3FRUB

Neonatal fc receptor, ph 6.5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/binding protein)
molecule keywords NEONATAL FC RECEPTOR
publication title Structural basis of pH-dependent antibody binding by the neonatal Fc receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 99
sequence length 99
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fruB00
5SWSE 2YR3A 5I71C 4P99A 4NN7C 2D2OA 3ZKXB 4EDXB 4Y4KD 3QO1B 4NO0D 5C3TA 3AUVA 1GYAA 4Z95L 3RNKA 3W0WA 2VKXA 2XWJA 2B5IB 3ZKQD 4FP8L 5AUMA 5CJQL 2J12B 3FO0H 3JVGA 3IDJB 3VFUA 1SY6A 4XTRD 2X89D 4PJ7B 5CIPA 4GQ9H 2VDKL 1QBLL 1RIUL 4J4PA 1BOGA 4HG4J 12E8H 1R5WA 4O58L 5ADOH 3JV0A 3VFNB 3GJFK 5C6TH 1JI1A 1FFQA 2VXTL 3LD8B 1JZ4A 2VLJE 4YX2H 1I7UA 2CRIA 5D6CA 3SBWC 5IGXH 2DN7A 2P49B 3VG0H 3O6MH 1P2CB 2BNUA 3SE4C 2CUMA 3HC4L 1CG9A 5LCVL 3MCKB 2IEPA 4UTBL 1I9IH 2PYEA 2AV7A 1HK6A 2YA1A 3RWIA 5GZNC 5IR1B 4NO5B 4LCCB 3SE9L 1IC1A 2AEQL 3ZYZA 2ZSWB 5JXED 1T2QH 2NTSP 4U6TA 3TVMB 4LQFL 4AEIH 2G60L 3QO1A 3DJ9A 3QIBD 4LCWA 4LCYA 5I66A 1X7QB 2EDQA 2BSTB 3NCYP 3RA7L 4KRPC 5DMJB 3VA2C 4HULB 3DUHA 3AS2A 3IDJA 1S7UB 1T2JA 2W59A 1D6EB 4Z0BH 1FZKB 2BRRL 3QQ9C 1CLYL 4PJ7A 4WV1B 5IB2B 4JB9H 1MFBL 2OJEA 5TPWL 4XNZB 3SY0B 1XFPA 5F88B 2P44B 3GFUA 1LDPL 1RUQH 2BX5A 1AO7B 4Z18A 1L9MA 2AS5M 4N68A 4KTDL 1KEMH 4UILH 1MHHA 3D69B 4J3SA 2N7BA 3HKFA 3UEZA 4NZJA 1EO7A 3TV3L 4OLYH 2ZCHL 3OKNB 4NO0B 4GSDH 3EDDA 3MCKA 3BN9D 4WEBL 4UAOB 5IR1A 3ULVE 1XGRB 4HWUA 4OLXH 3T09A 4MB4A 4NO5A 5IVOA 5F6HI 3H42L 4WTZG 2X7LB 4WFHE 3TVMA 3RUGF 2FEDD 2NY2D 4ZS7H 3S3PA 3VWJC 3ARFA 2BSTA 3ROLA 3PWPD 1JNNL 3CVIL 3OKLA 1S7UA 4XP4L 4LPTA 1FZKA 4NDMA 1QZ1A 2CRZA 4YHPB 1IC7H 4E9LA 3L3KA 4WV1A 4CVWA 5LVEA 5IB2A 2G2RB 4TTDD 1TQCB 3SY0A 1B6UA 5F88A 1HQRB 2AK1H 2VXSH 1FZMB 3KLDA 4DJMA 2EH7L 3LH2H 2PW2B 4U1MB 5EIIA 2YKLH 1Q9WB 1FNFA 3MOAL 2MPAH 3D69A 5GGVY 4PB9H 4FQ2L 1VEOA 3FCTA 4QXUH 4LSUL 4I18B 3BPNC 4Y4KA 3QIBB 3P9WB 3FZUD 4DKEL 3UPRA 3FHQA 4X6FB 1YJDL 3T0XA 4FRWA 3FRUA 1DQLH 4U6XA 2CXGA 1XGRA 5HGGS 5J12C 3WJLA 2X7LA 1PBYA 3ARGC 5FKPA 4ZXBD 2ORBL 4OCXL 2X89A 2CIKB 5LG1A 5TFSL 1YA5A 4WI5A 4N0FA 2EDRA 2DLEA 1CF8H 4TPRH 3D0VA 5DUPH 1FDLL 5ICYB 5BV7B 2YD8A 4WTWA 1KCUH 4Y4KC 4UT6L 3V6ZA 2QQLH 4CADB 4O02H 5BV7L 4X6BA 2V5RA 2YZ1A 1FAIL 1IEBA 2XNAB 5DR5L 1A02N 2G2RA 2P8PB 1URLA 5C0AB 2ATKB 4PR5A 4MXVF 3LZFL 3P40A 4XTRC 1FZMA 4M6ML 4Y5XC 4U1MA 1CE6B 2B1AL 1HZHL 1ZTXL 3WLWC 2QHRL 4N0CD 1FN4B 1DDHB 1BD2D 1NAKH 2BDNH 3QUZD 3HPLB 5FYKE 1CFSA 5C0CD 5JXEA 2L7UA 1KT2B 2H1PL 2J8UF 1MWAB 1I4FB 4OZIB 3NZHH 4LGSB 5FF6B 1MWAL 2NY2B 1OF2B 3PWPB 4U3CA 4AIOA 2R56L 4GRMB 2F54B 1QP1A 3VFRB 1YYMH 2AXFB 3G08B 4XC3H 3IDYC 2WIMA 4OF5A 1EXUA 3KXFE 3DX6B 2CIKA 3GBLA 4N5EC 5IMMA 4K3EL 2E7MA 3FO9A 5DD0L 4J1UB 4M43L 5DJ8B 3WFHA 2WM0A 4HK3N 3LIZH 1RSFA 4XPTL 4JHAL 1BZ7B 2XNAA 3BGAA 1CDIA 4IDLA 3MGOA 3HNSL 2XIDA 2YD4A 1CU4H 1X6LA 3BH8A 2P8PA 2ATKA 5I1IL 4K7PX 3PE9A 5JA9A 1IC5H 3C5ZB 1AJ7L 1H8OA 1VDGA 4LMQI 3UTZB 1CE6A 4JFFD 3TYFB 3C5JB 2W0PA 1SJVA 1G0DA 1FN4A 2Y5EA 1DDHA 3INUH 5EB9A 3HPLA 3RY6C 3GSNB 1KT2A 1WWCA 2XA8L 5CGMA 4ZXBB 1I4FA 1MWAA 3GSNL 1JIBA 4OZIA 3GO1H 3MOBL 3JUYA 2BHZA 2B1HL 4WI4A 1OF2A 3PWPA 1RUMH 5HVFB 1DBBL 4KDWA 4ZUTB 3DARA 2VKWA 4WFFE 2AXFA 3G08A 3NBNA 1EHLH 1YPZE 5EUOF 3DX6A 2Z92B 4XPGH 3PNWB 1FV1A 5FHAL 4WNQB 3P3YA 4J1UA 4PLKC 5DJ8A 4Z76A 3QCVH 4JFXA 5T1LD 5IBUB 1CE1H 4ZFOB 4GKSA 3LB6D 1BZ7A 3M8OH 4ZFOL 1BIHA 5DLML 4XMKL 3SO3B 4ELME 1Q9OB 4JEGB 1BD2B 3QUZB 4L8DB 3LHPL 3U9PH 3D48R 4L5FL 1XGYL 4XVUD 3AROA 3F12A 2FD6H 1RZFH 4CNIB 1DANU 5CZXC 4PJ8C 2XY2A 3ARZA 3TYFA 4LEXH 3WFBH 3NCYS 1FNGB 1U3ZA 2NY6D 3O81A 3QP3A 1J0YA 1QA9A 4ZXBA 3P4OB 3T3MF 3ET9F 4UU9B 3IU4H 1AXTL 1JHTA 5ICXB 1HHHB 1BZQK 1V7NL 4JVPA 5DD5H 4EI5C 4B0MM 3PABB 4LLWB 2Y6SD 3MFFB 1JK8A 4ZUTA 5JO5B 5IV2A 1RIVL 4I2XB 3FZUC 4JQIH 1P84J 2X4QB 4OCWH 2Z92A 4OTXH 3PNWA 2Q6WB 2OMNA 2PTTB 2DLHA 4WNQA 4JR9H 3HMWH 5FO8B 5C70A 2NZ9D 3WO4B 3RGVB 3G9AB 4ZFOA 1QSVA 1BQUA 5C0RH 2EDFA 3DRQB 1V05A 4JFFB 4MDJB 2DLIA 3RZWA 1CBVH 3MRGB 1W0WB 3CFJB 1TNMA 1Q9OA 2DJUA 2FX7L 1BD2A 3QUZA 2AJYH 4J23A 5C0BB 5C0CA 4K9EC 1KN4L 4P2OD 3B5HA 2R69L 3ZLQC 3ZE0E 1A0QH 4OBRA 4WI6A 3GI8L 3BRGC 4CU8A 1R3JA 3BQUC 3HC3H 3MBXL 5TE7L 1GGBL 1I85A 2V6HA 3D5OF 5HYQA 3P4OA 1G7QB 1QNZH 3P9LB 1WV7T 4XAWH 4UU9A 5H37H 3B9KD 5ICXA 1HHHA 4PJCB 2G5RA 2WLZA 3DHMA 3PABA 4LLWA 4UV4H 3STLB 3IYLW 5T1LB 3MJ8B 2DYPA 1FFOB 3UZEA 1CQKA 2EKSA 3LOWA 3BRFA 2AGJL 1PX4A 3RUGA 3V9FA 2X10A 3RU8L 3IAPA 3L3JB 2EXYD 2X4QA 5F7EH 3I75B 2Q6WA 2PTTA 1LP9F 3SKNB 1JHKL 1NUNB 4OIBA 4QKXB 3VFVB 3RI5F 4FQXD 1OVZA 1WIPA 5EC2B 4LOUC 5AD0B 1BGXL 2HYMA 2LV4A 4YPJA 4P2RD 4JFFA 5ESQB 2HWZL 1BF2A 4NRXB 3MRGA 1ADQL 1FH5L 1JHLH 3VXSD 3Q6GH 4Z7VE 2VZSA 1AP2B 3TWCH 5MP6L 1VFOA 4H8WC 3G04B 2YOCA 3ZKMC 1CS6A 2ZCLH 2D7OA 2OJZH 3RRQA 2KL6A 5J3HD 3JV4B 1RUPL 3VW3H 4CRPA 1GC1H 4HV8B 4ZAKD 3U1SH 3KPSE 3FB7A 2Q3AA 3MRNA 2ZCKL 2OR9H 1G7QA 1BBDL 5ID1A 4G8FB 4EVNA 3L6FB 5T1LA 3MJ8A 4HCRL 3HR5B 3TLRA 1R0AL 1E6JL 3QJHA 1ED3B 4RDQF 2XYCA 3I75A 3CU7A 2PW1B 3CMOL 