3JV6B

Crystal structure of the dimerization domains p52 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
ASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor RelB
publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 16
structure length 107
sequence length 107
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv6B00
3WFHB 3PDGA 4JKWA 2ICWB 4JE4B 1IGJB 4S1DC 2OSLB 4BSVB 2DQUH 4AH2B 5C71A 2YOCA 4UV4H 4E0RB 4G43B 1D9KC 4MAYD 3B4NA 2AXFA 2CK2A 2J8UE 1G7PB 3CAFA 4ERSH 3DUHA 1AI1H 3CFEA 3HNTL 3UPAA 4Y4KB 1Q9KB 2CGRH 4H26B 1YYLH 1P4LA 2H8PA 3SKJH 3OGOE 5C09B 5ID1A 2F53B 2DAVA 3RJDA 4Y1AD 4O58H 1DBAH 2V5YA 1C5CL 4F37K 1IZJA 2DTSA 4Y1AA 1BFSA 1XGPB 4XC1H 3B5GA 5TH2B 4LCYA 2XWTA 2C5DC 3N85H 3NAAL 4GRLC 5MEPA 4WO4B 3EGSB 1GAFH 4GMTL 2W9EL 5CP3H 2EECA 1TETH 3T09A 2EE9A 3RZCA 5J57B 5HD8C 4NNXA 1IAIM 2NLJB 4XGZB 4XWOC 3WXVH 2QADC 5DUBA 3G08A 1I7RA 4L9LA 5FF6A 4I5BA 5DGQA 3QP3A 4MAYB 4X80L 1CDUA 1MIEL 3BKJH 1HH6B 5JW3H 2HWZH 1RFDH 3QQ4A 5J13B 3B9VA 1XT5A 4NC2B 1QHOA 4FS0A 4FQ2H 3BH9B 1G7LA 2FEDC 5IB4A 4OM1H 1N4XL 3BUYB 1KENL 3QEUB 2WP3T 3EDKA 1K2DA 4CDHA 3LV3A 4MDJA 3QZWB 3G6AA 4Y1AB 2AAVA 4H88H 5GS2D 1A6TB 3IETA 3LPFA 4LLMB 2X1XR 4KPHL 4M7KH 2AP2A 3T77A 3VCLA 2OCFD 5IBTH 3ARYA 3GI9H 1MOEA 5CHNB 4NJ9L 5CD5D 1ZHNA 1D5IL 2AEIT 1EEYA 1JE6A 2R0KL 3G5XA 4NO3A 5JHDB 1T1YB 4OCRH 4ZAKD 5ETUB 1FVCA 1QPXA 4FMKA 2AVGA 3MZTA 4ZAKA 2BZDA 4DK6A 3VRIB 4R96A 3OAUH 3GKWH 1IC4L 1SHMA 1GGCL 2CD0A 3X3GH 2OJEA 4JLRA 2J6EL 1YPZE 1VGKB 2ZCKL 4F7EA 1FIEA 4YBQC 4U6YB 2J8UA 1KXTB 3FB7B 1MY7A 4Z78B 4BZ2L 1NGXA 3EO0A 1TDQA 3FFDB 3BT2H 1CFBA 3CFKB 3C8DA 2X40A 5A2JH 2AEWA 4P9HH 4LVNC 4KHXL 1JTPA 3IETB 1QSEB 5IB5B 1MF2L 3WNMA 1G0XA 1S7UA 4YPGB 4OLEA 4OZHB 4JZJC 3KHQA 1XGYH 4KKAC 3IDNB 3CVHL 2AJVH 5E4IA 3S96A 1NGPH 1R5VA 1YMHA 1F4XH 4U1KA 2FR4A 3QSKB 4JQVC 4X7SH 3QDMD 5IM7A 2A6IB 4S2SB 2GJ6E 3ZHLA 4KK6C 5IHBA 3AY4A 4EDWL 3QDMA 1CWVA 5IB1A 5BV7C 3N9GL 5FA3A 3CC5B 5I66B 2HFFB 2VDKL 1FYHB 4HWBH 3EFDH 4MJ4A 4FQHA 4XNYH 1KBGL 4XBPB 3GHEL 4X0KA 2W0LA 5FOJA 3PGFH 5IVOA 4ODHH 2JIXD 5DK0B 2OJEB 2I5YL 3ARVA 1MNUL 4KHTL 2X7LA 2JIXA 4B5EA 3NABL 5L9DH 2EIZB 5B8CA 5CEZL 2BVOA 4PJHF 1UWEH 4JFQB 3TBVA 3FMGL 4E42B 2HTKD 1MFBH 5DEFB 4PRBA 2P7TB 4J6RL 3GK8L 1EZVX 3KG5A 4HHAB 4LNRA 1T6VN 1EHXA 1HEZA 3MZGB 3AU1A 3BSZH 1A2YA 1ITBB 2GAZB 4JR9H 1U3JA 3STLA 4KQ3L 3DO7B 3DX9B 1H3WM 2MPAH 3L5JA 3MRFA 3MRKA 4QXTB 2LFGA 5FA3B 1IGIH 1X3DA 1JMZA 4P0DA 3BESR 4FQHB 3ULSB 1QKZH 1ZGLA 3JWDH 5IMKB 1DCLA 4LEXH 2NY3C 1RU9H 2B4CC 4K3HA 1CLYL 4NNPH 4NUJB 3U6RA 3MTRA 2HT2D 2FD6H 2VXQL 3EO9L 4NPYA 3W9DB 1N6QL 4DGYL 4PB0L 3NGBC 4L29B 3UBXG 4JM4H 2ZOKB 1YPZA 3RRQA 1CDBA 2IH1A 4PJIF 3QPQD 3EDFA 5EFIB 5DJDB 5CJXC 5J9PA 5CEZE 3STLB 4LLVA 3ARBD 1KIUA 1UXSA 5D6CB 2X6MA 4PJEA 4Z7NF 1ND0B 5B39A 1D5MB 2OXGA 2A83B 1U8QB 2PYED 3ARBA 1X6NA 4YUEH 2R2CA 1PZ5A 3ZMRA 2PYEA 4R4FL 5I17A 1A6UH 1OAUH 2DD8H 2GJ6D 2EKSB 1D6EA 2PKDA 3RWIB 1MHEB 3MRPA 4LVOC 2CLVA 4WFGE 5LGKA 2GSIA 2GJ6A 4UAOB 2W9DL 5IROC 1QD0A 2EDKA 5HHPA 4RWYH 2Z31D 3OKOB 3MCG1 4PV9A 5JXED 1T7ZA 2R8SH 1DFBH 4NPYB 2GJZB 4HUWB 2Z31A 3KLDA 4KK8D 4N0UA 4HWEL 5JXEA 2IGFH 1OHQA 5E5RB 5LCVL 5CLTA 3H3PL 3C09B 4UTAH 4LSVL 2X1OA 3BUTA 1YPZB 5A16B 1EA9C 5MERB 3NFPA 4H0GA 3LN5B 4OB5H 3LB6C 1XF4B 4LLVB 4PBWD 1HINL 1M7IB 4DEPC 1FVEB 4K8RC 4NFBA 5I1DA 1JN6A 1IGTA 3O9WB 4PP1D 4IBLT 5BVPL 4EZMA 4ZNEE 5IESH 3ARBB 3DNKA 3WS6A 1OOAA 5JPMA 2J6EA 4ZS7L 3W9EB 4XB8A 2YD6A 1NCAH 1LO3H 1WQVT 3NPSC 3DV6A 1KGCE 1T83C 1KPRB 4UIKL 3H9YA 5JXAH 5EUOF 4GKSB 3JTTB 4NN5B 15C8H 4N0FA 3UJIL 4W4NA 1HSBA 1XF3B 3BD4A 3ZYJA 5IJKC 1ED3B 4ZS6D 3QUMA 4KGJA 2XQBH 4HULB 1X9QA 2ZSVA 1K4DB 3BVNB 4C58B 3IXAA 4XAWL 3CVHA 4WV1B 5T33H 1MCPL 5F88A 3EJYC 3HN3A 4MNQE 4TOYL 3MUHL 3T1WA 3P73B 1WZKA 4G5ZH 4LPXA 5TDNB 2K7QA 3CFDB 3D48R 3L3JA 4PJAB 2GTZB 1N0LA 4EUPH 1MWAA 4GG6B 1KC5H 1OTSC 1JVKA 5T5FH 1ZT4B 5AWNL 4OLVH 4ZYKB 5E6ZA 5JPMB 1T2QL 3S98A 5CEZD 4JPKL 2G2RA 5FYKD 4RX4D 5H94A 3WLBB 3X13A 2XY1A 3WFCL 1RZKC 4ODBD 5GSVB 4RX4A 1LK2A 4UV7H 2P49B 5DQ9A 1AE6L 4XMKH 1BVZA 1WAAF 1J87A 4MLSA 5E8DL 3G6DH 3HAEA 4ZPVA 3VXTA 3BEVA 1T5XA 4WFGD 3SDYH 4N5UA 5D1XD 5IMOA 3TNMB 1ZGLP 3L9RA 4IRZH 4Y4HC 5IHZA 3FT2B 4LVEA 5D1XA 1G9NL 3RHWF 2Z4QB 1JPSL 5GJSL 5D1ZC 4EBQL 1Z3GL 4NKQB 5K9OB 5FYKU 1H3VA 5C07A 2R2EB 4XNZC 4J4PC 4JRXB 4JGUA 2DQEH 2CKNA 2D4FA 4XAKE 1YNKH 5IB2B 2BRRH 3GBML 4LSUH 4LQFL 2IG2L 1BEYL 1OB1B 1IQDA 3CPLA 4A2MA 4K3GA 4JFXB 4XP1H 5DWUH 1CDHA 4OLUH 4R97C 3WNKA 1DQJB 5LQBL 3L5XL 4EXKA 4ZNEA 4MQ7A 3O6MH 5DMGD 4M61A 5CBAA 4MQSB 1KGCD 4TNWK 1UG9A 3BEVB 2VSDA 3P0GB 1U41A 4Y5VA 2EDTA 5DRNA 4QHNB 1OGTA 4QRTA 3DYOA 4XXDB 1FNHA 4FFZH 5HVHC 5I19L 5BMFL 1Q8MA 5BQ7B 1KTLA 3VI3E 2IBZX 4I48A 2GY5A 2PCPA 4PY8I 4LOUC 3MBED 4OUUB 1RMFL 2LTQC 3U7YL 1RJZB 1JHLH 3GUTB 4JQXA 4QGYA 1FZJB 3RAJH 2BNQE 3VH8B 2I25N 5ESQB 4L3EB 1J1PH 1MVUB 3MUJA 4BFIA 5D8JL 1O7VA 3RWDB 3UBXI 4UT6H 2BNUB 3N06B 5EUKA 1BD2B 1TCMA 2CH8A 5EO0B 4QYOA 4LSQH 1U8MA 2HTLD 4ZPTB 4FFYL 4HW6A 5HTSA 4DCQA 5JOFB 1HHHB 4HS3B 1QQDB 4PJGF 1NFDF 4NOFA 2NY0C 