 1WTLA 3D25B 5CD5C 4Z8FH 2IFFL 4PJHA 5D2LA 2Q1EA 5DMKA 3D39E 2D03H 3Q1SH 3LSOA 3BZ4B 2X4PA 4HUWA 4Z77A 3QQ9D 3SE4A 2FX7L 2R1YA 1UWEH 4WV1C 5EC2A 1KSRA 2ZKHH 4PLOB 5ITFB 4ZSOE 3D39D 4K3EL 4FQ2L 4FQXA 2X42A 2GHWB 2IEPA 3GMRB 2HJKA 1EMTL 1Q0XH 4JFXB 3SCMD 3AXLA 2QQLL 1JNNH 5A2JH 4JQIL 5T1MB 3OKYA 4U1KB 4X6DE 2ERJC 2WBJA 3O8XC 3QQ4A 1IL1B 2AQ3A 3HB3D 1CR9H 3GMPB 2BNQB 3G5XA 4R96A 3NIFF 3PWLB 4JRYB 1NANI 1G7JB 3D85D 3I75A 3FRUB 1MRCL 1JHLH 1UQSB 3HFML 3TPKA 1FG2A 1NBZA 4CVWA 3MCKB 3GSXB 4JB9H 1F4XH 1G6RL 4DEPB 1NGYB 1UXWB 1OLLA 3CFBA 4JFZL 5E2WL 5DR5H 1JN6B 3OKLA 5TPWL 3EW3B 4OI8A 3RX7A 2HG5A 5HY9A 4YHIB 2HH0H 1BEYH 3B3IA 5DZNA 3SGKC 3HC4H 3U46A 1EJOL 4J3UA 1WSST 2LABA 5I1EL 3PIQA 3EJZD 3E6FA 5DRXA 1V3KA 2DYPD 4ZUWB 5IVZA 4H1LG 1ZA6A 2FBOJ 3HNTH 1YUHA 1C12A 5IVXA 4HC1H 4QWWD 5IBLC 3ZO0A 1KBGL 2CKNA 4MB5A 1RK1A 3MO1B 5KANI 3V0AC 4DZ8B 8FABB 3WIHA 4JRXD 4X9GA 4K3DH 1B3JA 2NR6D 1PLGL 2DIJA 4YGVA 3OGCA 3L7FA 4TVPL 3U7YH 3DMMC 3OL2A 4A2MA 3OX8A 2Y07L 1FNLA 3DHJA 3JUZA 1G6VK 4WGVB 1RZIA 1T80A 5IF0B 3MOBL 3FO2B 1MQKL 4PJGE 2WUBL 5EBWA 3BZFB 3VDCA 3HZKA 4OD3H 4JG1L 2DQIL 1MHHA 1XIWA 4OKVB 5JXEA 3RL2A 4PJ8A 2C1PB 5T33H 4FA8A 3WD5H 3U9PL 3R8BB 1RUKH 5CBEA 4OCWL 3JV6A 3ZKXB 2FCBA 1BFSA 4LGSB 2HVKB 3S3JA 3V6OE 2BY2A 2H32H 4FMFA 3VRLE 1T1ZB 5F7WC 2EYTA 2R2HB 3U30B 1FZKB 3ARTA 4OD1L 2EDBA 4EBQL 4G3YH 1XF4A 1E4XI 4M8VA 5JDSA 5DLML 1MWAA 4KZDH 5I1DB 1OSZA 1P84J 3HCVA 4M48L 1U2HA 1S9VA 4LLQB 3JWDL 4G42B 3QPQC 2FECI 2P5EA 4BFIB 1AGCA 2VAJA 4S1DD 3S36L 3UTPD 3BRGC 3GIVA 2IMNA 3BP6B 4WWID 2ENSA 1H8OA 3KPRA 3GBMH 1AE6H 4LRIC 1K3ZA 4NC1E 2XA8L 4MJ4A 1CXEA 3EYOB 2NXZC 3TVMD 4G6KH 4GW1A 5I1KL 1QLEL 5BRZE 3HPJB 4N0RA 4UOW1 3KPSA 3BX7C 1QZ1A 1E6OH 1KB5A 4GKSA 3TLRA 