2IO5A

Crystal structure of the cia- histone h3-h4 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
154
structure length
154
Chain Sequence
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/structural protein
molecule keywords ASF1A protein
total genus 28
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2io5A00
5EIIG 2CU9A 4EO5A 5C3IA 5BNXD 4ZBJA 2Z34A 2Z3FA 1ROCA 2IO5A 3AADB 2HUEA 2IDCA 2IIJA 2I32A 2YGVA 5BO0D 2DZEA 1TEYA 4RRPM 1WG3A
chains in the Genus database with same CATH superfamily
2Z4QA 3RX9A 4KMTH 4PRBB 4Y2OA 4PRNB 5FYKL 4M43H 5HDRA 9CGTA 1MIEH 3WUWG 2NOYA 5IWLC 3HBQA 3QR0A 3ZDXE 1JZ5A 4UTBH 1HHIB 1T03L 4IDLA 3VFOA 1AS6A 1HKLH 2XT1B 1KWGA 1JMXA 4M93B 2BNQA 3EOYG 4RMBA 3K4ZA 5C6TL 5EUOF 1U95A 3IDXL 4QKTA 3U9PH 3IGKA 5CEZH 4JEGB 5E9DA 5GQBA 4ZPTB 4UT6H 2O6CA 3STLA 3DETC 4C47A 3SYQA 1B0GB 1OAYL 4X5RA 1N3NA 1I8KB 1R5IA 1HTYA 2WYZA 4HW6A 3RI5K 3LS4H 1A64A 3VQMA 1RZPA 3BH9B 4WO4B 3HE7D 1WH0A 3HKFA 1RJZA 2HJLB 1DLFL 4YZFE 1Y18B 5L2KB 4MQ7A 5TE7H 4X6BA 5GRVK 2DBLL 3UZQB 3JTTA 2DPKA 1JPGA 2BCKA 3FU6A 3NFSL 4B0MB 4A7TA 3MLWH 3WAKA 1HL8A 5I6KA 5HI3C 3SD5A 5I0DA 3AY4A 2ZXCA 1MG2C 2G3ZA 5AD0B 4HOZA 2AK4B 3D05A 4YPGB 2UX7A 4JO2L 4PI2A 1OLLA 5I15H 1I8AA 4AE0A 4KMQA 1CK0H 4NO5B 4WKZA 5I1IH 1TETL 3MRKB 4JFOB 3TCLA 4WAFA 4MQXC 1A14L 5KN5A 2OYLA 3FTUA 4LHUG 1UENA 3DGDA 1D5IL 4E9WA 2E7LA 3VO0A 1XSIA 4GLRI 4NNXA 1Q0XL 5PAZA 4JGNA 1T20A 1DCEA 5FO7B 2QSVA 2VMCA 4HPYH 5HHQB 4DVBA 2XICA 3QDHA 2C3GA 5KYXA 4F2ME 5BJTB 1JPSL 3HI1A 1LNUA 1R46A 5EV7A 3F7VA 3AG1B 3C60C 4IRZH 2EDRA 2W91A 3QORA 4MDRA 4F7EA 4L8CB 3MGTB 3BZDA 4OM1H 1EQWA 1BYPA 4PRAB 5M7QA 1OAQL 5TF1L 3WKYA 3ULVE 4ERSL 2V2TA 2NTSP 3G6AA 2DQUH 5ACZB 3CZJA 1ZSDA 4KTGA 3T4AB 1NSNL 4YHZH 5D7IB 1QKZL 1NANH 2EIKB 4YHOL 1JZ8A 5H4YA 3VI3E 4O4YH 3NVQA 4D3CL 1O9WA 5SX5K 1KPUA 3NA9L 3O4LD 1SYVB 4F8NA 5CGMA 3NUKA 4HH9A 5B39B 4GMSL 1U33A 3E7JA 2AC0A 3EIFA 1SPDA 1NANI 1L9TA 5EORH 1Y0LB 5IEKA 3N0AA 4MXWH 4PJ5A 4JQXC 5KVEH 1DBBH 1MNUL 1G7QA 3GXFA 3ZHFA 1HL5A 2F7QA 5C0BD 2Q0ZX 3AADB 3MJ9L 3V0HA 4DZBB 4H5SB 3UYRH 4KK5D 1C12A 2CD0A 5A16A 1R3HB 4MSWA 4KNTA 1AAJA 4IIQB 3U0PA 4N2HA 3Q8EA 4G7SB 2DYRB 3G7TA 1CYGA 3O8XA 4JB9L 4R4BB 3V4PB 3D69A 4AQZA 3U0WH 1OP9A 4YLBA 4RGMB 1Z0MA 2WP3T 4NPYA 4J8QA 3HNTH 4RFNB 3TPUB 1O7VA 1JTOA 5BV7H 4DP4X 4R7DB 2PYED 1KY7A 1PEWA 5AB0A 3RHWK 1MZYA 1UH4A 4JBSA 3SGJC 3L1OH 4JY4B 4H1LG 4BJLA 5CD3A 2Z8VC 4UAOC 2X6MA 5IROD 3BOVA 3P0VL 4ELME 5DJYA 1QKZH 4QMEA 3S35H 4TPRH 5FW8A 3BWUC 1UJ3C 5CIPH 3BN3B 1JHTB 1W8OA 3W38A 1JN6B 5MI0B 2ZCLL 2NLJA 4WV1A 4ERSH 2WINA 4YJZL 3GMMA 5FYJU 3OB0K 4OM1L 1MRCH 1EXUA 1FORL 4B60A 1EHXA 2VXVH 3KCWA 4MA3A 4KJPD 4WDIA 4PP1C 5D7JD 1G9NH 3RWDA 3UAJC 2VSMB 1Q1PA 1UQSB 4HUVB 3RAJL 1UB5A 2EJ1A 1J1OL 4OM0H 4ES9A 3B6SB 2LAAA 4XVUD 1KNOB 3BKCL 3NACL 4X9YA 1HFUA 1KLFA 2R15A 1IC1A 3GMPB 1CIUA 2WPGA 4AYEC 1R9FA 4Z95H 4JANB 3VFGL 1FNLA 1KC5L 3H9YA 2PWHA 5IB2B 3I3DA 3ARVA 3FT9A 4NQEB 2HFFB 2NNRA 3NPSC 4PWKA 4J2XA 2ADYA 3VG0L 1N5AA 3FT3A 2YPLA 2HN7A 4FHBD 3IGFA 4MMXA 3V6FB 1I3RB 2GPZA 2D0FA 4MHHI 4V2BA 2BIPA 2H45A 4BXSV 2BP0A 5D1QA 3MACH 4PB0H 4GO9A 4QRQA 3CHOA 4YSQA 5CINL 3MV9E 4H5SA 3KYNB 4N0CC 2VH5L 3ATFA 5F9WB 3MROA 3VXPB 1T5WA 1V3KA 2ZNWA 1PS3A 2J71A 1FHNA 3D87B 3C8KA 3GI9L 4A2MA 3H7BB 4ODXB 1DLHB 2B3IA 3HEIB 3H3BC 4DERA 4L9LB 1V3JA 3BP4A 2B2XL 3PQYD 1K2DA 5J1SC 4Z3EA 1FGNH 2ESVD 5C0RL 1E27B 2LLGA 2NYYD 5F89A 3L4XA 5FFLA 4X4KA 1EFXA 1A22B 1AZVA 4MJ4A 1KV3A 4OFVA 4QXGH 4KRPB 4JVPA 2X05A 4BUQA 4RDBA 2OMTA 4XMPL 2K9UA 3RGVA 4IMLB 1BAFL 1RIVH 4JPWL 2FT8A 3CVHL 5KS9E 3HB3B 3MYZA 1GL4B 2DV6A 1OCWH 3G6DL 1QW8A 3U36B 5C08B 3LZPA 3O6MH 2FSEB 3VFSB 4J1UA 5KZCD 4ADIA 3WEBA 1E6JH 3GINA 2A9AA 1G6RA 4KXAA 5LGHH 3ECBA 2P8LA 4CSZA 1EJOL 4AK2A 3BIBX 1WIUA 1OF0A 2WP3O 4WK4B 2DM4A 3TC9A 3II3A 2Y22A 2ZUVA 4QWWD 4M8VA 1KXVC 4NRXB 2HMID 2OL3L 2OL3H 1AD9B 5I8EB 4JRYE 5GSRB 1NC4D 3VA6A 5C07D 1UWXK 1I82A 4ZS6C 4PGDB 4KKBD 1EHLL 4WGWB 3BGMA 4NPJA 2IPKB 1NC2A 3SGKC 3A6CL 1G7PA 4G3YH 1JRHL 1BM7A 4BCXA 5TFSH 1NGXA 2FX7L 2IBZX 4DGIL 1G7JB 4M5YH 4A2HA 3DO4A 4UQ2A 2GJPA 1YNLH 1MVUB 3QR1A 4P07A 1GC1L 3VCLA 1OPGL 3VXSA 3H0TA 3VWKD 1FSKC 4UQDA 1B2WL 1SGKA 1KTLB 4JQIH 1HXMB 1NUGA 4OLXL 4JUSA 4KUZH 4LSSH 4OQTL 3ZTEA 4OV5B 4PJBB 1MWAL 2YBRB 4JO8A 3DBXA 4BFOA 4P2YA 3AABA 2X4NB 1JZHA 2ALAA 1QABA 4W81A 5BS0E 2IBGA 3CSTA 3LHPL 1HK6A 5JHDB 4OR1A 2XTJD 3H7BA 1RZGB 4XC1H 1XIWD 3FFCB 2QHLA 1KACB 1XO8A 4N0FB 4ODTL 4TQ8A 4WO4D 4EIZC 5BRZE 2EVFA 2XPGA 4C4KO 2CE6A 4I2XB 1EGJA 3PHAA 5ETUB 3WJMB 4YDVA 3QJVB 3I6LE 4WI8A 3V9CA 4M9PA 4LCWE 3DETD 4QOKA 2ZP9A 5FGBC 3U9UA 2QADD 1F02I 3HLKA 2FSEA 4GQ9H 4ZTPL 4WK2B 1JHLL 2BVTA 2FVNA 2ZX5A 2UXTA 4HISA 1NUDA 1RK7A 1QO3A 4OZFB 5AKTA 5GSVB 3KJ4B 5LUMA 2BSED 4C56A 1KLUA 3AXHA 3FQ2A 1E3FA 1BXAA 1F3JA 3MKGA 3OXRA 1HYRC 1UXWA 4K9EH 1IBHA 3BESR 4OD1L 1NDGA 3KEDA 2YK1H 3VTMA 2NZ9D 4IRJB 3AGWA 4BQCA 4O02A 4PV1C 1FZJB 4WFFE 4OCRH 1P4LB 2BDNL 4JRWA 2I9LA 4NAQA 3CFQA 4JQVC 3TBBA 4EOWL 5B1AB 1YQVL 1R3IH 1A8ZA 1SJVA 1W9XA 1XCTA 4EIUA 3DGCR 3K5RA 1QA9B 