2IO5A

Crystal structure of the cia- histone h3-h4 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
154
structure length
154
Chain Sequence
b'MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASF1A protein
molecule tags Chaperone/structural protein
source organism Homo sapiens
publication title Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
pubmed doi rcsb
total genus 28
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2io5A00
1ROCA 4RRPM 2HUEA 5C3IA 1WG3A 2CU9A 3AADB 2DZEA 4EO5A 2IO5A 2Z3FA 2IDCA 2IIJA 1TEYA 2Z34A 5BO0D 5BNXD 2I32A 4ZBJA 5EIIG 2YGVA
chains in the Genus database with same CATH superfamily
2V7HB 4KFZC 4H25B 2LV4A 3S2AA 4KUCD 4AQAB 3CFIC 3WIIH 4AQEB 2BSCA 2ZAHA 4P9HH 3IS0X 1IMHC 1W72A 3PWPD 2ICWI 1IGJA 4Y4KA 4LIQE 3QYMA 3S3DB 1A8ZA 1VENA 2BHUA 3HZVB 1R1CA 5KANI 4U4IA 4G8GA 2W38A 2W9DL 2YUZA 1RZIA 2IH3A 1SDYA 4PVMA 5DUML 2LHAA 3C09C 3S36H 3FCBA 2P26A 3V0EA 3M8OH 2WBJA 4CADB 1E4XI 3NIFF 4Z7VA 3NZHL 2FR4B 2VDNB 3FQWA 2P8PA 3BLBA 3MCKB 4O4YH 2YGNA 1NINA 2R1WA 2GTZA 3WKQA 4P5TB 5EF3A 1T4KA 3ME0A 1MCWM 4U6YB 4GAYA 3QI9A 3O8XC 2CRYA 2F1BA 2DQUL 4JN2B 4OCXH 1I8KA 3QNXA 1JXGA 3TF4A 3DMMB 3BP5B 1AAJA 2H2PC 2YAEA 2MKLC 3JZYA 3TBWB 4J8RB 3KJ6H 4MNGB 2YBRB 4LL4A 4M5ZH 4PRPB 3DO7A 2B1AL 2I32A 1QSZA 1BFTA 1KY7A 2WINB 4RISH 4APQB 1UA6L 3EYVA 3EOBA 3UBXB 4ZMXA 1VFOA 4WUUB 3HB3D 5E8NB 1HCFX 3NA4A 4AQZA 4K9EC 1SOKA 5IOPB 2AEPL 5ABZA 2BSTA 1O5PA 3U0TB 1A4KA 2R29A 2WQWA 3IDIA 4LVOB 1S9KC 2EKJA 1OW0A 5IQ9A 1WZLA 3DECA 2OMWA 3HR5A 3JWNH 4ADJA 3DTXA 4HG4K 4AV0A 4OFVA 5F7FA 2LGNA 1U3HC 1HH6A 2ZKWA 1QRND 4BV1A 4NKDB 2AZAA 3HVDA 1Y1DA 4U6VH 1UURA 3UZVB 1MCHA 4R2GD 3NEEA 4G6JH 4DNLA 1EO7A 2OR7A 4AM0A 2D3NA 3GJFA 4G59C 2UXFA 4KI5D 3FQ4A 1WBZB 1FFOA 2K3TA 3NFNB 1T5XA 2BK8A 2CDEB 2C5DC 3EJQA 3RDTA 4QHMB 4HS8L 1DEEB 1OARH 3V4PL 5F9OL 1RZFH 3PHQA 4LPXA 3G04B 4BSWB 3UC0H 3DIFB 4OF8A 4AQEA 1RK1A 1F1DA 3T4AB 1PU0A 3DPDA 1DZ0A 5GGRA 3MLUH 3X13A 3G5YA 3APDA 3C6SA 3TN0C 3LEXB 5IESL 2A6DA 2Z91A 4FHKA 4KPHH 5DRWB 3MLVL 1JL8A 3FB8B 3F6JA 1DBBH 4QXWA 4FNQA 2ZX5A 4HP5A 1K8DA 3D06A 3NMEA 4OLYL 3G08B 1TVHA 4NS0A 1KJ2L 2LABA 3ELQA 1Y1UA 2VIRB 3NDZE 5CHNB 5F7UA 2Q7YB 2DQEH 3FU8A 4YAQA 2NW3A 3NGBB 1MQKL 1HQ4B 3BUYB 3PWPB 1AHWC 4XP4L 3GLDA 3FO1A 2QV4A 2WNWA 3FT9A 2FD6H 3MV7A 1E28A 3RVUC 3TBYA 5JPMC 1FC1A 4YPGB 1HZLA 2Y7SA 2EXWD 1L9QA 2YA0A 3MYJA 1NCUA 4FL4C 3NVQA 3HRZB 4CJ1A 2V9UA 4QY8A 4WFEE 4B9YA 3DO7B 1S7XB 1GA2A 3FFDA 3P0YH 5I1GL 3RX5A 2MTPA 2APBA 4AEFA 1J9QA 2SODB 3VTTA 2Y1AA 3KPSE 2VTFA 4QRUB 3AM8A 4OLVL 4Z95L 3TTSA 4EPSA 4K7FB 4PGZA 3L4WA 5I8KH 1NMAL 2H32H 4JZNA 1MVUA 5LGHH 2DF3A 3VU2A 4B96A 3WENA 4CSPA 4EI0A 1Q1PA 4UT9H 4QPEA 5DHXB 2GYSA 2H7WA 3S3CB 1GJIA 4KVNL 5EBWB 3VYOA 3BPLB 4S0SD 4A7SA 2Y3NA 2EDMA 1MH5A 3ZE2F 1U2HA 3RNQA 2ZCKL 3EG9A 5E08H 1DTUA 4W9DC 1CFQB 2ZD0A 1KDJA 3TESA 4QHUA 3S35X 1IZJA 2W1NA 4PJ9A 3FT1A 3X2QB 4Y5YC 4FS0A 4WTWA 3T4AC 2J12B 4JFZH 5HYJA 2EQDA 1GW6A 1J0IA 2R9HC 1LP9A 2FO4B 3H54A 4MZ3A 4OLWH 3ZDZF 4BSWA 1Q9KB 3VGGA 3F7VB 5I8CA 5KSBE 5D93B 3UZEA 2GUOB 1WBYA 5F71A 2UWEE 1LMIA 4GEJA 3WLWC 2JLPA 5C0CD 1BXUA 4BCYA 1FWXA 5F0LB 5JUEH 2XV0A 3UTQA 1NJ9A 1IGCH 4GMTL 3ARFC 2WP3O 4NXSA 2DWYA 2JMRA 5DGQA 3GEFA 4F2ME 4DW2L 3OWEA 5EZPA 5DU7A 1JV2A 3V6FA 1QFWM 2P9RA 4RNRB 1H15B 3GTVA 4YDJA 1PZCA 5B21A 4UDTA 1UXLA 1BFSA 2O6FA 3H7BA 3MR9B 4K9EL 2E4TA 3U6XA 4R26H 4Z7VF 4EAEA 3MC0A 3MLWL 4ABUA 3VWKD 2YEZB 3N41B 1FPTL 4UNTA 4E9RA 3VFSB 4YHKH 3NSXA 2YKLL 1TNNA 4AM0Q 4N8PA 2A38A 3D34A 3MRKB 4U1MA 3W2DL 1S7XA 2HWZH 4KKBD 1WG3A 4DEUA 3TWYA 4MXQD 2KL6A 3BPCA 4JG5A 3QUML 1PY4A 3PV6B 5LXGL 3GSOB 2WIIB 4PTUB 4DQAA 1KXQE 2FQEA 4L48A 4JRXA 4RMTA 2PCFA 2VAJA 4WFGD 3EGSA 1WZKA 1ZE3C 5IBTL 4Z3FA 5MEND 1CGWA 3MA9L 1YVLA 3IMUA 3CN2A 1NAKL 4H8HA 3H2PA 3IBEA 1KV3A 3OAWA 2OKMA 2VAAA 4IBTA 1IGFL 1JVKA 1XXFC 3WFBH 5B38B 1JSYA 3EG9B 3KPNA 4MA7L 5KJRH 4AK1A 4OIIL 1PZUB 4OQ1A 2EIJB 3PL6A 5GSRA 4KJQC 5F89A 4LDOB 4WWKB 3OJDA 2WZPD 4X4KA 1HZHH 4PGCB 1ET5A 1B0RA 1T7YA 3VXSB 1CT8B 4FJZA 1A6UH 1G7MA 3EDKA 1DO5A 3VE0B 4K3DH 2ZSWA 1KTRL 1QPPA 2VLRE 2GUOA 4M7LH 3KYKH 5DHYA 4BZ2A 4M29A 1QSEB 1C5BH 1B0IA 3HFMH 2RB8A 1J1OL 3PAVA 2CIKA 3QPQC 4RRPA 3QFJA 1XHHA 5JNYB 4ZXBD 2A9DA 4FYRA 4CN4A 4JRYB 1FORH 2NYYC 3CGTA 2R23B 1E5AA 5HVHB 1TR7A 3ZSTA 3VXTA 4FQLL 2SEBB 2H47C 5BO0D 1F97A 1JV2B 1PDKA 4ZW7A 1TETH 4WDIB 3U2JA 3SDCA 4MD0B 2VKWA 2UYLA 2VR8A 1XAUA 5IROA 4XMXA 3ULSA 4N68A 2L4OA 3NH7H 2Y69B 3QAZB 1DQLH 4OFYA 3SQOH 4PJCB 3UZEC 3FQ1A 4FTVA 1U58B 1VADA 3FO2A 5GS0H 2XLLA 2J8UB 4G42A 1PFOA 3LXCA 4KUZL 1BZQK 4MBOA 4FFZA 3GHEH 2GHWB 3DLQR 2XBTA 1Q94B 1M05B 4FYTA 3FTGB 1UM4L 4PV1C 1L5GB 4P48A 2HRLA 6FABH 1Z1WA 1F58L 2DQIL 4GS7C 2D7TH 4KBPA 4I77H 4PJXF 4PHZA 4ZUWA 2I60L 3LIZL 1JP5A 1RJYA 3WTSA 1S7SA 2MRYA 5GJTH 4XBEL 3DI3B 2BW4A 5EA0H 2JCCF 1RURH 3BKMH 1ZT4A 3N91A 2Q87A 3EYSH 3CZLA 4RISL 4X9YA 5IHBA 3DURA 1U8NB 2OCJA 5AZ2L 1JXFA 1JN6A 2GCYB 3FSVA 3L54A 3CFJA 3D39A 2BIPA 1A02N 2CXKA 3LV3B 4JFYB 3BLPX 3BH8B 2X70A 2RA1A 5EULV 2FX7L 3VRIA 3O81A 4EDWH 5BS0E 4L5FH 2E74C 5INCB 