2YEZA 1C1EH 2QQKH 1ONQA 3FL7A 1LO0L 1U58B 3O4LB 5IB2B 1OTUD 1HIMH 2XZZA 4HIJA 4XT1C 5FB8B 2HT2D 5FUOL 1FNGB 4IRSB 4Y2DC 2NY6B 5TDOA 2G5RA 3QULB 4NIKB 5I75B 4NFDA 3BAEH 3LQMA 2CKBB 1BD2E 4B41A 1QD0A 1P2CB 1D6EA 3TIEA 4CNIB 3SKJH 3U4EB 2YBRB 2FD6L 4OF7A 1F6FB 4MA7L 2XICA 1J8HE 4KHXL 5E95B 3MPCA 5CJOH 4TSAH 4QHKJ 3BYTA 1YEDB 3SE9H 3L3IA 3M17A 4CAGA 3EO1B 2GUOB 4G9FE 4MD5B 5DJ6A 5J12C 1A6ZA 3HC3H 4M3JA 5MERB 4N0CD 4KJYB 4XPHH 2OR9L 3EYVA 3BWAB 4S0SD 2CRYA 2J1KA 4TNWK 4MA8L 5I73B 4OIBA 3GO1H 2FJFB 2FEDC 1KCRL 5JHDA 4BH7B 1OP5K 2NX5B 4OF8A 4YE4L 1NC4A 4HC1A 4NQCE 4QHMB 2ADJA 3IF1A 1EH9A 1B6UA 1JK8A 4QXGH 5IEHA 4ZPVA 4IOIB 3I6GA 1M7XA 1CE1L 4Q2ZA 5ICZA 2MQCA 4PGJA 3RTQC 2FR4B 3O3BA 3L95A 4HUVA 5KSAD 1KJ2H 3WNNA 2YSSB 4L5FL 3MROB 2PTUA 4LCCA 4UNVA 3TO2A 4MJIB 3QFJA 4L9DA 4QRSA 1S78C 1I7ZB 4ALAL 5E5MA 3GK8L 4GMSH 3KXFA 3LQZB 3P73B 1A7RL 4EN3C 1BQUA 3MLSH 1XMWA 2CK0H 5L7XL 2ZG3A 4KK9D 4JPWL 5SWQB 1N5YH 3DI3B 3HE6D 2CLRA 1RHFA 3T77A 2EDNA 3TIDA 3N1PC 1CZ8L 2C3WA 1VGEH 3EO9H 4GAFB 2R0KL 2DQGL 4K94L 5D70L 5E8OB 3C08L 4X6BA 4BYHA 2C3XA 4JJ5B 1D5ZA 2X89A 1A7OL 1B6DA 3MUGA 1DBBH 2F54D 2K1MA 3MBED 3K80A 2HRPH 2FO4B 1YA5A 3P0GB 5I8EB 1KPRA 5D1ZD 2DD8L 1A2YA 1LVEA 1WBZB 3GSVA 1U2CA 3SKUD 4BSWA 5HHQB 1X5GA 3QRGH 5ADPL 1X5KA 3DNKA 5F93C 4R4NC 3KNBB 1CL7L 4G7YH 4JY5H 4GBXA 1H3VA 4PB9L 4BQ8A 2A83B 2NY5C 2NW3B 2I24N 3QHTC 2EIZB 5DXWA 5MEOB 1LO3H 5EO0B 1PG7L 1RPQA 5DRWA 3TN0B 4Y16C 5FO8B 1N64L 2GJ6B 3CNKA 4I0CC 5EBMB 4NNYB 5JNYA 4AJ0A 3L3OA 3DYOA 3HNVH 4LLDB 1RUQL 4ODHL 4QGTA 4YFDB 3NMEA 4F7MA 1OCWH 5E99H 3VGDA 5E08H 2H8PA 4NRXA 5I1JL 5LWYL 4WHYG 2M2DA 1QRKA 2NY2B 5DQDL 5KVEH 3VFWB 3ZMRA 4DKEL 5C2BL 4FNLH 4N0YL 3PWUB 2GK0A 5E2UL 4M03A 4XI5D 4FQCH 2V2XB 5F1OB 