4ZUSB

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusB00
2NY4C 4JDVB 4JVUA 4M6OH 3NFNB 2QKIB 2OR9L 3RQ3A 3BRGC 2F53A 4XTRD 1I8IA 3KYMA 3BDYL 5L88L 1IM9A 5DHVB 5L2KD 3X3FH 1AIFA 4N0UA 2XN9B 3WIFB 4PJXA 1WUNT 3LEYH 3OJVC 4DUVA 3MGOB 4KJQD 3ULUF 3WO4B 1NBVH 2DJSA 1AR1D 3P9LB 1P4BL 4NQDE 3M8OL 3QJFB 1CE1H 3QJHB 3IDNA 4PJFA 2EICA 2R9HC 4E9LA 3QZWB 4JFYA 1FNSH 5LG1A 2IH3A 3ZKXB 3MC0A 4NGHL 1MCPL 1SJXA 1XGTB 2CMRL 4UILL 1NMCC 2DQHL 1KF9B 4Y4FC 4TNWK 4H26B 1WK0A 2X89A 3STLA 4EI5B 3L6FB 1A6TA 1MFDL 4JB9L 3DGCR 4LSVL 5DJCA 4KKBD 1OLLA 4XCFH 2YZ8A 2BSRA 4Q2ZA 4DKEH 1E28B 3BKJH 5BV7B 4ELKA 2ZNXA 4G6KL 1L9NA 4OGXH 3NABH 3G5VA 4JZJB 4Z7VF 1U95A 2HFFB 3D18B 2YD8A 3ZT5A 1T3FB 1R5VB 4PLJC 4NSKB 2IG2L 5IQ9A 3L3DB 3INUL 4PBXA 4CVWA 3QNXA 1L7TL 3S88H 4TVSa 2YD1A 4PG2A 4QRUA 4JZOB 1T7WA 2DLIA 4PD4J 2H3NB 1FCCA 4XXDB 5JXAL 2DQEL 5E1AB 1U41A 1GZPB 5ICYA 1QQDB 2B1AH 2DWDA 3SQOL 3OG4B 1BVZA 1YUHA 1TQBC 3CSBA 1DQJA 3S37H 3SDAA 5EBLB 2YXMA 1AY1L 2HJKB 1ZLUK 1BREA 2FHFA 5C2BH 4KDWA 3KR3H 3EFFA 4F7EB 2EYRA 4R4BB 1FAKT 4KDTC 5DLMH 1W0WA 5HJ3B 3FCTA 1O0VA 1CTOA 4E5XB 2FBJH 1FJ1B 3O45A 2EIDA 1SYSB 5FDYA 3FT2A 1Y0LB 5I0DA 4QCIA 3LS4H 5D2NE 1YMHB 5C7XH 2IANE 4LASL 1A6ZB 2QADC 3VDAA 1IFHH 3V6ZA 2X4NB 4QRSB 2HJLB 4FQJL 5T3XH 3ARZA 5AZ2L 4JFEA 2BCKB 1D5BB 3HNVH 1VEOA 2FIRT 4TQEH 4LEOA 5EC1B 1WQVT 2ZCKH 4LVNB 3AB0C 3QPQD 4YGVA 3HC0A 4WU7A 1UXSB 1RMFL 4WFFE 4N9OB 4PLOB 1LDPH 4DZ8A 3PJSB 4PREB 5DJ2B 4HJ0C 1MRDH 3X3GH 2P47B 2CKNA 3HMWH 3LSOA 3FAWA 4EBQH 3KDMB 5D96B 1E27B 4K71C 4FG6D 2GAZA 4MJ6B 4MS8D 5KZCB 2JTDA 3H7BA 3PWJB 1JHTA 2GT9B 4XCCL 4H1LG 2PYFB 1JYWA 5DWUL 3EJYD 2GK0A 1XCTA 3SDYL 1OTTC 1ONQB 4I3RL 3VFUA 5IFAH 1X5GA 4RGND 3HMXH 5E4EC 1RY7B 1RIVL 4QT5B 3QFJB 3WL9A 3NN8A 4H20H 1TFHA 1EVTC 2HWZH 3UTQB 4MHHI 3NCJH 1EHNA 5B22A 4MA3A 1NANH 3AREA 1Q0YH 2MCPH 4V1DE 4MB4A 1EEUA 5HYEA 5F1IA 5TE7L 1NC2B 2Q8BL 4LPYA 3T0EA 2ESVD 4XI5C 4B5EA 4ONHB 2CK2A 5KOVC 5TH2B 3TFKC 1K5NA 2MKWA 2DQTL 3U6RA 5C3LD 3G04A 3ARFB 3RZCA 3DVIA 2FWOA 2ICCA 5LGJB 2CLRA 2J4WL 2LU3A 2PCPA 4PGDB 2VDNH 4U1HA 4IOFC 2M26A 2DN7A 4OT1L 2YZ1A 3QIUD 1X4ZA 5E56A 4HLZH 2NR6D 1NSNL 4ODXA 3Q5TA 2D7OA 4BZYA 4G8FB 5F8RC 1CL7L 3KPNB 1LE9B 1GL4B 5I1GH 3QQ3A 4PJ7A 4Z0XA 3PWUB 3GRWL 2C1OB 1JHLL 1JZ8A 3RWIB 4D9QE 4MNHA 4AEHH 5JORA 4IHOA 1GGUA 3ULSA 5DD6A 1P84K 3KPRB 4R26H 1KOAA 4LIQL 1NCDL 3GBNL 4RDQG 1UA6L 4GXVH 5FA3A 4JG0L 3L5XL 1KJ2B 4TUJA 1MI5A 5KAQF 4TUOB 3P40A 1ADQL 1T1YA 4NKMA 4NRXB 1WITA 4YDVB 4PJGA 4BQCA 1WC7B 3E6FB 2P7TB 1HDMB 1HIML 4OZHF 1GGTA 2WAHA 2Z8RA 3VFOA 2B8OT 2NY2D 4HWEH 1AXSB 2PO6B 5JXEC 3BKCH 4CU6A 25C8H 4UT9H 1A6WL 4G7YL 1JGEB 4NOFA 3RWHA 1MRCL 1XF1A 5HYSA 3U4EB 3BKYH 3N9GL 5L0QC 3BQUD 3MLTB 2VDMH 4UNTA 4IDJL 3WNMA 2VDQH 1XF5A 4TSBL 3QXVA 4YPJA 1RI8A 5KANI 1NFIB 4ENED 2DTSA 2HTKC 1KB9K 1UCTA 2NW2B 5KS9E 1KJ3L 1X9QA 5D1XB 3REWA 1KIPA 4K7PH 3SDXB 3AMLA 5FHAH 3ARBB 3WFCL 4BQ9A 1A7NL 1T21A 1YNTA 5TDOB 5DEGB 1CXIA 2HLFD 5C07E 4HIJA 4ZG1A 4AEFA 2XOTA 4JFDB 3VXUA 3H42H 1ZA3B 2LABA 1LWRA 3GSWB 3P11L 3K2UH 1XIWA 4PJIA 3QUYA 2DICA 2PW2A 2FIKB 4PRHB 4HKZB 4PJ9A 4MB3A 3GSNH 4LSUL 5BOPA 4YIQA 1A3LL 3IKCB 3G5ZB 5JPNA 3FRPG 3QO0A 4X4YA 3MV8B 1NCAL 1BD2E 3RX5A 4TVPL 3H7LA 1H3VA 4JGJA 1SJEA 4YXLL 5FGRA 3FB6A 4M6ML 2VJXA 3CDGA 4P2QB 4ZS7L 3ZE1E 2ZPKH 3ZHDA 2NY3D 5DJAB 4ORGB 1GPOL 3CH1A 1TNNA 3CC5B 5D8JL 3ZHKA 4KRPD 4L4TA 5EA0H 4H1LB 2GJZB 1F8TL 2HN7B 3F7VA 2EE3A 3H3PH 5T3XE 4DAGH 1CFVH 3QUKA 5DRZB 2YKLH 1U93A 5FOBB 4OTXL 5I2IA 1G7QB 2XWJA 3BKML 4WFGD 2HVKB 4HGKC 2CKBA 3AMKA 1ORQA 2IALA 2NY4B 1AGEA 2NQCA 4N1HB 1AXTL 2BVEA 4RRPG 4S0SD 1CL7I 5FXCH 5GISL 2FR4B 4OLXH 3MRMB 4GG6A 2A0LC 4LLQB 4Y89A 2P8MB 1NPUA 1MSPA 3RL2A 1K2DA 4JDZA 4IEFB 1YYML 3FQXB 1QUNA 3BWUC 4LRNL 2UWEA 5F7KC 4YK4C 4F58H 4QRRD 3SGDH 5LKNA 1HI6A 2VISA 3QDJE 4XB8A 3HI1B 5BS0E 3VFTA 5DURD 4XCEB 4M1DH 4ZYKB 3WXVH 1F11A 3WIIH 1FVEB 1J11A 2UY7A 4Q97A 5F96H 5IKCA 12E8H 3OPZH 1RV6X 3SKNA 3NH7H 5EIIB 3JV4A 1AFVH 2YD7A 3BN9C 3OAUL 4UU9B 1N7MH 1NMCB 1I9EA 4RQQA 4X8XA 2FLBT 1CFSB 5CKAA 1JGUL 3EGSB 5TQ2L 4OD3H 3WNPA 2ADIB 3HE7C 1MLCA 5EBWA 5IBLC 3MBEB 1T20B 4HGMA 2D9QB 3RKDC 1WAAF 2GQHA 5I17B 2A2QT 1G7MB 3VW3L 1A9BB 5BVJB 3P0YH 3CUPA 3MFFA 4LCWA 1IAOB 2Y5TB 4RMRA 4P5TB 4JVPA 5EOCL 5EO0B 4AENA 4PJCF 3SHSA 1X44A 3TM6A 4J8RB 3SPVB 2DQUH 1CGVA 2EXWD 5HY9B 2XRAH 3RWEB 1HNFA 4LHUG 5DJDB 1EAPB 4FNLH 3WJLC 2AV1A 2EDTA 5BRZD 1JNJA 4RFOH 1XAUA 4LLWA 1LK3H 2AAVA 3G6DH 4HHAA 4QHKI 1EGJA 2Y1VA 1HILA 4KI5E 1G7IB 4MSWA 1H3TA 3DYMA 2OZ4L 5C0EA 4AM0A 3MRRB 1CU4H 5TF1L 1WWWX 4G8IB 2JJTC 1MJJA 5D7SH 2HTLD 4PGBA 2ZCHL 5GGTA 1EEYA 2B4CH 3ZYIA 4OI7A 3MODH 1KIQA 4S1DD 5CHNB 1UH2A 2E7HA 2F5BL 2OYPA 1N26A 1BZQK 2H26B 1RVFH 3T0BA 4YUEH 3QEGH 5I1DA 4OZ4A 3KPPB 1BQLL 4HC1H 3WJLA 1XH3A 3SCMC 4ZXBA 1MEXL 4H0GA 1I8MB 1U0QA 4I0KA 3HNSH 4D0CB 1FH5H 4IOSD 2CXKA 1FL5B 1QSFD 3WNKA 5EUKA 3ALWA 5FKAA 1Q0XH 3MRDA 3SDDC 3MRBA 4S2SB 4I9WE 1XZ0B 1JV5A 4HUKB 5J9PB 3OB0H 5K33A 2LU7A 3KPQB 1LP9A 4QGYA 4Y4KC 3TT1L 4L8BB 1F13A 3BZ4A 