1G7HA 1XF3B 3HZYA 4W6YB 1DZBA 3QK0A 2F68X 4KXCA 3MLSL 4CC4A 3UABA 2AJUH 2LU7A 4Z3HA 3JWNC 2V7HB 3MR9B 2ICEA 5DMGD 1UZGA 3NCXA 2HFEB 3L54A 3PCYA 1TQCB 3RVVC 4JO4H 4MNGA 3GLDA 3AMKA 3TBTB 4IIZA 3F64A 4L4VA 5KYYB 1FFNB 4NQEE 2R7EB 4PRPD 3BLBA 1QOKA 5DWPA 5B21A 1Q4NX 2XPZA 4BH7B 2GBTA 4PJAE 1GMIA 2FX8H 1AE6L 1DBML 3ZKXC 1XR8B 2LR4A 4KTEH 1YYLH 5AUMA 3TEZA 3FB8A 2EC9T 1U4EA 3MCKB 4K94C 2J4WL 2Z92B 2AW2A 1WK0A 4LCUA 1C5CH 4X0KA 5LWYH 3IDIA 4RH4A 5DD1L 1ZV2A 4Z7UB 3MUGA 5T5NG 5SX4H 1CC3A 3H9SE 1ORQA 2PO6D 3OKOB 1MFEH 5J11C 4IU2A 1HHHB 2BM3A 2BWIA 2OSLB 3UIYA 4K3JH 1D7BA 1QUPA 1TMQA 6CGTA 2Y3AA 1KGCD 2B1AL 2NT1A 2TAAA 4AMXA 2OYMA 3CDGA 5GISH 2WNWA 2F18A 1ZA3B 1COBA 3CDCA 4O4YL 4BFNA 1GZPB 4EIGB 2HN7B 4L3ED 4GNKB 2VZ3A 1L4IA 2CNYA 4XNZC 5E8NB 3O45B 2JCWA 4AW4A 2QZ5A 4I3RH 4FXKA 4KHXL 4Z7NB 2GI7A 4XNMB 3BHBB 3GKWH 2GCYA 1T83A 3QUZC 1A7QH 3WN6A 3QXWA 5KSBE 4OUOA 1U95B 4GP5B 2Y9RT 4U2YA 4OCXH 3FUJA 4HETA 4PRNA 4ZMNA 3BAYA 4F24A 3FUDA 1QBMH 2VDMH 4P5KA 1KIQA 1AO7D 3BQUC 3OKDA 2WXPA 4DP8X 5IT2H 2GB2A 1WFNA 3I84A 1LE9B 5IROC 2Y7LA 3LN4A 2VISA 5D93B 3GF8A 5K59E 2YS4A 4KHTH 1T7WA 4TUOB 1F13A 3EYSH 3OX8B 1NDMA 2P24B 1FYTB 4H25B 1DDHB 1NBQA 1RZQA 4P2CG 3WHE0 1M42A 1CK0L 3FOLA 4H40A 3QEQB 4ZNCD 4IU3B 5I1IL 2WC7A 2MKWA 2W59A 2E75C 3P4OA 3CK0H 1YG9A 5DFVD 2D9CA 2D0HA 3IWUA 5F7KC 4M3HA 4XVUC 5B7MA 4AMKH 2Q2EB 2ADJA 4ORZC 1F0LA 2NUPB 5M95B 2F61A 2E7DA 5DRZB 1TQBB 3GLAA 3ABZA 4U1JA 4TKWA 1UM5L 4JFED 5ESQB 4X0KB 4XNXL 3WL9A 3UTOA 4ZW6A 3K2IA 5I71C 2ZKHL 2R69L 4KI5D 5C2BH 1XDTT 1MZZA 2DIBA 3GMLA 3LXUX 2C1PB 1AZUA 4P04A 3V52L 3F62A 5G4NA 2N59A 5DSCA 3N5AA 4OTXH 2MCMA 3SJVB 1EEYB 4WVRA 3KPSB 1Z9SA 1WEJH 2UZIL 3IJHB 4AQ1A 5LXGL 1XR8A 1AGEB 1CXIA 3ABGA 4YDNA 1RHHA 4MJID 3FFCE 3F7YB 3ZL4L 1I75A 2PP9A 1HAWA 5FM8A 3ZIYA 1HHKA 1BLIA 1OD7A 3L5WA 1Q1JL 2ZSVB 2AHIA 4K55A 4V1DB 4UMGA 5HTSA 2R39A 1JV2A 2K4AA 3HCVA 4UTBL 1T03H 1J88A 2M26A 3G04A 3IDIB 3KWXA 3GS4A 1GY2A 4RGNC 5EO9B 5ERWB 1O5DT 4TSBL 4PUBL 1A6AB 1V54B 4XAWH 4PV8A 3KGRA 4DCQA 1BAFH 3VD5A 4WJ5B 2GIMA 4LRIA 4HCGA 3TZVA 1R5VA 4Y9GA 2V17H 4JDZA 4JM2F 1MWAB 5DJXB 2ZAHA 3GKWL 1C08A 4RCAA 1RUKH 4I3RL 1KJ2B 1FGNL 4PJ5B 4E9SA 2YSTA 3G5XA 4ALAL 1D5ZB 1DDHA 1FF5A 2YEQA 2ZKHH 2LVEA 3HG1B 2Z31A 1FPTL 1BVKA 1OGAD 4D94A 1FCGA 1JD9A 3TFKD 3L2NA 3UYPA 5DQJB 1J5IA 2P24A 4PH8A 2B39A 3M1CA 4WGVB 3OKKB 4YBQC 1AMYA 3NIDF 3C6SB 5A2LH 4BSVA 3SDDB 2YPVL 5I1JL 2R83A 2H2PD 4I77L 1M3JA 4PCTA 5K93A 1DTUA 4DUWA 3B7RL 4F37K 4H8QA 1UD4A 4MNHA 1XX9C 5LWYL 5EWIL 2CCWA 3OG6B 1YMMB 4H88L 4LFHG 1OALA 4NBXB 3RZCC 4AM0A 4Y1AA 2NX5E 3E2HC 2UWEB 2LU3A 2DLHA 2F7OA 2NTFA 4IGBC 1J8HB 1YYLL 4U1NB 4F7CA 3FS9A 1CBVL 1U8HA 4N2KA 4WNJA 4YVUA 5E1AB 2BIQA 2BX5A 1IILE 2F53E 2XG5B 3ZQ9A 1Z9LA 2EDYA 3KDMB 3B2VH 5I1GH 1HSAA 4QXWA 5KS9F 1G9NL 1JNJA 3WNPA 4NAJA 2VDLL 5FEBA 5F3HA 4RFEB 1XXDC 1WICA 1T6WA 1LXMA 5JIIA 4FGMA 3OBAA 3SCMC 1HJCA 5IFJA 1JVKA 5DF0A 5KSAA 1QLEB 1INQB 3QFJB 1JGUH 4FL4B 3BSZA 3UAFA 3RVWD 2H3XC 2BSRB 3U2SB 1LILA 1VFMA 5C09E 1I3UA 3Q43A 2GW5A 4LHUA 3NZHL 3U1SL 4H1LH 4JG1L 1T0NA 1WV7T 5I0ZA 4JKMA 2WXQA 3O9WD 3S8FB 1H19A 1DLHA 2BS8A 2OJZH 1H3TA 3ZOAA 2CLZA 2H4EA 3H1ZA 3MYJB 2QADC 5EC2B 1S7QB 3Q1SH 4XHQA 3W0WA 4HJGB 2VSDA 1P6FA 5AW6B 3W11D 2CK2A 1LO4H 4S0HA 3CD4A 3CCHA 3ULAB 1IMHC 5EC1A 5E9DB 2EILB 1JTPA 3FNKA 2MRYA 2ZYIA 2VR9A 1X5JA 2P5EB 3ZMRA 4B9FA 5EIIA 4GQ9L 2WBJC 2ARJB 4LGPB 3RIFF 4GT7A 4HT1L 4MNHB 1I7UA 1SY6A 3BJLA 2FX9L 1VA9A 1C16A 3BWAB 2ITCA 4KFZC 2ZUQB 3QUYD 4CMHB 3IWVA 5E6UB 3NCWA 4JO3H 1SLXA 3CMOL 1DQVA 4W9ZA 4XB8A 3ULUE 1M4KA 1M2VA 2Z31B 3OPUA 5SX4I 1ITCA 1GC1C 1EWHA 4PWHA 2AJXH 2VYRE 3BVNB 1X5AA 1BM3L 3IFPB 5B3SB 3MUHL 2AQRA 2ZE0A 3D9AL 4X4YA 3KNBB 4JQIL 5E6SB 2EE2A 2JI1A 4C54A 1ZHBA 5DZJA 2D8KA 1N0LA 3LXCA 4WCYH 1X5MA 3BCDA 4JY6B 2HH0H 4HWZA 4Y1TA 4A6YH 1BEXA 4NWTH 3VGDA 3MRFA 4FNSA 4GSDH 3ZTNL 3ISRA 4FD0A 4F2MA 5L0QC 2D31A 5EU6E 1P5VA 3OB0H 3LQMA 1FVCB 5ITBL 1MJUL 4LIQH 1PD0A 1VLXA 2ICES 3UROR 1D7FA 3RZWA 4N0UB 1MIML 1YSOA 4UQBA 4WWNA 1RI8A 4GOSA 1ZLVK 3IETB 3GZOA 3TZVD 5DHDA 2VDRH 1CT8B 2ZOKA 3BD3A 4BA8A 4GQRA 3QPKA 4ONGH 2X4SB 3CFUA 1U8PA 3GGWA 4K2UL 4QHLA 4K07A 5L4MA 5K33A 1MVUA 3QCUH 3MLWL 4RFOH 3V6OE 4MQXD 4UM9D 1SYSA 4QHNA 1UOLA 2H6PB 3MJWA 4LOUC 4HF5L 1X5YA 2MSPA 5HYSG 2DBLH 1U58A 3DWTA 2FJUB 2R56H 3TOPA 3HOGA 2X70B 3MBXH 5G5DB 3OMZA 2Y1VA 2E7HA 1JFQH 3C6EA 4GG6E 1S7TB 5I2IA 3BUDA 1UD6A 4OZGB 2VERN 4XPGH 3X1NA 5KBKA 3C60D 3QXUA 1H6TA 2ICWB 2QT6A 4TLTA 5HHXL 3I9AA 3HR6A 5F1IA 3UPAA 1RULL 1MJ7L 1O9ZA 1DSFL 2EXTA 4F57L 5FO9A 4KRLB 1NBZB 4LSPL 1RK0B 4BA0A 1FO0B 4AV0A 4MDIA 1UKQA 1XR9A 3I50H 3RWDB 5JMRA 1ILSA 3UTQB 2D7TL 3ARED 1D5IH 3FKUS 5GJTL 1CLYL 1S7UB 1DVXA 1QBAA 3GXIA 2HRPL 3APNA 3QAQA 1RUMH 3ETBF 1A9EB 5DJYB 3KG5A 4WW2C 1XF3A 3HZYB 3O11B 5DFVC 4U1HB 4L4VE 3L2LA 4M6OH 3U46A 5B1JA 4R7XA 1M53A 3P3SA 5ANHA 2L3BA 5LQBH 2YXVA 3VG0H 2B5IC 4FQCL 4JZJA 3GSRB 2FTAA 3N85L 2Y1ZA 3VFTB 3CZUB 1K3ZA 2IWGA 1DVFD 3N44F 1OTTD 5LGHL 5LAXA 3LKNA 4F7TA 1NDGB 2YAQA 4Z95L 2XIIA 2B5IB 4TSAH 3IU4H 1H5BB 5ILTH 1X9QA 4BH8A 