5HDQH 3DDFA 2VDNH 5KYWB 1OALA 1WVZA 3UO1L 4EQ3A 4Y8AA 3MOAL 5KS9A 1XXDC 1FSKC 1FZMA 4WWKA 1ECZA 3FUFA 4S1DD 4XHQA 4Y5XC 3MFGB 1GC1H 1EBPA 1OAQH 12E8H 4Z7UE 5BRPA 2CPCA 3REVA 3CIAA 2KZBA 3QFDA 4HKBB 4QLRA 3TN0D 3U4EA 3WKYA 2EUXA 5CILL 4L29A 4BWWA 3OQ3B 1T5WA 1F3JA 4W9IC 4K8RC 4GSQA 3KLLA 1T0OA 3VFRA 4PJBF 3LRSB 3MHZA 3TBBA 3EOTL 1QSEE 3V4PH 4PJIB 4XMUA 1MF2L 1YPZB 2WVUA 1OGSA 3WUWB 1ZRUA 3TO2A 1RZPA 2D7OA 1YYMH 1UM5L 3E2HC 4N20A 3EOYG 4QYAA 4TSAL 5FUCC 3ARUA 1WO2A 4RLDA 4GUPB 4EN2A 1KJVB 2CDFA 2IWEA 1Y7VA 3CQQA 1HWHB 4U1JB 3ZRCC 4AI7A 2P5EB 4BH7B 3OHXB 4BD4A 4RMSA 3SDCB 4YXHL 1PTZA 3OR7A 4PCTA 3MJ8A 4KKZA 3FK3A 1K8IB 2WM0A 1NIFA 1T7VA 3MRRA 4XE0A 2XWBA 4FQHB 5KVEL 5K9OB 2ZOOA 4MNHA 5E6UB 1YRKA 1ADQL 1YDPB 4OI9A 5B8CA 1JYNA 2PO6B 1J0KA 1Y07A 3IDJA 3S9DB 4XWOD 3QS2A 2BCKB 2COVD 2NXZB 2F5BH 4JFOB 4Q9RH 2RQEA 4FLSA 4FJ6A 3N44F 3KW7A 5AAMC 3RHWK 1WC7A 3TJEL 2K3HA 5A6LA 1BD2B 2UZIL 4HALA 1DCLA 4KKLC 4MGXA 3CVHL 1ANUA 1G7LB 1M9WA 4OD3L 4RAVB 1A6AB 4KOBA 2EYSB 2XVKA 1YYCA 2WSKA 3FUDA 4PS7A 4X9BA 3OF6A 3U30B 3QR2A 5DJXB 1EX0A 4JO2L 5IB4A 2GCYA 4C56A 4HJUA 5B3SB 1FVEA 1OPGH 2W9LA 1UC6A 3B9KC 1N6QH 4K15A 3ZHKA 3PUUA 4UBDC 4XI5D 5DMGD 3B3BA 3N9GL 3CZFB 4HK0B 4UB0L 5TD4A 1AHMA 4M5ZL 1IAIH 4HC1H 4GKLA 1T7WA 3IFNL 4F9PA 1MRDL 4GRMB 2IGFH 3QDJD 2QDWA 3V4UL 3IETA 1ZVNA 3GRWL 1P6AB 5FS5A 3SO5A 3D5OF 3AY2A 1LHZA 5CINL 1XF2B 5IB5B 3SPIA 3TCLB 4KMQA 2BSBA 3ARFB 1MLCA 2CJ3A 1YEHH 2APTA 3SKMA 3IVKB 5TQ2L 3QJFB 1IAII 2OSXA 1QD0A 5CGTA 3W0WE 1MIML 4MKTA 2PP7A 4PJIA 4XNXL 4KQ3H 4HUXB 4QGTA 1KBWA 2IANB 4QGYA 3N1FC 1MVFA 3QNYB 2EIDA 4NJ9H 4W9LC 5LCVH 4OZ4B 2Z0UA 4NGHL 1KJVA 4WWKC 3EJTA 2ZNWA 1TZIA 4XVJL 4TXVB 1F6FB 3GINA 4N8CH 4M7KL 4RAUA 5EO9A 2FSDA 4N0CD 3GMRA 2GSGA 1J7VR 4MJ6B 4Y4HA 3TCXA 5IVXA 2G4EA 3L3IA 1MUJB 2R2BA 4KXDA 1RPKA 4ZW8A 5CBAA 3MRRB 4GG6B 3D2UB 3LKNA 1OSYA 4LSTL 3L3OB 4ZUUB 4KK6C 4PVBA 3VH8B 5D7LA 1AQKL 2H1XA 3MUJA 3D8MA 1KBGH 1XL4A 2BSSB 1M7DB 5GGTL 5TF1H 5BO1L 2OJZH 1O6VA 4BYHA 5DEZA 3CPUA 4MAYA 5ID1A 3T1FA 2CD0A 1EEYB 2HKHL 1BD2A 4L1HA 1P0SE 3ARRA 1Z7JA 2LVEA 2ZOKB 2C9XA 1QYGL 2WWMD 5EU4A 1RP8A 4KC3B 3A0OA 4X6DB 2XPGB 5GRYA 3MJ9L 1KB5A 3NTCH 5GGSB 5T1DH 1XB8A 2PO6D 1BA9A 1RUMH 1EBAA 5E5MB 2KDYA 1JYVA 1BGXL 2JLLA 2CJUH 3PHOB 5CSZB 3ECQA 3TXAA 4HUCA 4GW4B 3MZGB 4QRSB 3K74B 1GCYA 4HKXA 5GZND 4L9LB 4NDMA 3BFQG 4XO3A 4L8CA 2XX1A 3RILA 3L1FA 1DYZA 1RUPL 3IU3A 3LNGA 2Z4QA 3MODL 5AAMA 2A9AA 4HSAC 4HX1A 3U1SH 4OLVH 1F42A 3SE9L 3RGVB 3RIAK 1LO2H 3BD4A 3AWGA 2FIKB 1IGFH 3I75A 3WFBL 2V5TA 2WBKA 2DW5A 5HI3C 2HB0A 2QGEA 3NRFA 1ZEAL 3FTZA 1ZLSH 4S1QL 4HZLA 3Q1SL 4UT9L 4WNJA 3HN5A 4K5LA 3ZDYB 4ORGA 4XTRD 3B7YA 1JMZA 1OAUL 2F9BT 2VLKB 3HFFA 4NSKB 4UT7H 4ABWA 4QHNA 4P5SA 3QUZC 2XQYA 3BN9C 2UY7A 2YKKA 1JPTL 1D5BA 1KCBA 1PX3A 3TNNA 3WOVA 4ZMWA 4XZ4A 3TEUA 3QUGA 4UQCA 1YA5A 4KVCH 4GLRI 5HI4C 5J0BA 3AG3B 1T0MA 3BIAX 3PJLA 4F15C 5IJCC 1S7VB 3NP3A 3MA7A 1P7KA 5JO5B 2P47B 3FDWA 5CSGA 3MZTA 5AALA 4Z3HA 3O3DB 3GMRB 2XN2A 4Y4HB 3H9SA 3S8WA 1ZANL 4OQTA 3KLDA 4FQLH 4BIKA 3CMGA 1FV1B 5I19H 1M2OA 5GGRY 5D9SB 1QR4A 2XSKA 5IQ7L 4IMKC 5AL8A 1MDAA 1XF1A 5C0EB 1M7DA 2E9IA 4ODVH 5F7EL 4E2OA 3BUTA 3M1CA 3SJVE 1N26A 1CU4L 5CEXA 3R7QA 1TU2A 3EJJX 4YL4A 1IBYA 1PFCA 1EEYA 3VI3A 2TRHA 4PS3A 4GAGL 3WL9B 1T89C 3MV01 4ZTOH 4HDIB 2BS8A 4HSCX 4AGLA 5DJDB 1AGDA 4X8JB 5F7WC 2VMCA 4M1GL 4WTZA 4M5YL 3SOBH 2F8VA 5JPNA 4PJIE 3P3SA 1R24B 1R3JB 4YEFA 1D2OA 4FD0A 4PTTB 4X7EC 3WIFB 2FJFB 4OCYH 1FP5A 4PP2A 1Y18A 1HE8A 2ZX9A 4QRSA 2D8KA 4PJAF 1IEHA 3U4BH 5SWSB 2P8LA 4L1LA 1KJMB 2BFGA 2V7HA 2APFA 1QBAA 1WDAA 2MOGA 4X6BB 5KVGH 2DDQL 4OF3A 1T6VN 3IGAB 2VJ8A 2AV1B 4AITA 1F56A 4PJCE 4EXPX 4K0OA 3F64A 5GRWA 1J0ZA 2ZYHA 1EHLH 3ARZA 2FIKA 3BAIA 3I75B 3IXTA 1XF5A 1BFOB 1MOEA 3UO1H 2HFTA 1I9JH 3VFWA 3D4GA 4XO9A 1TJHL 1KEML 5CKAA 2IH3B 3EJCA 4ORGB 5KW9H 2Y9RT 2V2XA 2BMKA 4IGBD 2AJYH 3MX0A 3T8VA 3X1GA 4G6JL 1GGIL 4NQVA 43CAB 4HU8A 1GC1L 3B9VA 4QHNB 3BAXA 2VABB 3PABB 4G8IA 4DFHA 4S11A 3PGCA 2VSKB 3MLXL 5E95B 3RVXC 2WD0A 3MBWB 5JMRA 3Q3GA 3KLKA 4K23H 4R4FH 3BZ4B 1NCAL 3LZFH 4KH9A 5HYSG 2Y06H 5KJ7E 3ECBB 1VFBB 2A4ZA 4JN2A 3QI9D 4FFWC 1MWAH 1IE5A 1IC0A 4DOHB 3DSNA 4MJ2A 5SX5K 4NQCE 3FFCE 1IM3A 4JPSA 4LB8A 2AJVL 4G7SB 4P57A 4N3UA 4YLBA 4I4WA 1TCMA 3EOBB 2WUBH 3FCSB 4TS6A 1MEXH 2J8UE 3GZKA 1MW2A 4JREC 3RZCC 3P3UA 1A4KB 1ZK9A 4MASA 4JQVC 5CJQH 4YFLI 4ES8A 5IW6A 2EILB 1YEFL 1SHXA 2DQGL 1QP1A 2PXYB 4FFZL 4YHML 5IF0B 5DVMA 3HTLX 2AI0H 5SX4I 3GBNL 3UTSE 2V2WB 2O93L 1JFQH 3V9CA 3UG5A 1FRGH 1IBHA 4X8JA 3T08A 2Z31D 5JIKA 4GOSA 3OGCB 4X7SL 1NIDA 5FGSA 1KG0A 4L3CB 4UM8A 2QVIA 4W9KC 3O8XB 4I88A 1D7BA 5IJKC 4RZCA 2CDEA 5BS0D 2GB2A 2KHAA 1IV8A 5C1MB 3BRGC 3GKWH 2NTFA 4Z3GA 1CDJA 1WAPA 3DV6B 3CZNA 3PHQB 2D7TL 3G04A 3KBHE 1GR7A 4LSUH 4X6BA 4AMKH 1BEYL 3UBXG 4HYTB 3M07A 4XPBH 5FYKL 1RK1B 1J88A 5B3JF 4RMBA 3QJUB 4ZSOE 2L7UA 4U3CA 3OB8A 4JZJA 1XSOA 2A6DB 3TPUB 5FCUL 2ZOLB 4OM0L 4NKIL 3RDTC 4N8UA 1QTSA 2OLDA 5DS2A 5J6SA 5JPNC 3BW9A 3O3BB 3O45A 1A7NL 4H1LA 4PJAA 2I9LA 3UYRL 4BQ9A 1CXLA 1SLWA 2B77A 2B4CL 3FN0L 3GUFA 3V0IA 