1OGTB 4QRPE 3O3BA 5E2VH 3D0LB 4LAQL 4ZFOL 5F96H 5SV4A 5C7XH 5FM4A 3FB6B 3TVMC 2RQ8A 5GGSA 3K4AA 5FHBH 1N5AA 4I48B 4LCUA 1A7OH 2PCPB 4D9RE 2HA1A 5EC2B 1BGXL 5DJCA 1JWUB 3D39E 1IAKA 3N1GC 2QHLA 1VESA 1QG3A 3VWKC 5D93B 3L7FB 3MBEB 4GSDL 1EEQA 4Y2DD 5KVFH 4MNQB 1T66D 1T21A 2IMMA 5ICXA 2GUOA 1MJ7H 3OPZH 4GRMB 5SX4H 1G9MC 1BF2A 2Q86A 1Q0XH 5DRXA 1AH1A 4YNYA 5E94B 1T7VA 1QUNA 1HHIB 3SEPA 1MLCA 4FFVC 4F57L 1H8NA 3WUZA 2X4SA 4HKXB 4XAKD 3UTTE 4OT1L 1QLFA 4P3WA 3H9ZA 1AFVL 3BDXA 2PO6B 4JN2A 4NBZB 3U46A 3IJSA 1TTFA 4XCYB 5CJQH 1W0WB 4G8GB 4PJCE 4Z77B 3CZFB 1N64L 4Z95H 1IAKB 1KCRH 4QHLA 1F6LL 3FQUA 1H8SA 1GL4B 1Z9LA 4DFIA 3MRDB 1NSNL 1T3FB 2E27L 5DD5L 3TWCH 3PNWB 5CS7A 1KPUB 3H9HA 4HEME 4JREC 3HFML 5DI8A 3B9EA 4Y2DB 2IFGA 2UUDH 3I3BA 4U0QB 1JGEB 4WCYL 4UBDC 3G04A 5LWYL 3JBG7 3TJEH 3OKEA 2J88L 3IU4L 4TSBL 4EDXB 2ERJC 5IWLA 5DJAB 2YMXL 4JHAH 5IW6A 3EYUL 2BNQD 3SKNA 3BRDA 1LEIB 2ZG3A 3V9FA 3BDYH 1A7NL 2BNQA 3QXVA 4PRDA 5H37G 4NQDE 2DM4A 3FRPA 2AJSH 4ZUTB 1IM9D 2ITCB 3RUGB 1FBIL 2NW3B 1CTOA 2D0HA 1IM9A 2Q7YA 3HE6D 4M5ZH 2HFGH 3MNVA 1BJ8A 4NQEE 4R7NB 4ZXBC 3ULVD 2NMSA 4XH2A 5HDOA 1CXEA 3MGOB 3WS3B 4D9RD 3ARQA 4EOWH 3SHSA 1OSPH 3BZFB 1I9RL 3D39D 4WEMB 1JF1A 4DN3L 2MWCA 2P43B 1JGLL 4Q6IA 1KPVA 3CSYB 3ARZA 4X9GA 3DYPA 5D7JC 4NHUA 1CG9A 4S11A 2XNAA 4NQTA 1OM3H 4K3DL 5GGTL 4NWTH 3ULUL 4TRPL 4PJ9C 4HX1B 1LO4H 2KH2B 1PY4A 3TN0D 1A64A 4L1DA 2BNQB 1B6DA 1OP3K 2X05A 3EW3B 1NMAH 4TUJA 3ZTJH 1VADB 4UILH 3UTTD 3U0WH 1OQOA 1F90L 3U2SB 3U30C 2DQJL 4CMHB 4WGVB 4X9IA 3VGEA 3DUSA 3NPZB 4RGOH 5FK9A 4TTGA 3KNBB 5FHAL 4ONGL 1PLGH 1YEHL 4OTXL 3SO5A 4PJ7F 3UTZA 4Z8FH 4GXVH 3EJZD 2JB6B 4M7LL 3MNVB 1ZS8B 5D70L 4XH2B 3HE6B 4QRPB 5I2IA 1INQA 4A6YH 4PJCA 1GC1L 3K2MC 4D9LH 5C0RL 3DV4B 2BVQB 2YEZB 4OLXH 4Q6IB 5L2JA 4MNHB 3GJEB 1TTUA 3PWVA 3ZKSD 3D39B 3FKUS 4U1MA 1BX2A 3ZTNH 1D3CA 1NCDH 3F58H 5JORB 4S0TD 3TZVD 3CIQA 5GS1A 1Z6JT 1U3ZA 4AG4H 4ZFOA 5IT2H 3VFOA 4HUUB 4N68A 3TZVA 1EJOH 3AM8A 3MXVH 3TN0B 1HYSD 3U7WL 2BDNH 1H5BA 5A40E 5F93C 3JZ7A 1FORH 5JW4R 5J1TC 2PNDA 3ULUE 4P99A 1DQDL 3LS4H 3UTTB 4RMQA 5D2LA 4FQXC 2IH3A 3BO8B 3OKDB 5KSAB 1BAFH 5IKCA 4NQDD 2WP3O 3RWJA 2E8YA 2W1NA 4Y5YC 1MJUL 4JFFE 3RWGA 1BZ9A 3VW3L 3VXNA 4NQDA 5I8EB 1FRGH 3O2VL 4YLQT 4HQQH 4R2GB 3VXRE 4OF0A 4HIXL 3W0WB 3F62A 4XHJC 5L2JB 1JFQH 3BGAA 4NQED 2G60H 2H2SC 2QEJA 5EPMB 3RWHA 3L3OB 3SDCD 1RZJL 2ORBH 2E6QA 1FAKT 4NQEA 1S7SB 3VXQA 1QFPA 3S5LB 3SDCA 1WC7B 4ZFOB 1ZANL 5JR1L 1KG0A 1LVEA 5BVJA 1P4IH 2OTUB 1B3JA 3PDOB 3SKOA 4JM2D 3MMEA 3BQUD 3O0RH 1MJ8L 35C8H 4RFEB 5CIPA 1KIRA 3P4NB 3DMMB 3F12A 4P4KD 4QTIL 5L2KD 4JM2A 5ILTL 1A1MB 3BQUA 4LLUB 4QNPF 5HDBE 5KW9L 3KPLB 4P4KA 5DD1H 5L2KA 4QF1A 5I1CL 3WEXB 3DLQR 1NFIB 1HIMH 5BCAA 1VFBB 3RWGB 1BZ9B 3ESUF 1ZWIB 2APFA 3ZDXF 4JFDE 3IDMA 1S3KH 5D5MF 4N8VA 2FH6A 2EYTB 2FNBA 3MACH 4GAYB 1NMBL 1IM3B 5IBUB 1UGNA 4YHOH 3SGJC 5HYJE 5E2WH 4KRNA 4IDJL 2R0WH 3KYMB 4NQEB 5J11B 2R23A 2C7UB 2GKIA 3DI3B 1DSFL 1E4XH 3T3PE 1CGWA 1B0GB 1I8IA 1P6FA 4BFBD 5JA9A 3GSNL 3MMEB 4NQXB 1UCBH 2RCSH 2EDEA 4UNUA 5LGJB 3NZHL 2O5XL 3WFEL 2CLZA 2XA8H 4U1IA 3WYRA 3QO1B 2XXCB 3W39A 4QF1B 4O2CA 2K1MA 3C6LD 2PTTA 4EQ3A 3ULUD 1KACB 1OTUC 5HSFA 1BZQK 3TIEB 3GHBL 4P2OC 3C6LA 4KROC 2N56A 2VDPH 2Z93A 1YEFL 4LIQL 1XGTB 4XTRC 5JNYB 2DJSA 5C0ND 3ARDC 3HC0B 2B1HH 3MFFA 4KK9C 2VLJE 4X6BB 5LKNA 4Q9QH 2BP3A 3OKKA 5DUPH 5T1LD 3VXRD 1B4JL 3HMWH 3KWWB 3OB8A 3DIFA 5IHUL 1G7HA 5ANMB 3UTPE 1NAMH 5T1LA 4F9LC 3VXRA 1RV6X 1I75A 3L7EA 4IOSD 1OCWH 4ZUVB 2FGZA 1I8IB 5DMIL 4X98A 3BKMH 4ZTPL 3N1QC 3FRUA 3QEQE 2DJUA 4OF7A 5ICYB 3T3ME 1KJVA 5JUEL 4MZ3A 4J2XA 4K23L 4P2QE 2CKBA 5DZNA 1LEKA 3TP4A 4HGKC 5GRUH 1HKLL 4NO5B 1I8MA 1U3HB 4GG8B 5I8KH 4HK3J 2OQJA 1TMCB 4HXAL 3FQXA 3B5HA 5T3XH 1NC4D 3QIBD 4JDTL 1MSPA 2F9BT 1YDPA 1WIOA 4WNQB 4X4ZA 5CJBA 1NC4A 3QIBA 4HXBH 5JLZA 3C5ZB 3ZKND 3OQ3B 5CEXB 2H1PL 1AGEA 5GGSY 2IFFL 4JFFB 3BN3B 3U1SL 1LNUA 3CFJB 4XP6H 5E56A 5F7KC 3EHBC 1PAMA 3CCHB 1T0NB 4F7PB 4OQTL 2UZIL 3B3IB 3PGDB 3ARTA 3DRQA 2X09A 3SKMA 5IOPB 2QKIA 1YNTB 4P9HC 1CLZL 4I3SH 2UV3A 4KI5F 1MAJA 4NZUL 1NLBH 3WKNA 4DZ8B 1Z0MA 1ETZA 3SN6N 5CUSL 4G3YL 1A1NA 1DUYA 1I8MB 1HDMA 3RVVD 5EZLA 5TE6L 3LDBC 1R3IL 3PIQB 4OZGE 4FQJL 4YHNA 2FB4H 2GW5A 4MX7B 5J06A 2A1WL 4MDIA 4FQPA 3ROLA 1DVFD 3HI1B 1TCRA 4U1GC 3IB4A 3VI4F 1ZLVH 2NY5L 5FYJH 5TDPB 1E28A 2V2XA 1U8IB 1DVFA 1FNGA 2Y5EA 2GT9B 5CSZB 4JFDB 4KTDL 32C2A 1W8NA 1T80A 2VLJD 5C6PB 3QDGB 4KZEL 3LRSA 1WCBA 1FFPB 4DQOH 3TNNA 4FQ1L 1TZGL 5HYJB 3ZT6A 3ZSTA 1P5VA 5KSBF 1TNMA 1YC7A 2VLJA 3PHSA 1G7MA 3Q6GL 4JPWL 1YJDH 3UTPD 1CK0H 1MRDH 1S7TB 5IVZB 3VXSE 3GMOB 1T1ZA 2NNAA 12E8L 5FFLA 1EO8H 4JKMA 2D7MA 4OFDA 4ODXB 4XVSH 1ZA3A 4PJXA 1DUYB 3QEQD 5DJ0B 4PGBA 3UTSE 4RMWA 4OFYD 4UDTA 5CZVH 3JSSA 2NY2B 1L0YA 2PTVA 5DHVB 2E7LC 1RZ7H 4P2QD 3MLTB 4OFYA 3MUZ1 1MEXH 1KB5B 2XWBB 4KI5C 2Z9TA 1JNHB 3PGCA 4LSPL 3DRTA 4U7MA 3IDXH 4H1LH 3JWDC 1FNGB 3GIZL 1J1XH 4MA8H 4XPTL 4YZFE 1N0XL 5ESAA 4WIQA 4NJAH 5DJXB 2R69H 3OKYA 3HE7C 4IM8A 2YK1L 1PZUB 2DQDH 1U6AH 4PGJA 5ADPH 3LRSB 3OHXB 4DGVH 4XVUC 2CK0L 4KKBD 2GQHA 