4ZUSB

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusB00
5A16A 3V0VA 1JZ8A 1PY4A 4ZSOA 1KNOA 2XKNB 4B0MM 1LO4L 1XF3A 1RUQL 4JFZH 1UJTA 4ZXBD 2C3HA 4YBQC 5T3XD 3RWGA 3VGAB 3SE3A 3MLRH 2VLJE 2Q86A 4BZ1L 5F21B 3RZCC 3SKJH 1E28B 2OL3H 1P7QD 1EJOL 2ITDA 1FGVL 3NN8B 4H26A 4NN7C 1FH5H 3V5DA 4EVNB 2DLHA 5GPRA 5DYOA 1IGFL 1IVLA 1DN0A 4R0LA 3CJJA 3NIGE 2QQNL 2ICEA 3MRIA 1ZHNA 1DANU 3RZCA 4F3FB 3OTTA 3LKSB 1A6PA 3FCTA 3T3PF 4LP5A 4ODTH 3TYGL 4JVWA 1T3FB 1G9NL 1RV6X 1BVLA 2VL5B 3SDDD 3DMMB 2BDNL 1P7KB 3WIHA 1DFBL 4OQ1A 1YEEH 1U8NB 4MMZC 1ZT1A 3HI5L 2XI9A 2BSTB 1BAFL 1HE7A 2DJUA 3BDYL 4JREB 4L8CA 1VKXA 3T1FA 4OF5A 4G7YH 4F2MA 4PGDA 4X6DB 3BUYA 2A6JB 3QQ3B 3QCTH 5H94B 1EGJA 1MAMH 1IAKB 5C92A 2AJ3A 1MF2H 4L3CA 4B41A 1NANH 4GRLA 4IBLT 4S2SA 2O5ZH 4Y4HD 3S6CA 5EUOF 2R0ZL 5IJVA 5JUEL 5J12C 3L6FA 4JM2C 3H6JA 2MNUA 2I07A 1HEZA 2DD8H 2E5EA 2I27N 3FB7B 3GB7B 2YN5A 4H5SA 4PJ7B 3DECA 4JFXB 4GAYB 1CF8L 4HWZA 5MEOA 1TTFA 3GO1H 3ULVH 1PKQB 3CFJA 2NX5B 5C0JA 1S7QA 4O9HL 2AK1L 5ACZA 1BFSA 4G6ML 1QBLL 3SO3C 1RUAL 4Y2OA 5JMRA 5ITFA 4G7VL 3TBVA 1MHCA 3B43A 2OQJB 3QDGB 5F6IC 4BSVA 2YRPA 4JPWL 4DKDC 3K4AA 4IOFC 5FYKE 4N0YL 3IAPA 3GHEH 4PJ5A 3VJ6B 3CFDA 1T4KA 4QRPE 5GS1C 2E9WA 4J6RL 2H9GB 1H15A 4Y4FB 4NO0B 1KIQB 5E1AA 1QP1A 3DUUB 3ZL4H 4HT1H 2UUDH 3T4YB 3VGEA 2G5RA 3B3IA 2E6JA 1OW0A 2EYTB 4K9EH 1OLLA 4N1HB 5J1AB 1CFNA 3QFJB 3QA3B 5FA4B 5GS1A 4YHZL 1N6UA 1KENH 3KNBB 3T0VA 1AKJB 3CSGA 5T1DH 3PGDB 2X05A 5FECB 1EDQA 2B2XH 3HR6A 2VWEE 2VE6B 1HXYB 4LLUB 5EWIL 3JWDC 3QUXD 4ZS7L 3CLEH 1BIIA 4ZAKA 3KPRE 2WBWB 1NPUA 1NCBL 3EIFA 1FG2B 1JZ4A 3KHQA 4OCWL 4XBEH 1RJLA 5CJBA 3V9FA 5DRWB 1A6AB 3MV9B 1T6WA 4PRPA 5F7HA 3L3OA 1A14H 3H9SD 4J3WA 3RWHB 1D6EA 4WJ5B 5DLML 2VLRB 5F93C 1LO2L 4LSVH 3MRGB 4DUWA 1X7QB 2XN9D 3MLZH 3ARFB 4HJGA 1HINL 5BW7A 4XAWH 3VXRE 1GGTA 5IVXB 4O58L 4LHJB 3SKNA 1OSPH 4PJDF 1PFCA 2AXJA 4PRNA 3C87A 4N8CL 4JFPA 1R3JB 5C7XL 5ID0B 4YX2H 5CBAB 5ILTH 1FPTH 1SY6A 1YMMD 4JPIB 5I1EL 3B2VL 3C6LB 4P48A 1VA9A 4NT6B 3D3VA 4OIIL 3BQUC 4XNQA 4UMGA 1I3VA 3ULUC 1FE8H 4GG8B 2D7TH 3F7QA 5I6XB 1CL7L 4QRTB 3OZ9L 2BSRA 3TA3B 2LAAA 1DL7L 1YN6A 3QXAA 3IAQA 4FQQB 2AEPH 2H45A 4L5FL 5TGBA 1KEMH 2XKSA 3FO2A 4U0QB 5D5MA 1RFDH 3TYFA 3WFDL 4MNHA 3L7FB 4NO5B 4Z7QF 1XR9B 4XNMB 3VMPA 4JZOB 4NO3B 3IJYB 1NCTA 5F9WC 4HFUH 3RNKA 5IBTH 3MOAH 3WXVH 4GBXB 1H0DA 1VGKB 4IHOA 5JDSB 2AV7A 3CCHB 4J7RA 2VAJA 2VDNL 4XPHH 2BVTA 3V4PH 5IQ9A 3MC0A 3MLXL 5GGTH 1UH2A 4U1MB 3JUYA 5I71B 2DWEA 4I1NB 4DGYL 5EOQL 3PL6D 5ICXA 3EYVB 5LCVH 1U8LA 5DJ2B 1WZ1H 3DXAA 3OQ3B 3MRNA 3FT3B 1JGLH 5L7XH 3MA7A 5EBGA 4WWKD 1RUMH 5DHVA 5C0BB 1IKFL 2F19H 3P9MA 3NABH 2XA3A 1A1OB 4MAYB 3ABZA 1SJHB 1RJYA 3IU3B 1MI5D 3WS3B 1Q0YL 1M4KA 4OCMC 4EI5D 4NQDD 1JYNA 3OKKA 3ZTJG 4NN5C 1N4XH 3ZTNH 2AQ2A 5C0DB 4XNYL 3KS0H 1J1OH 3AXLA 4J1UA 1UZ8B 4FFVD 4JY4B 1M6OA 4G80B 1GGIH 5B39B 3DIFA 3MA9H 1KG0A 3G08A 2IGFH 5IF0B 5DZNA 1FYTB 3IDNA 5C0ND 4ESKA 2NY3D 1F2QA 3PWVA 4JFYA 4OLEA 4WNQB 3BH9B 4N0FB 2CLRB 5D72L 4M48H 2DQCH 2KDGA 5CZVH 4X4XA 4P3WA 3I85A 1RD6A 3NVQA 3T65B 3HUJA 3UYPA 1WFTA 1KPVB 4MXVF 2X9WA 4R4FL 5E2VH 2HRLA 3O6LH 3W9EB 3IJHA 4OZGA 4P23C 1H3PL 3QO0A 4MJ6A 5BRZB 1G7QB 2XFXA 3I6LE 4YDJA 3WHE1 5DUPL 1C5BL 3DI3B 3BZFA 1WBZA 1UXSB 3ORJA 1V3LA 1AGBA 2EEDA 1JGDB 3BN9C 4YE4H 3DNKA 1HH6A 5ENWB 4M7JH 3GMOB 1F4XH 4H0HB 1Z5LA 1RZJL 2XQYG 1HHHA 1HILB 1K4DA 1OTTD 3BISA 5I74C 4UV4H 5C0AA 4HCRL 2YWYA 4XMKH 1YMME 3VFRB 3QUZD 4Z9KB 5HHOB 4IDJH 1DSFH 2VLJB 1NEUA 5EZLB 2YSSA 4RSVA 4AM0B 4Z7VE 1Y18A 5CJOH 5JPNA 4ZNEA 1M05A 1CD0A 2OMBA 4LMQI 5BS0D 2FJHA 1DLHA 1YEJH 1NC2B 1B6UA 3O41B 1G7IB 3M1BA 2EO1A 1MHPL 2BHYA 4YHPA 1DVFB 4R26H 1CQKA 5KSAD 1ORQA 5DD6A 3H2WA 1F5WA 2VXVH 3IFPB 1IEAB 1ADQH 1BD2D 5KSVB 5AUMA 5D2LE 4CN1A 2GI7A 3MFFA 5K59F 3LH2H 5ETUB 2ZKHH 4RGMC 1OT1A 1A7RL 4ELMA 3TM6A 1ND0A 4PLJC 3V7AG 3WDHA 1NSNH 4OZHF 3P4LA 3QQ4A 1A9EA 4JO4H 3KYOA 3MO1B 3HB3C 1U95A 3MREA 5CINH 4UINL 5MP6H 5SX4H 1WQVT 2R0WL 1S9WA 3GSVA 3P77B 3GSNA 1A02N 3F65A 5D6DC 3O3EB 4PJHF 1B88A 2ARWA 3VFVB 1IILE 3BO8A 3VG9B 4HLZG 3RWDB 1A9BA 4DVRH 4W6XB 1OTSC 1S7SA 5ITBL 2X70A 3ZYJA 4Z5RA 1NMBL 1IGIL 4M00A 4XGZA 4OCXH 5DFVD 2PYFA 3QEQB 2YEZB 1Q8MA 2VAAA 1XZ0B 5I1LA 1DLFH 3VWKA 1R0AL 3KPLB 5A1AA 2R39A 1QFUL 5IGXH 1P2CB 4P5KB 1CD1B 2VDRH 1LK2A 5C8JA 2VN4A 1MHEB 4KI5E 4TULL 4OD3L 1F3JB 1S3KH 3C5ZA 5KW9L 4OV5B 5I1AB 5FUOH 3PNWA 5FV1L 5DUML 4F7PB 4YHNA 3VFNB 4L4TE 3RZCD 4MA3B 4AH2B 3MRDB 4POZC 1A3RH 1NDGA 3NOIA 5BZWB 2NY1C 3AREC 3TF7C 3QIWC 4NQCE 3MJ9L 1NL0H 1MFCL 4UNVA 4FFYL 4KKLC 2ICWJ 2PW2B 5K9KA 4LCUB 4P2OB 5J13B 3C60C 3MFGB 4LLQB 5I76B 2AJSH 3S5LG 5FHAH 3HMXA 3G6JE 4U4BA 3Q5OA 3KPRB 4X4MA 2VDMH 2DQDL 3U4BH 3HMWH 5HSFA 4Q6IB 2NY2C 3FN3A 4KRMB 4PG9B 5ICZB 4HKBB 1VGEH 5F9JA 4XVSL 5JW4N 1LD9B 3U0PB 4ZXBB 4GRLD 5BOPA 5E8DL 4PJBA 5KVFL 5DK2A 1GZPA 3G5XB 4NHCH 1OTUC 4NZRL 1HWGB 3VXRB 2L4OA 1A6VL 3LZFH 3WN5A 3EJYD 2ZUYA 4CMHC 3LB6C 4KVCH 4I3RL 4U1HB 3TBYA 1Q0XL 5B8CC 5DJDB 1MAJA 1PLGL 5JIHA 4HV8A 1OAQL 3WKNA 1I4FB 2NXYD 4XPTH 