4X4XB 4NKDB 1U8HA 1YEEH 3QXAB 4J3OC 1WFNA 3WDHA 4P2OB 3HNVL 2Z9TA 2IG2H 5EC2A 1A14H 1KB5H 2Z93B 5AD0A 3MA9L 1INDL 1MCLA 1SM3H 4HIEB 3WHE0 1ADQA 4NRXA 1TJGL 5DVKA 1N6UA 1EBAA 1VESA 2VH5H 1AP2A 3G04A 2NPLX 3BXNB 3NABH 5FHBH 3IXTB 2VLME 4UUJB 3JV4A 5EWIH 1V7ML 5C71A 1UC6A 5CJBA 3U79A 4ERSH 4HV8A 2VERN 2XTJB 1X3DA 1IKNC 1EPFA 4MJ2A 5KAQF 4KPHL 4NOFA 4M4PA 1MI5E 2NY6C 4HCRA 4FQXB 5DT1H 2UY6A 4G8FA 3L6FA 4ODHH 4X9GA 5I19H 1CGUA 1NGQH 3HR5A 4AK1A 1YECH 1ED3A 4P2RB 3C2AL 4NN5B 4AL8H 5E00B 4Z8FL 1G0XA 4G6MH 2YPVH 3NOIA 2FR4B 2HT4C 5E9DE 2PW1A 3TT1L 2APWA 2OX5A 4NKDA 3VXSB 1JGVH 4JM2D 1MCJA 2FGWH 4P2OA 3S3JA 1O5DT 1GRWA 4RWHA 2Z93A 5CZVH 1DR9A 3L1OH 4HIEA 3GSWB 5KVEL 4D9RE 4KI1A 3TN0C 3MRKB 2CDEB 4UT9L 4L9LB 1KN2L 1I3GL 1MVFA 2D0GA 2DKUA 4ZAKB 1A1OB 1RIHL 3O2VL 3VGDA 1A64A 1DVFD 5IM7B 5AG9A 2DMKA 3FFCD 1M4KA 3DIFB 4UUJA 3B9KA 1UM5H 3SCMD 4Y8DC 3M1BB 4MLSA 1LO3H 1CT8B 5EU5A 3QIWB 1EO8H 32C2B 1ZT7A 2H2PC 1L4IA 5KVDH 1LO2L 1KIPB 3VU2A 4H5SA 3MLXH 5IUSA 5KOVC 1NCCH 3MGAA 5GIRB 5DJ6B 2QSVA 4FQXA 4P59H 4UIMB 2P24B 4IMKC 2BERA 4OCYH 1S9YA 3B9KC 4PP1D 3MBEC 4XPFH 4P4RB 4HMEA 3T08A 2FR4A 5K9KB 1EZVX 3F58H 2DI8A 3CX5J 2OTWA 3VXPB 3TJHC 2M2DA 3IDXH 1CI5A 2YMXL 3GSWA 4JFHE 1H3VA 3MRKA 3BIKB 2CDEA 1T89A 4L9LA 3BZDA 2YZ8A 4RX4D 4ZAKA 1A1OA 1F90L 5CP3H 5CEYA 4P57A 4KJQD 5FYJD 4W4OA 4G7VL 2QQQA 2B0SH 3LN5B 5IM7A 4WHDA 3VFMB 5CGYC 1J8HE 4P3WA 4JPKH 5D7SL 4PY8J 1QFUL 3M1BA 2AEWA 4ENED 3RVUC 4XGZB 1J12A 5A2KH 4HKXB 1D7FA 5ESVB 3X12B 1KIPA 1U93B 4JFEE 1GGCL 4N0YL 4EI6B 3GB7A 5IEHB 2H32B 1UXSA 5GPRA 4M8VA 3GSVB 2D9CA 5GIRA 2R2CA 2Y25A 1VA9A 5DJ6A 1NMAL 4I9WE 3DYPA 4MA7L 4UIMA 2P24A 4P2QE 4DK3A 5JMOC 2VQTA 1T7WA 3RL2A 4IBLT 5DVLA 3BVNB 5K9KA 2EDTA 3C08H 5GRYA 4DGYH 4M1DH 2LQRA 1MUJB 1FO0B 1KELL 3FQTA 1CD9B 3G5XB 1NKRA 1DVFB 1FO0L 4J3UA 1J87A 3FFCB 3JWDH 2EIBA 3EO0B 4NQEE 1UWGH 1DBJL 4OJFH 3SCMB 3BIKA 3MRCA 5GGUB 3KS0J 4I77H 3QI9D 4D0DA 2X9WA 3EDEA 1PG7X 4WDIB 3RWHB 4UB0L 2RAMA 3LN5A 4K8RH 4QXWA 3T0ED 2G5BB 5EBWB 3VFMA 1JWUB 1D9KD 4RGNE 4BZ2H 1YNTB 3GHEL 1GHFH 5HDQH 1JZ7A 4XGZA 5GRZA 2W60A 3DMMC 4HKXA 5HI4D 5IKCB 1A9EB 5ESVA 1HINL 3OAUL 4UBDC 3GI9H 4LPXA 2W38A 4EI6A 4GG6F 2H32A 5DVOA 5D2LE 2H2SD 4C56B 3GSVA 3L5WB 3O8XC 4JM2A 3RWGB 4BZ1H 5GSVA 4HF5L 1NAMB 4RFOH 1NCWL 1XGTA 4OCNC 4EIGB 1I1CA 3OMZA 1LEKB 1NAML 1J5OL 4ZSOE 4Q9RH 4NJ9L 3TO4C 1XCTB 3O9WD 4KK6D 1GGUA 4MHHG 4P2CG 3BVNA 4JRWA 2VO5A 4MCZB 5B38B 1MUJA 2XRAH 1FO0A 2DLTA 3QCUL 3SDYH 4KVNH 3G5XA 1DVFA 1FL5B 3FFCA 5FYJL 4F7CB 3EO0A 2A74B 1G9NL 5JOPE 4LLDB 2DLFH 1G84A 3MJ9L 5GGUA 5CLWA 3CMGA 2R23B 3RIAK 4FHBD 1HSAA 3TESA 1WFTA 2VXUL 3RWHA 1F3DH 4CMHB 5DQDL 1FPTH 2G5BA 2BSED 4NZUH 3MUY1 4PTUA 3TC9A 1AQDB 1MCIA 1YNTA 3TPKA 1C5DB 3E6HB 5IB5B 3VXRB 1PEWA 3DX9B 2ZG3A 4JY4A 1YYLL 1A9EA 3CLEH 1AKJD 1EMTH 3ABZA 5C6PB 1A6UL 4PRHE 3KNBB 1KCKA 4NHUB 3V5KA 1GAFH 3B2VL 3RWGA 1YNLH 5DJ0B 3LN9A 1FCCA 2AEPL 2KBGA 1WIUA 1I7ZB 2DTMH 1NAMA 2JK5B 1LEKA 5FUCC 4S1QL 5E6ID 2ERJB 1MJUH 1BAFL 4MAUL 2AJZA 2YN5A 5EPMB 2JCCE 2E3VA 1XCQB 3QI9B 4RX4A 3UTPE 1J1XH 4KQ4L 4MCZA 2ED9A 5GGSA 4CN6A 2F53E 2JB6B 1BFVL 2LTQB 3HUJB 5F7KC 3T0EB 3S35H 1FL5A 5IOPB 1D9KB 5E24E 3MJ9A 2A74A 5A3ID 4LLDA 2QSQA 2X70B 2R23A 2EICA 3ESUF 3U9UB 4NFCA 5EBGA 4QRTB 3RPIB 5T3ZD 1AQDA 4H88L 5HHMD 4OM1H 3QDMD 1C5DA 3HS0B 4AEEA 3VGAB 1F4XH 4K7FB 4LVHB 4WO4D 1G9NC 2A6DB 5I9QB 5HY9B 3O9WB 3K4AA 5KZCD 4ENEC 1MF2L 1B90A 3KNBA 4NHUA 4PBVC 3GSUB 5DJ0A 3MR9B 4NQVB 5I76B 1C12B 2NY0D 1KENH 3FN0H 4PGEB 4MJID 4Y1AE 4GW5A 5EPMA 3QI9A 1JI2A 1G7PB 4L3EE 5D93C 2A0LD 2JB6A 4X7SL 3DI2B 3HUJA 4OD2A 3KYAA 3KYOB 1D9KA 1EV2E 1IAKB 2AW2A 2OMBA 3RWFB 5MEQB 1N26A 1IEHA 3TBSA 1R5IA 2BJML 2YD6A 4JPIB 2V7HA 2X70A 4MQXC 5D6DA 3U9UA 4Z7NE 2IAMD 3I02B 4BSWB 4JDVB 1F4HA 5HYFA 4HPOL 4Y19D 2R9HD 4QRTA 1EO5A 3NFPB 3RPIA 3K8KA 4W70A 5HHOD 1OD9A 2ZWLT 5ISZB 1G6RB 4RRPA 5FUZH 1G6RL 4OGYL 2Q8BH 4JZOA 2FH8A 5BS0D 4Z5RB 4PJ9D 1UKTA 5E6IB 2A6DA 1IGIH 2HP4A 3O9WA 2AJ3A 5L2JB 1AHWC 3IFNL 4R96B 4IRSC 2V5YA 3W9DA 1E4JA 5D6DC 1WZLA 3GSUA 4HIIB 2F9BT 3MR9A 2X09A 4B5EA 3IKKA 1QG3A 5I76A 1C12A 1DFBL 4K07A 2H2SC 3DROB 1JRHI 5JHLH 2XACC 3WFCH 4F7MB 1G7PA 4E0RB 3PV6A 1OTUD 1I1FA 3MRIB 3UO1L 3KYOA 4MLIA 2E27H 2EDWA 4XP1L 1IAKA 3QDMB 3PJSA 5F7DB 5T3ZL 3WIIH 1EH9A 2P45B 3KPQB 4BH8B 3RWFA 4NZTH 3THML 5MEQA 4JPIA 4WO4B 4HPYH 1XR8B 1JWSB 4BSWA 4JDVA 5HD8D 1AKJA 5FB8B 3QXDB 3VGGA 4KQ3H 4M93B 3NFPA 2BNRE 4MA1B 2FJFB 2I5YL 3HNTH 5T5FH 5I15L 5FDWB 1G6RA 4QTIL 4J12A 3TBWB 1QRNE 3PL6B 3KR3H 1OAYL 3IJYB 3LEYH 1FP5A 2E5EA 5E6IA 2W0LA 4MJIB 3G5YB 5L2JA 4G6JL 3BPOB 2JELH 3LMJL 4XMPH 2ITDB 4XPHL 3ALPA 1OAXL 4HIIA 3CC5B 4JGUA 3B9VA 3DVFA 4BK4A 1T0MA 3H7BB 1T66D 1BIIB 5DC0A 3VGHA 4WUKL 3ZZ1A 2IJ0C 2V2WB 3WCYA 3M17B 1MPAH 3FQUB 5B3JF 3K2MC 5KSUA 1AR1C 5EO1B 4D3CL 2IAMB 4E0RA 1A4JA 3D85D 2F5BH 3QH3B 1WBXB 4PJBE 1FYTE 4U49A 3GJFA 4YBQD 4OGXH 3BFOA 5J89A 4YZFF 5HHOB 3FFDB 1Q0XH 1MHEB 3QDMA 2CDFB 5K9OB 1QOKA 3KPQA 3UJTL 4BH8A 3B8SA 9CGTA 3JWNC 4WO4A 4Q6IA 5BS0B 5DSCB 1XR8A 4JO4H 4PJ9B 5FB8A 3A0OA 1NPUA 1XGPB 3QXDA 5MHSE 