1JF5A 3LPGA 4ZS6C 4P2YA 3DETD 5GXBB 4XBPB 5ISZB 5CMAB 5GISL 4YDIL 3D5OF 3H2WA 1F5WA 3KS0J 2Y72A 1J1XL 4P23A 4IRZL 4FTVE 4YHNA 3DVNA 3RWGA 1FO0L 4H26B 2IALB 4JM4H 3FQWA 3KYKL 3WKML 1D5MB 5HYJE 3RWCA 1G9ML 5GS1A 3QQ3A 4M3KB 2Z8SA 3F6LA 4QYOA 4N8VB 3MV9A 3G04B 3EFFA 3KVQA 1AI1H 4OT1L 3BZEA 4FTVD 3EYFB 4M7ZB 3HZVA 2H6PB 5HYJD 2NXYC 1JJUA 4HH9A 5TF0A 1KT2B 1FYHB 3QUXB 4X4ME 1DDHA 4OV5A 4L4JA 1HH9A 2RIKA 1KJ2A 1BX2B 1UM6H 2R9HC 5GJSH 5FDWA 5GS2H 3B9EA 2ZPKH 3WSQL 3SJVB 4TUOB 3SEPA 2XG5A 3DSFH 2EE3A 5J1TC 4MA3B 2VE6A 4LMQI 2OM5A 3WN5C 2QHRH 2ZSVA 3LKNA 4MNQE 1U8KB 3L3GB 1JI2A 3MNZB 1CDGA 4GG8B 2X4QB 5JLZA 2HT3D 2P24A 3MRFA 1S9XB 1MEXL 5IR1A 3NGBB 1D9KB 2OLDA 3V0VA 2VR9A 5BMFH 3RVWC 2HFGH 1OQOA 2EE2A 4MNQD 4K8RD 4HLZH 4GAGL 3G6DL 3ZKMD 1NL0L 1C7TA 4Q74A 2DWDA 1T0NB 3PP3K 4MA1B 3RWJA 2DI7A 3JWNC 5F7EL 1YPZE 3STLA 1ORQB 2NZ9C 3REWA 4X4XB 4OJFH 2FB4H 4J3WA 3CDFA 3LEXB 5F6HI 3QI9A 3TZVB 4WGWB 4AM0A 5D1XB 5GRZA 3RY6C 1Z5LA 1NUNB 1QSFA 5ID0A 4PP2A 1A7BA 2CKBL 3HUJA 3TJHC 4BQCA 3ARDC 3O6MH 2MSPA 1EFQA 4F7CB 4LF3A 4JG0H 3FFDB 3H3PL 4HWEH 5TDPA 3X3GH 3EYUL 1YYLH 1I1RA 3IVKB 2F53D 3KJ6L 1NCNA 3ULUE 3S98A 3T3ME 4PIRF 1R3HB 1AQDB 1CQYA 3MLXH 2VQUA 1E4KA 1TCRA 1WFTA 4KFZC 1NFIB 5EBLA 3QXAB 1FHGA 1CD9B 3KJ4B 5IK3B 3WHXB 1MI5E 2Y4SA 1VFAA 4YDJB 5C07D 3EDDA 3ULUD 1K5NA 4ISVB 4JHZA 5FYJD 4FFWC 4P5TD 4C58B 4P4KC 2DTML 4I2XA 4GRLD 1M4KA 4ZPTA 5KSVA 4Y5VC 4DEPC 4Z7OF 1KCUH 1KJVB 1W8OA 2VLKA 2R2BB 3P77B 2Q86B 3C60D 3PL6C 3VGGA 1G9EA 4X7DC 2NYYC 2P5WE 4JGUA 1WAAE 3U83A 3PV6A 1W72L 4O2FA 1NKOA 3OAYK 4JHWL 5KS9B 4HS3A 5LXGL 2VUYA 3EOBB 3HKFA 4GT7A 3ARYA 2EEBA 3S5LG 3UDWA 5C09A 4WEBH 3G5YA 1I8KA 5D71H 4HKJA 5DEGA 3UEZA 43C9B 3CU7A 3CZJA 3QNXB 4QHLA 4ZQKB 2RCSH 1X5ZA 