2IO5A

Crystal structure of the cia- histone h3-h4 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
154
structure length
154
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/structural protein
molecule keywords ASF1A protein
total genus 28
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2io5A00
4EO5A 2IDCA 1WG3A 2Z3FA 1TEYA 2YGVA 2DZEA 2Z34A 2IO5A 2HUEA 3AADB 5EIIG 2CU9A 2IIJA 5BNXD 2I32A 4RRPM 5BO0D 5C3IA 1ROCA 4ZBJA
chains in the Genus database with same CATH superfamily
4NZFA 1TLMA 3NFPA 4RA0C 2HTLC 5GZOC 4L37B 4O02A 4XCYB 4TLSA 2YJQA 3WFCL 2H41A 4RFOH 3UPRA 4KJQD 4LDEB 5I18L 5JHLH 5F9WC 1DQML 3TIDB 4M1GH 4C56E 1KENH 2A9NH 4H5SA 3IT8D 5FCUH 4RDQF 5CSZA 2QZ5A 4AGOA 1JHLL 4Y1AB 1EXHA 3QFJA 3ARZA 5F8QC 3OHMB 3KBHE 4HOZA 1ETZA 3TEXA 1ML0A 1T04B 2IXQB 1ASQA 4PJ5D 4JQXA 3NRPA 4GRLB 4WK4B 2EACA 1E5AA 1HSBA 3B2UC 2QADD 4PGJA 2F53D 3VJ6B 1FYTD 1F3JB 1HZHL 1HINL 5IHZA 2DWYA 3T3PF 1HYRC 1BOYA 4TNFA 4ETQB 2WO3B 3KLKA 4N8CH 2NNAA 3HG2A 1S7VB 4H8VA 3VXNA 2C5DC 3LPGA 2FLBT 5TQ0H 2CHNA 3ZHDA 1TF4A 1XMWA 4U1NA 3QWOB 4FEMA 1T0OA 2MPVA 4A2GA 4CBPA 2C7UA 4AW4A 2VDKL 3B7SA 4D94A 1WZLA 3DBXB 2KZ1B 3QXDB 4LHUA 1DSWA 1AE6H 5EOCL 1E50A 5A7BA 5I24A 3IVKA 3CMOL 4I5BA 3WIAA 1BF8A 2Y9RT 3AG4B 2DWEA 4L8CB 2LHAA 4L3CA 2ZSWA 1UOKA 3MV8A 3KWWA 3GK8L 3QPKA 4U2ZA 4Y5YA 4JKLA 1OTSC 2FYVA 3UTTE 4OZFB 4BH8A 3DX9A 3OKKA 3ZE2B 1H3XA 3QK0A 3FUEA 3C6LA 1E28B 2ED8A 4M62H 4AVJA 1E28A 3MGTB 4WFED 2CG9X 1LO3L 5E6YA 4JQVA 1R17A 3MUZ1 2WLYA 4OCSH 5K1VA 1EDYA 3IDJB 1T5XB 2ZF9A 4LOFA 5IR1A 1AD0A 1MJ7H 3ZTNH 4IDJL 4JGUA 5BPPA 3BKCL 3NGBC 3F7YA 4Y19B 4TLKA 3TO2A 1YEFH 3AU1A 5J6SA 4Y0GA 3K5SA 4AQ8C 3EBGA 4Y9FA 3TU6A 3DDGA 5B8CB 2P5EE 4FQ2H 2IO5A 3SYAA 1E5ZA 3ASOB 3QJHA 2VE6B 4R7NA 4F7KA 4I48A 1MWAL 3DHUA 3FT9A 2L4OA 1FVDA 1URLA 3BQUB 3IGAB 4K0OA 3U9PH 1AYOA 3BSZH 3D85D 3KYMA 4HC1A 3BC9A 5L4MA 2Z31B 4J4PD 4EPSA 3DV6B 2PCFA 3QORD 5IVZA 3HZKA 2W0FB 3HUJF 2H26A 3GXPA 3DX8A 4I0PB 2EICA 1KY6A 2XICA 1EFXA 1U8LA 3ARFD 3BD5A 4APXA 3O41A 1HOCB 3FT1A 3Q44A 1YN6B 1L9PA 1WIOA 3PUCA 5AOIA 5EU7E 1BGXL 3MLXH 4N8VB 3OGCA 3SOBL 1NAKL 4BKLA 4D8PB 2R0ZH 1WYJA 2P8LA 1MNNA 3VCLA 5I6MA 1ZDSA 5T33L 3PIQA 3EZJB 2R4SL 4M03A 3T77A 1CFVL 5E6UB 2I9LB 5I1JH 3ES6A 5GRYA 2J5WA 5SX4I 4EZKA 2CAKA 4YC2C 3ES6B 4XMVA 1B3JA 1T22B 3DI3B 3G6DH 1ZGLB 2CXGA 1WEJL 5TE4H 2X0WA 1U91A 2GHZA 3DVNA 5DJXB 3UIZA 4HWNA 4G8GB 2D31B 3ARBD 1BVKB 2NUTB 1NCDH 3RGVA 4NQSA 3TZVA 1U58B 1QFWL 1U8QA 1WC7A 3B9KB 3FO1B 4A6YB 5J12B 3AZUA 2W38A 3S5ZA 3FSZA 3V7AE 1U58A 1WC7B 2IWKA 4NI3A 3IXAB 3NSJA 4U6VH 5CEYA 5ESQA 5GS3A 4LCCC 1QABA 1HIML 4PIBA 5J56B 2OTUB 3I3BA 4FTDA 4HCRH 4Y7OC 3WL9A 1AGCB 3MV9E 2BOBB 2C3WA 2VC2L 4M93C 3FU9A 4CNIA 4JN2B 4BQ6A 1OTTC 5E95B 4ABUA 2J8UB 4UOZA 4LEXL 3UO1H 1AR1B 4XVSL 5A6IA 1GY2A 2CUAA 1P5UC 3L17A 5KW9H 4HS8H 5EBGA 2JCCF 1IV8A 4XGZA 1JNLH 1ZJAA 4UAOB 3T2NL 5TF0A 4XBPA 1JGVL 1U3HA 1YN7B 3FN3A 4HKZB 4ODUA 4QOKD 5IBUB 4AJ0A 3MBWB 2X4PB 2PR4L 3RX9A 3NSFA 3D0LB 4PJIE 3QGVA 2P26A 5DI8A 3GMOA 1CL7L 4YSQA 1SJHA 3HZMA 4ODWA 3HN3A 3FFCB 2EEBA 2AJZA 3BIBX 2DWDA 3P3TA 4HIPA 2EECA 3RYMA 2GI7A 1HNGA 2CO2A 3NIFF 4XO4A 4OF7A 4ZX3A 4QXTA 1JUFA 3RFZA 4PJEB 3EKCA 4PGCA 5I1KH 3MKGA 3EOYG 5HHOE 3L1GA 2YC1A 3RQ3A 4PS4H 4LESA 1TSHA 1G9HA 2J1ZA 2BFVL 1UUNA 3CFKB 3CN3A 4XOEA 4BXSV 4Z23A 5C08B 4IU3A 1SJVA 2VDOH 1RZKH 5E94A 4AZ8A 2C8NA 4CW1A 1OF2B 1EJ6A 4PCKA 3WDJA 3DIFA 2EE9A 3CQPA 4GRMA 3DPBA 4PJCE 4XE5B 4CW1B 1JD9A 3HN5A 4B7LA 4MZ3A 2XV3A 5INDB 1U0QA 3IU4H 4JO8A 1UH4A 3N85H 3BUYB 4MAYA 5T5NF 3F84A 4JVUA 4WDIA 2JB6B 4Q4EA 2EKJA 2ORBH 4PWKA 1I7UB 4K3JL 4QI3A 5GRVK 1D7FA 3VI3E 4X6BA 3E6FB 2R23A 2GG1A 4KVPA 5KSBA 4P23A 4PMEA 2X3AA 3UOAB 2VN3A 5B1JC 1YNTB 1FIEA 3FQTA 1OHZA 5FA3A 1KC5L 1QRND 4MAYD 3IGAA 2X4UB 3O3AA 3KCPB 3QG6B 4HZLB 2NY3D 4CC4C 2VE6A 1R5IB 4ATTA 3HOGA 2WXNA 3KPTA 3P54A 4UQ2A 4LLMB 2AKRB 5EEYA 3N3EA 2G3XA 2Y22A 1TZIB 5ANMB 1PZBA 2QPSA 2VLJD 3MRNB 4E9SA 4L3EB 4LDOB 4V1DD 1Q90A 4WWKB 1MHHA 1AHMA 3ABKB 2IALA 4YLCA 4HEMA 4LLWA 4TUKH 1ESOA 5CGYD 4Y8DC 2XZZA 5D2LB 1FHNA 3RA7L 4DPCX 4JKKA 4PJAB 1S7SB 4PBXA 3U7AA 4UILH 2JIXD 4YQXL 2JKIS 1CDJA 1V27A 2PP7A 4Y2DD 1KSRA 2DBLH 2YPVL 1ONQB 3FU7B 4RX4A 3V6OE 5TPWH 5C9JB 2OZNA 2WZ0A 4XN5A 3U4AA 4BINA 2XHNA 3PAYA 5D1QC 5GRUH 1HQ4B 4I0CC 1RJZA 4HPOL 2OZ4L 3UO1L 4KTGA 2R0KH 4ZNEE 3ZMNA 1UUSA 3BGMA 3AGVA 5LNDA 5IJCC 3OXRA 4PS4L 1BVKA 1BZOA 1F6AB 4WW1B 1HHKA 4F2MB 3OJMB 4Z7IA 2UXGA 3BD3A 2I5YL 3NABH 2H32B 4E9QA 4U4IA 2X4QB 3G5VA 3O0RL 1JOIA 4FNRA 3X3GL 2IDCA 3BP6B 1IAKB 2XTJB 3I9AA 4WU5B 2OMWB 4L8SC 5ITFB 3CHXA 1I85C 3SYOA 4NWTL 5EBMA 2E7HA 3K46A 3UTPD 3NP3A 3QQ3A 5F21B 4KJQC 1NBVH 5AVVB 4CU8A 3AVEA 1JZEA 2HLFC 1A7NH 5IBTL 4AH2B 4KKAC 2V5SA 3V4VB 5I1DA 5F1NA 3S88L 4JFFD 3H3PL 4OFVA 2VLLA 5AOZA 1CFTB 2EIMB 1AGEB 2A74C 2FLMA 1S9YB 2IPUK 3G7TA 5I1JL 1QI5A 3EGDB 5L8KB 3VRIB 5JUEL 3IU3A 1JZIA 4QYAA 4YLBA 1OANA 4ODTL 3D0LA 3BPNC 2VC2H 3TPKA 5IEHA 1PF3A 2EEAA 2V8MA 3QQDB 5DO8A 2KERA 2OW6A 5FO9A 1L9TA 4XBPB 3QIBD 2I9TB 1E4KC 2GBVA 4FYTA 3AAZA 5E8OA 5KVEL 1FLTX 