3FPXA

Native fungus laccase from trametes hirsuta
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
499
structure length
499
Chain Sequence
AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Structure of native laccase from Coriolus hirsutus at 1.8 A resolution
rcsb
molecule tags Oxidoreductase
total genus 144
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fpxA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fpxA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fpxA03
2DY2A 3PAZA 3FU9A 1W8EA 4DPBX 4YSEA 5B1JC 2BO0A 2XWZA 2MTAA 2UX6A 4DPCX 3EH5B 3QJVB 5TK4A 1SFDA 3NJIA 2QPEB 2P80A 5AFAA 5I6KA 1ETJA 1ILSA 1MZYA 2GHZA 4W9ZA 1GS7A 4BK5C 2QPDB 2XXGA 4G70B 5B1JA 1BEXA 2XYBA 2XV3A 1L9PA 4HCIA 5I5MA 1A4BA 1PZAA 1IBZA 2YAEA 1A4CA 4KNTA 4A2DA 4ZK8A 5TK2A 4E9YA 2YAOA 4AX3A 1V55B 2GC4C 3FQ1A 4W1TA 4E9TA 1XB3A 1TEFA 3ABLB 3WIAA 3NSCA 1AANA 4AZUA 1J9TA 3UADA 4DP9X 3D12B 4HCGA 2UXFA 2W8CA 1JXFA 2EINB 2PP8A 4F2EA 2IH8A 2PLTA 4JHVA 4DP4X 1AG6A 2FQFA 1PLCA 2DYRB 1J9SA 3IBOA 4UF7C 2HX8A 4L0PB 4NERA 5I6PA 2PP7A 1IC0A 1BXUA 2IH9A 1JZFA 1J9QA 2P80D 3OMAB 1RZQA 4KO6A 2OCCB 2X88A 4GP5B 1OE3A 1N68A 1W6LA 9PCYA 1PZCA 3OMIB 1X9RA 3AG1B 4FAAB 6PCYA 1JZIA 4BDVB 3FSWA 4YSQA 4CSPA 1NZRA 2VW6A 3T6XA 2PCYA 3BVDB 1T5KA 3NSYA 2PCFA 3PLYA 2BP8B 4A2HA 2EIJB 3SQRA 2IDSA 1OCRB 1KYAA 3X2QB 2AZUA 2QDVA 1EZLA 4NB7A 2A3TA 3T9WA 1WA1X 5IY5B 1SHXA 2JFCA 4KO9A 3EF4A 1PNCA 2PPAA 2YAPA 3FSZA 1TEGA 4YSAA 4HCFA 4QKTA 1HAUA 1AS6A 2Y69B 4WKXA 1NIFA 1JZGA 3TU6A 2LLNA 2XVBA 2GC7C 3QJSB 4DP0X 2YAMA 4GXFA 4A2EA 1OF0A 4E9WA 2HZHA 1TKWA 5I6MA 2PP9A 3UGEA 4Q89A 1GYCA 1HFUA 4DP1X 2YARA 5I6NA 1IUZA 3FQ2A 1B3IA 3SBRA 1A65A 2IDFA 1BAWA 3QJTB 4KNUA 1E5ZA 2EIKB 1F56A 4F2FA 1SJMA 1KCWA 2HRGA 1CC3A 3FU7B 5B1KA 4YSDA 5EHFA 2H47C 3QPKA 1BXAA 4K9JA 4PAZA 1OE2A 2YQBA 1OCZB 2X87A 3ABGA 1CURA 1SDDB 7PCYA 1W6WA 2BP0B 3EH3B 1BQRA 1X9UA 1AZCA 5D4JA 3WNJA 4M4RB 1NICA 1ID2A 1ASQA 3FU7A 4GY4A 3ERXA 4GYBA 3ASOB 5B7MA 4YSUA 2XX0A 4BWWA 1KDIA 3GXUB 3WKQA 4BWTA 1EHKB 2CALA 1IBYA 1NDTA 3SBQA 2I7OA 2I85A 5D4IA 2E86A 4X4KA 5B3SB 3OD3A 5I6OA 5I26A 2BW4A 1MG3C 1RKRA 4YSSA 4F7KA 1PLAA 1JXDA 3H56A 1JERA 3PAVA 4HHGA 2IWKA 3CG8A 1ET7A 1TU2A 1ZIAA 1A3ZA 2FQEA 3NJNA 4YSTA 3PAUA 1PCSA 3IN2A 1WS8A 1I53A 3CDZB 3PXLA 3C75A 3NJHA 3UACA 1GS8A 3FU8A 1L9RA 2VMJA 2DV6A 5PCYA 2VW4A 2AANA 3T6ZA 1GY2A 1WS7A 2XXFA 3BQVA 2IWEA 2ZWNA 3N2JA 1OV8A 4HIPA 4P5SA 1NINA 3H4HA 2VSKB 2BZ7A 1J5CA 4E9XA 4ENZA 3AY2A 1R1CA 1RCYA 2HXAA 3FSAA 4KO5A 3NJJA 4BWUA 1HAWA 1BQKA 2NRDA 2GB2A 4YSRA 1AOZA 2XUWA 4G7SB 1L9QA 4TXVB 4YVUA 2EILB 2Q5BA 1N70A 3ZX1A 1NIDA 1JZJA 3RYMA 1WA0X 4JHUA 1AZUA 1NTDA 2UX7A 2IDQA 3FT0A 3FYEB 3AG2B 3GYRA 2BWIA 3MBWB 1SHWA 4YSPA 2EIMB 2YXWA 3HB3B 1ZPUA 2GBAA 2FQDA 2FWLB 3PCYA 4DP2X 4YSOA 4KNSA 1NWOA 2Y1AA 4DP8X 6PAZA 4BDVA 1E30A 1KBVA 4AKQA 3CVDA 3X1BA 3TBCA 1ZV2A 4E9QA 1KGYE 4E9VA 3S3BB 1QNIA 2BP8A 5F7AA 2CCWA 1AR1B 4DP7X 1ZIBA 1PLBA 2HRHA 3NJMA 2WO2B 4A2FA 3ZDWA 3AG3B 2VN3A 1GY1A 1QHQA 3NP3A 3ABMB 3NSFA 1CUOA 1KV7A 2VM3A 4KOCA 4N4YB 5ANHA 3NT0A 4NAJA 3SBPA 2DWSA 2BZCA 1CYWA 1ASOA 1J9RA 3DIVA 1VLXA 4YVNA 1AAJA 1AZBA 4E9SA 3UAEA 3MX0B 1KBWA 1MDAA 1XMEB 4G7QB 2FQGA 3KW7A 3ZBMA 2H3XC 1NIEA 1AACA 2DYSB 1OCCB 2OV0A 2ZONA 4BXVA 4A68A 3DTUB 2YAFA 1J5DA 1ET8A 2FJSA 2R7EB 4YL4A 1PNDA 1SFHA 3V9CA 4YSCA 4PCYA 2CAKA 4JKNA 3OQRA 5B7EA 3ZIYA 4MFHA 2XLLA 1SNRA 3T6VA 3FSVA 3U25A 3NJKA 4GP8B 2FTAA 3X1GA 1ET5A 4P5RA 3GDCA 3S8FB 3FQYA 5AZUA 1E5YA 2UXGA 3AG4B 1ASPA 1V10A 3QJQB 3UAAA 4AKOA 2JKWA 1MG2C 3FPXA 2GI0A 2CUAA 1SDDA 1URIA 2XU9A 1FFTB 1ADWA 3JT2A 3WG7B 1FA4A 2XV2A 2BP0A 4G7RB 3V9EA 2PPEA 3FPYA 3UABA 5B7FA 3IEAA 1M56B 2AZAA 3S3DB 5B1BB 1JVOA 3PPSA 4GP4B 2YXVA 1JZHA 2JXMA 1ZDSA 3CZUB 4HAKA 2PPDA 1OOWA 3AW5A 1WA2X 2WSDA 3NP4A 3X1FA 2RACA 1PZBA 3DKHA 1L9SA 2BWDA 1AZNA 4WTQA 2YAQA 4HALA 1NWPA 3NJGA 3NSDA 3WI9A 1A4AA 1JXGA 1BXVA 4QLWA 1KDJA 1ILUA 4G71B 3IE9A 1FWXA 3T6WA 3G5WA 2B08A 1A8ZA 4FA7B 3IN0A 3CDZA 3KW8A 4HHWA 4RH4A 8PAZA 5I5JA 2BHFA 3CVCA 1JOIA 1ZDQA 