3JWDL 4P5TC 5I1GL 5EO1B 4XC1L 4ZFZB 5B8CA 2DMBA 1KLGB 2R4RL 5F8QC 2OSLB 5F97E 3SDDB 4FXKA 3BWAA 4EIZC 4TSCH 4HUXA 5KOVC 3MRQA 2EDWA 5GGRA 4PJ5D 2D4DA 1MJ8H 3ECBA 4X9FA 3Q5YA 4NBXB 3HC0A 3QXUA 3L95B 1T0MA 4G9DB 1FSKB 5HXMA 1M71A 1KB9K 3UTZA 3OX8A 5ISZA 2IFFH 3O3DA 3LOWA 1OAZH 1BBJB 3CK0L 1N5YL 3F12B 2COQA 1ACYH 1WZKA 2DBLL 1ZV5A 3B9KC 3F6IA 4Y4HB 1JV5B 4HFWA 2OL3A 1CFQA 1S9YB 1L0YA 3S98A 2FCBA 3JZ7A 1QLRA 2MQ0A 1IAOB 5CGMA 1N5AB 1IBGH 3DRTB 1X5ZA 3EO9L 4KK8C 4R7DB 5GZOC 5MENE 2PYEE 3WFEH 2Z0BA 2KZWA 2Z31B 1HIMH 3ULUL 2J88L 1XCQB 4PRPD 4TUJA 4UDUB 3DX6B 4ZFGH 5T3ZH 2YA2A 2ARJA 1GPOH 5EN2B 1D5BB 5I66A 2XZQH 2PXYC 32C2B 4P4KA 3TH3T 4M62L 4XVJL 3U1SL 1R3IL 2D3VA 3WDJA 2QHRH 1HSAB 4BH8A 5HHXL 4LSRL 3S36H 5DVKA 2WIMA 3TN0C 2VKWA 3EUUA 4R96B 3CMOH 5JOPD 3K74B 5FO8A 1YDPA 5MERA 1S5IH 1I7RB 5D8JH 4S11A 4OFDA 4KZDL 4XPFL 3D3VD 3UEZA 2BNRA 4OLZH 4M03A 2JB5H 4MDJA 3TO2B 3C08L 1D9KC 3QJFA 5A2FA 2W9LA 1NBZA 5DWUL 5JA8B 3H9ZA 4EQ3A 2UWEF 1WWCA 1U8PA 4XRCB 4EEEA 3ULUD 5T5FL 2DWDA 4FQIL 1D9KA 5EOCH 1T22A 3S5LA 1TPXB 3H42H 4M43H 3TWCL 5FO9A 4ZPTB 2BRQA 5DRXB 1FNFA 4YHMH 4OF0A 5KAQF 1U8HA 1G6RH 2ICES 3K1DA 3WO4B 1I1AB 4K9EC 4ZNCD 1FN4A 1FV1B 5EC2B 3QPQC 1JZ3A 2B5IC 1K3IA 3BPCA 1AR1C 3BX7C 1EFQA 4X9HA 2NCMA 5HVGB 5L8JB 3C6SB 1CDHA 3DVNA 2Y6SC 1R24A 4FQCL 3WJLC 3KDMB 3DXAD 3VFWB 1R3KA 3CX5K 4GSDH 4K3JL 2ZOLB 4POUB 2I9LB 1YMMB 4PJ8B 1LDPH 3FONB 3NCCB 4NUGL 4YNYA 2YN3A 1H8OA 1S5HB 5JOFB 1GOFA 2F9BT 1JNHB 1UENA 2C1PB 5FDWA 5KS9A 3ZDYF 4YR6A 3DVGA 1KBGL 1A47A 2VLLA 1EMTL 2CGRH 2A73A 4E42A 5AZEH 2DMCA 3GMMA 3INUH 2HKHL 4JFDE 1QPPA 3BEWA 4KGLA 2EYSA 2HJLA 4LOUC 5GS3A 4P5MB 1Q72H 4O51B 3RWIB 5F88A 5I16A 1N26A 1NGQH 4L8SA 4XP4H 3N85L 3NPZB 3MRCB 4UBDC 5IFAH 3NTCL 4WW2F 1OAXL 4QF1A 3VXUA 3PL6B 1M7XA 4F9PC 3QNZA 4GKSA 2Z35A 1LMKA 2LU3A 2RBLA 2RFXA 1K8DB 3RDTB 5DRNA 3P73B 4KQ4L 3BKCH 5HHMD 4WWKB 1GGBH 4NBZB 4GO6B 4MLSA 3MZTA 4EBQL 1X5LA 2MSPA 4U6YB 1OP5H 5HDBE 1MI5B 3P30L 2KBGA 4P23D 4K23L 5D71H 2IADA 2QV2A 4D0BB 3FHQA 1W72H 3QUKB 4EI5B 2W60A 4U7KA 1JIBA 2B1HL 2UYLB 3LKNB 4NQDB 2WBJC 3BN9D 4P57B 5C0AD 1HXMA 2OTUB 3D39E 5ACMA 4K7FA 3BZEA 5DJAB 4JO3H 2HVKA 3GSRB 1QFWH 3ME0A 1QKZL 1T2JA 2WBJA 1B6DA 1OSZB 3CVHB 2NY3B 1ZLUK 1G9MH 2R2BB 1NGWA 4XP1H 3FQRB 5D4QA 5KN5B 1JWSA 4U1LB 1X6LA 4YPGB 1VFOA 2YPKB 2NY7L 3PQYE 5D93B 5HYQA 4L4TB 2NQCA 2JCCA 2BVPB 5DFWH 1BWWA 3QCUH 1XGRA 3C8KA 4APQC 4NQCB 1U9KA 4YWGH 3O9WA 4PB0L 3SDCA 1VESA 3S34L 1WCBB 4LBEA 3G6JB 4KHTL 1A0QH 3CD4A 4UDTA 4X6DF 5K9OA 3MV8E 2CKBA 3REWA 1AGEA 4PLJD 2XPGB 4L1HA 2PF6A 2E7BA 4PP2B 2EKJA 5F89A 2NYYD 3QUZB 3HB3D 2APWA 2Z4QB 3SO5A 1RVFH 5L2JA 4R90H 5IW6B 1CIUA 1W0WB 2QJDA 3MLTB 4BFEA 3DOSA 1C1EL 5E2WL 4PJ7F 2ADGB 3BOVA 5F7DA 5D6CB 1J87A 3HMXL 4CU6A 4NPYB 5HDOA 4QHMA 4HUUB 4F8QA 3HZMA 2O26U 1I8IA 3X3GH 2P7TB 3VWKD 5KSAB 1YEDB 3O6MH 3BE1L 3QHFL 3TJEH 3CVIH 3MLYL 4KROC 2MKLC 2VLME 1AI1L 3LEVH 4HC1A 1OGTB 4XCNA 1KCVL 5GGSA 4X80L 1FDLL 4BUGA 2VLKE 1AP2B 3FQXA 2AGJH 3O45A 2CDGB 2M2DA 4QLRA 5I8EA 1C12A 4KUZH 3NGBB 2XACC 1GGCH 1H3XA 4NDMA 3O2WL 5JZ7D 2QKIB 3AU1B 3O6FC 5T1LA 1MIMH 4OI8A 2GSGB 5SX5H 3VXME 5JHLH 3G04B 4KVNL 3SGDI 4ALAL 5DHYB 1ZLSH 3BEVB 2AAVA 5BVJB 3GBLA 1GSMA 5ALBL 4DW2H 1RIUH 5DMIH 3QDMA 3V6FA 1D7FA 2X4SB 4QHKI 2F5AL 3O2DL 4LLAA 2FRGP 2PYEB 3BGMA 1LHZA 5A16B 3V0VB 5IIEA 2Z8VC 5HHQA 3V8CA 1G0DA 3TPKA 1KNOB 4FG6D 1CDJA 1KXVC 1UXWA 4FP8L 4OZFB 4PP1D 4MHHI 3WNMA 4JFZL 1ADQA 4K8RH 3OKMA 4P9MH 1DQJA 2WNGA 3ARDC 3RWGB 4OB5H 4UT7H 3MUGA 4LEXH 4QXWA 3MLRL 5GHWH 2Q86B 3UDWC 1BQUA 1QNZH 3KLAA 3SKJL 3ARDA 4BKLA 5IVXF 4X7FC 4NRXA 1TZIA 3HPJA 3K8KA 1FH5L 3V5DB 4H26B 4QNPF 3SGKA 5DYOB 4KFZC 5F7EH 1DN0B 4G6AC 2JJSC 3UDWA 2ICEB 1ZHNB 2EXWC 4OCYH 4MD0A 3RZCB 5F3BA 5FM4A 1J18A 3FCTB 4ODTL 1U8JA 1CU4H 1DBJH 1IC7H 4TNVF 4IRJC 2OI9C 5DURB 5E70A 3GIZH 4IOIA 3GEWB 1YEEL 2Z91B 1ZT1B 4S1SH 3CIQA 4YDIH 5FHBH 1SQ2N 4WI7A 1ED3A 2XTLA 5E5UB 4YO0A 4L8CB 4G7YL 4F2MB 3BUYB 3OKLA 1JZ7A 4LPUA 1MAML 1EAJA 4LSTH 5ISZD 4HGWA 3MLSH 1Z0MA 3LPWA 4QEGA 1MF2L 3GJFA 4GRLB 2O5ZL 3JBG7 4HS6A 1KN2H 1DBKH 1FZMA 4OF3A 2C3VA 2CJUL 5EU6A 3UPRA 4BFBD 1CDUA 1KJ2H 3L6FB 2I07B 2DD8L 2JTDA 1HEZB 2DAVA 2FX9H 1A6WH 1WWAX 3U9UA 3THML 4KDTC 3QEUA 3VXPA 2CLZA 4L9DA 4N5UA 3RAJH 5INDB 1DUZB 4H5SB 2XXCB 5DQJA 1XGTA 2E9JA 5J12B 5IP4A 4HWZB 3MNZA 5MEOB 5FM5O 2IQAA 1YMHA 3P11H 1KULA 3MYZA 2CO6B 5CBEA 4GKNA 3CFJB 5C0JB 2J8HA 2VITA 1BHGA 5ACZB 4P4KD 3SGJC 5E8NA 4LEOB 1I3RA 3TBVB 4LASH 1EFXB 4BSVB 4X6CE 2IQ9H 3OXSA 3NBNA 4PJ5B 4JFEA 3QWRA 1S7UA 3VWJA 3STZA 5TE7H 3SGJA 1H15B 1QFPA 1X4ZA 4N90E 1I85A 1SEBA 5E1AB 3ZL4L 5F6IB 4HT1L 2X4RA 4K9EL 1R3LB 4XB7A 3GDBA 3UTOA 3OGOE 2HAZA 5GJTH 1CFNB 4A2LA 1KENL 4I9WD 5GS1B 2BNRD 4OLYH 5T1DL 1RURL 2GEEA 3U4EA 3MJ8B 2MPAH 3Q48A 4FRWA 1BIIB 3ULVD 5A2IH 1RZKH 1D9KD 1E6JL 5HYFA 4H88H 4XBEL 5IEHA 2R0KH 5B3NA 5JHDA 4PRPB 3WL9A 5B4MC 1A14L 3L3OB 3QNXA 2YXFA 4WHTA 1D6EB 3MLZL 1CDBA 4HJGB 1MCFA 4I4WA 1Z0NA 1BWMA 4G3YH 4N0UE 1N3NB 3RL1A 1CXHA 3T2NH 2QQLH 1F00I 1K2DA 3SKNB 1OSPL 5JORB 