2IO5A

Crystal structure of the cia- histone h3-h4 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
154
structure length
154
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/structural protein
molecule keywords ASF1A protein
publication title Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2io5A00
2DZEA 2YGVA 2Z34A 4EO5A 5BNXD 5BO0D 1WG3A 2CU9A 1TEYA 2I32A 2HUEA 2Z3FA 2IDCA 4RRPM 2IO5A 4ZBJA 3AADB 5EIIG 2IIJA 5C3IA 1ROCA
chains in the Genus database with same CATH superfamily
4XAWH 2AANA 1OAUL 1RH8A 4LSRL 4HS8H 2EE6A 3FQWA 3IFLL 2BNRB 3RIKA 3SOTA 2Z4QB 3VWJD 2VRKA 2JNZA 1A4JA 4AW7A 5HYJB 4N0FA 1JWSA 4XMPL 3CD4A 1XTMA 2HP4A 2EDMA 1E90A 3VQ2C 4A63A 1CLVA 2W92A 4UV4L 4GG6B 1Q90A 3DO7B 5D96B 3HNSH 3MV9E 2VC2L 4ICWA 1KBGL 1XSJA 2Y69B 3FJTA 4H40A 5ANME 4RGNE 2FYYA 3K4AA 4FQXC 1CGSL 3KL0A 2XQBH 5F89B 2UUDK 4J4PC 5F8QC 3PU7A 1U8MA 2X6BA 3MBEB 5BW7A 3EGSA 4KNTA 1DQLL 4QTHA 4CL7A 3UTTE 2D7TH 4HK3N 3OHXA 4LSTH 1FG9C 5DWUL 4ZNEA 1PS3A 2A5UA 5LG6A 3I02A 3BSGA 1S9KC 1R3LB 2FX8L 1YJDH 4LEBA 2N3JA 1V27A 4JMXA 3I75A 3L7FB 2R2HA 3LNIA 3MBXL 3MTRA 4IK7A 1OL0A 3HR5B 4NOBA 3F7VA 3D0AA 4UT6L 4RRPA 5J9PA 3RP1A 1B4JH 2DZEA 3OQRA 3BI9X 5SWSB 3KEDA 3FSVA 2VM3A 1KTLB 3F2LA 2Z7YA 3SDXB 5D7KE 1BFTA 3ENEA 2NY4D 2WUCL 5CEZD 1E6JH 2JCCE 1BEYL 1RUMH 3DHPA 1OD9A 4G9FE 4Y1AA 4FI7A 4GP5B 3BE1H 3NA4A 4CADB 1U3NA 3GS4A 2ZNXA 3LX9A 3L9RA 3DI3B 4EN3A 1U36A 4WI7A 2J1WA 2ZCZA 3QGVA 5EIIG 4ZMLA 4PRDB 4DKFL 3WXWL 3IAGC 5ESVA 2Y0SA 3MJ6A 2H2SD 3NGBB 1L4IA 4HGWA 4K5MA 2ZCLL 5E5LA 4Z0BL 4ZK8A 3VVWA 3Q3GA 4MNQA 4PTUA 1K2DB 5T1DL 3SYAA 4OM1H 3TWYA 1A64A 1X5XA 4PH8A 4HJSA 3VJ6B 1YMHA 1J18A 3NJFA 3KXFD 2APTA 5A2CA 5KSBE 3WY1A 4A2FA 2EEDA 4WEBH 4XO4A 3HAEB 4H1LB 1IKFH 2ICES 5FO9A 4LLVA 3QUML 4HUUA 5DO2D 1LP9F 4PCTA 3HI5H 3OGCB 2ZUWA 4PJFE 2E9IA 2DQTH 3UC0L 4R7DA 4X5PA 1PLGH 4DT2A 2P45B 4QF1A 3FTXA 3LKRB 1KG0A 2XTSA 3ARFB 2YGVA 2Q2EB 4N6RB 3OJDA 4YE4H 3UJTL 1FVEA 4GLRI 5E1AA 1IIIA 2GK0A 1K5NB 1P4IL 1I1YA 3WN5A 5I8KL 1KT2A 4NPYB 1JZIA 1NMAL 3P0GB 3QZWA 3V5HB 5F7HA 4XMTA 2HLEB 4J12A 4GI6A 5AALA 2A0LC 3VXUD 1G7IB 4HV8B 3QISA 5AZUA 1KEGL 4P5TD 4HPYH 4NFCA 2GJ6B 3IFOA 5IFHL 3H2QA 1DQTA 5EULV 3UTZA 4WGWB 1GYUA 2IQAA 5CKGA 1KYOJ 1HSBB 1BWMA 4KITB 3W11C 2GFBA 1NFIA 5BMFL 5DR5H 4IU3A 2PYED 3ML8A 4F7CA 2KS0A 4KOBA 1ZMYA 4P04A 1A3RL 4G6AC 1D5BA 1QW9A 1HEZA 3WFBH 1XCTA 1MCWM 2A6JB 1P5UA 3DSNB 2ITCA 2NNFA 3LH2L 4DO6A 1RPUA 1RIUL 2QADB 3KYMB 1I9EA 3LD8B 1QSVA 5IVXB 3V4PB 4OFPA 4PP2B 1Z5HA 1FNAA 5IFAH 3MLRH 2BVOB 3O8XC 2IXQA 4MMZB 5AB9A 4UQAA 2NY3D 1ZV5A 2YAQA 4TUOA 1KYUA 4XXDA 2G3NA 3V6OE 1A47A 4YXLH 4YC2C 1XH2A 4EIGB 3OR6B 3HZYB 1A9BA 4XB7A 2Z92A 4IMLB 4C56B 4MNHA 5F6IB 1RZJC 3GPEA 3D3VE 4NIYE 4LEOB 5AVXB 2HT4D 1FVCA 3V0WL 2W9LA 3GT6A 2A77H 2WXRA 3NIDE 1H6FA 4MDJB 3U0PA 4ODWA 4Y4KA 4C59B 2P26A 4QEGA 1KTJA 4M62H 1N8OE 4GKLA 1F42A 3H8NA 1MI5A 1Q1PA 3CFDB 5FB8B 1LE9B 1TZHA 2NY0D 4R7LA 3THMH 4A2EA 3F7YB 4KQ3H 4QRTB 2LAGB 5KYNA 2NT1A 5DDHB 1FYTD 3F58H 3WGVB 3ELAT 1ZANH 4RMVA 1M05A 4YDZA 1TQBB 3DX1A 3NABH 5DJYA 1N0XL 3RGHA 3NACL 2X38A 3FQRB 4BH7B 4YVNA 4L4VB 5DJ2B 3Q6GL 2XPGB 3ATEA 3IDJB 1SN0A 3E3QE 1J7VR 1TXKA 4R0LA 5DVOA 3OMZA 1PZAA 2ZYHA 4AQAB 3IM1A 3RWDA 2VDNH 1MDAA 1KIPB 2EKJA 3QORD 1YPZF 4PJ7F 3VI4F 3W56A 3OQ3B 1IBYA 2H8PB 2BXZA 2G30A 1OAZL 3EJTA 2DI7A 3OG4B 4CJ1A 1AHMA 1YYLH 5C86A 2ZX6A 1F86A 3GSWB 3L1EA 5HYFA 5GZNA 2NYZA 4HKXA 1WFTA 2X2JA 2JJUA 5HYJA 5FAAA 5IW6A 1PCSA 3CU1A 3BKJL 4GG6A 2C26A 4WY7L 3S2AA 3DO7A 1K85A 2Z8RA 1PAMA 3ECBB 1NFDE 4HZLB 1NOAA 3ZHFA 3V10A 1VEPA 2Z4TA 5JHDB 4RGOH 3TP4A 5F89A 3FN9A 2G3XA 3TEUA 4LRIA 3IJ7A 3KCPB 3N0PB 3MBEA 2OTPA 4G6FB 4JJ5B 2WZ5A 2JKTM 1IKNA 2APVA 4BQBA 1OSPL 2OMVB 2OX5B 2EDDA 1R3LA 1RUAL 2K4AA 1JP5A 1NLDL 2OSLA 3VQLA 4N2LA 5MEND 1OARH 4XVSL 3US1A 3TNNB 3HR5A 3ZKND 4XCEB 2Z64C 1FL6B 3ZE2E 4U4BA 4GRLA 5I6XC 3MRPB 1I53A 1ZT4B 1T66C 1U3HD 4RFNC 1KCUH 1WO2A 5TE4H 3SDXA 1JGLH 2VLJB 5FO2A 3TS8A 3HFML 3LV3B 1JXGA 3IETB 4NN5B 4I18A 2ZWLT 3L8QA 4OLVH 1J11A 3SBPA 2JFCA 2QQLH 3MLZH 4CVXA 1TJGL 3DECA 5LXGL 4X6CE 4Z7UF 4UUJA 4DVBB 4G6KH 1EUUA 4M5TA 4OB5H 4PRDA 1F4WH 3MJ9H 2DM2A 2H32H 2HH0L 4F9PC 4F5CE 1EHLL 4CDHA 1A0QH 2ADFL 3ZDYB 4Z7WF 4JM2C 3ZGIA 3B4NA 3VJ6A 4WEEA 2ARWA 2E0PA 5D2LF 2B14A 4X8XA 5BRZB 2OMWA 4NCDA 4W6YB 4LCYB 5DJ0A 2V2TB 1LO4H 4KI5C 5FWRA 1QHPA 5E6UB 3DTUB 2DQDL 3CHPA 3ZYIA 3TH2T 4N90E 4F58H 3OGCA 2E6JA 3K4DA 3NCJL 4MA7H 4I0PD 4KMTH 1SFHA 4XVOA 3V52L 1INDL 1FCCA 1G1CA 1A14H 1DP0A 4Z7NE 4GT0A 3LKRA 3WFCH 4X50A 5IB1B 4N6RA 1O9VA 1FJ1B 2OM5A 5F8RC 2CA3A 5HDOA 3RI5K 3FZUC 3NTCH 1K5NA 3AREB 2BWIA 4Z77B 4WO4B 4NPYA 4YDLB 4NZJA 3JYCA 4ZTOL 4HWBL 3FDWA 4Y19B 2G9KA 4MJHA 1G9HA 3UO1H 2F54E 5D9SA 1OZTG 3F6IA 5DQDH 4FG6C 4J5VA 2R9HD 3CVCA 3L45A 2HB0A 2XZCL 2WZAA 3QDME 4JFEB 5A2AA 1S7QB 4N20A 2CJUH 4NZTL 4W9LC 4DGIL 3QARA 2EDEA 2LW3A 1C5BH 3GF8A 4RAUA 4XNXL 3NFNA 1W6LA 4JFQB 2B08A 3FC8A 4N4YB 1ZVSB 1IJNA 2GBTA 4FKKA 3TBSB 1L9NA 2A6JA 1U4FA 3DSNA 1AGDB 5DVPA 2X4TB 5JOPD 5F6HI 1YAZA 3TGXA 3ZUCA 4WLCA 4ZX5A 3V4PA 2IGLA 5IVXA 