2IO5A

Crystal structure of the cia- histone h3-h4 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
154
structure length
154
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1A protein
publication title Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/structural protein
total genus 28
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2io5A00
5BO0D 5C3IA 2IIJA 2HUEA 1WG3A 2CU9A 1TEYA 4ZBJA 2DZEA 5BNXD 2Z3FA 5EIIG 2IDCA 4EO5A 1ROCA 2I32A 2Z34A 2YGVA 2IO5A 3AADB 4RRPM
chains in the Genus database with same CATH superfamily
2O6FA 2VUKA 4JQXC 4ZW3A 2B8OT 1WK0A 2X0VA 1NFDF 5EIQA 3S4SG 5I1AA 2QPSA 3PAUA 3GRWH 4GSUA 1T6VN 4BD4A 1WWAX 3CDZB 1G9NC 2WSPA 5KVEH 4YDJA 4W9DC 3QZOA 2LLGA 1G7LB 4WO4D 4GG6B 2IVFC 1K9TA 4L37A 3IVKB 5GGVL 5HYFA 1M4KA 1WFUA 2OYKA 5J1TC 1U3HA 2CDEA 2LV4A 3QORA 1I1AC 3W56A 3T2QA 2QTEA 3N04A 2C9QA 2F54A 2VRKA 3HUJE 4KUCF 4K2UL 4NNXB 4N0UA 1XGTB 4Y4FA 4ZTEA 4TVPL 5AW5B 5I8KH 2ARJB 4OZIB 2ETWA 1TZGH 4PJEF 2DYSB 5TE6L 2TRHA 2XWEA 4EKJA 5BS0E 1QSFB 1XF2A 5GGRA 3MV8D 5EU6E 1R3IH 1ERNA 2J8UA 3ZDYB 3VH8A 1G0DA 3F05A 2JKRM 1RUAH 4LLAA 1EHNA 3IU4L 5JOPD 1E4WL 1W72H 2JTYA 4GS7C 1OAJA 3TTSA 1S7TB 2BWQA 1FNLA 4R97C 1J8HE 3T3ME 4GMSH 3RY4A 4S1DD 2CM6A 5GRJL 3NIDE 4ORZC 3SDYH 5CEZD 1XXDC 5D96B 5EORH 4DW2L 4OCSH 3DDGA 1B0GB 1MFEH 1AR1B 1IL1B 2Z31C 3QEUB 1SY6A 3OHXA 4QGYA 1UWFA 2XT1B 2OCCB 3FUNA 5LBVA 1KJMA 1EK3A 4PSRA 3ARGA 5D7JB 2DJ4A 2N7SA 2VQ1A 5CD3B 4N5UA 4WK4B 4ZNEA 1WJ3A 4N68A 3GSRA 5MENB 3T0EA 3MACL 4QXWA 4S2SB 3T1WA 4A7UA 1HH9B 1MKFA 2X4NB 1KTJA 2QVFB 4Z23A 5CJQH 3IU3A 3N6YA 4L3EE 2WVTA 5DK0B 1E43A 1WF5A 1P1VA 2YK1L 4FQXC 4Q9QH 4FX5A 2FO8A 4ONGL 4QNPE 1ECYA 4ODUB 5GIRB 4PD4J 1IAKB 5GJTL 1DBML 4I5BA 1LP9A 3LZQA 4MMYA 1F3JB 1FN4B 4GSQA 4H0GA 5F6HI 5HGHA 1AKPA 1PAZA 2ADIB 2FUTA 5DUBA 5AZUA 5DC0A 5C70A 2EC9U 4HMEA 1QAWA 4J3OD 3ZXAC 1S5HA 3VFUA 3DXAD 4DETA 3NOIA 3CVHB 1JTOA 4GRMA 4CSTA 1IBHA 5DTFB 2NUPA 3BH9A 4HH9A 1ANUA 1TNNA 1MVUB 1N59A 3L4XA 1U92B 4TRPL 5DHYA 4WCYL 4PB9L 5IJVA 5ID1A 2ORBH 2YZ1A 4IBUA 3A4EA 2A74C 1I31A 2BP3A 1ETJA 2GSGB 3OTTA 4XXCC 4Z7VA 3FCTA 4PGEA 4OGQC 4XCFH 3VSUA 1JV2A 5DRNA 4IRJB 3UIZA 3QULB 3ECBB 5E6IA 4N6RA 3P9WB 2WQVA 4JPKH 3N9GL 3B3IB 4LHJB 1MFUA 1TKWA 1JZ5A 2D7QA 2WIIA 1IM9D 3UX9B 3QUKA 4HXAH 4CNIB 3WXWH 3ABLB 2DIEA 2ZYSA 4UYQA 1AKJD 2GBVA 5KG9B 2B20A 5EZLB 2JXMA 3MV8E 4CC4C 1X5YA 4Y16A 2ZCLL 3B7TA 2IQAB 1XQ4A 3HI5L 1RULH 5JOPE 5D1QA 3NSCA 3O4LD 2OA9A 1THCA 3UO1L 5D2LB 2PO6B 3PWPB 4Q6IC 1LE5A 4H5SA 3F5WA 2F53B 1X7QA 4EIGB 4P5KB 1XD1A 4UT6H 4NO5A 4P9ML 5CEZE 1KJ2L 2W60B 3QIWA 1MSPA 2XWTB 4XOAA 1T1ZA 1ZK9A 3O2DH 5FO7B 3O6KL 3TYFA 3GYRA 5ILTL 4HPYH 1RZQA 1X6LA 3V52H 2GJ6B 3RTLA 1AGCA 1E9OA 3QUZA 1F6FB 1TEFA 2DEXX 4JRXD 2HN7A 4NIKB 3T77B 3BAEL 2XVLA 1J05B 2R9HC 5EO9B 2MCMA 3LRKA 3LPOA 1SM3L 3MRHB 2B4CL 1HJBC 3C2AL 3L16A 2DD8L 3C9NB 4HG4J 3DHJA 5DHMC 4LSUL 2XOTA 4ZG1A 2EIEA 4IKKA 5FW8A 4K7FA 2K70A 5F9JB 2YXVA 4PR5A 2XICA 3PYCA 3QIBC 3UAJC 3VB8A 5K1VA 4JX0A 1AQMA 3VSQA 1KB9K 4PJ7F 5E0FA 2ZOLB 3KLDA 3JQOB 2VLKD 1U58B 2IDTA 2ZICA 4Q9RL 4OGAC 5F0PB 4MCZA 1U95B 2B08A 1JN6B 2I07B 3IRCA 3IXAA 1CFQA 3U30B 3VFWB 3DXAE 3FSAA 1I1FA 1WT5C 1I1AD 2UY6A 2IQ9L 2ZWLT 2YR3A 4MD0A 1SJEB 1AHKA 2ADGA 2NY5C 4H40A 4AIZA 1VPOL 4H8PA 4K0OA 2HG5A 1JF6A 2OMZA 3PJLA 4NLAA 1EH9A 4TLKA 1UWEH 3ZO9A 2BSDA 4K23L 2EKSB 1JS4A 2YXMA 4KUCD 5I6XB 4URKA 3EAKA 5FFLA 3JTSA 4IQHA 4PJHF 3TFBA 3SGKC 3JWDH 5H4ZA 4M5YH 2OMWB 4BSVB 1LEGA 1HYSD 3QR1A 3GKWH 1XIWB 3ZE0E 3I02A 4PJDB 4AT6A 5HD8C 1KJVB 1BZ7A 5EULV 4I1PA 3IJEA 4UOW0 4RRPG 5MEOA 1G7QA 4I9WD 2BIMA 4LPWA 5DGRA 1L9QA 4OZHF 3FL7A 4MXWH 1NBYA 1KBVA 4YSDA 4Z3EA 1G5GA 1OAXL 3MMEA 1BZ9B 5EZIL 1Q90A 1CTOA 1PY9A 2J20A 2DQCL 4OF7A 2R27A 1ZVSA 2AXGA 1KTLB 4R2GC 3H56A 4WHTB 1E9PA 4G70B 4LCIH 3T09A 3VGBA 2CK0L 5IHZA 4PGDA 3TCLA 2QQLL 4P2OD 2R8SH 1N68A 2FH8A 3IPEA 5I5JA 1KTKE 5I30H 2C9XA 3O4LE 3BPLC 4Q6IA 4FQXD 1CL7I 2JI3A 2YOAA 2DQUH 4ZMQA 4R26L 2XJKA 4JY4B 1WDAA 2YRLA 2K7PA 4X6FA 4D9RD 2WUBH 1AZNA 1RFDH 4NPJA 3VWKA 2AEQH 4PTUB 3QVAA 3QFJA 1QW9A 4FQ1L 4F15B 5I18L 1BWWA 4B5ZA 4U3XA 3WS6C 3BVNA 2FWOA 3IKKA 4HFWB 1F45A 1USZA 3P0VH 4PG2C 3DUHA 1ZMYA 5EZJA 3Q5OA 1TYRA 3QR2A 4LLQB 2FR4B 2TSBA 4FFYH 2YWYA 2XTJC 3IKCB 2LQRA 3C87A 2CALA 3FRPA 5C3LD 1U91B 1TZHA 1Q9OA 3DX1A 1VA9A 2EIJB 3INUH 5I8OL 1TQBB 4G43B 4P5TB 5KVFL 3L4WA 2ZF9A 3P9LB 2EE0A 3C75A 2VL4A 2VABB 4XX1G 5EBWB 4DEPC 4PM1A 4KVPA 4UBDC 2O5NA 2FYYA 2IC2A 4UQ2B 2QQNL 4P23D 3NZUA 3RU8L 3ZVVA 5ISZD 5F0MB 2E0PA 1NGWB 4XWOD 2P5WB 2QEJA 4DSYA 3O0RH 4KVNH 2FBJH 3QDJB 1QR1A 4F24A 2BY2A 1FNSL 2MOQA 1BLIA 4HC1L 2IAMC 4X8CA 3A4FA 4BHUA 3O3BB 3D4YA 5HI4C 3H1ZA 2AP2A 2BSED 2R7EA 2EXWD 5F3HA 1BQHA 4R90L 1FVEB 1IAIL 1RZ8A 4RNRB 2WWNA 4JJ5A 5EB9A 4KC3B 4AMKL 5EU4B 5EPMA 2PWGA 3MOAL 5CD5D 2G2RB 4Z78B 2XG4A 2X5PA 3MNVA 3CNKA 4PYHA 4MS6A 1H3WM 1K8DB 4KNSA 5CAYB 1SBSL 4X6EB 1N5YH 1MNUL 2XZCL 3P30H 4JKLA 2HCZX 2GSIA 3GJFH 2YC1B 3SE8H 3EOAB 1J8KA 4QR7A 2K9UA 4ZUSA 1XL6A 3LNHA 1KXHA 3GPEA 4R96A 3I9GH 1TFHA 4OLWL 25C8L 5L88H 2QADB 3A6CH 4PS8A 