4HWBH 1ETZB 3AMKA 4M3KB 4OZIA 5HI3D 5H35A 1A1MB 4JN2B 4PRNB 4KKAD 4JFPB 2MQ3A 4YX2L 5IROC 5ILTL 1D5XA 1FPTL 1AR1D 4K07A 3SDXA 2NTFB 1A2YA 5GGVY 5C86A 3W5NA 1I7TA 2HKFH 1RJZA 3P9LB 4JJHA 4XHQA 5IROA 1CVSC 3VRJB 1UADC 1DQLH 2BSRB 4CBPA 3QXAB 4H1LH 4PRHA 2AEPL 2N1KA 5FA3A 4JY5H 3BQUB 2VDQH 1OAKH 5TGBB 4NM4H 2OZ4H 3NIGF 4U6VH 1RFDL 3FO2B 3N1PC 3RVTC 1U41A 3TYFB 4P3CH 3B4NA 4X7EC 5SWSA 3ARBA 3L3HA 3ZE2F 4R9HA 3CZFA 4KU1A 2C7UA 4CMMA 4P46C 4HFUL 1B0WA 3WXVL 5IBTL 3MOAL 3RZWA 3RNKB 1G0YR 4RGNE 4PYHA 1V8HA 1H0DB 4IHOB 1ORSA 2X10A 4NZTH 3T0EC 4XPHL 5TFSH 3V4PL 4IMKC 4BQ9A 2YD8A 5IQ9B 5F9WB 4YFEA 5GGTL 3U2SA 5HPOA 4EDXA 2HLFC 3VXUD 3WDIA 1JPTH 4W68A 5ICXB 5C08A 2F8OA 4Q7DA 5F71A 5LCVL 3QNYA 3X17A 1U8LB 1WZ1L 3T0EA 1UCTA 3MRNB 1DANT 5GISH 1JGLL 3U7AA 4UBDD 5L7XL 2M1KA 1RUML 4ENEC 5DHVB 5J4MA 2F74B 2F19L 3PABA 3NABL 3X13A 1P9MA 1RJYB 4QXUH 3IXAA 3CFBB 4LQFH 1TJGL 2UY7A 5ELIA 4XWOD 1JWMA 1AH1A 3BUTA 1N4XL 5IBUG 2D7QA 1G6RA 1J1OL 3AXLB 1M6OB 3WFCH 3JVGC 3MA9L 3DIFB 1DDHA 1KG0B 2IGFL 3C09C 2WBJD 4NN5B 3HR5A 2VLKB 1W2KT 3DX7A 3QIBA 4JFYB 2Y72A 3D48R 3WD5H 2N56A 3OJMB 2DQCL 5CZVL 4P2QE 4X4XB 1QSFE 3N9GH 5ESVA 3RNQB 1BEYH 4GLRH 3HUJB 4AQ1B 3V79C 2EXYD 4HIJA 5E2VL 3O6LL 5LBSH 3WKML 3VE0B 5HHMB 3QO0B 1AO7E 4MJ6B 1XGPA 2JB6A 2XFXB 4YDJB 1CFTA 2DJSA 3P40A 3S37X 3BZFB 1WBZB 4F15B 3U83A 1IAIH 1AGBB 3NCMA 5TPWL 4ZMAT 5DVMA 4P23B 5DF0A 4M7JL 1F4XL 4F80A 4JRXE 2C4FU 1JF5A 1Z5LB 3FB6A 4KKCC 1HHHB 3L3KA 2IMNA 5K93A 4ZTOH 3VA2C 4UV4L 4KK9C 1NBVH 4KZEH 4XMKL 4C54A 5E5MA 4IDJL 4QRQA 4U1GC 1DSFL 1YEGH 1EH9A 3RUGE 2YSSB 4GG6A 2ADJA 2DM2A 2X4TA 3NCJH 5I74B 2QSTA 5L88L 2ED8A 5CJOL 4ZO8A 1Y18B 5JPNB 1LEKA 1M05B 3FN9A 1YEJL 1DLHB 4G6JH 3SGEH 3M1BB 4LLVB 3PWUA 1FAKT 4P2RE 4YHPB 1I75A 25C8L 5SV3A 4R26L 1RZIA 2E6PA 1ORQB 5HYJA 2VXVL 5DD6B 1RULH 4KTYA 4JGMA 1ADQL 4TSBH 1YYLL 5AUMB 1LO3H 3GRWA 2DOCA 1JHKH 3SEPA 3MNWB 2ZKHL 3L5WA 1J8KA 3VFUA 1ND0B 1W72A 4KROD 1NSNL 1MCHA 3QQ4B 4JO4L 4HXAH 3KYOB 2W9DH 5CINL 1U95B 1XEDA 3FRPG 3MREB 2VXSH 5MP6L 1G9MC 4RGMB 1ROWA 3JTTA 3S37H 5T1LD 4H0GA 2P5EA 5CSBA 2MWCA 1W0YT 3GSVB 4TUKH 5EFIB 5BO1L 4X4YA 5JW4R 1NCDH 2YUZA 3UTPE 3U48A 4LCCC 4BZYA 4L3EE 2BVOB 3KPSA 3QDMD 1WAAA 4Y1AE 1A9BB 2A77H 4DVRL 5I2IA 1S7SB 4YHYB 1KOAA 2X70B 4Z5RB 4AG4H 3QUMH 5DDHA 4OCXL 5L6YH 4LCCA 4OLVH 4EJ1C 3VDBA 2MHAA 2VAAB 3S35X 5I1LB 4LAQL 1T7XA 1LEGB 5LKNA 3QAZC 1X5JA 2YA0A 2F5BH 1ZVHA 4BZ2H 2Z8SA 4YH6A 4DJMA 4FZEL 3MCG1 2DF3A 2VDRL 1XF2A 2AJVH 1LK2B 4M9OA 2QLVB 2IPTH 3ARDD 1G7JA 1S3KL 5FUOL 2X1PA 3PNWB 4X4ZA 3MBEA 4FHBD 4YHNB 2I5YH 2N4IA 1A3RL 3FAXA 1NDGB 1YEKL 1UC6A 3BN3B 3MX0A 4NQXA 4CVZA 2EXWD 1YN7A 5K9KB 4XBPA 4I5BA 4LGRB 1MCPL 3FKUS 3GJEB 2V9TA 3AREB 4BELD 2AJSL 3QIWB 4HG4J 5KSUB 5FHAL 1F4AA 2HP4A 4RMTA 2VDML 4PRDA 3U4BL 3HMWL 4ZTPH 4PFEA 4EXKA 2C3XA 3GSQA 4XNXH 4PGEA 3C60B 1XGUA 3SPVA 1FFRA 4KXZH 4Q2ZB 2D7MA 5F9JB 1JPST 2E7LA 5JW3H 1AD0B 1HSBA 4MQSB 5D7LA 1IC4H 5EU6D 2NY2B 4FABL 1UM5H 4QRSA 4NHCL 1ZOXA 3S35H 4JPVH 3VFTB 3LZFL 2WQRA 3TNMA 1L7TH 5HVFB 4PJAA 3TBYB 3Q1SL 4HK3N 4HV8B 2AKRA 3VGGA 4XPTL 1HQ4B 4M1GH 2QSCH 4CMHB 5IKCA 2V5YA 4ZOCA 2WSKA 4K7PX 5DHXB 4C59B 3B9VA 4U7SA 5B8CB 5E5RB 3MRHB 4K8RC 2IALA 3BWAB 4TSCL 4HUXB 3MRQB 2YD4A 2VR4A 5GGRB 2HTLD 4JFED 3QWRD 1MJ8L 3EDEA 3R0NA 3HC0B 4DKFL 1IM3A 5H8DA 2DQEL 1T0MB 4ONFH 2A2QT 3BIAX 1YQVH 3UTZB 3OX8B 5ISZB 4NZDA 2IFFL 3AS1A 3FRPA 5F70A 1OAZL 3FMGH 1FVEA 2EYRA 2NZ9C 1CGTA 1ACYL 3EOYG 4RNRA 2G60H 1DN2A 2OL3B 3CSBA 1IGJA 5GQBA 3WIIH 1QLRB 5FK9B 3O11A 3H8NA 3WFEL 1EBPA 4EOWH 1JCKA 3B9KB 5I19H 1NGPH 1HKLH 4UV7H 4PUBL 1NEZG 1HIML 4UAOC 2AVGA 5J6GA 2NY6C 3BRGC 5JHDD 2P1YA 5M95B 2JF1A 1HDMA 4CNIA 1MWAH 1FFPA 4ZFGL 3VH8G 5T3ZL 1QEWA 4H1LG 5IG7A 2R2EA 4F9LC 2ARJB 4MB5A 2XZQL 3UYRH 3GSXA 3UC0L 5IK3A 3GSUA 5J1SC 4F33A 2HRPH 4P3DB 3EFDH 1A6ZA 2QHRL 1H5BC 5B4MD 3NACH 4MQXC 4C83A 1FAIH 4UTAH 3CMOL 3X11A 3IVKA 5IB3A 1CDGA 2OYPA 2KUTA 1YDPB 5MERB 4Z7OF 1S5IL 4JO2H 2IH3A 4OF6A 3ZKMC 3BAEH 3TN0B 1KJ2A 2BNRB 4H25A 3DARA 2CMRH 2JB5L 3OXRA 1YEHH 1LO0L 4UIMA 1NBZB 1BREA 1YPZE 4KI5F 3LRSA 3GKZA 4LPCA 1Y0LB 2J6EH 2YUWA 1IM9A 4PRHD 2YPVH 1NKOA 4TPRL 2FHFA 1U8PB 2BRRH 1D9KB 4WFFD 1T22B 3ES6A 2MKWA 3S5LB 3H42L 1FZOA 3HE6C 1PYWA 4JFOB 5SWSD 5FO9B 1EO8H 5T3ZD 1FFNA 3C2AL 1OP5K 5E8PA 4YHML 8FABB 3IJSA 5KVEL 2SEBB 1FLTX 1FN4B 1N6QL 1UKSA 5FAAA 2AQ1A 1WITA 5KJRH 3HPLA 5C08D 2OLDA 3IRZA 3NIFE 1R24B 4X0KA 3T0ED 4GSDL 4OD1H 3VFOA 2B5IB 1KV3A 5L0QC 1PX4A 3ZHKA 1LDPL 2HLFD 3MJ6A 4ODSH 5FYLH 5CS7A 5CLTA 4YNYB 1Z6JT 5B3JE 2FEDC 2D9CA 2QTEA 4JANA 5FDWB 4YQXL 3B8YA 5KS9B 4YR6B 2CGRL 1AY1L 4QT5A 2VLLB 3ZKNC 3C5JA 5AZEL 2YMXH 3INUL 3GMMB 5DMGC 5DEFA 3L3DB 1L9MA 4PY8J 3WBDA 4N5ED 3BEWB 5ICYB 2EYSB 2HJLB 2CIKA 3QIUA 4K7PY 1LEIA 1Q72L 4LNVA 5F88B 5E2TH 5I16B 3QIBD 1NGQL 3FQUA 4OGAC 4L8SB 5EU7C 4XP4L 2DQFA 5IFAL 2Y7QB 1FHGA 4PJCA 1PW3A 3VXUB 2CRYA 4S1DD 5E9DA 4A6YA 3KYNA 3MRPA 3QNZB 3DROA 4GKSB 1JRHI 4WEUD 1NEZA 3NZHH 2RFXB 4UU9A 4XH2A 5DRNB 3BKCL 2GJ6E 5GXBB 1S7VA 4HWUA 1PJ9A 4WY7H 5HPMA 