2YGPA 4PP2A 5DVKA 1ZHLB 1YEEH 5I75B 2EP6A 1BF2A 2BVOA 4MMZA 4G8FB 5I16B 1JXFA 1OLZA 4MXVE 4JZOB 3QQ3A 2BVPA 2RJMA 3OKYA 2HAZA 2P8MB 2AXJA 3UBXB 3K2UH 3HZYA 5F1IA 2BNRD 4IMLA 3BXNB 4O02H 4P59L 2CDGB 3EH3B 4OD3H 3NIFB 2NYYD 3RPIB 1XF2A 3IDNB 5EIQA 4U7SA 4L4TB 4ZO8A 1DUZA 3A21A 1NBZB 1QO3B 1GA2A 3FHEA 4P5KB 4Z3GA 1OTUC 4C83B 2FGZA 1AIFB 1QSZA 3QXAB 5FB8A 5EO1B 4UINH 1LE9A 5HVWA 3TZVB 4YSSA 4QRTA 3KWUA 3LQAH 5DDHA 5IR1B 5IT2L 5JHLA 2CMRH 3L4ZA 4L1DA 4YHZL 4D0BB 4GS7B 4LDCA 3FQRA 4BH7A 4HOWA 2YAEA 5IHHA 1NAML 3CFCL 4ZS7H 3L9EA 2IH8A 4KTDL 1BAFH 4L4VA 5DJ2A 2IWKA 3IDJA 4JO2L 3UGUA 4E9QA 4PWKA 5I18L 2Z8WC 4GSUA 4AQAA 3LNFA 3PQYB 1VCBC 3LKNA 4LOVA 5IUSA 5D7IF 3ZIMA 1KIPA 5CSZB 1XF3B 4I1RA 3EHBC 1PY4A 3T4AB 1E6OL 1F8TH 2H8PA 5I30H 4KRNA 1JWMB 5EPMB 3VXRD 4JVPA 4TUJB 2N01B 3CVHH 3GSWA 4G3YH 4JM4H 4M7LH 1CLZL 5DQ9A 4DZBA 2JELH 2VSDA 1NH6A 3DARA 4XTRD 3IXTB 1G7PB 4HWNA 1E30A 1QG3A 4GQPH 4ISVB 3TH3T 1D5MB 3BUYB 4ONGH 3KPPB 1D9KC 3ECBA 4PBXA 4PJXE 4U6XB 3SD2A 2EIMB 2C9XA 4XBPB 3C5SB 4AL8H 1OY3B 1ZCRA 2PUQT 1FZJB 5G5DB 4TSBL 2BHZA 1A6ZB 3SDCC 2P5WD 3IDMB 3KPQB 4MRCA 2A73B 4ZXBD 1YRKA 1CIDA 3EF4A 1KPVA 3NJKA 1JDDA 5EIIB 1QUPA 1Z7JA 1UWGH 2E5EA 3H1ZA 2OMVA 3IMRA 4OCSH 1KF9B 1SBSH 4KX8A 4P46D 1J8HB 4FRWA 1TVBA 5JUEH 1BX2B 4NQSB 3V0JA 1GGBH 1SJHB 1EBAA 2EYTA 2NX5E 3GSNB 1AR1D 2IMNA 4P4KC 3STLB 4FOMA 3N50A 5FECB 1X6LA 2H45A 4ZO9A 3FT2B 2VOTA 5GS1B 1FL6A 2WWOA 1OSZB 2XN9E 4YHMH 1BPLB 1UWXK 2NQCA 1T5WB 5FO7B 2K7QA 2AQSA 5TTRA 2G75B 5FEBA 2YEZB 3CZEA 4Q58C 2VLJA 2AW2A 3C60C 3TF4A 1Z32X 3QUYA 3VQMA 3LV3A 3IETA 5GS2D 4XP4H 2R1WB 3UMTA 1A5FL 4O9HH 2DAVA 3PABA 4V11A 4WW1B 3B56A 3MV9B 3NSYA 4BE6A 1PZ2A 4LGRB 4FADA 4IDJL 5ANMB 5F70A 3VGEA 4ZD3L 4RGNB 3U25A 4DVBA 4WIQA 1DCEA 4J3OH 4EI5A 1MQKL 4Q9RL 4OAWB 3GHBH 4IBTA 4MQXC 3ZRCC 4LARL 2BP8B 3TN0D 5AW0B 2ZKYA 2NR6A 4PRPE 5T5FL 5JW4N 1ICTA 2CO4A 4FQHA 4ZOCA 4XCFL 3UTTB 5BRZA 1HQRB 1AZBA 4RMUA 3CUPB 1CFQB 2V2TA 3T6ZA 3BQUC 3NRFA 2X70B 2DEYX 2AFNA 1SUHA 2ZPKH 3IXAB 5DFVD 1BZEA 1ITBB 1P0SE 4LCCB 3QR2A 4PFEA 1RAMA 3GWJA 1I85C 4PJ6A 2K8MA 3MLVH 4Q0XH 1JPEA 4S2SA 5F9WC 3ZE0B 3MRNB 2DEWX 3QUZC 3ISRA 5FK9B 5IB1A 1RPQA 1FJ1A 4OD1L 5KS9F 4Q4IA 3CN1A 1H3PH 4Y4FC 5I66A 3AREA 4CBPA 1F3JB 4WO4A 3QZMA 3X3FL 4FFYH 2IQ9H 5HI5C 4Z7QE 4G9FB 1HL9A 4LASL 1ZA3B 3BHBB 1SUJA 2X4PB 1YQ2A 4S1DC 2CPCA 2XWDA 2J5WA 3SCMB 1TQUA 4BDVA 4H88H 2FX9H 1KELH 1JE6A 4ZUVA 2DF3A 1YMME 2ICEB 5BJTB 3Q5OA 3QI9D 4FNSA 2XTJE 2I60H 1B88A 2DQGL 3PRZA 5LLIC 3VNZA 1OW0A 1DQQB 4MSWA 3LZPA 4I87A 3CSYB 2WUBL 1NTDA 2A83B 1K6QH 5IZ7A 4KKBD 5KSBB 1JNHB 4M6OL 1GYVA 1M71B 1ZVSA 3CCHB 2Z6FA 2FH8A 2D2CC 4ILDA 3PUCA 3QE5A 2UWEA 4X6DE 5DGRA 3RWFB 3LZFH 1AGDA 2OYLA 3MRKB 1AGEB 3NJJA 5E0FA 2UV3A 1AE6L 4WKZB 3JQOB 4QAMB 2D73A 1ZHLA 4GAYB 2NXZC 5I16A 4NC2B 2WXNA 5MP6H 4JZOA 5FV1L 1CFVL 1WAPA 3N85L 2WC7A 4PJ5D 5KVDL 2P8MA 3UBXA 5I1CL 5HJGA 2VLLA 1FFOB 4BFGA 3OJ2C 5T3XH 1NGPL 2CDGA 1KB3A 3L2MA 2Y6SD 4UOW0 3MNMA 1IGFH 4TXVB 1DBAL 1AY1H 3N41F 3WCYA 3WSQL 4BZ2A 3WDHA 2O61B 3IDNA 1M2OA 1HINH 4G11A 1U0QA 3AY2A 3CWGA 1SXAA 2VO8A 1YYMH 1YEWA 2WNKA 4L4TA 4M61B 5CP3A 5PCYA 3M1CA 1NBZA 1QO3A 4IW4C 4P5KA 5I0YA 3S8FB 1JNLL 3JT0A 4Q56A 4JKPH 1E4KC 5EO1A 1EO8L 4C4UA 4EVNB 1ZWIB 2AGJL 5J11B 4ZAKB 5IR1A 1WA1X 4Z6AT 3CZLA 4XCYB 3CIQA 3GI8H 2AV1B 1FFTB 5ISZE 3QQ9C 4D0BA 2BY1A 4KKRA 4ZPTA 4M8QB 1A7OL 4HWZB 5DLLA 1UZ8B 4Q6IB 2AQ3A 2PKDA 2YAHA 4HDIA 2HT3C 1Z3GL 4JHVA 1AXTL 4LSPH 2MOQA 4PJCE 2I25N 5KSUB 2ID5A 4PRIB 3VCLA 2RACA 2FEEL 1H5BB 3BWAA 5CSZA 3VGHA 1JGVH 4YDJB 1W72L 1U3ZA 1UUNA 3T4AA 1REIA 2J6WA 3B9KB 1DDTA 1JWMA 3SE9L 1M9SA 5EPMA 4ETYA 3RVVD 4TUJA 1H6EA 4PRAB 4OFQA 3BN9C 3RE0A 1YQVL 4KI5E 5EU6E 5BS0D 3FUFA 4R4FL 3NIDB 3SJVD 4HX1B 1KCSH 3BAEL 3IXTA 3CSBA 2UY6B 1G7PA 3DETC 4G8EB 3FF7A 4W70A 4XX5A 4ACTA 3HB3B 3F04A 4ISVA 2OZ4A 1D5MA 1O5DT 1MFBL 3BUYA 2WB1A 3KPPA 3PJNA 4NQEB 2EDWA 4U6XA 2Q8AL 4QNPE 4TLKA 4XBPA 2NY6D 2V2WB 4HUNB 3N1QC 3GJEB 3PDDA 5HHME 3SE4A 5G5DA 5E9DE 2W0PA 4H8HA 1A6ZA 3IDMA 4JFHD 3ULAB 3KPQA 1GS7A 1OLLA 3O6FA 5AOKA 3UG4A 2A73A 2OMUB 5I5MA 5E2TH 2NQ3A 1NMBL 3DHMA 1MRCH 4TVPH 3LVEA 5L2JB 5EIIA 3QG7L 3WFEH 2IAMC 3ZTJH 5I1AB 4K3GA 4WWID 4NQSA 1SJHA 3STLA 4MQTB 5FHAL 1SJEA 5FECA 1ZGLM 4K15A 3TT3L 1F1AA 3FT2A 5GS1A 2Y5TB 2RA1A 2IDSA 3MN8A 4A2DA 3WEAA 1WZKA 4G71B 2ICWI 1GOGA 4LPTA 1T5WA 3KLQA 5F9AC 1LK3L 3TV3L 5JDSB 2YEZA 2JKLA 2VDKL 2N1TE 12E8L 5GGSB 3O3UN 3C9NB 8FABB 4N2FA 4WWKD 5C0CB 4OIFA 1NC4A 2DWTA 4YOKA 4OZIF 2R1WA 3QWRA 5DUMH 5E8EB 3RL1B 3BT0A 2QTVA 1OGTB 3ZDZB 1PNDA 3RTQB 5ANMA 3VU1A 3LS5L 2IALB 2CO7A 5C3TA 3ZE1F 1OP3H 5F1OB 2BP8A 3QIBD 5HHXL 3X3GH 3AQXA 3VE0B 1CUOA 1E4WH 3TJHD 3WO3B 1T6VN 4MS8D 5AYUL 3TLRA 3EO1B 3SDAB 3VGGA 5JXEC 5L6YL 1EFXD 1TETL 1HQRA 4GRWF 4WNJA 5T3XE 1BJ1J 1NLBH 2AKRB 3FH5A 5F0LB 2ZOKB 2UXVA 2X70A 3VFPA 2F7IA 3IXAA 5F7BA 4JPKH 4M43L 4PVMA 5GS0C 4I3SL 2R56L 5JZ7C 3DXAA 4YBLB 2ZSWA 1UM5L 3MCLL 4U1LB 5DXWA 2DLTA 3QQDB 4OT1L 3MRNA 4OKDA 3N1FC 3Q6FB 4K2UL 1JWUB 2VXUH 1EO5A 5FK9A 3V5KB 1CXIA 2Y22A 1QFHA 1ET8A 1F3JA 3BP4B 4KZDH 1MCFA 