3CSYB 2R9HD 2QV2A 5FGSA 4NT6B 2ADJB 5CCGE 4AL8H 4LQFL 5DZNA 1FFOB 1RD6A 3KXFA 1JUFA 3MZGB 4S1QH 4RVBA 1KNOB 3PWLB 3FQNB 4KZEH 4JG0L 3QIBD 3MBXL 3TL5A 2FQGA 2DDQL 1AS8A 3MYJB 1MAJA 3QISA 4JO5A 3QZPA 5DD6B 2FTAA 4D9RE 5C6TL 1D6EB 5EIIA 3NBNA 1EUTA 4HWBH 2A83B 2AQNA 2NUTB 3V0DA 3SGEI 1T4KA 3PXLA 4CN6A 1MHHA 3H54A 3RNQB 1QLRA 1UJTA 4EBQH 3GRWA 3FU9A 2NT0A 3DUUB 4FG6C 1BQLL 4NN6B 3VXSB 5E6RB 3MJGX 3CFKA 1A3RL 3B2VH 4UCFA 2YPVL 2C1PB 4BHUI 2Z8SA 5T8IA 4YHLL 1K85A 3NAAH 4ODWB 2N01B 1HXKA 4B9GA 2AJZB 3WGUB 5CEYB 3ILPA 4L8SA 2HFFA 4L8CB 5E1QA 1A6UH 1KB9J 1LL1A 3PV6A 5C7XL 3RGBA 1KFAH 1EHXA 1VCBC 5ISZE 4OFPA 2ESVB 5JIHA 5C08B 5BMFH 1FNHA 1CGTA 3HJ0A 4QOKB 5HD8D 1UZ8A 3VFGL 2IAMA 3I6GB 3P4MB 5LQBL 3I9PA 1RZFL 3F6JA 3WMQA 3KMDA 4I3SH 1QKZH 3L3IA 4UQ3B 1NAKL 2G30A 2QFPA 1BAWA 1ILUA 2Y24A 2H32H 1J12A 2ZX9A 1HN1A 1WP6A 4JFWA 1AXIB 2HT3D 2Z7ZA 5D71H 4FNTA 1MDAA 1MFAH 3WKQA 4XX1E 4LSVL 3EUDA 4YK4C 2FJHB 5JW4Q 4Z0BL 5EUKB 1MCSA 1BW8A 1E5ZA 3T4AC 3ZIMA 2AKRB 4JN1L 1RUKH 5B1JC 2JKIS 4YR6B 5A1AA 3GUTB 1ND0B 3EH3B 2B3RA 2FX8L 1L0XA 2Y22A 3RTQB 3ZE1F 2E9WA 2PABA 2EH7L 4JRWA 3GXMA 1YNLH 2CJUH 2JE8A 3MRNA 1A7QH 1HXYA 1H8NA 3PF2A 4OBRA 5KVEL 5CXPA 3WSQH 3BN3B 1RK0B 3NK3A 1ZS8A 3E8UL 4R5VA 4PGCA 3V6OE 3ET9F 5B3JE 4YFLI 1KWGA 5J0BA 2VXQA 2UXTA 1D9KA 4ORGA 1EX0A 4O02L 1FL5B 4NUGH 5H37G 2X6AA 2X3CA 1A1NA 5H35B 1A21A 4XWGL 1MF2H 1OZTG 2XTJD 5B7EA 3ESPA 1TZGL 2P5ED 1VADA 5FFOA 3RWHB 2RFXA 1JFQH 1QWHA 3UTQB 1R3IL 2HUEA 2IGTA 2R0LL 5JR1L 3LVTA 3VXNB 5AW9B 3NIGB 1RUAL 2X41A 5SV4A 4WEBH 3D7PA 3T2LA 2F0CA 3GMMB 4UBDD 2FIKB 2Y06L 4JFEA 2VKXA 5EUOB 4Z7OB 2P48B 1J11A 2E46A 4ZW8A 1A66A 1IM3B 1W72L 2DWXA 1KULA 3PQYB 1RZKC 4XHJC 4QRQB 5FO8B 1ZANH 3BIKA 8CGTA 1VHPA 3S5YA 5I1IH 3TEYA 4ZUTB 3V5KA 1CD9B 2NW3B 2VGLM 4F7EA 3LKOB 3PIQA 1IFGA 3F7YA 2OTUA 5EORL 3KDMB 1QASA 4OCSL 2VE6A 3HB3B 5GGQH 3TJHC 1EQWA 2WD0A 1ZY9A 3GEFA 5HI4D 3TURA 4FTVD 4BJLA 1PYWA 4LCVA 4WEEA 5DK2A 1NFAA 4OD1H 3TVMB 1YNTA 3PJSB 3SKNB 2X6BA 2X4RB 5C0AB 3LEYH 5CR1A 4RAUA 4N0RA 1SUHA 3AS2A 1TJHH 4J3TA 2X4PB 4QHMB 4TQEL 3U4BH 1NOFA 3FT4A 4Q9QL 4HEME 5IW1B 4BH7A 4HOMA 3TEWA 1G7PB 4PFEA 4QRRA 1HHKB 4KTDH 2AQ2A 4PG9B 3BLBA 3MCKB 5K93A 5K9OB 4NX0A 3WE6A 3RPIB 1I8MA 4EUPH 3UC0H 1P7KA 4C47A 4C56A 1X44A 4U1SB 2LW3A 4M6AA 3QG6B 1V05A 1SLWA 2CUIA 2Z4QB 4BZ1H 1KBWA 3IF1A 2EVGA 3Q6FB 4MCYA 4ZFQA 2EUXA 1V27A 4FI6A 3TBVB 2FH6A 2ALWA 3OZ9H 1JDAA 4NXKA 4X5XB 2AQ1A 3NJNA 2XJLA 1S78C 2WQUA 2ORBL 3EJZC 5FXCH 4Y7MA 2HFEA 1T1XA 2WM0A 4XVJL 4Y9CA 5ES4B 2PXYC 1TLKA 2V37A 4EEEA 2YN3A 3HKFA 1IKOP 1E8ZA 2NY4D 4NFBA 2VDLH 3P02A 4XCFL 3MREA 4XXWC 3DJSA 4F5CE 5T1KD 4D94A 1UXWA 2BSRA 5PAZA 3VW3H 1XAKA 1UASA 4DH2A 1X5AA 2DMHA 3U48A 4QRUA 2P42B 2RR3A 4M3KB 3AROA 2J1KA 2Q10A 1G0YR 4I48B 3FQ1A 2FJSA 4AM0B 1OTSC 5L7XH 2X9XA 1HE8A 3NMEA 4OI9A 1EEZB 2PPDA 2BHYA 2XFXA 4O02B 1NC2D 1SBBA 1ACYH 1A6ZB 1FFTB 3A6OA 2O5YH 5JORA 3CDGA 2VDQH 4MAUH 5ETUA 5JPNB 4E5XA 3KJ4C 5J1AA 3O9WA 1CF8H 2C5DC 2JK5A 4FQLH 3WHE1 4TNWK 1T04A 1RULL 5K9QI 3AXLB 1JHTA 2XWDA 2DQDL 4QRSB 1DBAH 3HS8A 4QY8A 1W91A 5KZCD 4AE0A 2IBGA 1Y6NR 1IKFH 4UT6L 4FCHA 2YGVA 3BKJH 3SOTA 1JMZA 1J87A 2VSDA 3HI1A 3VFMA 3MTXA 4OIFA 1TXKA 3KNBA 3O2DL 1WEJH 3CZKA 4U1KB 3QI9C 4OSUH 1R5WA 4PB0H 4FTVE 4WI5A 3V52L 3TBTA 3U82B 5HYJA 2X28A 2Y2YA 3SYQA 1UWGH 4M8RA 3G5YB 4HMDA 4KDVA 5IROD 1A8JH 3DV6A 3VRIB 2NCEA 3CFJA 2HTKC 3CFQA 3QRBA 4XMKH 3ASNB 1SN2A 2CQVA 2E56A 4X4XB 4AEIH 1T0NB 5DWUH 1U8HA 1BFOB 1EMTL 4Z7NE 3B7RL 4BQ8A 3WUWB 2X89A 4G8GA 3FQXB 3HG1A 1N6UA 4M5ZH 5TF1H 3QXDB 1JERA 1MFBH 1MRCH 4JRFA 5I73B 2YS4A 1UURA 3D85A 5HDLA 1CGVA 2AQRA 4Q74A 5FYKD 1OXYA 5GSVB 2DBJA 1XTLA 3RWJB 2GT9B 5LUMA 3OKNB 4O2FB 4KKCC 5IV2B 4YC2B 5ESQB 1DQLH 1UWEL 1E5AA 2ZWZA 4XXWA 3MBWB 1AXTH 1MI5D 9PCYA 4LRIC 3JWDL 2CO6B 3ZJAA 2WQSA 3EO0A 1E3XA 3MNWA 2PPAA 1U9KA 4KXZH 5CIPB 4P46C 5D1ZB 3TLRA 3GSNL 3WV0A 4ZMLA 4AEEA 3Q5YA 3WKYA 2J1ZA 3ABGA 4KJQC 5B1AB 1O9ZA 1Z2KA 5DT1L 1R17A 3OR6A 3O3AB 2HLAB 1OTTD 1NCCL 2V3DA 5ANMA 3VWJA 4LCYB 1BP3B 1AQKH 2P43B 2XDHA 1CYWA 3E3QC 4KJWD 4NERA 4X0NA 3RWIA 2QMJA 4PY8I 1JVLA 1RJYB 2BWDA 4HULB 2B2XH 3KYNA 4LCIL 5FGBA 2R8SL 4WV1A 4NZRH 2G75B 2R23A 3WY1A 3KM2A 1SDYA 2FJGA 3GSXB 1QFWH 2CO7B 1MUJB 1ADWA 2X4OB 1FNEA 3ZMNA 4CILA 1F0LA 1G7HA 3TN0B 2LOEA 1IAIM 1G4RA 2BVPA 2L7UA 1M9WA 4NUJB 4F57H 4L4JA 1RP9A 2CPCA 1KXVC 5FWQA 1R5VB 3BDXA 3QB7C 2FL5A 5KSBA 3ARTA 3CFEA 2AEQL 2QHRH 2EILB 4BFFA 4CKQA 2BOLA 5IFHH 2YOCA 2UXVA 2VDRH 1UVQB 5DHXB 5KSUB 3CGTA 5FAAA 4HT1H 5D7LA 1U93B 2AAAA 2HTLD 4HJ0D 4Y9FA 1WITA 1D5RA 2GC7C 1CDYA 2H0FA 5FLVA 3P40A 3GJFA 1H15B 4FFYL 3D09A 4U33A 1T66D 4A7VA 4DP4X 3MNZA 3I85A 2VLRD 1M42A 2X1WL 3ILEA 3EJZD 1ORSB 2LU3A 3D25A 2Y25A 4O2EB 2YSSB 5HVFB 4OZGE 2PXYD 4LAJH 4H1LH 3BXNB 2DLHA 1K2DB 4Q6KA 4Z95H 3D52A 3RDTA 5I6KA 5ANHA 2F7QA 4XNAA 1ZHKA 1HIMH 1H9VA 2ZWKA 5I75C 1RMFH 1S7WA 4HK3N 4H0IA 4R4BB 5E9NA 2QR0B 2WOBA 4P59H 2B59A 2ZKWA 3LQZA 3ZE1E 4KVNL 5CEZH 2CMRH 4X6DA 1KB5A 3UJIH 5JIDA 5KYNA 1GYWA 3D12B 1JHLH 3O3DA 4NP9A 3LRMA 4XCYB 5T5NF 1OTSD 3AQXA 2AC0A 5FYKE 5E6YA 4MBRA 