1AZRA 1GW0A 1PF3A 3X1EA 3HEIB 4CSZA 2WO3B 1RZPA 4KO7A 1M57B 2YAHA 2GSMB 2PPFA 3FS9A 4N8UA 5I5IA 2QT6A 2VSMB 4AI7A 1BYOA 3QJUB 4A67A 5PAZA 2IDUA 1BYPA 4HZ1A 3NJLA 3ABKB 1KCBA 2J56A 2J55A 4G72B 5I28A 1SF5A 1L9TA 1CYXA 2N0MA 3CVBA 3ASNB 3OM3B 2AVFA 2BW5A 1DYZA 1E67A 2CBPA 2J57A 2MRYA 1E65A 2GIMA 3EH4B 4UAHA 4UANA 1GSKA 5AKRA 1XB6A 5A7EA 1BQ5A 3H4FA 1AIZA 1NPNA 1UATA 2TSAA 4DPAX 2VM4A 3TBBA 4KOBA 2XV0A 4AKPA 1OE1A 4A66A 4DP6X 4A2GA 1AS7A 2IDTA 2IAAC 4EF3A 3TA4D 2W88A 1QLEB 2QDWA 3S3CB 1JZEA 5D4HA 2UXVA 3QQXA 3OMNB 1MZZA 1OCOB 2CJ3A 1M9WA 2ZXWB 4M3HA 2UXTA 1DZ0A 2I7SA 1XB8A 2IWFA 1GR7A 2VW7A 3L45A 3QJRB 3S8GB 3TASA 5I6LA 2HX7A 1AQ8A 4E9RA 3NYKA 3X1NA 2HLEB 5B1AB 2H5UA 1WAEA 2ZOOA 5LDUA 1NPJA 1YLBB 5FC9A 1V54B 1NIBA 1PMYA 3N55A 1JVLA 1SF3A 1PY0A 2OJ1A 1PAZA 3FYIB 5F7BA 1GS6X 2R7EA 2FT7A 4Q8BA 5E9NA 2J5WA 3EHBB 1L9OA 2FNWA 7PAZA 1NIAA 3T71A 2FT6A 2DWTA 2PPCA 4DP5X 3NJFA 2HX9A 1AG0A 2Q9OA 1AS8A 2TSBA 3WNIA 2AFNA 1IKOP 3JTBA 3AZUA 2B3IA 2XX1A 3WKPA 2FT8A 4BXSV
chains in the Genus database with same CATH superfamily
1WVZA 3DSFH 3F5WA 5IWLA 1LE5A 1ZA3B 4R84A 4GNKB 4GO6B 4TOYL 3D18A 3HI6H 4NQDE 4KXZI 4PS7A 3REVA 1U95A 2D2OA 3K2UL 3SGEH 2YPLD 2W9EL 1MZYA 2X4QA 3RHWF 2IGTA 5K1JA 1MQKH 2WN3A 1ETA1 2QPDB 3CPUA 5EEWA 3WTVA 5CKGA 1JPEA 1MREH 3WS3A 5BOJA 3ZKSD 4FD0A 3APDA 1ED3B 1ZTXL 1KLUB 4X4ME 3TO4A 4RDQF 1JWMA 5DUBA 4ALAH 4HIQA 3FQNB 4FTVE 2DN7A 2O1AA 3RGVD 2GUOB 7TAAA 3GGWA 1XH3B 2AJVL 3MRNA 2VDLL 1PQZB 5EU7C 4BELD 2PWEA 1RUAL 3LKOB 4F9LA 4WZ9A 2Y7MA 2BIQA 2FRGP 3P69A 4ETYA 1S7VB 1N59A 3VXMD 5GZNC 3S36H 2XWBB 4JQXC 3X17A 3G08A 1GAFL 4WGWB 1AGFB 4FNQA 3ZQXA 5KBNC 3R18A 2X3AA 4PJGE 3T6QC 2PP7A 5FA3A 3RB5A 5DK2B 2XNAB 4MS8C 1MCKA 3OMAB 1CE6B 1T66C 4OTXH 3EO9H 4AGLA 1KXTB 3DGGB 3VDAA 3F83A 1D7DA 5JA9A 2NUPA 1UH4A 2VDOB 1DQJB 3FHEA 1DSFL 1CPUA 1FGVL 1JZIA 4H13C 4JZJB 1MI5D 1VZGA 1RD6A 2VDOH 2KC0A 2Q3AA 5DS1A 5AZ2L 4BDVB 1AXTH 5AALA 3N5AA 4WRLA 2J6EA 1A2YB 3CFDA 5I0DA 2EIJB 1FCGA 2L3BA 1W8OA 4WWNA 5EOTA 3SQRA 3D3VD 2O61A 3MRRB 2VZ3A 4XZ4A 5F6IC 1KYAA 2AI0H 4YMPA 1YMHB 2AZUA 2XC8A 3MA7A 1DO5A 3BEVB 3JYCA 1QYGH 3KMDA 3K72B 2O6FA 1T1YB 2C3XA 2IVFC 3ARBD 3H42H 5EF2A 1ZE3C 4ONGH 1HXYB 3ET9F 3SSGA 3SKNB 1PNCA 4XI5C 4IMLB 4JQVA 2FLRT 3K74B 4QY8A 3I6GA 2I5YL 1WT5A 3PGCB 1MFAL 4HCFA 4M5ZH 4GH7B 5KVFE 4FTVB 5I24A 3QZMA 5IB3A 4LEOB 4HX1A 4MWFB 1XCTA 2HTKD 1TITA 1AZZC 3KPQB 3MR9A 4WFEE 1UWEL 3Q48A 2UZYB 4NZ8A 3FN3A 3EGSA 3KG5A 1ONQA 4UT6H 4LLUB 1PVHA 2EDXA 4E9WA 1TKWA 5I6MA 2HTLC 2GK0A 4MCZA 5E94A 2BH0A 1IBGL 4HPHA 4EZKA 5C71A 3BUPA 4PJGB 1QI3A 3GEFA 3O4LA 3QNXB 2X05A 4L2LA 3FQ2A 5EUOB 3AS2A 2UVEA 3SBRA 2WZPA 1Y6KR 3DX8A 3R7RA 5T1LB 3CJJA 1RUPH 3P3RA 4XC3H 5HYQA 1OT2A 2GITB 2H1XA 1U8MA 4MAYD 4R6UA 1A5FL 4XMVA 5EBMB 4J39A 3CMOH 4QD2E 3B2UC 1XSJA 4JUTA 1DSYA 2JQAA 5DVNA 1CE1H 1T0NB 3VJ6A 2QQKH 3P9MB 1IFHL 2WD0A 3ABGA 5A2BA 2VQ4A 1MRCH 4I9WD 5LQBL 1AOHA 4DWHA 3IAQA 2Y5TA 4PHZA 1FAKT 1KBPA 2D9CA 3BUBA 4JG9A 5IVXF 4OI8A 3QEQD 3T08A 3SDCA 4BE5A 3OLIA 1ACCA 4GY4A 4YIQA 3A47A 4EQ3A 5FYJU 5C0FA 4DK5A 5KJ7E 1XR9A 2Y06H 3Q5YA 3T2QA 5FHAH 3X13B 3TT3L 4Q14A 3IVKB 4P48A 1DVSA 4ETQA 4PJBF 5ELIA 1MCSA 3MRFA 5INCB 1SM3L 5IREA 1M1SA 4OKVA 3QG7H 1WWWX 4IIQB 5CWSA 3H56A 3U6XA 3WAKA 3VFGH 3TA3B 2LE9A 4X4YB 3PYCA 4YSTA 4UINH 1ZJBA 4P23A 4ZMQA 5CD5C 4X50A 2Y25A 2JF1A 5EU3B 4FYRA 1GRWA 2WW8A 1S6NA 3UMNA 4CVXA 3C75A 2AJYL 4G8FB 5ICYB 1BEYH 2DV6A 2A9DA 3OB0K 1GC1C 2GJZB 1X7TA 2RQEA 3FFCA 4N2OA 3ARDB 4NO0D 4LBAA 3QUYA 4WW2A 2WO4A 3N9GL 4M62H 3GO1H 3ZDZE 3EYQD 4HIPA 3GLZA 3CZEA 1AI1L 2XHNA 1XVSA 4PJHA 3CHSA 4PBXA 3WY3A 1P84K 3CDYA 1CXFA 4KO5A 3CZGA 2VN7A 4Z7VA 5JZ7D 4H44C 4YSRA 4K3DL 5L4FA 3FUFA 3MLRL 3QDJB 3QUML 4G7SB 2OL3L 4TXVB 1WYJA 3M86A 3TYFA 4HEME 3SJVE 1X3DA 1QOKA 1EZUA 1ES0B 1UFGA 1W0YT 4KVCL 4B53A 1O0VA 5FYLD 1VF5C 4AEFA 3RYMA 5GGTH 1O5PA 1KJ3L 1W8NA 4OAWA 2C9AA 3ARPA 3LSOB 4JCWA 3NCXA 3H53A 4GRWB 4YDJA 2NXZB 4GRWH 5IROD 1AE6H 1T7YA 4OLZL 5FHBL 1BFOA 3HAEA 1UUNA 2H6PB 4CNIB 4NDMA 3QI9C 3VGFA 3BPOB 3RY4A 3BP6B 