3QEUB 3B83A 3GO1L 3BLKA 4LDEB 3S4SG 1ZA3A 3QNYB 2DDQL 4ZTPH 5C0RH 1OM9A 2X4PA 5F9JB 5EDSA 4IRZA 4X6CB 1QLEH 5C0NC 3Q06A 2ZD0A 3Q8AA 1QFUL 4PHXA 4OFDA 1OB1B 4KGJA 1YNLH 1YNTA 2DH2A 2WBJA 1H3XA 1XZ0B 3TA4D 3TZVD 2OW7A 4YPJA 1DQQA 1QSFE 2VZVA 3CSYA 5DJ8B 2PPEA 2A83A 5KSBA 1IL1B 2A6DB 3STZB 1M71A 3GJFH 3CCHA 4KU1A 4ZI8A 4FF9A 1XB8A 3RWFA 1ZE3C 2AJUH 2AXFA 2F18A 3MRKA 1MJ7H 1AGEA 3O6LL 3B2DC 4WKZA 2AJYH 4PLKD 3QCTH 5F0PB 2AJXL 4GSRA 4GAYA 3REVB 4B7LA 3PQYD 3DK0A 4EUPH 1X4ZA 3NN8A 3OZ9L 5C2BH 5IQ7L 5E2VL 3EJSA 1A1OB 1EXUB 2XWCA 3WG7B 1X44A 1CI5A 2H4EA 1UEMA 3FW6A 3KBEA 5EORH 1KCKA 1FFOA 3P11H 3PP3K 4PVNA 4Y4HC 1WUNT 1WTLA 4TVPE 1UD6A 1Q9WB 4DO5A 4TULL 2F54B 1TZOA 5HHOE 6PCYA 3PWLB 4KKAD 3LHPH 4MJIA 4FABL 2O61A 5TQ2L 4UYPA 3COOA 5CILH 4E5XG 4HQQH 2VDNB 1RUQH 4M61A 2WCGA 3BH9B 3KL3A 5KVFL 1PG7L 1QBLL 2TSBA 1L0YA 4J3VA 4DSYA 5JW5B 4LVOC 3WJJA 4DP6X 4GW4B 4EVNA 2VERN 1ZWIA 1HNGA 3G3LA 2BSBA 4ZAKA 5H8DA 2BPBA 3OKEB 5TDNB 3SE3C 4XCYA 2VZUA 1WFJA 1PAZA 5F44A 3GIZL 5HD8C 3U1SH 3BUDA 1L9RA 1MHPL 1OQOA 1BBJB 3HS8A 2G2PA 4HWZA 4O2EB 5CMAB 3QP3A 5IBTH 4WW2F 2FDBP 1J8HD 5KSUA 3ULVC 4FQXB 1KEML 4KY2A 4PRIA 2CGRH 5DHVA 5EF1A 1H5BA 1C1EH 2H3NB 2E27L 4YDJA 2O5XH 5BVJB 1JRHH 3V6OA 5D1ZI 3B9KA 4MNGE 2FBRA 2BP0B 3DBXB 5IGXH 2EIZB 1XQ4A 1RIVH 2CM6A 2VZTA 5I73B 2GJRA 4ZMYA 3SDYH 1WF5A 4HMEA 4GB9A 5LQBL 3NK4A 5J89A 2PXYB 4RLDA 1Y1UA 1OTSC 2XV6B 4FGMA 4TQEH 3INUH 4HPOL 4PMFA 1KFAL 2OMZA 4HX1A 2BFVH 1ZTXH 4G8EA 4NM8H 1VHPA 3L81A 2BDNL 1I9JL 4NQEA 2LGNA 1T0OA 2DPKA 2YD1A 3D5OF 4MB3A 3L4TA 4ODSL 2X1XR 4XNYL 2V2WA 4Y7MA 1JFQH 2VL5B 3GJEA 1SMDA 2OL3H 4K07A 1YPZB 3KPMB 1DVFD 4XN1A 5I74C 4G42B 2OMUA 3F01A 5KN5B 1DLHA 4PP1C 2Y23A 1LEGB 4E9WA 1QSEE 2BJML 1ZJAA 1S7RB 4AQOA 1FG2B 4DIXA 1N64L 2OTUA 4IIQB 1MCNA 5T1KB 1E4JA 4MXQC 1MF2L 5ALBL 1KGYE 3G6JF 1LTXA 2HTLC 4FYRA 4XI5C 3UAJA 4EIUA 2Y5TA 2NXYB 3T0XA 1E9OB 3CSPA 4DPAX 2ED8A 2FYVA 4JFZH 1S9XA 4RBPK 4C8XA 4IRSC 1GS8A 4UM8B 2EC9U 4RVBA 3VD5A 1PSKL 3QG6B 4JJHA 5GGSA 3DX4A 8FABA 3C9NA 1XGYL 5JR1H 4JK0D 1WG3A 5C0CA 1EH9A 2PR4L 1UFGA 2F8IA 5KBLA 5KANI 4XMLH 1GW0A 4GMTH 5E8EA 3RL1A 2Q1EA 5F7YC 1JG9A 1OGTA 2H2PC 4PJXB 3RTQA 1JNNH 3NSJA 1RL1A 5E2UL 3BGAA 2IALA 1DBJL 1MCLA 1X9QA 4Y5VB 4DQOH 5FHBL 4G2AA 3VE0A 3JWDL 5AAPA 1H8NA 4ABWA 3EO1A 3NAAH 5DD5H 4H8PA 4JHWL 3A6CH 5GS0H 2ZOKA 3RJQB 4HXBL 1CGWA 3RAJH 4H8WC 4HWUA 3FH7A 1UACH 2WV3A 4GXUM 4YE0A 1QABA 3CMGA 4EKJA 3HE7A 5IEHB 3W82A 2YJLA 3LHAA 4U1LA 5IMKB 4KQ0A 2CK2A 3Q6FA 2J1ZA 1JWUA 2UY7B 4Z7UB 2HJKA 4JPWL 5GRVL 2YN5A 4MMXA 1CPUA 1EEZB 1CU4L 2EIEA 4IKJA 2AEWA 2IJ0C 3T2NL 2Y1AA 2FIKB 3L5XH 1YAIA 3QEUA 1MCWW 3HUJE 4Z7WB 1N3NB 3IE4A 5CN1A 1T89A 2E74C 3QNYA 3O8XB 3W0WE 1WJ3A 4JZJC 2AK1H 2W5PA 2ZUSA 3OF6D 4F2FA 3O2DH 5LBVA 2BNUB 1LP9A 1M6OA 2Y9RT 3UIZA 1P84J 1J1XH 4XWGL 1FZOA 1U8JB 4PRPB 3GLZA 1BHGA 3NVQA 4NWTH 1XZ0A 5EZIL 4PI0A 4XP9L 4A2MA 5I1HH 3IMTA 4O02B 2Z35B 1ZE3H 5DJ8A 2VDML 1QRNE 2W9DH 5B3JF 4JR9L 2YPLE 3STZA 1N5AA 3LJ3A 1V7MH 3FN0H 1E2WA 1MJUH 2VSCA 5FYLH 3AU1B 4LK4A 4ADIA 4KXAA 3ZTDC 3FCGA 2R0KH 3REVA 2F15A 3QFGA 2DMCA 1G9MH 1JCKA 2JB5L 4KVNH 4NHUB 2WAQA 1A1OA 1EXUA 4LMQE 3LVTA 4GIPD 2WW8A 5F7DB 2VLKD 2O1AA 2PPDA 1CJYA 3PFUA 3KR3H 4Z7QB 1J5DA 3D3VD 4N5EC 1WWCA 2QEJA 4NPKA 4D3CH 1ZGLP 4JQIH 5J1SC 1TMQA 2VDPL 3HG1D 4JDTH 4N1CA 4IK6A 3RBSA 3IB4A 4OQTH 4DUVA 3BH9A 2AMUA 1SY6H 3G6DL 3I6KB 2EEXA 4G6MH 4QYOB 2R2EB 4AENB 3KG5A 4HEME 4GW4A 4WU7B 1JZ4A 4EF3A 3W9DB 2XTJB 3N44B 4X4MA 1MCJA 3CVHB 4YDMA 3OKEA 4L1HA 5TDNA 3VB8A 3RY6C 7PAZA 2QPFA 1LMIA 3CX5K 4PW3A 1PZ3A 5GHWH 2VH5L 2IWEA 2XU9A 4X6DB 2XUWA 3EBIA 3FU3A 4OIAA 4O2EA 2EXYC 2V37A 3WNMA 3QPQC 2RCSL 5AW9B 1KGXA 4R26L 1LVEA 4NAMA 4GSDH 3I9AA 4FNLH 4JPQA 4I77H 4BUGA 2H3NA 5C0GB 1PIGA 3MJ8B 4BFRA 5IJCC 3QIUD 2FO1A 2BP0A 1QKZL 3DBXA 3S3JA 3C5ZD 4HJ0C 4JFFB 4NO0D 3DX0A 2H9GA 3TBVB 2R29H 4HH9B 4HUCA 2OMNA 3MLXH 2PXYA 4J6RH 2E8ZA 2LLLA 2AZUA 4XN2A 4YSCA 3UTSD 3LRGA 5JIQA 3WIFB 1HIMH 2Q7NA 3BOVA 5I6XB 4XHJD 3H3KA 3EG9B 2E56A 3ABKB 4NENB 2EE3A 2NPLX 4YAQA 2XN1A 2VL5A 2B1HL 2DLHA 5D2NA 4IOFD 5D7IB 5BOZG 3VI4A 1YPZA 4PJ7A 1HJBC 3KPMA 1TYJA 5LN4A 2GBUA 4G42A 2DYPB 4L2LA 4AWJC 3IS1X 5DCCA 4LRNL 5KN5A 1SEQH 1YEHH 2EQDA 3K6DA 4U0QB 3A24A 4ZX3A 2HFTA 3SDAD 1K72A 1LEGA 4Y2OB 1MFEL 1YY9C 1S7RA 3LEYL 1FG2A 4HLEA 2F5BL 4PJCB 3CX2A 3L1GA 4X9YA 4XMXA 4IIQA 3RRQA 5D8JH 5T1KA 2Z7ZA 3DMMC 2EIKB 2ISDA 3MJ9A 1SM3L 1MNUH 4JM2B 2QHLA 2FRGP 4R97C 1ACZA 4U7MA 3EYUL 1E9OA 3MV7E 3KVDD 4Y9FA 5JLZA 2AZAA 3MJGX 3KBFA 5GRXG 1A6VH 3HTLX 5EU6B 4JM0A 4R5XA 2XYBA 4L4JA 1RXLA 3H3PH 3VRLF 3WAKA 3U1PA 1WA2X 3X1NA 2RQ8A 4YLBA 5FYLE 2H6UA 1T20B 4U0RC 2CH8A 3DGGB 3MR9B 2ENSA 1DEEA 2XZAL 4PJXA 1EK3A 3Q1SH 1MAML 5HHMB 4L9LC 4Y5VA 4ZW8A 2RFXB 3D2UA 4KROC 1BPVA 2DQIH 5EA0L 4FXTA 1CYGA 5FUCE 3X14A 3OLEA 5ICXA 3RZCB 2D7OA 4R4BB 5J5EA 5HHNB 4ANWA 1QZ1A 5GGQL 5CXPA 2HPOA 1QYGH 4E2OA 5I0VA 4N90D 1MJJB 5IEHA 5IBUB 1F00I 4K7PH 1TYRA 1X7SA 5L4IA 2F5AL 1RZPA 3KPRD 3FH8A 4X80H 2Q9OA 4Z7UA 1S8DB 3FRPB 4PGZA 8CGTA 2H1LM 1EEZA 4G59C 4LOEA 5EUOE 4U31A 2GC7C 2IVFC 