5AYUH 1SYSB 4U6TA 2V7NA 2XXFA 3F58L 3LEVH 4B0MB 1UH4A 3ARBC 5DURD 1DJYA 5HTSA 3L1EA 4Y1AD 3OMZA 4D0CA 1VACA 4LKCB 1AO7A 3SDAC 3KLHC 1MI5E 5TDPB 4P46A 1P6AB 3PHOA 1OT1A 3G6JB 1B0WA 1FH2A 4GAAA 4RGNC 4PU2A 3F7PC 4Y4HA 1J8RA 3SDXB 3TWYA 2TAAA 1F4AA 3B8YA 3BGAA 3NCYP 4ICWA 1N5YL 1YEHH 3P30L 1I8IA 3GZPA 2Y5TA 3SE8L 3GLDA 4J3OH 3MJ6A 2IPUK 2XV2A 3GDCA 3QI9D 4I8DA 1KBGH 1XGUB 4Y5YB 5CHNB 4EI6B 4HIQA 2EUVA 1W8NA 4FXGB 4NM8L 5CKGA 4E0RB 2KZKA 2FECI 2J25A 2VMEA 3D9AH 3K2UH 5L88L 5IR1B 3L9BA 4PGBA 3SJVD 5AYQA 3BSZL 2FO1A 3MV7D 1F3DJ 2HKAA 4AL8L 2HTKD 1OSZB 2P8PB 3NCXA 5DJCA 1TIUA 3DJZA 5EN2A 1KV7A 2W0PA 4KZEL 4JL1A 3H3PH 2WTRA 3FS9A 2Q8AH 4ZW5A 4CUCA 5JXEC 1ODAA 3I75A 3SY0A 1NPNA 2GITA 3TO4A 1OQOA 1NKRA 3FQTA 4HWBL 3QH3B 3DTDA 1TFPA 5DRZB 4PI2A 2K45A 2XG5B 4MQXC 4PLJC 1OM3H 4O2CA 3VXQB 4B3EA 1JRHH 3HRZC 3ZKXC 4EBQL 2RA1A 4GOSA 1MLBB 4Y7OC 2XN9D 5DSCB 2VAJA 2OW7A 4BXSV 3B2VL 3TFKD 1FVDB 3NAAL 4AGQA 3QS3A 1WC7A 2VLRE 2IXQA 4JM4L 4KKCD 3ROOB 3ZR6A 3LKQB 3NACH 3KPSD 4XVOA 3KDPB 2HFGL 1Q1JH 1A6UL 3QZMA 1XH1A 3FTXA 4PJAB 3FCUB 1KFAL 3RZCB 4PRAB 4QTIH 4XNZC 3FQ2A 2RMNA 1A0QH 1OPGH 3AQDA 2Y36H 2CO4A 3ZTJG 3RIAK 4F2MA 4KJQD 2YGPA 2YUWA 1CFSA 2BNQB 4JZNA 2ENYA 2F5BH 4DGYL 1JYWA 3KPRA 4I3SL 2GUOA 1QKZL 4TXVB 3I6KB 2DQFB 5KAQF 3H9SD 4I13B 3MRLB 3SPJA 1Z9NA 2Z7YA 2HVKA 3FHQA 3KS0H 3RPKA 5HHME 1S9XB 4YBHA 5D71L 1MFAL 1MWAH 1ZXQA 1MG3C 4L4VD 1TDQA 4JR9L 4X4MA 1F86A 1I3RA 2WBJC 4PMEA 2UZIH 3REVB 3W9EA 3EOTH 2NNXA 4YHKH 4WY7L 4WFFD 4Q58C 5DHVB 4ZMNA 2FIRT 1FGNH 5LDSA 1RUKL 5ECGA 1HHHA 4V1DB 5FF6A 1Y0LA 1TUPA 4XODA 5INCB 3RWFA 5BUAA 4KMQA 4KQ3H 1CN4A 3KYOA 4BRJA 1SN0A 4H20H 1OWWA 3CBKB 4JVUA 4NZJA 4WW2F 2CJUL 1TQCC 1A7QL 1UB6A 1G9NH 1WAPA 3MBEA 4EQ3A 5I24A 5HI3D 1HK6A 2OMUB 3WSQL 1KTDA 4DW2H 1GTNA 3RWGB 3PNWA 5IGXL 5D72H 2Q3ZA 3B9KD 2GBUA 5K9JH 4PJ9C 4A2FA 4WW2C 3P69A 3WTXA 3RVUC 1E7UA 1LVEA 3DX6A 3F83A 4NUGL 3MV9D 3WG7B 2Q8BH 2IDSA 4P2RD 4E9RA 1IGCH 5ESAA 3SJVE 2WZ6A 1MF2L 4BBWA 4IIQA 1JDCA 1A1OB 2I7OA 3MV7E 1JTPA 2JJSC 4O5LH 1FPTL 3KCPB 4UV7H 5H94A 3C5SA 3SQBB 1UGNA 4YDLB 1JXKA 4MWFA 4BA0A 1JHKH 3G04B 2KDYA 4LPCA 1FVCA 1QI5A 3GBNH 3Q1SH 3VQ2C 4WEBL 1SRDA 2IH1B 2OCJA 3UTSB 3DJ9A 1GMIA 3EFDH 4OGZA 2Y6TE 2FNWA 3LZRA 1ZS2A 1ZANL 2RCSH 2J72A 3CK0H 3PP4H 5EDSA 3QQDA 3UP6A 4DGIH 5MEPB 3QJXA 1A9BA 4XNXH 1OAQH 1Z9MA 3UDWA 2Z92A 3GI9H 3ZDXF 4FXTA 5E00A 2R2BA 1KCLA 4LEXH 4F27A 1GSKA 1E6OL 5IIEB 3C5JB 1QUNA 5DMGC 1O7DE 3D39D 3D08A 1W15A 5DJZA 1BF2A 3WOVA 3PWJB 5DS8A 3KPSE 1FH5H 3ILQD 1SF5A 5L6YH 1TJHL 5HJ3B 3SDAD 3QWRD 3SKMA 1KIPA 1M2OA 3U4BL 4FG4A 4G1EA 2R0ZH 4WI0B 1HI6B 1PSKH 5DEFA 2FAUA 3FU7A 4AV4A 4Z76B 5FECB 1R0AH 4KTDL 3ASOB 3FYEB 3ZT7A 1JSYA 5AVZB 1QBLH 4XH2A 1I8UA 1ZKAA 2O6CA 1J5HA 2DIBA 4X8JA 43CAA 1L3WA 1KY7A 1G7MA 2NNCA 1I8LA 3UC0L 4BSJA 1P1ZA 2IADA 3H9SE 1A3LL 1S9YB 4ONHB 4U1MB 3TIDA 5BZDA 2NYYC 3ESVF 2P46B 4L4VE 5HJGA 4LGPB 4TQPA 4BZ1L 4WWKA 2WZPA 4LO9A 2VDPH 3L8QA 4JFDE 4DZBA 4IKNA 5A3ID 5IT2H 2CLRB 1HX0A 3SQOL 3GB7B 1UT9A 3QJVB 2XQ0A 2Y7MA 3HUJA 3T6XA 6TAAA 5JHMA 2ZT9C 4IJ3B 4L1LA 3V0WH 5L8KB 1LO3L 5AAMA 3GMQA 4QWWC 4WHYH 5BS0A 1OW0C 4JFXB 5BO1L 2DKMA 4P4KC 4A2HA 1URIA 1LO2L 2HJLB 4AYFB 4AQ8A 1FGVH 5I1KH 4MGXA 3BQUD 4ZTOH 2WWMC 3LSOA 1RHFA 5CHNA 4CSPA 3KPNB 4MQXD 4HD9A 2HJFA 4MAYA 2G5BA 3WS3A 3MV9E 4Z77B 4K9EC 3QUXA 2NQCA 4P2RE 1KLUB 1G1YA 1NIBA 2NCMA 1IC4H 2Z9TA 2VC2H 2AMUA 3HE6A 3DVNA 1BOGB 4B9FA 1J8HA 1J9RA 3ZW3A 5B21A 4DEUA 1ACYL 1U0QA 2O5YL 3BP7A 4MAUL 1IAMA 4XZUB 4MA7H 4G83A 1GGCH 1S46A 4K3JH 5BOPA 4FQLL 3W39B 3T8XB 3V4UL 3FNKA 2BVUA 1C16A 1PJWA 1U3NA 4XX5A 3VA2C 5GQBA 3BZ5A 2G4GA 3WKMH 1N12A 3I3BA 1DBAL 4WEUD 4NQEB 1C8PA 1YEEL 1F56A 2K3HA 1ETB1 1AIFB 1KBKA 4XXDA 1ZPLA 1MRFH 4L3EA 3QYNA 1IKFL 4WI4A 4IK7A 4BQBA 4HLEA 1CTNA 5GS1B 3E9TA 4AQEB 5GPRA 3WL9A 3VXPA 1INDH 1YYCA 4HWEL 2F15A 1OCCB 2NLJA 4KQ4H 4PB0L 5DD1H 5AUMA 4BZ2H 1DDHB 5HPMB 3ULUF 3MRQB 2XRAH 1T89C 3FTZA 1U3YA 3ZHKA 4OJCA 3EADA 5FGCE 2DQHH 2PW2B 3TA3C 4WI9A 3MCLH 2WBJD 1OALA 4YAQB 4OVUA 4K5LA 2HPOA 1N0LA 3NP4A 2UYLA 3DPBA 2XZZA 3B5TA 3QUYA 1LE9A 3PDOA 4FEIA 4XMKL 2R51A 2NZ1A 1SJMA 4YHNB 3TGXA 2WWKT 3C60A 4NJ9L 3NIFF 1KIRA 2Q2LA 3K2MC 1RHHB 4ADIA 4AEIL 3MRKB 5KVDH 5DWUL 2VERN 4AQZA 2VCOA 4G5ZH 2QPEB 1B2YA 1F2XK 1DN0A 2W9DH 4HBQA 3UEZA 4TLSA 4Z3GA 3SDCB 5KJRH 5IZ7A 4HH8A 4URTB 3F7KA 5E4EC 2YA2A 5TF1L 3UERA 1T21B 3HS9A 3HS0A 1MRCL 4NKMB 3G08A 3IFLH 3RVUD 3S5ZA 2JB5H 4WO4A 2BINA 1BXXA 2Z35A 3Q3GB 4R5XA 2XVBA 1SOXA 2NY5H 4LGRB 1C1EH 1A9EA 3QDGD 4G6MH 3WIIH 3F01A 3MJ8B 4CW1A 3QZWB 2HVBA 4KVCH 5EF0A 5FHBH 4IGBC 2I5YH 2FSEA 3D2UA 2ZX8A 1N6VA 4ZS7H 2D2CC 3CZNA 3TZVA 3U0TB 1AC0A 3N2JA 1AXTL 1AP2B 2HT4D 4KO5A 4XPFH 3MV8A 3WO3B 4KDTC 3X3GL 1MIEH 3S4SA 2ARJQ 2PCXA 3LHAA 5ACZA 1KXQE 4ELKA 1KTBA 5T1DL 1FYTB 1MCRA 5L2JA 4MHHG 1FV1A 1ZA3B 1SYVA 1THAA 1XGRA 4KX7A 1EERB 3BRGC 2J1YA 1J9TA 2BY0A 4KXZI 3FCSB 1EO8H 1NJ9B 1Q9LA 1Z5YD 3CCHB 3DX7B 5JNYA 1ZT4B 5DMGD 2A6JA 5GS0L 2B2XL 2FE0A 3MLYH 4AZUA 1T6WA 3FT3B 2E3VA 3VI3F 4IBWA 1HTYA 4NZRL 1J48A 3FRUA 1YEWA 4ZX4A 4YEEA 1XH3A 3P4OB 4PJGB 