3D1MC 3RJOA 4JN1L 1ADQA 2DQTL 3G6DH 2MJWA 4Z3FA 5A3ID 5DZLA 4ADJA 3DOIA 3V7AE 2VAJA 4ODXA 5DD6B 4RRPG 3UBHA 3UP1A 2X1XR 1EERB 1P4IH 3M8OH 4HPHA 7FABH 1MRCL 4XNZB 3H54A 4AV4A 3A4FA 3GIVA 2P49B 4HUNB 3B9KA 4K5OA 1HEZB 1AP2A 2YPLB 4MMXB 4QHKI 1ZLWK 4LCUB 1ETB1 5CUSL 2OXGA 4DOHB 3VFUA 1DVUA 4Z76A 4MXVE 4QTHA 4OIIL 3ATBA 1Z9NA 1UA3A 2RACA 4HJIA 3T2NH 1IKNA 1E5YA 4P05A 1NIFA 4PJEE 3Q2NA 2EEDA 2EH7H 2CO4A 3VU2A 4X42A 1HEJC 4UV4H 4KJYB 3VXRB 1AKJB 4R2GD 1KLGB 5JHLL 1E4WH 1RZ7H 5TDNB 3DPDA 3CDFA 3UJIL 3MNZA 1B9ZA 4R4FL 5J6HA 2EO7A 3WOVA 4LLQB 4UZGA 1RUQL 3LEXA 4G6JH 4IHBA 1Q0EA 3ES6A 3FO0H 4WFHE 5DLLA 1IJ9A 4F91B 1RKRA 3M07A 1TU2A 35C8L 3OKNA 4WNSA 1YN7A 2ATPA 3FC8A 4Q7DA 2YUWA 3RKDD 3WBDA 4YGAB 3QO0B 1T2QH 4XBGA 3DX6B 3K8LA 3I2CL 5C7XH 5EOCL 4XXWC 2UY6B 4PRPA 5IQ9B 3MCLL 1DUZA 2I26N 4JKNA 5IG7B 4BRJA 5AZEH 2HT2C 3SGDI 4CN4A 2OMWB 1P6WA 1N4XL 3CDYA 3VSVA 2NQCA 4UT7L 1LO5B 1RK0A 3BEVA 5AZ2H 4WTXA 1TQCC 5F9OH 3F04A 3W3BA 4C4UA 5E4AA 3RAJH 3L4VA 5GHWL 1MCWW 5D2NE 3NZ8B 4I18A 3MLRL 5GIRB 3WIIH 5DJ8B 5D70L 1AGFB 2FB4L 3FQNA 4F2FA 1BAWA 5C0NC 1VEMA 5I1CL 2ITFA 4GP8B 4YHOH 4TQPA 4KTDL 2H3NB 3UPRA 1WC7A 4MCYB 1XB6A 2AKRA 2XQ0A 4XVSL 1CWVA 5EU4A 1A6UH 3GHEL 4DK3A 5I18H 2H8PB 3AROA 4M7ZC 1PZ2A 5INCB 3S3SA 2XYBA 1TZIA 4FQ1L 1GW6A 4UBDD 5EU5A 5IHUL 1OE2A 2I60H 4YXKH 4PJGA 5T1DL 1P7BA 2RGSA 4BFKA 2PNDA 4TLUA 2E8YA 3O2DA 4QPEA 4EN2A 4MXVF 4Z0BL 4AVKA 3AT0A 2C26A 3J8F7 5HVFB 4IBWA 3ZDYE 2NXYC 1DQMH 3GMOB 1K6QL 3MOAH 3Q8CA 4H8WL 5CMAB 5F7EH 4KZDL 4EDXA 4H8VA 4JZNA 4AUJA 4X6FB 2C9XA 5I76B 3SGEH 4Z7VA 1CFNB 2YRBA 2CJTA 2XN9D 5L8KB 3QI9A 4OJFL 4D0CB 2GBUA 3TPUA 2ADIA 4R83A 2J8HA 4H2AA 3U4EA 2IDTA 3DVNA 3KL0A 3QFDA 4JPSA 2WV3A 2FHCA 4KTYA 2DTML 3C8HA 2AEOA 4ZTOH 1FH5L 1WAAF 1A7NL 4AL8C 4KV5F 2RAMA 1RP9A 5JPNB 1P9MC 1WUNT 3PHOB 4ZXBD 4JY5L 4Z6AT 3VW3L 3PWLA 3ZL1A 4ANWA 2H32A 4QXTA 3D08A 4KKBC 5F70A 3MRJA 4I9XA 1Z5LA 5F0MB 4N9OB 3CHXA 5KVFE 2DQHL 3KWWB 1IE4A 2ZOKB 2FGZA 1HHGB 3VXUB 1MFBH 3KPPB 1D5MA 4G8EA 2EIDA 4FJ6A 1CYXA 3GSWB 3VWKA 2EO9A 2MIZA 5GS0D 3VXSD 2KQMA 1BP3B 5CO1A 2NPLX 3DMMB 4TN9A 5D1ZI 3UDWA 3KPMA 3IGAB 1TPXB 2QPDB 1JCVA 3BKJL 3PV6B 2XETA 4OU3A 1J9QA 1ZTXH 1PSKL 1BG9A 4IGBB 2AGJH 4HHAB 3AREB 3CPLA 3HAEB 2BSTA 1F45A 2D3NA 5ERWA 2O30A 3ERXA 4Z3TA 1IEHA 1A4KA 1M7DA 3FZUD 4Y2DA 3IE9A 4ZXBA 4KAQH 4UU9A 2XTJE 1BMWA 3C87A 2KPNA 4Y1AE 5KSVB 3UBXA 2RFXB 3U6XS 3MMEA 4FF9A 1G84A 2NY5H 2A6IA 4LEXL 1RJZB 4DNLA 4AT6A 3L3IB 4Z7QE 1EEQA 5CIPA 5EOQL 3CXFA 3QI9D 1SMOA 5ECJE 1FAIH 3HHMA 5HGDA 4TUKH 2YMXL 2P80D 3UAEA 2WZ6A 2LE9A 4V11A 4FJZA 4PJBE 4OLYL 4P5TA 4CBZA 4XPBL 4DPAX 5JTWA 4PJAA 3PWNA 4GBXD 2YA2A 2XWRA 3PGDB 4PRAA 2N7SA 4K7PX 3N41B 3WIAA 2JJVA 3FB7A 1MW1A 4WUUE 3M7OA 3H2PA 5CU5A 2HPTA 9PCYA 2K6YA 5TF0A 3BAWA 3FB8B 4MQTB 1YAIA 2EVIA 3KDMA 1WBZB 2FJGA 5E5MA 4I2XE 1NFKA 5CMAA 3AWFA 4DKDC 3QDGE 1VGEH 1M9WA 3CVHB 3PQYA 1T20B 2PCXA 3F65A 4KKNA 1NBYB 2E3VA 3FRPA 3ME0B 1I7TB 1ODAA 2F0CA 3KPPA 5HP5A 4H25A 3AITA 4JR9L 4FTVE 2BZ7A 2GI0A 4JL2A 2V3EA 3BDXA 3ZKQD 1SDDA 2VW4A 1TEGA 2ZUQC 4PVNA 3VFNB 2C5DC 4G59C 3DYOA 2WZPA 1KIQB 3MAWA 1AG0A 4NQVA 3GJFH 3FTWA 1IFHH 4TNVK 4IJ3C 3T4AA 5I8OH 4OCWH 3OGCB 4L8BA 2RCSL 4G1EA 3VYPA 4Y5YA 2GIYA 5J7CC 3ZN6A 4FQJL 4PVMA 5IHZA 1JS4A 1GYUA 4OZIE 1FP5A 3NJFA 4A2DA 2D7QA 4ZPVB 3OJMB 4DKFL 1BEYL 3E6FA 2A6KA 5K1VA 5FM5O 1B88A 2F1BA 1FFPA 2P8PB 1A7PL 3L9EA 2CKBB 5C07B 3HLAA 5BO0D 3VD2A 1HXYB 2BHYA 1J5OH 5I1DA 4L3EE 4MA7H 3VVVA 3O3AB 1R3LA 4KVNH 5C0FA 1GZHC 3GEFA 2FLBT 3O3EB 2G0KA 3LZLA 3EJYD 5IKCA 4NT6A 5GRUH 2D7TH 4PWJA 2PTTA 3AB0C 2CLRB 4PJAB 4UDUB 4MS8C 3O8XB 1QUNB 4N86A 4YC2C 2OS7A 1Z9PA 2V3DA 5E5RB 2GFBB 2X2IA 1MJJB 2YGOA 4YL9A 3SODB 2PPDA 5TD4A 3ZY7A 2XPGB 5IROA 4ECNA 3F12B 4V33A 4NN5C 1OARL 3DA0A 3BQUA 3LEYL 5B1BB 4N1CA 4YEFA 5D72L 5BO1H 1LD9A 1ZVSB 5L2KE 3HB3D 4X8XA 3WD5H 1OAUH 2EDJA 4DWHA 2Z8RA 1VGEL 3FQTA 2DD8H 3LIZA 1GCYA 3QEGL 4F58L 3BVWA 3M6DA 4J3OH 3FTXA 4FI7A 2ZSVA 4PBWD 2R0WL 1T83C 1BJ8A 4XPHL 1D5ZA 1JFQL 4FXKC 4PP2A 2R2HA 5DMIL 1QLRA 3H9SB 5E4EB 3RUGE 4JFPB 4KU1A 2DQTH 4Q6YA 5BXFB 4UTAL 1EANA 1VEPA 4OGYH 3TO4B 2VDPL 4B6ZA 3EYVB 1GZQB 1H8SA 3AG3B 4XPAH 3GIZL 5E4EC 4WU5B 4UIKL 3I6KA 1FLTX 1RZKC 4LLMB 4OF8A 4UWQB 5FO2A 3SBQA 1K3IA 2XG4A 4FQ2L 3F2LA 3QCUL 4LAJH 2X53A 2ENSA 4Z18A 1XTLA 1UM4L 4WWOA 1EEZA 2OKMA 1I3VA 2K9FB 3GMRA 3NJKA 3ZYIA 4HS3A 1PPIA 1SJXA 3O4LA 4U0RC 4HKXA 1CLZL 1RPQA 3ZUNC 2WZ5A 1MHPL 1EAOA 4HFUH 3TIDA 5HHQA 4E0RB 3NJGA 4ZMLA 1CLCA 3T3MF 4JFDB 4ENZA 3LKPA 2ZP0T 2OV0A 1LL1A 3E6FB 3OKOA 5EOTB 3QORD 4A6YL 4HV8B 2NY1B 3GJFB 2BW4A 1BBJA 3TF7C 3VI3B 2IWEA 3SEPA 5D8JH 4HWBH 4Q2ZA 5FHAH 1TZOA 2IOIA 4HSQA 2QPEB 3OL2A 2GG1A 1W72L 4GRWB 1MFCH 2VE6A 3BH8B 4AW7A 2ZCKL 2X87A 3N50A 4BWTA 3PL6D 3VFRA 3D6GA 5E8NA 4PGEA 1I9JH 2VC2H 5GRYA 2PR4H 1KYAA 3VQ1C 2IANB 1EJ6A 1T21B 4J8RB 5DQJA 3SZKC 1CR9L 3LPGA 2HJKB 4RIRA 2UY7B 3IEAA 3N3EA 4WTWA 3K6SB 1U2CA 4PJXE 4LBEA 3SQBB 4G6FD 2PWDA 5DUBB 4ZUTB 3VXMB 1BQKA 1MY7A 2Y4SA 4UINL 2OR7A 5EBWB 4IU2B 2FX9H 4RFOL 2FWOB 2H1PL 3GHBH 4LBAA 4P2RD 1UM6L 4NP4H 1C8QA 2HUEA 