3ZRSA 5BQ7B 2PO6C 4G9DB 4KHXH 4R96B 3KPTA 4BRVA 4CGTA 4Z7WA 1N3NA 3ULVE 1T5KA 4AKOA 1XGPB 2DWYA 4GUQA 3KD4A 2F54D 4Q6KA 1L9SA 3QCVH 1M56B 5JDJA 1AD0A 1GAFH 4KRLB 2Z1KA 4OFYD 3L3IB 4XOBA 3QDMD 1ECYA 2BVUA 1I8IB 2CO2A 3MJ7B 1WFOA 3FTYA 4PS4L 2ZOOA 1BJMA 4PRPA 1U8JA 2J2ZB 4XO3A 1UQSB 4Z3FA 3OKDB 4JEGB 1QEWB 5SX4I 4O02A 2Z35A 5C71A 1SOKA 5HGBB 1SVBA 3GSNL 4N8CH 5MI0C 2FL5B 1TTCA 3AU1A 3K8LA 1U8IB 4IQHA 2R4SL 2Z31C 4FERA 2HLAA 4LF3A 4UB0L 4JUTA 1UHVA 4U6HB 2C1OA 2BNQA 3D8MA 1FSKC 2R7EB 4NHUA 1NOLA 3AG3B 5ERWB 2K4WA 1BVOA 2YFNA 4J23A 5F7DA 2W80C 3MKGA 1IGIL 1U2HA 4QRSA 3HJ0A 3QQ4B 1ND0B 3DTDA 1C8QA 3I9GH 4WHTB 4W4NA 3DHUA 1E27A 2Q3XA 3U9UA 3DVGB 1E67A 3N40P 2CDEB 3TT1H 1JXJA 1AQKH 3EHBB 2YZ1A 1OT1A 2G60L 4OBSA 1IMHC 4TNGA 3FYEB 5EMYA 3I6KA 5CUSH 4QYOA 3VD4A 3GTNA 2B16A 2R2EA 5C0AD 1V55B 4WU7A 3D09A 1TTRA 3W9DA 5CJOL 1F97A 2OCCB 3CVHA 1ZLSH 1WWWX 2LU5A 4H0GA 1WUZA 4L3ED 4YZFF 1NOFA 3CBKB 4X6DA 2VXSH 3ISYA 5GRJL 4PGJA 1B2WL 4OW6A 1D9KB 2JH2A 1Q9KB 2QTEA 3DYOA 2DICA 5FUZH 4ANXA 1BD2B 4CU8A 3VG9C 2WLIB 1G7JB 1UATA 3SDCB 5T8IA 4I89A 1MCEA 5HXMA 5C0GA 3N43F 4M8VA 4ZMTA 3JYBA 1PG7W 4GAJL 4QRPB 1FO0L 3MJ8A 1U8LB 2F0CA 2IAAC 5CBEB 2B0SH 3E7JA 3GMLA 3AGVA 5DD3H 1PQZA 1ZK5A 1HS6A 1TQVA 3TBVA 4JFFA 3QUXB 4HH9A 3LYRA 2OBGA 4P4KB 5HHOB 3UJJL 2YD4A 2F08A 4OBRA 3GXFA 1CQYA 1T6BX 3C6LC 4D2NA 2L7EA 3WIFA 3FUMA 3TWCL 4NBZB 1JF1B 2FH6A 2P3YA 2E4FA 3QK0A 4IRJC 2E7HA 4ZOEA 3A6BL 3MVSA 5D1ZD 2XVGA 2VXTH 3EG9A 4NENA 4LPWA 5E99L 1AZVA 1TZ8A 4PJHF 5D7IA 2JJSA 5IROC 3VQ1C 1NPJA 1EAPB 1RZKL 1U6AL 3FU0A 2YN3A 3CDGB 3ESMA 1I1FB 1NANI 2I07B 3NUKA 3PE9A 4KK6D 5DQJB 3WNIA 4Y2OA 5EOCJ 1NCDL 2EVFA 4Y16B 3LKQB 5SWZE 2ICCA 1OD7A 3QWOB 4OCYH 1M6UA 4U1JB 4UTAH 2NX5D 4JQXA 4NCC2 4JPSA 1IB5A 4QTIH 3W11D 3KVQA 4ESKA 1ZKAA 3JV4B 4BINA 3BCDA 4F27A 4M8RA 2FUTA 2J6EA 3ABMB 1H3GA 4FI8A 2VR7A 3ABZA 4MNGB 3S36X 4X4YB 2XN9D 4IBUA 1NGYB 2IGTA 2PTVA 4LESA 4G6AD 1PPIA 4O51B 3VFSA 3BQUB 4DW2L 1EAJA 4FTVB 4TRPH 5C1MB 4YXKH 2YD9A 1FN4B 3MACH 3IKCB 5LBGA 4BK5A 3I2CH 4FDWA 2VUKA 2IG2L 3DGGA 3MR9A 5GRZA 1J0IA 1BFOA 3OKMB 1FFPB 3PGDB 1L9PA 2CQVA 3GSVB 3QBTB 5L4FA 1MG2C 5GGRA 3P0YL 3KH4A 3CLFL 1PEWA 3S4SA 2HPTA 2RFXA 1WZ1H 3B7YA 3DPDA 3PHOA 2YRBA 5C7ZA 1ZLVH 2ZYRA 4NJ9H 3VGFA 4HIEA 5CJ5A 1I8MB 4A6YH 5T1LB 4FFYA 3DURB 1BXXA 3BEWA 3S5LB 3RZCA 1QSEB 2IWFA 4R4BA 3ARBA 5J1AB 4WEMB 5E8OA 2WANA 1QLEB 3Q8FA 3LOWA 1IZJA 1YA5A 1MJJA 4OZIB 3F84A 3J27A 3E6HB 4PCSA 2J72A 2P5EE 1IO4C 1DVYA 4CMMB 3MNWA 4ZFFB 2KH2B 1S8DA 3GM8A 3EJRA 3QXVA 5EEUA 1DLFH 3C8DA 4B96A 3GJFB 4B9FA 1CURA 4G9DA 2YD2A 1D5RA 1IGMH 2KBGA 4R96A 4RMRA 1MFDH 1DFBH 3PGCA 1MREL 1XHHA 2ZJSH 4UIMB 4AJVA 3EJZC 5CCGE 3APCA 3IEAA 3B34A 1B4JL 4XPBH 4EUPB 3L3IA 1PBYA 3MFFA 5E6IB 3SGKA 4BKTC 3MJ7A 3RVTC 1YMMD 5DHEA 15C8L 2QLVB 2XLLA 3KYAA 2IPUG 1XDTT 4WO0A 2J2ZA 2Q87A 1N70A 1BZQK 5D6DC 5FM8A 3OKDA 1E6JL 2DI9A 5BZDB 1RUML 1QEWA 4XMVA 1MEXH 4L8CB 1T83C 1LD9B 2J8UE 2LABA 3NJHA 1IC5L 3BE1L 3MOAH 3MLSH 5KS9A 1CF8L 5A7BA 2FL5A 1CVRA 3RWIB 3IJSB 1E43A 1VEMA 2VQUA 1NUDA 4JDEB 1JYVA 2EDRA 4JL2A 1HWGB 5H94B 3UZEA 1D2OA 4U6HA 3KPSB 2X6UA 4J6IA 3BP6A 2LQRA 2VO5A 3MX0B 4OM1L 3MRMA 4EQ2A 3V7AE 4OFIA 2FBJH 5BNXD 2ESVB 5D4JA 5ERWA 2MCPH 4AMXA 1OP9A 1MWOA 3HR6A 3H9SE 3SPJA 3VW3H 4WEBL 1CG9B 5HDQH 1YDPB 3HC0A 1ND0A 5JIDA 1WCBB 4YWGH 3ARVA 3FQUB 1FRGL 5CP7B 5F71A 3QEGH 5DJCB 3W0WB 5ILTL 3TBTB 3DVGA 4HSQA 4TKWA 5SV4A 2CDEA 4V1DB 2DQTL 1QW8A 2QVKA 4OCRL 5ABAA 3L3OA 3NESA 4N1EA 4D9LH 1SDDB 1NCTA 2ZOUA 5I1LB 2B39A 4MJ6A 4JY6B 4YE4L 3M6DA 1T66D 5HHVL 4HWEH 3SO3C 4TVSa 3AB0B 5F7MC 3VRJB 4JG0L 2X10A 3TFKC 2AQ2A 1Z5YD 5FKAB 1IT9H 1QRNB 2YPLB 4QXTB 5ISZD 2DYPD 3RNKA 5AVVB 4L8SA 2P52A 1DHKA 4HPYL 1NJ9B 1D9KA 1TTAA 4AM0B 5BVPH 3H4HA 3FU6A 4K5NA 2F61A 5H37H 3J8F7 1P7KB 3TF7C 1BD2A 2OSXA 2GJZB 1EUTA 3BGFC 1HHIA 4G80B 2NSQA 2WLIA 5DR5L 3WY4A 1DUYB 4JRWA 3SDCA 4CILA 3KPLB 5IOPB 4MHHI 4X9GA 4ZYKA 4QRPA 1U8LA 2OL3B 5CBEA 2D03L 1PD6A 4MX7A 4M48H 4KKQA 3AUVA 3CN3A 2NY2C 2ZONA 3QUXA 3O0LA 4KI5D 5C07D 4Y4KD 1EVTC 4NQCE 5HHOA 5C09B 1J9CT 3TEYA 1MRDH 1EHXA 3BUBA 3RIFK 4MD5B 2IO5A 2XVKA 1WLHA 5HSFA 1JF1A 1BWWA 2W9EH 4R3SB 4BQ8A 2Y1ZA 3D39E 2RD0A 3ESNA 3QRGL 1PTZA 3GRWH 3NCXA 4XT1C 5FGBC 3WJMA 1L5GA 2BIMA 2ZP9A 3R4DA 5D1QC 1PVHA 3H56A 2B5IC 1S7XB 3MRFB 4ZZKA 4NLHA 2NUTB 1AH1A 4I9XA 5D7JC 5EH1A 3HC3H 4X99A 3WJLC 5E9DD 1JV2B 5C9KA 3CDGA 3HEIB 2G3MA 2Y25A 1A7QH 4LLWB 3I3EA 2DB8A 2I07A 4YGVB 2KYIA 5DQJA 5IK3B 5E4IA 4NYLA 4FG6D 1XSIA 3Q5TA 4NRYB 4Y16A 1JVLA 3LKQA 4H20H 4P9HL 4JO1H 4LSUL 4OD2A 4P3DB 4Y2NA 2O30A 4U1JA 4KXBA 3RILA 3QXUA 4AQEB 5KYUB 4BZ1L 2AEOA 4IYKA 1TJIH 3JV4A 4KQ3L 2Z91B 4ONFL 4PJAF 5JA9A 1ZANL 3ZHLA 1LQBC 3FUJA 3LSOA 3D9AH 4J28A 4MNGA 4W68A 1BVNP 2X05A 3PDOB 3RWGA 3NABL 3SKOA 1NGYA 4X4YA 1HZHL 5ACZB 4O51A 3NEOA 1L0XA 2BWQA 4RGMB 4BKLA 4OM0H 4FTVA 1FN4A 1JN6B 3FFCD 1RK0B 1X5KA 2CHDA 3IKCA 1ET7A 4FQIL 4GXFA 3B2UD 1VENA 2LT9A 2HWZH 3V95A 2VDNL 1F4AA 2W95A 3KBHE 5A6IA 1VA9A 4Z7VF 3DTXB 5HBBA 3VD9A 3OKMA 4F2MB 4U3CA 1FFPA 4OY9A 3WTSA 1LWJA 4FLQA 3GSVA 5KJ7E 4YDIH 