5DZPA 2GTWA 3HI1A 4HISA 2VO8A 1F1AA 3BGAA 3L4ZA 2GUYA 4YN3A 4YXKH 5CHNA 5T3XH 3UG3A 1DQVA 4RRPM 5JQ6L 4NP4L 4YZFE 5DC9B 3AS3A 5SX5K 5T5FL 4D7BA 1EO8H 1LP9A 1HXMB 2R1YA 2ITFA 4K8RH 3B2XA 1MCNA 4LK4A 4Q9CA 2XBZA 1PCXA 3EYFB 1MWAH 1MCSA 5HHNB 2WXRA 4M4RA 4HJEA 3KXFE 5CEZD 4TRPH 5FYKU 3PRZA 2GIXA 4GG8A 1J1XL 5FUOL 4QF1A 2VDLH 4DPBX 4MJIA 1D5MA 2AP2A 2X88A 3ZJAA 3ZRCC 2BXYA 3HC0A 4AQOA 2C1OA 3PAZA 1BD2A 5I8CA 2F58H 2YJLA 1FL3B 1BFVL 4BUGA 4K15A 2QHLA 3AQDA 5IQ9A 2A4ZA 1ID5I 3LEYH 3QXTA 4ELMB 3KXFA 4HIJB 3DUSA 2UZXA 2F54D 1QRKA 2IH8A 2A9AA 2W8CA 3GSQB 1N8ZB 2QR0B 3J27A 3QPQD 4X6DF 5DLMH 4KITB 5HYEA 1KB9K 1HE8A 4XB3A 3FQTB 4XP4L 4NKMB 2PWGA 5DMGD 1J5HA 4G9FB 3AW5A 3EO9H 1MI5B 1WCBA 3HZYA 3FT2B 3RVXD 5ADPL 1MCOL 1BFOA 1Z32X 3I85A 4YR6B 4HIIB 1CIDA 1KG0A 2VXUH 4R8WL 1B6DA 1BV8A 4R96A 2JTDA 5DJ2A 5KVGE 1NAMA 1RZPA 1NCNA 1M9SA 3PWVB 2WAHA 3NFNB 5GGVY 2ZKMX 4MLIA 3FO9A 3S6CA 5D2LA 2JQMA 2CR0A 4XN4A 2AEQL 4KKCC 1P1VA 1G6RH 2IALB 1OM3H 3RL1A 4NUQA 4X5WB 2JWYA 3OGOE 4JFDA 2EH7H 3HE6A 2X2YA 5EEXA 1ZPLA 4V1DB 3V95A 3X3FH 1UZ8B 3MRCB 4GAYA 3VH8A 4HETA 2XVGA 3F8UB 1T1WB 2DQCH 4AQEA 5HGBA 4U7SA 4PJBF 4Z7UB 2QKIC 2UXTA 4HHAA 1QSEA 2WVSA 5DHVH 2NCEA 3LRLA 1EXUA 3IWUA 2WHVA 1E4WH 1BYPA 4MAZA 5BRZE 3SE3C 2Y07H 1SHWA 1JS4A 4OLZL 4UT6L 1OQXA 5HBBA 2GJ6A 4PJDA 4ZSOB 3Q8BA 4NHUB 5LG6A 3S8WA 4XP1H 5J13C 2HH0L 1MJJB 5IMLA 1X7TA 3FRUB 2Z8SA 4JZNB 3W11C 2BPBA 4WW1A 5C0RH 1WBYA 3GMNB 2XIIA 3QUYC 2VDRL 1J18A 1PZCA 3ULUC 3BW9B 3ROLB 1BLNB 3LKOA 4RIRA 2ZX5A 4PJ8B 3BW9A 3ROLA 3MLYH 1BPLB 5AD0A 2XQBL 1HINH 4J6IA 3A47A 1M42A 2X9WA 2A1WL 3T3PE 3TM6A 4BM7A 5AWNH 1MCHA 4ODVH 2F61A 2V5RA 3GSWA 2FIKB 5HYSB 4WEBH 5CJ5A 3INUH 3IGUA 4S1RH 2WZPD 3GSWB 1L3NA 3RY5A 2XA8L 3KPNA 4KRPD 4PRPE 1CFSB 1V3MA 1FAIH 1HSAB 3S4SG 4OGQC 3PHSA 1ZA3A 1KTRL 2QGBA 1SJXA 3KYAA 3DSNB 4UTBA 3PWUB 3ZPDA 1FO0B 2XWRA 3BEWA 3F7PC 3HBGA 1DBBL 2Q10A 1DJIA 1DN2A 1XSJA 4XZUA 2HJKA 4O02H 2YA2A 3RLSA 3U36A 4J12A 2QQKH 4PRNB 4XZUB 5DZJA 2LABA 4WF7A 1ASPA 4GG6B 3GM0A 1A4BA 2CK0H 4L8SA 5DJXA 5C8JA 3SE4C 4JAMA 2V3FA 3HUJE 1PLBA 5IESH 4YFEA 5DGQA 4P57B 3SDCD 5L2KB 4M48H 3IFOA 3RX8A 2R1XB 4ZTEA 1KWGA 1LO2L 1KIPA 1A6ZB 1DE4A 3B2PA 4BA0A 1U2HA 1U8IA 5CEYB 3HS9A 5IESL 4DPAX 2IAAC 4L4VB 1FNEA 4Y2DC 1KDIA 1INQA 5HDBF 4P2RB 3N40P 1FH5H 3WN6A 4A63A 3QFGA 1JZ5A 2O30A 4P2RA 5JHLL 3EAKA 1MAML 2OL3A 1D5MB 1Z0NA 2K3HA 2VZ1A 1F00I 4AC4A 4RGNE 1UT2A 2VLRB 3ZSSA 4RNRB 4PRIE 2JI3A 1OLZA 3FH7A 2FYYA 1QNZL 2Y07L 4OLZH 4UT6H 1TVHA 2VR9A 3TYGL 4NQDA 4F33A 1AIFA 2I07A 5JW3H 5DHEA 1QSFB 1V7MH 3KPRE 4LLDA 1CB4A 2HFEB 3KXFB 2PN5A 2FRGP 1SDDB 1Z9NA 3G5ZA 5IIEA 2BNRB 4PY8J 4NPKA 1U8PA 4G6AD 4TQEL 4OJYA 1U8NA 1UFUA 4NCC1 2OMUB 2GPZA 1MY5A 2EYRA 1MREL 1U8NB 1OM3L 3RX5A 2X89A 1OP3K 4FFYL 2X1PA 3H3KA 4X42A 2GJ6E 4MAUH 3BP7A 3HI5H 3ZYJA 1FWXA 3O8XB 1IZKA 4XXDB 1A3RH 3RGHA 5L88H 2IBGA 1D5ZA 5T1MA 2HMID 1S9WA 1NLDL 4GAAA 3B9KD 3IFNL 3EDJA 4DEPC 5FO8B 1JRHI 1PPIA 3ZR6A 4KWUA 1YJDC 4JZJA 5IM7A 3JVGA 2UZPA 1FO0L 4CJ0A 2FUTA 2QTEA 3P77A 3GSVB 3H42L 2OSLA 3P4LA 3SDXB 4JZOB 1G7JA 2Q5BA 1XDTT 3Q3GB 2W5PA 2PETA 2Z8VC 3MRPB 3MLPA 3KR3H 1BWMA 2P80D 2XKUA 2GK2A 3LEYL 2ZG1A 1J0HA 1P6FA 2CJUL 3QJVB 1HHIA 3AT0A 3GSOB 1DBJH 4ODHH 4BJLA 2D03H 3MGTA 1J8RA 2ZAIA 4LFHG 3ILQD 5J13B 1IE5A 2CDEA 5CKGA 4BK5A 5KSBB 3BKMH 1S6NA 3ME0B 4AUUA 5DUJA 4HWEH 5IVXA 1VRSA 4MNGE 2N1KA 4MQ7B 5I75B 5B8CA 4PGZA 3UGEA 2BK8A 4IIQC 4Z7OF 4TULL 4N0YH 3H53A 4JFPB 4XNMA 3SO5A 1LEKA 4LLAA 5I26A 1S5HA 4K8RD 2AMUA 5ETUB 2AKRA 3ULVL 2N7AA 3OX8A 1JGLL 1MI5E 1L3WA 3T6VA 2QT6A 3VI3A 4YMPA 2A6IA 3ARDB 5CU5A 5EBWB 3WN5A 3UYRL 2J43A 5AYQA 3VGGA 3FRPB 4K23L 1UH2A 5JIHA 2DYRB 2DN7A 1RULH 4Q4IA 5HYIA 1ODUA 1GOFA 2H32H 2YRPA 2XN9E 3DJTA 5HVGB 1CK0L 3QXVA 1ORSA 2IH9A 4Y5XA 4KO5A 1E30A 4WKZB 5JMRA 1MHEB 2F1EA 4OFYD 5IFJB 5E5RB 5D55A 3NEEA 3NAAH 4JL1A 4R84A 4LMQI 1X6LA 4HK0A 1QO3B 3H3PH 3QDMB 3TA3A 3QYCA 5F7DA 1JZHA 1QO3A 3KHQA 3HG4A 5M95B 2NSQA 2CCWA 2UXFA 4DUXA 1XH1A 3P30L 2PWEA 2BZCA 1UM4L 1A9BB 3BHBB 2DYPD 3FBQA 3VXUB 4PJ9C 3T4YB 2H8PB 5DVKA 2NY2B 2AW2A 2NYYC 2P24A 3KPLB 4L5FH 4W68A 3SKJH 4LPYA 3RGVB 3SCMC 3TZVB 4L4VA 4DVRH 1YAIA 3EJZD 3PWPD 3L9BA 1A6ZA 1DE4B 3MLSH 4C4KO 2OQJA 5FPIA 5LGHH 1RZ8A 5I16B 1INQB 3AQXA 1NGWB 1QLRB 1QEWA 4S1QL 1D7DA 3MV9D 4X4XB 4Z7NE 3P4NA 1M7DB 4L4VD 3P0VH 2CO7B 5GIRB 2AK4D 4CVXB 1UA6L 4HUCA 5DUML 1YRKA 3O4LD 3S36X 3N04A 1YPZB 2KZBA 5HDLA 3RP1A 5C0AA 3GUTB 5KBMA 4OFIA 1FNSL 1D6VH 3BPOB 1BJ1J 4FQHA 4ISVB 2EC9U 3TA3D 1BF2A 3QQDA 4LKCA 5A2AA 3M8OL 2VDLB 2C4FU 3OBAA 4OD2B 3VYPA 1GJUA 8PAZA 4UIKL 3S8GB 3MV7E 1GS8A 1KN4H 3ULVD 1DBML 1MWAB 2WYZA 3RWGB 5ILTL 2BVYA 2QADB 4CVZA 1OPGL 5C0BA 4K5LA 3WJMA 2YLHA 1IM9A 3MRMA 5C86A 1OAKH 4ZD3L 2EXWC 3DK0A 4NN7C 5FK9B 1Q0EA 3HBQA 5IMOB 1SUJA 1G9ML 4JHAL 1CICB 3ZKMD 3NJGA 5C6TH 3BT0A 4AQ8A 1W0VB 5IM7B 4Z3EA 1DUYB 4XNBA 5IOPB 4QF1B 5CGMA 3ZE2E 4HJSA 2R2HA 2H3NB 3LIZL 1E2ZA 5A2KH 4J3SA 4H0LC 2MQ0A 5HGDB 3JTTA 3OL2A 4D0CA 2OMZA 2ICCA 3TVMB 5JIMA 5L9DH 3OB0H 2VYRE 1COBA 1NCCH 2WZAA 5MENB 1K5WA 1A6WH 4JW3A 5LBSH 3UBXB 3GSOA 