5IROD 1FFPB 3FRPA 3D39E 3KCPB 3H9ZA 1I8IA 3MBWA 4NC1E 3UJJL 2V9RA 4TYUA 1JK8A 4WVRA 5SWZB 3PJSB 2ALWA 3UTPD 4BUGA 4HC1A 4YPGA 2P5EE 5LAXA 2BH0A 4EUPG 3CK0L 5C6TL 3QYCA 1W6LA 2Y7MA 4RBPK 1BM3L 3T77B 5E7BA 4XCYA 5I74C 1A7RH 1ZLVH 1RZKL 4P57B 1A7QL 1R5WB 2A9NL 5IB2B 4O58H 5D7JA 1JHKL 3GB7A 3WHE0 5AB2A 3HZ3A 5KVDE 3WO3B 2QFPA 4FTVE 1CD8A 3K0WA 5EIIB 4U49A 4QF1A 5ALCL 5C0AE 1T1ZB 1JRHI 2IO5A 5IW6B 2VZ3A 2H0JA 4UZUA 5HHVL 3M88A 1ONQB 2JFCA 3QDAA 4JY4A 4L9DA 5JHDA 1UASA 2UVEA 1B4LA 2X6BA 1F4XH 3VM5A 4OM1L 1MH5B 2DI8A 2D2CC 3V0AC 3SDDD 1CXIA 5FM5M 4K5PA 2FCBA 2GIMA 1IX2A 3O6FC 2AK4B 4XB3A 3UG3A 3TYGH 5KSAC 3QFJE 4YPJA 5IR1A 2JF1A 3ZVVA 1KG0B 5C9JA 5T3XL 3KPSB 4WW1B 2HWZL 4QTIH 2HMID 3HHSA 4RCAA 1EA9C 1RJLB 1XD1A 3OC5A 4C57C 3DJ9A 2NTFB 5KSBB 2XKSA 3A6CH 2WLNA 2C1PA 1XEDA 4E9WA 3UAJA 1RZGB 2XTJE 3UTTA 2AXGA 2NX5B 5CD3B 4NKQB 1RUAH 4S1RL 4H8WL 4HGKC 2ITDA 3TBTB 3QULB 2VB5A 3O4OC 2XWCA 4TPRL 4UQIM 4FZ8L 4J4PC 1MJ7L 2XIBA 4D8OA 2YSSB 3QEUB 1HOCA 2BP3A 2NUPA 2X44D 4M3JA 3KJ4B 3WFHA 1LNUA 2HVJA 3KPLA 5AVVB 4E9TA 3W9DA 1RIHL 3I6GB 1IIIA 2XNAB 3MRQB 4GSXA 4P2RA 1E4WH 3FRPB 3UP6A 1ZSDB 2F1EA 3CZJA 5EUOB 3DUUA 5DRNA 1WITA 4Q6IA 3X14A 2FBJL 2M2DA 3CDYA 5C0BD 1HN1A 4HIXL 4N0FB 3BWSA 2QKIB 2MNWA 4EIBA 4CUCA 3RAJL 2FQFA 3CFTA 4NWUH 1MCWW 4KMLB 1KJ2B 4OF6A 3UIYA 2KZ1B 5K1NA 1KELL 1WRFA 2X4UB 1ILUA 4WUKL 3VG9C 3VTAA 3LS5L 1RD6A 2XDHA 3ATAA 3NCCB 2OMBA 5I1JH 1ORQA 4JW3A 5JXAL 1IAOA 4L4VB 3LXBA 4LQFH 2O5XL 3W3BA 1QW9A 3FN3A 1NGQH 2DIAA 3LH8A 2VDKL 3EGSB 2KT6A 1HI6A 1FC2D 4G43B 4K3JL 1VFAA 4NN6B 4CMMB 5LNGA 3MNWB 3U7WH 5T1JA 4K2UL 5I8EA 4ODVL 5F7EH 2ADGA 2H6UA 5EV7A 5TE7L 1B3JA 4YDZA 1MFDH 2AK4A 4FZEL 1YY8A 1A7OL 2FX8H 3GHEL 4G6FD 1SXNA 5FFLA 1M56B 2GI0A 4PJIF 1GGTA 3CWGA 4AV5A 6FABL 5EH1A 2H45A 3K2UL 2FGZA 1QBMH 4ZPTA 4YXLH 1T83C 4UT6H 2OX5A 3AREA 1S9VA 4ELMB 5HYJE 1AZNA 1S5IL 2R8SL 2EEDA 3MRCA 2DY2A 4PJDF 1UG9A 2K6YA 3P9WB 4HUWB 5IVZA 2J6EL 1AP2B 1A6VH 2LU4A 4TQIA 5KVGL 2F54B 2V8LA 4HHWA 5JNYA 3K3QA 3WHE1 1YNLH 4NCC1 1WA2X 4P99A 3TYFB 3IBOA 4JFHD 3ZTCC 2PYEB 2VDQL 2XNAA 2JKXA 3Q7JA 4IOIB 1AZBA 4MD0A 4MMZA 5FEBA 1VZGA 2CKBB 2CNYA 4RFOH 1T0PB 5B3JE 4LRNH 5DRNB 3QDJA 3Q44A 1F3DJ 1AE6H 5D96B 3FONB 3UO8B 1AIFB 5HDOA 4JDEA 2R4SH 3T8XA 3T71A 4J3UA 1EXUB 4KGLA 3RWJA 4BSVA 1U3YA 4UV4L 5DO2D 2PPFA 4O9HH 3WN6A 4OCWH 4LSDA 1N7ML 4IHOA 3QRGL 3RWFA 5AOJA 3SDCC 1RJYB 4FXKB 1W16A 4ODHH 1MW1A 3I84A 1ORQB 1QVOB 4PJCF 1BF8A 2VC2L 3MTRA 4MQSB 1XFPA 3P9MB 4ZBJA 3DBSA 3DV4B 3LNFA 4B95C 4KK8C 3D39B 3UG4A 3OVUB 2HMIC 3F7KA 5E7FA 4FERA 3Q9PA 5AUMA 2O5NA 3LV3A 4JFYA 1UYWL 3RTQC 4F7PB 1AJ7L 4BKLB 3H2WA 2F5AL 4MZIA 2HFFA 1DUYA 4F5CE 4RGNB 1BV8A 2GG1A 3X3FL 1JPGA 4FQIL 4IBWA 3EFOB 3HKFA 5JW3L 3L9YA 3MRBA 1EZVY 5SV4A 5AZEH 1I1RA 1ZDQA 3ZTNH 1XF4A 4WK4B 2RGSA 1FZKB 4NN5C 1QHOA 3K7UA 1GAFL 4KY2A 1KYOK 3B9KB 1FJ1B 2AJSL 2OR9H 4XAWL 5EORH 4JQXA 5DJCB 4F92B 2BIHA 3BO8B 4GAGH 5CFHA 5IUCA 5IWLC 2I9TB 1KPUA 3L3HB 7FABL 1ACYL 3SEPA 2X6CA 5C07E 25C8L 1N8ZA 4HUWA 1M71A 5E0QA 5ADOH 3LNDA 4JANA 2NSXA 2F54A 4TQPA 2VDOH 2B8OT 4QHKJ 4XMLL 1E8ZA 1FLRH 2NXYB 2HRPH 3HMXL 3KXFB 4HIEA 1JNLH 5KAQF 4JFQB 4MMZB 4M9PA 3SD2A 3TA3B 4DZBA 4NKIH 3MUUA 3RWHB 3VVWA 3WNPA 4X5WB 3TN0B 4TRPL 3JT2A 4IEFB 4KKBC 2OI9C 3GSNL 1MG3C 5J8OA 4GJTB 2ADIB 1CFVH 3OQRA 2ICWJ 4HVBA 4POUB 4JFOA 3JTTA 1XCXA 2XWDA 5EPMA 2ICEC 2AJ3B 4MQXD 4OZIE 1HIML 2W07A 1VFMA 2ZNXA 4PREB 1P6WA 1QVOA 3WLWD 2DWXA 4N6RA 2LLGA 3L5IA 4HFUH 4MD5A 4P2QA 7TAAA 5J12B 3ULVF 3B2UD 3WTUA 2ZF8A 2GJ6E 3MFFA 4UIKH 4JDTL 3OKKB 4U6YA 4R96B 4F7PA 4HU2A 4L5FE 4Z0BL 5DK0A 1X9RA 1XMEB 1AQKH 1UD2A 3IJEA 4MS8C 1JVOA 1JJUA 1TQSA 5FWRA 1ZA6A 1JGEA 1F4XL 2ZAGA 3GNML 2XOTA 4BZ1L 3RZWA 4HKZB 4PJGB 3NA9H 1DQTA 1J8HE 3NIDF 3NSCA 4OZFA 1CF1A 1KIQA 3B9AA 3TCLA 1D2PA 3L95A 4X2UA 3KYNB 3B9KA 4ETYA 5TJWK 4YDMA 1YEFH 1RCYA 3VI3E 3TVMC 4AXWB 2PR4H 3DX8B 3DTXB 4PEEA 1HX0A 1KPVB 3TFKC 1V27A 4F9PC 1FE8H 2RH0A 2RAMA 1DBML 1CF8H 3IU4L 1FZJA 4PCKA 2C9VA 4ZW6A 1M71B 4FQXB 4NO2A 5DWUH 2GY7B 2CJUL 5HGAA 1LO0H 4NPKA 2IANA 4K7PH 4GW5A 1BPVA 4X98B 1XB3A 4M6NL 5FYKU 3NDYE 1PZDA 3B5HA 3O2DH 4Z7QB 2GTQA 1C16A 2YGOA 3QB7C 4BGDA 2A2QT 1TQBB 5D7LD 2H2SC 1AYRA 2UZXB 1ZTMA 3BSZH 3PQYE 2X4OB 2C9UA 4GW1A 3DMMA 4NLAA 3NSYA 4YK4B 5GGQL 5KZCB 3IGKA 4LLQB 1L0XA 5FOJA 3LZNA 1P84J 5CBAB 4GG6A 5FYKH 1V54B 4PB0L 4DUXA 3ZJAA 5HHNA 4F7MB 3HPLA 4NZRH 4QRRA 3L1EA 4GRLC 1W91A 3QHFL 4DO5A 1RY7B 4HWEH 5JDJA 4JM2A 3R0MA 3BYYA 4ZFZB 1EDQA 1I75A 2J25A 1PS3A 5EPMB 2ZCKH 1TXKA 3MRNB 4W9HC 2WZ5A 4B7IA 2NLJA 4UINL 4GKNB 4GINA 5CGMA 2IQ9L 3OKOB 1WZAA 5BZDA 3V0VA 5ITFA 4WTZG 2Q7AA 2NY3B 3APFA 4Q2ZB 3P4OB 4X6DA 4DEPB 1KIRB 2X4NB 1SLXA 3EDEA 1BVOA 1D9KC 2VUYA 4IRSC 3PHOA 5FA3A 1T2QH 1KTDB 1AZUA 5HTSA 4U1GC 5DK0B 4IHBA 3HRZA 1JPFB 4OLZL 2OTUB 3OD3A 3P0YL 1LK3H 1O75A 2ICES 3P0VL 4O58L 1MFCH 2XWJA 3RFRA 3ZZQA 2EDLA 3U7WL 4ABVA 2Q8BL 5L9DL 2F74A 2PPDA 3IJ9A 3QIUA 2ZUTA 1RUQL 2DAVA 4KXZH 3LPGA 2A9CA 1BF5A 2VITA 4J28A 5FKPA 3WNJA 5AKSA 5I8OL 2H1PH 4UOJA 1TJMA 5DD0H 5HYQA 5A3ID 4BFNA 2XACC 2DQMA 3QUKA 3TLRA 1EXGA 1V7MH 4HIQA 4MAUL 