5HJ3B 2NW2B 4Z18A 3WHE0 4OZ4B 1TZGH 1XGRB 3G6JB 1W6WA 2AQPA 2EDYA 1I8MA 4JY5H 5T1LA 3DURA 4PBWD 4R6UA 5DRXB 3S5LA 3ALPA 3D0LB 5HJDA 5LKNA 1HJCA 3VM5A 1QSEA 3RU8H 5J1AA 5DK3A 4ORZC 3U0WH 5K9OB 2Q3AA 3FCUB 1WBXB 2F6AA 4GRLD 4B60A 1W0WB 4OZIA 4ZS6C 2EZ0C 4KJQD 3E6HA 2QDVA 1QACA 3DRQB 3MV7B 3IGAB 4LSRH 4CMMA 3DIFB 4ZFFA 1MHEB 2YD6A 5D1XC 3EO0B 3IFLH 3ECUA 1U58B 4FFVC 1AANA 1TQCB 4HK0B 5IHUH 3GJFA 1CXKA 3BUIA 5A2FA 3S9DB 5FV2A 1T0MB 3LQZA 5IVNA 3H55A 4XMPH 2ENQA 4FJZA 2JJTA 1OARL 5EBLB 4QWWD 4QR7A 1ORQB 4NUJB 4UIMA 5EOTA 4UV4H 4UMGA 4RH4A 5DT1L 5F6HJ 3DA0A 2JE8A 3CSTA 3EHBD 4EUPA 5E6IA 3CZKA 3QFDB 3F7PC 3SQOL 2YC1B 1UCBL 1ZHNB 4MBRA 3R8QA 3FPXA 4F7TB 1CGSH 4JL1A 4G8GD 3O9WA 2DLFH 4FQPA 4DTGH 1DQLH 1JK8B 1QSFD 4XCCL 1LD9A 1ZSHA 3TC9A 3FAXA 3LRSB 3KS0J 1GJIA 3MLZL 1VFAB 3A22A 3IJSA 3ZGHA 3C2AL 1W15A 2FX8H 4OCMC 3QJRB 2YA1A 2PWFA 3F12B 4OGAD 3MBXH 2DIJA 3KPSA 3MX0A 4UT6H 4B6ZA 1PCXA 4TTDC 3V6FB 2CHWA 4K7PY 2ESVA 4F8QA 1BM7A 4HD9A 5TDOB 1AYOA 5EUOB 2FJUB 4PJIF 4AGLA 4IGBC 1CG9A 1E2ZA 1YDPA 2QVIA 4X9HA 3AABA 1AZRA 4KUCD 2YAOA 3I9IA 1IC7L 2WUCH 3EBAA 2PPFA 3FQUA 5AVQB 5CP7A 5FFOA 1BEYH 2FTAA 4EE2A 4F58L 2BINA 5D93B 3TBTA 2KDGA 4FNUA 3MLTB 4KMTL 4FXGA 4V1DA 5BZXA 3RDJA 1C8PA 1H8SA 4GIAA 3AWFA 4NDMB 4X98B 2E7BA 3BPOB 2YBRB 5I1LA 5HI3D 4DKFH 3WXWH 4KDWA 5A3ID 2WWKO 4Z0BH 2ZCLH 4TOYL 2ZG2A 5H4ZA 4G7SB 4LCIL 3VRJA 3NMEA 2BH0A 5FKAA 2FLRT 2Q7YB 3C60D 5AD0B 1HXKA 2WJ7A 3GBLA 1F2QA 4HSAC 2YPLA 3UO1L 4QXTA 4K7FB 5DHYB 4BQCA 3B7TA 3PYCA 5DQDL 2CBTA 1NJ9A 3HW7A 3P9MA 1DN0B 4AM0A 3X11B 1IJ9A 3FSZA 3QUMH 2GJZA 5ALCL 1D7DA 3MOBL 3PL6C 4JX0A 3D06A 5FFGA 1EPFA 3NZUA 1OF2B 1DUYA 1RVFL 1TTBA 3UC0H 4YEFA 1NC2D 1LDPL 5AOMA 3KPLA 5I74B 5IOPA 2X0UA 4NQVA 4MXWH 4BM7A 2GITA 1XB3A 3DI2B 5DJ6B 2KPWA 5E7FA 1RFDH 3UJTH 3LRMA 5FO8A 2BS8A 1P4IH 5I8KH 3BQUD 1NMAH 3K71B 2ATPA 4WZ9A 4YSPA 5C09A 4LGSB 1QFWI 1SXSA 1TF4A 4MD5A 1A65A 1CYXA 2JJVA 1VIWA 1KEGH 4R3SA 4ZT1A 5IFHH 1LWHA 2DEXX 2F68X 3U4BH 4WW2A 1ONQB 3RGVC 3QUZD 1RZJL 1UB6A 5ESQA 4IRSB 5I5JA 4OFVA 5DURB 4F1ZA 1S7XA 3MRFA 5BMFH 4ALAC 1UOVA 1KIQB 2OV0A 1HH9B 4Y4FD 1JV2A 1ADQA 2XZZA 3DX2A 3V6ZB 1KNOB 4I3RL 3Q0HA 3K8KA 3P30L 1A3RH 3OAZH 4OD3L 4LLWA 4GKOA 4YGVA 5TH2B 3AY4C 1G94A 2Z7UA 5IK3A 2DWEB 4JO3L 1N67A 1PJ9A 4HSCX 3ARGC 4S1DD 1TFPA 3NFPB 4DKDC 5E6SB 1KPUB 4UINL 5KYUA 4AQEA 4BH8B 3RWJB 2N4IA 1KN2L 2Z91A 2W88A 4DVRL 2ZT9C 4LZKA 1PD1A 2CMRL 3SB3A 1K5WA 3PDOA 1JHKL 4ZDHB 3OKOB 4JKKA 4WJ5A 3ARWA 5ACZA 1NGZB 5DGQA 4DK6A 5AFAA 4ZOBA 2OI9B 4KH9A 4KK5C 4DEPB 4YHYB 4ACPA 1JN6A 3MUY1 1RK0A 2Z93B 3CFKB 3GDCA 2HFEB 1DJZA 2QGBA 1D7BA 2OULB 2VKWA 1QTPA 3IPBA 4FQLL 4N26A 4UBDC 5EZPA 5IWLA 1K8DA 4KAQL 2NXZD 1F8TL 3DTXA 4F2MA 5E6RB 4NNYB 4Z7OE 4HUXB 1TLMA 1JPGB 2DYRB 4G3YL 3NBNA 4OZ4A 3MV8E 5JPNC 3G6JA 4OLUH 2MCG1 4XH2B 1V5JA 1R47A 4AC2A 1BVNT 3U4EB 5DRXA 1OAXH 2BVTA 3D0LA 4C55A 3NACH 4CVZA 4A67A 2WNGA 4X5XB 2HVKB 3EIFA 1CFTA 3Q6GH 2R23B 3QH3B 4ONGL 5FA4B 4PLNC 5JIIA 4L1TA 4X8CA 4KZ0A 4LXFA 4FD0A 5K9OA 1FAIL 1WBXA 5AWNL 3O2DA 2A4ZA 5LAXB 3ETTA 2BSTA 3MI6A 3KW7A 5HHQB 4XPFL 3T04D 3DRQA 2R0ZL 3IGAA 5FOBA 1SHXA 2DJMA 2UZIL 3DIFA 1MHEA 4Z5RB 3EO0A 3QQ9D 4NT6B 1U58A 2ZX9A 3TA3B 2YPKB 3MRIB 1M7UA 4HK0A 1S7WA 4MB4A 1SBSL 5JPMB 1FA4A 2EJ1A 2ARJQ 3CBRA 2YLHA 3NA9L 5EB9A 1T2XA 1A4BA 5D4QA 4DP8X 2EC9T 4ZFOL 4NUJA 3W0WD 4WY7H 2E9WA 3X1GA 1E9QB 4GMSH 5KEZA 4GY4A 3ARZA 4I2XE 4NQDE 2H2SC 1ZHNA 1KJ3L 3JWOC 3NIGF 4G1MA 3VI3F 4RX4A 3A67H 3BN9D 1OCWL 5CIPH 4LU5H 1T0NB 5HP5A 3N5AA 1JD7A 4KFMA 2D4DA 4YO0B 4BJLA 1GTNA 1M57B 2FSEB 4K3JL 2AXHA 3DETD 3U2SB 1WV7T 3LRSA 4JQIA 2AEPL 2Z0UA 1VFAA 2KL6A 5DO2C 2IPUK 5AAMC 1N6QH 1S5HB 4DP2X 5D1QE 2AK4E 3IBOA 4OQTA 1NLDH 2HFFB 3GHBL 5A1AA 4PY7B 1SY6A 4XVSH 2WLNA 2CUIA 4UI2A 5E4EC 1UWFA 3IDYC 4EI5C 3EAKA 1QUNB 1R4XA 3V6FA 4BFJA 2FR4B 1HOEA 5TDOA 5EUOA 3SKUD 2VR9A 5AZEL 4XC1L 1XEDA 2W07B 3DKHA 1HQ4B 2IAMD 1DFXA 4OLWH 1MY7A 2OPCA 5B1JC 3SYOA 3CG8A 2X1OA 1X9LA 3F7RA 3HFMH 4A2HA 3WXVL 1AYRA 4P5TC 5C7XH 4IJ3C 3LZNA 1NCJA 4I9WE 3MLVL 5LXGH 1TJGH 4PJ8B 4HUVB 1DVTA 3U0TB 4NDMA 4HCRL 4X98A 2YBRA 1BJ1H 2Z0BA 4LLUB 3VXMA 3PPEA 2JTDA 4LKCB 2BHYA 2OMTB 4XPTL 3GNMH 3W1ZA 1H3PL 4PJGF 5AOZA 1KZYA 1EHLH 2ADFH 2IQ9L 2Q7YA 2IPTL 3EZ8A 5AD0A 1BZDA 1QA9B 2EDJA 2J8UB 2R29A 3C08H 3FT0A 4GXUN 5FGCE 5A43C 1TNMA 4K7FA 3APNA 3BSZL 5DHYA 3WKYA 3ZTNL 2G5RA 3PWPA 4QHLA 3GIVB 4ZW5A 1NPUA 5I6NA 1DN0A 3AITA 3SSGA 3X11A 4H88L 4UOJA 3SDDC 1KELL 3S3DB 3FU5A 1FE8H 4H2CA 3F64A 3MXVL 4OZFG 1CMOA 1OF2A 4L05A 3GXMA 3V52H 2I60L 3QZLA 1INDH 2CO6B 2KKQA 4DP5X 3QJZA 2NY5L 3Q2NA 4FEMA 3H9SB 2IBGA 5JXED 2XFXB 6CGTA 3LZFL 4YX2L 3RUGE 3G5YB 2VR6A 5I6LA 2HT4C 3QO0B 3K71A 4HWBH 4A2LA 3BJLA 3AG2B 2Y72A 4J3SA 1S9YA 3BGMB 4FA8A 5JZ7D 3UG5A 3R18A 5FS5A 3FOLB 4LLYA 1I1AC 1JVKA 2VXQH 5EFIB 4ALAH 5D1XE 4F33B 4NZTH 2NY0C 5E94B 4PS8A 3RVWC 3RFZC 2AEIT 2D31B 4S1QL 2ICWJ 1KIQA 2A99A 2APXA 1HH9A 1MCKA 4ODBD 2DWDA 4EQ3A 3V6ZA 3BWUF 2PCYA 1KNOA 4LP4A 1DQDH 3GINA 1KYOK 3GXNA 4U0RB 4XNXH 3SE8L 3UEQA 3VMNA 3CN0A 3AG1B 4KJWD 5GGTA 4AYFB 5TH2A 4LOUD 3ZKQD 