4Z7UE 4MHHG 1FIGH 2AXGB 2GAZA 1L6ZA 3N85L 1VEPA 1JZ3A 1K4DB 1IKFL 4DUXA 2A6IB 5C7XH 3V4PH 1MVFA 1RUMH 3PF2A 2FYYA 4L3EE 4GRWE 3SE3A 2PN5A 3S37L 3HI1A 1AHWC 3DIFA 4YHLL 5IW1B 4MCYA 1LNUA 1ADQL 3U1SL 3DJ9A 1TQBC 2EYRB 1Q9WB 2OJZL 2QKIB 2H2PC 3HZMA 3QJHB 2V2TA 3C87A 1AFVL 1EXUA 4DKDC 3MC0A 4HS6A 1MVUB 2OL3H 4ZO7A 5EH1A 1HCVA 1U8HA 3CX5K 1T21B 2DLGA 5DVLA 1UJ3B 5F1IB 4JZNB 1DQML 2FJHA 3RKDC 4Q9RL 2D4FA 4M62H 4LIQE 3DRTB 1HHJB 2OK0H 2B5IB 4L8CA 1JMXA 1N0XL 5DFVC 1ES0B 3QO0A 3U30C 3ES6B 5IJKA 5DMIL 3T0XA 3VG0L 5KAQF 2VXQH 4GMTH 5CINL 1FFNA 3B5HA 3GIZH 3FO0H 2Z4QA 4YHYB 4JAMB 4PS4H 4S2SB 4EXPX 2EDTA 1MAMH 1MHCB 4AMKH 3VJ6B 1YEHH 4KHTH 2GJZB 2VN4A 5HGHA 2E7LA 5DD0H 3OXSA 3RVVC 5K9KA 1RURL 1T03L 3EUUA 1OARH 4R0LA 5GHWL 1GVIA 2AJVL 3PP4L 4RFEB 1FNSL 3OSKA 1A47A 4PJ9B 5KVGL 3ARFA 1OOAA 2B7DT 2Y7QB 4OTXH 2Z31D 5E1AB 5IB5A 1ZWIB 3H7BB 5IQ7L 3WS3B 2BSTA 2EH8L 1F90L 4XGZA 3LS4H 3L6FB 4LL9A 4IRSC 3RGVA 2XTJB 1IGMH 2HT4C 4ELKB 2ZJSL 5I75C 3O11B 4ZODA 1VKXB 2RHEA 3LIZH 4NPYA 1FZMA 1II4E 1L7IH 3IDIA 2UZIH 2PKDA 4U05A 1NCAH 4G80B 4KK5C 2X1WL 5DK2B 4RMQA 3WLWC 1OT2A 4PY8J 1FYTE 3WFDH 4Z7NF 1U8JA 3KYMB 2QR0B 4ODSH 2F15A 5AD0B 1JGDB 1U6AH 2V5SA 3AAZA 1CDYA 1RZKL 1UB6A 2XI9A 1RAMA 4HS8L 5DRZB 3BH9A 4ZO6A 1EDQA 3MJ7A 1FYTD 3D18B 1BIIB 4WFHE 1MCKA 4CUCA 4YEFA 1VPOL 3D69B 1DVFC 1NLBL 2W38A 2R2EA 4HIEA 3KPLA 1CBVH 3NIGF 3QUMH 3O2DH 4XX1E 2O5YL 4BSVA 5FYLH 1HHIA 4WNQB 4NN7C 4IRJB 4YHZL 4HBCH 4JPVH 5CHNB 4RMUA 3VD9A 1I3RB 3F7RA 1GPOH 2AI0L 3PWPA 1HNGA 1DQDL 1IGCL 4FHBD 3NACH 1A6UH 4PJBB 1IM3B 2A9NL 1V7MH 4R7NA 1KELL 3EOAA 4RQQB 3VXUD 1RIHH 1YEIL 4XNUH 5TQ0H 2A38A 3LHPH 5DRNA 4QOKD 4YHPA 4F57L 1B0WA 3CJJA 5DJ0A 1IM9B 4HPOH 3AU1B 5EFIB 5F9AC 3GM8A 4P3DB 1ZHNA 4DGYH 