3K0WA 5F8RC 4HAGA 5DMKA 3ARYA 3B5TA 1CXEA 2NTFB 1A6WH 5DVMA 3R0NA 3TBWA 3AVEA 4FA8A 5ABDE 2XZCL 4OGZA 4X8JB 4R4ND 4MJIA 1A1NB 1FJ1B 3G5YA 3DLQR 3NCJL 1WICA 5D72H 5DMGC 4M5YH 5FO9B 4DQOH 4POUB 5KW9H 2HFGH 3CC5A 4R0LB 3BGFC 1EAPB 2R0KL 4DVRL 3DVNB 3H7BA 1BIIA 2UZIL 3EDJA 1ROWA 2XICA 2HMID 5BVJB 3M17A 4M3JA 3FQUA 2RCSL 2IANE 4F57H 3BGMB 2DQCH 4KRPB 2NY0C 3W11D 5EO1A 2IAMA 1EVTC 1X4XA 3QH3A 1WBXA 4Y19A 4PGJA 1Q9KB 1T03L 2CIIB 1MCDA 5HHOA 3FFDA 4MNGB 4Y5VC 2J88H 5K9OA 2CDFA 4HIXH 4LDOB 2A0LC 5JW4M 3TNMB 1WLHA 3U4AA 5I1GL 1YEIL 2VL5B 1EFXD 5BS0A 5DSCA 4PJ9A 3PIQB 4G3YH 1T0NA 3L5XH 5INDB 4W6YB 4HW6A 2VC2H 4MX7A 3QPXH 2IF7A 3MTRA 2VL4A 3CNKA 3U83A 5IG7B 1DN0A 3QQ4B 3ZE1F 4NNYB 1FE8L 4M6NH 3ARUA 2YEZB 4XWGH 4NUGL 3T0BA 5JQHC 4FNLH 1TJIL 4I0PC 4S2SB 2C9AA 4PRPD 4Y0GA 3IVKB 2EEAA 2YSSB 3RZCC 3EFDL 5KSVB 1E4XI 1Y0LB 5E4EB 5E1AB 1EAPA 4S1DD 4UIKH 1KGCE 3CXDL 1TZHB 2WK2A 2VN4A 5AZEL 4KAQH 3QAZB 1V3LA 5BVJA 1ULVA 1I3UA 3BGMA 3QPQC 4YHOH 1CFTB 1OY3B 1VFUA 5B4MD 1IAII 1Q9KA 3WS6A 1CLOH 2CIIA 4P9HH 2J3SA 3W0WE 3HE6D 5ITBL 1NCAL 3GJEB 4HK0B 4YEEA 1M7IB 4MNGA 5I1JL 1AQKH 1KXVC 2RFXB 3TNMA 4JDZA 1U8LB 2VL5A 2IBBA 3PIQA 4CVZA 5INDA 4M7KL 1LMKA 1I3RA 4PV8B 2A6JB 4FQJL 3MYZA 2R0WH 3W2DL 1GL4B 5IHLB 3SGJA 4PJHF 5H2BB 3MJ7B 2YEZA 5CUSL 2VN7A 4YDIL 4S2SA 2ZOKB 5EBMB 2OK0H 5L0QB 2YSSA 3QEQE 4V2CB 3D85A 4XVTH 5KSVA 5T5NG 1RVFH 2K3TA 5E1AA 2GK0B 1YEKL 3KLAA 1IQWH 2KUTA 1TZHA 2UWEB 2JJSA 3E3QE 3HE7D 4RMQA 3VG9C 4LHJB 4UOW1 1UWEH 1EFXB 5IROA 3O6FB 4CAGA 2HAZA 2IALB 4QGYA 1CFTA 5IQ9A 4LCWE 3B4NA 2GI7A 4I5BB 1MIEL 3MRDA 2W9EL 2HKHH 3GJEA 4HK0A 1M7IA 4HIJB 2W1NA 1K8IA 3OKEB 5JZ7C 3MV01 1U8LA 3GSXB 3O2WL 1DQJA 2X1WL 2NLJB 4S1SH 3PWVB 4PJ7E 4UTAH 4YE4H 4QXGL 1KYOK 1OP5K 3WDJA 5CJXA 4Y2DD 2OI9C 4D9QE 1N7MH 4PRPB 1IGMH 1XF3B 2A6JA 5IROC 1KSRA 2Q76A 3RHWK 5C0FB 4PJAF 4PUBL 2Z35B 3JWDC 2FATL 5D96C 2VZOA 4GRWB 4KV5E 5I75C 4TUKH 5DEZA 4LLAA 1PQZA 5H2BA 4QHKJ 4KC3B 4UQ3B 1ZWIB 2OSLB 4QRQB 3WNKA 5ANMA 2ZOKA 1TVBB 5EBMA 1JBJA 1RZJL 1KJ2H 2XN9B 4LLYB 1WEJH 2GK0A 1UM4H 2VE6B 4HGMA 3V4VL 1JE6A 2UWEA 3LKOB 3ARBD 4MS8C 5FA3B 3VMOA 2R2EB 1ZA6B 4LARH 1EFXA 5IVNA 1LHZA 4RISL 5JDSB 4FZEL 2CMRL 2HMIC 1DLHB 4PJEF 1DN2A 4PV9B 2DQIH 3NAAH 4NRYB 4LSTH 3HI6H 5DFVC 3FT2B 1IMHC 4LIQH 3GSXA 1NGYB 4F33B 3LQZB 3Q5YA 5ENWA 5F9WC 2ZUQB 3BZ4B 3BD5A 4QTHA 4PRPA 1XF3A 3TT3H 5GS1C 3MV8D 3FN9A 5I1HL 3LKQB 5BO1H 5L8JB 2HJKB 1WT5C 1AO7E 3S7GA 3SDDD 1ACZA 1ZLUK 1ZOXA 4X7CC 4R26H 1A7NL 1YEGL 3KYKL 2ENYA 3MCG1 4LVOB 4M00A 3N0PB 3HE7B 4OFIA 1XZ0B 1A2YA 1ZWIA 2OSLA 5HDLA 2BZDA 2FBJL 4DZ8B 1TVBA 3CK0L 5EOQH 4QHNB 2HLAB 1DQTA 1MHCB 3HE6A 2VE6A 3KPOB 3D6GA 3D87B 4QOKD 4PGCB 2DJSA 3K8MA 2Z8WC 4NHCH 1F42A 1HHIA 3VGEA 2R2EA 1MJJB 3WIHH 1ZA6A 4S1DC 2ICWB 4DTGL 5JR1L 2FEEL 1DLHA 1MCHA 4LEOB 4Y2DB 1F4WL 4NRYA 4M1CD 1XF2A 5C9KA 4PG9B 3MYJB 3FT2A 4GXUN 5TDOB 1VSCA 3RQ3A 4XB8A 3UC0H 3HE6C 8FABB 1JPFB 4F33A 3LQZA 1CVRA 5E2JA 2P8MA 1FC1A 4GXVH 3UBXG 1TZIB 3S36H 2HT3C 2I60H 3OR7B 3LKQA 1G7JB 1IC4L 1VHPA 1CDBA 3D9AH 3OAYH 3SE3A 4P3CH 3QDJB 3CCHB 4JPVH 4WY7H 1TIUA 1T20B 3HE7A 4U1HB 1W0YT 1XZ0A 5IFAL 5D7IB 3BEWB 4DZ8A 4K94L 1INEL 4LGRB 2JIXD 3AXLB 4G43B 4HWEH 1AI1L 1AXSB 2DBJA 5ADPH 4Q7DA 4QHNA 4EI5B 3KWWB 2HLAA 5LJYH 1B0RB 3SGDH 5GJSL 1MHCA 1JFQH 3BX7C 3KPOA 3BO8B 3QXVA 4TSAL 3FRPG 4S10A 4PGCA 1GSMA 3BD4A 1MQ8A 4ZUUB 1W8OA 3SE3C 1MJJA 5A2JH 5KTEL 3MLUH 1BX2B 1DBAL 2ICWA 5IBTH 4Y7MA 1T7XA 4MA3B 5BQ7B 2APTA 4Y2DA 4OD3H 4DAGH 3S9DB 1C5BL 1IFHH 3MV8B 5B8CB 5TDOA 4M3KB 3D3VD 4XNYL 1ERNA 4KH2A 5IMLB 4BQ8A 3SDDB 3QEGH 1QFWL 8FABA 3SQOH 1JPFA 4R2GC 1YNKH 5C0AE 1L0XA 2ZOLB 3ZTNH 5D5MB 4F58L 3QEHB 5DWUL 3GBML 4QO1A 1ITCA 5DA0B 3OR7A 3CLFL 1E6OL 1FVCA 1G7JA 2Y07H 3EYOB 1MAML 1G1YA 4QOKB 1DP0A 3I3EA 2DQJL 1T20A 2D31B 3ARBA 2FRGP 4U1HA 4FS0A 4TNWK 4CL7A 5D7IA 3BEWA 2FECI 3KLSA 4OZIE 1AXSA 4FFVC 1KCRH 35C8H 3KWWA 4NUJB 1HEZB 1OM3L 4FN0A 1RAMA 3MV7D 1B0RA 1UT9A 3PWPE 5J7CC 3BO8A 1J0IA 3OXSB 2Q8AH 4H1LA 1G0YR 4GKNB 4XCCL 2F54E 15C8H 1JL8A 2DQUL 3ULVF 1BX2A 4KHXH 1JNLH 5F6IB 1WTGT 3DETC 1YY9C 3NA9L 5AZ2L 3ARBC 3SGKA 5T1MB 4K94C 4MA3A 1MJ7H 1JF1A 3MV8A 2ZSVB 5F9AC 3RJDA 4M6OL 4WI3A 5IMLA 3HC0B 2RQ8A 3SDDA 5JIPA 5TF1L 3QIUD 5JNYB 5EORL 3PWLB 3DVGA 2A6KB 3QRFM 4X7TB 1PLGH 1H15B 2BXYA 5C07D 1DLFL 5D5MA 2WWKO 3QEHA 2I27N 5JQ6H 3C60D 2AXHA 5E5UB 4HWBL 3NIDE 1X5FA 5DHVA 1OARH 2RR3A 3AM8A 4F7EB 3MLZL 4QOKA 3S37X 3I50L 3Q6FB 3BH9B 5DUML 2D31A 1KEGL 5JORB 5DK3A 4UOW0 4RWYL 1WWWX 4IDJL 4OZHB 3AS3A 1X5KA 1A7BA 4AEHL 3VJ6A 3A6CL 2Z8SA 2FO4B 4HJJL 4GKNA 5EFIB 1WFUA 4WRLA 3D3VB 4DGVH 4UNUA 4X9HA 2YD1A 2X4OA 1ZKAA 1CXIA 4ODXA 2O5XL 1C16B 2XPGB 3BE1H 3MRBB 3EUUA 1ZT1B 1RJLB 2H9GB 3UMTA 2ZSVA 3S8WA 5MI0C 4LLVA 3V6BR 4HH8A 3MOQA 1RULH 2O61B 3PWLA 1P7QB 3S34H 2A6KA 3K46A 3O41B 2D03L 2QKIA 1BD2E 3HZVB 1H15A 4YH6A 4HWBA 2JIXA 1ZLWK 5JOFB 5TJWK 3MV7B 5TE4L 1JJUA 4F7EA 2IMNA 4DZBB 3NFNB 3WHXB 3QYCA 3BH9A 5JLZA 5GS0H 5JORA 1YQVH 4KK5D 3RJQB 1A7PH 4PRDB 4OZHA 1P4IH 1BMGA 2L0DA 4N0UB 4M7ZB 1QSEA 2BXZA 1NUGA 2YUWA 3OR6A 4U6VL 3RBSA 5I8KH 