2V2WB 1GGBL 1ZMYA 3VH8A 4H1LA 1AGCA 3BZDA 4YZFF 4H20H 3GK8H 5D71L 2IADB 2GJJA 1W72L 3MACH 2W60B 4QHLA 5I1KH 4CJ0A 1MJ7H 1HXMB 1ZLVH 3QR2A 2FZ3A 4XP6H 5DMKA 4JO3L 3BZEB 2HVKB 4Y5XC 1QFWL 5HHPB 2XZAH 2WBJB 2BNUA 4KK9D 4NQEA 1TCMA 3O3BA 4Z7WE 3TT3H 1P53A 2XWTA 3P4OA 1NGWB 2VZUA 4XP1L 3K2UH 3MQIA 4O2CA 4DN3L 5I8CB 1QRNE 2BHZA 1JWSB 3G5ZA 1A7BA 4R97C 3W11D 4PJFA 5HYQB 4DFIA 1UCBH 3QPXH 1INQB 1MFNA 4JHAH 1CVRA 1WBYB 3QCUL 5HYJD 1RU9H 4MQ7A 5J56B 1XGRB 1ZHBA 3C8KB 2EDOA 4YWGL 4AQOA 2PNDA 3GMRA 1IT9H 2EIDA 5TJWK 5C1MB 4J3VA 4WI6A 3EYUH 1QFWI 3LY6A 1NKRA 1JK8A 5GIRA 2BNQE 1MCLA 4APQB 4LBEB 4RAVA 2B0SL 1A0QL 5E24E 3D5OF 4BA8A 4UDTB 5K9OB 3REWB 1AGEB 1XIWA 3QEHB 4HMEA 4JFFE 2NY4C 1TJHH 1RIHH 4TRPH 2P5ED 3JUZA 4O02H 5A40E 3FOMA 1ZTXH 5TDPA 2FJGA 2P4AB 3P0YH 3OWEA 3QULA 5L2JB 3C9NA 3KPSD 3E8UH 1SJEA 3LEYL 3T3PE 3ZLQC 1A4JA 1II4E 2ZCHH 3DVIA 3RU8L 5F7DB 1R5VB 4LVHC 5HDQL 1ZA3B 1NJ9A 5JPMA 1VACA 1FYHB 4QHMB 4WCYL 5A3ID 1RIVH 3HZMB 2BVUA 3X3GL 1I8IB 5JIPA 3O6ML 1MIEH 2I60H 1X6NA 5KANI 3TJEL 2JELH 3CVIL 1NCUA 2HT3D 3HTLX 3LEVL 1Y6NR 1EEQA 2MOVA 2HT2C 4OKVA 1F11A 4MDIA 1KF9B 1NGXB 4JJ5B 2AGJL 1CGYA 3ZZ1A 4AT6A 4D2NA 3O45B 4RFNC 4Y16C 1MREH 4KROB 1KCUH 5I8EB 4KUZL 1C12B 5I1IH 4M4PA 1GGCL 1WSST 2ADIA 4NC1C 3EYFB 4FQXC 2BSED 3BP5A 4RWYH 4YGAB 1IZJA 1NDMB 4HGMA 1D5MA 1NFDA 3FOLA 3QFDA 1MIML 4Y16A 3A0OA 5T1LB 1MRDH 1L7IL 4PJ9C 5JHLL 4J2XA 3HN3A 1JPFA 4NWUH 1XGYL 2MQCA 4PRAA 3P4MA 3U9PH 3K80A 4DW2L 3BHBA 4K3HA 1RIUL 5DMIL 4GW5B 3GIVA 3QDMB 4U2ZA 4U1JA 2WLZA 4DK3A 3HZVA 4MQTB 3QUYC 1CFBA 5SWZA 3BGMB 5IESH 5E03A 4U3CA 4Y0GA 5IIEB 5HHQB 2XT1B 1H9VA 2PW1A 4K8RL 1QSEE 4OLXH 4F7MB 4P9ML 3QUYA 1DQJB 1SHMA 3O8XC 5LAXB 3V5KB 3ZE1F 3QHTC 4UT7L 3EDFA 1IJ9A 5D7LD 4LEXL 4NJ9H 3MUGB 4JZNA 5JQ6L 4RAUB 1T2QL 5GHWL 1Z9OA 3OKDA 3H3PH 2Z93A 1ZK9A 4G43A 1QNZL 5DJ6A 1TVHB 2VL4A 2W1NA 3AY4A 3KLAB 5HDBF 4LLDA 3ARDB 1GHFH 5BXFA 4BKLB 1KPRB 1KLUB 3ALPA 1RUPL 4NRXB 3HPJB 4WW2C 1LP9A 5JW5A 1CZ8H 1YY8A 3RIAF 5CCKH 1CS6A 1ZGLM 4ONGH 5FYJD 1WFNA 4ZDHA 3TESA 4MD0B 3FQTA 4QOKE 3CFCH 4HIXH 5F3BB 5HYJE 3RA7H 1EHLL 1Q9LA 1U8JB 1CU4L 1IC7L 5FEBA 4LGSB 2UZIH 4FQHA 3GIZL 5F44A 3NIDF 4IOIB 1YPZB 3QUMA 4LCWE 1CDIA 4S1SL 4YDIL 5FHBL 4YXKH 2UY6A 5F7MC 1T0NA 1CXEA 1NMCB 2Y07L 3ULUF 2OI9B 3DYPA 5GGUB 5K9QI 5CUSH 3FQWA 3OKLB 4LSTL 3SDYH 4D9RE 2YD6A 4HGWB 3MLSL 3VGAC 4Z77A 1FZKA 4Z78A 4PJDE 3DETC 5T1MA 4ETQA 4HS6B 1DBKL 5J6HA 4QHUB 5KVMC 1FZMB 4XP9H 2C3VB 5D1ZC 5EU6B 3UPRB 1BOGB 1MRFH 5C3TA 5B22A 4OT1H 5FIEA 2OTWA 2FX9L 4AEHH 1A6WL 4OLWL 3U9UB 2NZ9D 2AERT 4XZUA 3QEUB 3LPGA 3RAJL 1YUHA 1GYAA 1J8HA 1XGTB 4X6EA 4PLKD 4QRRE 5A43C 3U7WH 3U79A 2GTZA 3MNZB 3P11L 2IQAB 1YMHB 1W0VA 3CSYB 4IIQC 1U3HA 3A67H 3LEXA 3T2OA 2VITB 5HJ3B 1OAUH 2C3GA 1DE4B 2X7LA 2NY6D 4V1DA 2RJMA 3DUSA 3MCKB 2VDOH 2IQ9L 3NFNA 3OXSB 4V2CB 5D1QC 4HD9A 3BDXA 3SE4C 1S7UB 5DK3A 4U1IB 2B20A 1YYMH 1MCJA 3B6SA 2OM5A 1ZWIB 1JF1A 4MQXD 2DICA 5GJTL 5D1QA 2GITA 5C07E 4GXVL 3SE4A 1T1ZB 3D2UD 4OLYL 5IEKA 4U0RC 3I6KA 2ESVE 3V7MA 2R0LH 1CGUA 4J3UA 4YHIA 1QO3A 4XCYB 3U4EB 1IM9D 2ZG1A 2Z8WC 4ZUWA 3NFPA 2A9NH 2MPAL 4HEPG 1CGSH 1T7WA 5DGQA 4EQ2A 1TJIH 2R0KL 5IEHB 1AXTH 3HUJF 5JHDB 2EDLA 4GAJL 3LN9A 5HBBA 3L5JA 3PDDA 3QNXB 4WHTB 3S4SG 1TCRA 4NHUA 1KPUB 3I84A 1SVCP 1YNLH 2H8PA 4I4WB 4EUPA 1JGEA 4G3YL 5E1HB 2IANE 2AXFA 2CXGA 3K7UA 3RL1B 2QQLL 4P59H 3T2NL 4Y4FC 1K2DB 1P4IH 3QB7C 4HWBL 1JHLH 4OZIB 1QFHA 2NNAA 5H35B 3MLVH 5I1JH 1ZANH 1D5XB 4E5XA 5EU5B 5HGAB 1A2YB 3ZSSA 4WEBH 5MEQA 3PWNB 1R5IA 1I7TB 1YNKL 2NR6D 3N06B 5ADPH 1RJZB 1U0QA 4KKNA 4Z7WB 3BKYH 4JN1H 4MXVE 1DQLL 4TYUA 5FCUH 3FO1A 2B8OT 5DVLA 1CN4A 3UPCA 1BPVA 4PRHB 1X5GA 5FA3B 2VDQL 1OAKL 4OI7A 2I26N 2OZ4L 2BCKA 1MWAA 5EO9A 4HUWA 3DPBA 4P3CL 1J7VR 5SWSB 4UZGA 3L3HB 4LF3A 5EBWA 3O4LA 3CDYA 2C7UB 2YPLA 4CMMB 3QIUD 3ZKND 2PUQT 3ARFC 4OGYL 3AAZB 2ILLA 1ORSB 4NZTL 4U3HA 5F1IA 5TFSL 4NP4H 4PJGE 1UH4A 4P46B 4NKIH 4EDXB 1JPTL 1ZT7B 5E9DD 1BQHB 4XX1E 4JLRB 5C08B 3QNYB 5E00B 2W9EH 5EU3A 3T0EB 5MHSE 4OGAD 5GISL 3IF1A 2EH8H 5GRVK 4XCCH 2R4SL 3RKPA 1K4CA 1U8QA 3PABB 4UQ2B 3PE9A 3HG1A 5JLZA 4ZD3L 3BW9A 4QXUL 1XGQA 3CFEA 5C2UB 2RB8A 3T4AB 4LQFL 4DGIH 5K59E 2DQJH 3SY0A 4ISVA 1IEBA 1RZ7L 3GKWH 4HQQH 4OZHE 1G6RB 3V4UH 4HJ0C 2Q7YA 5I18H 3O0RH 2IPKA 1DDHB 3AM8A 2VO5A 3HR5B 4NQED 1OT2A 4LCIH 4R4BB 5CJ8A 3WD5L 4HJJL 1M7DB 5EDXA 5T5NG 3TGXA 4YBLC 5CEXA 4PJHE 3C09B 1BEYL 1T89A 4KY1L 4YAQA 1TZGH 1UKQA 1JPGB 3PP4H 1R3HA 3K81A 4OKDA 4HIJB 2FL5B 5LBSL 1RHHB 5E2UL 3HCVA 4PBWD 2JB6B 3IETB 1CFTB 4YIQA 2A6KA 3BJ91 3L1OH 3S4SA 3AMLA 4NRZA 4LPYA 1O7VA 1G7LA 5J8OA 4PLOB 2EDDA 3PHOA 2RIKA 1UVQA 2DQHH 2W38A 3T0XA 4TVPL 1XIWD 3FB6B 3BP6A 1BP3B 4ZTOL 3PDOA 1SM3L 1NBVL 4KZEL 1J5OH 3U6RB 5D1XA 4GLRI 3UTTA 4LSQH 4PJBF 4QRQB 3WE6B 1YEGL 1CR9H 4FXGA 3AROA 2NY0C 4GG6B 3NCJL 2ADJB 2X4TB 3SCMC 3OF6A 2BY1A 1DQML 4N9OB 2FATH 5GRVL 1KB5L 5IB5B 1UM4H 4J12A 2W0FB 1IAII 1B4JH 4HKXA 4N1EA 3RBGA 4G6JL 3BIKB 3FO9A 1GZQA 5DD0H 5CJXC 3UXFA 3PWUB 2O5XL 3V4VH 5BJTA 4M9PA 1OOAA 5HYJB 1RULL 4GW1A 