2M8XA 1Y0LA 1A3RH 1PZ5B 3VFRB 4PRIA 2JIXD 4YC2C 5LQBL 2X4UA 3HRZA 3MBXH 4GAJH 3OKMA 1OP9A 3UYPA 3TWCL 5D7LB 1YEJL 1JGUH 1NAKL 2PXYA 2OCFD 1UXSB 4MCZB 1UACL 1XF3A 4QTIH 3U7AA 2AJ3A 4XXCC 4EI6A 3VW3H 2CLVB 1NDGA 3HLAB 3VFMB 4Y4HA 3RVTD 3V7AE 3R06B 4ETQB 3T65A 2VL5A 2RFXA 4QHKI 2VJXA 4U6VH 1MCLA 5DSCA 4O9HL 4NZTH 4JDVB 3QCTL 1TFHA 2YRLA 1I9EA 5D5MB 12E8H 3IFLL 1U93A 4K7PY 5B38G 3GSUB 3S4SA 5C6TH 4LU5H 4LLVA 5JQ6H 4ENED 3TV3L 4LNRA 4CVZB 5C9JB 1JYWA 3CFIC 4PJXB 5IBUG 5L6YL 5H37H 4PJ7E 1IAIL 4ZFZA 4I3SL 2DQFA 4JANA 3T4AB 3AREC 4U31A 2GK2A 2B2XL 3BGFC 1RK0A 4MAYA 3U0TA 5LJYH 4X0KA 2HFEA 5EZIH 5EN2A 3FB6B 4JGJA 4ZXBB 3BUTA 2X10A 4XPBH 3M07A 4S1SH 1BJ1J 4K3GA 4P5KB 4DWHA 4UDUA 3NA4A 2Q6WB 4PJBF 2APXA 2IANA 5CEYB 5SX5H 1I1AA 1U3HA 3HMXH 4N1CA 5KZCB 1N0LA 5ILTL 5LCVH 4KDTA 3VXSE 1NGWA 1WITA 3VRJB 4H8WL 4O2CA 3MX0A 4OB5H 3CSBA 4POYA 3P30H 3LVEA 4LHUG 1REIA 2YKLL 4PRHD 4KQ3H 1RUPL 2VLJE 2B8OT 5IMMA 3WIFA 3VXSD 4JFFD 2WV3A 2NY2C 3UO1L 1CLZL 1GL4B 5TE6L 4YAQA 5GSRA 4JCLA 3X11B 1H3PL 1NFDE 4PBVC 5ETUA 4KAQH 5BW7C 3BXNA 5ALBL 2VLJD 1DBJL 1JF1B 3CVHL 4MDJB 4N68A 4EUPB 4DGVL 1HQRA 4HZLA 3K74B 3QG7L 4Z0BL 2XACC 1I7TB 2CO7B 1E0OB 3NCYP 3RWHB 3LD8B 5BS0A 4JFEA 5GZND 3QUMA 3O2DA 1CICB 2M1KA 3RIFK 5MP6H 5D5MF 4OLXL 3GSRA 4QXTB 2MKWA 1BJ8A 2IQAA 4NQDA 4F8TA 4L3AA 4POZD 1S5IL 2EYSA 4OD2A 4LSSH 3QUXC 4GH7B 1Z0MA 4PGCA 4ZFFB 1I7RA 3BUYA 4FQ1L 4JO3L 4PJXF 4WUUD 2VLME 3PGDB 5F7FA 3L1OL 4H25A 3VFVA 5CJBA 3QNYB 4OZGB 5L8KB 3MXWL 4MNGB 3VFOA 1AXSA 3BIBX 1YQ2A 4HDIA 4HWNA 1AKJD 4TSCL 5INDB 3FQXB 1MFDH 1CGVA 1SEBA 3UROR 3S3PA 1I1FA 2G75B 4Z7VF 1YQVH 3QUKA 1A9EB 3QHFL 5IB3B 3BT2H 3LDBC 3JZ7A 3CSPA 2XRAH 1IC7H 5C6WH 1OGAD 3NGBC 1YECL 4HXBL 4XNQA 3BKML 1EJ6A 5DHYA 3K4DA 4UNUA 