4PJAF 2OL3A 5I8KL 5IHZB 2DI8A 1QRNA 4GT7A 4J3UA 4NUGL 5GZOD 3JWDH 2VXSL 3TBVA 5TF0A 1IBGL 1Q9KB 5I8CA 1H3GA 4Z6AT 2H45A 2ZOLB 2P8PA 4BZ1H 3TVMD 3RAJH 5EIQA 4JRXE 1H15A 1KTRL 4K3HA 1UB6B 1OSZA 4GW5A 4K71B 4PRIB 3MREB 1BM3H 4NHCH 3BSZH 4X8JB 5IVOA 3AFLA 3WIHH 1G7LA 4S1SL 3LKNA 4BH8B 4WW2C 4LEXL 2QHLA 4R6UA 4O02H 4ZOAA 3PHSA 5LGKA 1KPRA 3BI9X 3MLVL 1HE7A 4MXQD 3AAZA 4L9DA 1A6PA 1C1EH 3RL1A 1WGOA 3GMPB 4J3VA 2W38A 3THML 3ZE2E 4WFHD 3UBXG 4J6RL 4Y2DC 4XCYB 2ZJSL 1S7SA 4IDLA 3S35L 4NQDA 1S5HB 1KB5B 2R0WL 2RHEA 4JKLA 3BP4B 5FM5M 1JWSA 4AMKL 4LPTA 4LPVA 1YQVH 4LCUA 1HHJA 4K3EH 2G5BA 3UC0H 3ULVH 3JWOL 3H0TB 5D6CB 3KJ6H 1TPXC 2AK4D 1RZIB 5GZND 4JPIB 2O5ZL 3CAFA 5E7FA 2BHYA 5I1KH 3O6FD 1BMGA 5IQ7H 2J3SA 4OZFG 2BNRD 3MOBH 4ZPTB 1JGVL 1WCBA 3BP5B 4HK3N 3VH8A 3CDYA 1QR4A 3QFDA 1J10A 3G6AA 3I02A 4PJFF 4KUCF 4FQLH 2IC2A 4M62H 3T4AB 3BEVA 3WFDL 4X7CC 1R3JA 1A4KB 2FD6L 5GJTL 1F4WH 5KW9L 4MX7B 1DVFA 1I7RB 1QVOA 3FFCB 2E6JA 1OY3B 4L8CA 1JVKA 3FB8A 3TH3T 4X6DF 4JM2C 4LHUB 3ROLA 2A6KA 4K94H 1MIMH 1QBMH 2VABA 5HHMB 1IGTA 3CFBA 3UCRA 3OKLB 4HWBA 1TJIH 3FMGH 2J5LC 4LPUA 5D2NC 4E41A 3LPFA 2CLZA 2F54E 4GBXA 2OP4H 3WE6B 1I1RA 5ECJE 3IDGB 4ZUUB 3QQ4B 1VADA 5GGVH 4CVXA 1ZANL 2HFTA 4NM4H 1G7HB 3KXFB 2VC2L 1INEH 5L0QB 4U1GC 3C08H 4IIQB 4U1NB 4JHWL 5D1ZB 4M8VA 4URTB 5IB5B 4KK6D 4BFEA 2CRIA 4XPFH 2P44B 3TV3L 1E4XH 1T2JA 4XAWH 4X99B 3OGOE 4IRSB 1JPGA 1DP0A 3TN0D 4M8QB 4Z7QE 3EYVA 3UTTA 1MCNA 2MFNA 5D2NA 3IDIA 1KN4L 2CDFB 4OZIF 2LAGB 5EZIL 3LKQA 4YDIH 5F44A 1JZ7A 3MV01 4HF5L 3VA6A 1WV7T 2WWKT 5KG9B 2Q86B 2OJEA 4FXKB 4M4PA 5DJYA 5J57B 2K1MA 4OCWH 5KSUB 2DIAA 1UFUA 3CFIC 3OKEB 2FX8H 3FZUC 4JDVA 2ZSVB 4IOIB 1T03H 4OZGB 5GRUH 2WINB 5DEFB 2Y4SA 3FT4A 4L4VA 4NC1C 3TNMA 2A74B 3CSPA 3U46B 1HH9B 1EEZB 3IS1X 1YA5A 2EDWA 2VXQH 3OL2A 3CVHA 1W72L 4APQC 3MGOA 4XBPA 4O9HL 3WYRA 2J8UE 1K8IA 2FDBP 3BUYA 4DN4H 4UIKH 3OR6A 2AXGB 1CXHA 3S97C 2O5XH 1A5FH 4UT6L 5FGBA 4LOUC 5DQ9B 1ACYL 1HWHB 1J0JA 2Y36L 4H25B 1RPQA 5IBTH 5IUSA 4KK5D 3VWKC 1WIOA 2R0KH 2PO6D 2WBJC 4OCYH 4ONFH 3ZE0F 2I60H 4P5MA 1ZHBB 2VLLA 3UBXB 1Z3GL 1QR1A 1NGXA 4Q7DA 1G6RL 4QXUL 4R97C 5D2LA 4JAMA 2LVEA 4GRWF 2FLRT 2NYYC 4LLDB 4NZRH 5ISZB 1QFHA 1BPVA 5HD8D 3CU1A 4YK4B 3V0WH 4OJFL 4Z95L 1T04B 4K2UL 1CBVL 3MOAL 3OF6A 4FP8H 3SO3B 1DBKH 1HYRC 5B4MD 4KKLC 3O6ML 5F21B 4WHTB 3P0VH 4QWWC 1CLYL 2EDLA 1DCLA 4HH9A 4YHLH 4OZFB 3F7PC 2O26U 4RBPH 5IEKA 5DJ8B 2OR9H 3RRQA 3PV7A 3DHMA 3HE7B 3QUXB 5E2TH 5E8EB 5C0FB 4HD9A 4KVCH 1FYTA 2F53D 5IVXF 2R69L 2FX7L 2X4SA 4Y19E 1NGZB 2BNUA 2ADGA 3NIFF 5DR5L 1BWWA 1P4BH 4U1KB 3M8OH 4N9GB 3DROA 1MCRA 3CFCL 5T3ZL 4PLKC 4MD0A 5DA4A 2HJKA 3EDEA 1HWGB 1FO0L 3W2DL 4O51B 4LGSB 2P5WB 4NGHH 5EN2B 3IJHB 1QLEL 3MTRA 4YGAB 5I76B 5HJ3A 5DI8A 3N1FC 2P48B 2DQHH 4YHML 1EJOL 3EO0A 2HRLA 3KLAA 3OXRB 1MFDH 4PBVC 4JJ5B 1CDUA 4QRTB 2EH8H 4NO5A 5CD5D 4JPKH 5GXBB 4KRNA 4EOWL 1VFBA 3O41B 1UQSA 1H3PL 2ADJB 5FAAA 3RWFA 1EX0A 5FUCE 1IEAA 2KQMA 3FQRB 5D71H 1A6ZA 4G6KH 4E0RA 1YEKH 2HJLA 1MWAB 2BXZA 2R2BB 3MO1A 1H9VA 2WNGA 2ID5A 4LGPB 3GEWB 4PJGF 4HUXB 5F3HA 4HAFA 1TCRA 3INUH 3CMOL 1FFPB 9CGTA 2R9HD 5DEZA 5L8KB 3REVB 4L8SC 2A38A 2BZDA 4NRZA 2AK1L 3LH2L 3QDGA 4PJDB 3TPKA 3SCMB 1WICA 2VITA 4YC2C 2JB5L 5B38G 4Y4FD 1E27A 4MJ6A 3RGVC 3VI4E 1PZ5B 3GSVB 2H41A 3NFPB 2DQEH 2PYFA 4HIXL 5F8QC 3SDDB 1UCBL 5FM8A 3V5KA 5IW1A 4YHOL 1UVQB 4QXTB 4RNRB 3DX8B 2P45B 1G84A 4Y4KB 3MRPB 1QBAA 4AL8L 1OD7A 4Y5VC 2H9GB 4G6AC 1AO7A 1MELA 3D6GA 4CNIB 1ZHKA 4PJHF 3SDAD 1VHPA 4GQ9L 4TSCL 3VCLB 4L8SA 2IAMC 3MNZB 4DJMA 5KSBF 3O2WL 3T8XA 1M7IB 4OKVB 4Q9CA 1NC2A 1OAQL 2UY6A 2JIXB 3P9WB 4NQXA 1OF2A 4M00A 3W0WE 1NUNB 1INQA 2ZP0T 4WV1C 1NDMA 2W0PA 3EOTL 4LASH 4R2GD 1A6AB 4ZFZB 4Y5YC 3NCBB 1KXTB 1QYGL 1WBZA 2BSTA 4HJJL 4EN3C 3W5NA 1UKSA 3UYRL 2Y6SC 3Q6FB 1RURH 4JFED 5ICZA 2R23B 3PP4L 4HGWB 4NNPL 3BW9B 2NZ9C 4Y2DB 1RMFH 3I6GA 4JANB 2ZKHL 3BD5A 2JB6A 2IAMA 4Q0XL 3KPNA 1FNGB 4PTTA 4Y1AD 4QNPF 1OB1B 4HZLB 4X4XB 3H9SE 4WHCA 1VB9A 5SWQB 5HGDA 4XCCH 4LCYA 3E6HA 3DURB 3MRJB 5C0JA 4GG6F 4QXWA 3SDYH 4WV1A 2EEAA 4W4OA 2IADA 1DLHB 3MCKA 3QCTL 4O2EB 1TPXB 4ZFOA 1QPPA 3RVUD 2DD8L 3ZKNC 1OP9A 2QADD 4C59B 4MJIE 2UWEF 5K59F 3FHAA 5E6IA 5DD3H 4KI5C 5EU4B 1A21A 4JHBA 2VLJD 3SE9L 1JNLH 2QQKL 1U8OA 4MNGB 4DTGH 3BAEL 4DZBB 3DX6A 3GMQB 2CXGA 5DQJB 4Z7WA 4FFYH 2VZUA 5INCA 4HJ0D 5GRWA 2Q8BH 1W8NA 4JO2L 3BXNB 4Q9QL 3VXSE 4X0KB 4IMKA 3HS0B 3BWAA 1QA9B 2X4PA 1Z9OA 1RUKH 2WP3O 1L6ZA 2JF1A 5HYQB 4RFEA 2RAMA 1XGRB 1JE6A 3SDXA 3F7YB 1OTTD 3GBLA 2J4WH 2J5LB 2FHCA 1ETZA 5GGVY 4OFIA 4YX2L 1IGJA 1QNZH 2IANB 3ZYZA 3RTQC 2J8OA 2UYLB 1HH6A 1IC1A 3ARDA 1S5IL 4FXLA 1VFOA 4F8TA 3RWGB 3O3BB 2ORBL 3M1BB 4PV9A 5HYJE 1FG2B 2R1YA 4YXHL 4K3JL 5IHUL 2VDKL 3GRWH 4U1GB 2V5MA 1JHLH 4NZJA 2DQDL 4S11A 4WWKA 4N1EA 1MVUA 5B3JE 4QTHB 2RCSL 4U6HB 1IARB 5CP7A 5HDQL 1UJ3C 2HFGH 4LIQH 1NCDH 3OKKA 1N5YL 1S7QA 1UA6H 4XI5D 3D85D 4JZNB 5JW3L 3L5XH 4P2QA 3T08A 1K6QL 1D9KB 1RZJC 3DHJA 5B38B 3SGJC 3GSXA 5EZJB 5ITFB 3IGAA 5CIPA 1MI5D 1BZ7B 4XPAL 3CC5A 1BGXH 1KPUB 1GXEA 3RTQA 