3JV6A 3TCXA 2EDJA 1UQSA 3OKOB 4JKPH 5IM7B 4TSBL 3X14B 2PR4H 1LO3L 4XNUH 4MXQC 4L1DA 1JHKL 4PIRF 4ZYKA 3BMVA 3BD5A 3L5WB 5TDNA 3QYCA 3VFUB 4B50A 4KQ3H 1GIGH 3BESR 1PDKA 4N8PA 1W72B 4ZS6C 4HS8H 4C56A 3S88H 1U92A 4W70A 4RMRA 1FNGB 3BD3A 2VXSL 2YKLH 4ODHH 3T3MF 3SGEI 2C3WA 3S37L 3JTTB 2ICWA 4Y16D 3H7LA 2ZSWB 4FMKA 4JQXA 4NKDA 4PJDB 4AENA 5I73C 4TUKL 2FBOJ 4X4YB 1NCDL 3L5HA 1REIA 1MEXH 2A77L 5AYUH 3BJLA 4X98A 3R06A 4JZJA 4AG4L 3F7VA 2JJUA 1PY9A 5SWZD 1AIFA 4OLVL 4LCCB 4QRRB 5FM5M 2MHAB 1E27A 5DRZA 1S8DB 3VRIA 1B0RB 3QUYD 3PV6A 2F5BL 3L5XH 5D70H 4BZ2L 4MA8H 5E2JA 1FGNH 3SHSA 5D2NA 1N6VA 4WFED 4DK6A 2AJVL 3SBWA 1XF2B 2F8VA 3VGFA 2IPTL 2RHEA 4WI2A 1G7JB 3QAZB 4PGCA 4NN6C 1UZ6F 4NZUH 2N7BA 3IDYC 5ADOH 2HFEA 3KJ4B 4I0PC 2I5YL 4RGOH 1JUFA 2R23A 5DO2C 1BF8A 2EC8A 1U8KB 3RWJA 4Z7UA 4F57H 1ZT4A 4PJIA 3LS5H 5DJCA 1CD9B 4I0PA 4NQXB 1SBSH 2CIIA 3PHQA 2VZ3A 1QR1B 3OR7A 2BY0A 4JDTL 4I5BB 5FGCE 1F4WL 1AXSA 4DCQA 2FECI 3MBXL 4LSPH 5F7KC 2VUOA 1IL1B 1C5DB 1C7TA 5M7QA 3MYJA 3JV4B 3ULVF 3EDDA 1XAUA 2ZUWA 4ZTPL 3MRKA 4XNXL 3FFDA 4PGEB 3WIHH 1XGUB 3AB0C 3SPVB 5EUOA 1ZEAH 3P9WB 1GGYA 3PGCA 4KK5D 4JDVB 1HSBB 1IC4L 5DD3L 3WS6C 1UM5L 3N1GC 1NLBH 3S35L 4JPVL 2A74A 4IDLA 3DETD 4NQVA 1K8IA 3TNMB 1L7TL 1TVBA 3K1KC 2VH5H 1J8HD 4OUUA 2BK8A 4YDKH 4G42A 5DQDH 2X89A 1TNMA 3GHBL 2PCPA 2UWEE 4PTTB 4Y19E 2AKRB 1FIEA 1U3HD 1J0YA 5AZ2H 1NLDH 4M1GL 2WZPD 4MZ3A 4MB4A 2XA8H 4NUJA 5IKCB 4GMTH 4TNVK 4P2OC 2J8UA 2XIDA 3GGWA 4MNGA 4V1DD 4S1RL 4FFZL 5IVZA 4WFGD 4HBQA 2IALB 5E8EA 2HFGH 4WHCA 4C4KT 4JRYA 5KS9F 4NCC2 4TVPE 1UJ3A 4ONFL 2O61A 1MFBH 1T1YA 4NRYA 3TO4A 1YQVL 1NBYA 1QZ1A 5FKAA 1PVHA 3EZJB 3WIFA 1UWXH 4F7CB 1BJ1H 3Q2CA 4ZXBC 5D1QD 3VA6A 3IAGC 3EFFA 2UZXB 3FMGL 5KG9A 4O2FA 4U6TA 2EYRB 5AYQA 1T20B 1KEGH 3FL7A 2G60L 2KPNA 4RNRB 4Z76B 1KTRL 1IGJB 1NCWH 2P8LA 4YDVA 3WIIL 5C2BL 1UYWL 4X5WA 5EZJA 4PJGB 4P2CG 4EDWH 1VEMA 4EOWL 4YUEH 4PJEA 4ODXA 5I19L 2CDFA 1HKLL 2DQGH 5F8RC 4NKMA 3IGAB 3KPQB 4LDLB 3DURA 1I1FA 1U8MA 1EAPB 5J6GB 4WIQA 3I75A 1P5UA 3ZDYE 1H3WM 1HDMB 4CNIB 4X5LA 1L9NA 4CU8A 1QEWB 4J23A 5IG7B 1G7HA 3UYRL 4UAOB 4BQBA 5C0FB 1KTKE 3GSXB 3SDDC 5IK3B 3GSUB 2NY6B 4OD2B 1BJMA 4F33B 1A6ZB 2H3NA 2GHWB 4QKXB 1Q38A 5L2KA 3NACL 4JAMA 4CW1A 4OFYA 5TQ0H 4C83B 5HI5D 3K2MC 1FAIL 4K7PL 2V7NA 5EOTA 3X11B 5IB3B 3HNTL 1XH3A 1H5BB 3KYMB 1OQXA 1H3UA 4JO2L 1K3ZA 5FF6B 5IUSA 3VD3A 5FKPB 5IR1A 4WI4A 4UT9H 3BAEL 5E6YA 4Y4HC 1KJ2B 3D2UB 2CMRL 4H25B 1KB9J 4NNYB 4M7KL 3OXRB 4UB0H 5I0DA 1YEHL 4KGJA 4I2XE 1FVDA 4QHNA 5E7BA 3X3FH 4UIMB 2Y06L 4C57C 2J6EL 4U1SA 4WUUE 1A6TA 2YPVL 2H2PC 3E3QE 2BRRL 4DOHE 5F6HI 2AJZA 2W59A 1G7MA 4LIQL 4XXDB 4K71B 3ES6B 2JCCF 1FZOB 3QDJE 2CR6A 1OARL 5EC1A 1EO8L 4G5ZL 1VPOH 2EE3A 1FFNB 3O4LD 4MGXA 3LHPH 4D0CA 2YPLD 1T21A 2ATPA 3OB0K 1MVUA 4IJ3C 4MD4A 1CK0L 3IJSB 3HE6B 1FO0A 5CD3A 4N0CD 3RRQA 5BV7H 4ODUA 3TJHD 1ZLVK 1BZ7B 5KJRL 1IGYA 1SBBA 5HYIA 4TTDC 3ISWA 5AAWA 4OD1L 2YUVA 3WEXA 1FCGA 3QJHA 4DQOH 4AZ8A 1JWUA 3LD8C 4AY0A 4QCIA 4H0IA 4PV9A 4WV1C 1CDYA 3MMEA 1S9XB 3MRLA 4K3EH 5DC4B 1PEWA 1EEZA 2DLIA 3QUXC 3QP3A 4JANB 3IS1X 2AXGB 5H2BA 3BPOC 3PWPA 4O2EA 5DHVH 4IRSA 4LVEA 4QT5B 2YMXL 3MV11 1DBMH 4G8GA 5DEFB 1B90A 5JXEC 1P6FA 4JQVC 4Z0BL 3BPNB 4JVUA 1HZHH 4X6DE 3WO4C 2CIKB 4XVTH 4Y2DA 1P1ZB 4PRIE 4DGVL 1P4BH 2WIIA 4FOMA 3MRBB 3VXNB 5J7CC 5E2TL 5JXEA 3M8OH 4HJ0D 4MAUL 4JQVA 4X9GA 3FQUB 1IMHC 3ROLB 2DQFB 3H0TA 3TH4T 4HKZA 3FB5A 3ZKXC 3HI1A 5EB9A 2OMNA 1FLRH 3KYNB 2JIXB 2EDFA 5MI0C 4N9GA 1ZS8A 2C4XA 5FYLD 3DROB 4DAGL 1NEZB 2J7LA 2OP4L 1WZLA 4HWEH 1CWVA 1S7VB 1S9VB 4WY7L 3CX5J 1SMAA 1AC6A 4WGWB 1PKQE 3OL2A 2LU7A 3VH8B 2NX5E 1N64H 3I50L 4H1LB 1ZSDA 1AGCB 4WUKH 4DWHA 2E9BA 3GK8L 4RRPG 3CDCA 5IJKA 2Y36H 3ETBF 3QDGE 1OCWH 1BJ8A 3WLBB 2VXQH 3MACL 2FO4A 3DBXA 3K8MA 2D4FA 2X4UA 4KDWA 4QHLB 5I1KL 1MJ7L 5D1XD 3UTTD 3E6HA 1TXKA 2FZ3B 5CEYB 4XP6L 3U0WL 5DMKB 4AEIH 4D3CH 4E41A 4Q9RH 1BFOB 1UA6H 2FX8L 3OF6D 2BNUB 4NQEB 3TT3L 3O3BB 3RFZC 2FD6H 1R6VA 2XWTB 3P4OB 3K2UL 4HKJA 4O2CB 4XB8A 4TSAH 5GRUH 2FLBT 2HTKD 3MV7E 4OJFL 4HUMB 1UCBL 3QPXL 3VXSA 5DEZA 4JHAL 3BP4B 1RU9L 3RY4A 3LDBC 1JGUL 4LU5H 4MQ7B 1DQQA 5JW4M 1I9JH 5AG8A 1CBVH 4R97B 1TIUA 3T2QA 1IT9L 3GMRB 3PIQB 1EZVY 2ICWI 1I1YB 2AK4D 4JO1H 3VXTB 1IQDA 3WLWD 1MCOH 1YPZF 1Q94B 1TVDA 3FT2A 1F42A 2GTWA 5GIRB 4C56D 2VLRE 5ID1B 1A7PH 4RAVB 2XWBA 5CGTA 3FB8A 2Q6WB 2A9MH 4J4PA 4MXQD 3JXAA 4HUNB 5IVXE 5KSBA 1TJHL 1RIHL 3LKOA 1VFMA 4TRPL 2IJ0C 4FFVC 4W6YB 4O02L 4BH7A 4QNPE 1ZTXL 3IKKA 2BP3A 3FOMB 2ED9A 3DRQA 1NBQA 3P0YL 5C0NC 4NSKB 1KGCE 1CXKA 1U8IB 2NY3C 3QULB 2NY4B 3C9NB 3E8UL 5CFHA 1A4JB 1MCRA 2ZCHL 4LIQE 2FEEI 4ZQKA 2LE9A 3GSNH 4M4RA 1QUNA 4M3JA 3WXWL 1I8KA 5JPMB 1VACB 3WNPA 2VDLH 1RIVL 2APVA 2I60L 4NFCA 4G9FA 4YK4C 2WQ8A 2VR9A 2JELL 4LVHB 3PP3K 1VADA 3UTSA 4OKVB 1F11B 1CCZA 4MDIB 1A3LH 3FRUA 4KMTH 5CILH 4RMVA 2ZUTA 3MROA 4WU5B 3V6OC 4AT6B 5IFJB 2FIKB 3MUJA 1MREL 3I9GH 4U7MA 5DMYA 5I1IL 1U8OA 4Q0XH 4CRPA 4EN3A 1I9RL 1I3GH 4JG0H 5EORL 2ADIB 1W8NA 1SYVB 5DUBA 4RWYL 3SJVA 3UJIL 4UI2A 1D5MB 1NFDB 