1J9CT 3VGFA 5IMLB 3TBWB 1VKXA 3U4AA 1X5XA 5LBSL 4UDTA 2R69L 4F57L 1LK2A 3T2OA 3RI5F 1BECA 1I53A 1QRNA 3V4VH 2QHRL 3T6VA 2ZIDA 3V0EA 2EJ1A 3FSWA 5IFHL 3MLVH 3R0NA 3SDDD 3M45A 4M7JH 1P5UA 1QFWI 3WKPA 1JZ3A 1WCBB 4HT1L 1VFAA 4HUUA 4NFCA 4XBPB 3IB4A 1CF1A 5D93B 3VXUA 4Z7WF 2COQA 5IMKA 5C0CB 1XFPA 3WFHA 3LS5H 1NCBH 1R3KB 5D1XC 1DVFD 5I28A 3ZUNC 1N2RB 4F7KA 4DGVH 4HIJA 3VFRA 1OK0A 4C4KT 5J6HA 1X5MA 1NGZB 3RKPA 4AH2B 5AD0A 5E94B 3FFCB 1ILSA 1PKQE 3ARDC 2I9LA 3RVVC 4W9JC 2HJKA 5F9WB 4JAMA 1WPCA 1AY1H 4MXQC 1HIML 1RMFL 1T1WB 4HWUA 2EIKB 1L9PA 1G9HA 2UXFA 4P59L 4AYMC 5JLZB 5MERA 2J5WA 2CMRL 4XCEB 1IAOB 4EIBA 3AUVA 3PG2A 3SE9H 1HXMB 4Y19E 1JHLL 5AW4B 4CMHC 4LGSB 3VTAA 3JTTB 2B14A 3NQIA 3V6BR 1IBGH 2CGRH 2QGEA 4LSTH 3DYOA 1IC1A 5AYUL 2HSIA 4H4NA 2NZ9D 1ZHBA 2XVKA 3HC4H 1NFIB 1RIUH 3V6ZB 1IM9A 3UPRA 2X9YA 5HHXH 3FUKA 1AKJA 1SNRA 3AG1B 3VRJB 3BYYA 5C0JB 2NDGA 2OX5A 4A7TA 4AW4A 4NO0D 4WU5A 3WIFA 3VGAC 4C54A 4NHCH 5JOFB 3NABH 4LCCB 2FEDC 4LOUD 4G80A 2JKXA 3PUUA 1OOAA 1YEHL 1P2CA 3O4LA 1OP5K 4NQVB 4KKRA 2J5LC 5T33L 1B0IA 4HIEA 4KKPA 5GZND 4H0HB 5C2UB 2D0HA 4HZAA 2YAMA 4QCIB 1KBGL 3QNXA 4M43H 3MV11 1Z5LB 3RIFF 4JNXA 2PTTB 3LNFA 3OKOA 2VITB 2JCWA 2VW7A 3PXJA 1DTUA 4LLMB 4LVHC 3D9AL 3K2UL 4MDJA 5EV7A 5C8JA 2VDOH 3L4CA 3TA3D 4Y4KC 1NBZB 2X2JA 4FA7B 1G6RB 2F7RA 2K8MA 3VM5A 3P3RA 3IN0A 4PRIB 4HHAB 4TKWA 2Q7YB 3ULUD 4M3HA 4NIYE 2EDHA 3H3PL 3ALPA 2Q8AL 3WNNA 1I7UA 4AQ1B 5JYMA 3KGSA 4M48H 1B4JL 1TZAA 1JZJA 2R4RH 1NKOA 5HJBA 2O72A 3Q9QA 3CU7A 1GRWA 1OM3L 5CMAB 3WU1A 4FNUA 1U21A 5LG6A 4GKOA 1JRHL 5AKTA 2Y1YA 1EDHA 2B5IC 1AGEB 4V2CB 3UACA 2RIKA 3ZK0A 4E9QA 4W9GC 5E9AA 1UGKA 4OD2A 3FT2B 4PREA 5IFJB 1HKLL 3T9WA 4R7NA 5E5LA 3HZMB 3NACL 1JRHI 1RERA 2EDLA 4IGBD 1DUYB 4S0HA 1GL4B 3II2A 1Q1JL 5D55A 3VFSA 3CHXA 1K4DA 1A4BA 4UU9B 3WYRA 1LEKB 1TVHB 2YUVA 3U1SH 1YPZA 2X2HA 1NCGA 2FDBP 3D4GA 4HV8A 1AC6A 4KKAD 1OB1A 1OPGL 1PL3A 2Y36L 1T20B 2B7DT 1SUJA 2F5BL 4PJ8B 4FKEA 1C7TA 4G2AA 1UYWH 2Z3FA 5JHLA 2VXSH 4K4KA 12E8H 2HZHA 3EO1A 4QD2E 3CN3A 1JMXA 2O5ZH 5B4MC 3ZQXA 3AREC 3MRIA 4TLTA 1MWAL 4PWFA 5CN2A 3ESOA 1J18A 1FSKB 1UCTA 3SCMB 1R46A 3V5HB 2UZIL 3EOTL 5C0IA 1OQXA 5E6ZA 3EJUA 3RKDD 1FGNL 3LQMA 3K8MA 1JV5A 4UAHA 5BZWB 5DUJA 3NFNA 1UWXK 4CC0A 4KQ3L 4XNMB 3U2SB 5A40E 4H20L 2EO9A 4G6JH 4P2OA 2EE6A 5HGGS 2BOCA 5I6MA 5EEVA 1G9NL 1R5IA 4BFIA 1TNMA 4MJID 3O8XB 3AAZA 3ARFA 2Z1PA 4NQDD 4RRPA 5ABAA 1ASPA 1XMEB 5D72L 5I1AB 5DQDH 4DF9A 1WCQA 4MD5A 4YDJB 1A7PH 3WTYA 5LKNA 1BZ8A 1WAAE 4Y4KA 5D8JH 1M71B 3OSKA 3OJVC 1BYPA 1T22A 4L37B 5BO0D 1MCKA 3CC5A 3BJ91 4YS4A 2CDEB 3QORB 4UV7L 4XP1L 2BNRD 3A6BL 2F54B 4Y4FB 3ULUE 1BQSA 1JHKL 4N0UB 4X7SL 2MQGA 3ARDD 4JRYD 3Q1SL 3RVVD 3VG9B 2VWEE 1EJOH 1XF2B 5GGRB 1YEDA 3GXTA 4MXQD 2J8UB 1D7CA 1ZT1A 2XKUA 1RZKH 1WBZA 4LDCA 3RJDA 3VH8B 3EFDL 3B7YA 1CDGA 4ZOBA 3ZY7A 2RCSL 3CK0L 3PP4L 4FULA 3TPUA 2YXFA 3NIFE 4N8PA 2EDOA 5B22A 2Q76A 3TX4A 5LCVH 2IPUG 4P23A 5ISZA 3HN8A 4XNXL 1OAQL 2M26A 4GW4A 4I18A 2NSQA 3GI9L 3X1FA 3BZEA 3CZLA 1X5JA 4DKEH 4LEXL 1EHLL 3ML9A 3BH4A 1DEEA 2YUZA 4NKDA 5I26A 2F1AA 3V0FA 3WEMA 3OHXB 5BV7B 1IGML 1KJMB 1WD9A 4OZFH 3QHZH 4PIBA 3ARGB 5L6YL 4GBXD 4X7DC 2VQ1B 3GDBA 4J2QA 4X4YA 3T0EB 3GSRB 4PJBE 4Y9GA 3CE1A 1PSKL 2OJZL 2OR7A 3WBDA 3MRRA 3GC3A 1R0AL 1FLRL 3IU3B 1QSED 1QBLL 5KEZA 3NSYA 4PRDA 3RFZC 3ZKQD 1L5GA 2XV6B 1SLVA 1J7VR 4ONOA 4I5BB 4LK4A 1LP9B 4MMYB 5HGHB 2WWOA 1IMHC 1IB5A 3WFCL 5DUBB 1LJMA 3V95A 3B1TA 1SJXA 1FFPA 1RU9H 1Z7JA 4KX8A 3V6OA 3W37A 3CFNA 2VDPL 1S5HB 4FKKA 4RLDA 3QNZB 3STBA 5SX5K 4GRMB 3VFUB 5IT2L 4F8PA 4IHOA 1WZ1H 2NUPB 3BH9B 4G71B 4HH9B 5IESH 1TITA 4R4NC 4DPAX 1A5FH 3KVDD 5A2IH 1ZPUA 2FJUB 2V9QA 5DHYB 5DJ2A 3V0WL 3TU6A 4F9LC 1OCZB 5IJVB 3MUY1 4BKSC 1E28A 1ZD6A 2JTDA 4JKPH 3VI3E 4MJIE 4OCMC 2HXAA 4NSKA 4NQDE 4Y88A 3K1KC 1FGVL 4EI6A 1QATA 4ZTOL 2C4FT 3GBMH 4RBPH 3FCTB 4Z7VB 3QRLA 3MGOA 1I1CA 3M1CA 4P3DA 1JV2B 5DRNB 5HHOD 3L3GA 3ROLA 4AVHA 5E6IB 3EJYC 4QLRA 3AT9A 4F1SA 5A6IA 4N6RB 2VC2L 1S5IH 3HC3H 4KFMA 5DO8A 4LVNC 2ROXA 2BW4A 4V33A 5DEZA 3RWCA 1TKWB 4AIEA 4X7TA 1Z9PA 2BNRE 2JELL 1RZGB 5EO1A 1GGCL 2WIIB 4K3JL 1YN7A 5LN4A 1D5XA 2YGOA 4Z7WE 4JRYE 3QUKB 2A4CA 2ZD0A 4YSUA 1GPOL 1O5DT 3WKML 2JXMB 3CXDH 4Y16B 1NINA 4K5MA 2W07A 1MRFL 1JPFA 1UADC 5D1QB 5H8DA 1EFQA 4ZOCA 1UM6H 1LYQA 3HI6L 1GY2A 1F90H 5A2CA 4HEMA 5IUCA 4CC1A 3FQUA 5DYOA 1DO6A 1WHOA 1I85A 2BM3A 1HHIA 1LE5B 2L4OA 2ROYA 1INDL 3F5WB 3MRPA 1X7QB 4H5SB 5C0GA 4KQ4L 3NJJA 1ZV5A 4NO5B 2XRAL 1A14H 2CPUA 5BRZB 3UYPA 3QIWB 4NZUL 1H3TA 1T1ZB 2WBKA 3Q2LA 3LN5A 2DQHL 4Y9BA 3DIFA 3TYFB 2DLGA 5C09D 4GG6F 5I6OA 1OLLA 1BPLB 1L6ZA 4WK0B 4EAEA 2FX7H 1AGCB 1E9OB 2EC8A 3QUZB 1MFDH 2BIHA 4WTXA 1JPTH 2CKBH 2FQFA 2HN7B 3W81A 5ICZA 1LQBC 2LU7A 3F7RA 5LDUA 3EO9H 4XMZA 5KVDL 3GF8A 4OZIF 5DJYA 2HT2C 1CB4A 3O11A 4G5ZL 4JQIA 2YO3A 4U2YA 4K7FB 5KJRL 2YAFA 2H2SC 2VERA 1EJFA 2VLMD 4PR5B 4YHIA 1QFWM 3L08A 2ZP8A 2GJZA 4YHOH 2JB5L 2VDNH 1U42A 2CO1A 4NENA 2X87A 5DJ0A 4MCZB 4B9CA 4ZZKA 3IXAB 5C0EA 1CFQB 2NY5L 5IJBC 3RPBA 5LVEA 1OP3K 1FF5A 1I1FB 2W38A 4BKLA 1V54B 5SX4I 2UY6B 4ADGA 3B8SA 