1G9MC 1HIMH 4JM4L 1CD1B 5BJTB 3L9RB 2X44D 5HYIA 1GRWA 1A6WH 1LK2B 5GGUB 1DBJL 3UMTA 1MRCH 4X5XB 4RISL 3N9GH 4RGOH 4D9RE 3C60C 4XNXH 4IDJH 3L5IA 1KNOB 3MRMA 4XP6L 2FB4H 2IQ9H 1FDLH 2ED9A 4P3WA 4YHNB 4V1DB 3Q0HA 3WNOA 4BUHA 4UQ2B 2C1PA 4AH2A 4LBEA 3NCMA 3WUWG 2X70A 4PRBB 3SGJA 1A7NH 5JUEH 4NIKB 5FM4A 3U0TB 4APQB 1KXQE 4D2NA 2Q20A 3T2PA 3SEPA 2APTA 3GI9H 3P11H 4OB5H 3PGCA 3VXUD 2HKHL 2AEIT 3M17A 5E8PB 3R4DA 4UDUA 4EDXB 3WDJA 2X5PA 3MLSL 1XIWD 3S4SA 3HUJE 2WBJB 4P23C 3EYUH 1NCAH 5JXED 1WBXB 4PJ9D 2JCCE 4OF0A 4TRPL 1I7ZB 2ZWLT 1A7QL 4OFYA 3JTSB 4M6MH 4R97B 5E00A 5DXWA 3OGCB 4LLVB 5I9QB 1IILE 2VQ1B 4MWFB 1H3UA 4O5LL 4YFLI 1HEZA 1IAIM 5D7IE 3IAQA 2HTKD 3MBEA 1T20A 1O5DT 2VWEE 5E6ZA 4Y4HB 5I17A 3U2SB 1F3JB 3VE0B 5CINL 4CBPA 3DOSA 1UWEH 1A9BA 1FN4B 3R06A 1QSZA 3STBA 4XMKH 4P5TA 3EO9L 4I5BB 3MACH 5BO1L 3QULB 5JR1L 1IQWH 4KKCD 1TLKA 4HLZG 3SPVA 1YEHL 4HSQA 4PUBH 4RAUA 5FOJA 3WXWH 4P23A 4ONGL 2LTQC 3E0GA 1AXTH 5DJDA 2PW1A 4GRLC 3MLPA 4UMGA 1S7UB 5L6YH 4AJ0A 1SY6H 3TO4B 2JJWA 2MPAL 2Z4QA 3W9EA 1YYMH 4JFPA 3ZTNL 5FV1L 1G7IA 3V5DB 3SKOB 3KPLB 3MRRA 4QF1A 1QFUH 5HGHB 4G8IA 3VXME 5DJ0A 1JPTL 1ZOXA 3QEUB 3ALXA 1CF8L 5HTSA 5FEBA 5KS9B 2JK5B 5I1AA 4F37F 2F15A 3CXHJ 4KZDH 3LKRB 5IFHL 1YEIH 4MXWH 1CK0H 2GJ6E 5TE4H 5FYJD 5C07B 5DRNA 1K8DB 2GKIA 3FQTA 4WNQB 5LXGH 2AJXH 2F54A 3MLRL 1JGUH 1CICC 1RUML 3OKOB 5IF0B 5TQ2H 5EO1A 5JOEA 3B2UC 1IGCL 2FGWL 1CFTA 4N90E 4HPYH 5FO8A 2ZUQC 2B4CC 1SBSH 5ETUB 1X5FA 2YA0A 3SGEI 3T2NH 2X4UB 5IEHB 4CAGA 4OSUL 5AYUH 2V7HB 3GSRB 5CP3H 2W1NA 1KYOK 4KKAC 4XNUL 3VRIB 5J9PA 3UP1A 5E2WH 4PPTA 5FUZL 1ND0A 5J12C 1MCHA 3IXAA 3UJJH 1Y18A 2A77H 1RJZB 3D39E 3VU2A 3AM8A 1UM6L 4N0YL 4NFBA 4YC2B 2X05A 3VMPA 5ID0B 4Z7UE 2IBZY 4HXAH 3RGVB 1QRKA 2CDEA 3ARGC 3IFOB 3O9WC 4JQIH 3WCYA 1J7VR 4RIRB 5CCKL 1EXUB 4X8JA 4WJ5A 3SDCC 3G5YA 1T2QH 3LV3B 2VAAB 4UNVA 3O4LA 4WDIA 1OTSD 1VFUA 3NIGE 4BH8A 1JUFB 4XC3L 3P4MA 1CLOL 4LIQE 5IBLD 4TTDC 3Q48A 5B39A 3RKDD 1A3QA 3C9NB 3FB7B 1HSAA 4Y5VB 1LEKB 3LEVH 3QWOB 3SKJH 3WUWB 4O2CB 3DBXA 3KYAA 2F5BH 4M1CD 2OXHA 5TGBA 4NRYA 4IM8A 1MOEA 4HS8L 3QDJB 1YEEL 5BS0B 1BX2A 1G9EA 3EOBB 2FBOJ 1HHHA 3L5JA 3U4BL 3LN5A 2J6EH 3ARGA 5C0DA 4OCSL 5EOQL 4ZXBD 3BP7B 4HT1L 4YQXH 4P2OB 5GGRA 2FJGB 4XPBL 4M03A 3S3SA 3RVVD 4OGZA 3S36L 4P5KB 4AYFA 5DFVD 1FORH 2YUZA 4EN3B 2Q3AA 1CR9L 1RZIA 1JCKA 5I8KH 4NUGH 5ACZA 5IHBA 1AHWA 3O2DL 3BDXA 1C12B 3IYLW 1UZ8A 4WUUE 3BJLA 4PGJA 1IBGH 1URLA 1QRND 4JY5H 4F33B 4ZFFB 4JFXB 1EDQA 1YEDB 3BGMA 1TZIB 1WBYB 2Q3ZA 1U8KA 2ZG3A 1MCWW 4KQ3L 3DYPA 4PG9B 3SCMD 5IR1A 1NLBL 2PF6A 3ROOB 4X9GA 1RHHB 2DQGL 4S1SH 3PWNB 4JG1L 3OKYA 1P2CA 1FV1A 4LHUA 4X6FB 1T6WA 5F6HI 1S7RB 2Z91A 3KHQA 1FL3B 5I1HL 3LPGA 2HFEB 1FVCB 3THMH 2VUYA 3UPAA 3DV4B 3VFNA 3MRKB 5FUCC 4Y19A 5ENWA 2IQAA 3IVKA 5K9KA 3KYOA 1JL8A 2OTPA 4MA1B 4A6YA 2BNQE 1WFOA 2R0WH 4K94C 1MHEA 4NO0B 5EZOL 4OAWA 4WI7A 3V6OA 4G6ML 5FB8A 3CH8A 3X12A 1K3ZA 4IIQA 4NQDD 2PETA 2D9CA 4GMSL 2DLGA 4QO1A 1WWBX 2Q7YA 3JWOH 4X99A 3OKMA 4DGVH 2CQVA 4IRSA 1UYWH 2H2PC 4QHUA 3MV9A 4RAVB 2OTWA 1IGYB 1IL1B 3ARUA 2DYPB 4HPOL 4LVHC 4M9OA 5GS0L 1K4DA 3OSKA 1N6QL 4G7VL 1AGBB 2HJFB 3TBYB 5KN5A 4X9BA 5DQDH 3P77B 3BPOC 5AYQA 3HR5B 4X4ME 5IVZB 1J1XH 4HUNB 1MRFL 5D7JC 3JXAA 3UTPD 3WJJC 5IW6A 5GJTH 2FD6H 3VWJA 3IDMB 4O00A 5D70H 5KW9H 4H88L 1F02I 5C0AB 4EDWL 1NAMA 2R2EB 5CJQL 2IH1B 3TO2B 1HINL 5B8CA 5IVNA 5KVFL 4N0FA 2BVTA 1C5BH 1C08A 2EYSA 4E42A 2DBLL 1WEJH 2BOBB 4L5FL 5JLZA 4JRXB 5A2FA 5IGXL 4JLRB 3GSNB 1EFXB 3QI9C 1FGVH 2VDPH 3HB3C 1XF4A 4JPWL 4NBZB 5I8OH 4LLYA 3DRTB 5J6GB 3VXOA 3I6LD 3V5HB 1L6XA 1P6FA 1A6UL 3HE6C 2R1XB 1ZANH 4GBXD 3VFWB 2KH2B 3LVEA 1F97A 2OSLA 5DQ9A 1MLBA 2VC2H 3S6CA 3WJJA 3MUGB 3C60B 2NXZC 4I2XE 3C2SA 1FGNH 4JCLA 5I75C 4P57B 1BF2A 3TV3H 3G6JE 3WS3A 3U0PA 2XWBA 3BH8A 3S8WA 5F9AC 3DX7A 4G9DB 4ZQKB 4Z7OE 3DLQR 4JM2D 5DJXA 1KN4H 2AW2A 3W39A 3U0WH 1MNUL 1S78D 2CR6A 3S36X 3U9UA 5BVPL 1UACL 5EZIH 3W0WA 4CN1A 2DWEB 2ICES 4OQTH 2P8LA 3IDJA 1HCVA 4P4RA 1CFQB 1N2RA 1YPZA 1JZ2A 1PKOA 4MCYA 5HPOA 2AJUL 1KTKE 4XPTH 3X13A 1KIUA 1U6AL 3ELAT 1T0MA 4OCXL 1FP5A 4GMTL 1E6OH 2NY5L 4R0LC 5J56B 3OZ9L 1DUZB 4R8WL 4MD4B 3EJZC 4I8DA 4M7LL 3SJVE 4YAQB 2FJHB 1I1FB 1DJSA 1NAKL 1M7XA 3WHE1 4WFFD 5C0FA 2CIKB 2ZZUT 4YHZH 3DO7A 2SEBB 4ZSOE 4L4VD 3NZ8B 5EFIB 3MUY1 1VGEL 2GK2A 3LQAL 2V7NB 1P7QA 5E2VL 5DVLA 4GAJL 2W92A 4HIEA 4UT6H 2H6PB 1MCDA 1M1SA 3L3JA 1FZMA 2WUBH 3DXAB 4O51A 2Y36H 4XP1H 3IJHA 3L7FA 1RZFL 2LTQB 2Z93A 4XNMB 3QIWC 5AD0B 2IPUG 4GRLB 3RY6A 1KCVH 5F9DC 4HX1B 2JJVA 3PNWA 3RDTC 4RCAA 3QXAA 4F15C 1G6RH 2YRPA 4N8VG 4QXUH 3FZUD 5GGSA 1CGSL 1PG7H 2BRRH 3C5JB 3CLFL 2AVGA 1Q9OA 1T83A 4FFWC 2C4FU 1EGJL 4X5LA 2AQ1A 2FYYA 1KSRA 4FXGB 4CN6A 2ADJA 1YDPA 3B83A 5IMMA 4OJFH 1KCKA 4K2UH 5J1TC 1BVLB 3MOAH 3KAAA 1MWAA 3DYOA 5GGTL 2FL5A 2NY6B 4D0DA 1B3JA 3BN3B 4I18C 3QH3B 3B4NA 3Q5YA 3O6MH 4HUXA 4JY6B 1YNKL 4KROC 3DUHA 3V6BR 2EDHA 4LOUD 1R3KB 3FQNB 1CICB 2ITCB 2MTPA 1X5XA 1MCQA 3VWKD 4GS7B 2WBJD 4L29A 2AJVH 3MNVB 4LLUB 1Z9LA 4DEPB 1DL7H 1JWMB 1J0KA 