2YD7A 3EDFA 1N0LA 2V5TA 2FO4A 5IGXL 1AFVL 3VG0L 3D3VA 2NY5L 2ICWJ 4I2XE 3DPBA 3AMLA 3QIUB 2AEIT 5AWNL 5GGSY 4PJEA 1P5VA 1CD1B 1C16A 1K8DB 1J11A 2XPGA 4GBXD 1A6TA 5C07B 3MRBA 3HZMB 4PPTA 4LRNH 1ZAGA 3QDAA 1ZT1A 2E8YA 2H9GA 4OB5L 3C60B 4ACPA 2LU7A 4MD0A 1IBGH 5EZLA 5HJ3B 4POZC 4JKWA 3WE6B 4OF8A 1T2QL 3BIAX 2O61A 4JFFE 1WBYB 4YWGH 5DJXA 3O6LL 1UA6L 4C55A 2FYYB 3VH8B 3O41A 3KLHD 3HZVA 1JVKA 2EE3A 1NEZB 4F9LA 5IVXB 3GMPB 5JOFA 1ACYL 2O93L 3MXWL 1Q9LA 5DO2D 3MV7A 1FIGH 2FIKB 3TJEH 4U0RC 2DLGA 2ZG1A 1DQDH 2Y06L 3NFNA 4G7YL 3WKML 5D2NA 5AYUH 3SE8H 5ELIA 1MREH 4PRDA 4R90H 5ILTH 1OGAA 4P5TC 1MCRA 5I17A 4N0UA 5E6ZA 3RPKA 3WNOA 3MLVH 4F9LC 2AQ1A 2MJWA 4PJCE 3BUYB 4W68A 5TDNA 3RL1B 5I8OL 1FRGL 5MEOA 2NY4D 1S7SA 2AJUL 5C0IB 4LLUA 3QIUA 2AI0H 1H3XA 4R7DA 4Q9CA 4JJHA 3VCLB 3NTCL 2VRAA 1CD1A 3ALXA 5C07A 1CDCA 3RVVC 1YPZF 4WCYL 1NLBH 1T1YA 3HZMA 2X4RB 3CXHK 4L8SB 3U4EB 1N0XL 3C60A 3WUZA 3QZWB 5BW7A 3WE6A 1SBBA 3C8DA 1S9KC 1MCWM 1WBYA 2HKFH 2FYYA 3VH8A 5KJRL 1LK3L 3MLPA 2ID5A 3HI5L 5CILH 5BMFH 2QR0A 3QB7C 5IVXA 3GMPA 4BH7A 4ELMF 3VXUD 1OT2A 2XZZA 3UYPA 4NQDD 1KNOB 4ONFH 1EUTA 3A6BH 1A3LH 5CCKH 2FIKA 3H6JA 2AJVH 3HI1B 4CVXB 2M26A 2BCKB 1K3IA 3RKPA 4PIRF 1MCOL 4HBQA 1NMCB 3OKDB 1NBZB 1RZGB 3DV4A 4JG0H 4I8DA 4FQIL 1CLCA 4GBXB 3LH2L 4Z7OE 4NWTL 4NM4L 4ZS6D 3RL1A 4ODTH 5KSAD 5GGVH 4K23L 2GFBB 5C0IA 1NBVL 4TULH 4K3GA 3IDUA 1KPVA 2ITCB 2QLVB 1EEUA 1WFOA 4ZO8A 4PGBB 3U4EA 2VZUA 2IBZY 2ZUVA 5T33L 2E6PA 1FLRL 4JY5L 3JZ7A 3PGFL 4OQ1A 2AABL 1EUUA 3UJJL 5KSBB 3AAZB 5EZJA 5DUPL 3PUCA 4PJDB 2WBWB 4QNPE 1BQHA 1UB6B 4OFDA 2GJ6B 3OPZL 3WS3B 4JFYA 5DHXB 4Z0XB 2W65B 3DMMB 4GKZB 1C5CL 1ZA3B 3HI1A 2BCKA 1ODAA 5T1DL 1NCDH 3ZE0F 3OKDA 1N5YH 5HBBA 2VDRH 3HZKB 2XFXB 1Y6KR 3EOAB 1J18A 4JDTL 4U2ZA 4JFOB 4PD4K 2HT2D 4GBXA 4KK5C 2R1YA 8CGTA 1NCNA 3D2UD 5DHYB 4YPGB 1K2DB 2J8HA 5I8CB 1ZXQA 2GFBA 3HFML 4Z9KB 4P2RE 1I9JL 1K6QH 4FZ8H 3LS4L 1FGNH 3U7WL 4TOYH 2ITCA 3CVHL 4RGMC 3VXSE 1CXLA 3OZ9H 1ZLSL 3N1QC 1UENA 4L4TD 1GPOH 3GNMH 3S37H 2XQBH 1S5HA 4NQDB 3G6JB 3TBTA 1IGCH 5C2BL 2VDQH 1N4XH 4WU5B 5IJKA 5J6HB 5B22A 5C0GB 1KJVB 2QSCL 3ULVC 3OAZH 1AIFB 5KSBA 3AAZA 3DOSA 5C0EB 1FL6B 2IPTH 4WENB 3T1WA 2OM5A 4PJDA 1LO4L 1UB6A 3C6SB 3IT8D 1O7SA 2R8SH 3WS3A 4Z7VF 4Z0XA 4JHBA 2W65A 4GKZA 1ZA3A 1XF4B 1OSPH 2CPCA 2VDPH 3WNNA 5KSAB 5IBUG 4R4FH 5E8PB 1EHXA 4N1EA 1TDQA 3HZKA 2XFXA 2ZUSA 4YFLI 3EOAA 2QQNH 3F7QA 2EDOA 5HI5C 2YA2A 1RUAH 2XKUA 2FHCA 5HYIA 1PSKL 4P3DB 5DHYA 2N4IA 4QRPD 3INUL 1EGJH 1K2DA 4GUPA 4NRZB 3IDMB 4I0CC 2PXYC 4KFZC 4TVSa 3QFDB 4BKLA 4G5ZH 1LWRA 3VFOA 3GSRB 3CVHA 4ZFGL 3L3GB 2NY4C 1LNUB 4DN3L 4OZGB 4HXAH 3VXUA 1I8KB 5IMOB 4ODVL 4XPAH 2LFGA 4EBQH 2X4SB 4NQDA 3G6JA 3N1FC 4PRAB 2W9LA 3B8YA 4X5XB 3Q0HA 4WU5A 4QRRD 2YUVA 2BVPB 1G9MH 4XPGL 5DEFB 5C0GA 4F2MB 2F8VA 4OM0H 2EH8H 2BOCB 2EDDA 1FL6A 4GAGL 4ZUVA 2MFNA 4OLWL 2VDLH 4KKCD 5JW3L 4W4NA 3M8OL 1AXIB 3MLRL 1XF4A 1RURH 5DRWA 2G75B 1KCSL 3D2UB 2HRLA 4KROD 4K71C 3C09B 4LHUD 5KSAA 5D9SB 5E8PA 4LP5A 4FMKA 1QD0A 2CKNA 1ZV5A 4U33A 1T83C 5SX5K 5LGKA 4UINH 4XCFH 3FONB 4PS4L 1U8MB 4FG6D 1FFPB 1I8LA 4N8CH 2CO6B 2D7PA 3H3PL 5EU7E 1TXKA 3LEXB 3LPWA 5IBLC 3UBXI 4L4TB 4P3DA 1HXMA 3O6KL 2D7TL 2L7JA 2DBLH 4IJ3B 3IDMA 5M95B 2DD8H 3EJYD 3QFDA 1L0QA 4MCYB 1F6AB 2IH1A 1MLCB 3GSRA 5GGTH 5GSRB 5MEND 2ARJQ 1MCFA 1LNUA 4HJGA 1F4YH 4OZGA 1I8KA 3RHWF 5GZOC 2VZTA 2X4SA 3R06B 5L88H 3FFCE 3HHRB 5HHQA 4X5XA 1ES0B 1I8LC 1S9XB 4NN6C 1IGTB 5DEFA 1NH6A 4PJ5B 4EUPA 4JR9L 4NWUH 1E4WH 1N3NB 2HJLB 2GSGB 1X5GA 3WFEH 5IP4A 4N9GB 3RVWD 2HRPH 1DQMH 5ITFB 1KC5L 2G75A 3D2UA 1GZPA 4QRPB 3MGTA 3TBVB 2HFFB 3T0AA 4KRMB 3SGEI 3R4DA 5HYJD 5CFHA 3TEUA 1QLFA 2NQCA 2DMBA 1U8MA 3LEXA 5LAXB 2Z91B 4L4TA 5K93A 3U4BH 4FQCH 4HC1H 1NDGA 2KQMA 3HPJA 4UNVA 3HC3L 3QCTH 4AJ0A 4UV7H 2VXQH 4QRRB 1MLCA 2VZ3A 3TH4T 5DJCB 4XP5H 4PREB 4R3SA 4KKNA 1S3KH 2GITB 1F3RB 3HB3D 3E1F1 1HI6A 5FYJE 4F80A 2FX9L 2O26U 3R06A 5EZOH 1G7HB 1MHPH 1ES0A 3OG6B 3V2AR 5I0ZA 1CGSH 4JG1H 1S9XA 2X40A 1IGTA 5CWSB 4KROB 4LHUB 4ELMA 3BDBA 2CLVB 1N3NA 2HJLA 4YDVB 2GSGA 2VXVH 2VSDA 3I6LD 5JPNA 4MQ7B 4KMTL 1M71B 2EDYA 4LF3A 4JPWL 5ITFA 1B2WH 2Y5TB 3H3KA 3PDOB 1JGLH 4P23D 4QRPA 3BKML 4JZJC 3SOBH 3TBVA 4D9LH 2HFFA 2V17H 4DWHA 2HG5B 3ILQC 4HIHB 5DTFA 2LAAA 5H35A 3MSPA 2Z91A 3WDIA 4U6YA 2H8PA 1R3HA 4LKXA 1JUFA 5DJ2B 1BJ8A 1GC1L 2ZUWA 5D7JA 4D0CA 2PR4H 4QRRA 4JGJA 1T21A 4I3RH 3RIFF 3FB8B 5LGHL 1PD6A 4GLRI 4J2XA 2Z0BA 1MVUB 3ZDXE 2GITA 1OP3H 4M5ZH 4WVRA 2K1MA 1BM3L 3HUJE 1TPXC 3T0EE 1RHHA 4XMLL 4F37K 5EC1A 4MYWB 2HH0L 5CWSA 4NZDA 4LHUA 2ADJB 4RMSA 4TSCH 5D7JC 2CLVA 4YDVA 4GO6B 3FMGL 5HYJB 4XAKD 2Y7QB 5ID0A 1EJ6A 1V3KA 3L3IB 4KK8D 1KJ3H 1GGIL 4MAYD 4HUWA 4KKCC 1WF5A 3K4ZA 2OCFD 1H0DB 1SEBB 5MENA 1GGYA 3QFJB 4ZDHA 2HG5A 3BGFB 5FHBL 3IJHB 1ORSB 3LN4A 2FB4H 5EWIL 4OUUB 4MVBD 5D2LF 5DJ2A 4MB5A 3WXWL 1I1AB 3A67L 3O0RH 4GMTL 1HWHB 1IGFH 4QWWC 5E2WL 5B39A 2VTFA 3VFGL 2QJDA 1TFHA 2Z8VC 5F1NB 1J9CT 1I9RH 3FB6B 1NGQL 1TETH 1TZGH 1PKQB 4K7PL 3GRWH 4PLJD 2ADJA 4P23B 5LQBH 1IT9H 2DM4A 4M8QA 4TNWF 4NZRL 3BJLA 4M7LH 5E99L 4J3XA 5J1SC 