3GXUB 1RURL 1JZFA 1TQSA 1MLCB 1ASOA 2DWEA 2GI7A 3WEXB 4BFIB 2EEBA 5DJZB 5C0ND 2EE2A 7FABH 4JKPL 4L9LB 1GZHA 1OALA 1UZ6E 2V7HB 4KROB 5BO0D 3RWJA 1FZMB 4X2UA 5T3ZE 1UCTA 2FEJA 3VSTA 3UPAA 3HCVB 3EOYG 4ZDHA 3OKOA 5DRWB 4FXKC 1RHHB 2WYHA 1AQHA 3O4OB 3GSUB 4PJHB 1ZS2A 3R06A 4NQCB 3QDGB 4R4ND 1B2YA 4I5BB 4NCC1 4GQRA 2GJJA 2FO4B 2Z93A 3DYMA 4NKDA 1ZJBA 2HFEA 2Q76B 2DOCA 5FYLD 3D39B 2OZNA 2H0PA 3W3BA 5IF0B 4BCYA 2C7FA 3O3EB 5AAWC 3SO5A 4EN2A 4NNYA 1TZIA 3HLKA 4HUXA 1JPGA 2EE0A 4OUOA 1WD9A 5GGVY 5IT2H 4JKLA 4Y4HD 1GGTA 4XH2A 4QGTA 3AS0A 1QQDA 4AVKA 1DTUA 4Z76B 4YHZH 1JZ8A 2D7MA 3U4EA 2EVJA 3HC4H 3P69A 3GSRB 3QPKA 3JWNG 4X5XA 1NAMH 2HVKA 2VQTA 2WTPA 4KTDH 2R23A 5FA4A 3GB7B 5EU3B 5LAXA 3PY9A 3DGDA 4HG4K 3ZKNC 5C0IB 1SLXA 5CWSB 5HHQA 4A7UA 1HYRC 4KI1A 1E6OH 1RULL 2CJ3A 3BAXA 1ZLVK 1U3HC 5E2TL 4CA4A 4Z5RA 3VYNA 2RALA 5CEZH 1O7DC 4NT6A 3TA3A 1P53A 4JZNA 4APQA 5I76A 3WFEL 2XDHA 1CLZH 1NC4D 3HKFA 4RCAA 5JPMA 3O2VL 2Z31B 1ZS8B 4P2QE 4WJG3 2QVMA 3BKYL 4W9FC 5GZOA 1B6UA 2R0WL 2BOCB 3L17A 1IAKA 2BHFA 2PCFB 4AJ0A 3ULVD 3FO1B 5E4OA 3K72A 4PD4K 1E9QA 2SODB 4U33A 1BF5A 3X2QB 3Q1EA 1Q1JL 4AIEA 2ETWA 1MH5B 1Y18B 1PY0A 3LDBB 4RMQA 2C3HA 2Y6TE 3E0GA 4MAUH 3FFOA 2A3TA 4QOKE 4JFXA 4TSBH 2VXVH 1T0NA 4BCZA 4YO0A 1OTSD 2LR4A 3TH4T 3WLBB 4V2BA 4DHLA 5F7UA 4XXWC 2WQXA 3TJEL 1QWNA 3IJHB 3BPNC 2YQGA 2EDHA 3DXAD 3BW9B 2R4RL 3CDFA 3L48A 3LKPA 4JG1L 2VDLL 3RYMA 2HLFD 3B6SB 5C0BB 3MV01 3CFNA 2HFFA 4IMKA 4PY7A 4FLOA 2XIIA 3Q43A 3CVIL 4JPVL 3RY6A 3X3GL 5ICZB 4OIIL 1QUNA 1E4WL 2FR4A 3K5RA 1K4DA 3QO1B 3FUIA 1NLBL 2F58L 2ZUXA 4LDOB 4TN9A 4WNQA 3ZHDA 4ODHL 2IDFA 3ZBMA 1HQ4A 1OGAB 3WKMH 4OJAA 4JPKL 3EBGA 2FT6A 1KV3A 4P48A 1BSIA 5DZNA 1A5FH 5DEZA 5TE6H 2CKBL 1JK9B 4QAWA 4XI5D 2ATKB 4PJ8A 4IDJH 4HUVA 3U0TA 4JB9L 1UD3A 4LLUA 4Y7OC 1CGVA 2KI6A 4LKCA 1MQKH 1OOAA 3QR1A 2OMTA 4Q52A 2Y5EA 5IMLB 1FIEA 3PAVA 4W9IC 2MNWA 1Q0YL 5IY5B 3CDZB 2VLRE 3MCG1 1QA9A 1S3KL 4PSPA 4YIQB 1H3WM 4IRJB 3RKPA 5C0RL 3GIVA 1N19A 3Q48A 1QLEL 2H2PD 1OP4A 4JS7A 3NPZB 5TJWK 3S7GA 1RY7B 4BV1A 4PRHE 4GI8A 3MV11 4M1CD 4POZD 3ZKXC 2CO6A 3WEOA 5D5ME 3U7YL 4D0DB 2DKSA 1OWRM 1KBPA 2AXGB 1EZVX 3MO1B 4JGJA 5TF1H 2XFXA 2NNXA 4P23B 4XVUC 1CFSB 2DI8A 4MJID 4X8GA 1MWAL 2XX0A 5GGUB 3X3FH 3X12B 5IHBA 3BT2L 2XETA 5CD5D 1U92B 4LASH 3VTAA 3BGMA 2VN4A 2Z65C 4HOZA 1BIHA 3HG0A 5K9JH 5T1MB 4F33A 2NNRA 5IB5B 3VGDA 2WNXA 5E94A 2CRIA 3PJLA 4UIKH 5EORL 4IU2B 4HFWB 5CEZE 3APFA 3T5WA 2DQGH 1UD5A 2WP3T 3JV5A 1H15B 1P4LB 3IMSA 3UYPB 4WI0B 1URIA 4LB8A 3T0EA 4UNIA 2AJZB 4M6OH 3TIDB 3DBSA 2QKIB 4AYFA 1MLCA 4XODA 1KXQA 1MXGA 5DJZA 1T03H 4L37B 4OJYA 5SWZD 4L9LA 3VXOB 2V7HA 2WCPA 5FLVA 1MLBB 1FZMA 5GS3A 3LZRA 3QDJB 5CZKA 3FCBA 1KTRL 1URLA 3ATAA 3FBQA 1P4BL 3KXFE 5AW6B 3DO3A 3KCWA 3N85H 4QT5B 5KVDH 5DRWA 5EZJB 2G5UA 5I1CH 4PJHA 3ME0B 3BZFB 2XJLA 5IBTL 2JXMA 3P77B 1YHPA 3QDGA 1NGPH 4I5BA 5DZ9A 4XTRC 1DBAH 4LHUG 5AVSB 3WSQH 2Q76A 2CGRL 4UF7C 4HALA 3D39A 1BAWA 1C1EL 4R7NB 5FW7A 1NQBA 1JRHL 1X7QB 3O3EA 1JNLH 4B53A 4WFEE 1FHNA 2VN3A 1RIVL 1EO8H 1M7IB 4QHPA 4EZMA 2AGJH 1U2CA 3DUHA 1CD1A 4O4YL 1JOIA 4MCZB 4N5ED 3ZPDA 3VXUE 1EO7A 1MFAH 3TX4A 5H4YA 1B0IA 4NM8L 1WVZA 2FWLB 3GMOB 4HHAA 3WU1A 5HVHC 1Z3GH 2AJVL 3GB7A 1AXTH 1BYPA 2AVGA 5JW4Q 5EU3A 4KV5E 2OMYB 1JFQL 2WXLA 3GBNH 5C0IA 1IAII 2G2RB 2B77A 2OL3L 4WI6A 4NN7B 3QNZB 1RZQA 1W72H 4Z7VB 3BDYL 2P5ED 2UX7A 4KVPA 2YWYA 1Z9PA 3SE9H 4Z23A 1VCAA 3G08B 4Z3JA 2B9BA 3QFJE 1DVXA 2HMID 4Y8AA 1NCGA 1ZS8A 1JZJA 3CFMA 3U1QA 5LGHL 4R4FH 4NRXB 1MHHB 2BOCA 3PGFL 2A7BA 4YDNA 3FO1A 5D7LD 1T04B 5IQMA 5CINH 2HJLB 2RR3A 1VACB 2A74B 1A8JH 1MFBH 2Q8AH 4I8DA 1RMFL 4LQFL 1XR8B 2PWDA 2AMGA 5F3FA 1MH5A 1Y18A 3U30C 2UX6A 3MV8B 5LGJB 3T65A 3V5DB 4LGPB 4HJ0D 1J9QA 4DFHA 2JVUA 3UX9B 2ZUQC 4G7VL 2COQA 3WLBA 1KLFB 4B9YA 1NMBH 3EYOA 2EO7A 1G4RA 4HC1H 2AQQA 4XMLL 1TCRA 4GMTL 1ZK9A 3QG7H 3IJHA 2Y24A 1QD0A 2OSYA 3AQDA 3ESUF 3HE7D 4GBXA 3IWVA 3MROB 3QQXA 2Y4SA 1WAAF 3BW9A 1EBPA 1IILE 4NB7A 3B6SA 3WNPA 2WXMA 5C0BA 1KBVA 5FHAH 2J4WL 2W1NA 2JJWA 4NNPH 5ICZA 3V0IA 3QHTC 5HYQA 3AXLB 1OM3H 1FNGB 2WMPB 3SOBH 3TO4C 1WICA 1BP3B 2XG5B 3QO1A 5TFSL 3G5VB 4GG6F 3TV3H 1LK3H 2F7QA 3A6CL 5JNYA 2P5PA 1RZ7L 1OGAA 2GIXA 1YY9D 3GI9H 5G4MA 1UACL 5AG9A 4WI3A 1NIAA 5F1NB 3DRTB 4WTQA 5H37A 3QUMB 3DMMD 2LU7A 2X09A 1JK9A 1E65A 1FNLA 1X5LA 4R84A 3AWGA 1DDHB 4I2XB 1GOHA 2ATKA 3OWRA 3LXBA 3O3AB 5IV2B 5IREA 2WKOA 3NSCA 2UUDH 4KMQA 4KPHH 2NY2B 1YEFL 2QVTA 1CE1L 3CC5B 3ILPB 5KVDE 1IM3D 5JHBA 3CDZA 4DP9X 5AYUH 2E75C 2W0LA 5L6YH 2ALAA 3QCUL 1FP5A 4BFKA 4PJIB 4S0HA 3LPPA 1LMKA 3U46A 2E7DA 4WFGE 1SHMA 1ETB1 2B5IB 4M43H 4I3SH 5D7JB 5HDBE 2R56H 2Y7MA 1DZBA 1UM5H 2WAHA 2HUHA 5F1SA 4NWTL 4U6TA 1HTYA 2YQ3A 4URTB 5FWQA 1MFUA 3ZL4L 3E2HB 4K2UH 5I1HL 4D0DA 1QATA 1JXKA 2W9DL 1UOLA 3QZOA 1OV8A 1QTSA 2AXGA 2O6EA 3RWCB 1V7ML 3FN0L 1MJUL 4P23A 1CFSA 5FYLL 3G9VA 5GISL 2AQRA 2VISB 4W9ZA 2WKGA 5GGUA 3GO1H 3X12A 3ARDC 1LWRA 1JZ3A 3ZDWA 1U92A 5MENE 3B7SA 4G72B 4CW1A 3BMVA 1U8QB 2DDQH 1QVOA 2MOVA 4KWUA 4EOWL 2N59A 4GUCA 4BFNA 3EKCA 4JFTA 2VR8A 2WQWA 4B9GA 5T1MA 4B5ZA 1QFUH 