1AC6A 2V5YA 4I3RH 5DJ6B 3U9UA 4HG4K 1P2CB 4M7LT 1UTDA 5D7LD 1INDL 1QW9A 1G9NC 4M7KL 5SV3A 4BWWA 1ZV9A 4E36A 3QJZA 1TJGL 2XRAH 5I0DA 5JIPA 3L4WA 4BKSC 3ULUH 2R9HC 1I7UA 4LVHB 4DZ8B 3H2QA 3MNZA 2BNRD 3LRMA 5CN2A 4PP1C 1EJFA 4R26H 4WCYH 3ILQC 1RIUL 3G08A 4JFEA 4OD3H 1U33A 2Z0BA 2VDOL 4XHQA 5IB1B 4RGOL 1C5BL 3UTPE 2ZX8A 3CVHL 5FA3B 2R15A 4ZT1A 1JGUH 5D1QA 5J6GB 1SFHA 1MRDL 3PQYA 1CXIA 3PWVA 3UYRH 4JFYA 1GA2A 4IK6A 3O2VL 4P59H 3OWEA 1FE8H 4DN4L 2EDOA 4EUPB 4FMKA 4JO5A 3MCYA 4LP5A 2D3JA 3C5XA 3SDYL 3ZDXB 2QKIB 2F68X 3QPXH 1RURL 1MG2C 1ZOXA 2OA9A 1JGDA 3CHOA 3LKPB 2JKLA 2M8XA 2XN2A 3IU4L 2VLKA 3FYIB 4HKBB 4PJ7B 2NCMA 3BN9D 1JNJA 5CJXA 1CURA 4QXGH 1U92B 1A02N 2X89D 3GDCA 2I26N 1WAAA 4PJ7A 1JNLL 2LLLA 1D5XB 3L8QA 4HZ1A 3IM1A 5B1BB 1CLOL 2CUHA 4G43B 2BLFA 4ZS7H 1RZIA 1I4FB 4XC3H 4JBSA 5D7JC 2Y1ZA 3FSWA 1FF5A 4KNSA 3KPQA 4WY7L 3BGMB 5BW7A 4IGBA 3K4ZA 2Q7YA 3VD3A 3K6SA 1GZPA 4U1GB 5EU3B 3CC5B 1WD9A 3K6SB 1FSKC 3PL6C 3MXVH 3KPLA 4ZQKA 2P7TA 5SX4H 3QUMA 2YGNA 2A74B 3V6FA 2ZX6A 1SXSA 2JCWA 2H8PA 3GSRB 4M7ZC 3K5RA 4JFQB 4B3VA 2CQVA 5EEWA 1KCRH 3I84A 1FGVL 3BP4A 5I19L 5CEXB 1XCQA 4R3SB 1XZ0B 5F1SA 3EYQD 1UWXH 2J25A 1NGWA 5KVDE 1QQDA 1SYVB 2XKSA 5T8IA 3MCLL 5C3IA 3V0EA 2K7QA 5EG6C 5SWZD 4AIOA 3O0LA 2EIJB 3EJTA 3WNKA 1YPZE 1FDLH 3QUKA 2OR7A 1I7TA 4WJ5B 4XBMA 2LU5A 3SE4A 3WMPA 5DR5H 4BE6A 2IPTL 3LNHA 3MXWL 1IEBA 4GMTH 4OZIA 2EAEA 5KJ7E 4J2XA 4PLOB 4MJ6A 4QOKA 3Q2NA 4Q0XL 3GUTA 5C07D 2Y7MA 4PJ9A 1FO0A 3VQ2C 3IU3B 1PQZA 3S97C 1NJ9B 2VDOB 2XBTA 4APQC 5KVDH 3MBWA 1DO5A 5HHOA 1GCFA 2EDQA 1MCIA 4FKEA 2CRIA 3R7QA 1GGCH 2GY7B 5GGSY 2G60L 3F5WA 2FQEA 2IBZY 5C0BE 3GGWA 3KH3A 3D39D 1M6OB 1WWBX 3SN6N 1ZD6A 3RWIB 4YDJA 3NZSA 2IG2H 4PLKD 1KCLA 3ZVVA 4LPUA 3EYFA 2W81C 5EPMA 1J11A 4BFGA 1JPSL 2EEXA 2J5LC 5HDWA 3FCUB 3ZDYF 1EO5A 2XWXA 3CUPB 5CBAA 1C16A 3ARBA 3HE7D 4MXQC 1RD6A 5F0PB 3VTAA 1BIIA 3IDGA 3KVDD 1I8IB 1S9VB 4DGVL 3LJ3A 3OKKB 4L4JA 4A39A 3QUXA 4GKNB 5J6HB 1UD5A 2NR6C 3A5VA 5TDNB 5L2JB 4MDRA 4N2KA 5FLVA 2YD5A 4HFUL 5CFHA 4YFLI 3AM8C 4F1ZA 2C1OB 5I8CB 2ZWNA 1GCYA 4LB8A 1CGUA 1PAMA 3H9HA 4WDIB 2DKUA 1GGBL 4M7LH 4HD5A 2BW4A 4LLUA 1WHOA 5IQ7L 1U8OA 4WWOA 5FKPB 2CKBB 4P4KA 2RA1A 1XL4A 1I9RL 2FWSA 4ZUSB 3VXTB 5I8OH 2NTFA 2XWJA 5GS2H 2JJTC 3TH4T 1PZSA 2CDGA 3MRRA 1XGQB 5I23A 5IY5B 1KCBA 4NUMA 4E5XG 3HE6D 4OGXH 5FS5A 4JFEB 2CJTA 4PG9A 4TQHA 3GSNH 1Q1JL 2FX8H 4BCZA 1BMGA 1V3KA 2M1KA 4F9LA 4DF9A 4YXLL 1Q72H 1XT5A 4JZJB 4GO8A 1S7UA 4L3CB 4QY8A 4XHJD 4WFHD 4QYOA 1TPXB 4D8OA 2WKOF 4PVLA 3L5IA 4L29A 5H2BB 1OB0A 1MCDA 3ZTNL 5BZZA 3ULAB 4I1RA 4JFDE 2GYSA 3SE9H 3FTWA 5F3BA 4ZFOL 3TJEL 2D9QB 3GSNL 1SBBA 4H0IA 1YEKH 2W59A 1NA8A 3Q9PA 3LD8B 1R3IH 8FABA 4P4RA 1PD0A 3UZQA 4UQ3B 1DDHA 5DMGC 4XN7A 5EN2A 4CMHB 1ZWIB 2DQEL 2WQXA 2YD1A 4MS8D 4DGWC 5CD5C 1CYWA 2Z7UA 4HX1A 5IMLB 1PYWB 2EXTA 1A2YA 4IBQA 1NTDA 4NRZA 1DQMH 4HX1B 4DEUA 1DVFC 4KZEH 4AI7A 1GS6X 4DH2A 3EYUL 2UVEA 3CFTA 1ZSDA 4YVNA 3B7UX 3MROA 4HJ1A 4MJID 2A6DB 3IXAA 2P45B 3UZEC 3SDAC 3OLDA 3HE7A 3KYOA 5HTSA 2Y5EA 3TVMD 2E86A 2B1HH 2G5BA 3ZK0A 1JTOA 4NT6B 1YVLA 2F7RA 3MREB 2X6AA 2DQUL 4IU2B 1JNHA 4TXVB 4ECNA 1FYTA 3NIGE 3SKMA 4BBWA 3WIIL 2EXWD 4IU2A 1GZQA 2F53A 1L7IL 1WH0A 2Q76A 3RIAF 3O11B 2X28A 3G04B 4OJDH 3LXBA 3B8SA 1CF8L 3E8UL 1RZJC 3L45A 3QJUB 4QTIL 5EU5A 2NXYD 4F7TA 1H3VA 3C5ZA 5TH2B 3TBVB 3VD2A 5I18H 2DQIH 1GR7A 4PRHE 3IKCB 1Q94B 1J8HB 1R3HB 5I1IH 3NPZB 2QDWA 3LNIA 4YS4A 2K3TA 2I9TA 3TF7C 2Q2EB 2YD8A 4PJFB 4XP6H 5C0CB 3H9ZA 4GRWE 2HB0A 4E5XA 3H54A 1P7BA 3T0DA 5EEUA 3O6FA 1IIIA 4Z7VB 5KSAC 1UXSB 5ALCH 3HE7C 3WNLA 3JWNC 4XCEB 1RZ8B 2CSPA 1UWFA 4M1DL 3P2DA 1CYXA 4M43H 2J3SA 1WA1X 4P5SA 4S1DD 4BWUA 5DJCA 4F5CA 2ZCKH 4HBQA 2J8UE 1FRGH 5SWZB 4O2EA 4Y2DB 3IDGB 4QLWA 4X7SH 5FHBL 4HEME 4JM2F 5TDPB 1CS6A 4WHYG 3P2BA 1M53A 5T1LD 5D72H 3TJPA 1HI6B 2FJGA 4IHBA 3N40F 3QCUL 1SNRA 2EH8L 4C58B 5IROD 1NIFA 4HLZG 1IKOP 3FQRB 5J11C 1WT5A 4UTCA 4DNLA 3B2VL 5B4MC 4I3GA 1NANI 4AGMA 3NJJA 2BNUA 4G9FE 1YG9A 3WGVB 4K71C 3N9GH 3PY9A 3LV3B 4P59L 2VL5B 3LRKA 3RDTA 2X42A 4U1LB 5ID1B 3LVTA 3WAJA 1U30A 1M05A 3ARGD 3VW3H 5H94A 4MCZB 1CCZA 1H6UA 3QUZA 1ECYA 4HH8A 5H37A 4EBQL 4PREB 3BZ4B 2ARJA 1EZSA 2BIOA 1AJ7L 4J3UA 4EI6B 1KZYA 4LLMA 2EIZB 3PQYE 1T5WA 4P05A 5LGYA 4X5LA 4Z7WB 2VQ1B 4OD3L 1S9WB 4LSTH 2Z92A 5D4HA 5EZIL 5F7EL 3W1ZA 2Z92B 3V79C 3LN5A 3PQYD 4I3SL 3SGDI 2AQPA 1FGVH 4D0CB 4AEHH 3HFMH 4V1DE 5A43C 4YEFA 5TFSL 1TXKA 2Q7NA 3EOBB 1EHXA 3MOAL 5CLZA 3FTGB 2O61B 1A0QL 3TURA 1NOFA 5F3BB 4QHMA 1UZ8A 3MRCA 5LKNA 2W1NA 2ZXDA 3QULB 4MAYC 3U2JA 4XP9L 3ME0A 4WCYL 4JRWA 5D7JD 2E8ZA 5JQIB 1MCQA 1EGJA 3L5HA 1P4IL 5D7EA 2F74A 3BQUC 3ABZA 4PJEE 4F9PC 5KSVA 3W9DA 1IZJA 3LEVH 4PTUA 4XNMB 2F54B 1D5BA 3BFOA 5KYUA 2YD7A 4YHNA 5D2NC 1Z0MA 4HJ0D 2ZJSH 1QSZA 2PW1A 1T3FB 4H25A 5CZVH 4PJHE 3NIGF 1KBGL 4JFYB 4JFED 3IWVA 1MI5D 3HZKB 3QQ4A 1JVKA 2VABA 1M71A 2VN6A 1JTTA 3UP6A 2ZKXA 3C09C 2F8IA 3LKQA 2QEJA 4B5ZA 5ISZE 4RDBA 4OCWL 3LXAA 3DIVA 4YSPA 5GGQH 4J28A 1S7SA 3FQ2A 1P7QA 3BP5B 3MJ8A 4IHOB 1SY6L 3LNGA 3P9MB 5D1XD 5KSAA 4CBZA 2CCVA 2W9LA 2RH0A 3K91A 