1HN1A 8FABB 2C3WA 3IJHB 2HLFC 3LHPH 4N1HB 1XCQB 3LMJL 5EOCJ 5KVGH 4PJ8C 4XMPL 2NNAB 4WHTA 4CNIA 2BSSA 3S37X 4UQ3A 3ILQC 1FFOB 4DGIH 2YXFA 4XNQA 3MRRB 2XN9B 2FSEB 4PGBB 5ITBH 3HB3D 1NUFA 3HI6L 2OR8A 2DN7A 3QEQB 3QHFH 4N0CC 3LQZA 1W0VB 1AGDB 4KI1A 2LVCA 4R8WH 4P2QB 2RJMA 2H2PC 3CXDL 3SOBH 1PYWB 4X8JA 2V7NA 2N1KA 3KXFE 3MRNB 4WU5B 5DMKA 1E27B 3WDJA 2XPGB 4RSVA 2DBLH 2Q1EA 1I85A 1MFNA 3ARGD 3GSNB 5ESAB 5HVGB 1CLCA 1ADQA 5MHSE 2XZCH 4TULH 3NCMA 3ARGA 4FP8L 1IGFL 5TE7L 2F19L 4XP5H 4M6NH 1J11A 4GW5A 1KIQA 4DFHA 1PG7X 4OZIE 3QJFB 4JRYB 4LDEB 2VABB 4J3XA 2WINA 1KCUH 4NCC1 1Q94B 2X5PA 4F7CA 1OF2A 5EB9A 2RB8A 4FTVB 1C1EL 5KVDL 4G8IA 5C0CA 3VXSD 1H3PL 1IL1A 3IDGB 4OD1L 1XCTB 3JWNC 2OR9L 3MV8D 2AEPH 1C16A 3VXSA 4Y2OA 1TENA 2VMFA 5C0JA 3BGMA 2B1AH 3QCTL 5I18L 2EZ0D 5F6HI 3MV8A 2Y36L 5EZIL 3MOAH 2Y72A 2V2WA 3UZQA 1HZHH 1I4FB 2GFBA 4OZGB 5D72L 1MFCH 3KYOB 4BKLA 2YS4A 3P4OA 1U8LB 2A6JB 5C9JA 5F89A 3MRMA 1I1RA 1EERB 1PW3A 1MELA 2NY4B 5I74B 3H8NA 1OARH 1KEGH 3DX6B 2A9MH 5EIVA 4PJDF 5D96C 4R6UA 1G6RB 4U6VL 4YH6A 4XCFL 1WISA 1ZTXL 2PYFB 2P5WD 3QAZB 4F7TA 1F2XK 3FONA 3MRIA 1P69B 3Q3GA 2NY3B 2UWEE 2P5WA 4HBQA 3U36B 1TJGH 4OGAD 5CILH 3KAAA 3QO0A 2UY7A 1FCGA 3CK0H 3MUY1 4XVJL 4AIZB 2IQAA 2EXWC 2ZNXA 2IPTL 4PRHE 5EO9A 4AQOA 1JYXA 1FLRL 1V3MA 4M1DH 3FFCE 2CMRH 3NGBB 1KT2A 2I07B 3LEXA 4KMLB 2QJDA 4HDIB 3RWEB 2AJZA 3UTSB 2B0SL 5FGBC 4RAUB 3WSQH 2WLYA 1QNZL 1QEWA 1KUMA 1UKTA 4R4NC 3KXFD 4R4BB 3K8KA 3X12B 4Q9CA 3AB0B 4I18A 1L6ZA 1R6VA 4CUCA 2C3GA 4P46B 1J5OL 3WXWH 1NDGB 4KKCD 5F9JB 5ERWA 5B38G 1SBSH 3KXFA 4UUJA 5EU6E 1FVDB 4M62L 6FABH 1ACYL 4OCXL 3ZDZF 1IJ9A 2ENSA 3WO3B 3E8UL 3FONB 2V5MA 1RK1A 3RL1B 1SYVA 1U8KA 2PW1B 4IIQC 4PLKC 4LSSH 5DJ2A 1YYMH 4RQQA 5FO7B 5DD0L 2VYRE 3QO0B 3WNLA 5JIPA 3TPUB 2CLRA 4P48A 4WTZA 1GGBL 3DJ9A 4IRJD 4OZIA 5CEYA 2NXZD 1QACA 4PY7B 2YD9A 3DGGB 4JO4L 5IFJA 4IRJA 4MA3A 1FL3B 1SM3H 4WI5A 4HC1L 5E08H 2XTJC 4M43L 4XBGB 3O45B 3B2VH 4JZOA 3WL9A 2B39A 4DEPB 5IV2A 5EDXA 4K7FA 1FH5H 3MRBB 1BQHB 4RGNE 4Y88A 4LPVA 2R4RL 2F54B 4UT7L 1UJ3C 5D4QA 4GAJH 3AXLB 1WZ1L 4YBLC 4O4YH 1AHWA 4RMVA 1ZT7A 5EBMA 1YEGH 3RVUD 3NBNA 2GHWB 3TF7C 2VKXA 3S35H 1P53A 4I3GA 3ZHDA 1UACL 3O2DL 5T5NF 3GRWL 1CFTA 4HT1H 5DJ2B 3TBWA 1WZMA 4Q6YA 2FIKB 5CJ5A 3WN5A 4PD4K 4HK0A 4NRXB 3X14A 5JQ6H 4L8CA 1KJMA 1V7MH 5CEYB 1AQDB 3CUPB 1RIUL 2DRUA 5HHVH 4BQ6A 2G5RA 4L4VB 4QOKD 5TE4L 4MJ6B 2W38A 4IRJB 1YEEL 3F7YA 5IFJB 2YPKA 4P3CH 5ECJE 4M7JH 5I1IL 4X7TB 3T2NL 3PE9A 3T08A 4QOKA 2GJJA 4GMSL 4PRHD 4JZOB 1F42A 3EFFB 1YMME 1Z9SA 3P9WB 1R3KA 3FFCD 3ARWA 4PRHA 5JIKA 4CMMA 2XOTA 4K7FB 3EOBA 4O02L 1CE6B 3WFDL 3NMEA 3T8XA 3FFCA 1GPOL 4PD4J 5HYSB 2CPCA 2ID5A 3HCVA 2V17H 5FYLL 1PX4A 1WWWX 3L95B 3HUJE 1HCFX 4LHUD 2P8MA 5T3ZL 2CXKA 5EBMB 4ODTL 2VZSA 1F8TH 3MLXH 1REIA 3U9UA 4TYUA 5LGHL 1FG2A 2IPUK 3QUYA 3QIUC 3MGTA 3QWQB 1MCLA 5E8NA 3NCJL 4PRPE 4U1SB 1P5UA 2F74A 3RPIB 1KJMB 2O5ZL 4EJ1C 4G8FA 2E9BA 3HNTH 4JY4A 2R15A 3LPGA 4UOW0 5KSVA 2UWEB 4HMDA 1RUML 1OWWA 4MD5B 4NUGL 1SBBA 5T1DL 4BZ1L 1B2WL 4DKEL 2EYSB 5FCSH 5D1ZB 5D9SA 3IAQA 1HNFA 5E5MA 3TCLB 4OZ4B 1BREA 1C5CH 2Y23A 2QSQA 1HSAA 1YQVL 3HCVB 2CRIA 3QI9A 1RZ8B 3NAAH 2VR5A 5CGMA 4IS6B 4RGND 4KRMB 4LHUB 4GMTH 2W9EH 1OD9A 4YHIA 1AXTL 3UDWC 1T6WA 4PV8B 3OR7A 2FGWL 2R2HA 5EU6B 4APQA 3MR9B 5FYLE 5SWZE 5BJTB 1J0ZA 3DETD 2PR4L 5F9AC 4POYA 4X80H 2AQ1A 5I73B 3I02A 5T3ZE 1MIEH 5HVHB 4Z0XA 4I0PD 2D7OA 4YWGL 2CDGA 1NQBA 3R8QA 3KJ4B 3KYAA 2ZZUT 4I0PA 5HDQL 1X4ZA 5GHWL 2BVPB 1TNNA 1CVRA 2LTQB 1N4XH 2BOBA 3FQTB 3O41A 5TDOA 2IAMC 4NKOA 2O5YH 1GVIA 2X4OB 3S37L 1HSAB 4YHML 2X70A 4CJ1A 1G7QA 4N0RA 3E6HB 3DVFA 4AEFA 5C6WH 1QSZA 4KPHH 5HXMA 3RU8H 4P5KB 3HRZA 4RAVA 3O3EA 5T5NG 3VE0A 1WT5C 2J5LC 2CDFB 3V6ZB 1D5IH 2R0KH 2VC2L 2XA3A 3QFDB 4HS8L 1ZA6A 3MREB 4HC1A 4HIHB 3HUJA 5IMLA 1H9VA 1RK0B 1UH2A 2HJKA 4DVRL 4P4RA 1U95B 1HI6B 2Z8RA 4PTTB 2NTFB 3TVMB 1IC4H 2X42A 2YRLA 4LBEB 1EK3A 2ATKB 2CDGB 2VE6B 3CFBA 4KKLC 2F8VA 4HK3N 2C3VB 3W2DL 1CD8A 1PG7L 2ZCKH 1A6ZA 1XH3B 3SGDH 4ISVA 4HIEA 3DXAB 3VWKB 3SQOL 2ZOLA 3NZ8B 5HPMB 4BZ2H 5IHLB 4O5LL 3TBSB 4LFHD 4K55A 4KHXH 2YC1A 3GRWA 3IDIA 1MF2H 3HR5A 4FG6D 3DVIA 1YMMB 4Z18A 2RHEA 1H15A 2GCYA 3T65A 4N1CA 3VE0B 1LO2L 3AREA 5HHMD 4XI5C 3RWFB 2R29L 5SWQB 3B2UC 4WHYH 4WDIA 1ZA6B 5EC1A 5EOCL 2HN7B 3HUJB 4EDWH 3RP1A 5BOPA 4P4RB 4U0RC 4K7PX 3N9GH 3RVTC 4DW2H 1NKRA 1NC2D 2VDKH 2VR4A 1QFUH 3R0MA 5F3HA 4X6FB 2ZP0T 1PVHA 1KBGH 3VFNA 4DWHA 4YXKL 3T0BA 3GHEH 4QRRE 1NC2A 3B9KD 3MLRL 4JVUA 5SWZD 3CFBB 2I5YH 4ENED 1N8ZA 2V6HA 4KHTH 3D0VB 3B9KA 5T3ZD 1KV3A 1EGJH 4ISVB 4PRPB 4PYHA 5SWZA 4HIEB 3RGVB 1JL8A 1XF5A 5FAAA 3S8WA 1LD9A 4R0LA 2DB8A 3WUWG 4KXZI 4JREB 2GTWB 1JIBA 4N8CL 4TUOB 3O8XC 3U79A 3IDIB 2W65A 3KPMA 4NQSA 4BUGA 4J6RH 2VAAA 1RAMA 3RL2B 5E99L 4J1UA 2CDEB 2ERJB 2JLLA 4KQ3H 1ZVSB 1A9BA 3CXHK 5J3HC 4HFWB 1W72B 1VFOA 1VB9A 4TNVK 4LGRB 4X6CE 3CD4A 4RIRB 1IAOB 4WI9A 3INUL 3V5KA 3D18B 1XF2A 5H35B 3ZTJG 4OLWL 5D7IB 3MJ9L 2NQCA 3MLZL 3KLHD 3WIFA 1C5DA 4MCZB 3GI8L 1QSFD 2APBA 5HI3D 4KY1L 2FWOB 1OT1A 1NH6A 4H25B 1CLYH 3QNYA 1QR1A 3O3DA 1QSFA 