4A39A 1MNNA 2ZKXA 4KVCL 3IJHA 5DS2A 3M7FB 5L9DH 1K3ZA 4MD0B 5FHBL 5J13B 2I5YL 2ADGB 3MGTA 4ZS7L 3SD2A 3VFNB 1JNNL 4AIZB 3X1EA 2HG5B 2OMZB 4N2GA 4XPFL 4Q0XH 1MIEL 5IOKA 2QVMA 5D96C 3IETA 1WBXA 4F9PA 1OL0A 3JTSB 6FABH 1PX8A 5HHOE 4QTHA 4AC2A 2E6PA 1LEGB 2SEBA 4W9IC 5KYYA 5D7JC 3BESR 4N0FA 3I02B 3V55A 4AT6B 1BZ7B 5TE7H 3IJEB 5H37A 1OCRB 1DVXA 5MEOB 1G7QB 4YL4A 3LN4A 1NBYB 4LBEA 2APFA 2H2PC 2XNAA 1E8YA 2VW4A 3MMEB 3MLYL 3UBXA 2XYCA 2JLPA 3UJJL 4FTVA 4R83A 4YSRA 3QHFH 3QCTH 2W0LA 3DRQA 3MZTA 4YX2H 2QLVB 2OPCA 1ULVA 1ZVSB 2AXGB 3K4ZA 1E9PB 5IHZB 3TBSA 1UJ3A 4PGDB 3TCLB 1CFVH 4J8RA 3C8KA 1JDDA 2JI2A 5I1GH 2X09A 4NKIL 4Q9BA 4HDIA 2J8OA 3PS6A 1BLNA 1QFHA 3EOBA 1QA9A 3H9HA 2PTUA 2BPBA 3MLVL 5CJOL 3QZWG 1EANA 4X6FB 5HYSG 2YD2A 4PJCE 1SMAA 4XP9H 4Y89A 3AY2A 3VI4E 3VWKB 5K59E 3QFJB 4C58B 1BQKA 3CFTA 2FWOB 3WLWD 3ULVD 3ZX1A 2ZPKH 1KUMA 2Z8WC 3BEVA 2YD1A 4DGVL 3AITA 1IRAY 1UACH 5EZJB 5F7HA 3PP3H 4K3EH 3UG4A 1QPKA 4IRJC 1R1CA 2W88A 3FRPB 2ZOUA 1UKQA 2LGNA 4I4WA 3IVKA 1JAEA 1Q9OB 2NXYD 5MHSD 3CXHJ 2Y07H 4PJ6A 1AY1L 1LQSR 1ZLWK 3JWNE 4MX7A 2F58L 4X2UA 2VLME 4PMFA 3AUWB 5D6DA 2NTFA 2FYYB 5F0JB 3SYAA 5FK9A 3PWNA 3JT2A 3SE9L 1IGIH 1VGEH 3NRQA 4HLZG 1X9QA 2A77H 3K6IA 4XB3A 1A3ZA 4GLRI 2CGRL 4KROC 4TL4A 5D2LF 5F89A 1NCHA 2G3NA 3DBXA 1QR1B 5HXMA 3F04A 4A2GA 5KJ4A 3JVGA 1C5BL 2PPFA 4L9LA 5DD0H 4I87A 3HC4L 1SHSA 1U30A 4PIRF 3TNNA 4A7QA 5D7SH 2NY3B 1RIUL 3ARUA 4GW1A 1NC2A 1H3UA 1N5AA 5F3HB 4YQXL 2R7EB 2PO6C 1BQHB 1RZ8B 3UBXI 4AM0Q 4P2QA 4X99A 1E3FA 4JJ5B 2ZXEB 3K0YA 1U33A 5FUCE 4NHCL 3NABL 4LOVA 2BP8A 3HNSH 1IFRA 4U1IA 5EPMB 3MLSH 3IGLA 5AKRA 1V7NH 2XG4B 3MNVB 4BEIA 5D6CA 5HI5C 3KBEA 3O6FD 2P5PA 2XC8A 3UBHA 5CZVH 1Q4NX 4G7YL 1DE4A 4M43L 2GSIB 3LXAA 5JW3H 3A21A 3TT3L 1PU0A 4GSRA 4TN9A 3ZTCC 3BP4A 5TD4A 3EDDA 1N8ZA 1WG3A 2VDOL 4ZUSB 4MNQB 5MI0B 3KWVA 4M4RA 3T3PB 4RQQA 2KKQA 4IMLA 4GUCA 4X7EC 5FOBA 4R96B 5LGHH 1OEZW 4FQHA 2DQMA 2KZWA 5IROA 4GMTH 1RUPL 1JGEA 4LE8A 1S6NA 2EAEA 2MHAA 4BUQA 5A2BA 1X9LA 1JVKA 4NPYA 1PAMA 3U30C 2HT2D 3LPGA 1DLHB 3KXFB 1JUFB 3GS0A 4WNQA 3SPIA 2ZXDA 3CPLA 4JKWA 4M48L 1XTMA 1BF8A 5FX3A 3WN6A 4OZGA 4KH9A 4DAGH 5F6IB 2R0WH 4MJ6A 3UEQA 2ZAGA 4F7PA 4YJZL 4LASH 2OKMA 3T6ZA 2HYMA 3N85L 1JZ7A 5EIIB 4ES8A 4X5LA 5KSAD 4FA8A 3MGAA 1KGJA 4PWIA 1QSFD 3UTOA 1T4KB 4PJDF 3IRZA 3ULVE 4M6ML 1MHHB 3DECA 3X12A 5I0XA 1QLRB 5I6XC 1MREH 3BP5A 3R8QA 3HLKA 1BYNA 1DYZA 1ZJAA 3CFKB 1XZ0B 1CLOH 1PEWA 2IOIA 1XIWC 1GAFH 4QMEA 3NESA 5K1NA 4AI7A 1FQ9C 3ILPB 3UCRA 4B9YA 4L8SB 5C6WH 2HFFB 4WUUE 1KYAA 1YAZA 1KZYA 1AD0A 3HVNA 1RZJC 4KI1A 4K5NA 1MI5A 3PV6B 1AR1D 1KBBA 2Z7WA 5F96H 1C5CH 1XF5A 35C8H 3L9EA 4KK9D 5D7JD 1UYWL 1NM9A 3FAXA 2XFGB 2VXSL 2BIPA 1UZ8B 12E8L 3EFFA 3D18A 3GLAA 3REWA 1E6JH 1JZHA 4HJEA 3OPZH 2O5ZL 3VTMA 5F3BA 1NWOA 2AJSH 2H2PD 3VXOA 4B27A 5JMRA 1NCAL 2ZUQB 3NYKA 3L3IB 2BS8A 3PWPA 3N91A 1H6TA 1S7UA 5AW1B 2R1YA 5F7DA 2W81C 1GZHA 4OCRH 3MU3A 1DVQA 2D2OA 3OAWA 4PBXA 3VFOA 3TXAA 3GZKA 3F62A 5GS3A 4DFHA 4G72B 3WKNA 4HCRA 4F15C 3S97C 1EBAA 3IWVA 4LVEA 3RVXC 2C4XA 4HWZA 3CHOA 3MRNB 5DQDL 4IRSA 1HXYB 1WISA 2KZBA 1A7PL 2IMNA 3CMOH 1JXJA 1ZS8B 3FFDA 2F61A 4PGCB 4HOXA 4U6VH 5I2IA 4JMXA 1TQBC 4P5TC 4L4TD 2PWFA 1D9KB 4ORGB 4TNVF 5LXGH 1UOLA 2LR4A 5DWPA 4BQCA 4D9QD 1A1NB 3K7UA 4XNBA 2AJVL 4WWOA 3UFIA 4RMQA 2PYED 4ENEC 1RKRA 3I9AA 4BQ9A 4ELME 5JO5A 5ICUA 1YYMH 2WLIA 3QPXH 1VADB 3HPLA 4YEFA 1EJOL 2RFXB 2DKUA 5CEXB 2VLRA 1EAQA 1RZKL 1OPOA 3IDGB 3VO0A 3ZU8A 5DFVC 3GKZA 4JFEB 5IJKA 4DUXA 2WBXA 3VUAA 5LCVL 4UNVA 3Q8AA 2J7LA 2DWDA 1IC5L 4ZSOE 3FK3A 1X4YA 3PGDA 3FB7A 4FNQA 4DKEL 3K80A 1OSPH 4GO9A 3V5KB 4F7EB 3PIQB 3F7YB 1YMME 2OTUB 3B2XA 4ZFFA 2BJMH 2VE6B 1SDDA 1M2VA 2FHCA 4AG4H 1OGSA 1Q38A 3QHZL 1PYWB 2XUWA 2PO6D 2IPTH 5DK2B 2RB8A 5AOMA 2F53D 2QDVA 2VZVA 1BF5A 5FM8A 4XBGA 1MW0A 1BZ9A 5MEQA 4B41A 4RAUB 3FT4B 4CVZA 1S7XB 4BH7B 3OKDA 4M4PA 4QRRB 2E76C 1USQA 2GJ6D 2WQAA 4GUQA 3BP6A 5JIKA 1UEYA 3ZKMC 3ZN6A 4A66A 3WE6B 2YJLA 4O4YH 1I8MB 1CFMA 5CBAA 1AIZA 1XT5A 1RU9L 1P7KB 4MB5A 4C56B 3VH8G 2ZX7A 5AG8A 1LWHA 2P28B 3HVDA 1WZ1L 1X6NA 4CGUB 5IESL 3IF1B 1A5FL 1H0DA 1FO0A 1ZIBA 4MCYB 3RX5A 3RNKA 3SJVA 3U2JA 3D87B 1KGUA 3A5VA 3MV7A 2B77A 3UTTD 3EGDA 2HFEB 1T1XB 5JUEH 4OM0H 2XX1A 3AFLA 3BZFA 2TSAA 1QW8A 2E7BA 3LS4H 4UANA 5EC1A 3U83A 3GBML 1UZ6F 2YAOA 4TOYH 4ZAKD 4NN6C 1ZLSL 3MREB 4NRZA 4OBSA 1XSJA 4K9EH 5D2NE 3SBQA 2ZUTA 5GHWH 1UXWB 1X4ZA 1E0OB 2BSRB 4ZFOL 5JPMA 2NZIA 3F65A 4LARH 2DMGA 2GIYA 1JYVA 5EBWA 4QRUB 3QRGH 1S5IL 2DQIL 3HC3L 4L4TE 4D9QE 2WCPA 3DTXA 4IBYA 4BE6A 4CJ1A 2PYEE 1DQKA 5F7AA 5FV1L 2XFXB 1TLMA 1E5CA 3FHAA 4P4RA 4U1LA 3H85A 4MQSB 3HNTH 4XE5B 3RURA 1AD9A 1JZDC 2K4WA 5JORB 1XIWD 2ZWNA 3CDGB 4JFUA 5ETUB 1T1YA 4BA8A 4E5XB 2FNBA 3ZKND 3KL0A 3CXDL 5J1AB 4G7SB 2F5AH 3O9WB 2MCAA 3WY2A 4ETQA 2JK5B 3KPSA 4W70A 1T04B 1JNHA 4NRXA 1JHTB 1JL8A 5AVYB 2DQJH 4DGWC 5LN8A 1UM6L 5EOTA 1F90L 2HWZH 3IS1X 4X6BA 4J4PD 4QY8B 1K8IA 1NGQL 3N1FC 2YD5A 2JIXA 4TVPE 4PH8A 2FLRT 2JKJA 2ZNWA 4GQPH 2HRLA 3AB0B 3HI1B 3VFMB 4WIQA 2OW6A 3KNBB 3AM8A 3T71A 4G6FB 3OR7A 1L7IL 2Z7UA 3QQ3A 