1TITA 4JZJC 4W4OA 2VZUA 3FULA 3EH5B 1PNDA 1OAYH 3NCYP 1YEIH 1ZLEA 3K7UA 1ZA3B 4FLRA 4NQVB 1N26A 3BEVB 1FZKA 5AW3B 5FO9B 1IBDA 3OXSB 2WANA 4B5EA 3WHXB 3TBBA 3BHBA 3N85L 4I13B 4CL7A 1RL1A 2BRQA 2CALA 4GSUA 1WZKA 3I9GL 2VCOA 4GEIA 1U6AL 1RZGA 2A74A 3O4LA 2EYTB 3KPOA 4ZAKC 5C07B 3H7LA 5F9JB 5SV4A 4OZGB 5KW9L 3SKJL 2GBUA 3TWCH 2V9RA 4NWUH 4OZHF 3FH5A 2D7QA 3WIHH 5C70A 1UA6H 5DUMH 4CU6A 1FFRA 5C6TL 3RJDA 2P5PA 5H37G 1FNEB 3HS8A 3HZVA 3J2PA 4Y5VC 2AAVA 2DICA 1KYFA 3GJFK 5T5NG 5L6YL 4YDKH 2NY1D 2A83A 5FYJH 2QV2A 3DX7B 3JXAA 2DQJL 4UT9A 5CBEA 1EERB 1NH6A 5K9OA 2FJGB 4WFHE 1PQZB 5GRZA 1PIFA 4IRZL 1KPRA 1B0RA 3IF1A 3NSCA 5K69A 3GBNH 1UFGA 1X5AA 1IGCL 4LKCB 2PR4H 2Q87A 1Q0YH 1N6UA 5C0FB 2J2ZB 4PJGA 5GGSA 4BZ2A 2NUPA 2Y7LA 2ZP0T 5DO2D 5FB8B 5DRXA 4AVHA 1DVQA 4ZUVB 1E3ZA 4HW6A 5FDWB 1NEPA 4DP7X 5C0BB 3HEIB 3L3GA 4L0YA 3CU7A 4GH7B 3UTSD 1NEUA 3M1OA 4EMZA 4LEXH 2P5EB 5E6SB 1D5ZB 3RUGF 1LP9B 2QMJA 5T33H 3WNPA 2DJUA 2NY4D 4ANKA 2ENSA 5CCJA 2X7LA 2J1XA 1A4KB 4P2YA 1KG0B 5EPMB 3IJYB 2XYCA 1RFDL 1H3UA 4KQ4H 4MB3A 3FUJA 1BGXH 3NIDE 1K8IB 2B0SL 2NY5L 3DHPA 4M6NL 4WTWA 5LCVH 1T1XB 2WQVA 5JORB 3ZDZE 1KPVB 4NFDA 2WVTA 3SPIA 3CN1A 2FEDC 3SDXA 5FO7A 4LCWE 1CGSH 4LDCA 3RWJB 4LRIA 1ZVHA 3HNVL 4GUOA 5HPOA 4KNQA 3H0TB 5LLIC 4L4TE 3QQ9D 4CN6A 1JZ6A 1KJ2L 3DXAB 4ACTA 3QVAA 3B9AA 1K4DA 4IJTA 1UENA 3FQNB 1X9UA 3DXAA 3AG1B 3HC4H 4AVKA 5AVRB 5JHDA 1EXUB 4FQ2L 1EWHA 3QULA 3RU8L 2N59A 3HCVB 3LNFA 3I9IA 1MVFA 1KIQB 2G3NA 4G8GE 1NFDF 1RJCA 3BVVA 4PSPA 3RAJL 1JD7A 2WWNA 1HKLL 2P80A 3BKML 4HWEL 3TO2B 1PD1A 3FRUA 3OAUH 2AERT 3C6LD 3OG6B 3W9DB 2K0RA 2X4TA 3MQIA 4K2UH 4X6CA 5DS1A 4WO4D 5D1QB 3D07A 2QSCL 1AJ7H 5KANG 2KLTA 3LAFA 4EZJA 1N64H 2GABA 2GVYA 2YEVB 5B7EA 5EO0A 4AEIL 5KBKA 2NOYA 4BCYA 5EO0B 2R2BA 5CLTA 4N9GB 3EJSA 4KMQA 3OKDA 4X9HA 4Q9RH 4KRLB 3SO3B 1JGDB 4JFDB 4FTVB 1FG2B 2F7PA 1ZLSL 4BYHA 1VDGA 4G5AA 4MASA 3FFDA 2CIIB 1KJVB 2ADIB 2ARJQ 3CH1B 4FFWC 2AJUL 3V5KB 3QZNA 2X87A 3CFBA 4KVCL 2JTYA 5DC4B 2YPKA 1AI1L 4PGBB 2EC8A 4M43L 4TSAL 1HHKB 4U1MA 3JUYA 3LMJL 5EIIG 3ZDYE 5B4MD 3HFFA 4PR5A 3MSPA 3B9KA 4NO2B 4I4WB 4MSWB 3EGXA 3N1PC 3GBDA 1A4AA 2D31A 3QSKB 5BRQA 1I1AD 4POZD 1OSYA 2EDBA 3BP6A 5ITBH 3FUMA 5AALA 3VXUD 3CPLB 1INEH 1GYVA 1J0ZA 4IW4C 1YC8A 3GMQB 1AC0A 2OTUA 1NOLA 1JI1A 3GLZA 4OIBA 3IFPA 2ZOUA 4HHWA 3TO4A 3B9KC 2DH3A 1Z5YD 1I31A 4KNUA 4X6DA 4O02L 4OF0A 3RWDA 5L88L 3LHPH 3MACH 5BV7C 5C0CD 1WTLA 3TNMB 3E8UH 2CKNA 1OGAA 2FEEI 4P2OD 3EOAA 3VUAA 5I76B 1DL7H 5IB3B 1EJ8A 3VI4E 5C0FA 1ORQB 3ECUA 3QP3A 4F7TB 1QYGL 2X6CA 3G5ZB 4LF3A 4Z7WE 5HJDA 5IIEB 5L2KD 1NQBA 2CLRB 5D6CA 3RUGA 3UJTH 3KPMA 3WO4B 2QVKA 2E7DA 4GAJH 4EI5C 5DI8B 1HEHC 4ANVA 4P2RD 1GOHA 1XH2A 5E6IC 2FBOJ 3SKNA 2Y3AA 1KEMH 3QEUB 3SD2A 4X4YA 2WXGA 3FRPG 4QCIB 3KNBB 4H20L 1Y6KR 3T3MB 2JJSC 1JUFB 3VI4A 4DAGH 3RI5K 3TESA 1E4JA 2UVFA 3N1QC 4X4ZA 4UOJA 1QPXA 4KK5D 2HH0H 4URTB 1ILUA 3X17A 3OJ2C 1G7PB 4N86A 4KDVA 1B6UA 1EAQA 3HI6H 2OMZB 2WLJA 4RNRA 3QFJB 1QLFB 3MBEB 5B22A 4L4TA 4WSKA 4FXKA 5E94B 2E47A 2JNZA 3DIDA 1N7ML 1CGWA 4C4UA 1JWUA 1XGUB 3LXUX 1CLCA 3IJ7A 4LEBA 1FL6A 1G6RL 1JPGB 5BRZA 4U1HA 3SBQA 4KRPB 1Y0LB 4O00A 1VFBB 3CHQA 3OKOA 1WS8A 3NZ8B 3QT2A 4UINL 1KEGL 4NAMA 4XP5H 1ZT4B 5BZDA 5K9KB 2XTJC 4JQVC 5EOTB 3B83A 1S9XB 4YHMH 1TVBB 2NLJA 1FP5A 4P2RE 2X4UA 3Q48A 5IREA 4OZIF 4KXCA 1XGRA 4UB0L 3HC4L 1CLYL 4WEBL 4OKVB 2G9KA 2IOIA 4FXKC 4GMSL 4LQ1A 1IGML 4X8JA 2BSCA 1S7UB 1W8EA 4X0KB 2WWMC 1X9RA 3PLYA 3U4KA 6PAZA 2YMOA 1K6QH 3C2SA 1AGDB 3O9WD 4FXTA 6TAAA 3IETA 5D4IA 1S7QA 4APXB 4DN3H 2WGXA 1TQWA 3ISYA 5DLML 3GSXB 1X7QB 4OQTL 3WTYA 1P4BH 4KV5F 2QFPA 1G43A 4OIAA 4OIIL 4G6JL 4R5XA 3S36H 4N0UA 2VQTA 1BFTA 4FKKA 1FZJB 5JXEC 3PIQB 4LMQE 4WFFE 5I15L 3UJIL 5CINH 3B8YA 3LRSB 4UZSA 2AQ1A 3DYOA 2CO6B 4X5QA 3T4AB 3CZEA 5C0NC 1BJMA 2ADIA 1R46A 1A7OL 2OK0H 2XY2A 4G2AA 2ZE0A 4POUB 2VUYA 3PXJA 2XBDA 3KXFD 4H8WC 3STLA 1U8CB 2HRPH 4ZMYA 3O45A 4UQ3A 1Y07A 1OAZH 5A1AA 5MP6L 1PGRB 5IROC 1A9BA 1GW0A 2YAPA 1ZA6A 3O4LE 4PCYA 3TTYA 3UADA 3DV4B 4QAWA 3V5DB 1CQKA 1AYRA 2LE9A 2V7HA 1BM7A 3GB7A 1BYNA 4J7RA 2XTLA 2F9BT 1UQSB 1VERA 2APTA 3EFOA 1FVCA 3SPGA 4ORZC 4S1DC 4UZUA 3AQYA 1ZSHA 3CXDL 4PB0L 3GIZL 4G8FA 3UJJL 4NN6C 3L3DA 1XXFC 5KVEH 2XPZA 1JWMA 1I1RA 1I8KB 3IE9A 3CDZA 5KUKA 4RQQA 1F1GA 5EIIA 1R4XA 2V2WA 5FA4A 2XN9A 1CFSA 3FS9A 3Q0HA 1J9QA 2AXGB 4P3WA 3V0WH 4K8RL 5HY9B 3N44B 4C56B 3D06A 1C8QA 3N6YA 3IFLL 3VXSE 2CJ3A 4P2QD 2I9LA 4KBPA 4ES9A 4K3EH 4GMTL 1SLXA 4RGMB 3AMKA 4ODUB 4YXKL 4BQBA 4YSAA 4P2OB 2OJ1A 4W4OC 1AG6A 2C9UA 5D8JL 1HHGB 3SY0B 1J8HA 1R3HA 3O2DA 3ARXA 3LXCA 3FB5B 3WSQH 2XZAH 4MD4B 4W6XB 3OKMA 3KW7A 4DGIL 3VI4B 3HI1B 1VADB 3UAJA 4FXGA 2EDDA 4JB9L 4HLJA 3WXWL 2E27H 5DDHA 5ANME 3WHE1 1Z3GL 1ZHKB 5FUOH 5FECA 1NC4B 2A4EA 3GXUB 3MFFB 4K94C 5L6YH 3CZNA 2ITCA 2VLJE 3MXVL 1KELH 3G6JF 4FFWD 5GZNC 1SY6H 2ZKHH 5B38G 3FTSA 3O2WL 4X4XA 1F18A 3PWJB 3AS0A 5DZ9A 2QBWA 5GRUL 3PDDA 5GZNA 3V4PL 2MRYA 4FE9A 2A4CA 1CXHA 2Z31D 4YDVB 5T5FH 1IBBA 2VDPH 3WXVH 1RJLA 4HVBA 1RUPH 4ZFZB 3RWCA 3ZQXA 1M7XA 1I8UA 4DTGL 1F1DA 4WGWB 2DL2A 