5C09D 1MSPA 5ISZE 2JLLA 3L3IA 3NIGE 3K8LA 1R3IL 3BKYL 3ALWA 3HMXH 3KPSA 5IHUH 1H0DA 1SEBA 3IJSB 2VDML 2AXJA 3OB0K 3IJHA 1JPSH 1ORSA 5DD3L 4XWOD 3O4LD 3LDBC 4NT6B 1NC4D 2Y1VA 1G7MB 3D39B 4ONHB 4JM4H 5BVPH 2YC1B 5EA0L 5LBSL 1NCCL 4I48B 1QBMH 5JW5B 1G1CA 1TJHH 4HDIA 5F1NA 2JCCF 3VDCA 1S9WB 5HYSA 4HFWB 3FB6A 5T3ZE 3MV9D 4OCYL 4P2QD 1PKQA 4ZG1A 3QDME 3RKDD 3VXTA 4AEFA 2DL9A 4P23A 2Y4SA 4MAYB 2OYPA 1RZ7L 1UWXH 3GMRB 4CN1A 3O4OB 4XP9L 3T8XA 5L8LB 3UYRH 1CR9H 1JYWA 3T1FB 2OR8A 1ZANH 4XBEH 3WD5L 4JO3H 3S4SB 4MJIE 5J56B 4WI9A 3IJSA 5FM5O 4R4BA 4GRLD 4F3FA 1MI5A 1MAKA 4H0HB 1U2CA 2X4PA 4WGVB 3B2UC 1A6VL 2CKBH 4ONHA 1B4JH 1MCKA 2C26A 3DRTB 1GIGH 3NACH 4S0SD 1Q1JH 2P46B 1HH6A 2YC1A 4I48A 1NSNH 5HHNB 5JW5A 4XHJC 4Y19E 1MFAL 1S9WA 4KKLD 3TO2B 5C09B 1EEZB 5HHOE 5E2VL 5A2IH 5D1XC 3QWOA 4QHLB 2CK0H 3C08L 4MAYA 4YIQB 4JJ5B 5BS0E 2I07B 3GMRA 5F6HJ 5A43C 5BZWB 5I6XB 2DAVA 4XH2B 1A1MB 4L1HA 2UY7A 4Z7NF 4APQC 3QG7H 3H9ZA 4N1CA 4ODSH 5D7LB 3T1FA 5CSZB 3O4LB 3L9RB 4OJFL 1VGEH 2F8OA 2B2XH 5GRJL 3CD4A 1NC4B 1T7VA 4X0KA 4M9OA 4K3DL 3S4SA 5KN5B 3FKUS 3O2DH 5I1EH 4RSVA 4LQ1A 2I26N 4CJ0A 1WJ3A 4G9DA 5IESH 5FAAA 1LO0L 3U36B 4XC1H 1JGDA 2ADIA 4DW2H 1QO3A 3N06B 4S11A 4L29A 1EJOL 4JN1H 2X4UB 3ZDZE 2YWYA 3MV9B 5J1AA 2OZ4H 3G5VA 1PKOA 4Y16D 3ARED 3FQWA 2BFVL 3BDYL 2VAAB 4WW2F 1BVKB 4W81A 4OCLC 3B6SA 5H8DA 4M02A 1QTYT 4O2CA 2NXZD 1UEYA 3TO2A 1CK0L 5C09A 3ARTA 1EEZA 4YBLC 3DGCR 4MNGE 3OL2A 3UP1A 1C1EH 3C6LD 4P5KA 4JJ5A 2I07A 5E2UH 5BZWA 3SDYL 2MOVA 1A1MA 4J3WA 5FM4A 1SY6H 2IPUG 1MJ8H 4H26A 3MACL 4LSPH 3RWEA 2UUDH 5CIPH 1LEGB 2VR5A 3L9RA 3O4LA 3B5GA 2C7UB 4BFGA 4YNYB 2WWMD 3TYGH 4PG2A 1NC4A 4MJ6B 4KKBC 3MLSH 3N85H 1KB9K 1ZLVK 1NUDA 5DD1H 3SKOB 3TP4A 2CUIA 4MSWB 5K9JL 4ORGA 5BZDB 4JKLA 1ZHNB 1YN6B 4YK4C 1QFWM 2X4UA 1VKXB 3MV9A 5HGAA 4P2QA 3DUUB 1HHKB 4XVJL 3GM0A 1N6QH 4RRPG 5KS9B 4PG2C 4JY6B 4O4YH 2GHWB 1BVKA 4GFTB 1GAFL 4CMMB 4OLUH 4AIXA 1B88A 4GQPH 2Q20A 1AD0B 2WBKA 4FFYL 3LV3B 2NY3D 4UNTA 1XEDA 4PJBF 4GW4B 5BOPA 4OFPA 4Z95H 1MJUL 1V3JA 3F5WB 4FP8H 4ALAL 4Y1AD 5CJQH 2X5PA 3I84A 1J1XL 2APFA 1YEHL 1Y6MR 5F7YC 4L3ED 4EDWH 3RKDC 4GRLA 1IARB 4HFUL 1QBLH 1WK0A 3SDCA 1RIUH 3GMNB 3IRPX 1GVIA 3GKWL 4AENB 1L7TL 2VLRD 1UJ3B 3DTXB 4O58H 2PO6D 4MJ6A 3GMMB 3QNYA 2DTSA 5D1QA 1FCGA 3SKOA 1RZKC 2EC9U 4MSWA 4WI7A 4OM1L 3W9EB 5BZDA 4YR6B 3V7MA 4NGHL 2NXZB 1YN6A 1KYOJ 4GRLC 3M45A 5I73B 4LCUB 1VKXA 3HC4H 5LCVH 1HHKA 3SDCC 2UWEE 4UTBH 5GQBA 5TE6L 4RGNC 4HEPG 3S5LB 5GS2D 5FFLA 4JY6A 3ZL4L 3SE9H 2VJXA 4IIQB 43C9A 4CMMA 5D1QC 2R1XA 1SYVB 1X5HA 4XXDA 3LV3A 2NXYC 3EBAA 4YXHL 4GW4A 3RA7H 1A7OL 3F5WA 4OI8A 4X80L 3FO2A 4FTVD 3ZT5A 2BVQB 2A2QT 2Z31D 4PP2A 2Y36L 2BRRH 3QHZL 1KTDA 1CLYH 3ZKNC 4PRPE 1MFBH 3GMNA 3U82B 5TPWH 5F1SA 1T04B 1YUHA 1UJ3A 4HHAB 4GRWE 1LDPH 2IQ9L 4HK3J 3BMVA 4Y16A 3AREA 4ZTPL 3HRPA 4KTDH 4F7TB 4OCMC 3WUWB 4RZCB 3W9EA 3MQIA 4YR6A 3TV3H 3MRLB 2FWOB 2ZCHH 2Q8BL 1CFNA 4Y2OA 2NY3B 4NOBA 5DS8B 4YGVB 1EIBA 1Z3GL 1KUMA 4ETQA 3S5LA 3C6LA 5IEKB 2E9WA 1DSFL 2YXMA 3E0GA 4IIQA 3H42H 4Y16C 3VRJB 3K1KC 2DI7A 4U7KA 1U95B 4BFBD 1J8KA 3V7AE 5IWLC 4QY8B 5EIQA 1JNNH 1QYGL 3CVIH 3HCVB 3O3EB 2VLRB 5DQJA 2BVQA 1MRCL 2PO6B 5IMKB 5EUKB 3MLWH 5EU3B 3I6KB 4G6FD 3WIFB 4XP4H 3AY4A 3L7EB 3MREA 3Q5TA 1F6FB 5DQ9A 3C6LC 5DRNB 1VEMA 1CXFA 1T04A 5FEBA 1XIWD 4HHAA 3LAFA 4HPYL 2EH7H 2LVEA 5F1KC 2FHBA 2R1WB 4OBSA 4F7TA 2WWMC 4UDUB 3WUWA 3MOAH 3HNTL 2J5LC 4LSDA 4FQ2H 3AY4C 3OKOA 3PP3H 4LSUH 1ZHLA 1NUFA 1QR1A 2JTDA 5DS8A 4DKEH 4YGVA 5CBAB 3K74B 1YJDH 3OF6D 2YUZA 5IEKA 4Y1AA 2HFEA 4E42B 2Z31B 3F7PC 1PYWA 3FJTA 5CAYB 3VRJA 4JFDB 4L3EA 2ORBH 4OCXH 1NJ9B 3U30B 4U1KA 4QY8A 1PG7L 1A7QL 3HCVA 3O3EA 3KJ4B 2VLRA 1FDLH 1MPAL 1RZ8A 5IMKA 3ARDD 4UT6H 5EU3A 1BFOB 4LCIL 3DSNA 4LVEA 5BV7H 3L7EA 2MCPL 4I3SL 1FAIH 5DR5H 5DRNA 3QULB 4EKXA 4PJ7F 3ARPA 2QQKH 4FXKB 4DEPB 3EYSL 4NYLB 3V0AC 3LZFH 2A77L 4M6MH 25C8L 1CGWA 4BM7A 3F7VA 2B1AH 4PB0L 3CUPB 4KV5F 2R1WA 5DJDB 1CL7I 1HZHH 2W0FB 4HKBB 3TNNB 4BQBA 2QHRH 5D7IE 3WN5C 3C5SB 43CAB 1NFDA 2GY5A 2H1PH 1OAQL 4QF1A 4Q2ZB 3MLTB 1XR9B 5CBAA 5D1ZC 4EQ2A 4FTVA 2YPLD 2R56H 3K4DA 2Z31A 4E42A 2MHAB 3GMLB 1I1YB 3VD5A 3VRIB 3CSYB 1MELA 1NJ9A 4NQSB 4TQEH 1D5ZB 3AC0A 4ODBD 3MV8E 2NW3A 4U1SB 4K3EH 3UZQA 5DD0H 2BNQD 1XIWB 5JIHA 4M43H 3VI4E 1J86A 4G6AD 1FVEA 4XPTH 2WWKT 1UJTA 2W91A 4JHAH 4WW2C 1SJXA 5D5ME 3QULA 3HNSH 2VLLB 3JTTA 2V9RA 4FXKA 3BWUC 4NYLA 5I1IH 5F21B 4AMKH 2YRLA 2KDGA 5D4QA 1AJ7H 4QOKE 4WFGD 3CUPA 4LSQL 4HKBA 1Q0YL 4N90D 3UYOD 5IFJB 4NCDA 3RNQB 1IEAA 5DYOB 1RZIA 3C5SA 4ODWB 1JNHB 2XA8H 4XNQA 4WUUD 3MOBH 4XWGL 2B1HH 3JWOL 3FQNB 1DBBH 1FGVL 1L7IL 3TFKD 4FFZL 3BEVB 2BRQA 2NY1B 1MNUL 4ZPVB 3UTTD 3MRQB 3BPLC 1AD9A 1X5JA 1KACB 3QEQD 3TM6A 3VRIA 3CSYA 5FOBB 4NQSA 4UIKL 1D5ZA 4U1SA 2BVOA 5FHAH 1XIWA 2R4RL 3KPRB 3GKZA 4MXQD 3W39B 5AG8A 4OLVL 4NO3B 4U1NA 3VD3A 4X4ME 2BSSB 3FT3B 4PRIB 4OIAA 3MX0A 4P9HL 4X4ZA 2PTUA 4XMKH 5DLMH 5E8DL 2VLLA 2DKMA 4LKCB 4Z77A 3B3IB 2GUOA 3LHPH 1KJMB 3X3FL 2A1WL 4L5FH 2DM2A 1XGYH 1F11B 2VNCA 4H0IA 1OTTD 5DMIH 3BMWA 4Y5YC 4GW1A 3OF6A 1QFPA 2YPLB 