5ESVA 1JF6A 5K9KB 1G87A 4FP8L 3RKDC 4N2CA 4E68A 6PAZA 4NO3B 4WTZA 2ZT9C 1NOAA 4TUOB 1RURH 5DJ8B 1OSPL 4BBWA 3BGMA 1P4IL 1G6RB 2V5MA 5JW3L 1JGUL 2B39A 3S35X 3PABB 2HRHA 4M5YH 3V5KA 5C0JA 1NC2D 2FK9A 3MDJA 4V1DB 2JCCA 4Z6AT 3TJHC 2YRLA 4AYEC 1XZ0B 3TO2B 4DTGH 5CO1A 2R29L 1B4RA 5DWUL 1KV7A 3L4YA 4EDXB 1HJCA 2Q8BH 4F57L 5IHHA 1YYML 5TH2A 4WU5B 4AM0Q 3DIVA 1FI8C 2CBQA 4B7LA 1VLXA 4JFPA 4IOFC 3UAEA 4I1RA 4L3ED 4Y16D 3FXIC 4G8AC 2J88L 2FGZA 4QLRA 4WW1B 4H4NA 4XBGB 2FWOB 4BXVA 2J44A 4G9DB 4X9FA 4X98B 2K6WA 4Z3JA 1RHHA 1NKGA 1VFUA 5SWZB 4N90D 2NQ3A 1YECH 5F9WB 1I3GL 5ID1B 3W37A 4YC2C 4LMQE 4Y1AA 5CP3H 2VLJB 5CJ5A 1CFSB 4JKNA 3OQRA 3V8CA 3DX2A 1BV8A 3MRPA 4PWGA 3X11A 4AE0A 1HCVA 4HWEH 1E9QB 2XLLA 4B3VA 2ZYIA 3FSVA 4ECNA 4K8RC 2PYED 2XYCA 3U82B 1S7QA 3QR0A 1BBDL 1Z3RA 3QUZA 2CRMA 1XCQA 4XMWA 1R3IH 4Q4EA 2LLLA 3HIZA 1IM3B 4HPOL 1BFVL 1E5YA 4Z7OF 2VQTA 3M1BB 1P5VA 3TH4T 1G43A 4TNWK 3HE6C 2ESVD 2NY2D 4JPSA 3V4PA 1B4LA 3E6HB 3VQLA 3TH3T 1MAMH 2UY6B 3ZRCC 2FX9L 1S9YB 3MTXA 4DKTA 2VITB 4IMKA 1PL3A 2BP0A 2OX5B 3SODB 1BW8A 3TYGL 3V4VB 2OW6A 1DVFB 2PCPA 2QR0B 5GSRA 3B5HA 3QORB 3MCLH 2VIRB 3K91A 4ZO6A 1DQMH 1KGJA 4PY8I 1CFBA 2QMKA 2WBJB 3JWDH 5SWSD 5IQ7L 1UURA 3QAZB 2BIPA 3STZA 4UOZA 1J0HA 1TZGL 4HKJB 3HZ3A 3KLHC 3L5WA 5EB9A 5TDNA 4TN9A 3DROA 3QWQB 1JCKA 3EO0B 5T1KB 1DE4B 4FG6D 3U4KA 4HJJH 4Z9KB 3T04D 2X70B 1ZGLB 1JWSA 2CO7B 4CGUB 5L6YH 5FOBA 4D9RD 4PS4H 5DJAB 3GSQB 4HJ0C 3FBQA 5DYOA 43C9A 2YPLE 3I9GL 5IEHA 4U1NB 1HX0A 4QYOB 2IEPA 3MRCA 1TJGL 5BJTB 2ZUYA 1CLOL 2BHFA 5I5JA 3BP4A 1PDKA 2XZQH 4N8CH 5D2LF 3U1SH 1JUFB 3F7YA 5FYKD 4WO4B 4GAYB 1RZPA 5L2JB 1HS6A 2F0CA 4KKQA 3R7QA 3B6SA 4RFOL 4P3CL 4HKZA 1X44A 1BLIA 4FEIA 1MRDL 1H3VA 3FUKA 2DQFA 3U7AA 1NC4A 1U8IA 3NJLA 4UIKL 5GSVA 4G72B 4UV4L 4WWKD 5EBLA 1SF5A 4HA1A 3C9NB 2EH8L 4N9OB 3BVUA 5DUPH 3VXME 5F7LB 1PZSA 3BLPX 4QHKJ 3KXFB 3PDOB 5IMMB 5E5MB 3B37A 3SPCA 1CFTA 2Q7NA 3O4OB 4QNPF 4DK3A 1GGBH 4G2AA 1AO7B 1Z7JA 3E3QE 1PSKL 2IJ0C 5LGJB 1NPNA 2OMTA 3BZ4A 5GRJL 4OSUL 4YN3A 1IIIA 4PVNA 4ZQKB 1MI5E 4M93C 3O3DA 4F15C 3M45A 2J1ZA 1P69B 2BRQA 3LKQB 4KY1H 5HHMD 3IDMA 3UBGA 5F1OB 3D3VE 3EJQA 1OLLA 1SYSB 4GSQA 4HW6A 3VD2A 3MFGB 2H9GB 3L3IB 3KR3H 1IMHC 1RI8A 3EFDL 5DTFA 5IVXE 2ZXWB 2AQSA 4M3HA 4O00A 4B96A 1T2QH 1KLFA 1HL9A 4HIEA 3WU1A 2OMXA 2WBWB 2ZKYA 3TBSB 1KOAA 1NBZA 2E9GA 2WCPA 4JRWA 1G7MA 3IWUA 3LNHA 4W9KC 5I66A 5F6HJ 2ISDA 5EU5B 3FOLB 3QUKA 3OKEA 3MRDB 4LDLB 2E9BA 1XGYH 5DR5L 1G5AA 3MNDA 1F6AB 2FEJA 2A38A 5EO1A 4XBPB 3N55A 3ARGD 4IBSA 4PJBE 1ZXKA 4YK4B 4ZUVB 4FFYL 4MMZA 5E03A 3VGGA 5IG7A 1GS6X 2RA1A 3D4CA 1AGEB 3ELQA 3PUCA 3ATDA 3GPEA 3QRGH 1CK0L 4YFDB 5HHOD 5D6DC 2F8VA 3QC6X 4OI9A 1AP2A 1YUKB 5F70A 1RL1A 5AG9A 2VR7A 2VDMH 3HNSL 3D07A 5HDWA 2IBBA 4LASL 1JHLH 4FTDA 5DJ6A 3DO7A 4YBQC 5CEZD 1UA3A 5AOZA 2CO2A 5ANMA 3WKYA 1VEOA 3CXHJ 1V27A 3WKPA 1OIOA 1KWKA 4MD5A 3WL9B 1DVZA 3LEYH 1WDAA 1E3XA 2AK4B 3RPIA 4XPGL 4OF5A 1OW0C 3P73B 1ETJA 2GHZA 3VI3A 4OD1H 1U92B 2NSMA 4XPBL 3AU1B 5FYJL 4BK5C 4ELMA 4Z3TA 5BV7L 4N8VA 5FCUH 4EVNB 4PVMA 1FYTD 5FA4A 3ETSA 5IHWA 4PWKA 2L7QA 1G7LA 4ZK8A 1R33A 1NCWL 3FCTA 3V8OA 2GC4C 3VYPA 4JKPL 5F7EH 1TEFA 3MNVA 3VCLB 3VFMA 5L9DL 4CC4C 1AANA 2QFPA 3D2TA 3W5NA 3BUYB 2NY1B 2HJFA 3QQ4B 1IQWH 4RSVA 2FBOJ 1KJ2A 1JK9B 4MXWH 1KXVA 2BVOB 1NCTA 3HKZA 1FNGB 2EXWC 4OFPA 4F7TA 2MCPH 4ZXBA 3ZTDC 4AYMC 2H2PC 4PRIB 1HIMH 4XOBA 5AW4B 1TQVA 4UF7C 3W0WA 4C55A 1FFNB 3DV4A 2Y07H 4Y5VC 2OYMA 3DO4A 3N0PB 5T1DL 1ZT4A 5I1JL 4QIRA 5GZNA 4JQXA 2YA2A 4MAYB 4NZJA 2VZVA 3IDUA 1YNKH 4TQEL 5T3XL 4MB3A 4RQQA 5DZNA 2VW6A 2VR4A 3PL6D 5I6XC 2DQMA 2PR4H 3KBPA 4PBDA 1KTDA 3NQIA 4JPKH 5L2KA 3K6NA 4MJIA 3KWWB 5FYLE 1HH9A 4B9IA 5FUCE 5IVZB 3QDGD 3L1EA 1SYVB 5IV2A 3JWNC 3DX7A 4TSAH 3OAZH 1ZGLP 1ETB1 3FSZA 2VT0A 2N7AA 4NT6B 5LCVL 5DRNA 1KELH 5CZXD 3CN2A 1DHKA 4P2RA 5DEJA 4YDLB 2EP6A 4ZMNA 1Q9WB 4G11A 4N5EC 1V7ML 4Z7OE 1HEZB 1E43A 3LNIA 5EN2A 3RWIA 4AENA 4K9EH 4DEPB 4A2EA 4YX2H 4WENB 1J5OL 5IMOA 1MXDA 3VA2C 5KSVA 3AS0A 5E8PA 3VXNB 3SDDC 2BPBA 2CIKB 2H0JA 8FABA 3DOIA 2CO6B 