3PDGA 1GIGH 3GGWB 5IB5A 1O7DE 1GKEA 1NICA 4Y9EA 4FMVA 3IJYB 3IJ9A 4YDKH 4IU2A 3SPVB 2HRPL 2PLTA 4YHNA 1ULVA 3EGXB 2PO6D 5D6CB 1H15A 5AUMB 5FGCB 2P43B 2HRLA 4WI0A 2YZ8A 3TIDA 3SGJA 2QKIA 3MRJB 4JDTL 5C08E 3FQYA 3GPSA 2NTFB 2AV7B 1PLCA 5BRQA 1DJXA 4HS3B 3O6LH 2VZ3A 3DUUB 3RL2B 2AJXH 1NWPA 2R69H 1MLBA 2C1PB 3FSWA 3DROB 1I9IH 3QDJA 4PGDB 4TUKL 1OCZB 3OZ9H 1P9MA 2TRYA 2ZF8A 4QT5A 5EZJA 3A6OA 1T2JA 3OAZK 3ULVL 2MPVA 3ME0A 3BZFA 1X5ZA 3P77A 3QA3B 1CS6A 1V3MA 5DFTA 3FB5B 4FNLL 4TULH 4I77L 4GQQA 4FABH 2E59A 5TQ2H 3FU8A 2ZXCA 4R7NA 2LV4A 1N68A 1AG6A 3STBA 4WK4B 5D1XB 4BZ1A 1M7DB 1X7QA 2ILLA 3FTGB 3BAYA 3OB8A 2NY6C 4XX1G 1PG7H 1KTCA 3QSKB 5DJXB 5FX3A 1XGUB 4PJAA 3PP4L 2YXFA 4AZ8B 3MLXL 4E41E 2FIRT 4MCZA 3IBEA 5IVXF 3GIZH 4XNQA 2J5LB 1XIWC 1NGWB 1UXWB 3GMOA 3OPUA 1EGJL 4GP4B 4HISA 3J07A 3WN6A 3KJ6L 32C2B 4W6XB 1KEMH 2OMYA 2G2RA 3ARTA 2E27H 3D50A 3F85A 4Z7VA 4X0KB 3ZVVA 2WBKA 1I3RB 3BZ5A 4Y9GA 1SEQL 1XSKA 5CIPB 1SOXA 2HZHA 3VH8B 1EDQA 2E86A 5GS2H 2P80D 4LOFA 5JOPE 3UMNA 5LQBH 1MOEA 1PG7X 4UQ2A 4NRXA 4HPOH 1MHHA 2K6ZA 5JMOC 1KFAH 1T04A 3EDKA 1OIOA 4GKNB 3VD3A 5IB2B 4JKWA 2BDNH 2A9MH 1VACA 2GY7B 2A74A 3ULUF 4XNDA 2XQYK 2WINB 4UT6A 1SXNA 1P1ZA 1XR8A 2A4EA 4ODSH 5EOCH 4XNYH 4G7RB 3MCKB 1RQ5A 3MV8A 3IWUA 3QIBC 4TMPA 5I0WA 4XWOC 4FS0A 2GI0A 2OXHB 5I15L 1H6UA 2DQ6A 3P0VL 3MYJB 3TJHC 4MDIB 1KLFA 1FYHB 2DW5A 3C6LD 3QXTA 5B8CB 2J55A 4IRJD 1IZKA 3MROA 3UADA 1MVUB 1N64H 2Y7SA 4V33A 3ATFA 5D4HA 3S3PA 5E23A 4V2CB 1Z2KA 1U41A 3N06B 1MF2H 1BZOA 3NJLA 2BSEA 4GW5B 5IROD 3BZDA 1U30A 4RAHA 1W80A 1M2VB 4NWUH 5LB1A 2WLHA 2WMPA 3BVNB 2XG5A 4H8WL 4JANB 1DJIA 1AGCB 1QBML 3PHQB 4P2QB 5DVNA 1VDGA 4QJ4B 1DSFL 1DANU 1QR1A 2CHZA 3PL6B 1QYGL 4KXDA 3HMXH 5F1NA 4LVEA 4RMSA 2P4AB 1RZFH 3QUMA 4YQXH 1MFNA 2YXWA 4TSCL 4K7PL 2QHRH 1DDHA 3QHZL 3O3AA 5IV2A 3VXRE 5E2UH 3T0AA 1OCCB 1DBJH 2X2UA 5EEXA 4XP5L 1LJMA 1DVSA 4N85A 3KWTA 5F21B 3WNLA 2P8LB 3FO0L 1WWBX 2R1YA 4U1KB 4R8WH 4NHCH 1LQSR 4JHWH 1SBBA 2NDGA 4PJIA 3QCVL 5EU7C 4OCXH 4HXBH 4OQ1A 1J5OH 2X1PA 3RGVB 3TURA 5EC1B 2BNQD 4PGBB 3KYKL 4JHAL 4PLKC 1THAA 4FYTA 3RI5F 2P24B 3PV6A 1NGXB 2WXIA 2I9LB 3VDAA 4TVUA 4ZMQA 4FG2A 4XRCA 3KW8A 4WWPA 3OB0H 3LN5B 4JPWH 1EIBA 3QEQA 4NBXB 1CU4H 5D4IA 4PJ9C 5EC2B 3I6LD 1T1WB 1Y0LB 5IUCA 1TTUA 1A3ZA 4CVWA 3MU3A 4XN4A 1U8QA 1NBYA 5K39B 1YEIH 1TVHB 3ZDYF 4FXLA 4OR1A 1A1NA 2C9UA 3VWJB 4QUOA 1W91A 5JO5B 5I6KA 3GEFA 3GGWA 4JKNA 4ZBJA 4RNRB 5I1KL 4XWGH 4YSTA 3SPVA 4GINA 3CIAA 5EZIH 4Z78B 3I9GL 4MZ2A 2ZXQA 5AUMA 1RIHH 2VDMH 1AQKL 3MRJA 3FL7A 2XWEA 3HRZC 2XT1B 2AV7A 2DJUA 2RB8A 3FO2B 4UWQB 1S9WA 4HS3A 3POHA 3KDMB 3RL2A 5JPNB 3C75A 2C1PA 3RPBA 4IOSD 3C5JB 3DROA 4HPHA 3D33A 4YEEA 1IRAY 3T0DA 4Z8FL 5D5MB 1ZLSL 4LVNC 2JB5H 2X2YA 1TPXC 2H0FA 3IJEB 3QXDA 2BIIA 1L6PA 2PCPB 1ROCA 1UOKA 4M6ML 1DSWA 4AYBA 2BRQA 4M1DL 1TT6A 3QA3A 1NAMB 5FUZL 5AB1A 3FB5A 5ESAB 1YUHB 3MRHA 1QFPA 2D0FA 2VDPH 1JIBA 1ACXA 2VL4A 3CU7A 1ETA1 1HL5A 4M03A 1PL3A 1M7DA 2H1PL 5CZVH 3S5ZA 3G6DH 2CXKA 4N9OB 4U1IB 5FYKU 2NY4B 1RK1B 5DTFA 1GH7A 5HGDB 1RZGA 3DWTA 5DJXA 3WBDA 2HX8A 1WAEA 1T2QL 1JDAA 4AZ8A 5CBAA 2BM3A 4JKMA 1NDGB 2QPSA 1MFVA 1SEBB 5AQ0A 1X5AA 3CPUA 4BCXA 4GO9A 1NGWA 1UXWA 2JI3A 2YOCA 1KLUB 3U6RB 2EXSA 2RCSH 4PVLA 4XBGA 3S88L 2VMDA 4R26H 3DHJA 3HAEG 4H1LG 1SQ2N 2WSPA 1T1XA 3VMOA 1KENH 2D0HA 4ELME 2C3VA 3F3HA 2ZUVA 4QHMB 3L3DB 4XN9A 5I28A 1N7MH 1MAJA 3KXFB 3II2A 2QFPA 1AGFB 4X0KA 5A7EA 3TFKD 1I3RA 3MSPA 5CIPA 1Z1WA 3AM8A 3CFTA 2GY5A 3NIFF 1D6EA 4GW1B 1QKZH 3OM3B 35C8L 2VERA 4B0MM 3ZJAA 2OQJB 2PNDA 2P42B 1IAIM 1SOSA 4UM9D 1TITA 4UTAL 3HS0C 2FATL 4GO8A 4W9CC 3RA7L 5E4EB 5T33H 3SPGA 1LGVA 5IIEB 2DBJA 2BSRB 4AE1A 2C7UB 4X0NA 1WZLA 1CC3A 4AK2A 4NQDD 3KLSA 2OYKA 2WZ0A 3EUUA 2M2DA 2VQ4A 1G7QB 1GL4B 4PI2A 3VXUB 3MACL 3K6OA 1UT9A 4MDIA 3W2DL 4LRNH 4P5TB 2CR3A 4IJ3B 3I2CL 3N2JA 1UJ3C 1RJYB 5B8CA 1XH3B 1GY1A 1OP5K 1MFEH 3LEYH 1MVUA 4FZEH 3WS6C 3AG4B 4PWEA 2RQEA 1M7XA 1I1CA 3BO8B 3KLHC 1EJFA 5D1QD 2PYEB 5IVZB 2AK4D 4P2YA 3NPSC 1TEYA 2FZ3B 4LL4A 1WZ1L 4GW5A 1R0AL 5D7JD 2MQ0A 1GC1C 4HBCH 4NJ9L 1HNYA 2XFGB 3BPLB 3EYUH 4A6YL 4F1SA 3BVNA 3BX7C 2Q7AA 4JANA 3O4LE 1AGCA 2F8XC 1B0GB 1J1PL 3VXSE 3PHQA 3GLEA 4NQQA 2VB5A 3VI3A 4EDWH 2LHAA 5MHSE 3ZK0A 4M7ZC 3PL6A 5FR3A 3GSXB 2IANE 2NY3B 3U9WA 2CHNA 2XZAH 4I9WD 4N22A 1UT2A 2R59A 3G9AB 2LFEA 5B38G 3KHQA 1A6PA 3UH8A 4Y2DA 1DLFL 3S98A 4BUQA 5MEOB 5BS0E 5I9QB 4UOW1 3EO9H 3UBHA 5D70H 5TK4A 2WBXA 2IADB 3U7WL 4FEIA 2XWBA 1DFBL 2P8LA 4LAQL 4XVJL 5EHFA 4HWBA 4TL5A 2CCLA 2ZJSL 4U1NA 2DN7A 2ROYA 1BVZA 3MBWB 5IJKA 2FJHB 2E4TA 1IQDB 4POUB 4LCWA 4JG5A 2NY0B 3JSSA 4PGBA 4ZPVB 4F7KA 5ACLA 1FYTB 3KWVA 2JKXA 2P24A 4N0UE 4U3HA 3T8XB 2I9LA 1UWXH 2F5AH 1ZHBB 3LIZL 3RTLA 1I8UA 1CGYA 2ZXBA 4PR5B 3LN5A 1P2CB 4CSSA 3AY4A 4KJPC 1ZLUH 3MLSL 1L9MA 3R7QA 3KE0A 2H6OA 5F7WC 1Y0LA 4N6QA 5H2BA 3QORB 3BDBA 1DN2A 4KKZA 2J57A 1ID2A 5C92A 4ZS6D 1MJ8L 3TVMA 5I19H 1A4KB 2TSAA 1JGIA 4P0DA 3GSQA 3VWJA 4NX0A 5C97A 2MCPL 5JO5A 4FXKB 1ZIAA 3RVUC 5ICYB 3KS0H 4RNRA 1JYWA 3II3A 4FFVD 4PS4H 4PJDE 3AXIA 4LHUA 1NFKA 43C9B 4Z78A 2YA2A 