4OZHE 1OQXA 3OB8A 5DI8A 3RNQA 5DYOA 4PYHA 5EBLB 4ODWA 1JNHA 4YUEL 5EU6D 3TA3C 4LVNB 5IHZB 3QO0B 1FBIL 2FJHB 1NL0L 4K2UL 4KY1L 5EIVA 3VD7A 2D7MA 1MQKL 1AXTH 3QJFB 3D3VE 3FQNA 1V7NH 4M1GL 3ARDA 2DQEL 4OAWB 3UAJD 4P4KA 1RIVH 2D4FA 4DOHB 3MRQA 5DJZA 3FOLB 5J11B 1T5WB 1CZ8L 2B4CL 2YBRA 4RFNB 4XBGA 3CDCA 5FOBA 2NW2B 1P6FA 4MNQD 4L8BA 2ZG2A 4MD4A 2Q87A 1AY1L 1M6OB 1U91B 1YMHA 3PXJA 2QADD 5EU4A 3W39A 4XNUH 4NO3A 3UX9B 3MJ6A 3VRLE 2BSSA 3FT3A 4F9PC 3QUYD 2GAZA 1Z0MA 4XPBL 3FB5A 5TQ0L 2MMXA 2A9NH 3K80A 4LKCA 3ARDC 2FX7H 3MNWA 1MIML 3E2HC 4P4KC 4WHYG 4QGTA 3L3OA 1KN4H 3MV7E 1F11A 4WU7A 5EO0B 4WUUB 1PFCA 3V7AG 2R69H 4U2YA 4YE4L 2WZPD 5D2NE 1V5JA 2YPLA 1B0GB 5E8OB 4F7PB 4N0UE 3UTTB 4KMQA 1JPTH 3MBXH 1V8HA 5EBLA 1GGBH 5TE7H 5HI3D 2C4FU 4KZEH 5IHZA 3QO0A 4NCC1 1AO7D 4JQVA 2FJHA 4OZIF 4ZOEA 1X5XA 1WISA 2ZKHL 1BZ9B 1FORL 2H3NA 2BNQA 1G7IB 1FNSL 4JO2L 4OAWA 1KJ2B 4OT1L 2YK1L 2AGJH 4MNHB 1T5WA 3RU8H 5FYLD 5C07E 1BOYA 3MODL 1UM4L 2BSRB 1DEEA 2CD0A 1K4DB 5DDHA 1JHKH 2GSIB 1CICD 1M6OA 1EDQA 3DYOA 1U91A 1YEDB 4M61B 3VGFA 3PF2A 3MUJA 3CPLB 3O45A 1BGXH 4OFKA 3KJ6L 3OBAA 3X13B 1ADQH 5IVXE 5HVHC 4PYGA 4LSTL 4E5XB 3HI6L 4TUOA 5EU6B 5KG9B 5EO0A 1JRHL 3IFLL 4WUUA 3KS0H 3L7FB 4AT6B 5GJTL 1SJEB 3NIDF 2GQHA 3CXHJ 1FSKC 3W82A 4YHLL 5CD3B 1VFBB 3JVGC 1B0GA 1S5IL 1RUPH 5E8OA 1FAKT 3AU1B 3UTTA 4F15B 5C1MB 3QEQA 4KUZH 1SBSL 1F00I 2ZCKH 1GOFA 4J4PC 4MNQB 3QUXD 4CW1B 1F3JA 3WEXB 2DB8A 1BZ9A 1G7IA 2QADB 3JBG7 4KJYA 1RK0A 4HCRH 4S0TD 1R0AH 2C1PB 3QUYB 4EDXA 1T3FB 5K59E 1NEUA 2BSRA 4IRJB 5DFTA 3LRSB 3CMOH 1K4DA 2GCYB 5FK9B 3UJIL 3PWNB 3VFPB 4JHZA 1J05B 2F5AL 4HUUB 1YEDA 3WIHL 4M61A 3HNVH 3DURB 2LU3A 2BVEA 4GG8B 4H1LG 3OXRB 3MA9H 1INDH 5E8NB 5K33A 5EN2B 5C7XL 3X13A 3E3QC 3VFSB 2FIRT 1TJGH 1TQBC 5SWZD 1AGEB 3MRJB 1OW0A 4KI5D 4JZNB 5EU6A 1DUYB 2EZ0D 5KG9A 5I0DA 3IFPB 3VFNA 4Y4FD 1MFCL 2B5IC 2FL5B 1OGTB 1HKLL 2XG4A 2MQ3A 4HMDA 1ONQB 4XCYB 4NQTA 5C0AD 1MFEL 3BT2L 3AU1A 1P2CA 3OKKB 4JKPL 1A9BB 4HBCH 4XNXL 5F9OH 5C0NC 5FYLL 4MNQA 5D71L 1CLZL 5AYQA 3X3GL 4CW1A 3WEXA 1CICB 3IDIB 4LCCA 1WZKA 3DHJA 4QYOB 3WJJA 2ZSWA 1CL7H 2DQTL 3LD8C 5ADPL 4NKIL 3H3BC 5EZIH 3C2AH 3MCLL 4N0RA 3TBYB 5FCUH 4K7PY 1DZBA 4Z8FH 1X7QA 3LRSA 3WFDL 3DX7B 4LFHD 3TT1H 2GCYA 3BZFB 1WBZB 5FK9A 1NKOA 3PWNA 3R1GL 3SDAD 4QRUB 1OAUL 1J05A 4PD4J 2F54D 3PGDB 1D6EA 1Z9SA 3DURA 2C5DC 4GG8A 1S7VB 3UCRA 3VWKD 1H3PH 3OXRA 5E8NA 5JIKA 2WUBL 1FIEA 5EN2A 1E4KA 3B9AA 2VABB 3VFSA 5KSBE 1T80A 1GCFA 4KJWD 1AGEA 1KN2H 2NNAB 3MRJA 4PJDE 1YEJL 1RIHH 2GJ6E 3O2VH 3TVMC 1AO7A 3ARFC 3QUXB 2B7DT 4HXBL 1OGTA 4LPUA 3RWDB 3EOTL 2HTKC 3NGBB 3PV7A 1ONQA 4XCYA 1ZK9A 2VZVA 3OKKA 1A9BA 3LKSB 1RMFL 4J6RL 3OKNA 5JDJA 4WV1C 1LO2H 2DMCA 4NO0A 3C5ZD 1E4KC 2XQYK 3I85A 4ZTOL 2IBZX 4P0DA 3LKNB 3LEVL 4XNZC 1CICA 3IDIA 4PJCF 1IILE 1U8JB 4QYOA 5K9QI 3V0WL 2VR9A 4L9DA 4ISVB 4IMLB 35C8L 3IS1X 1Q8MA 2AVGA 1CDHA 2Q8AL 2VQ1B 1RY7B 3DX7A 5SWZB 3VXUE 1FC2D 1WBZA 4KWUA 4QRUA 4NQDE 2C1OB 3G6JE 3LVEA 4TYUA 3AB0B 5T3XD 2ZJSL 4XBPB 1X44A 4Y4FB 1JNLL 4YHPA 2YMXH 2P1YA 2F58L 3GBNL 4UAOC 4MMZC 3TIDB 1E4XL 4X98B 4XVSL 3WJLC 3PHQB 1MH5B 3MA7B 4H0GA 4KRLB 1HQRA 1OTSD 1F90H 1A6PA 4FABL 1KLGB 2EDEA 4G7VH 4HS3B 1N64L 3S96B 3QUXA 2EO1A 2PW2A 4DCQB 3ORJA 1Q9WA 4U4BA 3D1MC 4Y4HD 4J3VA 1QFUH 4QT5B 3KVQA 1IAIL 4YC2B 3S98A 3LKSA 4I18A 1T6VN 3QIBA 3WFZA 1GGCH 4N0YH 1OLZA 4X6FA 3LKNA 1UEMA 4B53A 3QUMB 1TQCC 3SDAB 4Z7OF 3VI3E 3QUML 1NMAH 3NMEA 3OKMB 1U8JA 4MA7H 1NBYB 4UT7L 1G7LB 2ARWA 3VWKB 2BMKB 5E94B 4IMLA 5AAMA 3CJJA 2VMFA 1BQLL 1A5FL 4C83B 4RAUB 3J7HA 4OZGE 5SWZA 1EX0A 3V5DB 5JXEC 1R3KB 5ICYA 2C1OA 4I18C 1KELH 1YJDC 3QIBC 4CADA 4XBPA 1FO0H 2DWDB 4Y4FA 5M94B 1NCTA 3H9SB 3GK8L 1DBJH 3TIDA 5C0AA 3JV6B 3PHQA 1MH5A 2HLFD 2FDBP 1MEXL 3MA7A 3RGVD 4UB0H 5DEGB 3S96A 4HS3A 4Q0XL 4DN4L 4QNPF 2CLZB 4R9HA 4DCQA 3BPCB 5BV7C 3EO9L 3GHEH 2OXGA 5D70L 5C0BD 5DK2B 3VH8G 5HVWA 2ESVD 4BZYA 1HINH 3O3DB 5FF6A 3CIQA 2Q1EA 3LS5H 1UVQB 4YHKL 4L4TE 3QUMA 7FABL 5LKNA 4MJ5B 1YQVL 6FABL 4GRMA 5IT2L 4OF3A 3VDBA 2F54A 2P5WD 3VFRA 4Z78B 1NBYA 4XZUB 1G7LA 1NCWH 1RI8A 3G6DL 2BMKA 3BN9C 5T3XL 3VWKA 1NAMH 1J5OH 4NJ9H 4YDKL 4X6CB 1I7RB 4H20H 5I16B 3ARVA 1MY7A 3V5DA 1X5AA 1R3KA 2JJVA 3V8CA 2FEDC 1JZ2A 2NY2C 1E28B 1VFAB 1G9NH 1N5AB 2D7QA 4PJ5E 4Y4HB 3MJ9H 3P4MB 2CLRB 1F5WA 2DICA 3SDXB 3C5ZA 5DEGA 3VXQB 3EFFB 4MZ2A 5DQDH 4Z7WB 2CLZA 3CDFA 4TTDC 1OPGL 3UTZA 3BPCA 1KTLB 3C5JA 4QRPE 2F8XC 2CR3A 3GSNA 1S7XB 1IM3B 1YYLH 5FV2A 3REVB 3K3QA 2X4TB 5E2TL 1RJZB 4L3AA 1UVQA 3BRDA 1A6UH 1DQDL 1U6AL 3JTSB 1J88A 4FFWD 1BQHG 3B2VH 4MJ5A 1D5MB 4ONGH 2AEPH 1MREL 4Z78A 4XZUA 1MFNA 4QRRE 3FL7A 4KDTA 3J8F7 3O3BB 4X6CA 4PBXA 1SVCP 1BAFH 5I16A 2WP3O 4MAUH 3SQBA 1BPVA 1WZ1L 2F74B 4KQ4H 4ZXBC 5GRUL 3BZEB 2OQJB 5CBEB 1BFVH 4EN3D 1MAJA 4NC0B 1N5AA 3I2CL 3OHXB 4Y4HA 5FDYA 4L8DA 3AMKA 2ESVB 3GDBA 1QLEH 4CNIA 4UDTB 1W72B 3VXQA 1VPOL 1JPGB 1YN7B 3I6GB 2V2TB 2OTUB 1W72L 2WUCH 1CFBA 4H88H 1FNGA 5CILL 2P5WB 3GHBL 4YDLB 4HJ0D 1S7XA 5E5MB 2R15A 5MENE 1WAAA 5CEZD 3SO3C 4N0CC 1A3LL 1LEIB 1N59B 1XF5B 3QUZC 1H3UA 1Q72L 1DUZB 4HS8L 1D5MA 