4Z78B 5I1LB 4TVPD 4CJ0A 1GGUA 4MA1C 4FQIH 4Q9QL 3GGWA 4Y4FB 3KWWB 1S7TB 4H1LB 4F9LA 3CFKA 4G43B 1E4WL 1S5HB 5DURD 2LVEA 3TZVC 4D0BB 2DTSA 1BVLB 4OGXH 3C9NB 5D1XC 3RZCD 3EJYD 2BHZA 2A0LC 3WEXA 4PJDF 3MODH 2W60A 1GGCH 3GM0A 5HD8D 3REVA 3P4OA 4NCC1 3ARWA 1KGCD 1P4BH 1Q9KB 3MXVL 1FGNL 5HHOE 1QP1A 4JY4B 3VFPB 3QDGB 1P7KA 3PGCA 5FHAL 3G08A 3RUGE 3PHQB 2EDHA 4QXUH 3BDYL 1FAIL 5I71B 1LDSA 1MFAL 4XC3H 3JWOC 4Z0XB 5HHOD 3KJ4C 1HKLL 5EUKA 1ZHBB 4XVUC 4KJPC 1G9NL 4XNXH 1Q72H 1KPUB 1RSFA 4AEIH 4X6DA 3HMXA 4OZGF 1TTGA 4L4VB 1NAML 5KANG 1MSPA 1HEZB 3JVGC 2IPKB 4U1MA 2A2QT 3FCTA 5F44A 4KMTH 5IGXH 4RGOH 4HEME 1FORL 1CXFA 5C08E 1BJMA 1T89C 4BZYA 1ERNA 4HJ0C 4ELMF 2ZUSA 4CVXB 3K81A 2G2RA 1PD6A 1QQDA 5DJ2B 4APQA 2PYFB 1KIRB 1FNEB 5EZLA 2HVJA 3D2UA 4WO4B 2DDQH 4ORGA 5C08D 3IAPA 1G7IB 4ZYKB 5J1AA 1IGJA 1Q0YH 2PYEB 3HR6A 1P53A 2NY1C 1UA6L 3IS0X 4LKXA 1PX4A 3I50L 5HGDA 3NZHH 3U0WL 3QDAA 2AABH 3OWEA 1QNZH 2B4CL 2C4XA 3QXTA 4CMMB 1SJHB 2DJSA 1Z9SA 1YNKL 3EIFA 1YY8B 5DQ9B 4PRNA 3NIFE 4LAJH 2CDGB 4HEPG 3WKNA 5JPMB 3KLAA 2Y23A 2ESVE 2P8LA 3LS5L 5F7DA 3IJHA 1TZGL 3UAJD 2W0FA 2R2CA 3B6SB 1J0KA 3Q48A 2Y25A 5CJXC 3QG6A 4PY7A 5LKNA 1EPFA 5DUMH 3MRIA 2B5IC 3QRFM 5J06A 5DEZA 2ESVD 4DZBA 5GRJH 4LSQL 3U2SA 3D9AL 2ZUTA 1I9RH 5D7SL 2E9IA 3O6KL 4CMHC 5H94B 3KR3H 3C5SB 4C4KT 4YHYC 1OD7A 1A0QL 2VDML 5AYUL 1MQ8A 4OLWH 2V5RA 1ZHLB 4XPFL 1KN2L 2F19L 5D1QB 2W1NA 4PV9B 1IGFH 1WZLA 5C0EA 3FQRA 4JFYA 4U33A 1FL3B 4LRNL 5HTSA 1FC1A 3LMJH 3D0VB 1I3GL 1NCWH 5FV1L 4NQVB 4CRPA 1OL0A 3AM8A 2FX9L 3SE8L 2O5ZL 5CGTA 4PJ9C 3PNWB 2VXSH 4IS6A 1BAFH 4HUUB 4NM4H 2IWGA 5CD3A 2YD3A 1FN4A 4WVRA 1JF6A 2MCPH 5T5FL 1LEIA 1BOGA 5L9DL 4XC1H 4LSVH 2XTJC 3A6CH 5BRZA 4HJJL 5DGQA 4S1QH 2J8UF 3BN9D 2I9TA 1FC2D 