5ERWA 3RHWK 4J8RB 1MCFA 4QOKE 4A04A 2OYLA 1JCKA 5DD3H 4BWTA 2Y72A 4P5KB 5D7LE 1EVTC 4R7VA 2PYFA 4HDIA 4LRIC 4PRDB 3U82B 5HVWA 3VD5A 4RX4D 4ALAC 1A3ZA 4RETB 5IWLA 3EO1A 1YNTA 2UV3A 2BIPA 1GHFL 4WNJA 2VITB 4N26A 1NCGA 1XR9A 3Q8EA 3WNMA 4FNUA 5AVWB 1MN4A 5ENWB 5JO5B 2JB5L 3J07A 2EYSB 4QRPB 3CZGA 1L9MA 3EFFA 3U7WL 4TPRL 3QCTL 2OBGA 3K4AA 5IVNA 3BDYH 1TQUA 1A5FH 2KH2B 1B88A 1I9IL 3NIDB 1KIUB 3UGUA 2RB8A 4N6QA 1W6LA 4JY4A 5BVPH 2AANA 3CVIL 4C47A 4HH9B 4KMTL 1D2PA 1Z9PA 4XO9A 4A55A 3HVNA 4IGBD 4M9OA 1NANH 4AEHL 4EQ3A 1TYRA 4AUJA 3NFNA 3PREA 5CLYA 3LQMA 4PJAA 4J4PC 3MLVL 5IBUG 1UH3A 3L3IB 4ZDHB 3U6RA 2GJPA 1UD8A 4DGYH 3EGSA 3HG3A 3ENEA 4NQTA 5HGBB 4AYDC 1NPJA 3ARVA 4NKDA 4NZUH 2YARA 3SQOL 1LWRA 4HPOH 4WTZA 3LH2H 1OP4A 1BVZA 3RJOA 1TZGL 1YJDH 4ZMNA 2ATKA 3BKYL 3X2QB 2RFXB 4KH9A 2AJ3A 4MX7A 1RZKL 1DBAH 1MFUA 2Z1PA 4OLVH 2BZ7A 4AENB 2XWBB 1NIDA 1A2YB 4Z9KB 5ICYB 1MW3A 2GJZA 4JM2C 7FABH 4NZRL 3ZKNC 5KS9E 2XYBA 2VW6A 3FMGL 1TMCB 2JCCB 1OTUC 5CGYC 3CZUB 5B1AB 1BEYL 3PYCA 1TTFA 4HCGA 2NY6C 4FL4B 4RIRB 3LOWA 4XI5C 5D72L 1QBLL 9CGTA 2PP9A 4OKDA 2A6DA 3I6KA 4JGJA 3VFRB 4BCXA 2FJFB 3EDKA 1EFXB 1ICTA 1MW1A 1U8LB 4FG4A 5C6PB 2AQTA 4G5ZH 5IQOA 2FGWL 2FX9H 4NQCE 5EORL 3SQBA 2IGFL 5AB1A 4B7IA 5IJVB 5KVEE 3MR9B 4Z8FL 5LDUA 4MCMA 1CFQA 4J6RH 5HPMB 2P42B 2MCG1 2ATPB 3NIFB 4RGNB 4HJJH 3REVB 5EIIB 1J5CA 3WUWG 1KELL 1RSYA 3QEQA 1IFHH 3WENA 4BD4A 2A6JA 3ABGA 4ZAKA 1N5AA 3GMRB 1KGWA 1SXAA 1S3KH 3ILEA 43C9B 1KCVH 2PW2B 2UWEA 5ESVB 2G75A 4FG2A 3UZVA 3ECBA 3R06B 3LDBC 5DFWH 2WXHA 2PW2A 2UWEB 2NW2A 2OSYA 1K8DB 3NJVA 1II4E 4AM0Q 3BEWB 2QQQA 4YVUA 5E9DE 2ENPA 3A67L 4S1QH 3IDXL 2G3MA 4J3OG 4JG0L 1RZFL 4TNWF 4ICWA 2VRQA 1ZLVK 1AQHA 1A8ZA 1NOAA 4NZTL 1HT6A 4L18A 1ZHBA 1EX0A 1YUKB 3HHMA 2FSEB 1BOGA 3CQFA 4KK9C 3FU0A 2IPUG 3ARDC 4U6XB 3L5WA 2YGQA 4K7PX 2ZSVA 1BMWA 1WEJH 4RLDA 4IBTA 1HH6B 5HI4D 5FYLE 5LN8A 1SN2A 5CNHA 1BX2A 4DO6A 1TCRB 5HJBA 4M8QB 1DP0A 5IB2B 1TR7A 2EDJA 2D7TL 2HFGL 2PYEE 1JXJA 2DH2A 1AQDB 5JYLA 4ZMQA 5EEVA 5EULV 4R4ND 4UBDD 4BK4A 4FTVD 3EJZC 4XP6L 3ECVA 4B9YA 5BO0D 1OXYA 3ZT6A 5JIKA 4F33B 1N59A 1O9VA 4N2FA 1LO4H 1UB6B 4XXCC 4KDWA 1FFOB 2HFFB 3HAEG 1AO7A 4NKQB 2WC7A 2OMUA 4FDWA 4EIZC 2HT4D 4I77L 1VPOL 1R3LB 4DZBA 3DOIA 4Y89A 2KPWA 3WDIA 3CX5J 1MOEA 5CFAA 3PWPE 5E6IB 5KYWB 1IM9B 1MEXH 2F54E 3RZCD 2NZ1A 12E8L 4PW3A 2WCPA 3ZIMA 2IIJA 1XH3B 3C2AL 2R39A 3TBWA 4B9JA 4PRPA 1MFEH 1F6FB 4JLRA 1RUKH 4QRUB 4XWGL 4IKJA 1WD8A 3VXSA 5LG1A 4CC4A 4JPWL 4QIRA 5FO7B 5C7XH 5J1AB 3GSVA 4FQJH 5DUBB 2HRLA 1CTNA 1TJXA 5AB0A 5MEQB 3DBSA 3KBFA 3QH3B 3AB0C 4XMTA 2Q0ZX 5EOQL 2VM4A 1AXTH 1SMDA 3QZLA 4FZ8H 4EVNB 4IJ3C 2ADJA 4UDUB 5A6LA 3UX9B 1QFUL 3FJTA 1S7XA 5JPNA 1U8JB 2NW3A 1XIWA 4QHMB 1HHIB 4JM2D 2RHEA 3KL3A 3CN2A 3MNZB 1BQLH 4GW4B 3GSUA 5DT1H 3V0JA 2GT9A 3S9DB 1XD0A 3PGDA 2VT0A 3QR1A 1T80A 4ALAL 4PG2A 3S36L 4XPGL 4HF5L 5F9WB 3WDHA 4Z3JA 5B1KA 1SFDA 2UZYB 3VX1A 3MYZA 1TYJA 4GSRA 1DQJA 5JXAH 4M62L 2A3TA 4XE0A 2PXYA 4PRAA 1MHPH 2CGYA 2W60B 2H1PL 1CI3M 2K9UA 1EJOH 3OKEB 4L29B 3E7JA 1KBPA 2R69L 5GRWA 3PHQB 2VABB 1KF9B 2Q86A 1OAQH 1G7MB 4PV8B 5INCA 4NT6A 4QTHA 4CMHC 4PRIA 4DQAA 4LP4A 4HULB 5BXFA 5D93B 3H9SB 4MQSB 4RCAA 4D0BB 5I5IA 5M94B 5J1SC 3VH8B 1T0PB 3BP5A 3MJ8B 4R4BB 4YHPB 2CO6A 1MVYA 2E74C 3O11A 1YYLL 3OVUB 3T4AA 2DMBA 3QEQB 3FU7A 2X2UA 5AB9A 1E9PA 3K2IA 3CFBB 4YDIH 4X6FB 2E4TA 2H9GB 3E8VA 3KE0A 3QDMA 5C7XL 1X5YA 4JPWH 5ACLA 5LWYL 3JYCA 2YAMA 4L8SB 3L1OL 2FCBA 3T0EC 3K8LA 4GAJL 5KEZA 2TRHA 2C9PA 3VFUA 4E68A 2PNDA 4ZQKB 4EN2A 4K7PY 4ZX5A 5TE6H 1IO4C 2EVFA 2KQNA 2NYZA 2NX5D 4OAWA 4PJ5B 3V4UH 3PWLB 3BN3B 4AL8C 1BZ9B 4UM8B 1UZ6E 3MJ7B 1ZCRA 1HILB 3V7MA 4N9OB 1GTFA 1A1NA 5JW4Q 3EHBC 4PJCB 2BS71 2WBJD 4IRZA 5A3ID 5F6IC 3CLEL 1J1PH 1UM5H 4TVPL 2KZKA 1I1FA 4WK2B 5FUZH 5F9AC 5DD5L 2ZWZA 5DSCB 5JDSB 4MHHG 2WQSA 4BZ1A 4KKZA 3DOHA 3JBG7 5HYJA 3MRDA 3HC3H 4ZMXA 3QEHB 2LT9A 4ZBJA 3RWGA 4CVZB 2DIEA 4D3CH 3D4GA 3U2SB 4KZCA 1BPVA 1AKJD 3N42B 4F2ME 5SWQB 3O6FB 4XXDA 2G0LA 5LUMA 2XQYG 3D05A 2PO6C 1P53A 3S5LB 4PQXA 1G7IA 2FWUA 4ANWA 2KLRA 5AKRA 2YEZB 4QHLA 4AQAB 9PCYA 3ET9F 1RPUA 1EHLH 3WKNA 1HJBC 2AVGA 2ZOOA 4CUCA 3GZPA 3V7AG 5C09A 3LB6D 2QGCA 2AXWA 3DMMC 5PAZA 3BAJA 4XNQB 5B1JA 4O2FA 4CGUB 3FQUB 2HTLD 2H2PD 2JXMA 1VHPA 4M93B 3RNKA 4BFFA 3RPKA 1DZBA 1E4XI 1I8IA 4QO1A 2R2CA 3NESA 3FTXA 4N6RB 2BMKB 5D96B 3AREA 4ZMPA 2X2HA 2BMKA 3PGFL 1G7QA 3DJZA 2XUWA 4Y1AE 4IQHA 3ZKND 1RUMH 4QJ3B 2YRZA 3U7YH 2WTRB 4EVNA 4J6RL 2IWFA 3GLAA 5A16B 3X12B 4XH2B 2F18A 3QORB 1WITA 3UDWA 5EUOB 3X12A 1HX0A 3X1FA 1J8SA 4BK8A 4MQTB 2VW4A 3EO1B 2R4RH 2WLLA 4ZMOA 1DJGA 1F45A 2J6EL 3A22A 1BXAA 2LOEA 5E8PA 3TX4A 3DURA 1UXWA 4PJIA 4QXGL 3L3HB 1P4LB 4XVJL 1FIGH 1MFAH 1WP6A 1THAA 3BVUA 3S5LG 3VB8A 4IK7A 1JGEB 5ALBL 4RMSA 4TM9A 1UZGA 4HKXB 4WFGE 4C8XA 5D7JB 4M02A 7PCYA 1U8HB 1TFPA 1S7QB 2IH1B 3KLAB 3MGOA 4NJ9L 2NNXA 3Q8CA 5EWIH 4M7JL 3ZTJG 3BWUC 4LL1A 2CA4A 4OGAD 2AK4E 3KDMA 3LIZH 1KJ2A 4EZLA 1KIRA 1OD9A 2Q86B 3B2DC 3WEOA 3QDJB 4DK5A 3CVHH 2NY7L 1B0GB 5D4QA 5CCHE 2PXYC 4JPQA 3TFKC 2WYHA 1DVFD 2V7NB 3AY4C 5D7IB 