3QEGL 5ITBL 4M3KB 2ZNWA 1EWHA 1II4E 1P84K 1IUZA 4YHKH 4AUUA 4I85A 1JGEB 5HI4D 4R5TA 4ZW6A 2W8CA 4D9LL 5KYWB 2R4SH 4UTBH 1P6AB 1HNFA 3AT8A 3A3YB 5HDBB 3KDMA 1NCCL 4HWEL 4UB0H 5JPNA 5F9JA 3WENA 2CALA 2E9BA 2JCCF 1ZOXA 5T3ZD 4WTXA 1IT9L 3JBG7 1TNNA 1LO5B 3IJEA 2PCPA 4ENEC 3ABGA 2D7QA 4MCMA 3P3TA 5DC9B 1IGIH 2ERJC 3ZR5A 1UT1A 2NZ9D 2WKLA 3LB6C 1NAMA 5MENB 2X0VA 5ESAA 2DS4A 1U3HB 3KNBB 5KSBF 1W72B 4PJBE 1TUPA 2IDQA 3M8OL 3ISWA 3MNZB 5HHPB 5LCVH 1G9NC 3S8GB 4IOFC 5FFLA 1RK1A 5HGDA 4UYQA 4X4ZA 4IGBD 4K8RD 2DQHH 5CJOH 1G7HB 4QRRA 1G7MB 2J88H 3FTSA 3HS9A 4XE5B 4PJFF 1W2KT 3PNWB 4WV1C 3U48A 4CBZA 2ALWA 3FNKA 1SEBA 4ZUUB 1CR9L 3FULA 2W9EL 1KLUA 3U6RA 4X7DC 3VMPA 3P9WB 3GRWL 1C5DA 5BUGA 2ADIA 1IAOB 1RD6A 2VJ0A 5GGVL 3EFOB 4PWGA 5DWPA 3EH5B 3RHWK 2QQKL 1J8SA 3L3DA 2F9BT 4GAJH 1NGQH 1AGFA 1FO0H 1Z0MA 2C3WA 3QEHB 2ADYA 5J13C 4GW1A 5E08H 1CXEA 1U8KB 3FCSB 3BPNB 3NK3A 3ASOB 4LPXA 3T3PE 5EU7E 2X6VA 1ODAA 2OQJA 5KZCD 4M6NH 3UJJH 1OO2A 5E6YA 4I0PB 3NZ8B 4YHOL 3MFGB 1I82A 3TWCH 1HWHB 1GGIL 1A7BA 1G87A 5IIEA 2ARJB 1Z9SB 3A6BH 3D9AL 3JVGA 2C7UA 3QIWC 3IDUA 1UA7A 3ASNB 2CNYA 1XBRA 1CICC 1KB5L 2GC4C 1BVKB 4EZLA 3WNOA 1RZKH 1U6AH 3K6FA 1LK2B 4QOKD 1G7QA 3Q9PA 3UXFA 4D9RD 3VXUA 5DD1H 5DJDA 3BVTA 3D7PA 3GZQA 5G4NA 4Z3IA 1RJYA 1XH3A 2OA9A 2DLIA 3FB6B 1NCDH 1OOWA 2DLGA 2J56A 2QZQA 3MUGB 4HLZH 3IDXL 3BO8A 2PYEA 5IVZA 3Q2CA 2WNWA 3CZSA 1UZGA 4JVUA 4XZUB 4Y5YC 3ETSA 1ZLWH 1C12B 2FZ3A 3L6FA 1CDHA 4NOFA 3NIDF 1TKWA 3GEWB 1G5AA 3UOAB 3CGTA 5T5FA 3LEXB 1KY6A 2YAFA 2FD6L 4FQ1H 4HP5A 2GSGA 3WNNA 1OANA 3ARGD 1S7TA 4U7KA 3UBXG 3GD1C 4IEFB 1AR2A 2D7NA 1NMCC 2GJPA 5KSAC 3GSXA 3NSFA 4RFEB 2IG2H 4NKMB 3LH8A 4LNRB 5FYKD 3SPHA 3ZKXB 2ZOWA 4POYA 4K3HA 7PCYA 3GXIA 3UYRH 3O9WD 4OI7A 3MMEB 5KTEH 4BZYA 3P0YH 2YD0A 3NCCB 5IHUL 3CLFH 4AYDC 3DX9A 3NCFB 3P3YA 4PVBA 2Y2TA 1G1KA 4KK5D 3GZPA 4U4IA 3FSAA 4DPCX 2FQEA 4CGUB 2VLRD 2CLRB 2VABB 3S96B 5BXFA 1DCLA 1VZIA 5IVOA 2QV2A 4UBDD 3MBWA 4DK5A 2UZYB 2MKWA 2E9JA 1H8OA 1IQDA 4KKCC 1JD9A 2DH3A 1U8NB 4K5PA 3ZZ1A 5CKAA 4LPUA 4ZPVA 5I1GH 4G82A 1E3ZA 2Y7NA 3O41B 4PRHD 1FYTA 2OMXA 1KB9J 1XEUA 2MRYA 3T8XA 1PY9A 4ETQB 3QJHB 4N8UA 5BZWA 2DLFL 1ZHBA 2VIRB 4AQ1B 4DTGL 4YHLL 1GHFL 1U8HB 4PR5A 5HDLA 1J5CA 1P2CA 3LTVA 4ZMNA 2VQ1B 1WT5C 3ZDZF 1NFDF 4U1GC 2FK9A 1YY8B 1JCVA 5FIEA 1Q38A 2PW1B 2WLJA 3QAZB 1KGCE 2Y3AA 3QORA 4UU9B 4W93A 1MREH 2WD0A 1VERA 3RWHB 3OVUB 3GKZA 4OH2A 3KH3A 5DMGD 3P73B 1A4KA 3VGBA 3VXRB 3BAIA 4ZFZA 2EUZA 1F2XK 3FMGH 4S1SL 1F45A 5DK0B 4U6VL 3F8UB 3SE6A 1KGWA 2MTPA 3NYKA 1ZA6B 4X9BA 1SOQA 1PFCA 15C8H 2OLDA 4JO4L 5JIHA 43C9A 4FFWC 1S5IH 4LLAA 2X89A 2HCZX 5K1JA 3ZE2F 2OR7A 1IC5H 4HAFA 5F96L 1CF8H 1FH5L 2VMEA 4BWTA 1NUNB 3ET9F 1KLGA 1JGEA 2A38A 4PJEE 4HFUH 4H25A 4ODXA 4CKVX 3VSQA 3F6LA 1J9TA 1AAJA 2BP3A 2P5WB 3LRHA 4JO5A 3K6SB 2VR4A 2DQFB 4FQJL 4YH6A 4HU8A 2GTZB 4ZXBB 4P2OD 2F53E 4QGYA 5C6PB 1KJMB 1LO5A 1OB0A 1E9PB 4P46B 4KVCL 4X6CF 2A1WH 4UQDA 1IAIL 1AR1B 2CLZA 4DN4H 5C0FB 1FRGH 4B3VA 4RZKA 5DYOB 4TPRL 3E9TA 3VXTB 5KVEL 5ILTH 4FJYA 3BN3B 4M56A 5CN2A 3VFMB 3QDAA 4N2EA 4OCRH 4HEPG 2FJSA 2X5PA 4MXWL 5D1ZC 1G9NH 2PTTB 4EI5D 1I7UB 2H0EA 4MAYD 5A16A 1KXVC 1W72A 5L2KE 3ML9A 2BZ7A 3MNZA 1RFDL 4WFED 5HHVH 5HHPA 5JORB 1E28B 2FWOB 1G7HA 4JG0H 1G7MA 2YSSA 5DZVA 5E8NB 3QULA 4ZQKB 4N2AA 3PNWA 1HXYB 1R24B 2Q3ZA 3IMBA 1KN4H 4ZUUA 4AQ8C 4KK6C 1MRFL 1MFMA 4H0LC 1R1CA 3RVXC 4Z7NF 2YEVB 3MA9L 3GHEH 3Q01A 3U4BL 5AOJA 2DIBA 1IAOA 3PJSA 4S1RL 1ETZB 3EFOA 3TN0B 4D8PB 4CC1A 3P3UA 4TNEA 1R19A 2OK0L 2X41A 2KLSA 3PXJA 2FT7A 4YDVB 3LEVL 1JF5A 5CCHE 1E50A 3W5MA 1SHSA 4K3DH 2D03H 1U8KA 3FCSA 3PP3H 5EZLB 2IH3B 3S35L 2EDQA 5CLYA 3SQBA 3LN9A 3QFJD 2WSKA 2O6CA 3VFTB 4HS6A 2DMHA 2X12A 3SDDD 4I0PA 2FNBA 1ZSDB 1OAKH 3L3GB 1KJVB 3E1ZA 2O6PA 1Z9SA 2HYMA 3QRGH 1VLXA 4LLDB 5K9KB 3ZZQA 4AGPA 1KSRA 2VLKE 3H0TB 5BW7C 1A66A 3T4YB 4OJEH 1BVKA 3OHXC 4FQCL 2OSWA 3VXPB 1LK2A 1A21A 3T6WA 5F7LB 5DVLA 2WO4A 3ROLB 1A9EB 1N2RB 3MUHL 4CJ0A 5J3HD 3HG1E 4Q89A 3D85A 2DL9A 5KBDA 5GSVA 5B38B 2CO3A 5KVMC 4MXVF 4TQ8A 1I1AD 1AQ8A 5IB3B 4MYPA 3MUGA 4P9HH 4LSUH 3QI9B 5B4MD 4YR6A 4ODUA 5DMYA 3RVWD 4ELMB 3FT3A 3ALWA 4H8VA 4QO1A 4YFLF 4EIBA 1FFQA 4ONFH 4OLUL 2G9HA 1HC1A 3H6JA 3QAQA 1HZHH 1BQ5A 1OAXL 1T21B 2F1AA 4HG4J 5C8JB 4KRPD 3D48R 3HHRB 5E95B 1GPOL 3EDFA 4KTEH 5BOPA 1TJMA 4B7IA 4HOMA 1I9RL 5IQNA 4IEFA 4FQIH 4P2RD 3VSUA 1F4YH 2EABA 3B2VL 4XB3A 4RFEA 4NKMA 1JPFB 3FB7B 4PJ5B 4BYHA 1X5MA 2L4OA 2XV3A 3FT1A 1WAAA 2J25A 1JXDA 2ZXWB 2BNRA 5EN2B 2Z4QA 3MMEA 3B7RL 2D3VA 4AIZB 1WZMA 1PNCA 4N2HA 4PD4J 2YGQA 1W16A 3UTSE 2AQTA 2CLRA 4OJFH 2VABA 1ROWA 2LLNA 3V4VH 4GMSL 4IM8A 2ZKHL 1HFUA 3B8YA 1YEGL 1JYXA 4NGHL 2UZYA 1U8NA 1CO1A 4W4OA 4WFGD 2N1KA 5T3ZL 3VG0L 3O41A 1Q0XH 3A67L 4C4BA 4ETQA 3QJHA 4LU5L 5EZOL 3EFDL 3H9ZA 3NIGE 4KK9D 3WN5C 4AQ1A 4RBPH 4IBYA 4JY4B 1U8HA 3D6GA 3O4LB 1NCAH 4M7KL 3FQ4A 2HVJB 2HG0A 2VQ1A 1T1YB 1D5IH 2VDMB 4NQTA 4PJXF 1VB9A 4W6WB 2CJSA 3CH1B 1CDYA 4JRXD 2XBZA 1YY8A 1N6QL 2PW1A 2IANB 3L7FA 5J6GB 2JLPA 3RWHA 4IHOB 4X7CC 5KBKA 5DT1H 3OXSB 3PWVB 3P73A 4Z0XB 1FIGL 4K8RL 5DK0A