4ODVH 3VXQB 4ONGL 2BNQE 1U8IB 4LLYA 2Y36H 2IAMD 1RHHA 5HHVH 1WWWX 4P2QD 5E6YA 4ZUUA 4P46B 2E7MA 4JRYE 4ZAKA 5IV2A 3GZKA 4YXKH 3RPIA 1XGQA 2X6MA 4OZHB 3NAAH 1MJJA 5K9QG 5JOEA 2R0WH 1A6TA 4OGYH 1JGLH 1BD2A 2ADFH 5HHMB 3WS6C 4HF5H 3B2VL 3BSZL 1Z6JT 3TPUA 3E3QE 2E7BA 5I9QB 3G6JA 1J8HA 5BV7L 1LO5A 3A6BH 4F7EA 3X14B 2HJFA 3MFFB 1RJLA 1GOFA 1UH2A 1OF2A 1NUDA 4U6XB 1U8NB 4X7EC 4G9FA 4WI9A 5DO2D 1T22A 2FGWL 4FFZH 3ZTJH 4CJ1A 4K9EL 4EVNA 1N8ZB 3QIUA 5F1NB 5JPNB 3VFNB 4MLSA 4IRJC 3CPLA 5JW3H 4A6YL 3MJ8A 2CUHA 2VXVH 3EHBC 5DZOA 3W9DA 2VZTA 5DHVH 3UPCA 4P57B 5I1AA 1B2WH 4TULL 2FWOA 3TGXA 2DBLL 1FDLL 1KLUA 1G7HA 2VABA 1AGDA 4OCSH 4WU7B 2ARWA 1QRND 4K7PH 4LHJB 4BELD 4Q9CA 2DL9A 3VU2A 4NQCA 1S9YB 2DLTA 5IB1B 3CVIH 4QRTB 2Q8AL 4NRYA 3ARBB 4PD4J 4I0PA 3VD3A 2MHAA 1VA9A 2XIDA 1J9CT 5F1SA 2YWZA 4LDEB 4NUGL 1I8IB 3FB8B 4EOWL 4AT6A 5L2KB 1OAUH 4JM2C 1DLFH 3W39A 4NKIH 3FT4A 3VXOA 3S35H 2YN5A 1GOGA 4P48A 4KVCL 1MCJA 2D7QA 1Q9OB 1FZJA 2GTWB 3OXRB 4G9DA 3MLYL 4K7PX 5CKAA 1HWGB 1NGXA 1O0VA 3RL1A 3MCLH 1ZT4A 3J8F7 2F58L 2FHCA 5I1GL 4OQTH 3CIQA 4XPTL 1ZLSL 3BKJL 2F74B 1MCSA 5C0NC 4W4OA 2IH3A 3PGFL 3TBTA 5E03A 2NW2A 2P4AB 4KK8D 3W0WB 4XP9H 4OLZH 1RJCA 3V0WH 3DVGB 1P7HL 3C6LB 2R23B 2DQJL 4FXGA 5HBBA 3N0PB 4C59B 1Z9MA 2ZOKA 1EEZB 3QIWD 1FGVL 3VWJC 3DYMA 5I19L 1GJIA 1IZJA 4ZXBC 3O4LE 4B7LA 1P1ZB 1URLA 5IBTL 4OGAD 4PBXA 5LAXA 3RWFA 4XMLH 3X13A 5DWUL 2BVOA 1C08A 2VC2L 1ACYL 1H5BA 2APVA 4ZFGH 2F9BT 1VGKB 2BMKB 5EU4A 4PJ5D 4FQJL 5IMKA 4Y19A 4F2MA 2NY6D 2VAAA 4YR6B 3X12B 2GITA 5JW4M 4KZEL 2X9WA 4YH6A 2E7CA 2AAVA 2EDYA 4TTDD 2FIKA 4F58H 4DW2H 4P59L 3O41B 3V5KB 1Y18A 2D0GA 5FK9B 1B4JH 5IW6A 2P1YA 1DEEA 2OMNA 3NABH 2WLYA 5E1HB 4JFDD 4UT7H 5TGBB 1MCRA 4AZ8A 4RMVA 1M7DB 2YD2A