5DFVC 4M5YH 5GIRB 4H2AA 4PJDE 3ZYZA 1IC5L 3B2MA 1IM9A 5T33H 2UY7B 3RPKA 1HJCA 2FTAA 4NHUA 3NCEB 4WHTB 4X8CA 1G7HA 1TVHB 2R0LH 1H6FA 1T21B 4I0CC 1WSST 2FUQA 4X7TB 5T3XH 2F7IA 3NPSC 1W0WB 1DO6A 3QARA 4HHGA 4ZOCA 4S0HA 4XP6L 4JGJA 3T2NH 2X4OA 4QHPA 2FEEI 3EF7A 3FQUA 2Q10A 4N90E 1YN7A 2AERT 4NQDB 4UT9A 1G7QB 2BRQA 5FKAB 3SBQA 4ZS7L 1DVTA 1I1AD 3HC0B 5HHNB 4F7MA 4S1DC 2MQ0A 2O4EA 4K5NA 3OKMA 3ABZA 2H32B 1A7BA 1NCHA 2Y6SD 1GGIH 4HS6B 2DTML 3Q01A 3X17A 4XNZC 1JGDA 1UXMA 1V3JA 4JHBA 4K94H 4XNBA 1E27A 2OMXA 4DGVL 3WEMA 2YA2A 4UANA 2IADA 5LBGA 4KI5C 1EZSA 3LN9A 1NCAH 4CW1B 5ITFB 1ETA1 1H15A 4YDJB 4G1EA 1ZK5A 3RG1C 3PWVA 1UWFA 4U0QB 3WJLC 1LWRA 4N22A 3VX1A 2BOBB 3BP6B 3QZMA 4FULA 4F37K 4F2EA 3LSOB 1WA1X 3ZYJA 1CPUA 2AP2A 2H6PA 3ARDA 3ABMB 4UTBH 3QIBB 3KPMB 1KGXA 2P8LB 2X1PA 5ACZB 1ACZA 2O6EA 4AT6B 1KELH 4U1MB 4HV8A 4Y5VA 5D1ZI 3C5ZD 5E4EB 3KGSA 2JI1A 4FQJL 4C56E 4MX7A 1S7RB 4EI5B 2E9JA 1DVFB 4B60A 1G9ML 5AD0B 5MEOA 3JV6A 2FBRA 1I9EA 1GC1C 5JXAH 1Y6KR 2N3JA 2WXOA 1QRKA 3I6LE 5EZJB 1E6OH 3MLTA 4OJCA 4ZO7A 4ZMNA 1G1CA 2V2XB 3S35H 1QFUL 2EICA 5HGDB 2H3NA 3FQTA 4RRPG 4IM8A 4OFPA 3COOA 3T4YB 1MFUA 1H6TA 5F6HJ 4OU3A 1WFUA 2WV3A 3PV7A 2NDGA 4MA7H 4GKZA 5JHDD 1K5NA 4NHUB 3O0RL 3WKNA 3AXLA 4KUZH 2AZUA 5BPPA 1HCVA 4AGNA 1ZV9A 1CE6A 2P45B 3K6SB 1OLLA 5AVSB 4XN7A 3TL5A 2DPKA 5GJSH 1IC4L 4PRIB 3GUTA 4NZTL 2B59A 2HLAA 2I85A 3S37L 1YAIA 3EOAB 5HD8C 3KYOA 2WO4A 4Z5RA 4R90H 2P3YA 4DO6A 3PY9A 4V11A 2XKNB 5TGBA 3KYKL 5AG9A 1JS4A 1PKOA 3EFFB 4JPVH 3FB6B 4KI5F 4LNRB 5FCUH 3RX9A 1S7TB 1WWAX 5D1XC 1ADQA 4PRNB 3GC3A 1QSEA 4ODSL 2H32A 2XPZA 2MEJB 4I18A 4CMHC 4FQ2L 4Y0GA 3KL5A 1EGJH 1MCEA 1QA9B 3BEVA 3BJ91 1IKFH 2WKGA 4PJ7B 1QUNA 4E9VA 4QTHB 3CPLB 3VXTB 2SEBA 3KE0A 4PD4K 3H9HA 4HS3B 3KGUA 2IMMA 2ZSVA 4RMQA 4NERA 3WY1A 4U6VL 5EU5A 4XE5B 3G6AB 1NAKH 1W0VB 1IL1B 2Z7YA 3QUMB 2VZTA 3MCG1 2IPKB 3FZUD 4XX5A 4XNAA 1FBIL 5DYOB 3TPKA 2H9GB 1JHKH 3NRPA 3FTUA 3EBHA 3WTVA 2VN3A 4MNQA 3SY6A 4DKAA 1Z5HA 2R0KL 3OAZK 1PLAA 4IK7A 4UNVA 1WEJL 2C7FA 1MCDA 5F44A 4Y2NA 3II3A 1BSIA 1NGZA 5TFSH 5HHVH 4FFYA 4F93B 4JKWA 4MCNA 1GGCH 1RZ8B 2F19H 5AEAA 1ZT4B 5DZNA 5KYXA 3VGAC 5ERWA 4ZX5A 3NZ8A 2JKWA 2D0HA 3BW9B 3O3BA 3O45B 4H1LB 3WJLA 3O8XD 4IOSD 1R6VA 4F8NA 4UV7L 5DJ6A 5FYJE 3PWNB 1RHHB 5AW5B 5D6DA 1FVDB 2B0SL 4KRMB 4YQXH 4G9FA 1M7IB 4KZDL 5AYUL 3BZDA 4H5SA 4QTIL 4RFEA 3HZKB 1MJ8H 4HGWA 2QBWA 2AK1L 2I26N 1ZE3H 1JZ7A 2VDPB 3PWLA 2BDNH 4ZOBA 1E5BA 3ARED 1N8OE 2HLAB 3QIWC 1RXLA 4HIIA 3VFOA 1TLMA 1Z32X 2YQGA 2G0KA 2P24B 4XAWH 1SY6L 5EORL 1A3RH 2ATKA 5IV2A 1T5WB 4FNLL 2HT4D 3FB6A 4NO3B 5I6LA 3KPQA 3BQVA 3QXVA 4U6TA 1PY9A 1EMTL 1QRNE 4I18B 2H3KA 5DTFB 4YUEH 2AJZA 3IFLL 2J20A 1KCUL 2OQJA 1QA9A 3BEVB 3BUDA 5ISZA 4XNDA 2CKBL 3PDOA 5EZIH 4YGVB 5DD3L 4PRID 4QTHA 1HNGA 2ZKHH 1H3UA 2OPCA 5FYJD 4WCYH 3V4UH 2YOAA 5CP7B 2GC7C 2PXYC 3PGDB 4ZK8A 3VW3H 4TRPH 3P54A 3IDYB 1CC3A 2MNJB 3MJ8B 3V4PA 4G11A 4IYKA 4EDWL 5I15H 2VL5B 1KOAA 1QO3B 5DS8B 5JOPD 2VXSL 3IDMA 3QG6A 3CUPB 3VXSD 3VWJA 4O5LH 4ODXB 3EHBB 5I1JL 3DPBA 3MV11 2AQ2A 2F7RA 2HVKB 2V6HA 4OUUA 3UERA 2AMUA 5JA9A 5DS1A 1LO3H 3CLFH 4P2YA 1A3LL 1HDMB 1Q0XL 4K3GA 4P4KC 1KXQA 5SWQA 2XICA 4GO9A 5F9JB 1FGVL 2XTLA 2VDMB 2X6UA 3IN2A 4K3JH 2CHXA 5AVRB 5AB9A 4WU5B 3GO1H 4BFIB 4XCEA 5IY5B 3LRMA 1VJSA 5JUEL 4YHYC 1WAAE 2ZYIA 2QQNL 3WUWA 4M6MH 3TO2B 5H2BB 2G5BB 3Q8EA 4JCLA 4X9FA 3LEVH 1ND0B 4GUPA 2DJSA 3BKYL 2ITEA 5JHBA 2HVBA 3NOIA 2BVPB 2X9WA 4MAUH 4GRMA 3T0DA 1MDTA 3OLGA 1I85A 2KPWA 3D2TA 5T33L 1K4DA 1NWOA 4P23D 5K1VA 3PWLB 1NBVH 1QFHA 4N9OB 4FQHA 1H0DB 4D2NA 1D5XA 1AGFA 3T0ED 3QDME 3Q2LA 3VFOB 1L0YA 3FTYA 3OZLA 4NIKB 5B8CB 4PWGA 3W2DH 1H3VA 1ADQH 5E5RB 4AWJC 4UQEA 5I26A 2BC4B 3F05A 3KPQB 5E9NA 1UT1A 4DKEL 3TT1L 2ORBH 2HN7B 3V5KA 4L37B 3HZYB 4Q9BA 1U0QA 3HNVL 3S4SG 1P7QB 5IIEA 2LU5A 1NTDA 4P23A 4NJ9L 4WQOA 4MA3A 2AQPA 1CI5A 3F83A 2FECL 3KLSA 4M7KH 3TP4A 3V4LA 2L7EA 5A6MA 2PCPB 43C9B 5F7BA 3PGDA 3K4DA 4WU7A 4PJ7E 3CMOH 1F4HA 4EZJA 4M43L 2R4SL 3VFNB 2VQ1B 5BJTA 1JZ3A 3HZMA 1SMOA 3SJVB 4AMXA 4G6ML 5E8OA 1A4CA 2UWEF 4XP9H 4OFKA 1DBKL 1TZHB 3VXPB 3PHSA 5BZXA 3EO9H 5EEYA 5D8JL 3TZVC 1MCBA 5D7LB 1W15A 1GGBH 5D7KE 3U83A 3CUPA 4TTDD 3VAEA 7PAZA 1A6UL 1OAUH 4UT7L 1U92A 4Y2DD 1S9VB 3DX6B 4ZDHA 4G6AC 1T22B 3V79C 2A9MH 3KHQA 4Q6KA 3QGVA 5H37H 3TGXA 1DVFC 8FABB 4G82A 5C0FB 2J2ZB 1R3LA 1TENA 4Q8BA 2Q2LA 1VEPA 4OSUL 2IGLA 4RWYL 2ICWA 1ZHNB 1NAMA 4L0PB 2XPGA 2NZ9D 5T5NF 4HOMA 4GUCA 1CL7I 1Z9OA 4OGXH 5EOTA 1KCVH 5E5MA 1IRAY 5F0PB 4A2FA 4IOFD 3AREC 1ND0A 4NRZB 3CFDB 2NY6D 1RSFA 1URLA 1IGML 5E6RB 2F0CA 4HCIA 3JXAA 4GXVL 2HX7A 2WGNB 2VR3A 3NEOA 3S5YA 2BINA 3LB6D 5B1CA 1M7UA 3MV7E 1QKZH 1DBJH 1ZTXE 2FEDD 1KLUB 3AITA 5I17A 1F13A 1E43A 1A9BB 2QZ5A 4RX4D 3OBAA 3QQ4B 3AGWA 4HF5L 2NY3C 3L3OA 4ZUUA 4K71C 4YDKH 5H94A 4N90D 5SWSE 1A1NB 1CLOL 3MLRL 5IFJA 3RKDC 1UD5A 4UM9A 2XQBH 2WPGA 5KAQG 1BAGA 2DI7A 5AB1A 5DHVA 5B8CC 2OJZL 3C5SA 3E8UL 3T0VA 1B6DA 4JVUA 1INQA 1GPOH 3DO4A 5IOKA 2EDDA 2YUWA 3B2VL 4JO1L 3FJTA 4P23B 3ENEA 2ED7A 2A1WH 3FMGL 3IJHB 4FXGB 3SKOB 3ETTA 4PR5A 3RJQB 5E2UH 3W0WD 1B4JH 