3UTQB 3MRIA 1CT8A 1Q4NX 2WSPA 3RIAK 4J23A 1Q9LA 3CH1A 4ONHA 3Q6FA 2NTSP 4JFDD 3RAJH 3FFDB 1NEZG 4WV1C 3OAZK 3DGCR 1ED3B 4MD0B 2XRAL 4WUUB 4OCNC 3V8CA 3RGBA 1NCWH 4GIAA 1BG1A 2Z34A 1UYWL 3GXMA 2Y3NA 2B5IC 3S2AA 5C2BL 2X0UA 3O45B 3VSUA 5ABZA 1A22B 3ZKSD 4AV4A 3IRCA 3C08L 1HKFA 1WBYB 2X1XR 4MDJA 4YWGL 3RHWF 2JB5H 4FFZA 3BVXA 1P5UB 3EFDH 3F7VA 4FQ1L 1CI5A 2GSIB 2JI1A 4H44C 3HMWL 1NCHA 4EZMA 3ZR5A 1IAIM 3GSRA 1K3ZA 1Q9KB 3L5XH 1OCRB 1FJ1A 4L9LB 4Z7UE 4BFNA 4MCYB 2IDQA 4NUJA 1MLBA 2ZG3A 4YDMA 4M6NH 2VDQB 3L4VA 4EJ1C 4LCCA 1CZ8L 1OB1A 2E9BA 4NZ8A 1YN6A 2IGLA 4QWWC 2EEDA 4GPVA 3K6FA 4YE0A 5E9NA 1LVEA 4N90D 1RK1A 1SN5A 3LX9A 1I1FB 3D4YA 4GRLD 4PBDA 4UT9H 4X7TA 3KM1A 3LEXB 2VDPL 4WUKH 4QRRE 5JTWA 3QHZL 3QJFA 4Z95H 5I74B 5JHAA 1OOAA 3EUDA 3HZ3A 1U95B 4GQPH 1T6VN 3MYJB 3PWNB 1EVUA 2DD8H 4HT1H 5HYJB 2OP4L 2APWA 4PRHB 3HPJB 1GGTA 4KY2A 3VFTB 3P30H 5JW4N 2CLRA 2FL5B 4OTXH 3AWFA 4YSTA 1CXFA 2ENYA 2NQCA 4DP0X 2WINA 4X5XB 1J88A 3HB3D 4HMEA 3K6DA 2X40A 3AADB 4WWKC 2W92A 3BT2H 4J3OD 4LSRH 3IJYA 4YHKH 5HHXL 5IMOA 1PX3A 3S5LA 3VSQA 5IZ7A 3AACA 3VWKC 2HCZX 3MMEB 3OZ9L 4GBXA 4ZW6A 1OCWL 5E08H 5CBAB 2OX5A 5F7BA 1D5IL 3CN0A 4FLSA 4JQIH 4QO1B 5CEZL 1WAPA 4PWIA 5DD0H 1CVRA 2OCCB 5A2CA 5ICUA 4LCWD 4IMLA 3MCG1 3EFDL 1W9XA 3L3OC 4FQ1H 3W11D 4QAMB 4YDVA 1IGFH 1U2CA 5D1ZB 4GKNA 4LGSB 1JWUB 1XGUA 1MJUH 4MAYB 1HL8A 2HFEA 1LE9A 3HNSH 2W07A 4ZUUB 3FNKA 1RJYA 5E8DH 4N0YL 5HHPB 5DWUH 3R8QA 8CGTA 5DQJB 3KDPB 1UKQA 3V6OC 1JXKA 4XVUC 3WKYA 5E1GA 2VLJB 3UPAA 4XC1H 1S7VA 3L5XL 2CKBA 2ZYRA 2X4OA 1BBDH 2HKHH 2X44D 4Z7OE 4HCRA 5H94B 4FFZL 1B2YA 3D85B 3NSYA 1BZ8A 3GIVB 4MJ2A 4XRCA 3NG5A 3BH9A 2OZ4A 2D8KA 3U0WH 2AXJA 4XAWH 1CBJA 2D7OA 2DWEB 3TL5A 5F1IB 1B3IA 4GB9A 1MZZA 1X4YA 2A73A 3NN8A 1YY9C 4K7PL 1PG7L 4O51B 4Q6IB 4Z7QB 4Z3IA 2B8OT 1S3RA 3GSXA 3CZKA 1L9RA 3V6OA 1UGNA 2VXVL 1F02I 3GEFA 2F5BL 5DHYA 4XVJH 3KPSE 5AG8A 1FQ9C 4GW1B 4AKQA 3ZTEA 1QTPA 1P4BL 1W0WB 4TVSa 5DHYB 1QSFE 2AF2A 2COQA 1W91A 2WQRA 3WNNA 3HI5L 3TBCA 1P4IH 3STLB 1RJZB 3QUYA 4NHCH 4DP4X 5KVGL 4XP9H 5ICYA 3I75B 4MNGA 4D3CL 2Y2YA 3BISA 3SDAA 1B4LA 4WHYH 4NHUA 1T6WA 2VR5A 4O5LL 4ONGL 4ZUTB 25C8H 5F0MB 1IGJB 3MLRH 3RX7A 3K6IA 3VTTA 2RAMA 2ZXBA 2H32A 2VDNH 1DVZA 5LO7A 5IHBA 4BSVB 4UV7H 1FVDB 3BQUA 1SOKA 3JZYA 5E1AB 4LSSL 1RLBA 3UEQA 3WU1A 3GKWL 5BZWB 4L1LA 1QRNA 2VQUA 3TT3H 5FUZL 3VFRA 1QR1B 3LCYA 2HT2D 4HFWA 5IFAH 4N2IA 4L3EA 1ZVNA 4LCCB 3TF4A 4YEEA 1T03L 1BQHG 3FQWA 2FEDD 5IMMB 3L3DB 1YDPB 5E2UL 1TPXC 4QRAA 3Q1EA 1VEPA 1FH5L 4Y1SA 1HE7A 3AITA 4YSEA 3GBLA 3VFOB 3VTMA 4QRQA 5GS2D 2QLVB 4PJ9B 1E8WA 3QEQE 1BM3H 4KROB 4JDVA 4LF3B 1FZKB 1RMFL 4TVPE 1AHWB 4GUCA 4YHLH 4N2GA 3E9UA 3SCMD 1RY7B 2Q7YB 3AAZB 2FHFA 2WINB 2GIYA 2FD6L 1T4KA 4LSQH 4X4YB 2IH3A 3ZE0F 4LPTA 1RZGB 4TOYL 2MCPL 2Q8AL 4KI5D 1FPTL 2YWZA 1E4HA 5DK2A 3NZHH 3WIFB 2E8YA 1A14L 2MQGA 3NA9L 3HPLB 3PP4H 5T3ZE 1DJSA 3DLQR 3DMMD 1FAIL 2CPUA 4JCWA 1XF4A 1DVYA 3AUVA 2F7IA 2PCYA 1F11A 1J9RA 4I0KA 5DDHB 2DM3A 3SD5A 1ID2A 4KK6D 4XXCA 4X9IA 3HKZA 2AJSL 3WS3B 1U41A 1LEGA 3Q2LA 3S98A 2NY1C 3QQNA 3MUY1 4UF7C 1BSIA 1BQHB 4DVBB 2LTQB 3WTSA 1OAQL 1TETL 2J8UA 5F6HI 2OMTA 3MLYL 5BUAA 4PUBH 5DEJA 5B3NA 1NMCC 2VNCA 4J3WA 2ERJC 4Z3GA 3CE1A 4W9IC 3MJ6A 4QRTA 1O6VA 2PWFA 3RVUC 1A6VL 1YQVL 1IE4A 3ULVC 3RL2B 3L1OH 3ARBC 4HF5H 2W07B 2DQGH 4ZUUA 4OD2A 4QR7A 3VI3F 1O0VA 1GMIA 4DZBB 4NNXA 3GWJA 2C3VA 2GFBA 3HG1A 1ZT1B 5JR1L 1INEL 3OKNB 5DT1L 1NPNA 2Q20A 1MCLA 3UTZB 2AABL 1R0AH 4UM9D 2R9HD 1EBPA 1E9QB 2O72A 5EU4A 3VXMA 3O3BB 3LKSA 3V55A 3WJMB 1YEJH 1PKQB 3FQYA 4FXGC 3T3ME 3E3QE 1GMEA 4OKVA 4CMMA 2WOBA 1EBAA 4PD4J 1IAOA 1SEBB 2X7LB 2V4LA 1KPUA 5DTFA 2RALA 2CMRH 4MNQB 3WY4A 5I1CH 3M46A 3LMJH 1H6EA 2ZG2A 4JFOB 2A1WH 4MNQA 3N50A 1LK3L 4F3FB 5LQBL 4PI2A 1AXTL 3Q5YA 4FZ8L 5DGRA 2AITA 4JS7A 4A7QA 4D9QD 1EJOL 4JY4B 4OLWH 4PRID 5JLZB 3ESNA 5DZAA 2V2TB 3QH3A 4FQJL 1D9KA 3FFOA 3MRGB 4GSQA 1SDAB 2ZPKH 1G4MA 4P5TA 3R7RA 3RWHB 3T0VA 2C7FA 5C0GA 3QJXA 3T5WA 5GS1A 3ZHKA 1PJWA 4F27A 2QVTA 3IJ8A 1EZVX 1HQRA 2O4EA 5DUPH 5JHLA 3SGDH 5E00A 5I1CL 5L4JA 1C8PA 1WT5C 4LKXB 3S3SA 1S7XB 1T5XA 4HIJA 5I8EB 5FKAA 2WWKT 1F0LA 2BDNL 1I3RB 2VKWA 3NZ8A 5FGCE 3VXTA 5C92A 2W91A 5HDOA 4N0FB 4DKAA 5FO2A 2VMDA 2EIEA 2I27N 3FT4A 5JW4R 1F8TL 4L1TA 1JL8A 4JM2A 4WLCA 3UO8B 4HUXB 3X3FL 2QSCH 2GUOA 4EN3C 3D50A 1E4XL 3KBEA 3PNWA 4KHXH 3SE9L 4NUGL 3WJLC 4RAHA 3L3KA 4KFZC 3TTSA 1L9NA 4XPGH 4FLQA 3DXAE 2O5YL 3VWJB 1FYHB 4XPAL 1IGTB 2VISA 1E6OH 3T8VA 4K3DL 3S35L 2WXMA 1YMMB 2FAUA 3OKDB 4L9DA 3V4VH 1JXDA 5I82A 2W60A 3DX8B 2H2PC 3S96B 2CBQA 1YNKL 2AHIA 3V0VA 4J27A 4JPSA 1TQVA 2WV3A 5FA4B 1T1ZA 4WV1B 4MXWH 5D2NE 3SO3C 1FAKT 2QV4A 5HYQB 43CAA 4A2LA 4W9CC 4PBWD 2L7JA 3V9EA 1H9DA 4RMRA 3MAWA 3Q1SL 4XP4H 2BIQA 3P4OB 1IEAA 3ECBB 3R06A 4G8IA 3D69A 3MBED 1O9WA 5FYJD 1JHLH 4NQCB 1ADQH 3DGDA 1X5LA 1O7VA 2JKRM 4IS6B 5TF1L 4XT1C 4UM9A 4KHTH 2HJFB 1M7UA 4PJDB 4ZSOA 1T0NA 5DJAA 5HHMB 3CPUA 2E56A 2Y24A 1NPUA 4JFHD 1AVAA 3WIFA 4AITA 2UZIH 3VACA 1KBWA 5AUMA 2CH8A 2MIZA 1O9ZA 5H4ZA 1CG9A 1BZ9A 4UM8A 5B3SB 4DGVH 1KN2L 1D2OA 1TETH 4JDZB 