3FOLB 4RFNB 4Y16B 2VDKH 1IQWH 1MRDL 2R9HD 2CUHA 1NAMA 4I0PD 1MELA 2IBGA 2ZPKH 5TF0A 4XMLH 1G84A 1C5CL 4PGZA 3U9PL 3P4MB 4MA7L 3T77A 2B4CH 2BOCB 4JDZA 1LE5A 1CGVA 3GIVB 2P49B 4OCSH 2ICCA 2YHGA 1OF2A 5EPMA 5IESL 5IV2A 4RRPA 3VFPA 5C0IA 4OLXL 4YGVB 1ONQB 3QUYB 3KJ6H 5EIIA 1AGFA 4OQTL 3SE8L 4U49A 4NJ9L 5GS0H 3F8UB 3H3PL 2ADFH 5CHNA 3OKDB 2IBBA 3ARYA 2Z93B 1AXIB 4G43B 4Y5YC 5FV2A 3SGDH 1NGZB 5DJ6B 4CVUA 1DTUA 4HS3B 4RZCB 1GHFL 4LLDB 4M6OH 3G5VA 2K7QA 5I30H 1BQLH 1CZ8L 5CCKL 1YY8B 3UBXI 2X89D 3TT1H 4Y5YA 4OZIF 3MODL 5DJ0B 1MCQA 4PJXA 4ZDHB 2XY2A 4M93C 3FQTB 3CFCL 4HIXL 4S0TD 4DFHA 3UYOD 4HF5H 1Q9LB 3DV4A 2UZIL 3U36A 3DVFA 4FQHB 3MNVB 4I2XB 2AK4E 1GCFA 4ODVH 1DEDA 3QUMB 5BCAA 1FFOB 4X99A 1CG9A 3EGSA 4JKWA 4YXKL 3P0VH 4JRYD 1T0NB 5BRZE 1GOGA 4PYGA 5DFVC 4KTDL 4GKZA 3TO4D 1JNNH 3GSOA 5CUSL 3FQWB 4IM8A 3SDYL 3E0GA 1F90H 4MJIA 3E2HB 2AEWA 4ETQB 3J8F7 4F7EB 1YEIH 5J6HB 4XP9L 4HHAB 1MRFL 3V0WH 1P69B 1S7WA 2XQBL 4AEHL 5HHOE 2OTWB 1HOCA 3RPKA 2CK2A 2A38A 2EZ0C 3EO0A 3QG7H 4XZUB 5F9OH 5BVPH 4R0LC 1M7IA 1YUHB 3F7YA 1J8HB 5D1ZB 4R4ND 3U7WL 3WNNA 2GTZB 2HFFB 4QTIH 3BT2H 3QXDB 1W0VB 3RX8A 4X9BA 1U3HB 2NW3A 1KCRH 3A67L 1QBAA 3LEXB 4FTVE 1OAUL 4HLZH 2X7LB 2FH6A 3ZE2E 4MNQE 4V1DB 1AD9A 3H9YA 4P4RA 4IIQB 1T83A 3DUSB 3EOBB 1JGVH 4XPGH 5L2KD 3NFNB 4WU7A 2VIRA 4OFYD 1QVOA 5C0EA 5DQ9B 1YYML 4YC2B 3MTRA 3B6SB 1RUKH 3FFCD 1UWGL 5D1QB 4GRLC 4FXLA 1OLZA 1FL3A 2FGWH 5IEKB 1HH9A 1FNAA 3I6KB 3NCEB 4PRIB 1C7SA 5B38B 5C9JA 12E8H 2FHCA 4IOSD 4YHIB 2P5WE 1ODAA 4WHYH 3BMWA 4XPBH 3CH8A 3I6GA 3EJYC 1OL0A 2A9NL 4U0RB 4U1KA 1CGSL 4M8QA 2AV1A 2YD2A 3W0WD 1UB6A 3D0LA 3RTQA 3BSZH 4TTGA 1KIUA 2NXYC 2H2PD 1C16B 1FVCB 4FMFA 1XF4B 3QEQE 1LNUA 2EE6A 3S97C 1TCRB 3B2UD 3LKRA 1YNLL 2DL9A 3C5SA 2H8PB 1S78C 5FFLA 1EVTC 1JGEB 2NLJA 2AXFB 5IW3A 4RDQF 5GGRY 3UJJH 5C0CA 1P4IL 4LHUG 1JHLL 4OFVA 43CAB 1V3JA 2NNAB 2Y1VA 1OW0C 3MLVL 5I1JL 2E8ZA 1VSCA 1ZANL 1G7PA 4E5XB 1W8OA 2LU4A 3RWCB 4WEBL 1LO5B 5GRWA 4XBGA 4HH8A 5DGRA 5MEQB 4TTDD 3TEUA 4CVXB 5ADPL 5C6TH 4GG6F 3MV01 4Q58C 1E6OH 1WEJL 4MCZA 5CEZD 2OX5A 3O3AA 3WFHA 1EUTA 3BKYL 4JN1L 5FCUL 3PGFH 1OM3H 3FO1B 4ZAKC 2X42A 4KJPD 2XWJA 2R2CA 4IRSD 3MV7B 2BCKB 2C1OA 1N0LA 1S7XA 1MWAB 5EO9B 4HUWB 4G8GD 4BK5A 4WFHD 2DB8A 2F53A 4LF3B 1E0OB 4B53A 3O4LB 1JHTA 2W0LA 4QWWC 1MFDH 2YPLB 2HWZH 4CADA 4Y2DD 4HIHA 5BW7C 3TNNA 1NCNA 5JXED 4QYOA 5T3XE 1CDCA 3ZYOA 3G5YB 1S7TA 1N0XL 3F58H 3R1GH 2NW2A 5FGRA 4PB9L 1HHGA 1Q9KA 5KTEH 2HA1A 4LFHG 4L4VA 3KS0J 2GCYA 3BRDA 2W9EL 3BPLC 2EH8L 2X41A 3IF1B 4XCCL 1FIGH 4X8JA 1FJ1A 3HE7A 4Q74A 2Q1EA 3KYAA 2F54A 5L8KB 1U8QB 3MCLH 4KRPC 1WAAF 3B5HA 5JLZB 3VXQA 1AHWC 2OJEB 3CFEB 4V2BA 3NMEA 4FQPA 2VZSA 4DGIL 1PKOA 2DQJL 2AABL 4XAKD 3WJJA 5C6WH 1R5WA 5DD5L 1IEBB 3OAYH 3VFSA 3GKWL 5FYKU 5BV7C 7FABH 5I8OL 4HQQL 5KVDH 3FFCE 1T1WA 5A2KH 5FUCC 3V4UL 1AHWA 2APBA 5I18L 2Q7YB 3O0RL 4RIRA 3VRLF 3S96A 1E28A 5F9AC 2IPKB 4E41D 1Q9OA 2IFGA 4EVNA 4RBPH 4LCIL 1FL6A 4HULB 3CDGA 4I77H 2AEIT 4JCMA 2DQTH 4LHQB 4URTB 5CSZA 5F7FA 3LKSA 4YHLH 3W0WE 4YAQB 3VXSD 3CVHL 1PGRB 1P7KA 4MWFB 2BDNH 1R3HB 1XR8A 1DFBH 1V7MH 4YBLB 1MLCA 1U8NA 4DUXA 4EIGB 3PJSA 3PXHA 1EUUA 4YFLF 3OKEB 3T8XA 2A6KB 3L1OL 4NRZB 4HXBH 1G7LB 5H94A 1IARB 1NFKA 1GXEA 3VI4E 3PHOB 4J4PD 1KC5H 4IMLA 2DQHL 4HLJA 4UT6H 5KZCD 1UVQB 2X9XA 2CUMA 5IHZB 4Z8FH 4LRIA 3IT8D 4LHUA 1BZQK 3PDOB 5JUEH 1J5OL 1LILA 4LSQL 1BGXL 3GB7A 5C09A 1CR9L 4FXGB 4L29A 2CKBH 4PJ7A 3OJDB 2P48B 3D1MC 4GAYA 1VERA 3RWFA 2FATL 3KPMA 1YECH 2EIZA 5D7IA 3GFUA 2E27L 1UM4L 2K1MA 1B4JL 4HKXB 3OKYA 5JO5B 1GZQB 2NY0B 3SCMB 1AFVH 3V4VL 1CICA 4G6MH 4G9FD 2OQJA 3DYOA 3JV6B 4GMSH 4DTGH 3UTSD 4XCEA 1T2XA 4YBHA 2N7AA 1P5VA 3VJ6A 4XNUL 2O93L 4F15C 1EV2E 2AK4B 2H9GA 4ZYKB 5SWQA 3H9SE 5TDNB 1KIQA 4HPYH 4W4OC 1GIGL 3DUUA 2Y5TA 4C56B 4ODBD 2Q8AL 4EN3D 2XN9E 3BYYA 3QFJA 4NWTH 4HC1H 2YKLL 3SJVD 4YHZH 4ODHL 5HYSG 3W9DA 4W4OA 2E8YA 1X5IA 2IMMA 3KXFA 4J8RB 4PTUA 2VE6A 4LLUA 4AENB 5EWIH 1OGAA 3QG6A 2P47B 4KPHH 1NCBH 1T1XA 5JW4Q 5AYUL 3MR9A 1QYGH 4OCWH 4PJGF 2OTPA 4X98B 5I73B 4Z6AT 5DRWA 1A6AA 3MV9A 2EKSA 3F7VB 4MHHG 3N0PB 3TBSA 4ZUUA 5DLMH 5C71A 3VRIB 2YD9A 3PV6B 3L5XL 2KH2B 4MA8L 4FTVB 1FGNL 5HVWA 5CSGA 5DTFA 5D2NB 3LRGA 2WP3T 4MNQB 1OPGH 2EDKA 3G6AA 1UWXK 5D7JA 4PGCB 5HHVH 3QI9C 4N8CH 3SOBH 5ID0A 2FO1A 2H6PA 4NZUL 5ADOL 2RAMA 1F3DH 4RGOL 2BMKA 3ARRA 1JUFB 4NT6A 3TIEA 3QI9A 3RWJB 4GG8A 2NYYC 4NN6B 4C4KO 3EZ8A 1L0XA 4Z7UB 2CLVB 1I7ZA 4F57L 3IDYB 4QRTA 1RSFA 4UTBL 4PJIB 3LS5L 3TA3A 3RBSA 1DL7H 4I0PB 1SBSL 4M5ZH 4D0DB 5LWYH 2CIIB 2E7MA 3OR7B 5E8OA 2P5WB 4YHYC 1AXSB 1U3JA 4LSPL 3LIZH 2KL6A 2MFNA 4UIKL 5FXCH 5T33H 3MRKB 3WIHL 1MI5E 3FFDB 2DTML 3DSFH 4OM0H 3GSWA 3VWKC 1ZEAL 4MJID 3CCHA 4Q6YA 4NQDE 4FQLH 4Z7OE 1J0KA 3AB0B 1F97A 1WIUA 5MEPB 1EGJL 2LFGA 3C5ZC 2A74B 4Z0XA 3ZYIA 2GK2A 2PN5A 1TVBB 3GJFH 5EH1A 2VH5L 2I24N 4OUUB 5DQDL 5JZ7C 3RIAK 2B4CC 2PCPB 5C0BA 3ILQD 2EZ0D 4AL8L 3P2TA 5AZ2L 1NLDL 4MAYA 4WHYG 2XA8L 2R2HA 3H7BB 3ILPA 2ZUXA 1NFIA 1Q0YH 5EZOL 5T1KA 2J8UB 5IVZB 4ERSL 1T04A 4XMPH 2HFGL 