1UA3A 1WV7T 2X3BA 3QRLA 1C1EH 2HFFB 3F12B 1BWMA 4OGYH 2PTVA 1EHLL 2DM3A 4CILA 3VXUB 1RZKC 3T3MF 1CTMA 3L6FA 5I19L 2HRGA 1URIA 3HC4H 4L8CB 1MCOH 2C3VB 4LCYA 3GBMH 1A3ZA 4BE6A 5LDUA 1EIBA 2RACA 2EUWA 1QNZH 2AJYL 3JWDC 3CX5J 3WV0A 1FO0B 1I3RA 1XD0A 3T0EA 4ORZC 2H26A 4FF9A 1QFWH 2HPOA 2VMEA 3WMSA 3IMRA 3P9LA 1ZA3A 3LHPL 3GTNA 3EYQD 5E8EB 5TTRA 3VXQB 3BCDA 1N8ZB 1OF2B 1OOWA 3UCQA 1NUDA 2VLKA 4NSKA 4TUOB 4W68A 1VLXA 3QQXA 5MI0B 5GISL 3LPWA 1V10A 2IANE 4Z0BH 5EO0B 5AYTA 3TNNB 3KXFA 5A7BA 1X5IA 3Q6FA 2DQDL 3CHXA 1C08A 2VSCA 1PLCA 1AOZA 1YLBB 3D1MC 1XT5A 3R4DA 5C08D 3EBGA 4HBCL 4IEFA 4NT6A 2OP4H 1HH9B 4WNSA 1OE1A 3PG2A 1JZ4A 2UX7A 1DUZB 2YHGA 1TMQA 4B9PA 2R4RL 2W0PA 4QIRA 2VCOA 3SBWC 2DJUA 2DQGH 5A16A 5E4IA 5GS1A 3VD4A 5D5ME 2XETA 1I9JL 1J9RA 4QDGA 5TPWH 2C9RA 3HI6H 4KKLD 1TJHH 4ODTH 2N7SA 4OZFG 3EBIA 2FJUB 1U4FA 2BW5A 3Q8CA 1NUFA 5MP6H 1RU9H 1U8CA 4G8GE 4JPKL 4NQSB 2BRRH 2BMKB 2FH6A 4PREA 2DLGA 4D0CB 3VI3B 3QR0A 2OBGA 4FP8L 4FL4B 3HAEH 4ISVB 3Q6GL 5AW3B 2OMVB 3PGCB 1WQVT 3BP7B 5K5YA 1N0XH 2GJ6A 3QZNA 4PMFA 2A9BA 3LNHA 4NUGL 5I0WA 1Z0NA 4UQAA 3X1FA 4NQEE 1OAKH 5FHAL 1OCRB 1QLRA 4M1GH 1R5VA 5BZZA 5GJSL 4DVRH 2EDOA 3ZE0B 5CBEB 4XBPA 4NIYE 4PP2B 1TQCB 5C09A 3I9GH 1Z5YD 4I4WB 4PUBH 1SEQH 1JYWA 1BMWA 3ZT7A 1PLGL 1LLAA 2W8CA 3BKJH 3QXTA 7CGTA 3S8FB 1CYWA 4Y2OA 2QHLA 3GK8L 3L95B 3KYNA 3OKEB 3CFUA 1XGPB 1CLYL 4P9HL 3IXTB 3N43B 3T3PB 2ADJA 3MRFB 4JO4H 1DHKA 1BW8A 1OP9A 3RHWF 4DF9A 4QXGH 4EDXB 3FXIC 2R2EB 4UBDD 2L04A 4OZIB 2Z64C 2ZTBA 5LG6A 2Z6FA 3UEQA 1TEYA 4PYHA 3RGVD 4H26A 5D1XE 2VM4A 4O02A 4IRJA 3KMDA 3WS6C 1JHLL 1T6BX 1B2YA 2WQVA 1IBZA 2V3DA 4ONFL 4D8PB 2X2HA 2HRHA 1I4FB 3HIZA 5J11C 3MCYA 5AVTB 2EABA 1FH5L 3O8XA 4IOSA 4C4UA 1XH1A 2XG4B 5F8RC 1UOLA 2ICCA 3QH3A 3KPOB 3NJGA 3D69B 1INEH 3DV6A 1F8TL 4H20H 1EAOA 2PW2B 1TSHA 3LDBB 4GRWF 5DMJB 4BQ6A 3TU6A 1KZYA 1AR1C 4JCWA 1EWHA 3GS0A 2P80A 3HPLB 3MGOA 4AC4A 4L18A 1ZGLB 1CBVL 1O9VA 5K9QG 3C12A 3SE6A 1ICTA 1P1ZA 3BH9B 1U9KA 5IHZA 4PP1C 2OR8A 3MRNA 4HLZH 2CGRH 3I6KA 3MQIA 5BZDB 4QHLB 3V0VB 4D0CA 1BZ7B 5FUZL 2BP0B 4IGBA 1JWMA 3PXHA 1Q9OB 1J18A 2G3NA 3L7FA 2Z31B 2NY2B 2YMXH 2XIIA 4QOKB 2GHZA 3MJ7A 3FUKA 2HJFA 2DQJH 1SUJA 1JGUL 3ME0B 5F7NC 3MRPA 2B15A 5FA3B 3PJSA 3WXVL 4WW2A 1WAAF 3FTWA 3LKPA 1XO8A 1CE1H 4F7CA 5I73B 2WXIA 5D1ZD 5T5FA 1LM8V 3B8YA 1JTOA 3T77A 5H8DA 2BHYA 1U6AL 4W9EC 4XBPB 1SY6H 4R4BB 4FXTA 3F04A 4MJIE 1KJ3H 5HVGB 1HHGA 2CNZA 2XZQH 4QRAA 4OBSA 1MJ7H 4HCRA 3GB7B 1Z9SA 3NK4A 1BQLH 2L8AA 1TUPA 5C7XH 2XWXA 2VITB 4QF1B 1T1ZA 3U9PL 1T5KA 2XHNA 4LCWD 4MXWL 2Q3AA 5C70A 3WTWA 3CCHB 3MRDB 2OW6A 3PREA 2X9ZA 4NI3A 4YSDA 2YPLB 2OMYA 2X05A 4ZX3A 5CIPA 2X4SB 1HH6B 1WGOA 3QDMD 2VDOB 1GS7A 5ES4B 4L4TB 1GYVA 4NO0D 3GBEA 3CE1A 3TNMB 1DBBL 3P2TA 1G7HB 3GBDA 3BVUA 2EO9A 2NT0A 5D7IE 4Y4FD 4JFEA 3LPOA 3JTBA 4LBEB 1MCQA 4KVCL 4OZHA 4PJ8B 1CVSC 2JJSC 2X5PA 4NUJA 2UUDK 2V2TB 5EO1A 4O5LL 1FUNA 1RVFH 4X8XA 1ORSA 2V5RA 3MGOB 3HJ0A 1QABA 1KGJA 2HFGH 2ITDB 4OTXL 1IBBA 1ZTXH 1E67A 2ENSA 3G5YB 4I1NB 3A6OA 3OB0H 3TC9A 3DYPA 2AVFA 1QKZL 1YC7A 2IDQA 4RGNE 2YPVA 3QHTC 2NY7L 5DLML 2MCMA 4HJGB 2EECA 4Z7UF 2WVVB 4QJ4B 3FUIA 3KPLB 4FZEH 1BLNA 2ZUWA 1QWNA 1CDBA 3P69A 1BZ7A 1M1XB 3U0WL 2Y7LA 1DBAL 1CD1B 4IDJH 5ELIA 1JWMB 1TTBA 2XN9A 2W9EL 1I3VA 1ZSDA 2NW3B 4A1RA 1DLHB 3K2UH 1OANA 3MNVB 4HIXH 4ZX4A 3MCLL 3U2IA 3SDYL 5JXEC 4Q6IB 5LLIC 1NCDL 1WA0X 4KQ4L 2J1WA 5D5MF 1ZHBA 3C8KA 2PXYD 3SGKC 3MYJB 1S7WB 3JWOH 2VH5H 1D5RA 2P28B 4JPVL 5D1QB 4H0IA 5J6GA 1CGVA 1PX8A 4LFHG 1KLFB 1J5OH 3FFDB 2ZYSA 3LS5H 5DJ2B 1E90A 1KGIA 3VXOB 4ELKA 2BSED 2W65B 2C9SA 3IGLA 5K59E 2X0VA 4FFYL 1XGQA 1U33A 4L4VA 1MELA 4ZMOA 3E3QC 3ZT5A 3T09A 2DIBA 1MHCA 1QOKA 4PRHA 4YK4C 3RVVD 4R97B 1MCOL 2E9BA 4ZO8A 4F1ZA 1KTBA 1HHKA 1LO5A 1XR8A 4XPGH 1T4WA 2YPLA 3U46A 1NKRA 1YQVL 4LEOB 5JPMB 2EKSA 1SEBA 4WY7H 4J6RL 3GMQA 3VFMB 4M43H 1VRSA 5KBPA 3MLXH 4HZ1A 3D4YA 4P2RB 3EGXA 4YDIH 1WIOA 4HGMA 5AW6B 2FT7A 5E6IA 5CZVH 5SWZD 3FSOA 1GS8A 2QLVB 3CVHB 3PYCA 2AQRA 3WNOA 1S5HA 3V8CA 1PNDA 4YZFE 1Q38A 3D51A 4BFEA 4EBQH 3OJ2C 3GQFA 3S5LG 2ATAA 2WUBL 3AVEA 5J6HB 2FLRT 3P77A 3V5HB 3QUZB 4X9HA 4AYMC 5F0JB 2VXTH 1ZY9A 1UWEL 2LU7A 1HEJC 1QAWA 4UV7H 5ID0B 3X1EA 1ED3A 1RULL 3AG4B 3FULA 3WIIL 4XPAH 1DQVA 2VO8A 3BQUD 4HJGA 3MVSA 1M7XA 3MO1A 1XV8A 4Y1AB 5DRZA 5E9DE 3CBRA 4APQC 1Q1JL 2ALAA 3H9HB 4P3CL 4XC1H 1M1XA 2CRIA 1WCBB 1ZCRA 1VFAB 1DQKA 2DQTL 3FOMB 2AK1H 5F88B 4A6YL 3TA3A 2ZSVB 2P52A 2G9HA 2XN9B 3HAEG 4J8QA 4R0LA 2CKBA 3DOHA 1K4CB 2KLSA 3LKOB 5MENB 1A4AA 3U6RB 1O6SB 2BRRL 2FYYB 4RIRA 3MNVA 3UAEA 2FE0A 3KAAA 1DQIA 3PNWB 5F9WC 5C0AA 1TJXA 3QCUH 3BPOB 4G9FE 1AIFA 4UQ3B 4Z7WB 1RPQA 4ACTA 1A3RL 4GQ9H 1GMIA 1PSKH 3FHAA 4NKOB 4KX7A 4F1SA 3F2LA 3BP4A 1KLFA 1L7IL 5BMFL 3AT8A 5I6PA 2MFNA 3SQBA 1QBML 2XBZA 2OL3B 4GQQA 4HQQL 5IEKA 1N4XH 2QADC 2EDNA 2G5UA 4OFYD 1HHJA 5TH2A 1F4YL 3B2VH 4JO1H 2N1KA 1DP0A 3F3HA 5HDBE 4AKQA 2ZKHL 4ZFGL 1DFXA 4E36A 3SDCD 5ESVB 3TIDA 1AP2A 3FAXA 5AENA 1B4TA 1QSVA 3PWNA 4MNQE 2ZWLT 2NX5D 3UGEA 4J4PA 2Q6WA 4DKFH 3DXAE 1ADWA 4G9FB 4PJAE 4Z7WE 4N2FA 4HIJB 4LU5L 1R3HA 3NJVA 3KPNB 