1YC8A 2FX7H 4O2FB 2VH5H 3O4OC 4D9QD 1DN0A 3DX8A 3SDXF 3ESVF 1XCQA 3CFCH 4OGYL 5J12B 5A16A 3LZFH 3KWWA 1KV3A 2R39A 5AEAA 4EUPH 3VXPB 1EERB 2BFVL 3QEQB 5M7QA 3BHBA 3U79A 4PRDA 4F9PC 3OB0K 2I9TA 2KZ1B 2NY1C 2J8UB 4U0RC 1HOCB 1LVEA 1U3HC 5DMGD 3CXHK 5IMKB 4TN9A 3G5XB 1CXKA 1ZT1B 4PBWD 4K23H 1EH9A 3O9WB 3FONB 1KLUB 3FRUB 3SDCB 4EOWH 3VFSB 1DUYA 4DW2L 4KFZC 2JIXA 2YPVL 1UB5A 5D5ME 1OGTA 1DEEA 2DQCL 2GUOB 1FFOA 3TBTB 3GMRB 32C2A 1A6AA 2AEQL 3BO8A 1PDKA 2DM2A 2ZCLH 3TA3B 5C08A 2VB5A 4YZFF 3C6LB 4LDOB 3Q6FA 1UKQA 4IMLA 1YYLH 3KPTA 5FGSA 2R23A 3CMOH 4PLKD 4CADA 1WCQA 1UC6A 1FZKB 2PXYC 2VWEC 3LH2H 4QTIL 4KMQA 4NP4H 5EU6E 3K80A 2JB5H 3AY4A 4Y16C 3RX8A 1HXMA 3PIQA 2XT1B 4BZ2L 3QDGD 4MQ7A 5TDNA 4GKOA 4AT6A 4M02A 1P4IH 2QLVB 2DKUA 1U9KA 4HIXH 1AKJB 3HR6A 3RNKA 4GAYB 1BLNA 5IG7A 3NACH 5LGHL 3FKUS 4YHOH 2JCCA 3EDJA 3T65A 1FFNA 4I0PB 1MFCL 3WKML 4AL8H 1BD2D 5ESAB 2EDFA 4QRRE 1FYHB 4HXBH 3GUTB 3ARRA 2LU4A 3HN3A 3RI5F 3DIFB 3ZDZE 1QTYT 4GQ9H 4PJEA 4TSCH 4WW1A 1AO7D 4KUZH 2G9HA 1QG3A 5JIPA 2YD5A 4MNGA 1RJCA 4G6JL 2CUIA 5LAXB 4CMMA 3RUGB 1IC4H 2WQ8A 4JKWA 2IPUK 1MCLA 4P3DA 4C4KT 5H37H 5T3XD 5C0BA 1VDGA 3CCHA 3O3AA 2HH0H 1S9XB 2A9NL 4X0KA 5IOPB 2RFXA 4X98A 5C70A 3K74B 4JHAL 5A2JH 3OR7B 4PJBE 3EO1A 1ZHNB 1QYGH 4AQ1B 4U1MB 1RU9L 2VTFA 4N8VB 2HAZA 4HWBL 3UYRH 3TJEL 3HI6L 1FBIL 5EBGA 4BSWB 2X09A 2C7UB 4Z5RB 3MMEB 4X6BB 4G6AD 4RDQF 3O3BA 3MJ9H 3RZWA 3VFMB 3M1BA 4LLMB 2IAMD 5JO5B 1C7SA 1P5VA 1DBBL 1UZ6F 1MCJA 1T66C 5BRZE 1P7KA 4GSDL 2GJ6A 4YR6A 3RVTD 3TF7C 1PSKL 4U6HA 2VLRB 5SWSA 3V79C 5D72L 3QXTA 2YEZA 3PABB 1T4KA 2PTUA 3OJDB 3GIVB 2DD8H 5SX5H 5JDJA 3GIZL 1J05B 3GMMB 3MLZL 4G8EA 3B6SA 5IP4A 1JNHA 4KMLB 4L9LC 3V0VB 5T1MA 4M61B 1OAZL 1UENA 3BPOB 1OM3L 2KBGA 4K8RD 4XBGA 2CJUL 5MP6H 1MAML 2AGJL 4OZHE 3HPLA 3JV6B 5E6ID 5D7JB 4PRPA 5I19L 5AUMB 1J8KA 2V5TA 2NZ9D 3LKSA 5C9JA 5J13C 5IFJA 1BEYL 4F7CB 1U8IA 2A9ML 3GKZA 2B5IB 4TUKH 2ZG1A 3DVFA 1KNOA 1RJLA 1D5ZB 4JRYA 4LLAA 4QOKE 5HVGB 1BFOA 3JBG7 4JREB 1GGIL 4YHNA 4IS6B 5MENB 2W07A 4Z7UA 1JPFB 2EIBA 3QI9B 3NA9L 4NC0B 1KTLA 2OXGA 1MFAL 1E6JL 5CJBA 4L9LA 4O4YL 4OI9A 3ZKND 2G75B 4XTRC 5DVOA 1S5IH 2XFXA 3HE6B 3QDMA 3NCFB 5E2UL 5D7KE 1Q1JL 2YWYA 3Q5OA 4YXHH 3ARDD 3MQIA 4KI5D 4Q58C 3K8KA 5T3ZE 1PW3A 5IHUH 2VDKH 2VXVL 4KJQC 3ARPA 1AR1C 3BPCA 5DC9B 1HN1A 3PGFL 1ADQA 1SEBA 1C5DB 4ZUSA 4MNQA 1P4LB 1S7VA 3BT2H 1FC1A 4WWKD 1RJYA 1T89C 4XP9H 1DQLL 4PR5A 2GSGA 5IT2H 3JTSA 5FK9A 5JW3H 3L3OB 1LO3L 3DX9B 5D6DA 3WDIA 3K8MA 3IS0X 4UT7L 3H9SB 4MWFA 3S34L 4RZCA 4BQ6A 4U1SB 3QXDB 5KSVB 1ODAA 2GI7A 5FKPA 5CBAA 1CFBA 3DNKA 4HW6A 4ZUWB 4MCZA 4Y4HA 4OUUB 3GMLB 4FFZL 4M7LT 3RTQD 3DRQA 5FYKD 3N1GC 1MFBH 2OCFD 1YY8B 2YN3A 3TC9A 2BJML 1HZHH 2DTML 2D3VA 3O2VH 1P1ZB 3QULA 4MJIB 4UV4L 5CUSH 1II4E 5BCAA 4YWGH 3ZYOA 4R0LB 4X7TB 4WUUA 3ZT6A 2IPTH 4XGZB 2DI7A 4MD5A 1KCUH 3TYFA 2E9WA 5I8EB 2Y06L 5GIRA 1NJ9A 3TO4A 4RBPK 3QEHB 5IJVA 3PQYB 3D3VE 1U8NB 3VXSB 3SKOA 1XF2A 4XT1C 2AK4E 1I1AC 3MLXL 2F74A 5EOCJ 2HKHH 3IFPA 2F58H 3CXDL 1PEWA 4KH2A 2BNRE 4OV5B 5HHPA 3GK8L 3MLSH 1FSKC 5CJOL 3QIWB 5A2KH 5DUPH 2ARJB 1YMMA 2BDNL 4HFUH 3RDTB 5BXFB 1K4CB 1PKQA 5FHBH 1LO2L 3RIFK 3F5WB 5E8OB 2BNQA 4NKDB 4OFYD 1Q9WB 1P5UA 4EQ2A 2XZAL 1G7JB 1X3DA 4AY0A 2OQJB 6FABH 3SOBL 3IF1A 1WAAE 1DQTA 3U7AA 5BZDA 3GSRA 4QY8A 3MROA 5CINH 1I8LA 3FO0H 3AXLB 3LRSB 1DR9A 3UPRA 4NHUA 4OCLC 2R8SH 3EO9H 4I18B 2NXYC 1BBJA 1DSFL 5I16A 3WFHB 5JR1H 1U8QB 2VXTL 1A64A 1G7PB 2R1WB 4MXVF 2FEEL 4ONGH 5J6HA 4BK4A 1BQUA 2Z8WC 1S9VB 4M48H 4WEMB 1JWUB 4LFHG 5C09B 4P23D 2FX9H 2X4QA 1MCOH 4X4MA 5T5FL 3L5WA 1F58L 3NCCB 5JQ6L 3HNTL 4IRJA 2MPAH 4LSDA 1GYAA 3EJJX 3O3DB 4KK9C 4KRLB 4LSQH 3S5LG 5CEZD 3O4OB 1KTDB 4FG6C 4M9PA 4KTEL 4LPCA 1SYVB 1F42A 1RZKH 1SQ2N 3C9NA 3LKPB 5F7LB 1YN7A 1AGCB 3EJYC 3HZKA 3WFEL 2J1KA 3F58L 5IB4A 1D5MA 4Q6IC 5ID1A 2NY1B 4GH7B 2WBKA 1BIIB 4NM8H 4NO3A 5DK0A 2CGRL 3GJFA 3S96A 4D0BA 3MLRH 3OAZH 1U3HB 2DB8A 4KJPC 1AR2A 2ENYA 3L3HA 1DQQB 4UUJB 5CZXC 2V2WA 4UB0H 2F54D 1TCMA 3VFPB 3VG0H 3OV6A 5DD1L 5JIKA 4G42B 1GHFH 4P99A 1I3RA 1WFTA 4HS3B 3EHBD 1NEZA 5BQ7A 3VXRE 2AERT 1J1OL 4P2OA 4OF5A 2FJGA 4OZGF 2DQJL 5CJXC 4ZDHB 3ZHLA 4DQOL 1JFQL 3B5TA 1KFAL 3QG6B 2BVOA 1SEQH 2I24N 5L2JB 4ODWA 3LMJL 4WGWB 3GHEL 4HJGB 1CXEA 2FATL 2VN7A 2AKRB 5E08L 5D7IB 4PJAE 3BZFA 4F2MA 4JFFA 2MHAB 2PXYB 5HBBA 4ODTL 1OGAE 3C5SA 3VGHA 4N0YH 4JFXA 2Q76B 4Y16B 2OZ4A 1Y6MR 4MJ5B 5FO9A 2VLKE 4ZAKB 2NY0B 4U6YA 4DN3H 3L1OL 1GIGL 1KULA 5EBMB 3VGFA 3QIUC 1CICD 4PRAA 3PHOA 4KQ4L 3GMNB 3R1GH 5EOTB 4PP2A 1LNUB 3B2UD 1H5BB 1RHHA 1X6LA 3OKNB 4PB9L 1MCIA 1VFAB 3UJIL 1CLOH 4HDIB 4XNZC 1KIRB 1HKFA 2Z92B 3O4LD 4F7PA 1FL3A 4LKXB 3BIBX 4K8RL 3GB7A 1PY9A 2BOCB 2HFEA 5I73B 4KKAD 2EDJA 3T4YA 2FSEB 3FN9A 2HVJB 1AP2A 3LDBC 1JGLL 2ADFL 4R3SB 3HRPA 2XI9A 4CGTA 4NO0A 2VDRL 2L7UA 4OFKA 4QHLA 4OCSH 5EOQH 5JPMA 1OP3H 4C56B 5LBSL 2BVYA 1PQZB 3ARGD 5JW5A 4KPHL 1T5XA 2K3TA 2EDOA 1OWWA 2F53E 3C2AL 4PY8I 2L4OA 2XNAB 3DVGA 5T1LB 3C5ZA 5DHYB 1LEIB 1JNNL 2QQNL 2AS5M 4RA0C 5KTEH 4N0UE 3CPLB 2WIIA 3VGEA 