4O2CB 3CQQA 4BFIA 1X44A 4PD4K 2WXMA 4TUJA 4M3JA 1F4WH 4M29A 3CZSA 4OLUL 1MELA 4X8JA 3ZHKA 2NXYD 4NZRL 4FA6A 4N0FA 3JWOH 3QUKB 4ZQKB 1OP5H 4ZMVA 4M6AA 3OZ9L 3ARSA 5I0WA 1P4BH 1FH2A 5KW9H 2XI9A 3OQRA 5IK3B 1OANA 2ENQA 3S3BB 4DGUA 1IGTB 2P44B 1QR1A 4ZFOB 3CX2A 4BHUI 1IEAA 1CF1A 2BNQD 4B97A 3DTUB 3P4MA 4QTIL 4JDEB 5J89A 5C0ND 4LL1A 4X4XA 2JWYA 2F9BT 1I9RH 4X6DB 3D9AH 2F19L 3LRSA 1QLFA 3SKOB 3IRCA 1NEPA 2MTPA 4P9ML 4PBVC 4PB9H 4PPTA 1ZHBB 5DVLA 4WFEE 3NT0A 3CZGA 5D7KE 3T0VA 5I17B 4OZIB 3L1GA 1N8OE 3MLRH 4YR6A 4PJFE 3WGUB 3BLPX 3L81A 4IRSC 1CE1H 3KWUA 1WS8A 3TS8A 2Q7AA 3U83A 3V4PL 3V5HA 2X12A 1H6FA 3O6LL 1NL0L 1QA9A 3GC3A 3PWPB 2VKXA 4GW4B 3W82A 2ZXDA 1OGTB 1SHWA 3NJNA 3KLAA 3EFOA 3JXAA 3DURA 4UMSA 3WD5L 3I2CH 4MYWB 1JYVA 4K5NA 1DEEB 4TV3A 3SDCA 3QJZA 5D6DC 4PN6A 5ISZD 2PP8A 3WO4B 3MJ8A 4S10A 4MZ2A 5E8EB 1U8NB 1KCVL 1XD1A 5EU7E 4KJYA 2HWZH 5KYYA 4P2OA 2N4IA 3BYTA 4YX2L 4LEEA 3G9VA 3DX7A 1ACYH 3LY6A 4HCRA 5BUPA 3ILEA 2GSGB 2UWEE 2Q9OA 1WCBA 3MRIB 4LHUD 5I23A 1HDMA 4UTAA 1QO3B 1E4WL 4OFKA 2G5BB 4G42A 4U1IB 5CSZA 5EZJB 1KBKA 2NXZC 3QIWD 1VKXB 1BXUA 5DFTA 1TYEB 4MWFA 5LBSH 4J12A 3ZGHA 3V4VH 5KSUA 1Z5YD 2WVUA 4X4YB 3IETA 5HHMD 2AJVL 2CIIA 3BKYH 3QPQC 1NLBL 5JDJA 4KK6D 2CO2A 1DE4A 5EPMA 3POHA 3ZR6A 3EOTH 4UIKH 3ZU8A 2EE3A 4YNYA 2AXWA 3P4LA 3K71B 4G8GD 2XRAH 4N6RA 4XNQA 3DIDA 2Z7WA 2WZAA 4PW3A 3JTSA 1N64H 4HPOL 4HSCX 2Y0SA 4DP5X 4ZW8A 3T71A 4ZD3L 2ARJQ 5IUSA 3EUUA 1MCFA 1Z5HA 1SXZA 4BUHA 2XN0A 5B4MD 3MN8A 5FCSH 2Z35A 1S5HA 4XMWA 3LRKA 3MJGX 3PPEA 3UTQA 1KFGA 1GGIL 3T2NL 1LNUB 3RNQB 4XOAA 3NIFE 4KV5E 3DO7A 4OGAC 4OQ1A 4EF3A 1CE6A 4G9DA 3R1GH 1B4TA 4FQCH 4NN6B 3QUYB 4HQQL 5EBMB 4MAYC 3EFOB 1WQVT 4CJ0A 1DN0A 4I77H 3LPPA 4YDIH 2G30A 3UG5A 2VDNH 1J0YA 4NN6C 1PNCA 3FBKA 1UCBH 3MBWB 2Z31D 4KVPA 2VLRB 3LH2L 3APMA 1XGUA 1ZS8A 3RFRA 2K8QA 1DBAH 1MCLA 5G5DA 2AJYL 4WY7L 3KXFD 3VXUA 4Y19D 1IT9L 2R4SH 4MJHA 3V8OA 5C0JB 5F6HI 2OMVA 4NQSA 3Q44A 3TESA 2HTLD 3GSNL 2VUKA 2PCPB 4U31A 2WB7A 2P46B 4IBTA 5BQDA 4W9GC 1J8KA 1NCHA 2XWZA 4FCAA 2QGBA 1BHGA 3KJ6L 2BIIA 1ID5I 1QSED 4X6EB 3ZTCC 4AQOA 3P02A 2BNQE 3UAJA 4FQQB 2CKNA 2EXSA 3T2LA 2K6ZA 5DEFA 3OPZL 3BFQG 1RUML 2F74B 5E8DL 2IPTL 3GO1H 1HZHH 2ZZUT 4HIIA 1H8NA 1WD9A 4ONFH 4X9GA 4XVTL 2XVBA 4Y8DC 4RA0C 4IBUA 5CJOL 4LOUD 3V0GA 3VGAC 2QKSA 1S7XA 3DNKA 1IJNA 4L4JA 2FBRA 4XNBA 3L4CA 2EZ0C 1FL6B 5I8KL 5J12C 1LE5A 3P0GB 4FXGB 4MJIA 1JI1A 1U92A 2E27L 4IYKA 4FLQA 4ZFZA 3SOBL 1DO6A 3X2QB 4U49A 1DJZA 5D5MB 4OCXL 1T1XA 2J20A 2GK2A 3B9KB 2Z7YA 4AENB 2XC8A 2DJUA 5FOBB 5GGSY 1MFAH 3WO4C 5B7FA 4QRTB 2AQTA 1G5GA 3EGDB 1F2XK 2C9PA 1CDHA 1CZ8L 1GPOL 3L1EA 2JCCB 4WV1B 4J3OC 1P7HL 1XGQA 1QYGL 4KPHH 3UBXI 5E1QA 3V4VB 1I1CA 3ETBJ 5AOKA 4JFEA 5ETUA 4DP9X 5ADPL 3DXAB 7PAZA 3QS2A 3PP4L 1DBJL 4HXAL 2DQHH 4TVPD 3C6LD 1F11B 1P5UB 5FWQA 4AQAA 4JL1A 5BOZG 2ZD0A 3JWOL 2DWXA 1XF5A 2GUOB 4BINA 3DPBB 1J05B 1L9OA 4JQXA 3BWAA 4QCIB 5EF3A 2R8SL 1OWWA 4LDCA 2XX1A 3B4NA 5E6ZA 3C8KB 1PFOA 1EHAA 4LEXH 5LBVA 1GGBH 1NEZG 1ND0A 1J5HA 2VXUL 1N2RA 2AS5M 5AQ0A 4ACTA 3SYPA 1CTNA 1BM3H 4G9DB 4NJ9L 5A7BA 2XU9A 1QSEE 3QNZB 1FNGA 4JN2B 1L6PA 4NQQA 4EI6B 2UWEF 2IXQB 4I1NB 4IBVA 1JXJA 4RMRA 4QGTA 4L5FE 3RYMA 3MGOA 3S4SG 4KNQA 1AE6H 4LPXA 1K4DA 2FX8L 1FN4A 3CH8A 3P9MB 1LHZA 3PG2A 3MNZB 2WLKA 4W9DC 1A1NA 1F1AA 3OAZH 1ZS8B 1U4FA 1ZHLA 4Y19E 1OGAB 1PSKH 3GJEB 1F4YL 4XP9L 2E74C 3ZR5A 3OJDB 2X0UA 4P5MB 4YAQA 1GRWA 1JE6A 1HNYA 2JLLA 2O5NA 1ERNA 2P42B 2CCLA 1T04B 1S9YA 2E7LC 4PV8B 3PU7A 4LEBA 2NSXA 5B7EA 2NW3B 5AB1A 1LEKB 4L3CB 4JFZH 5I1CH 5KG9B 1NFDF 2CPUA 1GZHA 1WFTA 2PO6A 1NH6A 2IG2H 5KVGL 1DP0A 1JGEB 2QQKL 4JX0A 4G5ZL 5IKCB 3E8VA 1T5WB 2DLEA 2JK5A 4RSVA 1O6SB 4MZ3A 4DAGH 2LV4A 1EZUA 4QHNB 4W9EC 4EZLA 1BVNP 3BP7B 1FCCA 3JTTB 5AL8A 3Q13A 4OD1H 1R0AL 4KKCC 1RK1B 3INUH 5DR5L 4B9KC 3PFUA 5F88A 1A7NH 2I7OA 4JQIA 5CEYA 1QBBA 4S1SH 5C0CB 3LSOB 5JIDA 2J55A 3BP6A 4Y5YC 5I6XB 1JPST 2VWEE 5H2BB 2OW7A 3IU3B 4L5FL 4Y7OC 1MJJA 3PJSA 2JQMA 3LQZB 5CEXB 2EIBA 3KYOB 4LU5L 1OZUA 3L7FB 4AYMC 3WE6A 2ZCZA 4GG6F 4FA8A 5HI4D 1TR7A 3M45A 2DEWX 5TE4L 5E2WL 2APTA 3H85A 3ARWA 4RAHA 2ADFH 3NDZE 1ZSDB 4I89A 4Q52A 3CFTA 3B2VL 4MCZB 3Q3GA 1QUNA 4E41D 3BUBA 2V7NB 2VQ1A 3EADA 4JJ5A 5JIPA 5EC1B 4E36A 2BOLA 4FQ1H 4N2MA 4PJ6A 1ZGLM 3O45A 5BRQA 2WQAA 3PXJA 3QEQA 2W65A 4KKAC 4X4MA 3REWA 3GQFA 1KCRL 2HKFH 1ZDQA 3IF1B 3UX9B 3WE1A 3T6QC 2F7IA 3WY1A 3OHXC 4ELDA 2HSIA 3JV6A 3REVA 4NENA 1GXEA 2I69A 1CICD 2XOTA 3TJEH 3TU6A 3AGVA 4NUGL 4O02L 5EWIH 3QQDB 3I6GB 2W60A 5D7LE 3X1BA 4YIQB 2CHNA 3ARBA 1OOWA 2N0MA 1I9IH 4OFPA 3MXWL 4P5TC 2AXGA 1IAKA 3IBEA 2MKLC 1ULVA 5KSAB 4DTGH 1RMFH 1O5PA 3L3JB 4MNQA 1A4AA 5AW2B 2GUYA 2ZXQA 3MRNA 3QISA 1PG7X 4LCYA 2J6EA 2OTWA 3PL6B 1ORSA 1A7PH 1W72B 3JWNG 4ETQB 2Z93B 5D7JC 5FB8B 5I1KL 1T04A 1FZJA 1JZ3A 2C3HA 2Y06H 1BVLB 5DQDH 3SDXB 4JDVA 4U3SB 3TN0A 5LQBL 4N5ED 2CDEB 4K71B 4RMSA 1SHXA 2Y7OA 4M6OL 4JCMA 4QYAA 4P9HC 4R9HA 4WO4A 1NDTA 3NSFA 1TDQA 3UO1H 4GUQA 2YA1A 5J0BA 3D48R 1O6SA 4ZO6A 3ZHNA 3G6JF 5EZOL 2HRPH 2FHBA 3VQLA 4NQDA 3GM0A 4PRHB 4PUBH 3WTTA 2CR6A 4FFYL 3KH4A 