5TH2B 4D9QD 4JRYB 5GS0C 4XNYH 4JY4A 4G80A 1MFBL 2O61B 1JN6A 5IMOB 1HHJA 3AS3A 4FG6C 4NRYB 5D96C 1NBYB 4PP1C 3V6OE 3WIFB 2GIYA 3DTXB 1A64A 3LRHA 1FYTA 2YC1B 3VD7A 3U30C 3EFFB 4WNQA 5HYSA 3BH9A 4O2FB 4LAJH 1KEGL 1KTDA 2EDQA 5HY9B 4OCRL 4YDVB 2P8LB 1G0XA 3WN5C 4RFEB 2D9QB 4X5WB 5EZJB 4K2UH 4PJEB 4ODXB 2DQGL 3QXVA 3EYOA 3QRGL 5FO7A 4NKMB 3VGHA 3RTQD 3DURB 1U8MB 1P7QB 3QH3A 4ZFOA 2GAZA 1H3PH 3I75B 1DR9A 1G7QA 5BS0E 1INEH 3BKJH 1UXSA 3D0VA 5ENWA 1I1RA 1NAKL 2A6IA 3GMOA 4FQJH 2H3NB 4WI9A 3S36X 1BD2E 4XNZB 1JF6A 5L2KB 4DKAA 4LMQE 4JAMB 2DM3A 4LK4A 4CW1B 5C0CD 1KIRB 2V7NB 5EOTB 1S78D 4M6AA 3FFCB 2VLJA 4YPJA 5GJSH 4S1QL 4P9HH 1FNSH 5IR1B 4UT9L 2QQQA 1CLOL 1I8MB 4D94A 1EEYA 1NC2A 3AFLA 3X3FL 3O41A 1G7IA 1PQZA 1EEUA 4BSWB 5GGQH 2XTJC 2CXKA 1A6TB 1DVFA 1SY6L 2DMKA 4DKEL 2FWOA 5JXAH 5ALCL 5E4EC 1WVZA 3BI9X 3IFPA 4HK0A 4U2YA 3TLRA 2FJFB 3W0WB 3OBAA 4YZFE 5EC1B 1VPOL 4ZAKD 3P4NA 2F53D 1WC7B 3DV6B 3LHPL 5D9SA 2VXUH 4D0CB 2FYYA 1T21B 2G75A 2ATPB 4P4KC 4ZSOE 4NNPH 1MVUB 2VISB 3IYLW 4MD4B 1C8PA 2R1WB 4I8DA 5F7UA 1K5NA 2EEAA 3LV3B 1QA9B 2AJXH 5BV7L 4QWWD 1KLFA 5BOZG 4ODUB 3L3GB 4HEME 2VSDA 4IJ3B 1RQ5A 2DDQL 4L4VD 3RHWF 2DRUA 3P77A 1KJVB 4NJAH 3OAUH 3MJGX 1RMFH 4HMDA 3WEXB 4DQOL 5BQ7B 2F54D 1JWUB 4QCIB 1NMBH 1IGIH 4PV9B 4GAFB 3MRLB 4K3EL 1HHKA 4WTXA 1WIOA 2HVJB 2P8PA 4N0RA 2R1YA 4LLYA 4PR5A 3GMQA 5H2BB 5GRJH 3ULVC 3Q6GL 1EO7A 3LD8B 4XXCA 4JE4B 4WV1B 4IRSB 4KRPD 3KPLA 1R0AH 5E94B 3ARTA 1CT8A 1P2CA 3QUXB 4G8GB 2J5LC 4MMXC 3BPOB 1OHQA 4NGHH 4UOJA 3V8OA 1MHEA 1QLFB 4FN0A 5F1NA 4XT1C 4XVTL 4PGBA 2C5DC 3RVUC 3R4DA 4Y2DB 1P4BL 2GYSA 2WIIB 4QRPA 4JEGB 1KCSL 4F7PA 5DUMH 1AC0A 3CLFH 3M8OL 4R2GD 2AW2A 3H9SB 3HLAA 4P99A 4AH2A 3U82B 3MRDA 3WCYA 3UMTA 4ODWA 2VWEC 5F3HB 2OJZL 3H0TB 2XN9B 1JFQH 3FB5B 1WTGT 1QLEH 5HI3C 1I7UA 4KKAC 3EAKA 1T7YA 2XY1A 5IMMA 1NFDF 4N9GB 1MFCH 1ZS8B 4FFYH 4GFTB 4LCUA 1NGYA 3UJTL 1MRCH 4HWEL 4P0DA 3QHZH 5GS2D 3ZKXB 2EDYA 3CPLA 3KPRA 5MI0B 5E6IA 3OGCA 3DO3A 4WUKL 1FORH 2OR9H 2EO9A 4PG9A 5DEGA 4WW1B 4M6MH 5L9DH 4HAFA 2Y36L 4HKBA 4UUJB 1X9QA 1OCWL 5I75C 4PD4K 4LHUD 3VI3E 2X4UB 4PJ5E 5KVFH 3G5XA 1Q1JH 1S7RB 5LQBL 2Q87A 3VXRA 4DZBA 1UB5B 1JRHH 5C09D 4AEIL 4D3CL 3MGOA 2V5TA 4E41B 5J57B 3KVQA 4Q9RL 1UA6L 1D6VH 4U1HA 1EPFA 2FD6L 4L8SC 5DJDA 2X44D 4HKJB 2BVQA 4W81A 1I4FA 4TSAL 2KQMA 5GRUL 1KXTB 2UVFA 1ES0B 1CICD 1IC5L 5I1GH 2X4OA 5INCB 1WK0A 2QEJA 4LU5L 2R4RH 4ZO7A 3CUPB 1I9JL 4OTXL 1DQQB 1CBVL 5CWSA 3GUTA 4GAGL 1QFOA 4PRPE 4JO1L 1NCAL 1MCOL 3IU4H 1PSKH 3IDXH 3LDBB 3ZE1E 1BBDL 2GTWB 1A7PL 1KXQE 2XWBB 3QFJD 2A9ML 3FB8B 4M1CC 2DLEA 4XWOC 4OIBA 1RZGA 5KZCB 3GRWH 4K3DH 3F12A 1BM3H 1N5YH 5KSBB 3LKOB 3IDGA 4P2YA 3KXFD 4LFHD 4BH7B 2IPUG 2XQYK 1VFBA 1RI8A 3DRTA 3DRQB 5JOPE 1OGAD 3G6DH 3OV6A 1TLKA 3ULSA 2D0FA 2X4QB 1MCEA 2Z31A 4TQEH 3D3VE 1CLZH 1DEEB 2IAMA 1XCQA 3OJ2C 2AJYH 2G2RA 3HFMH 3GSNL 3EJJX 4UDUA 3GBNH 1BOYA 35C8L 1VFAA 3NIDE 1U36A 4EI6B 4XWGH 1I8KB 2X1WL 3BKML 1D5BA 2VDLL 2D0HA 4XI5C 2EXYC 3ULUE 2X6MA 4G9FB 3O9WC 3R0MA 5D5ME 3UZEA 3UTSB 4NOBA 1HSAA 2A83B 3SDCC 1U91B 1A3LL 1WISA 4KMTL 3FRUB 4LSRH 1WBXA 5CILL 1T66D 5FUCE 3MROB 1HNGA 1UM6L 4GUPA 1AE6H 4KJWC 5D7JD 4JPKH 3EJZC 3ARVA 4YK4B 1U2HA 4GXUN 4LCYA 2MCPL 4Q0XL 5F9DC 3ARSA 1U8OB 1URLA 1I7RA 4CDHA 4JG0L 5IB4A 4U1NB 1TQCC 4MX7A 5DUBB 4PPTA 5F7WC 3QI9D 3C08H 2VDKL 1IQWL 3L9RA 5DWUH 3SE9H 2IG2H 1JTTA 2YWZA 2ZPKL 3DXAE 3WNKA 2JE8A 2B4CL 1EHAA 5K33A 3FTGA 4ZO6A 3TVMC 2VXTH 4XVUD 4OCSL 3LN4A 1OWWA 1OF2B 1MCWM 1H8SA 3ZYZA 3HA0A 5IV2B 3ARXA 3K4ZA 3VFPB 2GK0B 5BS0B 1I1AA 3TVMA 2LAGB 1INDL 3KJ6L 5EIIB 5EC2A 2VNCA 5CMAA 4L4JA 1AGFB 2NY5H 5GS0L 3V6ZA 2ADFL 5CHNB 1MFEL 1ZXQA 3HI6H 3LCYA 4HW6A 2EECA 1BD2B 3CXDH 4KH2A 5I30L 1BQLL 1YY9C 2I9LA 1FL5A 3QEGL 4PJ8A 3TT1L 5CKAA 4Y5YB 4A2MA 3C5ZD 2BC4A 3NPSC 5C0BD 4PJXB 2ZZUT 4NUGH 4HIEA 3D69B 4NQSA 5TF1H 4CVWA 1ULVA 2R56L 4MAYD 5JOFA 4OM1L 2ZOKA 4Z7VA 4HF5L 9CGTA 1NUFA 3D18A 4HDIB 4RQQB 5C0GB 5HGDA 1X5KA 2VC2H 5T1KD 2ZCLL 5DD1H 3HUJE 4NKOA 4M93B 5FYJH 1EMTH 4OZGE 1CG9B 3EGSB 3P0VL 3V0AC 5HHME 5IWLA 3CSPA 2HKHH 3DYMA 1ERNA 4GKZB 1JNNL 3GSOB 5D7SH 4P5MA 2WM0A 1F90L 5D2LA 1FYTD 4R7NA 3IB4A 4O51A 3ARQA 4MJIB 3QWQB 5GS0D 2NXZD 1BVKA 4WHDA 4ZSOB 4YHKH 1YEIL 1X3DA 1JTOA 1XF3B 3MRCA 3N85H 4LSDA 5C0AE 3NTCH 3KR3H 3V0WL 1S7WB 3PL6A 5CKGA 3QG7L 3EO0B 3SGKC 4S0SD 5BVPL 1JJUA 1JVKA 3F7YB 1K8DA 3RDTA 2UUDK 2OL3L 1M1SA 4POYA 4ZNEE 4QTIL 2ITDB 4QXGH 1KCRL 5E7FA 1CIDA 4R0LB 1OQOA 4EBQH 2YS4A 3MRIB 2ENSA 3P30H 3FO0H 1MJUH 4I18C 4OZFG 5IT2H 2RR3A 3RI5F 4R3SA 3QUKA 4P4RB 1V7NH 1ZE3C 1JGVL 3JWOH 1NMCC 4XPGL 2VTFA 1B9ZA 2VIRB 1QVOB 1BVLB 5C0EB 5DJZA 4XPAH 4I18A 4ELME 1RUKL 4PY8I 2FGZA 1VKXB 1QKZH 3T1FB 1OSZA 1FL3B 2FGWL 4PGDB 3GBMH 5E56A 2R2BA 1HH9B 3QCTL 4I3SH 1AJ7H 4LPTA 1NC2D 2XV6B 12E8L 2ZCKH 5C9JB 1GGUA 2AJ3B 2YPKA 4L3CB 4OGZA 4L4TA 2XXMB 1DVFD 4S2SB 3CXHK 3I6GB 4U1KB 5IJVB 1EHXA 4M8QB 4HH9A 2AV1B 3V2AR 2OR7A 1UB6B 4NQCA 2XTJD 3BSZL 4IEFB 4YXHH 1X5AA 3Q6FA 1P4LA 4PRBA 2CRMA 1QD0A 3S34H 3HZKA 6FABH 1LNUB 1WCBA 3GO1L 3ULVL 