3OLDA 3LDBC 5BW7C 2A5UA 1XB6A 4Q58C 2WWMC 2Z8SA 4HD9A 3ESOA 3NSFA 1RI8A 1NOLA 2GAZA 2AQNA 3AW5A 1C5DA 3K91A 4Y9CA 3C6LC 3RQ3A 3ARVA 2HXAA 3H6JA 4NNPL 1A3LH 4FA7B 1DJIA 1JZDC 4PRIE 1KCSH 1EGJA 3CXFA 3F5WB 3FF8A 5D6DC 2XV3A 1KCWA 1KIUB 3GSVB 2BLFA 3QZBA 5J6HA 2VZUA 4AG4L 4YDLB 5EZOL 5IBLC 4DHLA 1DJGA 5DTFA 5CGBA 5TE4L 4R3SA 1JFHA 3DIDA 3PDOB 2HRPL 2Q3XA 5F96H 3MO1B 3EJPA 1JZJA 4FQCL 3EYOA 3ZL4L 1V3LA 1JZIA 5CLTA 3D87B 1UWGH 5DO8A 3H7LA 4WDIA 1NFDA 4MLIA 4GI6A 4JPWL 2G9HB 2EUVA 2WZ6A 1G6RH 5EDSA 2XTJC 2JKIS 1Y6MR 2APSA 3QUZD 4JG9A 3TN0A 4PJFF 3Q8FA 2P5PA 1T20A 1X3DA 3ULSB 4CSTA 1IKOP 4MCYA 4CVWA 1QO3A 2VWEC 1JXDA 3G5WA 3DX4A 4FQIH 2J8UA 3I74A 1CFVL 1UB6A 3B4NA 5D7IB 4H8VA 4S2SA 3PQYD 5JOEA 3O2WH 4XPHH 5BQDA 4LVNB 4UT6A 4DKEH 2D3LA 4L4TE 1TDQA 2VDKB 1NBYB 4ZUWB 4Y1TA 3CZKA 2VXVL 3SQBB 1SJHA 2OSLB 5GHWL 4JLRB 4U2YA 5G5DA 1HHJB 4YBQD 3BO8A 2ZUUA 3ZKND 3O2DL 4NQED 1PCSA 2JJVA 5ICYA 4ESKA 1HEZA 4GRLD 3PP4H 2CR3A 5ESVA 5I76A 2XI9A 4JANB 3ZKXC 2WNKA 4IBQA 1B0GB 4LLAA 3MRGB 1YSOA 1IQDB 1EDHA 2FH8A 1RIHH 5GRJH 3ZDXE 5D1XB 5LGHL 4XPTH 1THAA 4YX2L 5INCA 4EIZC 2ZIDA 4AIEA 3I9GL 4NUQA 2R59A 3IDGA 4XWGL 1JK9A 4KITB 1XCWA 5GZOC 3NBNA 2XA8L 3QCVH 2I25N 1P5VA 3HS0A 3UMNA 1LTXA 1NCWH 5DURB 1CDHA 3D7PA 4F27A 1VPOH 5KVEH 5D72H 4N8VB 1RSYA 2BY1A 3PDDA 3EYFB 2PR4L 1JPEA 4G1MA 5ACLA 5B1JA 1F3JB 4OSUH 4RWYH 4AZUA 2AEOA 3VFRB 2VDLB 3ATDA 5TDPB 3CHQA 3JV5A 4OW6A 1MLBA 4PBDA 3BGAA 2UZIH 1M6OB 3BSGA 2J6WA 4XNUH 4HEME 4JMNA 3CN3A 4B9GA 4HAKA 4LDEB 1GHFL 2LLNA 5DF0A 3I2CH 1R33A 2BIMA 4WI0A 4LAJH 1LDPL 4JFSA 3WHXA 3P0VH 5KSVA 4JO2H 4CVZB 3CLEH 4TOYH 1T7XA 4KK5D 4AKPA 1U91A 4F15B 2OYLA 5DLMH 1TO4A 4QWWD 2BPBA 1R3KB 3UTPE 3OXRB 1DJZA 3AY4C 1OP3H 3SJVA 2CK0H 3VRJA 1T20B 3IJEB 3K1KC 1UADC 2H0FA 1D7FA 4F9LC 5JQIB 1BZ9B 4IDJL 1J1PH 1KBKA 3A67L 3SPJA 4JHAH 5EUKB 2VLKD 1AZVA 1MCFA 1BYOA 3EXJA 3K4ZA 2B7DT 2NYYD 4BBWA 1WC7B 4MJHA 1DVZA 4CGUB 1QSFE 4F8OA 1MSPA 3BLKA 2VH5L 4HPHA 3EYUH 4WEEA 5I71B 4MZ2A 2EYSA 4F33A 3QUYC 4R7XA 2WVTA 4P8QA 2ICWB 1BVKA 2L7JA 3DX0A 1GZPB 1E2ZA 1JGUH 4XMKL 4OIAA 1CF8L 1GY1A 4KNTA 3BGMB 5HGAB 2GK0B 4AJ0A 4N2EA 2AFNA 3LAFA 4P46C 5AW4B 4X42A 1G1OA 4DGYH 1G0YR 5LCVL 1NC4D 4WO4B 4OKVA 2VNCA 4RFNB 4YS4A 3OMIB 5SX5H 5L9DH 2X2UA 4DJMA 4UILH 4LEBA 3DC0A 2AXHA 3D07A 4LF3A 3WAKA 2F1AA 1U2CA 4XXCA 1JD9A 3FS9A 1C9SA 4BXVA 1WPCA 2ZAIA 3EO1B 3QWQB 4LOEA 3VI4A 5FO9B 1KYAA 5IFJB 1CFBA 4HUNB 4TSCL 3NABL 4JHWL 4G9DA 4FHJA 5IG7B 4C4BA 2CLZB 1NC2D 5GRVK 3TA4D 3W1ZA 4Z7QE 2FX9H 1FIGL 1KB9K 1KGCE 1WS7A 2N01B 2WSDA 3V0WH 2V5YA 2WQ8A 2QPDB 3KWUA 1NCGA 3DGDA 4HUMB 3Q1EA 3SD5A 4BFOA 1LE5A 1BVLA 3LQAH 4GSUA 4WI0B 2X4NA 1MRFH 2RHEA 1VGEH 3MXWL 4IBYA 4OJDH 4YSTA 2AJUH 4PV9A 1JWSB 5EEZA 2W5PA 5F3HA 3L3IB 4EJ1C 5IT2H 5J5EA 1CTOA 1CZ8L 3UAAA 3TBWA 1Q9WB 4N1CA 1IIKA 2EE3A 1JZ6A 3LH2L 1BZ9A 4U1KA 1TETL 2GEQA 1MPAL 1VF5C 1WZMA 3CC1A 3EYVB 1AH1A 3W39A 3QIUB 4Y16C 5EWIL 1FL6A 1UZ8A 5IOPA 5E4OA 2D3JA 3T1FB 5LBVA 3D6GA 3WS3B 3BFWA 3CAFA 1CL7H 3FQ2A 3NESA 3FOLA 3O41B 3Q2NA 4PJ8C 3EO0A 1OF2A 1PKQE 2OMWB 4OGAC 2NCEA 3EZ8A 2WYIA 1XQ4A 4XBGA 1W9XA 5BMFH 3BN3B 1KN2L 4YHLH 1QR1A 3UCRA 1HQRA 2WLLB 2HH0H 4Q4EA 3TOPA 1QSFD 4G6KL 4NKDA 3UTOA 3BGMA 1L9MA 1TQCC 5B39G 2K45A 4U3SA 3WY4A 2Z92B 4N1HB 3JWOL 4LPVA 3OZKA 4X7TA 4B9FA 4JKPL 2Z31C 5I75C 3C9NB 1FFOB 1PG7W 1HH9A 1T5XB 4F3FB 3F58H 5B7MA 3IU3B 2Z4QB 1F2QA 1YMMD 3CDGA 4Y1SA 2EADA 5KBLA 2AEWA 3N85H 3ZHNA 2HKFL 3KZ8A 3GJEA 4EKXA 3D33A 5PCYA 2OYPA 3DXAD 3C5JA 3OKMB 5IG7A 3WEXA 1U8CB 5G55A 3QUYD 2J4WL 3JWDH 4KTEL 4L23A 3WFCL 5JDSA 5DQJB 3WBDA 3B1TA 4ONFH 3H85A 3QDGE 4C47A 1NDMB 3WSQL 4GKOA 3EGDA 3W11D 1K5NB 2BSDA 4UIKL 1BLIA 2VLRD 5GS1C 4JRFA 3WEAA 1OQXA 3UZQA 3AXLB 4PY8I 2VM3A 1B2WL 4LSVH 5F9DC 4P05A 4DN4L 1BQHB 2GVYA 3GXDA 4O51A 3V0DA 3K6NA 1IC4H 5A40E 2X28A 4TSAH 1N9PA 1VESA 3K5RA 3HUJB 3H9SB 5F7LB 5DSCB 3IAPA 1I8MB 3RUGF 4HJEA 3KPRB 2Z1KA 3OJMB 1OSZA 2F19L 3SE3C 4Y5VB 2B5IC 1M4KA 4U1KB 1N5AB 4ZD3L 1S7RA 5BOPA 3S4SA 4BINA 4C58B 2AF2A 4JFFD 3INUH 3OKEA 2RBLA 4OJFH 5CO1A 5H35B 4WV1C 4KKNA 4D7BA 5HPMA 1II4E 1OAXH 2D3VA 1L0PA 2DMKA 3BXNB 4K7FA 4F57L 3H3PL 2UZPA 4HPOL 1EQWA 3MLTB 3NCJH 2VISA 4JR9L 2DV6A 2VMJA 5T3ZH 3WL9A 3TIEB 1A0QL 1USZA 2Y24A 3RNKA 3SCMA 4C59B 5HHQB 2O6CA 1TJGL 2ZX6A 4LBAA 2VXVH 4I48B 4MJ4A 4PJ5B 4N4YB 4XN9A 3ULUD 4UI2A 2HLEB 1TZGH 1R24A 4EN3D 5E00A 2WZ0A 1A3QA 4JFWA 5CZRA 1WZ1H 1Y18B 5FW8A 2E6QA 4B9KC 3AZUA 4B53A 2XG5B 1CE6B 1LEGB 4Y7OC 4HT1H 1NCNA 5FO7B 2YO3A 4NB7A 3ZHDA 2PW2A 1AQ8A 4MNQB 3BVWA 1GSKA 2BO0A 4PRIA 3V9FA 1A14L 3GUTB 2K6ZA 3CDGB 2A6IA 2C8NA 1NMCB 4I8DA 3IFOA 4ZMVA 1LP9B 2FO4A 4HJJL 4I5BA 5KOVC 3ZZSA 2WXMA 1IARB 2TRYA 3APCA 2XRAL 5KS9E 9CGTA 1FG2A 5D7HA 3WEXB 2G60L 1AKJB 4PJEA 3RUGA 2OULB 3TWCL 3VGAB 5BS0A 3ESNA 3B1UA 4LCCC 3RWCA 4F8QA 1OP5H 1EGJL 1IKNC 4YQXL 4YFEA 1GSMA 3ZQXA 4HOXA 2Z31A 4XZUB 3KW8A 1DQJB 3ZXAC 1S9YA 4PJHF 3ZSSA 1A65A 3NRQA 1GJWA 4NQQA 1R4XA 4JBSA 2HX8A 4K7PY 4PJHB 5DC2A 5I30L 1BVNT 2YRPA 5EU5B 1DL7L 3G6AA 3MREA 4Z7OF 1M3IA 3V6BR 2WLJA 3JV4B 1F11B 5DJAA 1KCSL 4OD1H 3SDDC 2QMKA 3HUJA 1LK3L 