1AGBA 5JDSA 4G9FE 3IJSA 1JN6B 4QHNA 1CLCA 2OMBA 4FQXB 3BGAA 4XMLL 1SM3L 1UKTA 4PJFE 4PB0L 4W70A 4RMUA 3JWOC 2FO4B 3CFEB 4I77L 4KQ3H 5GHWH 1JPSL 5C0AA 5D7LB 4Z7VA 3DI3B 2JE8A 4AIXA 1U58B 4NNYB 2YPLB 1IAIH 3QQNA 1IC7L 1NC4B 2GTZB 2YPKB 4X6DE 4CVZB 5C86A 4CL7A 1MJUL 4S1QH 1QFOA 4EI6A 5I1HH 3HZVB 4O58H 3GSNA 1YEGL 2P42B 1EFXA 3QCUL 3A67H 3RGHA 3AC0A 3B2VH 5FYKL 1AGFA 4ESKA 43CAB 2NY3C 4RFNC 1IZJA 1BBDL 1XGYL 3UROR 5HHQB 5DDHB 3CX5J 4FFVD 5EZOH 4Y19D 5CSZB 2IF7A 4G6MH 1QFWM 4P9HL 5HHOE 5J1SC 1GC1L 3MUGA 3U1SL 1FAIL 4L3EA 4GMSH 5MI0C 4PJDF 1EPFA 3V52L 3F6LA 4HCRA 1DN2A 4MA8L 1MCKA 1A2YA 1NBYB 1LE5B 1GGYA 5F9JB 2P46B 4ZO9A 4Y0GA 4KZEL 43C9B 4ZQKA 4U1IA 4HPOH 2AEPL 1JZ4A 4G80A 3U7YL 1R24B 3KNBB 4G7VH 4P4KA 4XVSL 3MV9D 3VXTB 1E4WH 1HSBA 5L2KB 4NKIL 1REIA 3ZSTA 1P9MC 1FL6B 1U92B 4JFZL 4WO4C 2ATPA 5D1QC 2I07A 4OIAA 1HINH 2GY5A 2W65A 2VN4A 4HUVB 3VWJD 4NQTA 1BFVL 2E8ZA 2DIJA 1RZ8A 3B3IB 5EWIL 2DBLH 2R29L 1U3JA 4L5FH 4HULB 4P2CG 1LO4L 1U8MB 4L8DA 3HC4L 3ZDXF 5IGXH 1VGKB 2A73B 2I9LA 5F1NA 4LKCB 2ATKB 2P49B 4AQOA 2E7LC 4YHPA 3D87B 3R8BB 1PYWA 2C3HA 4GG8B 4JPWH 4GW1A 3L7EB 5IHLB 3QRFM 4ZD3L 5BMFL 1A6UH 4JFEE 2ICEB 4JEGB 1P7HL 5F3BA 2CKBH 3TBWA 3PHQA 4GAGH 5D7JD 3BX7C 3TCXA 2V2XB 3P73A 4XNQA 5AD0A 5GS1B 1RFDL 1A22B 3EOAA 3ILPB 2H1PL 5CSGA 2J7LA 1B6UA 3X14A 4ELMA 2OJZL 1FZJA 1R5WA 1B4JL 4BKLB 4DCQB 1KLGB 3P9MB 3PXHA 4XVTH 1NDGB 1RULH 1MHPH 2E7LA 2IWGA 4LARH 3ECBA 3D69A 2C3VB 4WTXA 4NUJB 5F88A 3TESA 5TE6H 4I3GA 1UACH 2GTWA 1N3NB 5E5MA 3MXWH 4ISVB 3HB3D 3DUSA 5FYJH 3DGGB 3DO3A 4WHYH 3W0WD 2LE9A 4NQCA 3UTSA 1FSKB 1U8HB 1U6AH 1U8LB 4PFEA 2CRMA 2E8YA 4QRPA 4OCXH 1W72A 2HTLC 1BQHG 2Z35A 5JHDA 1FCGA 1R3KA 3FQNA 2NY5H 2ITCA 3OZ9H 4R8WH 1OAKL 2NXZD 2LV4A 2VZ3A 3VD9A 4XVUD 2XZCL 1X5HA 5ITBL 1NAKH 2WLYA 3T0EE 1CQYA 1F6AB 3RP1A 4HV8B 4HEME 1U8JA 4WY7H 5CSBA 5EU3B 5HHXL 1W0VA 3MCG1 4JO4L 5IWLC 3H6JA 4TTGA 3NIFE 4HC1A 3FT3A 4UTAL 3V4VH 4R9HA 5E2VH 4R4FL 2X4RA 5H2BB 5C0RL 3GSOA 1V3MA 3WN5C 1V7NL 3SY0B 1P7QD 4J4PA 3QO1A 4LF3A 2KKQA 3OXSA 4ACPA 3HPJB 3LN4B 4JDTL 4TPRL 2BVQB 4NNXA 4ZOCA 1HOCA 5F9OL 4XVJH 4N5UA 2YBRA 5GRVL 5DZOA 5IMKA 4OZHA 3GZKA 1NMBL 4A2MA 1CGSH 2DIBA 6CGTA 4BH7B 3QHZL 1EGJH 3EJZD 2E7BA 1KJMB 3TVMC 5IB2B 3MRNA 1BAFL 4LMQE 2FJFB 2I25N 3OBAA 4PTUB 3HRZA 1MF2L 3KYNA 4GFTB 4QOKA 4HIIB 2ED7A 3ZDYF 2J2ZA 3V6FB 5CEXB 1S9YB 3C6LA 3MJ8B 4Q6IB 3RA7H 4PJGE 1YNKH 3QP3A 3TJHC 4F9LA 2DS4A 2NLJA 1EO7A 2CIIB 3IXTA 4U33A 4ZUVB 5INDB 3TWCL 3QA3B 4MXQC 4CW1A 1NCBL 4L1HA 2XACC 4RGNB 1KB5L 3PGDB 3EAKA 3LIZL 4R7DB 3OX8A 5F89B 2BVPB 3NGBB 5HYJD 4PIRF 1AKJA 1LMKA 5I15L 1ZWIA 4LRIC 1CFNB 1EK3A 1OAXL 3FQUB 3MCLH 2E3VA 4U49A 1YC7A 2ESVB 1MJ7L 4I0PA 4OGYH 4W6XB 4YHKH 3SJVB 1R3LB 4L4JA 4HQQL 4XNYL 5TFSL 2HP4A 3OKDB 4ZODA 2OL3H 3TIEB 1HYSC 3O3EB 2EZ0C 4ZSOB 1GZQB 3CFKA 1KPVB 3VXUE 4NQEA 4PJHE 2AJSL 4Z18A 3QNZB 1I9JL 5GZNC 1KGCD 3GNMH 4KROD 4PJIE 5GS3A 3RJDA 1CDGA 2X4TA 3O6FC 5I1IL 3QIUB 4Z77B 4X6CA 2D7TH 5H94A 4J12A 3QHTC 2KPNA 4F80A 4DW2H 3W82A 1O7VA 4Y5XA 1XGPA 1OAUH 3WHXB 3HI5L 2W0FA 5DMKB 2AXFB 2E5EA 3I2CH 4MJ4A 1TZHB 2C4FT 4MDIB 1ITBB 3MRHA 4NDMA 3KPMA 2AEQH 2D7PA 1XF3B 5EUOA 4K9EL 1TMCB 1I7UB 4F3FA 2UZIH 2AEWA 4BFIB 4BSWA 5KSAA 3HZYA 4L4TE 5C08D 4LL9A 4KI1A 4Z5RA 1KG0B 1S7XB 5EULV 3LDBB 3D3VA 1VKXB 5F7DA 3LEXB 4HIHA 3VFMA 4JE4B 4QEGA 3WFBL 1OP5H 4QNPE 1UWXH 1QLFB 4RGMC 1JF1B 1AQKH 5C0IB 2H32A 1BJ1H 2NY2B 3ALPA 3MV7E 5E7BA 1T0NA 5TDPA 1PLGL 4TNVK 3UXFA 1A7OH 4GG6E 1BQHB 4X7DC 2CDGA 4RWYL 3OWEA 1BWMA 4D8PB 1E0OB 3BQUB 1N59A 3K1KC 1I3GH 2QR0A 4EVNB 1FNEA 2UWEE 1HHIA 5K59E 4HK0B 1A02N 4M61A 1YEFL 4KHXL 4ODVH 3MRLB 1I1YB 3NTCH 3J7HA 3BIKA 1MHCA 3TN0C 3QUZC 5FYJE 5KS9F 4G6JH 3CK0H 5DHXB 4XZUA 1V5JA 4PY7B 3GI8L 4NCDA 1QKZL 5GSVB 1KELH 4TSAH 2VXUL 4HKJA 4PJCA 1QSEE 2A9NH 4BFBD 1D5ZA 2IBBA 4JHAH 5C0ND 5C0BD 1JRHH 1FZOA 3D2UA 3VRJA 3DARA 3UZVB 4OM0H 1RU9H 2BC4B 4NQSA 4JY4A 2C9AA 3TJEH 1ES0A 3EFDL 3HI6H 4ODUB 2V2TB 3SGKA 3WLWC 4KV5F 4BSVA 1FBIH 2MNUA 2WMPA 4Z0BH 1TJGL 3FOLA 5D5MB 2NY3B 4RFNB 1NGQH 1XR9A 5FUOL 3ZE1F 4WU5B 1EHAA 4U6XB 4LCWE 3QUZA 4FZEL 3OQ3B 1NEUA 1IM3A 3FOMB 4EUPG 5JOFA 4KRPB 2FGZA 2QSVA 5C1MB 5HDBE 3SO5A 3TGXA 1DQML 1S8DB 3NMEA 4HUUA 4QYOB 5MI0B 3VXMD 3STZB 3D5OF 1IC5H 3H9HB 5KJRL 5EPMB 4I0CC 1T2XA 5I18L 5D72H 2GJ6D 5CBEA 3MRFA 5SWSD 4KK5C 3PL6C 4GRMB 1WT5C 3GIZH 4NN7C 3MLZH 1YQ2A 1UXWB 4JKKA 5E94A 1HK6A 4ZPVB 4QXGL 1FIGH 1OM3H 2CJUH 1MAMH 4U7SA 1A8JH 2AGJH 1BZ9B 1Q94A 4JCMA 3WS6C 1CIDA 4I48B 4XXCA 5I19H 4ZNEE 1BEYH 5HD8C 1B0RA 4QRRB 5L8LB 1M4KA 4PRPD 4Z8FL 1OWRM 5DO2C 1A6VL 5DURB 3DVNA 4PJAA 5JW4R 4MAYC 4X7TA 1M05B 3CX5K 3RWJA 5B4MC 1OGAA 4MAUL 3CFJB 3OHXB 2R0LL 4KXZI 4D3CH 3JVGC 4FRWA 1BJMA 5I8EA 5IV2B 1Q9LB 2VLKA 1HKLL 1XGUB 3D39D 4JRYD 3EUUA 3NA9H 3CVHH 2Z31C 4KVNL 1RK0A 1E6JH 5DVMA 4R7NA 4O4YH 3G9AB 4WTZG 2EDDA 4KY1H 4YHIB 4RMWA 5E2UH 1KEML 1Z0NA 4PJBB 2PTTB 3VXNB 2NNAA 3HG1A 2VXVH 1Q72L 3QDMD 1AI1H 2KUTA 1NKRA 3CMGA 3B9KA 3PGFH 1DDHB 3NPSB 2ARJA 4OLWH 2W9EL 4MAYA 3GHBL 4ETQB 2D03H 4FTVE 5AWNH 2EIZB 