1R5WB 3H9SA 4ALAH 3RTQC 2NY6C 1D5IH 5GRUH 4W6WB 5D2LE 2FX7L 3DTUB 4ZJ9A 3TBTB 4JMNA 5HYJB 2Y72A 3ULUH 3HN5A 3LNDA 1KCKA 1LWJA 1E42A 4L4VA 1JPTL 2F53E 2CKBL 4GRWE 4ONFH 4FNPA 3DV6B 3RA7H 3L9RA 3EO9L 4JFDA 4LHUB 2PWEA 5GRVL 1BAGA 3CFJB 3OAUH 1OAKH 4WFHE 1FP5A 2FX9L 1OE3A 3D1MC 2Q86A 2VJ8A 4D0DA 2GJ6E 3NIGF 2FT6A 5GGUA 1U8HB 5LWYH 5IB4A 4G8GB 3PPEA 3GJFK 1KB5L 2HRHA 3M1BA 4YHOL 5EUOF 4Z7OF 2W59A 1EHAA 1UXLA 4N1EA 2VDMH 3HG1B 3S34L 3B9KA 1CLZH 4P5TD 4HJTA 2VH5H 4LNRA 3IDJA 5J6SA 1I1YA 4JBSA 3D85B 4ENED 1AXSA 1L9NA 4UYPA 5L9DL 2CNZA 1EV2E 5L4MA 1AOHA 1JYNA 3TJPA 4EIZC 3LVEA 3UTTE 4PWEA 3G9VA 4OU3A 3QDJD 5DFAA 4AYEC 2CHDA 5DFVD 2C1OA 2WSKA 2BVOA 3HB3C 2PKDA 6FABL 2RTTA 3EO0B 3MNWB 1JCVA 3AGVA 1Z3GH 5BXFA 3GMRA 1TZ8A 5KOMC 1E7VA 5TE7L 3TVMC 3GLZA 4MJHA 3AGWA 5I5RA 3OR6B 4ELDA 5E08L 1B9KA 1EXHA 1II4E 4B7IA 5ANMB 3VWJB 1UCBH 1LDPH 1WUZA 3VACA 3AMLA 1YY9D 4XT1C 3QCTL 4BUHA 3RWIB 4A7SA 1HKFA 3T8MA 4YX2L 4OV5A 2AEIT 2A4EA 1HH6A 2KMWA 2GB2A 5ICYA 3TV8A 2MCPL 4PWGA 3KYNB 4OFYD 1LD9A 3JXAA 1QTSA 4UQ3A 4L0PB 4WV1B 2R23B 1X9RA 1ONQA 2FD6H 3IMSA 3O2WH 5KN5A 2FJGB 2E7LA 1X4XA 1MJ8H 1FNEB 3D69A 3K5SA 1G7HB 2VB5A 2FJHA 2NY0D 1P84J 3DJTA 2BVPB 3SEPA 3DSNA 1AANA 2D7OA 4UMSA 3EF7A 2QADD 1BYOA 5KSBB 4LPVA 2FL5B 3ARQA 4XP9L 1J86A 2D7TH 3CFEB 4PW4A 2I69A 1OAYH 1UD5A 2OTWA 2X12A 2WGNB 3MO1A 5D7LB 5GSRA 2J8HA 2ZPKL 2AQTA 3M17A 5FEBA 2CD0A 2YKLH 4JM2A 1LGVA 3GJFB 1BFVL 4HFUH 2R39A 3NFSL 1I9IH 4K94H 3DYPA 5CUSH 3H9YA 3ZTNH 5C0FA 4RH4A 2YBRA 3BDYH 1KMGA 3MNZB 2YEZA 3N1MC 3OHMB 1CGWA 4JG1H 4GT0A 3OJMB 1C08A 1MH5A 3D25B 1F02I 5CWSA 1FHGA 1DSWA 2R56H 4XTRD 1Y7VA 3RDTB 3NZSA 2QV4A 1ZHKB 1BVLA 3VXSD 1FIGH 3MX0A 2ZXBA 1IGIL 1VGEL 1F4YL 1S7WB 5FYKU 2A77L 4NNPH 4QF1A 3VNYA 2BRRH 2B59B 3BQUA 4I85A 4IM8A 3IE9A 3LQZB 5JPNC 3K6NA 1KXQA 4OUOA 4X6DB 2B16A 4S0TD 1GC1C 4OD3L 3UPAA 1H8OA 5DD0L 1FJ1A 5D7SL 1RXLA 3NJFA 5G5DA 2ESVD 2ICEA 5C08D 3FN9A 2V7NB 2EVJA 4PWJA 2M83A 4D0CB 4PWKA 1VACB 2FEEL 4FA6A 1ETA1 3ABMB 4HUWA 1UTDA 1AO7B 3MLSL 4ZO7A 4P46B 3PHOB 1V7NL 3WO4B 4MA8H 3HHMA 5I0YA 1DBKH 5KTEH 4LLDA 4TSBH 4Y4HB 4PSPA 2OSLA 3GMOA 1V55B 2RH0A 1E2VA 5CZVL 3BO8A 1I8IB 1UOKA 2ICWJ 5JW3L 1V10A 2Y5TB 4MZRA 1JK8A 3X1BA 4PG9A 2JJWA 1NIDA 1TOXA 3RTQD 4LSSH 4EN3D 4EVNB 5LGHL 3MRCA 3VG0H 3NCYS 4ZXBC 4M5SA 1SJHA 4KKQA 4GMTL 4OR1A 1A22B 4PGBB 3JBG7 4L2LA 5J4MA 3WHXA 2C8NA 4IS6A 3QG6A 3VSTA 4MNHA 5DJCB 3ATAA 5I73C 2RAMA 2HRPL 1NCDL 2ZOWA 5EN2B 3W9DA 1S3KL 2X6MA 3KHQA 3WN5A 1NKGA 2IH9A 3MOBH 4LF3A 4DAGL 1LK3H 2WTRB 2R0WL 4OIIH 1NMBH 4OF0A 2NY1D 1D6VH 2MPVA 3I75B 1OF2A 3CFBA 3QO1A 1U8NA 3SY0B 3FT1A 4LASL 2GITB 3RL2A 3TO4B 3V8CA 1HSAA 3FQTB 3CZFA 1EJ6A 3K0WA 3TWCH 4KNTA 4YC2C 1V7MH 2KPNA 2EXSA 2JKTM 4O2CB 1BVZA 1TENA 2FZ3A 3P9MA 4PLKD 4TNWF 4U1GB 4Y19A 3IFPA 1MREL 2XTLA 2I32A 4JO1H 2UWEF 4ODVL 2X2YA 4NBYB 3CFMA 5D1ZC 1CLOL 1IM3D 5DVNA 4B9IA 2QPDB 3DK0A 4Y8AA 2VLJD 1GAFL 3PQYD 4HUVA 2BSTA 4QEGA 1WC7B 4WWNA 2IXQB 2XZAL 3D2TA 2JF1A 2AANA 3MHZA 1DO5A 1B2WH 1UM4H 5T3ZD 2BXYA 1UA7A 4NDMA 5JPNA 5F96L 1SHXA 5C9JA 3CVIH 1CT8A 4AW7A 2QTVA 5AVSB 1HILA 3BCDA 4F2MB 4FQIH 1CFSB 4JZNB 1E6JL 3KGRA 3KPRB 3OPZL 3VGEA 4FABH 2AJSL 2GUOB 1XMWA 5KVFE 3MA7A 1RI8A 3HBQA 3CN0A 1HSBB 1DCLA 2HVKB 3TN0C 5C08E 1L7TL 1NEZG 4Z7UE 2MWCA 5E5MB 2EYTA 2WMPA 3VX1A 4OCRL 5BQDA 2GKIA 1FFQA 3Q0HA 4ZDHA 5CF3A 1I3RB 3W9EB 5E99H 4AGNA 3WTSA 4IBLT 5LB1A 3FUDA 1WIUA 3FKUS 1HHHB 3JWNH 5FF6B 3QJFA 3RWFB 3KYOB 3UAAA 2CXGA 2YMOA 4CN4A 3CHQA 1UB6B 2WYIA 4YWGH 3MBEB 4N22A 2CBPA 2CDGA 4Y2DD 1IX2A 4X6CE 4FFWD 1PPIA 1KTDB 4KPHL 3PNWB 4U6VL 1SXAA 4M00A 3SDDA 3K5RA 5TPWH 4KKLC 4ZXBA 3R18A 5LXGL 3MRGA 1F13A 3DX6B 5GGSY 3ZYIA 2F8XC 2D8KA 4EI5A 1HHGA 4QKTA 3TV3L 1NAMH 4MJ2A 1RSFA 4DERA 3DX3A 5T3XL 5ESAB 4OF6A 2FVNA 4IIQB 1DVFA 1YYML 1DFBH 1KCSL 3QPXL 1NUNB 5JQIB 2HUHA 4FLHA 4GKSA 4LCWD 3IMBA 3OZLA 1NQBA 3C5SB 5H94B 1MFCL 4MWFB 4FOMA 1CGXA 4MVBD 4KOCA 5ACMA 3KAAA 3L3JA 3M46A 4EI0A 1SXCA 4HK0A 2BY1A 1ZAGA 4A6YH 2CHNA 2NY7H 4F8NA 1M7IA 4LEOA 3G6JF 1Y6KR 1E40A 1TQUA 1DSFL 4MLSA 1MCQA 3QIUD 4K7PX 1XBRA 2H1XA 4ODSH 3SDXF 3B56A 3QQDB 4KBPA 2C9AA 2CR3A 1A9BB 1H3PH 2VDLB 1EPFA 3ZE2B 2BJML 2GAZA 4HAFA 4JFYA 4QJ5B 5CIPA 5LAXA 2Z64C 2Z92B 5F2FA 1KCVH 5E00B 4Z7OE 3HZKA 2R2BB 5ICXB 4OF5A 3V4PH 4WI3A 5C0RH 2VLJE 3TNMA 3PQYE 2EDKA 2IPTL 1QUNB 3EG9A 5CU9A 4W9KC 1YECH 5DJZB 4ZFZA 2BHFA 5DS8B 4JHWH 5DI8A 3GZQA 2CJTA 5B1CA 4PRHE 4M7ZB 5GGSA 4TM9A 3C8HA 3FO0H 1OCWH 1YAIA 3CVBA 3SKMB 1KIPB 4NO0A 4G1EB 4GI9A 2VDQB 3KW7A 4Y5YC 1GGBL 3FU7B 5DEFB 2V7HA 3ZMRA 2OM5A 3OB8A 1TMQA 4XC3H 4X8JB 4MHHI 43CAB 5I23A 3B1UA 5AW6B 1G7MB 1LO4H 5GZNA 3SQRA 5CCHE 4NZDA 1P1ZB 2IADB 1KN2H 3UYRL 5K5YA 2ITDA 2GCYA 3HE7D 3TIDB 1KT2A 3BISA 1WAAA 5BZDB 4JREB 4GKNA 4IW4C 5C1MB 2BRQA 3C6LA 3DRTA 4WWKB 3S37X 2W9LA 4DZBB 3UIYA 3ESUF 3SE4C 3NA4A 3HUJB 4OLZL 3EJJX 5JUEL 4HOZA 2F1BA 2ZCHH 3GMQB 4YXHH 1JWMA 5BS0B 1BMWA 3QZLA 1HEZA 4K9EL 1YG9A 3S96A 5GHWL 1IVTA 2ED9A 1BV8A 5IWLC 1WWBX 1PTZA 4MTMA 5AQ0A 5HYIA 2O61A 3L2LA 3LSOB 1JZ8A 3CDCA 3QRGL 3T8VA 1NM4A 2JMRA 5K9QG 4JO4H 2HJFB 4MAYB 2G5BB 