4EUPB 4NQUA 4TLTA 5J3HC 2ADGA 1W2KT 3ARRA 4ONOA 4YUEL 5J1TC 1BWMA 2WXNA 5FO7B 4XP9H 1GXEA 2Z1PA 4JN2A 3L3JB 5C0EB 1P7HL 3VQMA 2EIKB 4TF4A 3BKCH 1U8KB 4ZFGL 3CFUA 2FH8A 1GGYA 3LB6D 4KRMB 2XJLA 4GKNA 2H47C 1MN4A 1JNNL 4LPUA 4PAZA 1FVDB 4L3EE 1MF2L 3KJ4B 4K3GA 1SXZA 3HZMA 1RIUH 3KDPB 1FNAA 1NMBH 1KBGH 1TZAA 2BY2A 2ED6A 2DWYA 3KGUA 4N90E 5HHVL 1AZCA 3M88A 4ZUWB 4M4RB 1IM9D 2PW2B 1NBVL 4KGJA 2PTUA 2QSQA 4K71C 3UJJH 5DC2A 5J6HB 1SN5A 3ZL2A 1EXGA 1PY9A 1NDMB 2PYEE 3K2KA 4I3GA 3ULVF 4URTB 3D0LB 4YFLF 1M3JA 3QHFH 1KCUL 4MRBA 5D2LE 3WFZA 4HC1L 5CF3A 3FN0H 3PXHA 5I26A 4PRNA 1U91B 3MGOA 4HBCL 1XF4A 2R2EB 1RKRA 2ESVE 4QRQB 1WWBX 4FX5A 1WFNA 1TU2A 2WLLB 4TM9A 1CG9B 1G7HB 1E4XL 2Z4TA 2DB8A 1FPTL 1AMXA 2A6KA 2FE0A 4J6RL 5IQOA 1EZVY 4QRRA 2FZ3A 5BV7C 2I9LA 3P11L 4P46D 2VH5H 4PJEA 2DQTL 3W81A 2FIKA 2NW2B 2GCYB 5SWSE 3MV9D 2EECA 3VFSB 3H4HA 2DTSA 5E00B 1DQIA 2YBRA 3NPSB 2AAAA 2D0FA 4XMTA 2IMMA 5D72L 1I7UB 4Q6IA 1IGCL 1HAWA 4D2NA 1S7RA 4ODHH 1CD9B 1DDHA 2BP3A 4LSRH 2AXWA 2XUWA 3JUZA 2ZP0T 1UEYA 3P3UA 4C47A 3QIBB 3KH3A 4AYSA 3OKKA 1OPGL 4GXVL 1NFDF 4B95C 4B50A 2VDPH 4LLDA 4L8CB 3G04A 2XTJB 3AG2B 4MMXA 5C0IB 3RX9A 3U4AA 4G59C 1A8JH 1SHWA 4KXDA 3T1WA 1WAAA 1UB6A 1JGDB 4JMNA 5KSUA 4Z5RA 3UG5A 5FYKE 3V0IA 3H2WA 4W9GC 3PCYA 1M6OB 4HFUL 1JZ2A 1U3HC 1KFAH 1SJEA 1QFPA 5C0DA 2X4NB 2Q8AH 2KLRA 3LRSB 5DLLA 1FZMB 4HPYL 1E30A 3WOVA 3MNZB 2CO3A 3NCJH 2BY1A 3BEWA 1KGYE 1RP9A 3E7JA 4PD4K 4Z7WA 3VXSB 4O02L 5BQ7B 1EV2E 4GKZA 3WUZA 2C9RA 1BQSA 2CUIA 5TJWK 3IFNH 5C2BL 2K7QA 1D5MB 4KITB 2MKWA 4FKKA 3OB8A 2E56A 1ZHBA 1ZV9A 1FN4A 5E0QA 5T5FH 2E27H 2YD6A 1ORSB 4NYLB 3CU7A 1J9RA 1ZHNA 2Z92A 5HJDA 2WP3T 4PV1C 1D5ZB 1Z5LB 5HDOA 2FQGA 3V0VA 1NIEA 1AGCA 4OF3A 3R4RA 4POYA 2QVIA 5HHME 1K72A 4PJ5D 2QHRL 1F00I 2P9RA 4Z7QB 5L8KB 4YEFA 4MQSB 1Z9OA 5ACZA 5DJDA 2EO7A 1GH7A 3LY6A 5ECGA 1K8DB 4PJDF 2ZOLB 1C1EL 3D0VA 1S7UB 2CMRH 4M4PA 4P2QB 4XO8A 2P24B 3SY0B 4YHYC 5DMIL 5CGYC 2IO5A 3FQYA 1F2XK 1LO0H 2WLYA 1N5YH 3BVTA 3F5WB 2UXGA 3I6SA 3OR6A 4IJTA 4M48H 5GS1C 1S9VA 1LE5B 5AVSB 3D18B 1LHZA 4N6QA 4YE4H 1YZZA 2R1XA 1DUYA 5HHQA 5I1AA 3REVB 1U95B 3FT1A 4KJPC 2UZIH 3ILQC 2X4QB 2EH7L 5IGXH 4PLJD 4X99A 4JGMA 1TQBB 3HE6A 3FCGA 5HHOE 1JGVH 4BGLA 3WS3B 1DQQA 4HUVA 3A67H 4OJFH 5L8JB 1TNMA 1XSKA 5DUBB 1JWMB 3TEZA 4JRYD 3ZGIA 4J8RA 2AJZA 3GGWB 2ZJSH 1GGIL 3MRNB 3NTCL 5EIIA 2PPDA 5C7ZA 2AK1H 2V2WB 4OQTH 3B9KD 3BRDA 4L23A 5BZWA 3WXVL 5I18H 2MIZA 2GSGA 4LIQL 3SCMC 5JIIA 1N59B 4DO5A 4JO3H 3G08B 4JY5H 4L8BA 4ABQA 3L4XA 3O4LE 2WV3A 3PP4L 5FA3B 4KHTH 1FNLA 2ED8A 3MC0A 2J12B 3ZKXC 4FA7B 1IGJA 2HFGH 5T33L 3ISWA 5KBPA 1FYTE 5DI8A 3L9BA 2Y5QA 3RP1A 4CSZA 3BD3A 1F6LL 1C7TA 1Y7VA 2IADA 2WO3B 2ZCLL 1QVOA 2X3CA 2EUXA 4YLQT 2ITCA 2Q0ZX 7FABH 3CFDB 3G5XA 3RG1C 4DGIH 4UZSA 5EOTB 4JN1L 3EJRA 2O61B 5IBUG 2YD8A 1JV5A 3GZQA 3ARGB 5DVKA 1HNFA 3GBML 3MA7B 1XF2A 3TOPA 4DZBA 4AG4L 2IG2L 1B4TA 2W92A 4K7PH 5JHAA 3PJSB 2OR9H 4JFDA 4OGAC 5FGBA 4NQXA 3MKKA 2ZPKL 3QUMA 4QY8B 1PX8A 2WVVA 4UANA 1GSKA 1E6OH 3FDWA 5FK9A 3C60C 5LO7A 1BQ5A 2ZXAA 1UT2A 4AEHH 5IB3B 2TSAA 4BYHA 4ERSL 4HX1B 3FU3A 1RJYA 1XCTB 4G6JH 5KVEL 1OM3L 1YJDL 1A3LL 3V6FB 4HDIA 4A2GA 4G9FA 3EGSB 1ONQB 1EHXA 1BM7A 3L3HA 4P5KA 1IAIH 2KUTA 4ZTPH 1JDCA 1TKWB 3TA4D 5ESQA 2GK0B 5IBTL 4MCZB 5E94B 4NGHL 3S3CB 1ZVHA 1AHWC 3JWOL 4MQXD 1JYVA 2JWYA 3QDAA 4U49A 3O4LB 4F27A 3GLAA 3VWKA 3BPCA 3DX8B 5CCGE 5KYXB 2IWFA 5E6UB 2EVHA 3QDGE 5IQ9A 2COVD 3TEUA 5I6LA 5HYQB 1U8MB 5AW5B 1BMGA 4JG1L 5B1AB 4HSQA 3VJ6B 4J2QA 4MAUH 2NNXA 5I1CL 1VIWA 1LE9B 2R29A 3AADB 2MOGA 4DEUA 4DH2A 3MX0A 5A16A 2Y5TB 2AEQL 5CGMA 1SF3A 2EEFA 1V3JA 3SDCB 1PYWA 4ELMF 1Q0XH 2BERA 1AXIB 2OJ1A 3HE7C 3RZWA 1YEEL 5K5YA 2IC2A 2AGJL 4YIQB 3BD5A 3P30H 2X2UA 4N2MA 4HLEA 5C0FB 1J10A 1PZ2A 4DEWA 4OLWL 2CRIA 3AC0A 1IILE 3H2PA 1RU9H 4X83A 3C09C 1XR9B 4AGMA 4GUQA 4WKZA 1TTAA 3L3OC 2JK5A 3B1UA 3V52L 4KTDH 4ETQB 2M8XA 5D6DA 4Q9QL 3MRFB 3IFLH 3VH8A 4OKVB 3U7WH 5CWSB 5D7IF 2AEIT 2DLTA 1A9BA 4OM0L 3WLWD 2QMJA 2AEOA 3L9RA 4P23B 3NACH 4JNXA 2WXJA 1SFDA 4CVXB 1ACYH 4BM7A 