3BDBA 3L3GA 2EH7H 3ARYA 3CFDA 4XH2A 3JVGA 1IKNC 1P69B 3F5WA 1RIUL 4LNRB 5SX4I 3SKMB 5E8OA 4NJAL 1PX3A 1AQDB 1JGDA 5H37G 3O0RL 3P4NA 4GLRI 1D5XA 5BRZB 4MLIA 1YNLL 3KYKL 2ZOKB 2EEDA 1B88A 4S10A 4FFZH 1MWAL 3ES6B 5CD5C 1QZ1A 3P30L 4H5SB 1G6RB 3A6OA 3LRSA 2HKFL 3PDOB 5I1JL 1TQCB 3FQWA 2DTMH 4LK4A 4H0IA 2BSED 3BMVA 2M8XA 5DGRA 1U8QA 3ARSA 3VJ6B 3TCLA 4G9FA 1S9VA 4Z76B 2P5EE 2GFBA 2MJWA 1D6EA 3ZKMD 1NMAL 2A6IB 3DTXA 1MQKL 4WUUD 1IKNA 3NAAL 2QSTA 1N64L 4GW4A 4P2RA 3ZL4L 1J8HA 1JTPA 1CLZH 3UBXI 1ED3B 1FRGL 4JGMA 3VGGA 4G43A 3SQBA 1S7TA 1QEWA 1T5WB 3W9DB 2HT3C 3I9GL 1QSFB 1KTDA 3IETA 1Z5LB 1SYVA 3QIBA 3WN5B 4YNYB 4PG2C 1RUQL 4X6DA 4ZFGH 1EHXA 3I75B 3T09A 4TVPD 2APBA 1MFEH 3GK8H 2G60L 1TXKA 1I9IH 4DVBB 1OT2A 4NQVA 3EYFB 1HQ4A 3EYOB 3UTPE 5HXMA 2BDNH 3HAEA 3PWPA 4PP1C 3IAGC 1LO2H 2XWTB 1DQQA 1T7ZA 1YMMD 1RZKC 3SDAC 4EUPB 4Z7NE 2H2SC 4X7SL 3G9VA 5GSRB 3TVMB 4OLVH 2PR4L 5HHOA 1JMXA 2BNQD 3U36B 1A1NA 1I75A 2ZUYA 1HHKB 4DKAA 5GRJL 2P24B 1E4JA 5F7EL 1LO0L 3FO9B 4XWGL 4GJTB 1I1AD 1YEJL 3I6LE 4E41E 4NJ9L 5MEQB 3CZJA 2VXTH 1U3YA 4XP5L 4R2GC 1EV2E 1FFRA 1I8KB 2ERJC 4Y8AA 4HUWB 2AJ3A 4WEUD 1MH5A 4P46C 1T1XB 5IM7A 2PYEA 3IJYB 4OZIA 4XPHL 5T5FH 1F58H 5JQ6H 5E8NB 5ALBH 4M43H 2XZQL 3DV6B 4UTBL 3NIDE 4PJ8C 5EO9A 3D9AH 4RX4A 4IRJD 1S9WA 1I85C 1VFAA 4I1NB 2K7PA 3MYJB 1F4XL 2KDGA 4LKXA 3UTTE 5EZLB 2GITB 5A2LH 5BZWB 1F90L 1UM4H 1TVBA 1WF5A 3HCVB 2CGRH 2AK4B 2NXYD 2W0KA 3RVUC 5DC0A 4HMDA 1I1CA 4AIZA 1T80A 4P46A 5SWZE 2VE6A 3CSYA 1F5WA 3O6FB 8FABA 3F6IA 4PYGA 1KJVB 4HBCL 2BNRB 1JP5A 2NX5A 1GGCL 3FO2B 3BE1H 1J1OH 4PJ8A 1UM5H 5D4QA 4G8GA 4I4WA 4X6EB 1KFAH 2WP3T 1I85A 4OLYL 2ZSWB 5BOZG 4L4VE 1MREL 3AREC 1S3KL 4KK9D 5DS8A 2GY7B 4AK1A 2FATH 2UUDH 2XXMB 5CGTA 3TZVC 5E08H 1QPXA 3CPLA 1JJUA 5J1AB 2A6DB 3T0EC 3MOQA 3W81A 3UPCA 2Y5EA 2C3WA 4ODTH 2W9DL 3QUMH 4FA8A 5E99L 4N5ED 1ZLVH 5IB3A 4FQXA 4JFFD 3P0GB 2VZSA 2VLMD 1OSPH 3RZCC 1UEMA 4KGLA 4RGMB 5M94B 3L1OH 3CFEA 3HZMA 4KJPD 2XPGA 5ERWB 4NOBA 1MUJA 4KQ4H 15C8H 1ZVSA 1Z9SA 5CZXD 4U1LA 3LN9A 3QNYB 4G5ZH 2DQFB 2GSIB 5C0CA 2ICWB 1IGMH 3BVNA 4J7RA 3P4OA 3VG9C 35C8L 4ELMF 2GTZA 3VFRB 1QO3B 5D2LE 2OLDA 4XMPL 3UTZB 1W8OA 1OARL 2NTFA 2Y7QA 4NC1E 4ODBD 3TPUB 5DUMH 4HKBA 4K8RH 3HZVA 5DTFA 3TZVA 2DM4A 5EG6C 1ZVYA 1QBLL 5DUBB 4XX1E 3SJVD 4PLNC 2LQRA 5IVXA 5SX5K 3IU4L 3TN0B 5MERA 1EZVY 3F12B 5FA4A 5FO7A 4JN1L 1JGLH 2ADFH 1RK1A 4YPGB 4Z7QF 5CSZA 2VDRH 3RU8L 3ULUD 2VQUA 1T22B 4UV7H 2RJMA 3X11B 2YC1A 5F9WC 3O2DA 4KPHH 1NQBA 4BM7A 3BZEB 4WCYH 3QR2A 4GKZB 5DRXA 3C2AH 1M71A 3LQZA 1JNNH 4K3DL 5FDWB 1FYTE 4UDTA 3D0LB 3IDXL 1TVHB 3C6SB 3VXRB 5CGYC 4P3CH 3MLWH 1MCWM 1S7WB 4M6OL 5L2KA 3DJ9A 4KMTH 1SM3H 1HXYB 4PB0H 5K9OA 3GGWA 5AZEH 1G1CA 1SJHA 3TIDB 3MRCB 1TETL 2VL5A 4L3CA 4I77H 1JPSH 1ZS8A 2X4OA 4UINL 1PBYA 5C8JA 3LEYL 4M1GH 5GS0C 1ZSDB 3PV6B 3MRIA 4U0QB 1NBVL 5GGQH 1GJIA 1OTUC 2BMKA 5JMOC 2Q6WA 5ANMB 1I9RH 1IC7H 1GVIA 2WUCL 1AD0B 1KT2B 1B2WH 1M7DB 4GKNB 1XIWC 2AJZB 1EIBA 1MJUH 3QUYC 5DJZA 1NFDB 4FMKA 4D9LH 2O61B 4YO0A 4NN7B 4M5ZH 5CIPH 1LO5A 3IKKA 4LSRH 4PJ9C 5JNYA 3HLAA 4JR9L 3SE3A 4Y8DC 4WGVB 5FYKH 3BH9A 4QHMA 3L7EA 5EU5B 4WVRA 2F5AH 3VMNA 1VACB 3K3QA 5ICXB 2JELL 4F57L 4P9HH 4NBXB 5ESVA 1ZMYA 4MDJB 2BHZA 4DKEL 4WI6A 2V2XA 3BKJL 3QDGE 1ORSB 3V4PH 5GS1A 5C6PB 2DLFL 1CE6A 3MLUH 4PJHA 1W2KT 4L3ED 4OD2A 2EDEA 4OGXL 1EO8L 4FQHA 3NABL 3ILPA 3N1PC 1LD9B 4WEBL 4KKCC 1RZJH 1YJDL 3QB7C 4FQQB 3C09C 3K1DA 2D31A 1A0QH 2Z31B 3TBSA 5KSBA 3U7YH 1RZ7H 3MLYH 1G9MH 3S98A 3SBWA 1PEZA 1K85A 4JRWA 3GJEB 5A40E 4XWOC 3EBAA 4P4KD 3S88L 3U9PH 2F53B 5H35A 3KYMB 1JYVA 3DGGA 2DMBA 1AIFB 1NCTA 2YA1A 3S3PA 1AO7E 4PJXB 2FZ3A 1TDQA 5IMLB 1MJ8H 3GBMH 1BFVH 3ULVF 5EWIH 1NFKA 3IDNB 4PJFB 2HMIC 3RUGF 4X6CF 4JFYB 3HC4H 5T1KA 4MMZC 2IH3B 4LCCA 5HVHC 3KR3L 3MRGA 3M45A 4HV8A 5EU6D 5GJSH 4JQXA 4OD1L 4HFWB 3MV7A 4ZUTA 1KCSL 4M7ZC 2X9XA 1CYGA 2NY5C 3STLB 1T7YA 3HFML 3MA7A 1A6TB 2E6QA 5EUOF 1MHHA 3IDUA 3JUYA 3KPSA 1AXIB 4S0TD 5DJCB 4FABH 4OLZH 1MQ8A 3MUJA 5CJ5A 4CJ1A 3L3IA 2BSRB 4Q2ZB 4LSPH 5J11C 5FM5O 5F7HA 1L0QA 2VUOA 1IFHL 1OLZA 3MRQA 3LQAC 4WO4D 5D1QD 1NGYA 3A6CL 3G5VB 4MA7H 2LAAA 2OJZH 4PJ5A 4TQEL 5CEZH 5IQ9B 2ZCKL 4U6TA 3KLHC 5FF6A 4J2XA 1LDPL 1QSEA 4MLSA 1MRDL 4Y4FB 4AIOA 2GCYA 3HMWL 3CZFB 4EBQL 4N0RA 4JFHE 1OTSC 1RUPL 1SJVA 5ICYB 2VNCA 4NQCD 2DWDB 3UTSD 2YMXH 3FJTA 1ERNA 1YUHB 5FECA 4QRPD 3RWDA 2XZCH 5JHDD 3PGDA 3SDAB 2X2YA 4Z7WE 4M1CC 1CD8A 2VDOL 5HYSG 4H8WH 5DA0B 3UDWA 3EFFB 2CUMA 3OAZK 5C3TA 3HMXL 1N6UA 2EYRB 4YDLC 1W0WB 5HHXH 3FCTB 1ZT4B 1IGIL 2HWZL 4U05A 3O11A 3O45B 2ESVA 2MCPL 5I1LB 2VKWA 1SVCP 4ZXBC 2C4XA 4PGCA 3FT2B 1JI1A 3SDXE 4QCIB 1ZA6A 4LSSL 4KTDH 2V9TA 3MBXH 2V6HA 3QG7H 4R2GB 3RVVC 4OM1L 5MEPA 5DFVC 4C58B 4J4PD 3V6ZB 5F9OH 3ME0A 3UJTH 4JFEB 1TQBB 1NMBH 4DOHE 4ZNEA 2VDNL 1BJ1J 4UQ3A 4LEOB 3IFLH 1A47A 3CVIL 4M3JA 2XICA 2L0DA 3MV8E 4YGVB 4XBEH 4WU7B 2DMCA 1BAFH 4Y1AB 3I3EA 3WHXA 2G2RA 2Y07H 1ACZA 3PXJA 4OFPA 3DMMA 3ZLQC 1ZK9A 1MF2H 3WV0A 4P2QE 5DMJB 3LSOB 5I1GL 4ZOEA 2GAZB 4B50A 4QOKD 4YZFE 4NO2A 5C0GA 