3E2HC 5K9KA 4UOJA 1FV1A 4CJ0A 4KJQC 3K7UA 4DGYH 2H6PA 3CXHJ 4PB0H 1S8DA 3T2PA 3RX5A 1R24B 5BZDB 1S9XB 3KPMB 3FO0L 1C08A 3KPQB 3BMVA 4LKCB 2G9HB 1PD6A 4CU7A 4NN6B 4U1LB 4M6ML 4PYGA 1Q9LA 5DDHA 3ES6B 3BZ4B 3X11B 1XGUA 5FDWB 5KG9A 1HQRA 4M8QA 1Y0LB 5DURD 3GBLA 2YPLB 3NIGE 3UROR 5JDSA 1N3NA 2P5EE 3U4AA 5JOEA 4NDMA 3QFJE 4U6HA 5T1KB 4WI3A 3WIFB 3B5TA 3P11L 5JOPE 1JRHI 3V6BR 2LU4A 1CFVL 2W9DH 2DQHL 4JO3H 3O3DB 1HXYB 2AK4E 1FV1B 3M8OL 5DS8B 2CUHA 3QIWD 1I1FA 3MO1B 3DROA 5KSUA 2HMID 1K3IA 2A6KB 3IGAB 3VDBA 3QIWA 4P5MB 2APWA 4HWZA 4LSVH 4ORGA 1SQ2N 3HTLX 3QG7L 3PWUB 5E6YA 3U0PB 1UM4L 2VWEC 4ELMB 1A1OB 4XNUL 1MHCA 4M8QB 3IFLL 4LDOB 3HR6A 2A74A 3EOAA 3CGTA 3MJ8B 3GIVA 5E1AA 1ZLSL 3SDAC 5JDSB 1PSKL 4ZS7H 3JUZA 4Y16C 4TTDC 5HGHB 1K8IA 1DQML 3MV9E 1U0QA 3LKOA 1VEPA 4UIKH 5DTFA 2BSTB 4YFEA 4JPIA 1RIVH 2Y25A 5SX4I 3RKPA 3KYNB 5DMYA 2GK0A 4GXUM 4DJMA 3HLAA 3UJIH 3QYCA 1JK8A 2A73A 3VDAA 1JWMB 1I1FB 3D2UD 1KLGB 3SDXE 5ICZB 5E2TL 5IGXL 3MRCB 4QRRB 4XAWH 5F9OL 5F44A 3D2UA 4GUPA 4TOYH 2NYYC 2ZWLT 1HILA 5I6XB 2ZUUA 4ORGB 4O2EB 3WNNA 4WEUD 2M8XA 5DQDH 2NTSP 3PHOA 3BZEA 3ZKQD 2EDRA 3V8CA 1WSST 2EXYC 1MHCB 3UEZA 3SGKA 2I60L 3MUGA 3ARFC 1YC8A 3BKCL 2A74B 5BZWB 4XCCL 5AWNH 2Q3ZA 3QUXB 1T2QH 3GJFK 1FL6A 4HUXB 1AR1D 3WFCH 2V9TA 4IEFB 3LKOB 5FB8A 1NANH 4ZOAA 2C4XA 1ZLUH 1I9JL 4PJBE 4HH9B 1AE6H 3QUZB 3QFJD 2EIBA 4X6CB 4XNMA 4XWGL 1I1YB 1JK8B 3QHZL 3V7AE 5E8DH 5JOPD 4RRPA 3C5JA 3QFJA 3BN9D 1G7IA 2AKRB 1DL7L 5HVWA 4KRPB 3VRJA 1QA9A 3FCTA 2ZSWB 1NL0H 3WV0A 3WE6A 1S5IL 2AK4D 5CZXD 1G9NH 2Y6SD 2YZ1A 3DHMA 2WUCL 2AK4A 3EIFA 4F8QA 1JPSH 1AD9B 5GJSH 4Q9BA 1L6XA 4BQ8A 1Z3GH 1CL7L 3DSFL 3QBTB 1T5WB 3RJQB 5FDYA 3K0WA 2DMKA 3C6SA 1FHGA 3HI5L 1FL6B 4CRPA 3IU3B 4NQCE 3GBMH 5GZND 3U0TA 2LVEA 2MKWA 1I7ZB 4GAGL 4PS4L 4BQCA 1BEYH 1OAYH 4HAFA 1OAQL 2FJHA 1CFQA 3C60C 5F9DC 1NFKA 3MXWL 2NXYB 5LQBH 3L5XH 2VLRE 3E6FB 1DQTA 1A3RL 1I3VA 2Z35B 2P5EB 1MH5A 1AGFB 5GGUB 2FH8A 3DBXB 1AKJB 1G7IB 3I6LE 3UP1A 2VUYA 2P4AB 2QHRL 1U2CA 4OBSA 3GMLA 1P6AB 1SYSA 3O4OB 1NDMB 3QA3A 5BMFH 4PJFE 5DZLA 4FNLL 1JYVA 1SY6H 4BQ9A 3GSOB 2AK4B 5TQ0H 5IEKB 1UXWA 4EIGB 5DGRA 3OXRB 1FO0L 4HMCA 1RMFH 3RHWK 3L3HB 4Z5RA 4LARL 1KJ2L 3OR6B 2YD8A 4R90L 3IKKA 1CN4A 4XPAL 1MHPL 2CJUL 3BW9A 1QP1A 3HZMA 1Q0YL 2F8OA 3FN9A 4I77H 2YRZA 2VXTL 3KPNB 1H3GA 1S78C 3VFSA 1CFQB 3S4SA 2EDBA 2A77H 4NT6A 5FECA 4FFYH 5DHYB 5INDA 2H26B 2QQNL 1I1AC 3IKCB 3RTQC 2G75B 1RHHB 3MV9B 1BLNA 4LAQH 4JJ5A 4BYHA 4WHCA 1A0QL 4PJBA 3MYJB 1AO7E 3AAZA 5FKAB 4D3CL 1Q9OA 4EIZC 5I76A 3PWLB 4OV6F 1S9YB 4K7PL 4LF3A 4X5LA 1BGXH 1HOCB 2JJSC 3SDXB 1F3DJ 1T20B 4NN7B 4WWKB 3BI9X 2AJ3A 3MV7D 4GKZA 5FCUH 2W60A 1LE9A 3MV7A 1M6OA 4R26L 3RGHA 3T0WA 1IGYB 5D2NE 3VFSB 4EI5D 1AQKL 4F57H 2NR6D 1FFRA 1AXSA 4G7VH 1GH7A 1ZAGA 4Y4KC 4BELD 4MVBC 2QSTA 5I1KL 3H0TA 1AFVH 3CFIC 3LKRB 2Z8WC 1FGNL 4HS6A 3WKML 5IVXE 2D31A 4J12A 4JFYA 1I8KA 2Z92A 2VLRD 3N1PC 5FUZL 3AAZB 3BIKA 2ZJSL 1N64H 2KQNA 2A6DA 2DWDA 4H1LG 2VLRA 1YA5A 1F13A 4CU8A 1NKOA 3GMRB 1EH9A 1NMCB 5DD3L 4PUBL 2EDLA 1NGYB 1AIFA 5DEGB 3QDHA 3FOMA 1NSNH 1QFWM 2E27H 4WO4C 5DD5H 1F97A 3EYQD 4IRSD 1A6AA 3HFMH 2DKMA 3LZFH 4LP5A 4WCYH 1ZKAA 2JCCA 1OAXL 3IU4H 4MAYC 1J8HD 1GJIA 2YMXH 3EYUH 1CTNA 4ELKA 3MROA 4LCWE 3ALPA 1IVLA 1A9EA 1U8JA 3C87A 4BH8A 5KN5B 1J8HA 3H0TB 5IW1B 4EI5B 4OZHF 5J13C 3P77B 1A7NH 4QRSB 2OYPA 1FZOA 2QQLL 2VISB 4Y19E 4NQCB 1E4XI 1ZEAL 4HJGA 2OTPA 1P2CB 4ODSL 4JG1L 3K74B 3M1BB 3D3VA 1T22A 3NFNA 4FRWA 3R0NA 3BIKB 3SE8L 3UO1H 1FBIH 3BRFA 1AXIB 3OX8B 5DK2A 4JDZA 3WIHL 3LCYA 1U8PA 3HE7B 1MFAL 5F72S 1AO7D 3MOBL 4LRIA 4Z7WA 4BZYA 1ACZA 2APVA 5IK3B 1R3LB 2GY7B 1AO7A 1I9RH 2HRPL 4PJFB 3F7RA 4DN3H 1QO3A 1JGLH 2Q8BL 3HZVB 4IRSB 4LAJH 2F58H 3OL2A 1D9KA 3Q2CA 1S7XB 4HF5L 4U05A 5TF1L 4F33A 3OKLB 4K3DH 5GGTH 1FQ9C 3FO1A 3TBYB 1E6OH 4TRPH 2DMBA 1F6AB 2CRMA 2XV6B 5FGCE 3KPRE 4F7MA 4P3DB 3HNSL 3VXME 1JYWA 4PJ5E 4Z7UA 1L0QA 3OJDA 1IMHC 1F90H 4YEEA 1KJ2A 4R7DA 3VD5A 5FHAH 4ONGH 1YEHH 4OTXH 5DSCA 3IJYA 4YHPA 4OV5B 3JTSA 4GRLD 4M7LH 4OF6A 1MCCA 3QRGL 3P9MA 4C83B 5HGDA 5I16B 3BAEL 4GRLA 5HD8D 1GC1H 1DE4B 4HGWB 5C2BH 1IRAY 5C0RH 1WTGT 2QADD 4QY8A 4MJ2A 4QWWC 3CMOL 1SJXA 3G6JE 2C1OA 3TBTA 2Q6WB 4NRYA 4ZAKC 3QZWG 4KMTH 3HC4L 4LMQE 2FEDD 4QRUA 5K9JL 4FN0A 1ORQB 3GMPB 1T0MB 4OF5A 2W0PA 3U7WH 5D2NB 1FO0B 1V3JA 3OJDB 1A7PL 4P2RB 3D25B 2X9YA 1DQDH 1MCOL 5F1OB 4R3SB 4ZUWA 2UY6A 4Y19D 4D2NA 1BBJA 3JTSB 1HQ4A 1MJUH 3NOIA 4Y19A 5IVXB 1WFUA 3PWNA 5DO2D 1HYRC 5INCB 3VW3H 4HKBB 3P9MB 1Y18B 2AJXL 5DJYB 5BRZB 4OLZL 4JGJA 1VFAB 4HIXH 2DQTL 3S3PA 4YBHA 1MUJB 1ZMYA 1OSZB 2E7MA 2HAZA 3MRQA 4MNGE 5GXBB 1A3QA 3NA9L 5DHVH 1UB6B 4IOIA 5B3NA 3UPRB 1RZJH 3TBTB 4X99A 4NRZA 4OUOA 2RR3A 3OGCA 1KXVC 2D2OA 3BOVA 3NN8B 3V5DB 1KB5H 5J89A 4FQCL 5I1LA 1ZANH 4H5SB 1TQCB 3QNZA 5JR1H 4YBQD 1AP2B 1WFOA 5D7LA 3RZWA 1MCWM 4X5WB 3S36X 3TGXA 4IDLA 5F8RC 1MJ8H 2B8OT 2N4IA 4QTIH 5A3ID 5B22A 4BA8A 1BFTA 3KPRD 4ACPA 5ILTH 4LCWB 1HCVA 5C8JA 2AV7A 3VFGL 5KW9H 3KPRA 2O93L 3GSRA 4OD3L 5DC4B 3MA7A 1CI5A 4HBCL 5C08E 5J1AA 4GH7B 5CD3A 4JZJA 2R56L 3IS1X 2Z8SA 1NMBH 