4L1DA 5F9DC 4IU3A 3QUXB 4JB9L 4DN3H 2EVFA 3HE6B 4L5FL 3DVNB 4N1CA 3W11D 1J8HB 3T3MB 2DTSA 1OF0A 3HNTL 3POCA 3FHEA 3NIDB 3RE0A 3BP7B 4RFOH 4LCWE 5ITBH 2OL3H 2OXHA 1M3JA 5AVVB 5KVEE 2F5AL 3DX8A 1B90A 1P7QA 2V0AA 3BT2H 1A7OL 5CCKH 1PJ9A 3FXIC 4GP8B 1C16B 3NCBB 4FQQA 3K8KA 3VE0A 3UZEC 3NJIA 4PJBA 2HWZL 2DOCA 1TQVA 4GRLC 4XXDB 3L5HA 2C9UA 4QRFA 4L3EB 4PJXE 4WTZA 4EXPX 3NA9H 1MCIA 2EP6A 4FZ8H 1QHQA 3VD1A 3BC9A 3VXPB 2QVIA 4CJ0A 2NLJB 1D5IL 5GRUL 3TN0D 2NW2A 5DR5H 3C08H 2MQCA 4QAMB 2VRQA 1PDKA 4AE1A 3H55A 4RMSA 3RA7L 4J1UA 4ONFL 1BJ8A 1CURA 3QEHA 1BFTA 4R8WH 1KLGA 1N0LB 1ITCA 2UYLB 2CHWA 3DPBB 3QUYB 4OF3A 5T1LA 4ZMPA 1LE9B 1N64L 4WFGE 3C60B 5LGYA 2A9BA 1D5BA 1KIRB 2F74A 2ARWA 3X14A 1JZ2A 1I75A 2Y7QA 5LWYL 1E4KC 2XZQH 4FLSA 3VI3A 1DN0B 1XV8A 3BKCH 4NQDA 2W5PA 2VDML 3OL2A 2A9NH 4YDLC 3WJMA 1U8QA 1YYLH 2CA3A 1E4HA 1CLZL 5F9AC 3HS0B 2VH5L 3G08B 1RQ5A 3L45A 2WIMA 3NFPA 2EECA 1AMYA 3CH1A 4WO4B 1UOWA 2Z35B 4KOBA 1EZVY 5JHDD 1WZLA 5DZ9A 2DS4A 2JCCE 2OJEA 3NZ8B 1WAEA 4IBSA 4M3JA 2VDRB 1A6WH 2FT8A 3DIDA 3RY6C 1A9EB 2IV8A 2CR0A 2J6EH 4P07A 4CW1B 2BNRA 1WA1X 5IVXE 1UQSA 3O2VH 3QO0B 2MNUA 1F6AA 4Z7WA 2BS9A 2FSEB 5B38B 1JI1A 1ITBB 3RIKA 3TZVB 5DQJA 5TK2A 1P4IH 4M62L 3SE3A 2WXHA 3MV8B 3SPHA 3KLQA 3S4SB 4ERSH 1Z3GL 3DI2B 2O6PA 5GRZA 5C97A 3G5ZB 1J5OH 3VB9A 2NNRA 4ELKB 5DJAA 2ZSWA 1HWWA 2BVEA 4LHUG 1OOWA 4RAHA 5L2JB 3W2DH 4BV1A 1I3GL 1SYVB 6CGTA 1UCBL 1J5CA 2V9UA 2ZOOA 4KI5E 3PHQA 4ZUUA 1ZOXA 1MCLA 1Q9LB 5JNYB 2L8AA 5B7FA 2A6JB 2MRYA 4XI5C 3EDJA 1OARH 4J6RH 3LB6C 4PW9A 3TIEA 2UWEE 1RUMH 1HT6A 3FRUB 3O2WL 3X1NA 2GYSA 1MCFA 3EYUH 2I26N 3CVHH 4GRLA 1MJ8L 5DVMA 1DL7H 1QPXA 1XH3B 5FCUH 2WO2B 4M1CC 3WFZA 4XCCH 1F4HA 1VKXB 5IG7A 4UDTB 2VLLA 1LK2B 1FL3A 3P3TA 1ZCRA 4XO4A 4E68A 2D7TL 1AG6A 1X5IA 4XVSH 1OAYL 4D9LL 4K9JA 3E6HA 3C09B 1P5UB 1QABA 5KBLA 3QA3A 1VFAB 4HUUB 1CDBA 3MRMA 3P11H 2ATKA 2YKLL 4WO0A 5IMKB 3WFHB 3ATBA 4HFUL 3WIAA 1I9IL 4NC1C 1EZVX 5CUSL 3DXAB 5F1KC 1MCHA 3VFRB 4BM7A 4DESA 5J6HB 1BD2E 5AD0B 2XV3A 2HFTA 3VXRD 1BA9A 2VM9A 1E4KA 2F7OA 5PCYA 2I9LB 2JNZA 4C4BA 1LMIA 5E7BA 2CIIA 2R56L 1Q8MA 5BVPL 4TTDC 4JAMB 5AAWC 3L1OH 4BUGA 1HNFA 4X0KA 3UZQA 4XOCA 4OIAA 3NJLA 4NNPL 1AS7A 2BRRL 3M8OH 3OF6A 3LV3A 5MERB 2C3GA 3K4AA 2DYRB 1P69B 5HHOA 4POUB 3EHBB 3JTBA 5HYQA 3BPNB 3ZE0B 5FW7A 2AQ3A 3OAZK 3I74A 4XN7A 3IU4H 5JHDE 4DP8X 3RZCD 4X5WA 3T65A 4KDWA 2VO5A 1ZHBB 2NYKA 3R1GL 3IBOA 5TK4A 2BNQD 2ED7A 1OSYA 1IM9B 5CLYA 3UPRB 4Q4IA 1PY0A 4CU7A 4NQSA 1AKJB 3CAFA 2H7WA 1A3QA 3GSWA 2OX5B 1CD8A 3QFGA 2NX5D 4WU5B 3WIFB 1DBKL 4R4FL 5KTEL 2DF3A 4TSBL 4R0LA 1WIPA 4UTCA 4G80B 4YXKH 1PZSA 2WNWA 3W1ZA 5CJXC 1R75A 1P2CB 3O4LB 5C07D 4FFVD 4UI2A 5HGAA 4JFFD 1ESOA 3UG3A 4HIEB 4CSSA 1UZGA 5J5EA 5IQ9A 4V1DD 1AHWA 3S8WA 4CSZA 3QNXB 4PJCA 2V8MA 3KYKH 4RGOL 4FNRA 2YK1H 3OKOB 3SDXE 3VI4A 1DQMH 2LTQB 5ESVA 1BVOA 2XPGA 4MDJB 1PNDA 4ONGH 1MFMA 1NC4D 1JPGA 5HVHB 2XIIA 3MR9A 5C8JB 5GJTH 2Z34A 3SDCC 1YQVH 5B8CA 4C55A 4U1HA 1LWRA 3GRBA 5B3SB 2LABA 2JJTC 2VSCA 1ZVHA 3U7YH 5E8NA 1T2JA 4M61A 4HHGA 1NDGA 4MQTB 4WKZA 3MOBL 5FO2A 2HKHH 3WNJA 1LDSA 2DWEB 2WN3A 1NMBL 4YZWA 1D5MA 4Y8DC 4PS4H 1CO1A 3N43F 1UD4A 5LO7A 4KRNA 4TRPH 2ZKHH 5DUMH 1E5BA 2VR4A 2BFVH 2EO7A 4JCWA 2YD3A 3MA9H 4RMBA 3DDFA 4PJFE 3LHPH 2AABL 4JO1L 1DQQA 1B6UA 3BAXA 1I9EA 2J88L 4WK2B 3UTSD 4LOEA 2A9DA 4PREB 2V5TA 4DKAA 1MW2A 2GVYA 2Q7AA 3VXRE 3DOHA 4P2CG 4R7NB 3MLUH 1NAMA 2UVFA 3WIHH 4HX1A 1RZJH 2BVYA 4M29A 3ZO0A 1P9MA 2L04A 2YGNA 3VFSB 1UM4L 1EGJH 1K4DB 4NFDA 5J57B 5ELIA 3S98A 4PJGF 3CVIL 4HV8B 5IY5B 1OB1B 5DZPA 4GAGH 4QXVA 2V8LA 4OFQA 2ZCLH 3NTCH 4FMVA 5HDWA 1MCDA 4MJ5A 4AJWA 4YFEA 3EO1B 1M3IA 3K6OA 3U4KA 2IANE 3MRIB 4R7DA 4RETB 4ANWA 5FGRA 4XI5D 4QO1A 3ATFA 5C0IB 1ET8A 4E41D 1DJSA 3V4PA 3X1GA 3S88H 1JV5B 3ERXA 1SLXA 2NX5E 1MJ7H 3QUMA 4KKBD 3ESMA 4AJVA 1S7RB 4Y5VA 4J3UA 5D93C 4MD4A 1HL4A 4P2OB 5GRWA 2BOCB 4IDJH 4KZDL 3UABA 4YWGL 1R5IB 4JDZA 4IRZA 1QHPA 5C07E 3V5DA 4BFIB 3AAZB 2BNUA 3ARFB 3V7AG 4HW6A 4JFFE 3TO2A 2JI1A 1I7TA 1ZGLM 2N7BA 1MXDA 1SM3H 2B4CH 2JLLA 3C2AH 1U8PA 3KPPA 4MD5B 5D7IE 1MHCA 4LFHG 1HVXA 1I4FA 3P54A 5KUMA 5F9WC 2GTWA 1T22B 3CC5B 2JJTA 4BQ6A 1DFBL 4NKMA 5JDSA 4IOFC 2NY2B 4XN8A 1I7ZB 4GQZA 2W0FA 3ABZA 1KCWA 5JOEA 4QKXB 3SBPA 3V79C 3DGGA 4JHUA 4YUEH 4A6YL 1VSCA 1IKNA 1U8IA 2VZTA 1YEDB 2E9JA 4MFHA 1ZT1B 2NY7L 3WEBA 1WBZB 5FYJU 2ZCZA 4WUUA 5BQ7A 3FO9A 3O6LL 5HYSA 4WDIA 3LPWA 4AQOA 4ABWA 4ODSL 3TPUB 5IHWA 2Q76B 4P23B 5ISZB 3FULA 1H3PL 3VXMD 4GW4B 4I18B 1MCWM 4M93B 3BZEB 3NJVA 1KCVL 2VAAA 1HWGB 1I9JH 1PFOA 5L2KD 3Q8CA 4N87A 4LCCC 5F7EH 8PAZA 3QEQE 1DEEB 2Q20A 2FUQA 4NKDB 3FQWA 1ZA3A 1YECL 3HAEA 4UIKH 3S8FB 1Q0XL 3LJ3A 3KD4A 5F3FA 3OJ2C 4J3SA 4L2YA 3F3HA 4Z3JA 4GQ9H 3V4LA 3FO0L 1OCWL 3EFOA 4DP7X 4X4YB 3DX7A 1OAXH 3FPXA 1DFXA 1AMXA 2R0KL 3BUPA 3MRRB 2YPLD 5EZIH 3LH8A 3SPGA 1WBYA 5KVGL 5EHFA 5CLTA 3VGDA 1HZHH 4EUPG 5DZJA 2CBOA 2DQCH 4XC3L 3WNIA 4PRDB 5C0ND 1E8XA 1YMHA 1L5GB 3QQXA 4WHDA 1Z9SA 4P3WA 1DJIA 1U6AH 2H6UA 1NBCA 4BCYA 4L8DA 2VQTA 5JHAA 2X3AA 3FUIA 1FFPB 1E67A 4Z3HA 3THMH 4AQ1C 3S48A 2AEWA 1AQ8A 1XF3A 