3IRZA 4JM2F 3MFFA 5JO5A 4L3CB 4I2XA 2XTJD 2B8OT 3TZVB 1WGOA 4YBHA 1QFHA 1XGUB 3LRHA 3V0VB 5FO8A 1NLDL 1I85C 2E7LA 1JV5B 2RHEA 1XH3B 5CGTA 5IFHH 3BZEA 2OQJA 3RGVA 4FQLL 2HJFB 3UZVB 1IZJA 3DRQA 1QSZA 4M4RA 4MDJA 1W0WA 3CFJA 3OHXA 5GGQL 2RBLA 4RBPK 1DEDA 1R24B 5C0BA 2BJMH 5HYJE 4NNPH 3MXVH 1F58L 2ESVA 1KXQE 1KBGH 1SMOA 4XT1C 4UDTA 1W72A 4HPOH 1JPGA 1YN7A 5BRZD 2OTUA 2V7NB 4HWZB 3WO4C 2P5WA 3RGVC 1F2XK 3OGCB 1G6RH 4JO1L 4OGYH 4F8TA 1EZVY 2N1KA 5E5MA 5HGDB 1MCBA 3AS1A 3QFJE 3K1DA 3SO5A 5FYKU 2YD9A 5A40E 1LEIA 1XF5A 3P9LA 3IFNH 4PJCA 4YXKH 1NCDL 2CRYA 3STLA 3WNLA 3OX8B 3QIWD 4HUVB 1FFOA 1CFQB 4EN3B 1NCBL 1BVLB 1DFBH 3L3JA 5E56A 5IW1B 1XGUA 3SKNA 3ULUD 3VFVA 1XH3A 2Q7YB 3I6LE 2APVA 1WVZA 3PP4L 5ALCL 5HHPB 1PKQE 2IWGA 2XY1A 1QKZL 4GMSL 2J6EL 5ESQA 3UO1H 5BXFB 2FECL 3GJFH 5FGRA 4XP1H 1OAKL 4NP4L 2EIEA 1F02I 2KH2B 3THMH 5CJ5A 4KVCL 1OB1B 1VGKB 1ZHKB 3LB6C 1K85A 5EULV 3WNMA 5ETUB 1IGCL 1XF1A 1ZSDB 3NCEB 5CEZL 2P7TB 2I5YH 2C3HA 2V7NA 5I15H 4HWZA 3BAEL 4TNVF 4XVUC 2E6QA 1BJ1H 4QTIH 3S35X 4L4VD 3OGCA 4WWKD 1II4E 1OAYH 5F71A 5HGDA 5IJVB 3Q1SH 4YK4B 4OIIL 4EUPG 3H2WA 4G6JH 3LMJH 4PJFB 3N9GL 4XPHH 1O7VA 1OAXH 3CU1A 3OX8A 4HUVA 3PQYD 3D39E 4EN3A 1BVLA 1OHQA 2CK2A 2R29L 4WHCA 4WUKH 5E8EB 2AK4D 4LMQE 2Y6SC 5IW1A 4X4XA 3RDTD 1Z9OA 3V8OA 3QXAA 2IFFL 2Q7YA 4XAKE 4D3CH 3ZDXF 2FSEB 5H94B 1HYSD 2J6EA 3NZ8B 5BRZB 5INCB 2DQHL 4G5ZL 3HUJF 3I3DA 3V4UL 4X9IA 5BXFA 2NZ9C 1A7RL 1NANH 1S8DB 2ADFH 3UJTH 5L9DL 4OZFH 2X41A 1OB1A 3ELAT 1ZHKA 3OJDB 1I9EA 3KHQA 4EBQL 5DJAB 3BXNA 1ZSDA 1T0PB 4HT1H 2R0ZL 4G80B 3IXTA 2V9QA 2P7TA 1G9ML 4NQEB 1RFDL 4P2OC 2OP4H 1KFAL 2VDLL 2XZCH 4I4WB 1HILB 4O2FB 1G6VK 5T1KD 1RURL 1T4KB 4PJFA 3ULUL 3ARSA 2GT9B 4XRCB 1VB9A 3NPSB 5JPMB 2D3VA 2R0KH 3WLBB 2WBJB 4P2RA 4CDHA 4DVRH 4GS7B 5E00A 5M7QA 2UZIH 4UINL 5EOCL 1UACH 1Z2KA 4C56D 4UMGA 3VXSA 2RCSH 2XTJC 4F8QA 2FGZA 2EXYC 3F6LA 3FOMB 2DD8L 5C09E 3I3BA 5BRZA 1T03H 5INCA 3HAEB 4PJGB 4FQQB 3IF1B 5F72S 4FQXC 1VADB 2XZAL 3EHBD 1S8DA 4P46D 4L4VB 3X11B 4HKJB 4WWKB 5L7XL 1A6ZB 5I1GH 5FO7B 1KLUB 1YEIH 3OJDA 3RTQD 5HGBB 5C08D 3QHFH 4G80A 1AC6A 3DIFA 3O4LE 5BJTB 1F8TL 1J1OL 1P9MA 1HIML 4TRPH 6CGTA 1CT8A 4LASL 1S7RB 3QIWA 4R97B 32C2A 2WV3A 3PQYB 4LDLB 4UQ2B 3NIGF 3ZSTA 2WSKA 4R7NB 1FE8H 4LHUG 5J3HC 2O5ZL 1HILA 1W0VB 2AK4B 4NUGH 1T89C 4L9LC 1U3HD 3KPTA 4O2FA 3RDTB 1B9ZA 1TJIH 3EDKA 3GM8A 4ZAKC 2MQ0A 4CKVX 1UZ6E 3T3PE 3VXRD 1OL0A 1U3JA 3EFDH 4W4OC 3MV9E 1YMMD 4XRCA 2V2XB 5JPMA 3WLBA 3LKPB 3CXDH 1P1ZB 4P4RA 1LK2B 5AZEH 3P30L 3QIWC 4I13B 4U3HA 3VXPA 1KB9J 3VXMD 1UG9A 1M05B 3HAEA 1H5BB 1SYSB 5ITBH 4FQQA 1NCAH 4JVWA 3IF1A 2NX5D 4OSUL 5I1JH 4GOSA 4XP5L 2XWTB 3MRPB 4L4VA 4HKJA 4WWKA 1A6ZA 5FO7A 1KLUA 2VOTA 5B39G 4P49A 4IOIB 5T1KB 5BJTA 4RMTA 4KUCD 2P47B 4XHQA 4FQJH 3ULSB 4EOWL 1S7RA 4TN9A 3PQYA 1Z9LA 4UQ2A 4R7NA 5CD5D 7CGTA 3X12A 1DANT 1U93A 4XCEB 3NH7L 4MZ3A 2AK4A 5IEHA 3QUKB 5CUSH 4YDIH 3RDTA 2PN5A 3SOBL 1U8PB 2V2XA 2V17L 3WL9B 4QCIB 1YEKH 3U0TB 5KS9E 3LKPA 2W9DL 2JJWA 1P1ZA 3EJZD 1LK2A 4P46B 5I1CL 2GTZB 4PBWD 3RTQB 5C08B 2X42A 1H5BA 1MIEH 1TMCB 4JM2C 5EU7C 4PGDB 3SCMA 3RVTD 1OD7A 4A6YB 1MFDL 1W8NA 2PKDA 4A6YL 1ZHBB 3ECBB 4M5ZL 2VITB 3O2WH 4WDIA 4O2EB 4NQXB 1U3HB 4IOIA 5EBWA 1JWUA 5GRXG 4TVPD 3WSQL 5HYSG 3MO1B 3ULSA 4PUBH 2G9HB 1DVFC 1YMMB 2FATH 4CU7A 5IKCA 4Q58C 4AYFA 5L6YL 4GRWH 4XCEA 4D0BB 3SCMC 4PRBB 2A6IB 4NSKB 3QUKA 5J13B 2JJTA 3V95A 4C56A 3L5WA 5ISZD 1BFTA 1RZJH 3VXMB 5L2KD 2I9TB 2J1KA 4OI7A 2EO9A 1U8PA 3WNPA 3PHOB 3WL9A 4U1LB 4BQ6A 4QCIA 4JREC 4KXZH 1XCTA 3ZDZF 5FCSH 2NX5B 3V4VH 4YHYB 1TENA 1WTLA 2CXKA 3DO7B 4P46A 3P0VL 3DYMA 5B38A 3RTQA 4MDIB 4PP1C 4RISH 1PGRB 5C08A 4FZEH 3ES6B 4ZOBA 2CMRH 3P2TA 4WHYH 4F7CA 3P11L 3PGCB 2ZPKH 5DA4A 4PGDA 1QVOB 4A6YA 2CGRL 2AV1B 3GGWB 3Q2CA 3W5MA 3MUGB 1Z6JT 2IH3B 3FTGB 4JRXD 5KBNC 5I1KL 3ECBA 2VITA 5LWYH 4UI2A 1IM9B 1AC0A 4O2EA 1OSZB 4NQXA 1KCVH 4AH2B 3EHBC 1U3HA 4EIZC 3GRWL 4JFZL 3E6HA 5IB5A 5I1HH 1IT9L 4KJQC 3MO1A 3VXRA 5LQBL 3DX9A 2G9HA 1YMMA 5LGJB 3RGHA 1CXHA 3H0TB 4XNMB 3EYUL 1A7NH 1NGZB 4MB3A 1YEGH 3KYKH 4PRBA 1C7SA 2BP3A 3P4NB 4KZDL 3ZYOA 2BNRB 3EOBB 2FBJH 3NPZB 3RI5K 1WC7B 5J57B 3CK0H 4X6DB 1I7ZA 5EOCJ 2I9TA 4CMHC 3PL6D 2JK5A 1QRNB 3MMEB 4HX1B 1JMXA 4U1LA 2BHUA 2NX5A 1X5ZA 3U0WL 3DO7A 3UTSD 1JPSL 2DQGL 3S4SG 1XCQA 4MDIA 1NMBL 5JR1H 4DTGH 4AG4L 1B6DA 2IGFL 3ES6A 3T0EA 5IOPA 3KPMB 3PGCA 4Z7UB 1F4WH 1DL7L 2VLRE 5JW4R 3Q3GB 4TVPL 1L0YA 3MUGA 2IH3A 3FTGA 4LAQL 2ERJC 4PJBB 3GRWA 4PJIB 1Z5LB 3QI9C 2FO1A 3BKCL 4WI8A 2DOCA 1F13A 2E6JA 3HS0A 5CKGA 4M62L 5L2KB 1IC4H 2LTQC 4K7FA 1DBML 4XXCA 1YY8B 1RUKL 2X1PA 3T0EC 5LXGH 3H0TA 3UYRL 4XNMA 1D9KC 1QEWB 2EXWD 4HGKC 4IHOB 5HY9A 4ETYA 1NGZA 4LU5L 1NBQA 1CR9L 3P4NA 3QDGD 1DBKL 1MCPL 5IFAH 5F9JB 3EOBA 1NFDE 5HI4C 1ZANL 4K94H 4R8WL 1WC7A 1INEH 4NQVA 3V52L 5DFWH 4P5MB 4ODUB 2GEEA 5GJSH 2EIDA 4U1JB 4PGEA 4TSAH 4FTVE 4OCRL 1HHJB 2UWEF 2HTLD 4H1LH 3VGAC 5A2FA 4JRXB 4JFDE 5KTEH 5GZND 1OCWL 1DBAH 2CKBB 5I9QC 3O9WC 1IE5A 4KK6C 3HRZB 5D8JL 4YAQB 4LSRL 4MWFB 3KPMA 4KHTL 2JJUA 3NACL 4M6AA 1C5BH 1H3TA 3Q3GA 3MRFB 