4KK6D 4ZQKA 5GRVK 3QXAA 1U8NA 1G84A 4OFPA 2BHUA 1EV2E 3A6BH 3VFUA 1RUKL 1ITCA 4IIQB 2DJ4A 3G5ZA 1BFOB 2X9WA 4JAMA 2PXYD 1CD0A 4LVHB 3UBXA 3NACL 1DSFH 1A21A 1CGXA 4LCCB 1T04A 1U92B 1N6VA 4HG4K 2PXYA 1FL5B 1F58L 3GSNH 3OB0K 4TSAL 4FQIL 5ALCH 3WIHA 4PJAF 2IALB 4GG6F 3NZHH 2O5XH 3EDDA 1UVQA 4P59L 2NZ9C 1JF5A 1SEQL 1H3XA 3OF6D 3T4YB 5AG8A 2M1KA 5FGCB 5HI5C 1C5BL 3OF6A 1KIPA 2AS5M 3VXMB 3MA7B 4PJ5B 3BEWB 3N1MC 1IARB 5GJTH 4LLAA 4HG4J 3FQRB 5GS3A 4PJIE 1YEFH 3QPQC 4LIQH 5ISZE 4QHUA 2ICWI 1OP5K 4YGAB 3O3UN 3O9WC 4QHMB 2DI8A 4YJZL 3ARBC 3BIBX 1B4JH 3IDJB 1CICD 2FX8L 1RIHL 2ZCLL 3T0VA 1CICA 4KC3B 3WHE1 3VGDA 1OL0A 2B5IB 3G6JB 4ZTPH 4JFZL 4NN5C 4NHCL 1DDHA 4F15B 2SEBA 5AD0B 4XZUA 4KQ4L 2MQ0A 4MD0A 4WENB 5JUEH 4K23H 5EBWA 5JXEC 4J3WA 2WZPD 5JHLL 4WV1C 1HKLH 1G6RH 5E8PB 4YIQA 3QWRD 3AGVA 4YXHL 3CLFL 4JDTH 1P4BL 3QWRA 1ES0A 2BCKA 2VLLA 3DWTA 5JW4N 4PJHA 1JGVH 2H1PH 3BE1L 2IFFH 1J18A 2YD7A 3FO2B 1YY9D 1ORSA 2DICA 2XT1B 2ICEB 3PJSB 4AT6A 2VZUA 4L3CA 3ZE1E 4UDUA 3CJJA 1QRNB 3GM8A 4L4TE 4YR6A 1CICB 3IFPB 4OQTH 2UZIH 4WW1B 2XFXB 5CMAA 4MNGB 4X83A 2HVJA 4I0CC 3REVA 4YHZL 4O51B 5IROA 1CLZH 2XY2A 1I7UA 3NCYS 5EIIA 3P0YL 2VIRA 4G3YH 1E0OB 1YN6B 2BVTA 4NNYA 3I6KA 4ZS6C 5GGQH 3SO3B 3TO2A 1TVHB 1ONQA 5TE6H 1R3IH 2ZCHL 3LB6D 4FQJH 4U6XB 1OTTD 4K8RD 5LG1A 5L8LB 3BP7A 2A1WH 3LKQA 1S7QA 2VLLB 4K2UL 4NZTL 4JFEB 1DN2A 3EYSL 3P30H 2RFXA 4ZSOE 5MEOA 2P48B 1X5LA 1FZMB 3UZEA 2AV1B 1WFNA 2KZWA 4AT6B 3TFKD 5C08B 2Q87A 4MJIE 5ISZD 3C8KA 4KTDH 3VFMB 3VFTA 3OBAA 4PJIA 4X6DB 2VQ1B 1T83A 3UCRA 3KPPB 4MWFB 1YNLH 5ISZA 1RZFH 4NCC2 5C0IB 4HCRL 4FQ1H 2X1WL 1CFNB 3Q6GH 4JPWH 4LPTA 5DYOB 1FC2D 4G80B 5IJKA 3JUYA 4MD4A 3BDBA 3MJ6A 5EN2B 3U7AA 3S34L 4H8WL 12E8H 3VD3A 5DC9B 1WAAE 2VIRB 5GGRB 3C5SA 4NGHL 3L3GB 2C3XA 2WWMC 2VERN 3EUUA 3L3IA 1QVOA 1ONQB 1IKFL 1S7WB 1AD0B 4LLYB 3MRGA 2YBRA 3QQ3A 3TT3L 1X7QA 2R1WB 2X4NA 3V95A 4JVPA 2HG5A 4FQQB 5GRWA 5AYUL 4LDLB 1KFAL 2RFXB 4LSPH 3WJLA 4M1GL 3O4LB 3GIZH 3TH2T 2OZ4H 5F8QC 2J12B 3BPCB 4PJIB 3HMXA 1W0YT 4WHYG 1DQQB 3TO4B 4OJFL 3F7VB 3DURB 3MLPA 2AGJL 3LMJH 4X5XA 5DJZB 4LLWB 2HYMA 4Y4HD 4E5XB 5DZOA 5DMGC 3TJHD 4PBXA 2W07A 4Y4HA 1CCZA 5ELIA 5GSRA 1RZKH 1T2JA 3HI6H 2HKFH 5M7QA 1RQ5A 5EU4B 3CDGA 5EUOA 4CW1B 2IPKB 4J4PD 2DDQH 2R2BA 3CXDH 4RISL 3MBEC 5D93C 4X4YA 1D5XB 4L8SA 2HVKA 4U2ZA 3GMQB 4J4PA 4Y5XB 2H45A 3UAJD 2BC4A 3H9SE 3QPXL 1L9NA 3RUGF 3REWB 1IGFH 1IEAB 1A4JA 5TE7H 5I1JL 2F19H 4PP2B 4U0RB 3MRHA 4ZSOA 1YEKL 2NPLX 4MJID 3S3JA 3TC9A 3ZKMC 1UKQA 1EBAA 1LO5A 1ZHBA 3I6GA 4TVPL 4ZFZA 3GJFB 4AEHH 4MJIA 4MXQD 3BWAB 1JJUA 1FLTX 2PO6C 4L4TB 4J3UA 3VI3F 4HLJA 3OKNA 2VN4A 1C1EH 5GSRB 5H2BA 5KZCD 4PJGE 3PV6B 2HT4D 3OKMA 4D9QE 1FN4B 1N6UA 3P0VL 4OQ1A 1ZHKB 5HJ3B 2V7HB 2OR9H 4C59B 1H0DA 3MX0A 1TFHA 4P57A 5JW4Q 3QCTH 1ZSDB 3BRGC 3O3AA 5IIEA 1WAAA 4CN4A 2Y36H 5AZ2L 3UYPA 3S36L 2X4PB 3I2CL 3NFSL 3QWOA 1EAPA 4Q2ZA 4QRQA 1ZLWK 4Y2DC 1F00I 1OP3H 5D72H 1CXKA 5I8CA 3RNKA 1LWRA 4FXLA 4YDJA 1BBDL 2V9QA 3QUKB 1F3RB 4OSUL 4U6VH 3ILPA 5IR1A 4XCFH 3VXPA 1ZTXH 2NY0D 1ZHBB 2YWZA 3I6GB 4RCAA 4PG9B 4ZFGL 3V6OE 1D5ZB 4K3JL 4JFPA 2FJFB 3FT4B 4WHDA 5CBEA 3QCVH 4J23A 3ZT5A 1W2KT 4XVJH 2WAHA 5EU5B 3L1OH 1LP9E 1AGCA 1V7NL 1FLRH 2NW2A 2NX5D 4NO0D 5E4EC 4UIMA 1Z5LB 2BX5A 2NX5A 1FZKA 4NO0A 4S1SL 1IGML 1OQXA 2B0SH 2AEQL 4HCRA 4YAQA 4QRQB 1XFPA 2YUXA 5GS0L 1MQ8A 1PX3A 4F80A 3TA3D 3PWJB 3FOLB 5DT1H 1QNZH 2UVFA 5CKAA 3F5WA 3G5VB 4WW2B 3QULB 3TA3A 1T1XB 1C7TA 3KHOA 4NFDA 4XX1G 1J5OH 4HLZH 4D0DB 4MXVE 3H9SD 3L3KA 1MAML 4ZNCD 1X4YA 5IR1B 4FZEL 4QCIA 1G9NC 2FX7L 1UEYA 2EDHA 2FRGP 5I1HL 3MYZA 1MCRA 2EDNA 4JCMA 5HHNB 4LGSB 4F37F 4CMHC 2R0ZH 3EKCA 2P8PB 3M45A 4RZCB 1GGBH 3RDTB 1YN7B 1NGZA 5ESVB 2IBGA 4ZFFB 5IP4A 2IAND 1Y6MR 5HY9A 4D9QD 3HE6C 1NEZB 3OV6A 4HC1H 4L8BB 3DVNA 3EYVA 4M43H 4RDQF 4PJGA 1NFDA 2IANA 4UBDD 3LKSB 3T0EB 2ATPB 4Q6IC 3BP5A 4Y4FB 4PRNA 5ACMA 3B9AA 4GKNA 2VH5L 3SGDI 3TA3B 3SDAB 4XC3H 4UT7H 1IEBA 2W0FB 3MBXH 2ADIB 1WZ1H 4ZDHA 1VEOA 3MLUL 5F71A 3L3KB 4Y16B 2BY0A 3EJJX 2BK8A 1JGDA 4CN6A 3ARXA 5DEZA 3H9SB 1YEDA 4AM0A 3TN0C 1IC1A 3O2DH 3GRWH 3GSQA 3SY0B 5D71L 4O58L 1SJEA 3HPLA 2EDJA 3WFBH 3TYFB 5KSAC 4ZXBD 3V6OA 5TE4H 1M05A 5CSBA 2DI7A 1ZT1B 4UU9A 3SPVA 3CLEL 2P42B 4ZXBA 1BECA 1W72H 5I1IH 3EJZC 4G8EA 4GMSH 4R2GC 4Z7VB 4JDVB 2ADGB 1TETL 2HJLB 5D7JD 2WUBH 3W82A 4GO6B 5HYQA 1JWSA 4X6EA 1IT9L 4O02H 5D7JA 3KYKH 3M17A 1P9MC 1EX0A 1GPOH 4ZDHB 3SCMD 1EO7A 5FYLH 5JW3L 3LN4A 1JGDB 2IADA 5T3ZH 3TZVC 2E7HA 3SCMA 4PRAA 3AM8C 4M03A 4ODTH 3LOWA 2YA2A 2X4UB 4FQ2L 4V1DE 1EHLH 1QBLH 1DBJL 1R3HA 4C56B 1H5BC 5CJOH 1CFSB 2P24B 5LGHH 3Q5YA 3DMMC 4YDVA 5ITFB 3DX7A 2NY6D 3NCJH 2AQ2A 2CUMA 5E0QA 2G5BA 2O5ZH 2C9AA 3A0OA 43C9A 4H88L 4WUUA 4Q97A 3AUVA 4UQ2B 4XPFL 1RUMH 1FGVL 1MCKA 3HZKB 4NUGH 5T1DH 1B2WH 5C0BB 1Z9OA 3VMNA 1KLUA 1IC7H 1LP9B 3BPLC 3OMZA 5E8OB 2I9LA 2HFTA 4G9DA 1U91B 2Y1VA 4PG2A 4OKVA 2JJWA 1YQVH 2JB5H 5J11C 1A47A 4PGCB 5FKPA 3GSWB 3T0XA 2DM2A 3SCMB 1UWXK 1BIIB 3IVKA 3P3YA 4UINL 3QXWA 1J1OL 2ZUWA 5T1MA 3C2AH 5L8JB 3NIDF 5ENWA 4WTXA 3L6FB 3OXSA 4Z6AT 2FGWH 4JM2C 5L6YL 3BQUC 