3X14B 4Q0XL 3X3GH 4WEUD 4RAUA 2EH7L 5FUZL 1KB5A 3LMJH 5BVPL 1M7UA 5E2VL 1HYSC 1ECYA 2Z0BA 2Q86A 3H2WA 2ZXWB 5AAMA 1YJDH 1T66D 4FKEA 4KUZL 4LPTA 1F4XL 4OQTH 4ESKA 1RUKL 1VADA 4RGNB 5GGTA 1X5IA 4PTUB 3E38A 3M8OL 1UD8A 1T2JA 4NO0B 1I8MA 2GT9B 3QIUD 3HG1A 1RXLA 4R97B 5I0YA 3SPIA 4F9PC 1JPFB 4JCWA 3F8UB 1TLKA 1XGTB 3QZBA 2OULB 3DTXB 2G2PA 4NCDA 5C07A 1AGEA 2BINA 1YMME 4H1LA 1QI3A 1EHLH 5DD5H 3BP5B 2YFNA 1NICA 3U6XA 3RFZC 2WB1A 2YRLA 3X17A 5EFIA 3TT3H 3VRJB 1CD8A 2CA3A 2P4AB 3EGDA 2KYIA 4BWUA 1OM9A 4MAYD 1A4CA 4PJDF 1OWRM 3AS0A 3DARA 3FQRB 1IFGA 2KC0A 1W0WB 1NFDE 3PGFL 3CZFB 1U9KA 3Q8BA 5JO5B 2CUAA 2G0LA 3D3VE 1A3LH 1PBYA 2ZXAA 2XN2A 3HI1B 2OJEA 4PWFA 3DX9B 1KJ2H 4PLKC 4HKBB 2AEIT 4EUPB 3KMDA 1MJUH 3LB6C 5ID0A 4KAQL 3QQDA 4KK8D 4MXQD 2BIOA 1IVLA 4DUXA 3X11A 4BFEA 2VDML 1QBML 2C1OB 2Y6SC 3PNWB 2Z1PA 2XTJB 1X6LA 1EFXD 3G5XB 3PWLB 4NWTL 3SDXA 1FG2A 1ZA3A 2DM3A 3UJTH 3IJSA 5KN5B 3CG8A 4HGKC 1AXIB 4NCC2 4KWUA 4CUCA 1PZ5A 3IRPX 4L3FA 1N26A 4C83B 3DRQB 1S9VA 4F9PA 3JT2A 4M93C 1BLNA 4TVPL 3RWCA 3A22A 3NFPB 1NUNB 4OH2A 5AVQB 1ZJBA 5C0RH 1JYXA 1RZIA 2ZAGA 4Z77A 1CMOA 4NAMA 1OAKL 5DMGC 1R24A 1ZT1A 4LLYA 1SVCP 2I9TB 1YYMH 2KERA 1B0RB 1EO7A 1RY7B 2LU5A 3G5YA 1EZVX 4FQLL 4IJ3B 2EZ0D 4U1MA 1PYWA 3QEUB 5ALCL 2FUQA 4GINA 5D1QD 2HLAB 4HHGA 4WUKH 4UQ9A 1BPLB 3NAAL 4JFPA 4S1DD 4XXWA 4QXUH 3VFWA 4PJBA 2HG0A 5BXFA 3C6LB 3MLVL 2XZQL 1B4JL 2CBOA 1DQLL 1SVBA 5ICZB 1TMCB 1GZPA 2YPLD 4XP5L 1MQ8A 1B4LA 5L4IA 4PCYA 2Y5TB 2QGCA 5BZWA 4CU8A 5L2JA 4ZUVB 4OD3L 4JRXD 3QYCA 4BFBD 4Q97A 2DQIL 4LQ1A 1A3RL 2JJUA 3HVNA 4XR8C 1TJHH 3QUMH 1ZVHA 4PRIE 1X9RA 4BK4A 4ELMB 2C1PA 1CFSB 3E3QC 3HUJA 4ZW7A 2EICA 3UBGA 1H0DA 5EO1A 1YEIH 4DN3H 3O2DL 5BUAA 4K7PH 4TSCL 1JWSB 2WXLA 3WXWL 2WQUA 3BEWB 5E9NA 4B9JA 4L8SA 1UFGA 5CWSA 1YEFL 3V4LA 4GAJL 2E6JA 3MBED 4AJWA 5D7JA 3RDTB 4H0IA 1DSWA 1JL8A 1CQYA 5E94A 1UACH 2I5YL 5FUOL 3EYOB 4P4RB 4YXKL 3OKEB 4WCYL 2VXVL 1ZAGA 2WTOA 1A9VA 2Z64C 2FLMA 3DX6A 1F6FB 4FEIA 3FK3A 2P8MA 2WXIA 3L13A 4GP4B 4LLAA 3ARBC 3FO1B 1BZDA 2AI0L 1D9KB 3QXVA 1PEZA 4NHUA 3QRGL 5CBEB 1HH6B 1AS8A 1JV5A 2WKOA 3QGVA 3S35L 1ONQA 2PYEA 3BO8A 4XP4L 2ZOLB 1H9VA 3GB7B 3K3QA 4HX1B 3S4SB 1C08B 4QYOB 5TQ0L 5E5UB 2VQ1B 4D0BB 5I1GL 1F00I 3JYBA 3U1QA 3O8XD 1TU2B 3GBLA 3IDJA 2J5WA 1KTKE 4B9YA 4LPUA 1N7MH 5D96B 3MV9B 5E2TH 1AYRA 1MCEA 2BZDA 1KDIA 1P53A 1Q0XH 3MJ7B 4X98B 5DFAA 1M2OA 3H3KA 5CP7A 4EUPH 2EKJA 3IPBA 2AMUA 3O2DH 3RVVD 4L4TA 1FNHA 5IM7B 4XMKL 5B1JC 3SSGA 3G5VB 3BEVB 2VXTH 4OZHF 3HHSA 3QG6A 2FH8A 4XP1H 3FTSA 4JW3A 1A3RH 5DEFB 1CDUA 4LFHD 1LK3L 4HSAC 3NSYA 4OD3H 3JWNE 3ROOA 3WI9A 4G6JL 4AYFB 1ZXQA 1U8IA 5F7DB 2ESVB 2V7HA 3MR9A 2G4GA 3QXAA 4NNPH 4X8GA 4QEGA 3VD7A 1P5UC 2WUCH 3Q2VA 3X1FA 4YS4A 3EJZC 1KZYA 2OQJA 2Q5BA 2ZYHA 3FUMA 2ADGB 4CRPA 5LVEA 3VVWA 1E40A 4UV4L 4D0DA 4XCYB 3WUWB 3IXAB 2BFVH 4I0CC 4AQEB 3UTSB 1B0IA 3QWRA 2JQZA 4XGZB 5EU3A 4E41B 5EIQA 1LEIA 2J43A 5LAPA 1IV8A 1DJXA 1U8MB 2DN7A 4P2QD 4J3WA 3RUGA 2W9EH 2WIMA 4X99B 1E5BA 1YC8A 2PO6C 3LTVA 3QUMB 3QP3A 1IGIL 4BWWA 1LWRA 4ISVA 1XHHA 3DUSB 3FTVA 1F6AA 1GKOA 1SM3H 5MENE 4V1DD 2EDXA 3VFMB 3ABLB 3ET9F 4WJG3 3IKCB 5F1SA 4HULB 5SWQA 1R3JB 4HEPG 5AB9A 4JRYB 3N1MC 5B38B 2J3SA 3K5SA 4YR6B 2YFOA 4L4VB 4XC1L 4DGVH 1PZBA 2W94A 3IYLW 5IV2A 1JWSA 4JN1H 2BMKA 4PGCB 5L4JA 3UYOD 1NFDB 1U8OA 2JMRA 4FFZL 1CFTA 1HCYA 1IM9A 1NKGA 3IN0A 1Q1JH 4AENA 3WN5B 4OZ4A 1IBYA 1SYSB 5I74B 1FO0A 4XO4A 1G1YA 3QA3A 4Z3JA 5E7FA 3NTCL 4F33A 2ZOUA 4IRJC 4POUB 3K91A 5ANME 3L3DB 3X13B 5A6IA 1A1MB 3TYFB 8FABA 2K45A 3LV3A 1JG9A 5LXGH 2UXGA 2P43B 1JGDB 4F7TB 5AOJA 1IBDA 1A6WH 4GBXB 3S36L 1TJIH 1U42A 3CZNA 3TWCL 5BV7C 2XWEA 1DE4B 2ADIB 3AACA 1WFJA 4KXBA 3VDBA 5ABDE 2MOGA 3FFCA 4WI2A 3FQUB 4FG6D 4X98A 4KDTC 5ACLA 2QKIC 3EOBA 3PP3K 5KBLA 2BERA 2V2XA 5FHBL 4YBQD 1P2CB 5AYUH 3MXWH 2CBTA 5I1AB 2VDNL 5KSUB 2AQNA 4EUPG 3BVXA 4XX1G 4RWHA 4AUYA 3QJFB 3UO8B 5CF3A 3HRPA 3C9NA 3QNXB 4PYHA 2V4LA 5L7XH 2OI9C 4XPTL 3RZCD 1RUAL 5D1XE 4K23L 1R4XA 3HS8A 1XGZA 2B2XH 4TULL 3RVTD 4IKLA 4KHTL 4NO0D 2X0WA 4Y9CA 3WFHB 3O9WB 2R56L 4KI5F 3KE0A 3O6ML 4JZOA 4WHDA 2MTAA 4PJ8B 1M6OB 3FTZA 4MCMA 4L29B 5EU6D 2GJ6A 5DVMA 3T0EE 1F97A 1BZ8A 4HKZA 3SO3C 1P1ZA 1T66C 2WBJA 5IB5B 1F42A 2YD1A 1RIVL 4UM8B 2ZKWA 3H8NA 2APFA 2A9CA 3HG5A 1P5VB 3DO7B 1IGJA 3I02B 3MUUA 3V0IA 5GGRA 1BZ9B 3SE6A 1UOWA 3DDFA 2WINB 4Y9FA 1S4IA 3AUVA 4ODUB 3ZE0E 1PGRB 2PCFA 4FOMA 1AI1L 5T3ZL 2WKGA 5D1QB 2J2ZB 1YMMD 3V6ZB 1C9SA 5D7IF 4EBQL 1QPPA 4E68A 4N5EC 3H42L 4H0HB 4YSUA 2ZUUA 3S9DB 5C86A 3HC3L 4FQXB 5CN3A 4I18B 5LGJA 4ADGA 3OXSB 2AJZB 2OMXA 3TNMA 12E8L 3WFBH 2AV7A 3PGCB 1MEXH 2AJSH 1QRNE 3FH5A 4PJ9C 3RPIA 1J0KA 3EG9A 2WBWB 1K4CA 3SCMA 1BIIB 5FA3A 1CF8L 1FORH 5KANG 3S3CB 2BRRL 5BZDB 3LIUA 5E2JA 1LDPL 4AYBA 5IFHH 3FN3A 2AI0H 5D7HA 1OT4A 1A7OL 3D4YA 3GMNB 3TJHD 4YSSA 1H3PH 3AG2B 3LB6D 4R5VA 5CJQL 4BFGA 1VERA 5C3TA 3RRQA 2YWYA 3QEHA 3TA3D 2G60L 3I9PA 3RBGA 1BQHG 3O4OB 2XFXB 1O7SA 4R96A 2Y6SD 1QG3A 3IMVA 4JUTA 1E3XA 4LZKA 1PVHA 1UD3A 5HDBB 5BW7A 1IBFA 2EYSA 3UMNA 4KI1A 4DEUA 4HT1H 1U6AL 3RY4A 1XH2A 4RX4A 3QUGA 