4P4KB 1DVUA 5CGYD 2MPVA 4HBQA 1JF1B 2Y5EA 3D3VB 5CM1A 4TOYL 1OM3H 2NY7H 2DQUH 3GLEA 1MCKA 4KGJA 5E6ID 1OZTG 1WEJH 5H35A 3P11H 5FM5O 1NGZB 2XWZA 1OY3B 1Z3GL 3BXNA 2ZWSA 1DBAH 3GSOA 4Y4HC 1BWWA 3GMPB 4M1CC 3RWDA 4H44C 2B4CC 3NZ8B 3QAQA 2WOYA 1DVFD 3B6SB 3ET9F 5DJ6B 1E8WA 1G6RL 2Q20A 3UYRH 5HHQA 3QXDA 1PCXA 1IJNA 3E3QE 5DZJA 1NBVL 3EFDL 4LBEA 5AOZA 3MDJA 1A4JA 3SDXE 4M61A 4UM8B 2OYKA 3F7RA 5HGBA 5DZ9A 4NUJB 1AZCA 3F8UB 3NIDE 4ZAKA 2VWEE 2ZT9C 2VL5A 3C08L 3SGEI 2HSIA 1Q72H 1HXMA 4M7ZB 2LE9A 4LCWB 4ODXA 3GSRB 1RUML 2VUKA 3KR3H 2AEQH 1UXSA 5BNXD 2A6IB 3KHOA 4Q9CA 4FYQA 3HC2A 1TYEB 4ZQKB 4ZS7H 5B1AB 2EYTB 3I50L 1FIEA 5EUOE 3BAEL 4MDIA 1D6VH 3S88L 3QIWB 1KTLA 4JZJB 4NO3A 2IEPA 2WO2B 2KZKA 2X0WA 4QRPD 1OGPA 2X2YA 1AXSB 1UM6H 4FNUA 4HS8H 4XCEB 4MYPA 4N86A 3RUGB 3WKPA 5ABDE 3GIVB 2OQJB 4H2CA 5KYUB 3QEGH 2G5BA 3IWUA 1J10A 4QRQB 2MQCA 3US0A 4S1QH 4ANXA 2IAAC 3IJSA 2AJXH 3KVPA 4FADA 5KANG 1IILE 3O6FA 1PDKB 1V55B 3WY2A 2DEWX 2GEEA 2J5WA 3WMQA 2Z8WC 2PPCA 4OGZA 4URTB 2VQTA 3V0WL 1U95B 3TYGL 4GXFA 1XCTA 2VUOA 2ZQKA 2QJDA 1G1KA 1T7ZA 3QQ3A 1AGFB 4BA0A 1UJ3B 1XGRB 3WG7B 3VYPA 3A6BL 3QG6B 5HXMA 3CDCA 1Q94A 3BSZA 3FO0L 4FQJH 5AOIA 4ZFOB 1CMOA 1VGEL 4M4PA 3II2A 1LDSA 1JGIA 4JPQA 4FI8A 2CO1A 4RSYA 4AUJA 3VI4F 1I7UB 2Z93B 4KROB 4WI3A 4YBHA 4L37A 1NUNB 2J1KA 3DRQB 4JFED 5EOCL 5F9JA 4YXKH 5CD5D 5FO8B 3NSJA 4XC1L 4QOKE 4GO8A 2D7NA 3EH3B 1L9TA 5IQ7H 4MMYA 3Q8BA 4OV6F 3AQDA 2WXKA 2Q86B 5H4ZA 1OSPH 4P4KD 1XH0A 3CFJB 4IU2B 3RY6A 1DBJL 2NY4D 2J57A 3QXDB 3WNLA 3NIGB 2BWDA 3FH8A 1GYAA 2CK0L 2WXRA 4U4BA 2VQ1A 5E6IB 1DBKH 1N68A 4M61B 1MAKA 5IJDC 5HBBA 2IOMA 3NFSL 1P7HL 5KS9B 3B7TA 5KSBA 2ZP8A 3RBSA 5IW1B 3GFUA 2AXFB 4U05A 3S8GB 4RH4A 2KQMA 2HFEB 1SM3H 2IDSA 2A6KA 1WWBX 3DO3A 2DQCH 2JK5A 3N3EA 2IFFL 4G7VL 4KI1A 1ZLWH 3ARBC 2CCLA 1J05A 3QIWA 1KTLB 5AYQA 3BAJA 3GXIA 3N04A 3MBEC 4NN7C 5E1HB 4FQ2H 4ZMPA 1ZHNA 1AACA 4EO5A 3GI8L 3ZZLA 3E1ZA 5IIEB 2RQ8A 4BFBD 2HVJB 4L4VD 5JW4Q 5JW4M 4PS4L 4PSPA 1WICA 3KM1A 4QRQA 5I2IB 1QHPA 3HCVB 3IJSB 1M2VA 2XIDA 3QRBA 5FUOH 3L1OH 2JV6A 2R9HD 4NENA 3FZUC 3OHXA 1O6SA 2FYYA 4RIRB 1CURA 3S36L 3QIWD 3V0JA 1YC8A 4WU7B 3VA6A 1QNZL 2NSMA 3B37A 3HG2A 3HC3H 3WXWH 1E2WA 2YXWA 4XNQA 1XR9A 5A2IH 2XA3A 5T3XE 1G6VK 4IRSB 3BP4B 3LRGA 1XGRA 4MDJB 4J3XA 3TBVA 2JJWA 1DVXA 2X4UA 1I7ZB 4A2HA 1XSJA 3U9UA 3P4NA 4IJTA 2WXJA 1CLZH 2VR6A 4L1TA 3P1VA 1NSNL 4XO8A 1INQB 5IGXH 4A6YA 3GZQA 2YKLH 4PG2A 4RAVA 3ZL4H 1R3LB 4GQPH 2A1WL 1N3NB 4KRPC 4A2EA 4PB9H 4FDWA 4G6AD 2WQSA 2AEPH 4X0NA 4WJKB 5JLZA 2D0GA 4J3OF 4RBPH 1P5UA 5CR8A 5BQ7A 1J9SA 3ILQC 4HIJA 1U8KB 2DLFH 5E8DH 1QFOA 4JS7A 1Z66A 3Q8AA 1NLBH 4GMSL 4ZZKA 4E9SA 4PHXA 4KK9D 1YNTA 4N2NA 5HYSB 4DZBB 3DKHA 4N2GA 1ZVYA 4G9FD 3PWPE 4YHPA 1P2CB 3QO0A 4LLWB 5MEPB 1GTFA 3UTSA 2KZWA 3HE6D 5EWIH 3V0FA 3OKLB 2YD3A 4L8DA 3T0EB 4ZPVB 4C8XA 3GSVA 1I85C 1JERA 1GOFA 2EP6A 2JK5B 5IMKA 3GTTA 1OTUC 2DZEA 5E8EA 3VXQA 1J05B 4GKSA 1FQ9C 1HL5A 3O6FD 4QAWA 4CGTA 1B4RA 3N6YA 2OAAA 3WNMA 4ODHL 2PMZA 4QRRD 4YDNA 2FK9A 2Q8AL 4AEHL 1JNHA 1CLVA 1Z9LA 3OXSA 1P7QD 3RKDD 4I0PB 4A2MA 1FN4B 1CFSB 2CE6A 5DD3H 3UJTH 3SO3C 2EDFA 2VDLL 3RTQA 4PR5B 1UA6H 4KJYA 1M2VB 2HYMA 1VEOA 4KPHL 4P23C 1CXHA 4AL8H 4LO9A 4N9GB 1PKQB 5D4IA 3F58L 3LN5B 2OZ4H 2X09A 1C1EL 3QDJB 1D6EA 1BQKA 1CI3M 1SHWA 2BVTA 4ZXBA 1FH2A 4YO0A 3L2MA 3TTYA 4OF5A 3ECVA 1N64L 4BSVB 3DYMA 4YC2B 2IIJA 1NFKA 2BVUA 4MB5A 5C09E 3HG1B 4LLUB 4OZGB 5MP6L 4PGEB 3RWFB 2A4EA 3U9UB 1SJHB 5J1SC 1FO0A 1I3RB 3HBGA 5ENWB 1E9PA 4NQSA 4ICWA 1N70A 1QASA 2FWSA 2P48B 3B9KD 2YGQA 1EFXD 5ANMA 3CX5K 1IAKB 3AUWB 4IKKA 3BVDB 5I6XB 3ATBA 3STZB 3CLEL 3LHPH 3LKQB 3WCYA 3V4VB 1MW0A 1ZHLB 5DD5L 1ZLUH 5JLZB 1PF3A 1Q8MA 4MWFB 2D0FA 2B9AA 2Y1ZA 4GQRA 4XH2A 2P80D 4PJ6A 5CN1A 1C7SA 4N2KA 1SYSB 4CVXB 2I7SA 4PUBL 3EFOA 3GYRA 4FI6A 4G5AA 2JNZA 4HKXB 4PJHE 3APMA 3OAUH 4CC4C 1XF4B 3QK0A 1SUHA 3NAAH 3HS0B 3BWUF 3OKLA 4KO5A 4G8AC 3KS0H 3HE6A 1MI5E 4MHHG 3D18B 3K1DA 4HPOH 2OTWB 4EDXA 5CEZD 4WZ9A 2D7PA 2K78A 4FCHA 1L7TL 2WLMA 1E50A 2YN3A 5D71L 2EVJA 1YN6B 3SBRA 3UEZA 2FD6L 2ZG2A 1SBSH 2EEFA 2CHZA 4NM8H 4UMSA 1WGVA 3P73B 3H3BC 1E5UI 2P8PB 3K2MC 3K2KA 1V7NL 3BI9X 4CJ0A 1ZGLP 2XN1A 4TPRH 4EOWH 1T4KB 4NYLB 2EC8A 1DQML 4JFQA 4HEPG 4JDTH 3T65A 5B39B 4AYDC 1I8KB 3QNXB 1OHZA 5LJYH 1KC5L 3VRJB 1UWYA 1E6JL 5CBEA 1D9KD 1CDCA 2YBRA 4MCZA 1YNKH 4DVRL 4KZEL 3EJSA 2X2IA 4CDGC 3ZR6A 4WUUA 3IDXH 3W0WB 2FO8A 4W4OA 2D9QB 4U7KA 2ENQA 3SKUD 1P1ZB 3BH9A 3MUGA 4XCCH 3U6XS 1LYQA 1XGUB 3RPIB 4GI8A 5CEZE 2ZKYA 4MKMA 4V2CB 1TU2B 3CSTA 5FUZH 3VDCA 1G9EA 5ANMB 5EEUA 2GFBA 4LL9A 2EDBA 3CLWA 3RX8A 3C60C 1MQKH 3QC6X 5ABAA 4XP5L 2EYRB 4Z7AA 3DETC 3CVIL 1J0YA 3BVXA 4NQDD 3C6LD 2EDTA 2FIRT 5A2AA 3W9EA 4MWFA 4XH2B 4YXKL 2CGZA 2PP8A 5I5MA 2DWDA 3ARXA 1W0YT 2VDQB 2OXHB 1SYSA 4JQIA 1S6NA 3CHSA 3MLYL 4I9XA 4W6YB 5SWSA 4LLVB 4OFIA 2YFNA 5HDWA 4DEPC 1OM3L 1AVAA 4JFPB 2MMXA 2R0ZH 4XHJD 3WN5A 3W37A 1QQDA 3ZOAA 3FQNA 4WNQB 2JB6A 3WDIA 3C5ZC 3QDGD 4AW7A 2XY1A 4UB0H 1BD2E 4Y5XA 1XF5B 4X9IA 1AXIB 2CLZA 1J9TA 5F0MB 3V7MA 4X80L 1OVZA 2F6AA 4DVBA 5CU9A 1TIUA 2X4SA 4F24A 3HE7D 