1CXLA 2Q8AL 3RY6A 4L1HA 5GS0D 3SDDD 4P4KC 43C9B 2PR4H 5DRWB 5CWSB 3HS0A 5FM5M 4NWUL 3SKUD 1FJ1B 2NY6B 4HJJL 1EAJA 3S5LG 3MRJA 4Y5YA 3SDDA 5J56B 4JEGB 1XIWD 1LDSA 1S9WB 2PN5A 1RJLB 4EEEA 1DUZA 1U8OA 4YWGH 4WU7A 2H32A 4PR5B 1XIWA 4RDQG 2H2SD 4EN3B 5HDQH 2E7BA 3VFRA 4AEEA 1KNOB 5F7YC 1UQSB 1IFHL 5D5ME 1JP5A 3AS0A 5F1KC 1Q72L 3L5WB 4PGEB 2VDQL 4YHKL 3VXUB 3LPWA 3VGAB 4OKVB 3S37H 4YHMH 4PJ7A 1ZK9A 3GMMA 5DRZA 1X44A 4HWBL 4EVNB 1M7XA 3U4EB 4GKOA 5AYQA 1CGYA 4FZ8L 3ARRA 1BOGA 3E0GA 1U9KA 3IF1A 1AGBA 2VC2H 1R0AL 3OJ2C 5L9DL 4HS8H 5IBUG 1JPST 1I7TB 1UWEL 1VEMA 3JVGC 2X4TA 3RTQB 2ED8A 4DVRH 3ZYZA 4NO2A 3GGWA 3PL6D 1JPGA 4MSWB 5IJVB 1K85A 3EYFA 4K94L 2EH8L 1QZ1A 3PL6A 2Z91A 2YKLL 2FECI 4X4XA 3C6LC 3GSUB 4K71C 3ULUC 4JR9L 3OG6B 3B6SA 3SGJA 4MZ2A 1FNSL 3C5ZC 4L8DB 1T4KA 2MPAL 4O5LH 2LU3A 5C0NC 3IS0X 1FCCA 4U1JA 3T3PF 1IGIL 3BP4B 2AK1L 5EOQH 5E00A 1N2RB 5F7DB 4GBXB 1S9VA 4GW1A 5IG7A 3RFZC 3WD5L 3PP4L 1XZ0B 4LEXL 1LO2H 3R1GL 1WVZA 2R29H 5CP7A 5IMMA 2FD6L 2YD3A 2OLDA 1U58A 1RJYA 5HHQB 3MODL 5EOCH 1F4YL 4G42A 4M3KB 5K9QG 1XGQB 2E3VA 1GC1C 4O2FA 5CP3A 3KPOB 4PRIA 5IF0B 4P2OD 1L4IA 2HRLA 3DSNA 4U3HA 5C0EB 4V1DB 4YXKH 3MLRH 4YFDB 3I3DA 3TLRA 4P2OA 4ONHA 3QEHA 3LSOB 3ARDD 4KK9D 3QDAA 2C1PA 3QDME 1NANI 4KUZL 3ARDA 1E4KA 3RZCD 2V5RA 4UTBH 1FNLA 3VMPA 4N8CH 4PLNC 3ZKNC 4WY7H 1J0IA 4YEFA 1A6UL 4F9LA 2AXFB 5E99H 2YUVA 1S9VB 1UB5A 5D5MA 4JANA 3CFEB 4P23D 3T3MF 5JZ7C 3W5NA 4LLQA 1BVKA 4TN9A 4HIJA 4OGXL 2R8SL 1T7YA 4P23A 1P4LB 2H8PB 1RJYB 4OFIA 1CDIA 4CVZA 1BIHA 4Y0GA 4DKFH 4JO1L 3INUH 3NCBB 5ID1B 4P2YA 4UTAL 2ICES 3MJ9H 2Q3AA 3MLZH 2NY2C 3QEGL 3FQNA 3QCUH 4XXCC 1RZJC 3RVVC 2JJTA 3GI8H 1YEIL 4KY1H 4ZUUA 1V3LA 1X5XA 5EU3A 1NEUA 1RJCA 4CL7A 4OIIL 4LCYB 3S88H 1DN0A 2XWTB 4U7SA 1EFQA 3QT2A 5FO8A 2B7DT 5MEPB 4OF3A 3VWJD 1MCFA 5DJ6A 3VI4E 1FIGL 3RZCB 1XF1A 5IVNA 4NNXB 3VWJA 3FO0H 2EIEA 5C6TL 5DUBB 3G08B 1I7RB 4L9LB 5FF6B 4I5BB 3HC3L 1AY1L 1TXKA 5EO1A 2EH7L 1BVKB 1TIUA 5KSBE 3QQ4B 1X5JA 2XQBL 4U1NA 3UTQA 3GNML 3VFWA 1G7LB 2H9GA 1BVLA 5IB4B 2HT3D 4OZGF 3RY5A 3HPJA 4ZMAT 3R8BB 4LPCA 4M48L 1K2DB 1OW0A 2VLKE 1F3JA 3LV3B 4MDJB 4PB9L 1QBBA 3G6AB 4PJEE 3TCXA 1WF5A 1CFVH 2WW8A 5EU3B 4HWBA 2Y7QA 2DQHH 3GEWB 3QUML 5HYIA 3M8OH 2IMNA 3T77B 3UJTL 3VCLB 3THMH 5A1AA 2PYEE 4FXKA 5KS9F 2WSKA 1R5IA 2MKLC 3O81A 1ZHNB 1EEYB 3G5XB 3VWJB 4NO3B 1A8JH 2O61A 1JPTL 3PV7A 4KJYA 3QG7H 2D9CA 1FVCB 4X9BA 4LLDA 4ZAKB 3BYYA 4R96B 4N0UE 1JZ7A 4KKBC 1MWAL 4TNWF 2OMBA 1VCAA 3IFLH 3G6DL 4JLRB 1G7JA 5GRZA 3HZYA 3VFWB 1IGCH 1PSKH 1BVLB 4F7EB 2OK0L 1A6WH 4G7YH 2J8UB 3IFOA 2E6JA 1NGXB 3EO0B 2O26U 4S10A 4V2CB 5FYKL 2MCPL 1DQMH 2E7LA 4UI2A 2UZYB 1JNNH 1F3JB 4KI5D 2VZVA 4C4KT 3D87B 1C12A 4FMFA 1MCHA 5LBSL 1S7UB 3BHBA 1X5IA 4G6ML 5ID0A 1EUTA 2DLIA 1ZV5A 4A2LA 2DYPD 5E2TH 5IGXH 3S96B 4YGVA 1R5VB 1YMHB 4U1KB 2FR4B 2I26N 3KLAA 4XVUD 1CD1A 5IM7B 2BRRL 2DYPA 1YECL 4HZLA 4YDIH 3ARGC 1QLRA 4ODVL 1WGOA 4QT5A 1SEBA 3VFPA 3QDMB 3WDHA 5IB1B 2NY4C 1VENA 5I74C 4PTUA 4DAGL 3CFCL 4LLDB 2KKQA 4PJ8D 4X0KB 3QAZC 1LDPL 1Y6KR 3BKCH 4PJ8A 3LKPA 2P46B 3T2QA 1KTRL 4M7LT 2MHAA 4WUKH 3OAZK 2X7LB 4HUVA 2JIXB 5B8CB 1TTGA 2BVOB 5D1QD 3VDCA 4I2XE 3TBVB 1N59A 1CIDA 4G6FD 5KSBA 1CQKA 2DI9A 5D1QA 4NZRL 2AQ3A 4PRBB 4QTHA 1CT8A 2FBOJ 4XWGH 4AMKH 4LNRB 1JHLL 2YSSA 3QHZH 1HEZB 2VN7A 1EFXD 2VLKD 2YD1A 3AU1B 5EBLA 4UZGA 1A2YB 5EIQA 1JRHL 5FYKE 1EFXA 4GW4A 5DVKA 5I0DA 2VLKA 3C2SA 5K9QI 4HZLB 1FNEA 1S5IH 4U1HA 1QLRB 3MRKB 1JTTA 2D0FA 3MRFB 5IBLC 3TV3L 3S6CA 2VDOH 2PW2A 3V5HA 3AB0C 2WUCH 5SX5K 4P46C 1MRCL 2QR0A 3O6FD 4LSQL 1CL7H 3DSFH 2FHFA 5K59E 2BSED 4N5EC 4HKJA 1ZGLB 1E4WL 3O6FA 1K6QH 5BXFA 3PWPE 1GXEA 1OGAE 1INEH 1INDL 3HI5H 3U6RB 4IOFD 4HKZA 4PS4H 1K8DA 2NY5C 4OAWA 5FM5O 3DTXA 3FO9A 4OGAC 4OM0L 5FGRA 1MJJA 2FIRT 1A7OL 1OAQH 4NC1E 1VKXA 3B8SA 2WV3A 5B38A 5C07E 3MXWH 4CGTA 3FN3A 5F7HA 1FC1A 4BQBA 4HUKB 3JWOL 2IH1B 1A3RH 2HFEA 4JHZA 5J9PB 5F1IA 1HWGB 2EKJA 5EA0L 3ESVF 5DQJA 2QHRH 1CF8L 1UXSB 2NY1D 4PJEB 1Q0XL 5J0BA 4FNLH 5B39B 1KN2H 4O9HL 4I18C 1BM3L 2D7QA 4J7RA 1J0HA 4AJ0A 3V8OA 1P7KA 2PUQT 4NM8H 2Q76A 4L4JA 1T2XA 1FO0H 1PZ5B 4P2CG 2PYEB 5I17B 1D6EB 2UWEF 4LARH 3MRPB 2R1XA 2CLVB 5DC0A 3C08L 4R90H 4XPAH 2GSIB 1MHPH 5BXFB 3ZDZE 2GJ6B 1JHKL 5HHPB 2EXWD 4PV9B 2CJUH 4EI6A 3DUUA 1YZZA 4Y8AA 2Z31B 4N0UB 4QHKI 4WGWB 2VXTH 3RVWC 3P40A 4Z95L 1CBVL 5B38B 5BW7C 2W0KA 1UH4A 1KCRL 4QGTA 1FFNA 2BOCA 1NCTA 4IRJC 2NXZC 2I9TA 3W11C 3NFPB 3TWCL 2QQNH 4F3FA 3HHRB 5FGBA 1CQYA 5DQJB 5JPNA 4I2XA 3K2UL 1L7IL 2ZPKH 1MQKL 1A0QH 1EXUA 1JN6B 1IGTB 5I1DB 4D3CH 4M93C 1UFUA 2ZUXA 4DZBA 3JV4A 5AG9A 2BERA 3IRZA 2NY1B 3VD9A 4JKLA 3JXAA 1D5BA 3QXDA 2VXVL 2VITA 3DV6B 1Y6NR 3BDYL 1K4CA 5HGBA 3GO1L 1BHGA 3ZZ1A 2QBWA 4N0FB 1D6VH 1IBGL 2EDYA 1HSBB 1U8HA 3WN5C 3QUMB 5E9DD 4R26H 2ZSVB 1BQHG 1LEGA 4NKDA 3IXAB 2ADJA 3A6OA 3PWPD 3CVHB 1OGAD 5E9DA 5F88B 4PJDA 1KULA 3MJGX 2HFGL 4CADA 2BOCB 2XTJD 4G6AD 3PWPA 5I1KH 4HIIA 1OGAA 5MEND 3WKMH 3EAKA 5C07D 1OSPL 1I3GL 5JPNB 3L3JB 3QJHA 5MENA 4TVSa 1MWAB 3FL7A 5CCKL 5FUZH 3LS5L 4NP4H 1M7DA 2J4WH 4WI7A 3BH8A 2V2TA 3Q6FA 2ZJSH 