3ROLB 3ASNB 4JDVB 1BFVL 2HVBA 4ELKA 4XC3L 3QRGH 1F2QA 5HVWA 2JI3A 5B39A 1A7OH 3TA3A 2VITB 3HPJB 1VZHA 1ZANL 2G2RA 3L5HA 1W72A 3UGUA 3HC2A 1KELL 3GSOB 4QRUA 3V7MA 4XN8A 4XRCA 4Y5YB 2VL5B 5CD5C 4YE4L 4C55A 1ZRUA 4Z7IA 3JVGC 1VENA 5HJ3B 1BCIA 4JAMB 4XP5H 1E6OH 5T1KA 3UTTA 3E9TA 3TO4D 4J3VA 5AOIA 5ENWA 1UURA 4ZX6A 5HHPA 3UEZA 5TK2A 3CDZA 4FFZA 3RL1B 3HC3H 5CEZD 3EJJX 1G7JA 3QJTB 4NNYA 4D3CH 3OZ9H 4ODBD 4GI8A 1BZ9A 3WXWH 1YYML 3X12B 1U8KB 2WMPB 5HD8C 4FZEH 3ZKXB 5ADPH 1KBWA 2D4DA 3WUZA 1IQWH 4K3EH 2YQGA 4F7MA 1IAOB 5JUEL 2DBJA 4TOYL 1IZKA 4J28A 3OMNB 5DHVB 2GSIA 4Q9BA 4JRYD 4DW2L 4KZEH 1L5GB 4WUUD 2R0LL 3GRWA 1VADB 4KNUA 5D7IA 1B4RA 2JB5H 3SDCC 3U0PB 3W2DL 4KKLC 1FZMB 3V95A 5GGSA 4R3SB 4R0LB 1C7TA 4ABVA 4LLVB 1AR1C 1T0MA 5DEGB 1E9OA 1Q0YH 1D6VH 3QE5A 1CDGA 1PX4A 1BX2A 5K9KB 1DJIA 4HUKB 4LNVA 3FAWA 4TULH 5CJOH 2RHEA 4P46B 2NR6C 4WNQA 4XCEA 1CXLA 1VGKB 2EC9U 4P4KB 2BS71 4P0DA 4OBSA 3BP5A 3VYNA 4Y89A 2EVGA 5TF1H 2YD9A 1CVSC 1GTNA 2KQNA 1L7IL 4WHTA 2BSSA 4ZTEA 4LHJB 5D7LD 1JPFA 5F1NB 5C0AA 1BIHA 4HZAA 2J8UA 1A47A 4HKBA 3TNNB 5JQHC 2Y2YA 3WHXB 2RFXA 3WV0A 3BMWA 2BNQB 5CKAA 1HHJB 2WSPA 4UU9B 3V5KB 3K2UH 2YK1L 4CU6A 4K94L 3F6JA 3K7UA 4ZPTA 1G9MC 3KPRB 4RNRA 3V6OA 3K6IA 1E8WA 1QR4A 2BNUA 3HRZA 4OLWL 4Y16C 4PU2A 3C5ZB 3CWGA 1W8NA 1BQ5A 3VFRB 3LH2H 2A3TA 3QZOA 3RWCB 3V0DA 4W9HC 2PYFA 4LARH 3V0WL 4BFRA 5DMKB 5GZNA 4UCFA 1TOXA 2BC4A 2OCFD 3FOLB 3FN0L 3FQXA 2A83B 5I6NA 2KPWA 2FWLB 3CH1B 2YJLA 2X6BA 4AVIA 4F37F 3NP4A 4MNGB 3H3PH 3HG4A 3VI4F 1R5IB 5I8KH 3DX1A 1GAFH 3MO1B 3ULUD 4NZFA 5BVPH 2J8UE 1ETJA 3WTVA 1VCBC 1DLFH 5DJXA 3FHAA 1IL1B 3IFOB 4NP9A 4YDLC 1SMAA 2ZICA 3M1BB 4GAYB 4JFEE 4A7GF 4L8BB 5AALA 4PR5A 1OTSD 3ZKSD 3TBSA 4JGJA 4Z8FH 3TCLB 1FFTB 5GGSB 3EYQC 4ONFL 4XVTH 2MQ0A 2R1XB 3B34A 1IGML 2QLVB 1P84J 1S7WB 3WDIA 5DMYA 1SM3L 5L7XL 3N9GL 5A6MA 2KZBA 4K9EC 1L5GA 3CHQA 2YLHA 3BVVA 4PREB 4GUPB 3N0PB 1BVKB 4MA3B 4WDIB 4YK4C 1GC1H 4IOSD 1FBIH 4L37A 5IQMA 5A2JH 2L0DA 2L7EA 3IM1A 3THMH 2FZ3A 2Q7YB 2OJ1A 5IHLB 1HWHB 1QRNB 4PJHA 5GGUB 1B3JA 4OFIA 4PTTB 5F72S 4JVWA 3Q2LA 2FO1A 1E7VA 3VWJC 4CDGC 1YRKA 5HYJA 1CD1A 5E08L 4FJYA 1DBAL 3T0BA 2V7NA 3ALWA 4JJ5B 2WN3A 3T0XA 3MRBA 2G3NA 4HGWB 3GRBA 1Q38A 2UXVA 1TJIL 5ITFA 2XY1A 2DYPB 2XWTB 3CJJA 5C3LD 1A6AA 4KMLB 1FNEB 5IMLA 4OSUL 1MI5E 3DIFA 3O0RL 4X6CB 1NIEA 2MNWA 3Q2CA 3G9AB 1LLAA 5JA9A 1AIFB 3O3EA 4QIRA 1UWEH 3ZX1A 3DVGA 5FF6A 4WI5A 4UOQA 1KGWA 3WENA 3PF2A 2C7FA 4KKRA 3PREA 2GAZA 1N18A 2PTTB 4L4TE 4RFEA 2Z9TA 4DGVL 3V55A 5DHXB 3MYJA 5EC2A 2KKQA 2XX0A 2YMTA 5GRJH 3RBSA 4ZX3A 4PJEA 3BFWA 3CH1A 1XCQA 1OF2A 3QDMD 3QXTA 2A6KB 4K3GA 3GSNA 1Q9KB 1MCHA 4TF4A 1OTTC 1YY8B 3ABKB 4CC4C 3BT2L 2CKBA 1DJWA 5F8QC 3NQIA 3CFCL 1ECZA 1IBGL 2OSXA 1SN2A 3N43B 3O6FB 4XT1C 4HCRH 1KBGL 2Y7NA 1KCRH 2R1XA 1SJMA 1CLOH 3BSGA 3GZKA 4JQVA 2AJVH 4OKVA 5E8OA 3DSNA 4DETA 1X7QA 4J6RL 5IVXE 4V2CB 3P9WB 4K5PA 5DRZA 3FL7A 1CGSL 5HYIA 1KTJA 1UJTA 3Q6GL 2B9BA 3KBFA 5DJZA 2QFRA 2W5PA 4QT5B 4YDJA 1WTGT 1P7QB 2R0KL 4BZ2A 1CG9A 2KZKA 4NRXA 1AQ8A 3P4OB 1LO3L 1S9WB 3ILPB 5H37H 1KGUA 4K7PL 4TSCH 2VGLM 3P2TA 5CGYC 5D2LB 4FTVD 5D2NA 5FGBA 4GG8A 5KBPA 1BD2E 3CSYB 3HRZC 3C5XA 4P5KB 1F4WL 1PZ3A 4ZFFB 2BNRA 4K0OA 5F9AC 2UZYA 1E5AA 4WI4A 3PXHA 1FFQA 3RU8L 4WI3A 5JO5A 4FI8A 3IJ8A 4PJXB 3EW3B 4PREA 3ULSA 2CR0A 5HHPB 3GUTA 4K3HA 4APQD 2VCOA 1XD0A 3K1KC 1J1OH 4PS4L 5I0XA 2DQ6A 3FBQA 5GGVH 4FZ8L 2ZP8A 3KYOA 3VFNA 2FO4B 3GS0A 3T4AC 5IW6B 1NC4B 2A9DA 1FZOA 4XP4H 3O6KL 2WLIB 4JFXB 3UOAB 3CHSA 3ZGIA 4OGXL 1Q94A 2ZKYA 3L6FA 2AGJL 1XCQB 5EDSA 3D3VA 2VZUA 3KPRE 5FK9B 1IE5A 3L9RB 1MLCA 5GRXG 2B9AA 3B9VA 3BAIA 3WEXB 4N8VB 4EUPA 4M1CD 3BIKB 3BPNB 4I3GA 1N6VA 4HAKA 4NKMB 3GMLB 3TH3T 1KY6A 4CSSA 2BP0B 3PAYA 5IEHB 2YZ1A 4XBMA 2UUDH 5DURD 1YEFH 4QOKB 5EUKB 4D9QE 3HC0B 4K9EL 1PQZA 1R6VA 2XNAA 4WLCA 1SN0A 4UM9B 5JW4R 2XQYA 4UBDC 3ESOA 1RIHH 2JELL 3HE7B 2MNJB 1MHPH 3HFMH 1UTDA 4KQ3L 4NJ9H 1X5LA 3FUFA 2VLRA 3KBHE 2P47B 1TXKA 4OLUH 4KXZH 4EI5B 2D7MA 1S78D 4HCFA 5DGQA 1TZHB 2J8UB 4OZGE 4ODWB 5C0EA 1A8JH 1IGCH 4X5QA 3OXRB 5E70A 4NN5B 4MDJA 3VJ6A 1KMGA 4L2LA 2AEQH 3QJRB 3U6RA 4M7JL 2ICEB 5KYWB 3MLXL 1S7TA 4F2EA 2Q3ZA 2DI7A 3NRQA 3WTUA 4XX5A 1QFOA 1ZE3H 3TBTA 5IBLC 1QNZL 3TH4T 1ZY9A 3DECA 1TZIB 2ZIDA 3EJUA 3P73B 3QZLA 2GTWB 4MS6A 4G1EB 3RIFK 4RDQF 5JOPE 4Y2DC 3AXLA 5BCAA 5J12B 4YFEA 1SJHA 3QI9B 3BGMB 1FI8C 4Z7VB 3WNKA 4OVUA 4UM8A 1OPGH 2XWDA 3GNMH 3FN9A 3QIUA 3QFDB 1YNLL 2BCMA 3LEYH 4A2EA 4WIQA 1VFOA 2E47A 2YQ2A 3ATDA 4XVSH 3GSWA 5E6IC 1ZVYA 2VMFA 3A6BH 4PJ8A 1FGVL 4YO0B 3D3VD 3DVIA 5ISZE 1A1OB 5TH2B 2A73B 3MRRA 4LDLB 4W68A 5EEXA 2LFGA 3ESMA 4TNWF 5F9WC 3VWKC 5D1QC 4A6YA 1KBBA 2BJML 4LQFL 3SPVB 3MRJB 4HWEH 1OCCB 3EH5B 4E5XA 5IB4A 3ESNA 3ZVVA 4PI0A 4ACPA 3UJJL 5BZXA 5F1OB 4PJ9A 5IR1B 2ZWZA 1AO7E 3PUUA 5DJDB 1HH9A 1HL4A 5C9KA 3VSTA 4P2RE 5DZNA 1S6NA 5JXAL 2O93L 1ROCA 1D9KA 4APQA 3QG6B 1P9MA 3BHBA 1WBYB 4E5XG 4UILL 1GH7A 4I2XA 2XZZA 3L5XL 4FQ2H 1XBRA 2IDQA 3JTSB 1JSYA 1UZ6F 2YXMA 4X7DC 5GSRA 3DOHA 3TBVA 1CFQB 2Z91B 3T8MA 1OGTA 3EFDH 3OJDA 2WYHA 3ORJA 2UZPA 4FTVA 4WY7H 