5CLXA 3GK8H 5D1QC 1XH0A 2EKSA 1HQRA 3L17A 1NMCC 4FI8A 2VZUA 1B9ZA 3D2UA 3DXAD 3QFGA 4X8JA 4BFGA 1BMZA 1JTOA 1WUNT 3FFCB 2XN2A 4WW2B 3ZO9A 1OW0A 4B0MM 4PGBA 4NFBA 3D85A 1ZLUH 4M03A 1JFHA 1NFDE 2CHWA 1J5IA 5EO9A 5C0CA 2YAOA 4BK5A 4TVUA 5ILTL 4PJHB 4L8SA 5IP4A 1LDPL 3O8XC 3ULVH 3GEWB 3CFJA 5IJCC 3T0DA 4IKKA 4Z7VB 1I1RA 4F93B 1RHFA 4LEBA 3TYFB 2CCVA 2ZCHH 1IC4L 1IT9H 5HYJD 4F2EA 4CC4A 4M8QA 5EZOH 1NCGA 4OAWB 3NZHH 3SE8H 4YDJB 4A55A 4D0CB 5A6LA 3R1GL 3VD4A 4A6YL 2XZAH 1BFOB 2IH9A 2VDRL 3HAEB 3APMA 2A6DA 2P80D 3QXUA 4LSQL 2P5EA 3HAEH 4IRZL 2A6JA 3MBXL 4NDMB 2OCCB 1X4YA 1OE3A 3MV9E 3OMIB 3TJEH 2YPKA 1UD4A 3AG1B 5ESVB 4RNRA 5GRUL 2XWTA 5FGCE 4ZS7H 4Y5VA 4ZFZA 2XETA 4TVSa 5JIHA 3TVMC 3T6XA 3L1OH 1T5KA 5E70A 1WO2A 3US9A 5LBGA 3PLYA 2DJ4A 2UVFA 3BGMB 3KVQA 4IBZA 2VDNL 2HH0L 5C0JB 4EXPX 4FQLL 2JCCB 2EYSA 4XWOC 1EZLA 2NTFB 3T9WA 4ZFOL 1WA1X 4L18A 5ISZD 2DD8H 3II2A 2CDFA 3HS8A 4AT6A 4UM8A 3AXHA 4H88H 4HIHA 5CZVH 5CJXA 3R8QA 5JOPD 4XCYA 5D6CA 5TH2B 1E8WA 2GFBA 2K6ZA 1JPSL 2CXGA 5TF1L 4PJDE 4G3YH 4WFFD 2YUVA 4JFPB 4LNRA 2GIXA 3BOVA 1OWWA 1AS6A 5TQ2L 4M6OL 2VLME 2O6PA 1YJDC 2IPTH 4D9QD 5CLWA 3MBED 3D09A 1RHHB 3OLDA 1WHPA 4Y1AB 5GHWL 1SXAA 3X11B 4ZS6D 3JWOC 5HGHA 4C56D 4ZZFA 5JO5A 1PZUB 3UG3A 1HFUA 1WQVT 2NXYD 3N06B 4NXSA 3RX5A 4KZ0A 1IL1B 2F9BT 4ANVA 4E5XA 3QUZB 1XCQB 2EDKA 3NFPA 3THMH 2HRGA 4JGUA 3NVQA 4KRPC 5TF0A 3ZL4H 1FG9C 1P5VB 2DQUH 1BXAA 2W9DH 3C2AL 2N1TE 3A4AA 4RX4D 4FQ2L 2FJGA 3V4PB 5F88A 2Q7YA 4Z7UA 3V4PH 3LZNA 4JPWH 4W9HC 2BIIA 1S9XA 2BP0B 4GOSA 4LLWA 4HGWA 5KOMC 4PJ5E 1KCKA 5A2FA 3K6DA 2PCPB 5GSRB 4YDIL 5AOIA 1QNZH 2QGDA 3Q8CA 2JJUA 3Q0HA 1CXLA 3GXUB 4FFYA 1F1DA 4Q9RH 4ZW5A 3MV7A 1AY1H 4OCLC 3STZB 3VMNA 32C2A 3QIUC 3KVDD 2NZ9C 3L5WB 5TDNB 3CDCA 3RNKA 1T0MA 1RP8A 3DROB 3KZ8A 3B2DC 1YY9C 5EF0A 5EF1A 1DANT 4RZCA 4XVOA 5SV3A 3IJYA 2V9QA 3LRGA 4WEBH 3F3HA 5TD4A 1JWSB 2F74A 1CWVA 43C9B 3CG8A 2JJWA 3IJEA 3QH3A 4UILH 5DYOB 3U4BH 2E0PA 5CINL 4NZUH 1CN4A 3OZKA 3B56A 5IEHB 3B7RL 2ZX7A 4M3KB 3MRCB 2DOCA 3FTSA 3FU6A 5D7JC 3BP4B 1PDKB 3VRJA 3EBGA 3F7YB 3KL0A 1TYJA 1GOHA 1O9ZA 4PJIE 3REWA 1OTUC 3WSQL 4NNPL 4JRYE 1EPFA 2PN5A 3ZTNH 3B6SB 3D05A 2BZ7A 2XZCH 4HKZB 4NI3A 3F58H 4ENZA 2VABA 3B2MA 1R1CA 1BGXL 2DQFB 4K5NA 1NC4B 2O93L 4FXLA 5GSVB 5DMYA 2DQEL 5EBLB 4D9LL 2QQNH 1RLBA 3V7MA 4KUCD 1JMZA 2Q5BA 4DPRA 3F62A 4UTBL 1G0DA 1K4CA 1NAKL 3MJWA 5GRZA 2X09A 4LCWD 4ZMZA 3SOTA 4OI7A 2BY3A 2P8PA 3EJTA 5F96H 1CFTB 2IDQA 2J3SA 3VWJC 1LD9A 4A38A 3WJMA 3ME0B 4XN7A 1CLYL 2OMTB 3UMTA 3BZ4B 5ANME 1CVRA 3HB3B 3LZRA 4J3TA 1EEYA 2CPCA 5CJQH 4EJ1C 2G3ZA 3SOBL 3O3DB 2HRLA 4GEIA 2EABA 1MEXL 4N0CD 3AGVA 3MJ6A 3QA3A 4PGDA 4BKSC 3IDMB 3PV6B 5EWIL 2CA4A 1HE7A 2FUTA 3IDYC 1MSPA 5E1QA 2P43B 3VTMA 2W59A 4L1BA 2CGRH 1U3HA 1R24A 4U3SA 1PIFA 5DTFB 5I1HH 1PLBA 1WC7A 2Y6SC 4ELME 1KLFB 4RISL 1MFNA 4HIEB 1EGJH 2OMXB 3RLSA 1IAII 4X7SH 1NBZB 2K8QA 1HHKA 1G7MB 3FZUC 4KBPA 5I66B 1QFUH 5DURD 3BP5A 1UA6H 2F54D 2J20A 3OKEB 5FUOL 3GI8H 4FQ1H 2X89A 4XVTL 2XFGB 3ULUL 4B7IA 5AZEH 5J5EA 2B15A 5EO1B 4XNYH 5KVGL 3AT8A 3LIZH 1FVEA 3GZOA 4LFHG 4E2OA 2LT9A 2J7LA 2RBLA 3VGBA 4MMZB 5IG7B 4KUCF 3MODL 4GQRA 4JR9H 5D7IE 2FJSA 5LCVA 3OMZA 4ODBD 2WUBL 4DAGH 2WXFA 1IGTA 1AP2B 4Q6YA 2Z31A 3AT9A 3T6VA 1LP9F 3NA9L 3HFML 4OFKA 4PGEA 3NAAL 4HKXA 3KYOB 4ZO7A 1JD9A 3K7UA 3DO7B 5DJ6B 1JNHA 3ZUNC 1EMTH 2K78A 2WGXA 4P5RA 2WVUA 5ANMB 1MHPL 3MLYL 3ZDXF 4MNHB 4N8VG 1XF5A 4MKTA 2WKOA 4MD5B 4NQCA 3OHMB 3RZCD 4ILDA 1ETZA 3RPIB 4NZTL 3OZ9L 1CZ8L 2OCJA 3QJQB 3T0EC 2CR0A 1PZ5A 5F9DC 3A24A 3OKOB 4RGNE 1Q0YL 2XKNA 2GJJA 1QKZH 1YN6A 3VI3B 5BS0A 1H6UA 1HI6A 4Y2DC 4ELMB 5GS1A 3MREA 5LXGH 3QCVL 5KEZA 2VYRE 4LAQL 1J48A 5FA4B 2CHZA 1G7LB 2EZ0C 4OCRL 3FCTB 4M6MH 3ZZ1A 4F7CA 3VFMB 3MNVB 2XV6B 4GO9A 2F1BA 2HJFB 3DPBA 1WA2X 4OD3L 2AXJA 4RMBA 2MWCA 3N6YA 4R8WL 1PZBA 2EXTA 1KJ2B 4HUWA 3UJIL 5JW4Q 4AYBA 2BIMA 1N7ML 3NH7L 4U1SA 4F7TB 3QUHA 4I85A 4ICWA 4PRAA 4ZXBB 4BCYA 3SPHA 5B4MC 4HC1A 3HNTH 4ANKA 4UBDD 3CDGB 4KI5D 3W0WB 2B5IB 5ADPH 3DV4B 4AL8H 4JVWA 2HT4C 4JBSA 3DOHA 4XP6H 2FL5A 