5FXCH 1UJ3A 1KCLA 1Z0NA 5F3BA 2G2RB 1D5BB 5H94B 5DD3H 4PUBH 3AS2A 3X13B 4KDVA 1LK2B 5IQ9A 5DQ9B 2Z0BA 3ULVL 5HHOE 1DBBL 2ED9A 4UILL 1N7MH 3LRHA 1G0DA 2YD2A 3BJLA 3HAEB 4ZPVB 4RGOL 3VXTB 1T5XB 1OAXH 1PLGL 2P45B 4NKDB 5IMOB 2FX9H 2VDLH 3L9RB 5HYSG 5I73C 4GXVL 5IHZB 5D1XB 4NSKA 3QG6A 1EPFA 4HIIB 2QLVB 1OGAB 3QXTA 3V0WL 3RIFK 1X5HA 2QQLH 3KJ4C 4D9LL 2V9RA 2ZKHL 1F6FB 3IFNL 1ZEAH 3G9AB 4OLXL 2AABH 3E1F1 4ODSH 1B9ZA 2EDOA 4JG1H 5C07B 3SE8H 4IMLA 4WFED 4YQXL 4AG4L 1MFAH 4JB9L 2FL5A 1BZ7A 4I4WA 1IQDB 3BPNB 3CPLB 3KPSD 1MLBA 4M00A 3CSPA 2DWEA 2W92A 2DQIH 4ALAL 3QIUD 2HRPH 2BDNL 3KPSA 3U9PL 4RGNC 5ABDE 4DVBA 1FORL 4MQ7B 2Q8BH 4M61B 5CBAB 1AJ7L 1H3UA 2HP4A 3QIUA 4BUHA 3C9NA 4HF5H 1EIBA 1TZIA 4Y5VB 5HGAA 5TF1H 3ROOA 5DRNB 2XRAL 5C3TA 4QRTB 4BH7A 3DETC 1KTLB 3ULVE 3FZUD 3MCKA 4AENA 1II4E 3CZJA 5JIIA 1K9TA 3HNSH 1PY9A 3AS1A 4IHOA 1MFEL 4HUNB 4OCSL 5F7LB 1JFQL 1FAIL 2Y5TA 2KDGA 3MNWA 2RAMA 2X9XA 4JKPL 3I50H 5I0ZA 1MCDA 5D7IF 2FL5B 4BFIB 3QRGH 4PREA 2YPVH 3T0DA 3BAEH 4ONFL 2FATL 1J0JA 3PABA 2ICCA 2GK2A 5EUKB 3O0RL 4QYOB 1U8MB 3WMSA 1WEJL 3P4MA 4DCQB 3CU7A 4NKMA 2ZUYA 5HHOD 1CE1L 1LK3L 4KK5C 3O3BB 3EO1A 3GSVA 5EOTA 4OFKA 2W91A 1K3ZA 3D69A 5GGSB 5HHOA 5F9WB 1UWGL 5DUML 1N5AB 4LCUB 5K9JH 1PQZA 5DJCB 3MACL 4Q74A 1JPFA 1WITA 4YHOL 3RGVC 1A7PH 1BP3B 4OZFG 4KZDL 1MCOH 1UKSA 1GYAA 1T21B 2R0WL 3WIIL 1SMOA 5ICXB 2GUOB 4JFOA 4NIKB 4PPTA 2Q86B 3VD4A 3P4LA 5DRXB 4YNYB 3QB7C 1E6JL 4P9ML 2AJXH 4QKXB 1ODAA 4OLZH 2DKUA 1MLCB 2JELH 3STZA 5DD6A 2DQTH 1WT5A 2X4SB 4HLZG 5D2LE 3DHJA 1QLFB 1J05A 3NA9H 4GFTB 1FPTH 1GZQA 3WUWA 3CU1A 2DTMH 2XA8L 1WBXA 1FE8L 1R3JA 1F4AA 4JN2B 4CU6A 2IWGA 3U46B 3CH1A 2EYRA 3BP6A 3IJSB 4N8PA 1UH3A 1QFWH 2Y06L 2JK5A 4FQCH 4DTGL 2ADFH 4KKLD 4S1QH 5IEHA 1S7VA 4XMLL 4X7FC 4JQIL 3GMNA 1ZHLA 4Z7OF 4QHLB 4ELMF 2ARJA 3FQUB 2R0LL 5E4EB 3UTOA 5KTEL 1MFDH 1EHAA 3IAPA 1RD6A 1S9KC 4AL8L 3H9HB 5DUPL 5DJ8A 3VFGH 5DI8B 4DN4L 1QSVA 4IMKC 4UNTA 3G04B 4OD3H 4KTEH 1HHJA 4HBCH 3OKEB 4XI5D 4NN6C 5I9QB 1YY8A 2J8OA 3B2UD 2XQYK 5IW6B 1AR2A 3SKNB 1RPQA 3O11A 1DEEA 5L2KE 1SMAA 1OY3B 5ACZA 1CIUA 4PRDB 1H8OA 1WBXB 1B0RA 1RUKH 1XR8A 2AJUL 4A6YA 1CGUA 4PLJC 5LAXA 4JPVH 4C55A 3NACH 4ZO7A 5B21A 4LFHG 1AC0A 3RKDC 1IM9B 1F58H 2Q7YB 2MMXA 3WJJC 3KLHC 4QXUH 2L7JA 4HXBL 3O8XD 4P59H 5C0GA 4Q9RH 1SEQH 4OCMC 2CKBL 1OAKL 1HHGA 1RURL 5DJ8B 5E6ID 3O8XA 1JF1B 1QFHA 1KPVB 5GZOD 2CO7B 5E6IA 1LILA 4NHUB 1CG9B 2FO4A 2XNAB 3K8LA 4U4BA 3GJFH 1UZ8A 3NH7H 4P5TD 2X41A 4M4RA 5J3HD 1AC6A 4N9GA 4HV8A 4X6CF 4ZUSA 3P9LA 2QSCH 2GIYA 4P5TA 4WTWA 1Z9MA 4TUJB 5EWIL 5I1AA 2AXGA 2FX8H 3VGFA 5J4MA 2P8LA 1NCWL 2IC2A 2YA1A 3DUSB 5FK9B 3IXTA 3KDMA 1S7RA 2XKNA 1L7TL 4TPRL 4XBEL 4XRCA 5BO1L 3UTZB 3L3DA 2GSGA 2CUIA 4KJQD 1MREL 1T03L 1WIPA 4JFZH 4NHCH 1LGVA 1CXFA 5JIHA 5L88L 4KQ4H 5I2IB 1INQB 4M6OH 4PJCB 3RNQA 5C0DA 3Q5OA 5JHLH 5T3XE 5GRXG 2VL5A 5MEQA 3PWVB 5I6XC 4YXHH 4U1MB 1BX2B 3CLFH 2B2XH 4LEOA 1P4BH 1UZ8B 4XCEA 5K93A 5AUMA 5GS1B 5IFAL 1QOKA 1YJDL 1CK0L 1DQLH 2CIKA 2R1YA 3VFOB 4J8RA 1FYTE 3TZVB 5AZEH 3BE1H 3QUXC 4X7DC 1H5BB 3TYGL 1CVSC 1S5HA 1MCSA 2WWKT 4Y8DC 4ZO9A 1JZ3A 4XRCB 5D2LB 1WBYA 2IH3B 5FOBA 5IKCB 1F11A 4YHZH 4JKKA 3QUZC 5C0AA 4D0BA 5HVFB 3ALXA 2FJGA 3RWJB 2FDBP 4QLRA 3VXNB 3CMGA 4NQDB 3JV6A 3FHAA 3IDXL 1A4KA 4MA7L 1J1XL 3T1FA 1QBML 3BPLB 4KRPC 4QEGA 1E4JA 5C70A 1U6AL 3SJVA 3RWHB 2DS4A 2ZCHH 2FLBT 3PF2A 3VXQB 4N1EA 3SDCB 3R06A 5GISL 1IZKA 3U48A 4K2UH 2R1YB 4M5YL 4NZTH 4J8RB 5KVGL 1KG0B 3EYSH 5BVJB 1F3DH 2WIIA 4LU5L 4WFFE 5F7NC 4TTDD 4F2MA 3OZ9L 3SKOB 3GSXA 4DGIL 4Q0XH 3K8MA 1RY7B 2X4RA 1P1ZA 2XZQL 3FTGA 5CIPB 1KIRB 3F12B 2BNRA 1MRFL 4OCYL 4JM2B 5H37H 2BRQA 5JQHC 3BQUB 1WBYB 1AR1C 4P4KB 5L2KB 4HCRH 5FOBB 4D0BB 2NXYC 3VXOA 5F7UA 3SOBL 3SDXF 4C4KO 2A9NL 4NYLA 1NAMA 3IDMB 1A4KB 4N8VB 4P49A 4H8WH 4LCIL 2R9HC 3RIAK 5BS0D 1EEZA 4W70A 1U36A 4H20L 5L0QC 1NJ9A 3BN9C 3O4OC 2JJVA 4FOMA 4TULL 5CGTA 1IKFH 5BS0A 3W5MA 2VXSH 3N50A 2VZ3A 2R23B 1I3RA 3TT3H 3ARFD 5T3XD 4S0SD 4PJXE 5AYUH 1KFAH 3ARFA 2UZXB 2OTWA 1KCUL 1R5WA 3DVGA 4M1GH 4X8XA 4F2MB 1ADQL 1MCWW 2CQVA 2F5AH 4WI4A 1FYTD 3ZYIA 4XPBH 2CLZB 1YQ2A 4U1IB 3RWCA 1PKQA 3W39B 5GZNC 4JO2H 5J6HA 1NLDL 1FYTA 1U93A 4O2CB 4MJ5A 4G9FD 1Q38A 2B1AL 2PTTB 3ARUA 3WHXA 2IJ0C 5HHXL 4G9FA 4K3EL 2DQFA 3C6LB 2BMKA 4K71B 2FHCA 1JV5A 1UJTA 2Z93B 1QYGL 3TIDA 4WEBL 3FB8A 1PFCA 4XCNA 3MFFB 3QH3A 1IQWH 4NBXB 3OKKB 3NCCB 4RFNB 4HH8A 1KEGL 4AIOA 3X3FL 4LKXA 3HKFA 3EDJA 3DIFB 1G7HB 2FYYA 2DLEA 4YC2B 5T1LB 3S9DB 3VXRB 4RISH 4NN7C 3L7EB 4WWKC 4RWHA 5I1EH 4X98B 2EO1A 3MRLA 3FRUB 5FYJD 4WJ5A 3QPXH 2K7PA 3OWEA 3C60D 4XNXL 1KJVB 3SGEH 4WFFD 1TJIL 1Q9WA 1LEKB 2CKBB 2FEEL 5I1JH 3C60A 2X1QA 2VXUL 2OQJB 3RI5K 1YUHA 3FQXB 4TVPH 1GGIH 2UYLA 2VL4A 1YDPB 1UCTA 2NY7L 4PJFF 1NC4B 3QIBB 1KELL 5JLZB 3QH3B 4M1CC 4F58L 1AGEB 4DK3A 1DLHA 1LNUB 1QPPA 2J7LA 1NMCC 4OI9A 5FYJU 3ETBF 3LVEA 3DRQB 2OR7A 5AZ2H 3SKMB 2QKIB 5C0FA 5C0CE 1UM5L 3I2CH 1OPGL 3NFSH 4YFLF 4WJ5B 1VACA 4OCWH 3EYOA 2WNGA 4N0YL 1ETZB 2VDNL 4XP4H 1KEML 4H1LA 3MV8E 3O6LL 1BBDH 4KWUA 1A1NB 1HDMB 4OSUH 3WHE0 5EZLB 3VGBA 4EI5C 4ZFGH 