2QJDA 3H7BB 1JHTB 2R4SH 1ZGLA 4YFLF 2GK0B 5FYKE 1XCTB 1QFWH 1KG0A 2QADB 3ULUL 4GXVL 2EO9A 4G6FD 4KJYA 3OMZA 2VLJB 1U8PA 4PD4K 1BOGA 5HHNA 1ZHLB 4ZTOH 4LSTL 1A1OA 2C5DC 5D7KD 3AB0B 4G3YL 1IVLA 4JFQB 4OUOA 3WL9B 5TPWL 5T3ZD 3NN8B 5KVDL 1OAXH 3CDFA 2YUWA 4LU5H 4MA3B 4FTVA 4ODHL 1OP3K 1IQDB 4XRCA 4D8PA 4WI5A 4N8PA 3BKCL 1AD9A 25C8L 1IGFH 4HQQH 4WI2A 5ESQA 5F1IB 3T0EB 3BKYL 4PRNA 4WI4A 2VDML 1K5NB 2VDQL 2Q7NA 3TT3H 1NH6A 5LQBL 2AJSH 2VRAA 4M6NL 4NQED 3TJHD 4WHYG 4ETYA 2FWOB 5DVNA 2IPKA 4K7PL 3VXQA 2CLRB 4PY7A 1GAFL 2PCPB 5DYOA 4U1HB 3T0XA 5GSVA 4BELD 1RIHL 5E4EB 4TYUA 1IEBA 3H42L 3QDAA 4QRQA 2A6JA 1OW0A 3HI5H 4K55A 4B0MM 4ODXB 1V3KA 3VG9B 2VIRA 3K2UL 2KZWA 4PJ7B 4Z0XB 2P5EA 3K8LA 3ISWA 2MQCA 3GSNL 5HGBA 4MNHB 2W91A 2D7MA 4V2CB 5JORB 3RPKA 3RPIA 3D85B 1DVFC 4IHOB 2B1HL 2ITDA 5DD6B 3KPOA 1NANI 2EC8A 3S9DB 1HYSD 2EZ0D 5FA3B 5KSAD 4WU5A 5E9DA 4A6YH 4U6XA 1MI5B 1QLRA 4R96A 3D3VD 1NGWB 4S1RL 3RHWF 2BVUA 4JN2B 1T1YB 4NKMB 4LHJB 4PJGB 1TTUA 4HKXA 4F7TA 1UZ6E 4JO3H 5CWSA 1T1WB 5F9WB 5IMOA 1PLGH 4HCRL 4YEFA 4U3CA 4GBXC 3QT2A 3VFOB 3DUUA 4Z78A 3CJJA 3H3PL 3T0DA 4RWYH 4DAGL 1CFVL 2CK0L 1J87A 1N8ZA 1TNMA 2YKLL 3EDFA 3RWHB 1GSMA 4NCC2 5CEZE 5HYSB 1UXWA 3O8XA 2KQNA 4ZPVA 2XY1A 1XF5B 5DSCA 5F6IC 4U6VL 4OLXL 2YD9A 5DD0H 2MKLC 4UZGA 3REWB 4IRZH 2Q87A 3MJ7B 3GI8H 1T21B 4IBLT 4N68A 5F71A 3NCEB 1NAMH 1S78C 4HIJB 3VXUB 4ORZC 4HWUA 4R90H 4F58L 1HHGA 3UYOD 1XIWB 2BP3A 3CFJA 3OHXA 4KJWC 4PJIB 5DRWA 2MMXA 3QUYB 4OQTA 2ZUSA 2PW2B 4YFEA 3WIIL 4PYHA 2HYMA 3BD4A 4PJ9B 1F4AA 4YIQB 2Y9RT 3EFDH 4J1UA 3NH7L 3D2UD 5JPNB 3QO0B 4X4YB 1N7ML 5B21A 1I3VA 4R4NC 1A7RH 4K7PY 2DOCA 1OQXA 3L3KB 3MR9A 3WEXB 3WD5H 5FUOH 3JTTA 3CDGB 3RWCA 2AQ3A 3C8KA 4YXKL 3OB8A 3CH1B 1EJ6A 3T77A 1DQMH 1INDH 3FN0H 3QUZD 4UIMB 4L4TB 1KBGH 5IIEA 3JWNC 4Q6YA 5KJRH 4UNUA 3WO4C 3BIAX 3F7VB 1BVKA 1AJ7L 2Z8VC 5CMAA 3WSQL 3P0YL 3LS5H 2HG5A 3QDHA 1LEGA 5A2IH 4HWZA 3QUKB 1C16A 1U93B 2EC9U 5SWZA 5FGBC 5I2IB 5DMYA 1AQDA 1I7TB 2CKBB 4F7MB 1ORQB 2IALB 4NBYB 1AGEB 1DE4A 1ZVHA 2DQUL 2FRGP 3O4LE 4C83A 2XRAL 4PGEA 3RIAK 4FNLL 3WLWD 2AABH 3NFNA 2QKIA 5FCSH 1M6OB 4RFOL 3QHFL 2EXYC 3VXRD 3RL2B 1K2DB 4JDZB 4P59H 5DHVA 1A6VH 5HSFA 2UWEB 4XAKE 2XN9A 3WIFA 4KU1A 1HI6B 1R3IL 2VISB 3SE4A 2ZUWA 1CU4L 4MAUH 3VFTB 2R0LH 5D7SL 3P9LA 1F11B 3QJFA 3B8SA 3AS3A 3QJHA 1HKLH 1OGAD 5HVHB 3MODL 5IKCB 2YK1H 5CS7A 3QZWA 5CILH 3JV4B 4KVNH 2VLKD 3PDGA 1RVFL 4ZNCD 1R6VA 1U91B 3QEGL 3PL6D 1DLFL 1XGTA 3W9DA 4HC1L 1KEGH 1WFUA 2DKSA 3S35X 3ORJA 4H26A 4EI5A 1J0IA 3L6FA 4A2LA 3MA9H 5ADPH 1MLCB 2AI0H 5EBWB 3QSKB 3LAFA 4GXUM 3HC3H 5J11B 3VH8G 3HG1D 2O5YL 4OF3A 3EYOA 3GHBH 1WZLA 1E28A 3B9KD 3ET9F 5DO2D 5F93C 5JA8B 5JZ7C 1MPAL 3MFFB 3B9DA 2YHGA 4MAYD 3E2HC 4NJAH 4AENB 1ZKAA 3VDBA 4JZJA 2HFFA 3D18A 3E8UH 3JWDL 3SGDI 1T3FA 1R5VA 4NSKA 1YNLH 3GDBA 2F8VA 1EUUA 2FCBA 3L3DA 5DMGC 3QWRA 3KYKH 2AV1B 3RAJL 2Z31D 3CU7A 2YUVA 1V8HA 2UVEA 3P30H 3AROA 4LLWB 4LQ1A 4JZOA 1CZ8L 3BDYH 3BSZL 4HHAB 1F6LL 5L88H 4MSWB 2H3NA 4XXDA 4WI3A 3BMWA 5E1AA 1IM9D 4AM0B 5C0EB 1GZPA 1QQDA 4O02L 1MJJB 1NMAH 2W9LA 4PGBB 5F1KC 2XA3A 4YLQT 4ERSL 1MQKH 4G9FD 3NBNA 2DQIL 3V6OE 4GOSA 1C1EL 2EECA 1KIQB 5EBLA 3NAAH 3RX7A 1FLRL 4LVNC 4F7EA 4KUCD 1MCPH 2VAJA 4R4BA 5I1DB 1OOAA 1NBZB 4OZ4B 3NFSL 5FYLD 2CMRH 4P2RD 4UILH 4K7FB 1J8HD 1XH3B 4GKSB 4ZXBB 4X7EC 4E5XA 1FNLA 1FJ1A 4BQBA 4YDKL 1RUQH 1SYSA 3MYJA 3MV9E 1L4IA 5HYFA 4JB9H 1PAMA 5D96C 4LSVH 2G60H 1Y0LA 2X89D 3QIBD 8CGTA 5FKAB 5JTWA 1YMHA 1K9TA 3MRDB 4OCNC 4DKFL 1PX4A 3EIFA 3AS2A 4WTZA 3ULVL 1JV5B 2QQQA 4AEEA 7CGTA 2X4NA 3KJ6L 4QRSA 3JV0A 3PWPD 1LP9B 5JHLL 3BZ4B 2BCKA 1D5BA 2OL3B 1QRNB 4J3WA 3NOIA 4DGIL 3TBVB 2ZUTA 5I8CB 2IG2H 3MOBL 5EC1A 1JMZA 1UXSA 4KHTL 4UAOC 1L7TH 1K3IA 5GRJH 5HHOD 2D4DA 3PJSA 4PREA 1P84J 5DJ2A 5F7EH 1LO0H 1OSZB 4GW5B 4GXUN 4XWGH 5I6XC 2C26A 1F4WL 1YEJH 3KDMA 2HT3D 5J1AA 4NJ9H 3U83A 4XP5H 3LKOB 5JXAH 5CD3B 1KUMA 3LKNB 3PWJA 2GT9A 3SQOH 1KPRB 1QBML 1DBML 3AAZB 3RL1B 3V8OA 1ONQA 1TJIL 4PP1D 1AY1H 3X17A 2PYED 2XZQH 4N8CL 4QT5A 1OP5K 1UWXK 1YY9C 2H2SD 3QFJA 2BY0A 2ARJQ 2ICWA 2EDBA 1S7SB 5GGVL 4NQDB 2LFGA 3UTQA 4NM4L 4RX4D 1KB9J 1INEL 3RVTC 4X9HA 2OTUB 4LP5A 1JWSB 4K07A 5ISZE 4XX1G 2QQLL 3ARVA 4LCUB 3I6KB 5ABDE 4ONHA 5TH2A 1HHJB 4WW2B 4XPFL 2FO1A 2G5BB 4F37K 2RR3A 3F12A 4W4OC 3T3ME 4AEIL 4FQJH 4YPGA 3ARFA 5AZ2H 1YPZE 1U3ZA 4K8RC 4P46D 5LGJA 4PGDA 1GGCH 1BOYA 1O7SA 5E6IC 3RVWC 2CRYA 3VH8B 2XTJE 3QFDB 3G6AB 3I02B 3BEVB 4PJ8D 2HT2C 1S3KH 4G8FA 4X7FC 3RJQB 4G8GD 1LE9A 1R3JB 1X4XA 3FN3A 3PWUA 4OCWL 5TQ0L 2C1OA 1I4FB 1TVHA 3RWIA 2FX8L 1QVOB 2W9DH 1QHPA 2NTSP 1T03L 4L8CB 5DWUH 4IMKC 3ROLB 2A6KB 1JYNA 3KPRA 1CXLA 2O93L 2VABB 1IGTB 3CFBB 1KJ2A 2AV7B 4I3RH 2OM5A 4TUOA 2VXQL 3T1FB 2CLZB 4NRXA 1MAJA 2EDKA 1SHMA 4YDVA 2GW5A 4GBXB 1RIVH 3ARDC 1WC7A 4NT6B 3E6FA 2P7TA 1HDMA 1KT2A 1M7DA 4CVXB 3TEUA 2O5XL 3E1F1 2O61A 1BIHA 1AXSA 2PO6A 3O6KL 5C0CD 5TE7H 5IBTL 1JGEA 4WWKC 3ARED 2R0KL 3U4EA 4ONFL 3V9FA 5F6IB 2I60L 3MLTA 4NPYB 3TZVD 4ZMAT 2DQTH 3T0ED 2CPCA 4JM2B 4YH6A 1JPGB 1NFIA 4Z7OF 