4KDTC 1BAFL 1C9SA 1X9QA 2YIHA 4TRPL 5AOLA 4TQPA 3ILDA 2H5UA 2IPTH 3LPPA 1JWMB 3US9A 4XVTL 4XWOC 3CZSA 1BHGA 4JVPA 4X7EC 4FABH 3AM8A 5GGUB 4XAKE 3QDGD 2BOBA 2GI0A 4C55A 4GQQA 1NBYB 5GIRA 5B39G 1WISA 5ECJE 4X7TB 4ZAKD 3BKJL 1AIFB 3F65A 5CJ8A 1JI2A 4HU8A 1QBLH 5DSCA 1AGBB 5KSAD 5D1XA 1QTSA 1ZE3C 4FQHB 2E7BA 4ISVA 3ZQ9A 1IMHC 1WA2X 4MYPA 5E4EB 3SY0A 4W9DC 5TH2A 1U8PB 3TBVA 1XGPB 1FFOA 1F3JA 4NZRH 5DEFA 3FQ1A 5HVFB 4NO5B 3LV3A 4X6DE 1JHKH 3SKNB 2J5LB 4PP2B 3LS4L 4L0PB 2APVA 4U49A 4A2FA 4KPHL 1NCIA 2MNJB 3S88H 3T1FB 1ZANH 1CLOH 3L3GB 5D71L 1DLFL 2Z0UA 1NC4A 3KGUA 3W37A 1S4IA 4I9WD 1I8LA 1MSPA 4F57L 5B39A 1X5GA 2WIIB 2Z91A 4QHLB 1JJUA 3A67H 5FW6A 3TC9A 4HU2A 5J1AA 3ILPA 4HIEB 4XMXA 3SJVE 1LJMA 4OLXL 3VXSB 2ZOTA 4MJIB 1YO4A 3F64A 4W93A 2FBJL 4PFEA 1W8NA 4FXKB 5LNEA 5TJWK 4LSDA 1PZ5A 3SSGA 3O2VH 3BE1H 4OLUH 4F7MA 2VR6A 2XI9A 5E6RB 4HJJL 1G7QB 4ONOA 5EU7C 1QSFA 1XIWC 2V5TA 4MBRA 5DJDA 1NUGA 2VUKA 2GSGB 5BRPA 3UTTD 1FL6B 4LLUB 2VAAA 1G1OA 2RR3A 3BQUD 5I1GH 2WLLB 5T1KB 1Z5LA 1UOLA 3MUUA 2R8SH 3LZLA 4Z5RB 1ET5A 2H1XA 3FT4B 2A77L 3IAPA 3POCA 4W9EC 5EZLB 1XR9B 3BD4A 1XGQA 1AQKH 4GW4A 3U6XA 3QFJE 3LY6A 4UILL 3CFMA 3KYKH 3FOLA 3GPEA 4Y5XC 4TUOB 1P4LA 5BW7C 2BSSB 4YC2B 2ZYSA 1U93A 1L0YA 1OSZA 3BCDA 4G7QB 4JO4H 2WTPA 5L2KE 4N3UA 1SQ2N 3FHEA 1ANUA 3KH4A 1F4HA 4K7PH 3IETB 1DQKA 2DTSA 4DKDC 3NK3A 4KKLD 1WIUA 3RBGA 4TTDD 1UXLA 4KQ3L 5MHSE 4HBCH 3CZJA 4PS7A 1TZGH 3CZFB 1UCBL 5DD0L 4Z77A 1NFAA 5F89B 5T1LA 4HEPA 1E6JH 5C2UB 4WHTA 3AMLA 3V0DA 3PV7A 2H4EA 3BE1L 2XZCH 3D48R 2VMFA 3EJJX 4OLUL 3RY4A 3U4EB 4X6FA 3IAGC 2HX8A 2XWCA 4YFLF 2BNQB 1ZV5A 4LASL 5CEZE 1KYUA 1NM4A 2F7OA 2AVFA 1CDCA 1RP9A 5DJYA 1FFPB 3HRZA 4IKIA 4F57H 4OV5B 3DA0A 4NC1E 3FZUD 4NFBA 3T4YA 1N8OE 4XN2A 2NUTA 3T2NH 1TT6A 2WIMA 4D9LL 5I2IB 1FNSH 2AK4B 2NRDA 4YGVA 4QRBA 2YRLA 4IIQA 4ZFGL 3L5WB 2R0LH 4LARL 1YYMH 3OR7A 1CQYA 1VCAA 1FGNH 3H56A 1EEZB 5J12C 5LJYH 3E1ZA 3KEDA 5IVXF 3SQBB 1EEZA 3AGWA 3MLTA 1OZTG 1QEWB 2QGDA 2D2OA 4WGVB 3WV0A 4E9YA 1EFQA 3GMQA 5E08L 5EMYA 4GSXA 1H5BB 5ABDE 5TDOA 2VZOA 1RKRA 4Z76A 2P5ED 4CSTA 4XPFH 2W0LA 4D8PA 4F7CA 1GTNA 4B97A 4Q52A 5D7SL 3TNMA 1VGKB 5JHDE 5ESVA 2WXKA 3CV5A 3RJQB 3VXQB 3DYMA 3AREC 3V4PH 4KROC 3HPJA 5KS9F 4YWGH 4NNYB 2IDFA 4GBXC 3VGEA 2VJXA 3M8OH 2IH3B 2OXGA 4TSBH 1A47A 1KBKA 3FT0A 1UACL 3L2MA 5C2BH 3MRDB 4HS8L 4JRXD 1WZ1H 2HAZA 2Z31C 3F6JA 1VADA 3PXLA 4DGUA 2E27L 4GRLC 3W82A 4X8GA 1JYVA 3V0WL 1HNYA 4UQAA 5L8JB 1YCSA 4N90E 2F1AA 5B39B 5J1TC 4JLRB 3QAZC 3IJHA 3ZKXB 1R9FA 4JFZL 5K39A 1FL5A 3KLHC 2NY2D 1FFNA 2Q3XA 5E4EC 3T65B 2VMEA 3S8FB 1SEQL 1FFNB 4AJYV 2Y6SC 4LAJH 5FM5M 5KJRL 5CSZB 1M1XA 2L0DA 3M1BB 5K5YA 1AQDA 3H0TA 3HMWH 1AR1C 4ZPTA 4L1SA 1RV6X 4KKLC 1OTUD 4P9HC 5ERWB 3ZU8A 4KTEH 5BV7B 1IFGA 5I17B 4M5TA 1TU2B 1C5CL 1LMKA 5ACZA 4Y19D 5I17A 5GGSB 2AQRA 2M2DA 3RNQB 2CBOA 1MRFL 4M7ZB 4MHHI 1KT2A 2IWEA 1KN2H 1OT4A 1C12B 1XMEB 3O9WA 4RZCA 3BKCH 2R4RL 3CMGA 5I15H 5BZDB 1D7CA 4XNXH 4ZQTA 1DLHB 2ZXWB 1NAKH 4JHVA 5IV2A 1PLCA 1ZVYA 2HYMA 1L7TL 3E6HB 3L3HA 4WI9A 5GSVB 3ETBJ 2WYTA 4N5ED 5K59E 5MEPA 4GFXA 3MGOB 3D9AH 3PJNA 3HIZA 4EUPA 2FNWA 2X2IA 3H42H 1YUHB 2CO3A 2FBRA 4JO3H 1TO5A 1OP5H 4NCDA 5HHME 1OD7A 3SOTA 2TSAA 4GRMB 1OE2A 2V7NA 4O9HL 1Q0XL 3GNMH 4OSUH 1QLEH 3GBML 3QWRD 5D7IA 5SWSD 4RMWA 3TJEH 5I73C 2GEQA 3QDJA 4WENB 3IN0A 1IKFL 4PJXF 5FGRA 4GAGH 5E00B 2Z7ZA 1JMXA 4R5VA 2KI6A 2CM6A 4L4TD 5F7MC 2CCLA 4UNTA 3S7GA 1PCSA 5I75C 1HCVA 2YBGA 2XG4A 3HCVA 3II3A 4OLWL 4PVMA 4IKNA 1O5PA 4XX5A 5KSVB 1NDMB 4NUGH 3QZPA 2NZ9D 1AFVL 4EDWH 1LGVA 1RUML 1IKNC 1W72B 2VERN 3KCPA 1P5UA 3F7VB 3FFCE 3MNVA 3GB7B 1THCA 3QR0A 4DP9X 3GK8H 2ODHA 4HWZB 2AJYH 5EDXA 4UQEA 2R83A 5EUKB 4MXQD 4DQOH 1XL6A 3MTRA 4HJGA 4NRXB 3IMTA 3ZT5A 4OCMC 1KLFB 4RISH 3VH8G 4OZGE 5HGAB 3MACL 4ZO7A 4R2GC 1OE1A 5CMAB 3L9RB 2D7PA 1HOCA 2FO8A 1DCEA 3GJFA 5E0QA 3W0WB 1VKXB 5JPNC 3CBJB 5I0ZA 1SOQA 2ILLA 1A3RL 2ZPKL 1ET7A 3AC0A 3GPSA 4OCXL 4X98B 4OCRL 3SBWC 1ZLVH 1Q1PA 5CJQH 1AGEA 3WNJA 3T8MA 4R7LA 3V5KA 5AVZB 1CVSC 4DP6X 3PU7A 3BH8A 1N67A 2OXHA 4LEOB 4AV0A 1EAPB 4Y4KB 1P7KB 1JZDC 1OM9A 2APSA 1UD3A 2XSKA 3DOSA 4FNLL 3VXUA 4FQXA 5HYJD 1E43A 2O6DA 1Y7VA 4QCIA 2HUEA 5CCKH 3Q6GL 1R0AL 4P07A 3EJYD 1A14H 3MOBL 4H4NA 5L2KA 3CFEA 1NCAL 5T3ZD 3NZHL 2WTOA 3F85A 1A4CA 3CPLA 4FADA 1XZ0A 2VC2B 4N1HB 2BZDA 2XA8H 1OW0A 3E9TA 3HZVB 4QGTA 5F7NC 1A6TB 1NFDB 3O4OC 3RNKB 4DVBA 2W9DH 5LGJA 1TCRA 1BXUA 3PDGA 4DQOL 5DF0A 4UUJB 4AJVA 5E5LA 2NZIA 4PUBL 2YGOA 3NPSC 1MHCB 1OGAB 3A4DA 4XMPH 4P49A 5GGVL 2ZD0A 5L2JA 5FLUA 3WJJC 4QXVA 5E9DB 2SODB 2KL6A 4HIXH 1HSBB 2HKFH 3SGEI 5M7QA 1Q38A 3SHSA 3OZKA 4OCXH 3NCBB 3KPRA 2LU3A 2NY3C 2F53E 3B1UA 1AKPA 4Q58C 4YJZL 5E1IA 3P11H 4NQCD 1E27B 1FH2A 4ZUSA 2VWEE 1O7DC 2B1OA 4P2OC 5HJ3B 3FHAA 7PAZA 1E9QA 1RVFH 2G3ZA 5FUCC 5C0IA 4RFEB 1E8YA 2IC2A 4FNQA 3BN9C 5TTRA 3ZQWA 2E0PA 2J56A 2RCSL 5E7BA 1PKOA 2CNYA 1QWNA 1R3KA 5CZXC 2V37A 4LPXA 3F7QA 2DQMA 3H6AA 3LKRB 3DBXA 1WO2A 3QXDA 4YXHH 3G6JE 4ODSH 3THMH 25C8L 2K6WA 1QASA 1WJ3A 4NRYA 4U1SB 5I0XA 5I8KL 2WD0A 4AYBA 2BHZA 3IRPX 2C4XA 3QQ9C 