4YHNB 1GZPA 2M2DA 1VFUA 2UYLB 4K3JH 1I1AA 3VG9B 4MDIB 2HJFA 4FQLL 5JW5A 3ROLB 2VOTA 1TCRB 5E8EA 2QQKL 2V2XB 1E28B 2CIIA 1DVFB 3F7QA 1WWBX 4G6KL 2RIKA 4GAJL 1V7NH 5FO9A 2JJSA 4KV5F 32C2B 4LSRL 1OAZL 2VLME 2PTUA 2P5WE 3WFHA 1YEGL 2ITDA 3R4DA 1WCBB 2ICWA 5TF0A 3TNNB 2D7TH 1IGJA 1B88A 5C0FB 2AEQH 2OSLA 2VLJB 5F21B 1G7MB 4BSVA 4AH2A 3EBAA 5GS0H 4E0RA 3EYQC 4IRSC 4G43A 1T1ZB 5JQ6L 1G7PA 3MOQA 4Y4KD 1TPXB 1ZA3B 4PJXB 1EVTC 2IF7A 7FABL 5HHVL 3MSPA 3LEVH 3KLSA 3NIFF 1MAMH 5HBBA 4Y4KA 5IVXF 4P3CL 1Q9KA 3LH2H 4FZEH 4UDTB 4H26A 43CAA 4YDKH 2FX7H 3T04D 1QSEE 1GZPB 2F53D 4GAFB 5I1HH 4OZHE 3IAGC 3E3QC 5C09A 3VRLF 2F53A 3PGCB 3DRTB 5EH1A 3CSBA 1LO0L 5H8DA 3TT1L 3RBSA 1XGPA 1A7RL 3SBWC 4WO4D 5TH2A 3DGCR 4MAUH 1C8PA 2ITDB 5ALBL 4WO4A 3EGSA 2BVEA 1A3LL 1F8TL 3MLSL 3MLXL 3U4BL 5HI4C 4J3SA 1MIML 4L3AA 4WFHD 2J8HA 2YWYA 1F4HA 3OAYK 3PG2A 2NLJA 4XGZA 1WCQA 3V4UL 4WHTB 2VH5H 4S1RL 4CNIB 2BSSB 4UQ3B 4MAYA 5C0CD 4XNQB 5DVOA 3MLUH 1HH6A 43CAB 3SE3C 1NGQL 3LQZB 4UB0L 1RUPL 4NKIL 5CAYB 3BH9A 3QR2A 3BUYA 5D2NC 2ZG2A 5D71H 4X8JB 2V7NB 5DMKB 3CDYA 3QEUA 2GI7A 3QZWA 1A6TA 5FGSA 4OIBA 4UT9L 1I8LC 4LLMA 3ARGB 3CLEH 2ED7A 4LSTL 4QXGH 5JHDD 5GGVH 4GW5B 1KIQB 1HE7A 3WO4B 5CHNA 3V2AR 1WJ3A 2VLMD 5JHDA 1T1YA 4XB7A 1IT9H 2OL3L 3OB0H 1WIUA 2WINB 2VZTA 4R9HA 3KGRA 3BGFB 5ETUA 4F7CB 1OF2B 4QOKE 4G8IB 4Z7QF 3VRIA 5C0CB 1TQCC 4U2YA 5GRYA 1IL1B 2IBBA 3V0AC 3V4VH 1B4RA 1C16B 3VXSB 1DBJH 5C0JB 1VGKA 3BGMB 4U6YA 3IT8D 3MV8B 3FB7A 4Z78A 5D6DA 3FFDA 2V2WB 1QSED 2O5YL 3CFKA 2GFBB 4HPYH 3T4AA 1OP5H 1A7QL 3D1MC 1QSEA 2DOCA 5IB5A 4BKLB 4U7KA 3P4OB 4YPGA 5B4MD 5C9JB 4XPFH 5F89B 3MRMB 4OZHA 3RU8L 1FGVH 4QWWD 5DO2C 3IDNA 3OTTA 4RMUA 2IPUG 2YN3A 3G6JF 3TEUA 2P47B 2OP4L 1B90A 1UEMA 1DANT 1T7WA 2A6IA 3ZE0E 4S2SA 1JNLH 3H2WA 4F7TB 1ZOXA 4JY6A 3MRIB 3Q3GB 5C1MB 1IKNA 3ZDYF 2CR3A 2P5WB 3CC5A 2CO6B 2HFFA 5I66A 1KCVH 4LVHC 1HXMA 4LCCC 5GS2H 2IQAB 4XBPA 5DK0A 5EO9B 3BX7C 4UINH 3WLWD 1J1OH 1MCNA 1KT2B 2EIZA 4TUKL 1QLEL 5EZOL 3LEXB 4O00A 5L6YH 4JFQA 2Q8AH 1KSRA 2AJZB 4NQVA 5A3IC 4E42A 3HA0A 3T4AB 3O6KL 4NWUH 5DEFA 4HJJH 2P7TA 3FAXA 1QEWB 1RULL 4EUPG 4HHAA 3B83A 4I18B 5ERWB 2VDML 4UUJB 3KXFB 2GAZA 2MCG1 3DO7A 1IFHH 1OLLA 3DX9A 4TNVF 4KJPC 1Q72H 4JY6B 2VDQH 2WBJD 4YHKH 1RK1B 4QXTA 1SYVB 1U8KB 4DW2L 2QTEA 1QFUL 2WBJA 4RQQB 1UA6L 1CU4H 1HXMB 5IQ7H 2CLRB 4JY5H 3ULSA 5FUCE 2PXYC 2A38A 4FZ8H 4OZIB 3GFUA 5IMKA 2B5IC 2DQGH 1EGJL 2PF6A 3NTCH 4F15C 2D03L 4MA3B 4NUJA 4URTB 1R0AH 2NXZB 1CDYA 3W9DA 4PJAE 4NQVB 3WL9B 5IUSA 4GG6E 3VG0H 4DUXA 4K94H 3HG1E 5IV2B 2EH8H 4L29A 3WDIA 2ZOKA 4M93B 2YKLH 4X6DF 2BY1A 5EFIA 1J8KA 1KJ3L 5DJDA 4K9EL 2EE6A 5EZJA 1AHWB 1UT9A 1ZT7B 1DBKL 5D6CA 1FNSH 1ND0A 1MI5E 3QUYD 1D5MA 2A83A 1U8QA 1W8OA 1CFTB 2WBJB 2AK1H 3TBWB 3X17A 3WN5B 4KJWD 2EEAA 4HK0B 1CICC 3RWIA 2EKSA 3X14B 1MHEA 4L8CB 3LQAL 3VA2C 3WD5H 1Q1JL 3PP4H 1IAIL 1WLHA 2NZ9D 3R1GH 3EOTL 3F7YB 2YPKB 3OKOA 4EXPX 5HI5D 4QOKB 5L7XL 5A2FA 2GJZA 4HUWA 3MODH 1G9EA 1F4YH 1HNGA 3SO3C 4GOSA 1R3KB 4PRHB 4CMMB 4JRXE 5DHXB 3EOBB 4WVRA 2R4SL 3T8XB 5A16A 2OL3A 3FFCB 3V0VA 5MERA 4D0CA 3FT3A 3QI9D 4QHKJ 4F9PA 4UMGA 3LN5A 3O9WD 1RZGA 5HHME 1XF4A 5EZJB 1M7IA 5AEAA 1FVEA 3K46A 2P8MB 4KUZH 3O9WA 4OGZA 3U9UB 4APQD 1FG2B 3QUYB 5C92A 3W9EA 3RVXD 1YY9C 3MGTB 2XYCA 4YK4C 4OCLC 5E8NB 1WTLA 2F74B 1KPRA 2Y9RT 1QHPA 4G8FB 5GRJL 4WWID 4GKSA 3JTTA 4JY4B 4JO3L 1XF3A 4OGXH 1MCBA 5KSVB 1ED3A 1X5ZA 4YFLI 4B0MM 1K4DA 3BVNA 4ZO6A 2OI9B 2Q7NA 4ODWA 4JO1H 3MLWL 1CL7I 1KTDA 4WV1A 5D9SB 3QDJE 1KENH 5E5MB 5KVMC 3QEGH 2OL3B 3V0VB 2IQ9L 4D0CB 3FT3B 4L3EE 3P73A 5TDNA 3CFDA 1YEIH 3BWUC 5M95B 1RZGB 3HG1D 1OD7A 4PJAA 2GTZA 4OIIH 3QI9B 3OSKA 1OTTC 1FDLL 4GG6A 1ZT4A 3CVIL 1BD2E 3HG1A 3ZE1F 4ZYKA 1MPAL 4YHIB 1FIGH 2FECL 1NUGA 3D85D 3QQ9D 2AI0L 4NJ9H 4RGNB 2D0GA 3WLBA 3OR7B 4U3CA 2R2HB 4HUMB 3D85A 5C6TH 3TFKC 5GSVA 1MI5D 4HPOL 4APQB 3HC3H 1AY1H 4JHWL 1QSFE 4D8PA 4JRWA 2WWKO 3I02B 1RIVL 2EH7H 3TO4C 1MI5A 4CKVX 4Z0XB 1NUDA 5J12C 2EEBA 5LVEA 1GGCH 5I71B 1I9IL 3GNMH 4I0PB 2J6EH 4OD2A 4ODWB 3TNMA 1KTDB 4AY0A 4Y89A 2BOBB 4AK1A 3KS0J 2EDQA 3FT2A 3O41B 5TDOB 3W81A 4NKOB 1ZLWH 4M48H 2Z4QA 5DQDL 3A6CL 4PB9H 4HJ0C 2X70B 1G7QB 5A2IH 4JRXD 5K9OA 3QUMH 2R2EA 3ARED 3UJTH 3HG1B 3WJLC 3HRZB 4JRXA 4Y5XC 3CVHH 4RAVB 3O3EB 4PY8J 1GGTA 5TJWK 1EGJA 2ARWA 5IB2A 1JPTH 4FFWD 3D85B 4PIRF 1OB1A 5IMLB 3JV5A 4JFXA 2HJKB 4D8PB 4G8GE 5DLML 2Y4SA 1MI5B 1TVDA 4KXZH 1DQJA 4XX1E 1MWAH 5HDLA 3V52L 5LJYH 2WWMD 3QISA 1MNUH 2GITA 4MB5A 2LABA 4OD2B 4QHNA 1A6ZB 4XXDA 2OK0H 2QL1A 3NABH 3VU2A 1NL0L 1UZ6F 2ZOLB 3TJHC 5CEZH 1EDQA 2N7AA 4XPHL 5BQ7A 5FYKH 2MCPH 1RHFA 2JTDA 3GZKA 4WW2F 1A22B 2OBGA 3FMGH 1X5AA 1KB9K 2BJML 4OUUA 2YC1B 4JCLA 3HNVL 5LBSH 3HR5B 5GGVY 3GK8H 3QDJD 1DR9A 1RJZA 4G6MH 3HAEH 4L8SC 3GUTA 1H15B 2GCYB 4L5FL 2YRPA 3T65B 4L3ED 1CXHA 3QDJA 4MCYA 1FZJA 2LAAA 3AREB 3CDCA 3VH8A 5ESQA 4L3EA 1MVUA 1YECH 1NCCL 3UAJC 4WDIB 1OAYL 5EC1B 5HHMB 4ODVH 1A14L 3RWDA 1BD2D 2RBLA 4DAGH 4GRWE 4J3VA 3CFCH 3RUGE 2BNUA 5F3HB 3JV0A 3K81A 2I24N 1BD2A 5EO0A 1KB9J 3VFNB 5JA8B 3IDYB 4G6JL 1NC2B 2CR6A 2DKSA 4ZPTA </