4EEEA 4L2YA 3DXAE 1A8ZA 3VFRA 3SCMA 3KW8A 5ADOL 2AERT 3HHRB 2JI2A 4N8PA 2R0LH 2BNRD 4PTTA 2IQ9H 2VO8A 3A6CL 2YD2A 2BC4A 4RQQB 1U33A 2UYLA 3BC9A 3O9WD 3ZU8A 3E38A 4TUKL 4YL9A 3T1FA 4P59H 1KY6A 2H0FA 1NFAA 2A73A 3W56A 1G4MA 1F6FB 4G8GA 1A4KA 4NN6C 5JR1L 2G4GA 4RGNB 1KTDB 2EDMA 3AREC 2VMDA 2G60H 2YFOA 5L2KB 5HYJE 4MJIB 5B38A 1MOEA 4BZ1L 1HH9B 2X5PA 1CYXA 5BZXA 1K5NA 5DQDH 1PIGA 3SYPA 2CBTA 2FX8L 5DJ2A 2OW7A 1AFVH 1QFWI 5B39A 5F6IB 1AKJD 5IV2B 3IWVA 3DX7B 5CKAA 3LN4A 5IHZA 4AGPA 2H0PA 1D9KD 1UQSA 3MLWL 4ODSH 5E9AA 4X8XA 1Q72L 2W65A 5DRNB 2GJ6A 4JRXD 4P2RB 3MOAL 4LNVA 4TLSA 3BIKA 1X5JA 1H8SA 1DQLL 3HC0A 4XVJL 5EN2B 2Y7OA 3RWIB 4DGUA 2DWDA 2NY5H 5GS0D 5IMOB 1BPVA 2V3EA 5C08A 5KSVB 5E8PB 5GGSY 4X8CA 1ZVYA 4KI5F 5DQ9A 3GT6A 2UXVA 4LCCA 4O9HL 3FU0A 4W68A 2ZP8A 3FF7A 4QRRE 2N3JA 3LKRA 3RIAF 5ISZE 3ATAA 4JN2B 5D4QA 2OMVA 8CGTA 5IFAL 3A4DA 3AGWA 3VVWA 5JOPE 1NCAH 4GMTH 4JO4L 2FX7H 3Q8FA 4O02A 2F5BL 3KPNA 5ICUA 4FG0A 1P53A 2VZ1A 4E9RA 1AD9A 1MRFL 5BZDA 4M8VA 4FJYA 3G3LA 4CUCA 1G9MH 1LTXA 5C0NC 1X5AA 1F4XH 4L5FL 3HZMB 1J18A 4HWNA 2UWEA 1BPLB 3OHXB 4D9QE 1I9JH 4L29A 3MROA 3U9UA 4B6ZA 2PXYD 4JW3A 3U9WA 2ERJC 4CJ1A 1PAMA 5DYFA 1YEWA 4OCSL 1NKRA 3PXJA 3ZMNA 1YSOA 4C56E 3U30C 4F7MA 5GGVH 1TTFA 1WBZA 1IV8A 1EFXD 2X4RA 3AY4C 4R5VA 3X3FL 3L4TA 4ODVH 3UAJA 3ZMEA 3BXNB 1A6VL 1SPDA 5AOKA 3ILEA 4IBWA 5LWYH 2TSBA 4AVKA 4PRNB 4O5LH 3SE6A 4KK5D 2MJWA 1FH2A 4BSJA 5GZOC 4Y5YC 1ZVNA 4U4IA 3ZL1A 2ICEC 1E4JA 1AVAA 2CCLA 1TU2B 3KYNA 3L3OA 2FEEI 2HCZX 1MJ7L 3IRCA 1MLBA 2A6KB 3QJVB 2JKXA 3WNKA 4LSTL 4E41A 5DHYA 4Y4HC 5B3JF 2P3YA 4QMEA 4QRRB 2FZ3B 2OJEA 2I9LB 3KPRD 4PJEB 1G0YR 2GY7B 1BEXA 3NIGF 4TOYH 5FECA 2FIKB 4X6BB 3NESA 2JTDA 1GJIA 3K2UH 2XRAL 3W82A 2GQHA 1CGXA 2YBRB 3QR2A 2B9BA 1LEKA 5AW1B 2BVQA 3DJSA 4Q6IB 3NSCA 1QBLH 1S7RB 3B4NA 1DDHB 4DP9X 3F00A 5HVHC 1ZSDA 3IDXL 1OVZA 1ZTXH 3LVEA 5KW9H 1F8TH 1A7RH 1JXFA 3O8XA 2PP8A 3IKCA 2ROYA 2VDLB 4JREC 1XTMA 2AJVH 2FQFA 2VDLH 3OKKB 4Y4KC 2A0LC 4JY4B 2W80C 2HX8A 1EDYA 3G04B 4MMXB 2QQLL 1A9EA 2XWXA 5DD5L 3UCRA 3MLXL 1J9QA 1TJXA 1UB6B 3E8UL 3PHSA 3SD2A 4Z5RB 5KSUB 4PU2A 4X0NA 2FUQA 3WXWL 3M1CA 4DETA 2X6CA 3DHPA 1SJEB 1GAFH 4HK3N 5C0DB 4YXHL 1T2XA 3BGFC 1F58L 5C09D 1GZQA 3IM1A 4P04A 4NUMA 3VB9A 3BE1L 3OAYH 1NZRA 1OARL 4J3BA 1QHOA 3BVDB 2PO6A 3GJFA 3BEWB 1IARB 2LLGA 4Z7WB 3RFZC 4EIZC 2NYYC 3DGCR 4XXCA 2IQAB 2FR4A 1OCRB 2X40A 1DSFH 1FGVH 4GKZB 4NX0A 4TVPL 3TVMA 3LPPA 4GSDL 4LCWE 3ES6A 5CFAA 1Z0MA 1BQLH 1ZHBB 5I15L 1IZJA 1FN4B 5CZKA 4HZLA 2LR4A 5C07A 1LP9E 4NUQA 4FLRA 4XN1A 1ZHNB 2Z92B 1EO7A 5AVXB 2MFNA 2XN9A 2EVFA 3AACA 2Q10A 2ZUUA 1BOGA 1AQHA 1YEGL 4QF1A 3V0VB 4WKXA 1NIFA 2BDNH 4EN3B 3ESVF 2FLBT 4OBSA 5HI4C 3ZDXE 4L8DA 4X4ZA 4AQEA 3GMQA 4I3SL 5SX4I 2HPTA 1XBDA 1MFAH 3RWFB 1OF0A 1JFQH 3T3MF 4JG0L 3FUMA 5HGBA 5DJDB 5F7MC 4LE8A 3WDHA 3PHAA 1UWEH 3BVWA 2LV4A 3D0VB 2N4IA 2YARA 4YC2B 2XICA 3AS3A 4P4KC 1F56A 3KLKA 2F54E 1IBGH 3FU7B 4X80L 1QRND 2WJ5A 3BN9C 3OR6B 1S9VB 4ACTA 1R19A 2R1XB 1QACA 3OZLA 1DUYB 4OZFG 2XWDA 1IVLA 1MFVA 3VGAC 3W3BA 5HHQB 4NC0B 5LB1A 1X5YA 4POZC 1A5FH 4X99B 1OGTA 3LXBA 2XKSA 4N0UE 4OCYL 4GRMA 2XIIA 1U8HA 4LPWA 2VM9A 3HE6B 5AW8B 4DKFH 4I87A 1DQQB 1SUJA 1IFHH 4HUVB 5ECJE 1G0XA 4PRHA 5LQBH 2E8ZA 4FQXD 1YA5A 2OSXA 2J25A 3KNBA 3T65A 3CU1A 3GD1C 4J8RB 2AJZB 2WZ0A 4XODA 4HS6A 4H8HA 5EIIB 2RAMA 5KAQG 2I7OA 3P4MA 2X41A 5D70L 1KJMA 1W72L 5BZWB 4F8NA 4QGYA 2EICA 4K15A 3UC0L 2GSGB 3L81A 3UO1H 5IESL 4YSSA 3QIUA 5CD3A 2A4ZA 1TZOA 3PAVA 4L8BB 3TT3H 1ET7A 1ICTA 1UZ6E 4AVJA 2BSEA 1JDAA 2R9HC 1EQWA 1IGJB 2HSIA 3INUH 3TT1L 5HYEA 2VOTA 5DI8B 2K9UA 1FFRA 1GY2A 5DURB 3P2DA 2IADB 2VDKL 3WTYA 1A22B 1MCJA 1L7TL 1QVOB 2H0EA 2ZWNA 3B83A 1WD8A 1XQ4A 4WSGA 1P6FA 1FAIL 1JL8A 2ITCB 3J7HA 3CH8A 3L3GA 4LCVA 3G5XB 5D7JA 4YHIA 3LKPA 5IF0A 3BYTA 5GGQL 4HCRL 3BPNC 2YFNA 4JFSA 4H1LG 3ISYA 3N9GH 1G7JA 2BS9A 1XF2B 1ZLWK 4DZBB 4FNLH 1XD0A 4KZDH 2B14A 2KI6A 3V6ZA 5D7EA 3WMSA 3DX1A 4KI5E 4MQTB 4UT9L 4JFDB 5HVWA 3S0PA 3KCWA 2D3NA 3O3AA 5HDBF 4LPXA 3QUMB 1DQKA 2QV2A 3FH7A 4K3DH 2WVVB 3QUMH 