5DJ2B 4OFQA 3QI9C 4GW1B 5DMIH 2DDQL 5DYOA 3VFUB 1AQMA 1T22A 2JNZA 3WS3A 4OZFG 1A2YB 5I75B 4LCIH 5DRWB 1TT6A 5EU3B 4LSRL 3O41A 4HPOH 4XMPH 5KSVA 2HP4A 2OTUA 4HD5A 5EIIB 4UOJA 1Z0NA 4Y4KC 4KH9A 1Z3GH 4ZXBB 4HV8A 4XBGB 1DL7H 5HDLA 1I4FB 1F4XH 3ARBD 4LRNH 3WN5A 1HDMB 4JR9H 3SGJA 3WTXA 4M6NH 2NR6D 3RPBA 1J9TA 2V0AA 3VRIA 2OXHA 4BXVA 2KZ1B 4AYFA 3RJQB 3HI6H 5F93C 5L88L 4NKIL 1XCTB 4ZQTA 4JFYB 3RWJB 4IOIB 4P5MA 1P7QD 4ATTA 2LU4A 1J5DA 5CN1A 4FFYA 5IB2A 5D7SL 5KVDH 4G82A 2Y07L 4Q58C 1FG9C 3EGSA 3LH8A 3MACL 4PB0L 1CS6A 4E41A 1J12A 4TVUA 2ARJA 1S9KC 1UXWB 4LP4A 4WWPA 1YNTB 1HWGB 4YL4A 4ZNEE 4M6MH 1MOEA 3BH4A 4DP6X 3QH3B 3FMGL 4F33B 2OCJA 5C71A 2X28A 2HWZL 2J6EH 3KPLB 3D85B 2QKIA 4PJEF 5F6IC 4KDTA 3CVIH 3BWUF 4EKJA 1PZAA 1LO0L 1GCFA 5I1KH 1XL6A 3GIVB 5B3JE 2VR6A 4JAMA 2HJLA 4AG4L 4GG6A 2X4UA 5CFAA 4HZ1A 5GGQH 1ET8A 1EMTH 4AYDC 1ZS2A 3MLYL 4Y5VA 2PYEE 4WI9A 3B37A 5F8RC 3RE0A 4IRJA 3CIQA 2FSDA 4WFFD 3HI6L 1QR1B 4PWIA 1KCVH 4KX8A 3QORC 5DXWA 3OAZK 2X89D 3EO9L 1AXSB 2NNFA 1DSFH 5IHHA 2V2TB 3GUTB 4FTDA 5E1IA 2Z6FA 2NCMA 4QOKE 1I8IA 3EJYC 4M4RB 4QRRE 2AAVA 3QQ9D 4JKPH 4GXUM 4YFDB 1Z3GL 4H8WC 1J1PL 4IOSA 3MV8D 1I3RA 3B9KC 2AXJA 2YBGA 3EHBB 5J9PA 5MEOB 1RZFH 3BD4A 3L3KA 4MKTA 3FJTA 4HUWB 1BDYA 2OA9A 4UV7H 4BEIA 2X4SA 3HB3C 4DO4A 4RZKA 4WEBL 4WTZG 3IK2A 2ICWA 4FNLH 3S5LG 3ULVF 3LZNA 2H3KA 1GGYA 4MJ5A 3B9AA 5GS0H 5I8CA 5IHZB 4LVEA 5IGXL 5A3IC 1X5HA 1HINL 3W39B 3MUY1 4N8UA 1M7XA 3MJ7A 1DN2A 1FH5H 1H3VA 2FECL 4MBRA 1MAMH 1P5UA 1TYRA 2AZUA 5DR5H 3WDJA 4HMDA 2A6DA 3VI4A 3PWVB 3LNEA 2E8ZA 1XBDA 2QKIB 4WQOA 1IL1A 1BMGA 3BGAA 3GTVA 4ZYKA 1OV8A 4WW2A 2CZNA 1RJLB 4HX1A 4HZLA 4DKTA 1K8IA 2XCMC 4R26H 1OAXH 1AFVH 1WGOA 4IBQA 4N2EA 3T1WA 2R2HB 2Z3FA 4MJIE 4J3TA 3A6BL 3WKML 2F54E 3ZHDA 1F18A 4PY7B 1WZ1H 4OCLC 1KV7A 4K8RH 2VDQL 5AVWB 3OLDA 3ZSTA 2DQFB 4NCC1 4ETYA 5DDHB 5DUPL 4LP8A 3WHE1 5IHUH 3DUHA 1ODUA 1IGYB 4HWBL 3MODH 3K4DA 4YNYB 5C0AD 5J57B 3LNHA 1KTRL 2IADA 4C57C 4F8LA 1IKFL 1UG9A 3WFZA 2EYTA 4JHAL 3O6KH 5FFGA 2CALA 1XVSA 4R26L 1UZ8A 3FO2A 5IB1B 4XN9A 2X4UB 2ZKXA 4Y2OB 4LLUB 2DYPA 2XWTA 4HMCA 1QLRB 1WPCA 3H9SA 3L9BA 4Y0GA 2GITB 3G6JB 4PS4H 4AIOA 4N1HB 1FFOA 1R3KA 1W8EA 2VKWA 3GBNL 3TBWA 5E8DH 1GZQA 2NZ1A 2IQAA 4OI8A 3TURA 3P9LB 1QVOB 1U3HD 4NQSB 3K6SA 3JT0A 2EXWC 4QAMB 3PWPD 4Y9EA 3SJVA 4PTTA 5IGXH 3OR6B 4CVZB 3UAJD 2PPFA 3SBRA 1T0NB 4L8SC 1KXTB 3D7PA 1TSRA 4IRZA 4OJFH 4TQHA 3Q48A 4DFIA 1PCSA 4XOEA 1R5WB 4KO5A 1XZWA 1J87A 1LO3H 2D7NA 3QULB 5TE7L 2A4EA 2R0KH 2BH0A 3DVGB 1TQWA 5DZVA 5FF6B 3VAEA 2K7QA 3MU3A 4PJ9B 1N5YL 4ODHH 4AH2B 2WNKA 3ZMNA 1KIRB 4OF6A 1DQQB 1HHIA 3OR7B 4HWUA 4KPHL 4URKA 3A67L 3MREA 4BKSC 2HT4C 1HSBA 3VSUA 3GFUA 1WFUA 5JYMA 1U8OB 5KS9A 3IU3A 4MB4A 1YMHB 4LHQB 2D2OA 1TTBA 1YY8A 3VSQA 1A0QH 5FA4B 4M6NL 3U30B 1YYCA 1SOSA 2WXRA 3SE9L 3E8UH 4OCSH 5K9OA 3CLFL 3TVMC 3ZXAC 4BKTC 2AJ3B 4LLDB 4XO5A 4JK0D 1KJ2A 4NO5A 3NFNB 4Z5RB 1NMCB 1SF5A 4K3DL 1T1YB 2ZX8A 4RA3A 2X2JA 4OJYA 4QHMA 3X1GA 5GRUL 5AW8B 4NRYB 2XA3A 2IBZY 5MEQB 5L8JB 1RZKL 3IMUA 2DMKA 5GRJL 5B4MC 3MLYH 2NY6B 1CXEA 4MA7L 4LSTH 1CGVA 1UZ6E 4OCYL 4KBPA 2EDNA 1U93B 1QX1A 2W8CA 3QUXB 5BO1L 3ZPDA 1CL7I 2LW3A 1MHEB 1BYNA 4WKXA 1JNHA 2YN5A 3CUPA 2EEBA 4IKNA 4DKFH 3LEVL 4UT6A 4PRHE 3IVKA 1JFHA 3HR5A 3QDAA 4MVBC 3IJEB 4X6DA 1MN4A 4ZOCA 2DQFA 1Y18A 2CK0L 3P9LA 3LZQA 1IT9H 1VESA 2C3VA 2P7TA 4HK0B 5I1JH 2AZAA 2JKWA 43CAB 2GKIA 1FFOB 5D4QA 3SCMD 1EZSA 3ILDA 5FGSA 5CHNA 2KT6A 5FB8A 1J5OL 4Z7OB 2WO4A 4XBPA 1FNFA 3OHXB 3JYCA 1EO8L 4EI5C 4U3SA 2X3AA 4JREB 5AFAA 3UL4A 4JG0L 3OGCA 3HI5H 1AGDB 3STBA 3BYYA 1ZLSL 1QNIA 2AXGB 4R5TA 4AEHH 4YHKH 1SLWA 1FBIL 3AT9A 1YMMA 3MCYA 2ZOOA 3G6AB 2QVFB 2HG5A 2WO2B 4Z7UE 1LYQA 3MRNB 3MUJA 3QULA 5JHLA 3X14A 2F2HA 1E2ZA 4LSTL 4LK4A 3B5GA 4GXVH 4PRHA 5I73C 4FE9A 3PABB 1NL0H 3KPQB 4JGMA 3W11C 1DJYA 2P1YA 4OCWL 1TKWA 3J27A 3FOMB 1IKOP 1OB0A 4ZOBA 2IGLA 4CU7A 4ZODA 3K4AA 2DKMA 3WHXA 1PX3A 3R7QA 5DVOA 3QDJD 4Z5RA 1B3IA 2CDEA 1RERA 3QS3A 1NAMA 1J0JA 1V55B 4PB9L 5FKPA 4LGSB 4ZOAA 1FDLH 1BQLL 3DUUB 5IQNA 4Z7WB 2Y3NA 4X7EC 2VRQA 1U8LA 3C75A 4M7JH 1DANT 3RVXD 5HHNB 4NO0A 3WFCL 3PP3H 4YDZA 2QHRH 3CZFA 4IGBA 4FP8H 4NYLB 3LEXB 3B1UA 4OSUH 1LE9A 2JF1A 5BRZD 2AVFA 3RZCA 1HIML 3IGLA 4MD5A 1MW3A 3FO9B 4U3HA 4XCNA 2JTYA 2F54B 4HUMB 3BVUA 2EVHA 3MO1A 2VITA 3AS1A 5HDBF 3TYGL 3VWKB 3DI3B 3FUHA 2J88H 4RVBA 2XV0A 2XVLA 3ZK0A 4C58B 3M1BA 3M7FB 3TN0C 1P4BL 3J7HA 1IAIH 1YNTF 5CEXA 1RPUA 3C5ZC 4JKLA 1JZ4A 4A37A 1ZHLB 3FB5B 2H47C 4GSDL 3FCGA 4OV5A 4AMKL 4JRFA 5EZIH 2EIZB 4YK4B 2ATAA 4YOKA 1KB9K 4AZUA 3FRPB 3ME0A 4G6AD 4YC2B 3FFCD 1HS6A 2R1YB 4NOFA 5DJAA 5SX5H 1QATA 1A4KB 4Y2DB 1BZ7A 1U93A 2CH8A 1OOAA 1J9SA 5F3FA 5LGKA 3C8DA 5SV3A 1XEDA 4ZMXA 1S7VA 4LT7A 4GB9A 4KROC 4DCQB 1SQMA 2DI8A 2B8OT 4P2RA 4DH2A 2N1TE 1BQHA 1YCSA 4NM8L 3TZVC 2BIMA 1A6TB 4XRCB 2NY4B 2WNGA 3OHXA 2GHWB 5CIPB 1EPFA 1IM9D 4HF5H 2PR4L 3HC4H 4PIBA 3MBWA 3KPSE 5HGDB 3UADA 1HHKB 3SKJH 3QWOB 3MLXH 1I9RL 1F3RB 2WQ8A 4JGUA 4YE0A 3MODL 1W72H 4NRZA 2AEQL 3LKPB 4EDXB 5IJKA 2UYLB 2XV6B 4NQCB 2KMWA 4K2UH 1SFDA 1ZD6A 2GVYA 3EDKA 