5F7UA 3H6JA 3FB6A 4XOEA 4E41E 1OSEA 4IHOB 3B6SA 4MYWB 1CK0L 3GSOA 2A5UA 1T4WA 4BSWA 1E4XH 4ELMA 4JDTL 5DJ2B 3FSOA 5IQLA 2AQQA 2BSBA 3FU0A 4YXHL 1URZA 2VXVH 1E28B 1NGZA 3COOA 3LD8B 4N0CD 4NSKB 3QDMD 2A9AA 4NGHL 4E9WA 4NP4H 3H2WA 1LEIA 2FYVA 2VZ1A 2P9RA 1OWRM 1UKTA 1TR7A 2Y9RT 3TESA 4JO4L 4NQCE 2EDRA 5I8OH 5SWZD 2CUAA 3ROLB 4ZMZA 4M03A 4FLRA 4ZSOA 2V3EA 4HGWA 4DN3L 5KSAA 4I0PD 4BIKA 4DEWA 2EQDA 1JGVH 2X40A 4FJ6A 2QQNH 1YMMA 4RFOL 3RWCB 4X7TB 5ITBL 2OL3L 3ZZ1A 5EO1B 4DK6A 1QTYT 1YN7B 4PJ8C 3PL6A 5CCKL 4KQ0A 1D5ZA 4PD4K 4KJPC 4HJGA 3V7AE 1IGYA 4OGXH 5TQ0H 4ECNA 4HC1H 4OLEA 3T1FA 2ZWSA 1TZIA 2W07B 3BE1L 1IJ9A 1EZSA 1JPFB 1QX1A 2AK1L 2VQUA 5GZOD 2XBDA 1FSKC 5BZZA 3QT2A 2VZSA 2YFOA 3SCMC 2C7UA 1KZQA 3FQUB 3VXME 4NAMA 4PV9A 3NA9L 1L9SA 1JWSA 5DYOB 5EU7E 4AMKH 1HHIB 3MRPB 5C0GB 3AZUA 4AEHH 5L2KE 3DUSA 5EU3A 1IIKA 1RIHL 1RK1A 4N0YH 5E2TL 2NTSP 3NGBB 1KXTA 3C08L 5DR5L 3UYPB 2GTZA 3BX7C 3G5WA 4HUMB 2BOBA 4P5RA 3LN5B 3DIFB 2QGBA 4EN2A 1SBSH 3O8XC 3AY4C 1FZKA 1MNUH 2ZXGA 4N85A 1DZ0A 2EDXA 3TC9A 1UXSA 4FN0A 4HUCA 4MA1B 5GGVY 5F7BA 4BFJA 4WGKA 5ICZB 3C5ZA 3ATEA 1CZ8H 2YPLE 2C9PA 4UOW1 4WUKH 4BWTA 2XZQL 1G6RA 2EXTA 1VRSA 3O11B 4G42A 4ILDA 4O58H 2ZUSA 1UFUA 2AK4D 4I2XE 25C8H 5A2FA 4H8HA 3QORC 1F11A 2J8UF 4YHIB 2XN1A 2A9NL 3SIKA 4Y4FC 1FBIL 4TV3A 3FFCD 5DRXA 2H41A 2WWKO 4LQFH 4MSWA 4M8UA 3MJ9A 2GJZB 1EO7A 4KUZH 4ZUVA 3BVWA 1JVOA 3VG9C 4NENB 5DJ0B 4EZKA 2Z91A 4WI8A 3CQPA 5C0EB 3STLA 4L4TA 3MBXH 4OFDA 1IZJA 1XD0A 1A6WL 2X70A 1UC6A 4BKLB 1BJ1H 4U1NA 2J6EL 5G2NA 2PYEA 1YVLA 3LTVA 3IJHB 3GM0A 3O2VL 3DKHA 1KACB 2KQNA 4GXVH 4C57C 1QSZA 3C6SA 1A2YA 3MGTB 1XO8A 4LU5L 5T3ZH 1P4IL 2WC7A 5L4FA 2AQSA 1F58H 2EH8L 3S6CA 3QDME 3EKCA 3S35X 3UROR 3L95A 4ERSL 4L8BA 4H26A 3IETB 1WBXB 1J5OL 5C0DB 4MYPA 3OHXC 5E5RB 5BV7C 4I9XA 4QTHB 5SWZE 2J12B 2SEBB 3W2DL 2E9GA 3ARGC 3TASA 5KYYB 4N0FB 3GMLA 2X2IA 4PJ5E 3WNMA 3ZLQC 3R19A 5C7XH 3LN4B 4LBEB 2XNAB 3B5HA 2A7BA 1C5DA 3NEEA 1OARL 4J6RL 1MLCA 3B43A 3UBXB 4FTVB 5LAPA 3SYOA 1C9SA 1RUML 2FEJA 1SF3A 3CVHL 3E1F1 1DL7L 5FCUL 4XCCL 3TBSB 1OTUC 4L9DA 1UJ3B 4KTGA 4KK8C 3R4DA 4J8RB 3C8KB 4ISVA 4XVTL 3JV4A 4HDIB 1ZVYA 1BLNB 2MOVA 2IBBA 3EOBB 3H9HB 4NUMA 1PNCA 5GS0D 1QO3A 4PRID 1NANH 4Z7NB 3LIUA 3NUKA 4JN1H 3SPVA 1JXFA 4Y1TA 5B38G 3L3KA 3P11L 3ISWA 2FX8H 2YPKA 5LNGA 3GO1H 4DNLA 4MMXB 2EH7H 3I3DA 1FORL 3LYRA 3BEVB 3K72A 4LL9A 4NBZB 3CPUA 2YRZA 1RZIA 3D33A 3C8DA 3E8UH 5SWSE 1M71A 2Q6WA 3MROA 4I4WB 5E6IC 4CADA 3UH8A 4UTBA 4O02H 3UTTA 3L1OL 4GKLA 3OMAB 4YDVA 5BV7L 1D2PA 2CSPA 2AK4E 4MX7B 4XWGH 4C4KO 3M8OL 1YDPA 2NTFB 2NY4B 3N1QC 4ZAKA 1C7SA 2ICCA 3PWNB 5FK9B 2V5MA 4QXGH 4G3YH 2Z8RA 5JR1H 2A1WL 2R0LH 5E6SB 1IO4C 1TQSA 2EZ0C 2FJFA 5I17A 5F89B 5DD5L 4Y16C 4DPBX 4RFEA 2Y06H 3DBXB 5DA4A 4Z3IA 2SODB 4KJYB 4L9LB 5D1QC 3TNNB 4OI8A 3WFDL 3GTTA 4GW1B 4PJ8D 1NC2B 3RILA 1N5AB 4U6XA 5IKCA 4HQQH 1CDJA 5I0WA 4P2QB 4X99B 3LNEA 1MRDH 3T4YA 5E8DH 2VDKB 4ENZA 4PWHA 4Q7DA 2BP8B 4HJ1A 3P2TA 2UX6A 4U1IB 3QIWC 2EKJA 4YXKL 1JG9A 1NCOA 4J3OG 2YMTA 3L7FA 4U2ZA 3SCMD 5D6CB 4OQTH 5I8CA 3CLWA 4Z8FH 2EDEA 4J4PA 4U3CA 1NDTA 4GQRA 4NZFA 3QUZC 2HLFC 4P5MA 3TCTA 1TETH 3KEDA 1DE4B 3KL5A 3KYKL 4TQEH 2DIAA 4MMZA 1CICA 4DK5A 1DQML 1X5HA 3HCVA 3BP4B 4K7PH 4LXFA 1N8ZB 2GFBA 3O8XD 2OZ4H 3NSFA 2I60L 1YQVL 4M4RB 4RQQB 4IMLB 2JVUA 5FOBB 1H3VA 3GXFA 4K73A 4OJAA 4FQHB 5JIIA 3U7YL 2EEXA 1JGEB 4YSEA 2MHAB 3HLAA 3ISRA 2HKHL 3QNZA 4U0QB 4NPYB 2AV7A 3P77A 3MXWH 3FMGH 1T3FA 4PS4L 3RUGE 4WNQB 3CPLB 1KJ2A 4CVWA 3WAJA 3HR6A 1U3HD 4OZGB 2ZAIA 1NH6A 2ZKHL 4MJ6B 5DUML 2BFVL 4BE5A 4QTFA 3L13A 4F7PB 3MA9L 5J13C 1EAOA 1LXMA 3LHPL 5EC2A 2DB8A 3MLRL 4XVJH 3VYNA 1N6QH 1MZYA 1BX2A 3ZE1B 5EWIH 1RPUA 1EDYA 3HG5A 1G1CA 3OKLA 4X9YA 3X12B 4NUPA 3KG5A 3BP5B 3L4ZA 3DBSA 3MLUL 3MRJA 3WIHL 1RZJL 2CBMA 2D0FA 4IBQA 4ANKA 1QEXA 4WWPA 1MFVA 4HUKB 2X4QA 1EGJL 4GUPA 3BMVA 2XY2A 1RZGA 2DYPD 3S37H 4IK6A 1AD0B 1UHVA 3OBAA 1GH7A 1MI5B 4RBPK 2P45B 4GAGL 4XOBA 1T83A 3K8LA 4KROB 4XNYL 1XF5B 3ARGD 3NTCL 4JO2H 2AXWA 1F18A 5AVWB 4N25A 3T0ED 5GS2H 3EFFB 3D18B 3IFNL 3REWB 2DQDH 4P49A 2XKSA 1INEL 4GEIA 1RPKA 4TNFA 3T5WA 3VXOB 5F3BB 2RQ8A 2JQZA 2NYZA 4MAZA 3V0JA 1J0HA 1S7UB 3OSVA 1S8DA 3GQFA 3ULSA 2R1YB 4UUJA 5F7DB 3BIBX 4I0CC 3S88L 5BRZA 1RK7A 1JPEA 2VW6A 3NDZE 1MJ7L 2IWGA 3VFOB 3RQ3A 1OTUD 3VWKC 3BKYL 4GINA 4KK8D 4B96A 4HZ1A 3WUZA 4IDJL 3IDUA 5AVUB 2P8MA 4S1RL 2G5RA 4J6IA 3RBGA 4EIUA 2DW5A 2FWUA 2N0MA 4HWZB 4KKNA 1PX4A 1OM9A 5M94B 4PBWD 2CDFA 4IRSB 2UUDH 5EH1A 4Z18A 2QKIA 3FFDB 4I88A 4RISH 3NK4A 3F7VA 5I2IB 1IUZA 1GKOA 2WNKA 5CZKA 3ZZQA 3EDEA 1V8HA 1IQWL 1EMTH 4FKHA 3EH2A 3GBDA 2OQJA 4P57A 3IRPX 2X42A 5DXWA 5I0VA 3SGDI 4KXCA 3PAVA 5JO5B 5CP7A 2WLIB 1AS6A 3FUEA 4RMRA 3HPLB 4FG2A 1ADQH 4YUEL 5FM5O 3ZHNA 2Y69B 1Q94A 2VLRB 2K7QA 4HCFA 3QQNA 4PRBA 3O3EA 1T6BX 3D07A 2CA4A 2QSTA 2KZ1B 4I1NB 3VFNA 1H3XA 1XGQA 3GXNA 2NY3C 3LQAC 5TQ2H 4P3CH 4LZKA 2DWDB 2KLRA 2CCVA 3PGDB 3FB7B 1I9JL 1B4LA 4N5EC 4UQIM 5F7EL 2BK8A 2Y4SA 4ZFFB 4Z0XA 3DROB 2ZXAA 4AKPA 2VXUH 1SDDB 2KDGA 1M2VB 3GSNH 4UIKL 1WQVT 3KBPA 2ILLA 2DJUA 2HVJA 4LP8A 2