3E80A 3IMVA 1SOXA 3PWUA 4K3DL 4TF4A 1SM3L 4W9GC 5DC9B 3WIAA 4Z7WF 5IMLA 1MHPH 1K8DB 1ZHKA 4WWOA 2BP0A 5FGCE 4ALAL 5E99L 1NC2B 4PP1D 3PABA 4G8IB 1Z5LA 5L2KD 1C16B 3MV7D 2ID5A 1Z6JT 2NT1A 2YMXL 1B4JL 2A7BA 4PV9B 2MTAA 4YHZL 4XXWA 2UZXA 2XY2A 4JRXD 4QI3A 3VXRB 4Z3JA 4F7CB 3FT2B 4NWTL 1RPUA 2PN5A 5IUSA 3FF7A 3GZPA 2WKLA 4F7EB 1YEEH 4HEMA 3HC4L 3CZUB 4R2GC 3ZR5A 3GBML 3QIUC 4PJBE 4Y16B 3W39B 1QI3A 3HE7A 3W0WA 1CICA 5TE6L 1WT5A 1YEJH 2HT2D 1UM6L 3CN4A 3D30A 3F00A 1B90A 2W0FB 3MROA 3RPIA 1TT6A 1HKLH 4PY7B 5DJZB 4A7TA 3TM6A 2MQ3A 3M17B 3FUEA 3CCHA 4O9HL 4KDTA 5F1SA 3RP1A 5CZVL 1QR1B 4HW6A 5IHUH 5A2CA 3X11B 1AC6A 3GXNA 3QPXL 1CS6A 4AYSA 2V2WA 4D0DB 2B20A 4PJFE 5JHLH 1T3FB 5H4YA 3OGCA 4G80A 1I9IH 3HBQA 2GT9A 5DVKA 1ZHBB 3TH4T 4G7RB 35C8L 5AVUB 4OZHB 4PJ8A 1UKTA 5I0ZA 2EIBA 5D1QA 4F3FA 5DDHA 2XWJB 3ZGIA 3VD1A 4FC3E 4OJFL 1OTTC 3LX9A 3F01A 1EHNA 3TONA 3ESMA 1CGUA 1BGXH 2VO5A 1XGQB 1SRDA 4JR9H 1EHKB 2GBVA 3AWFA 5GS0C 3HI6L 5MEQB 1AR2A 2YD5A 4AIZA 4Y5XB 2X4RA 4OFDA 1NMCC 3F62A 3TPUA 5DQJA 5FXCH 4RFNC 2EKSB 3AG1B 3Q2CA 1YEKL 4MFHA 3DXAB 3RWIA 2R69L 3SQOL 1WAAA 3VFMA 4WW2F 1ZHKB 3UADA 3UMTA 2YD8A 3K6FA 1CD1A 2CA3A 3UPCA 4X5LA 1ETB1 3AADB 5I82A 1JBJA 1XWVA 2IH1B 3RVWD 4JG1L 4D0BA 3N42F 1PJ9A 1A9EB 3MCLH 4N3TA 1N4XL 1MXDA 3FT2A 3IFPA 3MRHB 3SGDI 1E4XL 1NGXA 4HULB 3ALPA 3WIHH 3FO9A 1F4YH 3HC0A 3QHZL 3V7AG 4R9HA 3SN6N 5DJ2A 5DEGB 3GS4A 4IKNA 3ULVC 5AVWB 4JG0H 1CICB 1QRNB 3OPUA 4JFHE 4DP9X 1G9MH 3PV6A 2Y5TB 3BPNC 5C0BB 2R39A 5ESAA 1DVSA 1KXTB 2B14A 3CVCA 4U0RB 5DJZA 3PNRB 4JRXB 4XVUC 5DD1H 5B4MC 1MHCB 4N2AA 4PRHB 4P9MH 3SCMB 5CLZA 3DSFH 1R34A 3CFKB 3SE3A 1UZ6F 1QFUH 2XXGA 2HTLC 3T8MA 2WXNA 2VDPH 3ARQA 5K39A 5FK9A 4R0LB 3VFGH 2CGYA 2VAAB 5B38A 5J13C 4GG8B 1KSRA 2EDEA 1DR9A 3BP6A 5AVYB 3G9AB 4M3KB 5JR1L 1QBBA 5HHOA 5F93C 2BX5A 3ZRFC 4UQ3A 3KPMA 4Z7WA 4KK5C 4NFBA 1H8SA 3SE8H 1KUMA 1NBQA 4PJ5D 4L3EA 5DDHB 1WTGT 5D7SH 2OMZB 4AGQA 2NX5E 4XVUD 5CIPH 1MNNA 2OL3A 4Y4FB 3VNYA 5DC4B 1AI1L 4HWUA 4CC1A 1HINH 4DGIL 5TH2B 1QX1A 4OCYL 2CO7B 1UOWA 1FDLL 2CIKB 2X4RB 2I07B 3OAUL 2FAUA 3DOIA 4JPWH 3NAAL 2YSSA 4YXHH 1NEPA 1A6WL 2NY5L 1DFBH 4WF7A 2R23A 3M46A 2DJMA 2DLFL 3BWAB 5E8DL 4L5FL 4XZUA 1OOAA 3E9UA 2M1KA 1QW8A 3C8HA 3L4TA 4X6EB 1Q1JH 1XBDA 4HZAA 2G2RB 4R83A 5IQLA 3N1GC 1DBMH 3ML9A 3LKOA 2JB5H 3TVMA 3U6RA 2O5YH 2ZXWB 3JV4A 2A0LD 3PNWA 3WO4B 3ATFA 4XRCB 2QKIA 4FTVB 3IFPB 2EIKB 3RDJA 3EOAA 3KYOB 4LSRL 3H42L 4QWWC 3KWXA 1T1WB 5BVJA 4K7PX 4FNTA 4S0TD 3EFFA 5FLVA 3RKPA 4MB4A 4LLDB 3NJHA 1LXMA 1JVLA 3FRUB 2WCSA 3GIZL 4TUJB 4QRPE 3B2DC 1BBDH 4PWEA 3A3YB 4HQQH 3TA3C 1SLVA 3GMPA 4NN5B 4P5RA 4XMWA 1S7UB 5TFSL 1NEZB 3DURB 3F85A 5I28A 1KBGL 3NPSB 5IM7B 3DETD 3BKCH 2XTJB 2YD2A 5D6CB 3UBFA 1OAYH 4X8GA 3UTSD 3V8OA 5FYKD 3L2NA 5TDOA 2B1OA 2VSDA 5DUJA 3S3BB 1A4JB 1L9PA 4IQHA 4HWBA 3KBPA 4GG8A 2L3BA 5BUGA 4Y9FA 5AW2B 5F7KC 1H19A 2BY3A 3GXUB 4FFZH 4XXDB 4YHMH 1N64H 3TO4C 3IS1X 3WTYA 3GSRA 2Z9TA 1BVNP 5E6IC 4NBYB 3CVHH 4KQ3L 4ZQKA 3RVVC 4RSVA 3T3PF 1JZ5A 4MZRA 2UXTA 1ZWIA 2MCPH 5JIHA 3A4DA 1I8LC 3AREB 2R56H 2ITFA 5HHPB 5I16A 2AITA 2ARWA 5LNDA 3Q06A 1N10A 1RZ8A 1CQYA 2X1XR 1N18A 4PRDB 1ZAGA 3J27A 5IBUG 3ES6B 1EMTH 4L1SA 4KUCF 1J8RA 2IQAA 4D9QD 4LZKA 3A21A 5KOMC 1B0GA 1KCUH 3SJVD 1AHKA 3K4AA 2KYIA 2ZX7A 1OIOA 1CFTB 1OGAA 4GI9A 3BYTA 5JW5A 4Q14A 2BZDA 1NFDB 2CG9X 4OI7A 4HGWB 4AYGA 1SNRA 4JFDD 1IC1A 3ASOB 3GRWH 3IDGB 4BRJA 4LLMA 2HT3C 5GS2D 4XVTH 2C4FU 2XN9E 5JMOC 2F08A 2BY0A 1I1AA 5DQ9A 1I31A 4LAQL 3FONA 1UJ3A 4NPYB 4F2MA 2G3MA 3O6KH 4X4ZA 1UB6B 3O6MH 3QXUA 4S2SB 2PO6A 5CFAA 3DJSA 4FXGC 1I8AA 2EVFA 1D3CA 1R0AL 4WSKA 4ADIA 1KBVA 3B7SA 1S7QB 1J9CT 2K4AA 4FFYH 2APXA 4I85A 1GY2A 2X6AA 4JLRA 1WFJA 1A6AA 4LPYA 5CCGE 1K85A 2A3TA 5GHWH 3RGHA 2O26U 2R1YA 5F7YC 1KLGB 4NGHH 4P46B 1G4MA 1XL6A 4POZC 1IEAA 5KUMA 4X5RA 3GMOB 4GIAA 3CH8A 3DVIA 1CFNB 2DYPB 3WLBA 5CP7A 3DJRA 5TDOB 3CSYA 1HESA 3N1QC 2IMNA 5HYFA 5DMIH 1R3KA 4FQXC 2PKDA 2QT6A 3ECWA 3OXRA 3AROA 4GIPD 5LN4A 4KK8D 1K6QH 3L5HA 4XC3L 4JZOA 2JI2A 4JHAL 3IPEA 2J88H 2IPTL 2Y4SA 4XWGH 2HJKB 4XCCL 3VQLA 2WHVA 1T66D 2DD8L 4KY1H 4F58H 3S96B 4ZFFA 4KRPB 2OJEB 2BVOB 5H37G 1D5MA 4Q89A 1NEZG 4TMPA 2H41A 5HHPA 5I16B 4YE0A 3ARDC 1VIWA 2V7NA 3LS4L 5FYLL 1ECYA 3L3HA 5EU6E 1F90H 1YNTF 4X6CF 1PZ5A 1GZPA 3A47A 3DTUB 1DJSA 3HI1B 1M6OA 2Q5BA 4XP1H 2WZAA 3L3GB 1G7IA 2HTKD 2EDXA 4DGYL 4XNUL 5CLWA 3KLAB 2E6PA 3LXUX 4P2OD 1L6ZA 3WHXB 5KSVB 4FZ8H 4M7JL 4YSRA 3MLYH 4CBZA 2CLVA 4MCMA 4MJ6A 1UD6A 3RWHA 4R97C 3TEXA 4YLQT 4H88L 1YEKH 3KL3A 1ZLSL 2CHDA 4QD2E 5FO9A 1OLZA 4MDJA 3TBVB 1NLDL 4H1LG 2BSSA 3P4NB 1BJ1J 3LXAA 2X7LA 4JG1H 3TO4B 2OZNA 3VFTA 5D2LF 5AKVA 2WWKT 5AG8A 3S37H 1FHNA 4KXBA 3RAJH 5C92A 4UQ2B 3S48A 5E2VL 1OWWA 2VERA 4HXAH 4QJ3B 2ZOKA 4G83A 3L45A 1NM9A 3QHZH 1OPOA 4YEEA 1OK8A 3GMOA 1U8OB 1P9MC 4HETA 2O5ZH 4ODSH 4P5TC 3RL1A 2A0LC 4J27A 3GI9L 4R96A 2X4PA 4IU3A 3CSYB 4OLXH 1ZANH 3N85L 4X6FB 2YJLA 1F5WA 3PL6C 1J12A 3EJYD 3SYCA 1TZHA 5AW9B 4WUUE 3VXPA 4JZOB 5K59F 4A2GA 4YHPB 1TVBA 3IEAA 5INDA 4P46D 1KFAH 1ZA6B 4YJZL 1CXFA 4G8EB 5LBSL 1F45A 5CZXC 1U92B 4D94A 4KV5F