5ACLA 2NW2A 3EYVB 5D1XA 4NZRL 3ARBA 1E4KA 5D2NB 2NCMA 3RZCD 5TDOA 3V0WL 5DEGA 3ZYJA 2OX5A 1ZV5A 4JGUA 5AG8A 4OT1H 4JFDA 3AGVA 1ZA3A 3LKQB 1XR8B 3GSWA 1NSNH 4FP8L 4ODSL 2VKXA 1CL7H 2FIKA 4PRHA 5DJYB 3P0VL 4HKZA 4P9HC 1FHGA 3IKCA 1GC1C 3G5ZA 4POYA 3MV8A 4YHLL 3PF2A 3GJEA 3FT4B 2YSSB 3GBNH 4L4VB 4EZMA 3TNMB 4JG0H 1NCNA 5E2TL 1TETH 4KVCL 5DJAA 5T5NG 3GO1L 4UINH 3CVHB 4MVBC 4ORGA 1KGCE 4ALAL 1ADQH 1S9KC 5IMLA 4XBPB 1E4XI 4HMEA 1K8IB 1Z9MA 3BUYB 4H1LA 2GJZA 2HN7A 4X80L 3OR6B 2WUCH 3L95B 4P48A 1X5JA 2FHBA 4FQ2L 3ZDXE 3MJGX 1TTFA 5DRZA 4G7YH 5FOBA 4DKDC 1ZLWH 1G7QA 2DRUA 4JR9H 2HVKA 4P5MB 4HFWA 2VLLB 2X6MA 1QR1B 3FO1B 4TSBH 2H8PB 1NGXB 1IJ9A 2FR4A 3LRGA 5CGYD 5D2LB 4JAMB 1MFNA 5C08E 4LLQA 2JELH 2P8MA 2EH8L 4XC1L 4F57H 4JPKL 1KJ3H 3WFCH 4XB7A 3MBEC 4M6AA 3FQXA 1DQDL 5D71L 2DI9A 2DLFH 1YEKL 1ZLSL 1EO8H 1H8SA 1KN2L 3HI1A 3WFZA 5GS0D 1BFSA 3WMSA 1J18A 4WEBH 3JSSA 4XCEA 4ZYKA 1OTUD 1YJDH 4P5TC 5FYLL 1FVEA 3RBGA 4LSUH 1AH1A 3H2WA 1A3LH 3QUYD 1TITA 3VWKB 5EIIA 4HH9B 4UU9A 1CGTA 4TVPH 1CFSA 4Y4FA 5IEKB 1J86A 4I3SL 4YXLH 3EGSA 4TNVF 3CZFA 4ZS7H 3DSFL 1F2XK 1FYTB 2ADIA 5GGSY 4Q9RL 2X4SB 1GPOH 4PJEE 3VMOA 5D8JH 2BNUB 3CD4A 2ADGB 4AZ8A 1F8TH 4MNGE 3DROB 1G7MA 4UOW1 4MD0B 3E2HB 4L4TD 5BVJA 5EC2B 1IAOA 2Y5TA 1AC6A 3EKCA 5EO0A 1R0AL 3GSUB 4OTXH 1T6VN 3BKMH 5C0BE 5T1KD 5DI8B 4J8RA 4OD1H 4ZS6C 1ZT4A 1KCSH 5HY9A 1OPGL 3EO0B 3RWEA 3KLAB 3HFMH 5GISH 1EAPA 5I1LA 3MV7D 3EHBC 5HPMB 4NO5B 1DANU 2X41A 4XWOD 4H8WC 4U7MA 1B0WA 1VFBB 1X5IA 3KPSD 5D5MF 1UQSB 4WTWA 3RWFB 1B6DA 1IEAB 4LRNH 4E0RB 1CDYA 1BF8A 2UZYB 1FNHA 3A6CH 3MO1B 4OLEA 5AAWA 2E9JA 1RURL 2EKJA 5F3HB 1TCRB 3FTGB 4JQVC 2HMID 4PJ5D 5CHNA 2YWZA 3V7MA 4NRZB 4YJZL 4KDTA 4Y1AA 5JIHA 3OAUH 5SWSE 3AM8C 3QDGB 5K9QG 2H26A 1Y6KR 1UG9A 2VITB 3VD4A 1PD6A 3KPPA 4P9ML 1NCCL 3ZDYE 1QSED 1I8MA 2QEJA 3LB6C 4D0CA 2DLTA 1RUPH 3HTLX 1UWGL 2IFFL 1FL5A 3GJFH 3V5KB 5IW1B 1BD2B 3FRPA 3MPCA 3MV11 4PRPE 4HAGA 4S2SA 3VW3H 1XZ0A 5CZVL 2YUXA 2HT4C 3KPQA 2VDOH 2VLJA 5EOCH 1AO7B 3ZDZF 4L8BA 1ZHKB 1ZHLA 5IHZA 3ARXA 5DD3L 1BECA 4JFQA 4LCWD 4JQVA 4L8SB 4UAOB 1JNLL 1IGIH 1Q9KA 4JRYE 4YBQD 4DTGL 3ARTA 5EB9A 2IGFL 2KL6A 2ZOLA 1JYXA 3KLHD 1IQDA 5I6XB 3T8XB 4FFYL 1UB6A 4PRIA 1VA9A 4LSSH 3MREA 2D0FA 4BUGA 4NQXB 1F3DJ 1OF2B 4OM1H 1INQB 3FB5B 1NDMB 2UUDK 1YECL 4PJBF 2OZ4H 3QDME 1RUKL 1WWAX 4DK3A 5TF1H 1WBZB 1LHZA 4RRPA 2BSTB 1N6VA 2VSDA 3S4SG 1RZGB 4OIIL 2ZCHH 1ZLVK 3CVIH 1JI2A 1QNZL 4OFDA 5ICZB 2AXJA 3GMPA 3ZT7A 1AHWC 4M3KB 4MNQE 5IB1B 3I6GB 3QUMB 1TZGL 2JB6B 2IAMB 2NMSA 4XCYA 4PTTB 1BQLH 2WWMC 5TJWK 3DMMD 1MEXH 1S5HA 3IDYC 1KB5A 2I26N 3BP4A 5HGDB 4LCYB 3D85A 3E6HB 5C0JB 5F7UA 3H8NA 5GRZA 1H0DB 4WV1B 2HFGL 4C54A 2IADB 3MCKB 3ULUH 4ZFOB 4Y5YB 1CN4A 2VZVA 1Q8MA 1NGWA 3H0TA 5D6CA 3KG5A 4JN2A 4K9EC 3TT1H 4JPIA 1BGXL 2IBZX 5E6IB 4LSTH 3MUHL 4G3YH 1T1WA 4DK6A 2VXSH 5TPWH 5KVDH 4U3XA 4EQ3A 1W0YT 1U8OB 3J8F7 4FFVC 4ZPTA 3BP5A 4U2ZA 4ODHH 3VGBA 3DX6B 3T4AA 4Z7WB 2F8XC 2J88L 4AG4L 5DGQA 2E9BA 4JKMA 5INCB 3V6OC 2CD0A 4FTVD 1A4KA 1EBPA 1Z0MA 4RGOL 4IIQC 4XNXL 4MX7A 4MB5A 5D1ZC 5MEOB 2E27L 1VPOL 5LQBH 1I7RA 3BWAB 4TVPE 2X4PB 3FFCA 1EAJA 4JJHA 2VR9A 2FB4L 4M6NH 5CJ8A 4LEXH 2IQ9L 1FDLL 4RFEB 1VESA 4IRSC 3MLVH 3MJ7A 5AG9A 1GAFH 4TNWF 1ETZB 5JUEL 1IGJB 3IU3B 3OKLA 4X9FA 1RIHH 1PZUB 1J5OL 1HH6B 4X4ZA 3BYYA 1YMME 3GI9L 3ARDB 1ITCA 1KCRL 4OB5L 4J6RH 2CLVB 1PKQE 2A83B 4PV9B 3WE6A 2R1YB 2ZJSH 3IDGA 4ZUUA 3QQ4A 2YN5A 3S35H 5JXEA 4DOHB 3VWJC 1G7HA 1L0XA 3KXFA 4WWKB 1MVUB 2WM0A 2P5ED 3EYUL 4AMKH 4KV5E 1LDSA 4U1NA 2B1HH 5B8CC 3LQMA 5D1ZA 1F4HA 5CP7B 5IB5A 3VI3F 3L3KA 3WEXA 3OKKB 1S7QB 4EIGB 1ZGLM 1A14L 4GAFB 3MZGB 3GSXB 4S1RH 4EJ1C 1D5IL 3IGAB 2GEEA 5CIPB 5E9DD 4OGAD 4M8QA 3K46A 2O5ZH 4UIMA 3RTQB 3VD5A 4HCRH 2CDFA 4ZOBA 1JGVH 1UWEL 4LVOC 1X7QB 2CK0H 2QHRL 4XMKL 3WFDH 3MACL 3DWTA 1I7TA 5KG9A 1IQWL 2Q86A 4F7MA 4FXKA 1CT8B 1QP1A 4PUBL 3WXWL 5KSUA 3OKEA 4U6VH 5B39G 1UJ3B 4KK8D 2ZSVA 4IOIA 3O8XD 1DVFD 4OZGA 1M6OA 3RI5K 2WINA 2C1PB 3GSQB 3MUZ1 5DEFA 4AH2B 1X5ZA 1XT5A 4LBEB 2X70B 3SN6N 5L6YL 1SY6L 2A74A 3U46A 1HH9A 1EEZA 3V0AC 5GPRA 1MVFA 2YRLA 1CWVA 1QFUL 3PGCB 1V7ML 4E41D 5CGMA 3M17B 2BY1A 4UDUB 5C92A 2AXGA 3SO3C 1UEYA 4KZDL 5DF0A 1YEIL 4MXWL 4V2BA 1CK0L 4LVEA 3S4SB 4DVRL 5IK3B 1I3UA 5TE4L 1IRAY 3KLSA 4H25A 5I71C 4X9IA 4JHWH 2DL9A 2EDQA 1U91A 5LXGL 2AJXL 4XVUC 5EIVA 2XTJC 1ZHBA 5E00B 3UBXA 3QQ9D 3AS1A 1NBQA 4HPYL 4YXKH 3QUXC 2V5RA 1HEZB 1SBSL 3T2NL 4JFFE 2VLME 4LLDA 1X6NA 5AYUL 5ISZA 2APXA 1EMTL 3T3PF 3WSQH 1AJ7H 3UTTD 4M7JL 3R06B 1T04A 5E2WL 3KGRA 3CX2A 1WLHA 4HF5H 1TIUA 4KJWD 3UJJL 4GQPH 2EE2A 4RAUB 2A77L 3VFVB 4P23B 4WHTA 5SWZD 1CG9B 4U2YA 1F00I 2PW1B 3RY6C 5DD5L 4OZFA 4JPVL 4HXAL 3QHFH 4R4ND 5DJ8A 5J0BA 2QL1A 4XP4L 2APWA 4JQIL 1Z6JT 1T83C 3HE7A 3QUXA 2Z4QB 3W9EB 3WBDA 4JFPB 5E8EA 4DUXA 1T2QL 3D25B 5KBNC 1W72H 1XEDA 1R3IH 4O9HH 4QF1B 1FQ9C 2DBJA 4FQPA 1NGZA 5DJ0B 3ULUE 2XN9D 2AJYL 3V4UL 4U1KA 4N9GA 2V9QA 5H8DA 5I1AB 2AP2A 3LEVL 2NW3B 4J3SA 2D0HA 5F70A 4XHJD 3SKJL 1ACYH 5DRNB 4YFDB 2P5WA 2OI9C 3FQTB 5EN2A 1NBZA