3GIZL 2FZ3B 4XNYH 4KRPD 3UBXB 1AE6L 2CR6A 3I02A 1QFWH 4RCAA 3STBA 1TITA 2BHYA 1FLTX 4F58H 2VYRE 1Z5LA 3QQ9D 5DWUH 5ISZA 3GBMH 3W81A 2CK0L 5FM8A 3CLFH 3DECA 1E6OH 5L2KA 2O5YH 1IQDB 4Z5RA 1MAMH 4GRWF 4IHOA 3NCCB 2J2ZA 2YPKB 5DHVH 4AZ8A 3ZE2E 4ZQKB 2DQJH 3QG7L 4R96A 4HUKB 3UTSB 5HPMB 4KU1A 1J10A 3HZYB 4P5MA 1OM3H 2UYLB 4ODUA 4EJ1C 1PDKA 4NBYB 5I71B 5I1EL 4U1JA 4NN7B 5CINL 3DROA 4Q9QL 1HHJA 4XCCH 4BQCA 1AH1A 2DQUH 4JRXA 4F7MA 4NQCD 2FBOJ 2A38A 5E6IC 3HRZA 4PJXB 3MRIA 3NA9H 4KTEL 3N1GC 5IB3B 1ZEAH 4OD1L 2I24N 4WIQA 4K3JL 5KVFL 2F19L 2GIYA 5F7DA 5I18L 5ESAB 3MUHL 1HSBB 3VWJD 2FZ3A 4MJ4A 2DI9A 5GHWL 5TF1H 1JWSA 2XKSA 5EORH 5A3IC 3DUSB 4JFQB 2X44D 4WTXA 3QDGB 2FJFA 2DIBA 1DLFH 3RNKB 5FDWA 3SGDI 5AUMB 1T2XA 1L6ZA 3PL6A 4HWBH 1IQDA 1MCSA 3IJYA 4BELD 4ZOCA 2YPKA 3RVXD 3MLZH 5JHDD 5CIPB 5DUMH 3UTSA 5HPMA 1KEGH 4RNRB 1BOGB 4WO4C 4P48A 4Q6IC 2ITDA 3U0PB 4IDJH 1R5WB 5I74C 3TYGL 4FXLA 5MEPB 3QRGL 4AEHH 4M93C 2UYLA 3A6CH 2MKLC 4MA1C 3S36X 5HDBE 1TVDA 5DD1L 1IKFL 4HJJH 4BJLA 2V2WA 4I3GA 2N56A 5CJOL 1FZJB 2BNUB 2BOBB 4PJXA 2O5XH 1XMWA 3BPOC 5FGSA 1CG9B 5IB3A 2PYEB 1QQDB 3ARGD 3RWIB 1HNGA 1MHEA 5ESAA 1MCNA 1HSBA 1TNNA 1IVLA 4PRIE 3O6FD 2MQCA 5TQ2L 3S5LG 2JB5L 2BVYA 1XGPA 3DUSA 4GAYB 4JFQA 2VDNL 2D03H 4LCYB 4LCWB 3QDGA 5I66B 4HQQL 3SBWA 4NPYB 2IAMC 2NTFA 2BY2A 2D4DA 3LQAL 1S9VB 2R9HC 1E0OB 4JN2B 4EDWL 5TE4H 2QL1A 4X8JA 2IMMA 1A1NA 1FJ1A 2YPLE 3SE4A 1F4AA 5FO9A 1KCLA 4RNRA 4RMRA 1U92B 2OJEB 3U0PA 4NQCB 2LABA 3REWB 4PJ9C 4IS6B 5D7IF 4Y89A 3WLWD 2EXWC 5DXWA 4R0LA 5MEPA 1A47A 4U6VH 2E9BA 3DVNA 1NGPL 2BNQE 1QBAA 1AFVH 2CJUL 1MHHB 3VWJB 2NY5H 4DOHE 1FZJA 5L8KB 2XTLA 2BOBA 5AWNH 2XN9D 3WUWG 5CJ8A 2QV2A 2HTLC 2R4SL 3DO3A 1QQDA 2Q3ZA 2C3VB 2AJSL 3OWEA 4OB5H 1IAIM 4PRNB 4R0LC 4N5ED 1OTUC 4WFGE 1WCQA 5IQ7L 2C4XA 3VI4F 5JHDB 3GMOB 3O6LH 1UA6H 4GAYA 1T22B 4N90E 1J1PL 1J0KA 3OKYA 4G8GD 4ZUSB 3ARFB 3ROLB 3FT4B 4KMLB 1QRKA 5D5MF 3C9NB 4NPYA 5IG7A 1E27B 3QQ4A 3ZT7A 4CGTA 5HD8C 1ACYH 4WUUE 3OKLB 3WS6C 3MXWH 4NNYA 1S9VA 4NDMB 4JN2A 3BPNB 3L3KB 2Y06H 2J4WL 4G7YH 4RMUA 4WFED 3WKMH 2KZWA 4KTYA 2A9ML 2XI9A 4XP6L 3UTTE 1U92A 3IVKA 4NQCA 3REWA 4IS6A 1Y0LA 4LPVA 1U0QA 5J12B 1NDMB 3U7YH 1NC2D 3ARGB 4L4JA 1UYWL 3LQAC 5EIIB 5I8OH 1FRGH 3V4PL 3VWJA 3SGJC 4K3HA 2AJUH 2Q7NA 3NCFB 1T66C 3DXAD 3FCTB 4OCSL 4IOFD 4GAJL 4Y4KB 5DF0A 4KKAD 4O9HL 3NTCH 3UPRB 4WCYH 2C3VA 3FRUB 4CBPA 5E08L 4U6XB 1UH4A 1N0XH 4PRNA 1PX3A 5E4EC 2RFXA 4LSVL 4YBQC 5FKPB 4PLKD 5JHDA 4FQ1L 3GMOA 2JJSC 1T22A 5KJRH 3QAZC 4Y5XB 1LK3H 4N0FB 4ZUSA 1D5XB 3FT4A 3HI5H 4LIQE 4PV8A 3D0VB 3C9NA 5EU6E 4O5LL 4A2MA 1I3VA 4BSVB 1E27A 1TCRB 3MLWL 3V6ZB 3NFSL 5DRXB 3MJ7A 4X6BB 1IEBB 3BP6B 4S1RL 1AR2A 3DWTA 5CZXD 1QHOA 4PJ8D 1MCOH 3QEUB 3I9GL 4HUNB 4PR5B 5SX4H 4OZHF 4R4NC 2C3WA 3CFIC 1LILA 3RVXC 3B83A 2NY7L 3QNZB 4FQIH 4MNQE 3QDJD 5CJXC 3UPCA 1NDMA 3ARGA 3IDYB 4X9FA 1UKQA 4IEFB 4NWTH 4NM4H 3ZT6A 3MLYL 1CFSB 4K23H 3O6FA 3ULVH 2IALA 4NC1E 1NBVH 4EI5D 1JF5A 4I5BA 5ECJE 3U48A 4G8GB 4WW1B 5FKAB 2IADB 4X7EC 3W11C 4HIJA 5L0QC 3OKEA 4M7JH 5T33H 4LNRB 2ATPB 2NLJA 1FLRH 5CKAA 3PWVA 4JY5H 4YHZL 3PGFH 1EXUB 4JAMB 4BFEA 1NQBA 3VRLF 4Y5XA 2EDXA 4MHHI 2AABH 1A3RL 1D5XA 5IMMB 3UJJH 3O6FC 3FO9B 4GKOA 4CUCA 5C0FA 4BSVA 2APXA 2Z35A 1TCRA 3WFHB 4BK5A 3OPZH 5DRXA 1NC2B 4MMXC 1PY4A 4UQ3A 1C5CH 3BP6A 5T1DH 1T1WB 3MGOB 3IGAB 4QRQA 2QQKL 3BH8B 3QEUA 2DDQL 3DXAB 1D5IH 3QA3B 5FYLE 4JDTH 4Q74A 1MRFL 2XN9A 1TCMA 3BQUD 3QNZA 4LLYA 1BP3B 3WHE1 1CGTA 1Q94B 4KJPD 4LAJH 3LKOA 5FA3A 2BY1A 3E8UL 4WEMB 3HFMH 1I9JH 5JDSA 4OUOA 5GRVK 5E1HB 3LS4H 4ZD3H 3U7WH 4G8GA 4WW1A 1RZJC 4PV9A 3CVHH 2EDLA 5FKAA 2IADA 5E7BA 1ZLSH 2OS7A 4OQTL 5B4MC 2CO7B 4LNRA 1DQQB 2ATPA 1NGYA 5C2BH 1LD9B 1BEYL 4JAMA 4TQEL 3IU3B 2QSCH 3BP5B 4PJ8B 3BZ4A 4LOUD 1FV1B 4DGIL 2AERT 4YXLL 2HJKA 5IVXF 5GISL 5ACZB 5ALBL 1LO4H 2ZUUA 4Z76B 4JFXB 3RY6A 2DYPD 4GKSB 1NC2A 1RQ5A 1PAMA 3CH1B 1IJ9A 1T1WA 3IGAA 5HHXL 3ZKMD 4YHML 2ZNXA 3DXAA 3QA3A 4W6WB 4AMKL 5FYKH 3F12B 1UADC 2ZUQC 4QHMB 3H9HB 1Q94A 1PSKH 3BSZL 4C57C 2FX8H 1OAZL 1QA9B 4LVOC 3HE7C 4ZFGH 4LEOA 3FAXA 5SWZE 1MRDH 4MA8L 3ZDYE 4DN3H 4OQTA 1JHTB 4KDVA 4KI5E 5K59F 4PG9A 3MYJA 4IOFC 4ODVH 4KKAC 1JK8B 4JKKA 5IV2B 5JXAL 2Z4QB 1DQQA 1U8IB 3L5IA 3SKJL 2WW8A 1LD9A 3NIFE 4K9EL 4GXUM 3IU3A 3BP5A 4PJ8A 1TZIA 4GAGH 4EUPH 5ACZA 4OLWH 3BQUB 3RWJB 3QDJA 3CCHA 4JRYD 1JWMB 2HFTA 3EYVB 4Y2DC 5JW3H 1P7QD 3CH1A 3MLRH 4G6KL 1KCSH 1ZT4B 3U7AA 2I9LB 2VDOL 2X9YA 5C0CB 2BC4B 3AXLA 4G43A 4IRZL 4EI5A 5EO9B 3S6CA 5DMIL 4QHMA 3H9HA 3GEWB 4PS4H 1UCTA 3H3PH 4JGMA 1R3JB 4ZUUA 3O6KH 2D7TH 4GT7A 1G9EA 4JHWL 5FIEA 1EEYB 1I8IB 2QBWA 3RIAF 1NGXB 3KAAA 5HYQB 2R0LL 4G8EB 5BQ7A 1S7TB 3F6IA 5FGBA 5B8CA 1YEFL 4MQSB 3PWUB 2HT4D 2WAHA 2DYPB 2Z4QA 1U8IA 2EKSB 5IVZB 3RUGB 3H9SE 5F1OB 3EZJB 3P0YL 2ZOLA 5SV3A 4H8WL 4RGOL 5KSBF 3TN0D 5IB1B 3NA4A 4ZO6A 1CXKA 1UXWB 3BQUA 3SGKC 3EYOA 4PJDF 3RWJA 4XNUL 1JWMA 3EYVA 3T04D 3CFCL 3NCBB 5FGBC 5B8CC 1KC5H 2A9NL 1ZT4A 4M48H 1SEQL 3SDDC 2I9LA 4U7MA 5F96H 2KPNA 2BC4A 1NFIB 2DQDL 3ETBF 5EH1A 5DMYA 4RMWA 4NUJA 5EO9A 1HEZA 3MRHB 3OXSA 2H2PD 5I30L