4OFDA 5FK9B 3ZR5A 3T5WA 1CB4A 2D0GA 1GPOL 1NH6A 1RJYB 2BNRE 4KVCH 1J1OL 3GMLA 4HT1H 3DYOA 4HDIB 4G9FB 1JPFA 4A6YA 3L3HB 4P5KB 4KK8C 4TTGA 3KPLA 4JPVL 2Z0BA 4JKKA 5ESQB 4IRZA 4KKLC 3SE9L 4N2FA 1B3JA 2D7OA 1KG0A 1MIEH 1GCFA 2JKRM 1QNIA 2H3KA 5DJXA 1MW1A 4HUCA 4IJ3C 3RVUD 3VWKB 3BPCB 4FP8H 5JQHC 4OZGA 3UYRH 5IQ9B 2ADIB 4UQBA 3QSKB 4M7JL 3FNKA 1P4IH 1JGUH 4HD9A 5BNXD 1SXBA 1YEKL 2JJVA 2BZCA 4ZFOA 2K45A 3CSFA 4JRXE 1KTCA 4Z3GA 3MX0B 5A16B 3SZKC 1MAJA 2E5EA 1OP5K 1JHTA 4F57H 2EACA 1FGNH 1YYMH 2ZONA 4I2XE 3BWUF 2XWJB 4ADJA 4PB0L 2X3BA 3ZZQA 4R26L 3BQUD 4GW4A 1NANH 2BOCA 4LP5A 1NGZA 2EEAA 1FG2A 2K3HA 1IIKA 4JZNB 3Q5OA 4L3CA 5AW3B 5B3JE 2W1NA 1JZ6A 4KH9A 4WKZB 1I3GH 3E80A 4NP4H 3VDBA 3NIGE 3LYRA 1D2OA 2BNRB 3AAZA 2KKQA 4L4JA 1NGWA 1F4WL 2Q3ZA 3VH8B 4MHHI 3IPBA 2FCBA 4GI9A 1RERA 5AZUA 1A9BB 3JZYA 3L9RB 3CX5J 2Q1EA 2NX5D 3NCFB 4L37A 1D6VL 2XXMB 5F1SA 1BBDH 1U8JA 3OG4B 3RDTD 4JFVA 3QEHB 3N3EA 1SDDA 2X10A 4PH8A 4JKWA 2QL1A 2EKSB 1HQRB 4JFEA 3DSFL 1BFVH 4X8JB 3D2UB 3DVGA 1B4JL 1HZHH 3HI6L 3V9EA 3T0EA 1GA2A 2ADFH 2IDCA 3H9SD 4PGBB 4PMFA 3D85B 3EADA 3NCWA 3GUTA 1VA9A 2UZPA 2FX9H 5EO9B 1D9KB 1VESA 1A7NL 2BNUB 4Y2DA 4L8SB 1QW9A 1FSKC 3CFJB 2XQYA 2NY3C 4ZODA 1SLXA 2YKLL 3ROLA 1U4FA 3I2CH 3AW5A 5IB4A 5H35A 2ZNXA 4ZO8A 5E5RB 3ARQA 1N5AA 2W9LA 3B7YA 3EOAA 5I8OH 4P2OC 4PJ8D 2Q76B 4M8QB 3WFCH 1BECA 3GSUA 5CSGA 1H8NA 4JZOA 5IVOA 4G71B 3T2OA 1FWXA 5CN2A 2QADB 2ZUTA 1T22A 3ZYZA 2A6DB 1MHHA 2P5EB 3KPRE 2A6JB 5JDJA 3S36L 3NRQA 3WEXA 1WGOA 3NIGB 2FIRT 2YPKB 2BX5A 5DO2C 5GQBA 4RNRB 3I9GH 4N1HB 3ZE2F 1UM5H 3KJ6L 4Y5VB 3V6BR 2F7RA 3ZSSA 4HK3J 1SGKA 2PPFA 3D39D 4Z3HA 1TJGH 1CLOH 4LZKA 3GNMH 2EUVA 5AL8A 1BYPA 2EYSB 1AXTL 2OMUA 4W4OC 3WHE0 5JW5A 1R3HA 4BZYA 3K46A 5I28A 2CDFB 4TLUA 4RFOH 4AT6B 4CADA 4P3CH 5I6XB 2FB4H 3JWNG 1SVBA 4UM8B 4HIHB 2C9XA 1MRDH 2XY1A 4XCYB 4K0OA 5D6CB 1RPQA 3IJ8A 4KGLA 2GFBB 5A3IC 1QYGL 4UIKH 4BV1A 1DL7H 3HHSA 3QQNA 3EH4B 4LNRB 3HMWH 4UTBA 1TLMA 2R0ZL 1OF2A 5KSBA 3N04A 3DJ9A 4H2CA 4ONGL 1EJ8A 4QHMA 5C09E 1XR8A 2CLRA 4KROC 4CBZA 1ZLSL 2EDOA 4WI0A 4M5ZL 3GXPA 1XMWA 4JM2D 3SDXA 1PKQA 3CFBA 1R46A 2W88A 5AB2A 3RWHA 2K9FB 1XTLA 3LOWA 5HGHB 3M6DA 4OSUH 5JO5B 3ECWA 3HPLA 2EJ1A 2BIHA 2J1YA 3W9DA 4UT6L 3V10A 4E5XB 2NR6D 3NFPB 2D4FA 1V7NL 3M7FB 1E8ZA 2ZKHL 4Y89A 4RA3A 1HC1A 3EFDH 4AYFA 4LGRB 1JZ4A 5FCSH 2CK0L 1D5IH 1L4IA 5T3ZD 3SY6A 5F88B 2Q7YB 4C57C 4Z7UB 4D3CL 4OT1L 3ZY7A 4OF6A 4OVVA 1EXUA 1S9XB 4LLWB 4LL1A 5K1NA 4HGWB 3HN8A 2XCMC 4BFBD 3ARZA 1PEZA 4R5TA 3HRZC 1MRCL 1N3NA 3N50A 4P5TC 4G5ZH 1E3ZA 3TPUA 2FD6H 3T3MB 2X7LA 1BM3H 2H32B 2ZXBA 5JYMA 3WELA 2H32H 1VFAA 3OGOE 3WCYA 3MV7B 3WFHA 1A25A 4FFYH 32C2B 2CR3A 3LCYA 4MDIA 2FT6A 1YC7A 4XCCL 4FABL 3PF2A 3RNKB 4WV1C 1T0MB 3CZLA 2P49B 4R90H 4FOMA 1CK0H 4IU2A 1NA8A 3QUXC 1QRNE 3EOBA 2NNAA 2B3IA 4JAMB 2HVKA 5EZJA 4RFNC 1U8OA 4P0DA 4BFRA 2Y06L 4L4VA 1G1OA 5HDLA 1A9VA 2F74B 2DY2A 1PD6A 1SJVA 3IJEB 4LASH 3QH3B 1N2RB 4NOFA 3ZPDA 4Z0BL 5KVFL 4J5VA 4TNGA 3CLFL 1HHJA 1HL5A 5EC1A 1ZY9A 2P4AB 2QPEB 2IAND 5AEAA 3CN3A 2VQ1A 2VRAA 3QEGH 4X8GA 5F0JB 3VFGL 3VRJB 4Y5YA 5GZOA 4G70B 2ICEA 5AKVA 2UUDH 3TTYA 3QNYA 4WJKB 1XHHA 1S7XA 5HDBE 4KJQC 1J8HA 4Y4HA 1IBZA 5JIQA 1A4CA 3P2BA 1BEYL 2C9UA 3CE1A 4LP4A 3NN8B 1UFUA 4XPBH 5FYJH 2VABB 3U4EA 3BIAX 2P7TA 4LKCA 2JELL 5HI5C 2HT3D 4HJTA 1EJFA 1WZ1H 1FORL 1OEZW 4YS4A 5HJBA 2BVPB 4ALAC 3HBPA 2ARJA 3LHPH 4NBZB 3PNRB 3QIWC 4OU3A 4XMPH 1K4CB 2HP4A 1SN2A 1YAIA 3MV8D 4JKPH 5L9DH 4IGBC 3RL2B 3S5LA 4IBVA 4N3UA 4Z23A 1P6WA 4ONFL 2AV7A 4JFOA 3CZNA 1LD9B 3WJMB 3KD4A 3DK0A 5FV2A 4GLRH 5GGTL 1EEYB 1JZ3A 4XAKD 3RFRA 4Y4KA 1N68A 2KLSA 4ZMYA 3H2QA 1AE6L 3QA3B 4H8UA 4M6NH 4PGDB 4S2SB 3WY1A 4B9GA 4FJ6A 5EOQL 4AYGA 3GTNA 1U58A 4EI6A 1U2CA 2WKLA 2PCFA 5JYLA 4ZMOA 1U3HB 1R24B 4FYSA 4U3SB 3QVAA 5LGHL 1WC7B 5T3XH 5KTEH 2Z3FA 1CLCA 6CGTA 25C8H 2ZTBA 2J2ZA 1NFKA 3H0TA 1HHKB 4Y4FC 4N0RA 2V7NA 3QFJD 3RFZA 2JFCA 3BP5B 2DTML 4PJXF 4M5YL 4MZRA 1WRFA 1JGEB 4BKLA 3B7TA 1RLWA 2Y1YA 4JY6A 4BZ1A 4IRSD 2OFQA 1KB5L 4YSAA 5F9OH 1FVEB 2F5AH 1XL6A 1B0GA 