3V0WH 3W81A 3RU8H 3ZDXB 2AQ2A 4NENB 2XWXA 4MFHA 4U7KA 3TH2T 1EHNA 4P99A 4XCEB 4ZO8A 3DX0A 4C56E 4PJGB 4LIQL 4AQ1C 4I5BB 2JELH 2B08A 2CU9A 4OLWH 1PKQA 2DJ4A 4P2QA 4RLDA 5LO7A 1A2YA 1ZXKA 5E6IB 3QWRD 5F7UA 4M8UA 5C6PB 3AT8A 4DEPC 3O3BB 3D18A 4MMYA 3MXVH 1N6UA 2BY0A 3CZEA 3FONB 2B59B 3OR6A 1FVEB 3IE4A 3AS2A 4H7VA 5ESVA 1LO2H 2DWSA 4LP5A 2HRLA 4NZUH 3T9WA 5F6IB 5SWZE 4JFSA 3R18A 2EAEA 1QLEH 5I2IB 4AUUA 1HHHA 4M62H 2H6UA 3D4ZA 3FU0A 4QHPA 4ZNEA 2JCCA 2KHAA 3O2VL 3QQ9C 3BT2H 2BC4B 1KGCE 4QRTA 4JM0A 2GIXA 3KLDA 4L4TD 5GGVL 2FJFB 4P3DB 1OQOA 2ITDA 1NMAH 1A6ZB 4X0NA 5IFAH 2AAAA 2AEWA 1EAQA 1JK9B 2FIKB 2OAAA 2YC1A 2IALB 3QH3A 4O51A 2YD3A 1H6UA 1IB5A 3ARPA 2XQBL 1EO5A 2BNRE 3QEGH 4XWOD 2YWZA 2VM3A 4KKAD 5D72H 4LF3B 3B7SA 2HLFD 4HIHA 3OXSA 1CICC 4GS7C 1JNLL 2WOYA 2KLSA 1MRFH 1R47A 4FYRA 4H88H 4JRXE 3BQUD 4YHMH 3B2DC 4YQXH 1QFPA 3KYKL 3NRFA 3FQWA 4H20L 4JFQA 4EXPX 1RUQH 1OSPH 2VN6A 4PGBA 1ASQA 1ZK9A 3SY0A 1VACB 3R0MA 4NPKA 3EBGA 3Q6GH 1EA9C 4LNRA 1RU9H 1K4DB 2CO3A 1AGCB 3EFFB 3OF6D 3D0VB 1Q9WB 2A9ML 2VDMB 3RDTC 1BVOA 3MV8E 1PAZA 1DJGA 1LEGA 1EAPB 2YN3A 3MBEA 3DRTB 4F93B 2BP8A 1CIDA 1E90A 3UMTA 5I16A 1KBGH 4XMXA 1KTCA 2DOCA 2ADJB 1VRSA 2J6EL 1FV1A 4NFCA 4PS3A 1IBGH 3D06A 2HT3D 4HUCA 5ABAA 2CUMA 5DC0A 1JDCA 1FVEA 4MJ6A 4DKAA 3SCMB 1DSYA 2YSSA 2EXYD 3E6HB 1TVHB 2N3JA 2JIXB 1EIBA 4GKOA 1RZ7L 2FEEL 4JRXA 4J3BA 3A24A 2R0ZL 3WS6C 4OT1L 4XGZA 1LEIB 2VLRE 3CQPA 3UBXB 5J9PB 4F7KA 1NOLA 2OMZA 5E9DE 3SHSA 1DJHA 1OSYA 2D3JA 3HE6D 3ZT6A 1FNSH 4OLVL 4DHLA 1HYSD 2FJGB 2WZPD 3N04A 2P5EE 1Y6KR 2CUIA 8CGTA 3HAEA 4TNGA 3WMSA 2A6DB 1BD2B 3RGHA 5I1LB 5BZWB 2Z35B 2Q10A 5EO0A 1TF4A 1C1EL 1B90A 4X9BA 4BBWA 1UKTA 4F80A 5T5FL 1RZGA 2IDFA 4QNPE 1S46A 1IUZA 2MNUA 2WLLA 4YO0A 2EXWD 4Z0XA 4DPBX 1S7XB 3PJSB 4N0UA 4BZ1L 2CKBH 3HPJA 1GS6X 3BZ5A 5C0BB 2X4RB 5E08H 5G55A 4MD0B 1HQ4A 1D5BA 1TJGL 4Q9QH 1A1MA 2DH3A 3AU0A 3TYFA 4HFWA 4K94H 5DURB 2WAHA 1CFVH 1QFWM 1RK1A 2X4OA 1K5WA 3BUIA 4GBXA 3SDXF 2O1AA 3LIZL 2ITDB 4PD4J 4FC3E 3LV3B 3ESVF 3THML 4TUJB 3RNQA 6PAZA 4YHNA 4NKDA 1U58B 2EDBA 2P80A 3D0VA 4U6XA 2X1OA 2VDOB 3T0EA 4HJJH 1IFRA 2JSFA 2OMVB 3EOBB 1KF9B 1L0PA 2EEXA 1YEWA 3K6OA 4UIMA 4X6DF 2OM5A 3FPXA 1IGMH 1WIPA 4YN3A 1P2CA 5CU9A 4D8OA 3U4EB 4MAYA 5BZZA 4PJIF 3S88H 5HGHB 4K8RC 2AXFA 4S1QH 2VJ0A 1CXKA 1NEZA 4GPVA 3V0AC 4BSWB 4MXQC 5DS2A 3W1ZA 3JV4B 1A4BA 1AHWA 3ZE0B 2ZF8A 3MRKA 4LIQE 6FABH 1P6AB 4Y2DD 5AVYB 4K23H 1BFSA 3D39E 4HH8A 4YSDA 2IFFH 2P5PA 5DI8B 4U1LB 2X9YA 5DQ9B 1G6RB 4HUUA 4X9FA 3NBNA 4N2DA 1OSZA 2VM9A 2X4TA 5I17A 1TTUA 1JTTA 2Y5QA 3FQYA 3HG1D 1WEJL 2UZIH 1E43A 1F5WA 1GJUA 4DT2A 1CL7H 4LLMA 4AI7A 2DLFL 2R4RL 5BJTA 4U6HA 5I5JA 4UB0L 3FT4A 4XCFL 4QYOA 1AG6A 1CFVL 5GS0C 4XVJH 3IKKA 4GW1A 4ZMTA 2OMZB 1MLCB 4GSXA 2VQUA 1UM5H 1KEMH 3ARYA 3QNFA 3EGSB 2XVGA 4UAHA 3RTQB 3WKPA 2WUCL 4HKXB 2CKBL 3MJ8B 2HFGH 4BZ1H 3SGKA 1PIGA 4WSGA 1KZQA 1JHKL 1SDYA 3U7WL 5F3BA 4Z7QF 4GKLA 4LVNB 2N0KA 4NQDD 4MRBA 2FAUA 4WENB 3UCQA 4LCVA 4GW5B 4Q6IC 1IGCL 5C08E 4R4BA 2DM7A 5CGBA 1JNNL 4AQAB 1OL0A 2M2DA 4FXLA 4RMWA 3FTGA 1XH1A 4CSTA 3P69A 4ZMQA 3HZMA 1KYOK 2G5BA 1I7UB 3EYSL 1WFMA 3N44B 4GKSA 4HA1A 2QQNL 4P2OC 5C9JA 3KGUA 5EA0L 3UXFA 4FXGC 4J3XA 5F3HB 2WVVA 1N19A 1WAAA 5CKGA 1RL1A 3HS0A 2BHUA 2AK4E 2DMHA 5C0GB 2CLZB 1N7ML 5D6DA 3QJOA 4BZ2L 2EADA 3PWJB 1QEXA 1A66A 2IAMC 5ADOL 3L5IA 2JJTC 4OFYD 3TEWA 1ZHNA 3AS3A 5IJVB 2Y72A 3NOIA 2A9BA 3LNDA 1S7RB 1U3NA 3DX7B 4HOXA 2R51A 3OLEA 5TPWH 4PJDB 5K69A 3R8BB 4X4ZA 1XGPB 1Y6NR 1AO7B 4IRSA 3ZZQA 3RGVC 2AK4D 4YXHH 2Q8BH 1E4XH 1TO4A 1L3NA 4NQCD 1KNOA 1E5CA 2G9HB 1I1RA 4WJKB 3GMQB 3RVXC 2OBGA 1WG3A 1HXMA 2YEVB 4LEOB 3TA4D 3T4YA 3T6ZA 3ZTDC 4WEMB 1GOFA 4XOCA 5GHWH 2IALA 3QEQD 6PCYA 2X3BA 1J18A 1MRDH 4BQ6A 5IB3B 3D25B 2E76C 3MVSA 2EINB 1KPVA 5LHDA 1J48A 3MCLH 5F9DC 3ZIMA 1E9PA 4AIZB 2DMCA 3OAUL 1XCWA 3SKMB 3D0AA 2YPLE 3KLSA 5DD3L 1ZPUA 1AI1H 3D4GA 2MEJB 5BRZB 4PJEB 4CC1A 1WYJA 4S1DC 3NZUA 4QF1B 1P69B 2QFPA 5BMFH 3EHBC 4NBZB 1WUZA 3JQOB 3O3DA 5KOVC 2R9HC 3NJVA 1MHCA 1TCMA 4O58L 1DQML 3F7PC 2R23B 2O4EA 4X5WA 4P49A 1CGSH 4P2AA 4U6VL 1NCBH 1UQSA 3DC0A 3UYPB 2X44D 4NHCH 4KO6A 1E2VA 2I9TA 1OT1A 5H8DA 4Q2ZB 4MQ7B 5IMOB 2VM4A 2NY7H 3UGXA 5CP3A 1KIPB 2GTZB 5E8PB 4HCRL 1AH1A 2C9UA 1NFIA 5CUSH 2NYZA 5C0BE 1JZ7A 2NUTB 5F1NA 1NBYA 1NBZA 4WV1C 4TTGA 1IGFL 2HVJB 2SEBB 2UY7A 3DO3A 2DLGA 5T1LA 1LP9B 1PAMA 1RVFH 4UI2A 1EUTA 3QZMA 3WFBL 5K59F 4YHLH 2C9AA 3T6VA 1DCLA 1XMEB 2PW2A 3QEUA 2F54A 3ZUCA 5HGBA 4FDWA 4IM8A 1QFWH 1ZSHA 3H42H 3MLTB 4XN4A 1AQKH 1W16A 5T8IA 1UATA 4ZBJA 5FV2A 2XDHA 4Z1PA 1ACZA 3TWCH 4N68A 1NCCH 1PCXA 1Z1WA 3QJHB 3PS6A 2M8XA 2DQIH 4M7LH 1DVFA 2VZOA 4EZMA 1C8PA 4RGNE 3ZDYB 2EVJA 3REVB 1HH6A 1JHKH 4N0YL 3LKRB 4JM2D 4GG8B 4WNQB 1MDAA 3PRZA 4EPSA 2R2CA 1CLYH 4J3OG 1MVYA 4M1GL 3CFDB 1DQKA 4JJHA 3VXNA 2PPAA 3MNMA 3OKDB 1XMWA 4NM8H 3RY6A 4EMZA 2W9LA 3GPSA 4GW4A 4XCFH 1BV8A 3ZE1E 1N2RB 4DGWC 3B43A 1EVTC 4X5WB 3ARFB 4AWJC 1ORSB 2TSAA 3T3ME 3EJZD 1MJ7H 5J6GA 5EN2A 2DQEH 3O3DB 4QXVA 4UF7C 5I26A 1YEDB 1LVEA 4OZIA 1IGIH 4FXKB 3S8GB 5C6TH 4DQOH 4RISL 4L0ZA