2V17H 3G6JA 5B21A 2NXYB 1S7QB 3C5SB 3UCRA 1SYSA 3QXWA 2HTLC 3VWJC 5ITFB 5C0CB 1MHCB 4PP2A 4ZG1A 1I85C 1F6AA 1LWRA 2H32H 3GHEL 2YBRA 3KWWA 3CFDB 1T4KB 5IW6A 3MLTA 4MCYA 1DUYA 1C1EH 1RK0A 5C6TL 2ADGA 3B3IB 4JFQA 1E6OL 2ED7A 4MCZB 2MMXA 5IBLC 3WFHB 3OKNA 3PGFL 1OM3L 1CTNA 3WUZA 4XP5H 3WYRA 3RWEA 2B2XL 2P7TA 5KSAA 2XWJB 5E99H 3LQAH 3HKFA 1BFTA 3RJDA 1QG3A 2C1OB 1SJXA 3MLYH 1S7XB 3CLEL 2WWKT 4ZAKB 2F53B 4X4ME 1KT2A 1FDLH 3ARGC 1JHTB 3B9AA 1MFDL 2HWZL 5KOMC 2APTA 1RJLB 4CADB 2K9UA 4OGXH 1U93A 2ZUQB 4QRPD 3TNNB 5DS8A 4P9HC 4QYOB 2W65A 3O2WH 3ESUF 3ARGA 4PJBE 1S7TB 2QKIA 4HCRA 4LSVL 2FIRT 3F58L 3R1GL 3RVUD 5IB2A 2A6DA 1Q9KB 3K3QA 4XAWL 5KTEL 3IDIA 1WFOA 2GCYB 5BVJA 1FIGL 3DHMA 5KVGH 3LPFA 5EIQA 3OMZA 5MENA 2F54B 4B7LA 3O2DH 2PYEA 3KPRD 3MCLL 5E6ID 4A6YH 4RISH 3BPLB 4XHJD 3D3VB 3TH2T 3VXQB 4XNQB 3E1F1 4OZFA 1FE8L 2J3SA 4FP8H 1X5YA 3RGHA 3TFKD 2D7TL 2HMID 1R5WB 5CIPH 4KRPB 7FABL 5KVDL 1YN6B 1JNLH 3ARBC 3VFSB 1FQ9C 1T1WB 1D5ZA 4DVBA 1AHWB 1KEML 5IMLA 3VXRD 4RIRB 3S96B 5D5MB 3V7AE 4B5EA 4MNHB 1OB1A 3T3ME 1Q9OB 4J3SA 5ISZE 5BV7B 4L3AA 5I1CH 1IRAY 1FL6B 4R2GB 4I77L 5DC0A 4CAGA 3CDGB 2DQTL 1MFAH 4O00A 5CSZB 1RAMA 4YHLL 2AV7B 5BMFH 1HHIA 3TBTA 5T5NF 1D3CA 5DT1H 2O5YH 2XTJE 4PGJA 4Z7UF 2DWEB 1V7ML 1XR8B 4IS6A 2Z91A 3HRZA 4PJIF 1MLCB 4M7LH 1VEOA 2QQKH 4LLWA 3PJSB 2WAHA 3DXAB 2VZVA 1BZ9A 1P9MC 5CLWA 1YQ2A 5CGYD 4GJTB 3T8XB 3MA7B 2XOTA 4LKCA 4HXBL 2E6QA 5HHNA 2L0DA 5DI8A 3P9MB 4BJLA 1KC5L 4BFIA 4UT6L 4IMLB 4TN9A 1FZJA 4Z18A 4Z8FL 1J1PH 2CUIA 4LHUB 2CJUH 1UZ6E 4N5EC 2IPUK 3LKPA 2D7OA 2V7HA 4M1CD 4OFIA 4KRNA 3OKKB 4IRZH 5C09B 4AEEA 3UAJD 3THMH 3ZTNL 5DJ8A 2CKBL 4L29B 5INDA 1DUZA 3QIBC 4J1UB 3F5WA 1GGIL 2Z31D 4JM2A 3RWFB 4I9WE 2BNRE 3G08B 2IAMD 1YECL 3KPMB 2EIZB 5D7IB 2R1XA 2BZDA 2V5SA 5IFHH 3IDNB 3MJ9A 2VZ1A 4S1DC 5FUZH 1S9KC 5F1OB 2DKSA 2ZP0T 3PWVB 1AFVL 2XYCA 2WP3O 5KANG 1CICB 4M48L 5C70A 3RKDD 4LEOA 3ULVE 1EFXA 4GMSL 4DTGL 4HUKB 3GMLA 4XCEB 2YK1H 2F15A 2J8UF 4MS8D 4NQUA 3DGGA 4XI5D 2QL1A 2EIEA 4C58B 4OBSA 5F7LB 5SWQB 3IJHB 4HPYL 4JHWH 3F6LA 3O9WD 2FH8A 4OZGB 2Y5TB 1R3LA 4JFDA 3SDCD 4NWTL 4HC1L 5C9KA 4OAWA 4KJWD 3EJZD 4YE4L 1RURH 3W9DB 3RIFF 1HH6B 3KXFB 4PTUB 3GJFK 2WWMC 3MJ8A 4M6NH 4QRUA 3T0WA 5J3HD 4LKXA 1K4DB 1OGAB 3QG6B 4KPHL 5C0AB 1E6JH 2HG5A 1T1XB 4M5YH 3U7YH 1QYGL 3MR9B 3AVEA 4FS0A 5IQ7H 2EKSB 4PJEF 5IW1A 3W11C 3HAEH 3TBSB 2GSIA 4ZUUB 1YC8A 2VN7A 4MVBD 3V95A 2AP2A 1TQBC 2FJHB 3I6LD 5KS9E 1I1AD 3TVMD 5AD0A 4JG1H 3EO1A 3BGAA 4KK6C 1N3NA 5HVHC 5DTFB 1JYVA 3ROOA 1WUNT 2J1KA 1OPGL 2WW8A 5JORA 1ETZA 3G6AB 1J1XH 5D7JB 1A1MA 4JN2A 5HHVL 3SOBL 4ETYA 3TCLA 2H6PB 1AQDA 1FFQA 1G9EA 3MFFB 4PJ8D 3LH2L 2NTFA 3D39A 4JRWA 4ZODA 2BVYA 4ELMB 1T5XA 2BMKB 2CH8A 1MCSA 3W39A 2DIBA 3TIEB 3P9LA 3QI9B 1A9EB 1QTYT 1YY9D 1I7ZB 5CP3A 3VXUE 3VRJA 2VJXA 4YXLH 4Y5VC 4M5ZL 1BQSA 5LWYL 4AK1A 3ZMRA 4P49A 3BQUA 4X7CC 3PUCA 5E8OB 5C0RH 3PQYA 2GUOA 5IHBA 2XZCH 1S9WB 2W92A 5FB8A 3GSNB 4ZPVA 2P24A 3LIZL 5K9QG 4Y5VA 2ZG3A 3W2DH 3BO8B 5T33L 4D9LH 4M8VA 3CH1A 5A3IC 3DSFL 2VMFA 2NZIA 4OM0L 4XCFH 3GSWB 4XGZB 1G1CA 1MNUH 4WRLA 3L3JA 2HT3C 2PYFB 4Z95H 1DLFL 4FQLL 1CL7I 3KPOA 3VWKB 4PBVC 2YOCA 3MV8A 4Z0XB 5IGXL 2Y23A 1JL8A 2YD1A 3MBEC 3CX2A 3KJ4C 3M17A 3VI4F 1IGCH 3RDTD 5C8JB 3ZKQD 3LQZA 3PWJA 3C5ZB 2F74A 1JTPA 1FG9C 3K4DA 1LDSA 5F1KC 4EKXA 2B1AH 4QGYA 1LVEA 2R2HB 3ILPB 2JCCE 1NFIB 2HH0H 2D0GA 5T1KB 3CFBA 4XMPL 1TJGH 1T04B 4O5LH 1NL0L 2NY5C 4I3GA 3B83A 4GRWB 1JN6B 1HHJB 4FFWD 4R6UA 5DJYA 1EBAA 1FP5A 1F8TH 2E7LC 4NM8H 2VLKA 4KI5D 5HYSB 2NXZB 1ZKAA 3LS4H 3RVXD 3OPZH 3V5HA 1KTDB 2X1QA 3NAAH 5D96B 4YDLC 3S7GA 1VGEL 5F6HJ 1KFAH 3BWUC 4L4TD 3RNQA 3U30B 1JZ2A 4PJBB 2XZZA 5DK2B 1GZPB 4K2UL 3ARWA 3QCVH 1UWEH 3VXMA 3EYOB 3N1FC 1QPXA 5FO7B 4NQCD 2WLYA 3WN5B 1AGDA 3VE0A 3WKMH 3QH3B 4ZFOB 2GAZB 3B5GA 4KVCL 5DFTA 1INEL 3LQMA 4NC0B 3RX7A 3BKJL 3KLSA 2R29H 3D0VB 3DLQR 5TPWH 1OP3H 4P23A 1DBBH 2CQVA 1MCKA 2A6IB 4FQJL 4RMUA 2DKMA 5FOBA 4X7DC 2Q8BH 4ORZC 4FXKB 2DTSA 1HN1A 4GH7B 3GMPA 1A6UH 1OP9A 5D7KD 5GJSL 3VWJD 3ECBB 4FZ8H 4P9HL 43C9A 4EUPH 2P42B 1FNSL 2HT4D 5L88H 1LE9A 1M71B 3ZDXE 1EEYB 1HI6A 3O3DB 3D85A 1PQZB 4LLVA 5GGQL 4WWID 5JXAL 25C8H 2FWOB 4HFWB 1CFQB 4PLKC 4HK0B 3VDAA 2APXA 4OI9A 1E4WH 3QDME 5IBLD 1IBGL 3JWOC 1YYLH 2D31A 2XTJB 3P4NB 5D9SB 2VXUL 3MNWA 5E4EB 2FYYB 1RZ8A 2G75B 4NNPL 1Y6MR 1HQRA 4MXWH 4TUJB 4C55A 1K5NB 2KKQA 2I9TA 2AJXL 3ARGD 1GPOL 4MA1C 2VABA 5I66B 4P4KB 1UH3A 3KPTA 2EE9A 3LN5A 5EFIA 5KSBF 3KLDA 5DMJB 5BO1H 4NJAL 4BH8B 3OAUL 2EE2A 1RMFL 5LGHH 3S36L 5I9QC 1A1NA 4F58H 2HYMA 2BVOA 2OR8A 5MEND 5EO0A 5FO8B 2PYED 3UROR 3IKCA 3MOBH 1VCAA 5D8JL 3EYQD 1FRGH 5D6DA 4KUCD 1HHKB 4NO2A 2P8PB 4OLZL 2R1YB 1EVUA 4KJQC 4LLYB 4ONHA 4PR5B 3GMQB 4MDJB 5GRJL 1LEGA 4LAQH 4K71C 3QJFB 3DX8A 3MUHL 4FZEH 1CT8B 1UEMA 3WFZA 2DKUA 1MUJA 4NGHL 2DWDB 5EOCL 4PG2C 4X6CA 4YBQD 4M43L 5F1NB 2AJUH 4PGBB 3ARBD 3OHXA 1WWBX 4QRPB 3CLFL 2J5LB 1UG9A 1MAKA 1G6RL 1U8HB 3HLAB 4PG2A 1XF5A 4HAGA 5EU6E 4ODWB 4JGJA 4WEMB 1JFQL 2H32A 1YEKH 1QLEL 3TP4A 1I7UB 3VGBA 3GZKA 3W81A