4XNUL 2EUXA 2HUHA 2DY2A 2IMMA 2UY7A 4JDEA 1DN0B 1KJ2B 4JUTA 4ABQA 1RK7A 4BSWA 3FPYA 2JIXB 2J88L 1GC1H 3UTQA 4FA6A 2CR3A 3ZHNA 3QDAA 4UDUA 3O2DH 3EGSB 3ARPA 1DBKH 2YXVA 1ZXKA 3FT3A 3RWHA 1H8OA 4JQXC 4GKSA 2B39A 4GW1A 4YX2H 4N28A 1ZLSH 4XH2A 2YUWA 2NY6B 1HEZA 5H35A 3ARYA 2IAND 4WUUA 4JRFA 5H37H 3Q43A 1BQLL 3I6LE 1I1YA 1N8ZA 2QR0A 4QEGA 5ISZD 3QUYB 3B37A 2AJ3B 3HMXA 3LPWA 4QTFA 1NDMA 4ZTOL 1E5UI 4P3DA 1BD2E 5KN5B 4Z0XA 4HLEA 3ZHFA 3BX7C 2Z3FA 3QDJD 4JG9A 2CDFB 1NDTA 3MTXA 1S46A 1TZAA 1U8HA 4AMWA 1J7VR 2FB4H 3NFSL 4XCFH 5BZWA 4BHUA 4RFNB 4O4YH 1P1ZB 4FMVA 4JUSA 4FLHA 1A1OB 3V0VB 3MV7D 5ESAA 1HZKA 4Q9QL 2F5BH 1I7RA 4YDKL 2D9CA 1MFEL 2CBPA 3PE9A 1E42A 4EQ2A 3HHSB 4G11A 1TJIH 5F3FA 4GQ9L 2XOTA 5IMMA 1Q0XH 4PLJD 1OP9A 4TV3A 5EFIB 4C56A 4R4BA 4KQ0A 4OGYL 4X2UA 1E5YA 1CU4L 1AZVA 1JN6B 4M6OL 4WKZA 3T77B 1EO8L 2EDMA 1JK8A 5EF1A 1EUTA 4ZPVA 3L1EA 2J8HA 3I6GA 4Y4KA 3WE1A 3UTSA 2JJTA 2O5ZL 3PG2A 1HHGA 4R90H 3C5ZB 1TJMA 1WWWX 1N4XH 4JHZA 3TA3C 3SBWA 5IVOA 5I66A 1QUNA 2JK5A 4PY7B 2HJFA 3GBNL 4JCMA 2OAAA 1MJJA 4MD5B 5C0DA 4AMKH 1ZHBB 2QVIA 2HKHL 2Y7SA 4AGLA 4E5XB 4AXWA 1NGQH 1GIGL 2V9TA 3EH1A 3QA3B 4XNAA 1OTSD 3GFUA 1OPGH 2UXVA 4G7YL 3HR5B 4KJPD 3WFDH 3QDJE 4NPJA 2FT8A 4O02B 3UGXA 1J1OH 3IDYC 5C1MB 3B5HA 4NNPH 3K81A 3BAXA 1EHKB 3VYOA 4P3CH 4AK2A 1XCWA 2HXAA 4HT1L 5C97A 1E5BA 3ARSA 1R5WA 4MRCA 1N2RB 1W80A 2OJZH 5J9PA 1MW2A 3IDMA 3JWOL 1V3JA 4U3HA 5KG9A 1X4XA 3CD4A 4P2QE 1TVHB 5DURD 3RFZC 4QRTB 2BM3A 4D9RE 2HT2C 1CDUA 4AL8H 1KBGH 2HJLB 3DTUB 4JE4B 1GY1A 4U33A 3CIQA 4XGZB 3C5SA 2Q3ZA 3C5JB 5KVFL 2DLGA 1P5VA 1KCKA 3DK2A 4EDXB 1ZTMA 2YKLL 3WLBB 2DM7A 4Z7VE 2EYRB 5C0IB 1L9QA 2GTWB 3GO1H 5GXBB 2EUWA 3SYQA 3F00A 3VRLF 1OP5K 1AIZA 2ZOLA 1T2QL 1JNNH 1IC0A 2A38A 3BUTA 2BHYA 3KGTA 4MZIA 1QA9B 1NIAA 1OAUL 3DRQB 4E9LA 1UXSA 4K5OA 4B41A 4JFOA 4E9XA 3IJHB 1KIUA 3LKRA 2VQ1A 4L2YA 3U9WA 4BRVA 1EK3A 4PH8A 3QW9A 4HIEA 3U1PA 4E0RA 2CBMA 2JXMB 1DFXA 2WIIA 2R2HB 3KM2A 4EAEA 1D9KB 4QMEA 1OWWA 4IMLB 3FK3A 3QNFA 5J6HA 2X6UA 2D7NA 1KGCE 3DPBB 4QPEA 4U0RB 5BVPL 4LXFA 2ZJSL 4NSKB 3A6CH 5G55A 3F05A 2MHAB 3K8KA 3J7HA 2OTWA 1U8JA 2LW3A 2NZ9C 3BDYL 1YEWA 1H8SA 2J72A 4ZMLA 4ELDA 1AQKL 2ZKYA 1K4CA 2VLKE 1KT2B 2ZYIA 1HHJB 4P4KB 3I75A 4MNGB 1AG0A 3DVFA 1G7LA 2OI9B 2DRUA 4N87A 4OUOA 4ZS6C 1DHKA 2DBLL 3EJCA 5IK3B 4BZ2L 3SKOB 5F3HA 2ENQA 3N44F 3WFBH 2EYSA 1QR4A 5DMKB 3B3BA 3B2VH 5E1AA 3KL5A 5KN5A 3ZKXC 1EDHA 1N9PA 3RVWD 2JJVA 2GHWB 1C5DB 3BESR 3KEHA 2FEJA 3L6FA 1QFWM 1J5OH 4IGBC 1XAUA 1NLBL 4OLXH 4OQTA 4CAGA 2QLYA 1KB5L 3QZBA 2IADA 2YUZA 3HG5A 3NJHA 3WFZA 3N41F 4O2CA 3DKHA 3PS6A 4Y4FB 2BFVH 4ZNEA 5CJXC 3AWGA 5GQBA 4BKLB 3H1ZA 3U7WH 4Z7NF 1ZANL 1F4YL 2BP3A 1FUNA 2AMGA 4JY6A 3BO8B 4KQ3H 4JRXE 5D1ZD 2H6PB 4LLQA 1I3GH 4K7FA 3GO1L 1I4FA 1USQA 5G4NA 4MFHA 2ICWI 2KMWA 3FC8A 3JT2A 2GBTA 1QUNB 2H9GA 2OSXA 5F7EH 3STZB 1WGVA 2BNRE 2VDQL 3KYKL 1KGYE 3QCUH 1BXXA 4JFPA 4G8GA 2WN2A 4Y1AD 4N2CA 3EUUA 3D4ZA 4AL8L 3SDCA 4OQ1A 5BOJA 5KSUB 3FUDA 1IT9H 5KVMC 4KPHH 4JFXB 4OZFH 1LE5A 1NBZB 3BAYA 2NXYB 3T6ZA 1AXIB 1QLRA 3O2WH 4Y2LA 1TOXA 2E9IA 5GZND 5F1NB 2YMXH 3JV4A 1TSRA 5KG9B 2YQBA 4JDTL 1R5WB 2A9MH 1SHSA 5HY9A 1RUAH 3BXNB 4P9MH 2BY2A 3T0EB 4LLYB 1QNZH 1J0YA 2XVKA 43C9A 2WZPA 1XZWA 3QDGA 3QO0A 2D4DA 3C5JA 4HCFA 3H7BA 1AO7B 2R51A 3BPLB 4DKFL 2A99A 2DQIL 2UUDH 1SYSB 3DMMB 4Q2ZA 1ZEAL 1I9EA 1PLGH 5D8JH 1UJ3C 1MVUA 2W0PA 3QEHA 4C57C 1ZHLA 3MX0B 1GGIH 1CF8H 1GYCA 4QTIH 2RJMA 4N8UA 3WTUA 3C60D 4UCFA 5T1DH 1PY4A 3MDJA 5G2NA 1UHVA 2EDEA 5I6OA 1XB6A 2UYLB 1P7HL 2OK0L 3W57A 4CKQA 1JHKL 3KS0H 1YEKL 2BSBA 4R2GD 1RIHL 2XZQH 1YMHA 2J1YA 1S7WB 2DYPB 3SOBH 1TNNA 3HLAB 4JREB 5FX3A 1Z66A 3PWJA 1UB5A 3HW7A 4JFTA 3TO4C 4K94L 4IKLA 3M1BA 3NP4A 2F19H 4YDIL 1QLFA 4AG4H 3DO7B 2RIKA 5CBEB 1PZUB 1NMAH 2FT6A 5HI5C 1HI6A 2ITEA 2XACC 1XF2B 2WNKA 5ACZB 1AD9A 2VXQA 4WUUE 1JZ7A 4HPYL 1HXYB 4MQXC 2BC4B 5IG7A 3QO1A 2FZ3B 3L7EB 5H4YA 2JB6A 5T1KA 1QHOA 2CLVA 4XCNA 2FZ3A 3L7EA 2B1HL 2F08A 3PV6A 2VXQL 2VAAB 3NJLA 1G7LB 4I0PD 1ZTXL 3ZE1B 3QHFL 3RGVC 3SCMB 3TZVC 5I8OL 4BQ8A 2BSED 1AQ8A 3PL6A 1DLHA 3BZEA 4IEFA 3IPFA 1XGRB 5LNGA 1E8XA 3DURB 5C0RL 5IHLB 3NCEB 1O6SA 2R1WB 3QNZA 4PJIF 4KHXL 3IS0X 3G9VA 4XMLL 3ZO9A 5C0JA 1RPKA 1KXTA 1XO8A 3RIFF 1R47A 2EXYC 5JORA 2XXFA 1BCIA 4F58H 5F9OH 5INCB 3F83A 4X5WA 2BHFA 3Q5TA 5EHFA 3OMZA 1T1ZB 4WV1A 2IPKB 3BSZL 4PYHA 1OARH 1G94A 3B9DA 3L3IA 4ZDHA 5A2IH 1RUQL 5CJBA 1ACYL 2FQGA 4MA1B 3P0YH 4W9FC 1CGTA 1BD2D 1KJVA 2D0HA 3BSZA 3NTCL 2W94A 4BA8A 3UEZA 3DHJA 1FCCA 3G6AB 3QBTB 5I8EA 3G3LA 3VG0L 2H1PH 3ECQA 3LQAC 2F19L 3NGBB 4XPAH 4PIRF 1E4KA 5AQ0A 2UY6B 3GSUB 4K94H 3X1NA 4C4BA 1ZS2A 5DMJB 3H8NA 3MV8E 4Y7MA 2WO2B 1LK3H 5GGTL 2PCPB 4P4KD 3VQMA 1KLGA 5KYUB 5I6LA 4XBGA 4AYFB 2DTMH 5IB5A 2HKFL 4PWGA 1MLCB 4ZXBC 3CLWA 2HTKC 2NDFA 4A1RA 4YGVB 2XTJE 1D9KD 1ZIBA 4JRYD 5DEGA 2A6IB 3ARDA 1L6XA 5EBWA 4RVBA 5FFGA 2E7MA 4YZFF 3PAUA 2NY1B 4TUJB 3UROR 1HCYA 3X1GA 3FSOA 4HPYH 4WWID 1Y1UA 1TJHH 3OV6A 4OF5A 2HLEB 4Q14A 4RRPA 1L0PA 2KUTA 1GGBH 2WLZA 4M7LL 4MNQD 4RQQB 4FTVA 5B7MA 2YA1A 3LRGA 1E7UA 1I82A 5EFIA 4ELKA