4F3FA 1CICD 2J8UF 3DX0A 2XVBA 1XCXA 2IOMA 2VLRD 1CXKA 3ZE1F 2HZHA 1IGTB 1OGAA 4PW3A 2Z31B 3S37X 1XH1A 3UGEA 3NIDF 1V7MH 4PGEB 2OMWA 4GRLB 4HKXB 1WPCA 1TVHA 1JNHB 5D1XA 1J5OH 5H4YA 5EU6A 4HWEL 1NANI 1MFBL 3EGDA 4FLSA 4GUOA 4U05A 1MCPL 1XF5B 1MCOL 1BP3B 4ZFQA 4NQCB 4TRPH 4OCMC 4WNQA 2BXYA 5AB0A 4K9JA 1YC8A 4ZRGA 4YHYB 4ZFGH 1Z3GL 3HZKA 3WN5C 5FDYA 2XKNB 4QRTA 1CURA 4TUUA 1RPUA 1YN6B 4PV8B 5BS0B 5GS1B 1HI6B 4NXKA 3MREB 2HLFC 4ODWA 3BAJA 3QFDA 1MF2H 3K2IA 1MJUH 4HOXA 1JMXA 1H8LA 3LS4L 5B7MA 1ZA6A 2X4TA 2XX0A 5HHVH 1HSAA 4F7CB 1D5XA 2WNXA 3DIFA 3LXCA 3ETBF 3O41A 3C5SA 5JORA 4P3WA 3DPBB 1VEPA 3A23A 1D7CA 1DQML 2J72A 4MYPA 3ZE2E 4HUWB 4ZO9A 4U1SB 4MYWB 2NX5E 4C59B 4PRAB 1N19A 1TVDA 3O0RL 4JJHA 3SDYL 1WFJA 1KCUH 3VFVA 1A7OH 2DM2A 3R0MA 4JHWL 1JRHH 4LHUA 3P4NB 2X6BA 4LFHD 1WS8A 2FL5B 2ENYA 4TSBH 3VFRB 5EDXA 4HJJL 1TIUA 4HBCH 3SCMB 2MQ0A 3UACA 1CXEA 2VMJA 3H9SE 2XTLA 4PTTB 3TA3C 3FUJA 5B38G 1E4XH 2BC4B 2OTUA 2X28A 3ZKXB 3ZXAC 2UYLB 5BW7C 5B39G 1Q94A 2ZUQC 4J6RH 2XZQL 4N8CL 3RRQA 3T1FB 3QCUH 3ZTCC 3RU8L 3U1SL 2A73B 3KLSA 4K07A 3P11H 4G8GB 1MKFA 4JO2L 1A4KB 1ODAA 3ARDC 3EHBD 4ZW6A 2DM7A 3KPSD 4EI5A 2EO1A 3R0NA 2IBZX 4Q9BA 4OZGF 4X7DC 3FL7A 5B38B 2WXRA 3SDAC 2EILB 1K5NB 3DX6A 2XWCA 5D72H 5DJ2B 4PR5A 5B39B 5F7HA 5I0YA 3E0GA 5L0QC 1NIDA 1IGCH 1RZFL 5D71H 3F6JA 3HS0C 1L5GA 1T5XA 4X6CF 3JSSA 4GQ9H 1HILB 2BRRH 2W65B 4GIOA 5DUPL 1GW6A 2GJ6B 1UWGH 3IBEA 3BIKB 3PY9A 1KJVA 2JQMA 3UBXA 2F1AA 3HC0B 2E7CA 1OPGH 3LNGA 4JANA 2DWDB 3D39E 1KGWA 2ZXGA 4ZJ9A 2CBOA 4JB9L 2NX5B 4DUVA 1X7SA 5EPMA 1R3KA 1LLAA 2AP2A 1H19A 4KI1A 4Y5XA 5DQ9B 4E41E 3KM1A 4HFUH 4LCCB 1T1ZA 3QDMA 2VE6A 2ZAGA 3LKRB 3CN0A 3V9FA 4F7PA 4QR7A 3O6KH 3V6OA 1BD2A 2OMVB 3BWSA 4HPYH 3N40P 2VN3A 4EDWL 2PYFA 3ABMB 1QEWA 1OD7A 2D3VA 1CUOA 3KPNB 3OKDA 4O02B 1V05A 5HHNA 3LKNA 2CHNA 1AD9B 1N0XH 5BZDB 1T2QL 2WLIA 4YDNA 1G9EA 1OK8A 3ZRFC 5F72S 4PJ9C 1U8QA 5C2BH 2UWEB 3NSJA 4L29B 1TO5A 4HV8A 2F6AA 2CM6A 4PG2A 1XGYL 5GRVK 5EBWA 3WFDL 1V3MA 1ZGLM 5FYKU 1F11A 4BRJA 1CO1A 3ZGHA 2OSLA 1D3CA 4I0PC 4G43A 3L5HA 4KK6C 4PCYA 1D5BA 4JM0A 1WBZB 2X4RB 3GSNH 2CE6A 4XHJC 4TULL 3O3UN 1RUML 4ZNEA 3X1GA 1KYDA 1YNTA 3NQKA 2QSCL 4QRPA 4EIBA 3F85A 1DLFH 4BQ8A 4XI5D 3U83A 3C09B 2VDML 1SQ2N 1DCLA 5T3ZE 1C1EH 3ENEA 3L3OB 3BH4A 5CAYB 4IDLA 4X9BA 3RIFF 1QUPA 4E41B 4ZMAT 5CNHA 5JW4N 2GI0A 5DHYB 2AJSL 3LV3A 3DJTA 2OJEB 2NW3A 3WG7B 4BZ2L 4J3OC 3RY6C 4XB8A 3KBHE 5FECB 4M9PA 2DQCH 4XMKH 2KQMA 4KKBD 4QRBA 5AAWC 3IEAA 4N1CA 5EEVA 2EH7H 1NMCB 3KWTA 3QYNA 3PPSA 2V9RA 1TTCA 1LEKB 1E4WL 2HWZL 3MMEA 2BVQB 2CNZA 3EDJA 4K5PA 5F89A 3CZUB 1RMFH 2R1YA 1X7QA 1ZSDB 2D3LA 2WTRA 3X1FA 2I32A 4LF3A 1KCVL 2WQRA 3E6FA 2Z91A 4W6WB 4ZAKD 5F7EL 3T77A 3O8XB 5HPOA 3IKCB 1AGDB 3RGBA 3NTCH 3EJZC 3NGBC 4X9YA 4A7GF 1IQWL 4L9LA 2W94A 1BXVA 1TT6A 1W72A 1ILUA 1A9EB 1SN0A 5F7DA 4MXWL 4FG2A 3I3BA 4YOKA 4P2OA 2ADYA 4LIQH 5ABDE 2V5SA 1JOIA 2G3NA 5LLIC 3HC4L 1BWWA 1AZRA 4PJXE 1GZQB 4RAHA 2Y07L 4XO9A 3UPAA 3PP4H 3X1EA 3D7PA 2YAHA 3L3KA 1UOVA 3GJFB 3UZVA 2PO6B 4H7VA 1MCWM 4OIBA 1KBBA 3GJFH 5T33H 5T3ZH 4GLRI 4AI7A 2WQWA 4WO4C 2FR4B 5EUKA 2DAVA 2DLHA 4F8PA 2J8UE 2ZCLH 4PJFF 3TVMB 4DOHB 3TWYA 2J55A 1F42A 2X53A 3ES6B 3MV8E 1NBCA 3DNKA 4HCRA 4PRHE 4XB7A 3ZE1E 2PR4L 3ASNB 2OR7A 2AKRA 2E76C 4HZLB 1DYZA 3FK3A 4XCEA 3NIDE 5C07B 4JPKL 2XN9B 4D0BA 5DXWA 2KERA 4OZHF 1H3UA 1VDGA 1BOGB 4XAKE 1ZHKA 2X2HA 4QF1B 5A7EA 5E7FA 5L7XH 4P05A 4UT9A 4LLYB 1LVEA 3QQDA 4L8DB 1TETH 4AQEB 3ULUF 3ARFC 1H0DA 3GMQB 3SE4C 4AKPA 4A66A 1AR1C 3VD9A 4KWUA 3FTWA 3LD8C 5KBLA 2A83A 5HGBB 4ERSH 1I1CA 4DNLA 5AW9B 5KVEH 2OKMA 4OJEH 2ZG1A 1JZEA 4OFIA 5D4HA 5FDWA 1KCRH 3TBVA 1YJDH 3VXOA 1A3LH 3LQZA 3GBNL 3QQXA 3TPKA 2D7MA 4Q56A 5F0MB 4YX2L 4HJ1A 2UXTA 1ZLVH 3QFJE 2ENPA 4XE0A 3GWJA 1N10A 5IBTH 1Q4NX 1G7QA 2QLYA 2VW7A 4JO5A 4J3SA 4NGHH 4A7SA 5ERWA 1NMAH 2DIJA 5C0BD 3WTUA 2XVKA 3KL5A 3QI9D 1UGKA 3DJRA 3CVHL 1NIBA 4IKLA 5JW4M 2MHAA 4B9JA 3FFOA 3VW3H 1OGTB 2J8UB 4JG1H 2NY6D 1U8HB 2VLRE 2DF3A 3RGVC 5I1CH 3ZW3A 1RIUL 3EJCA 4KAQH 4PRHB 5C6PB 3TNMB 1NMBL 1KBGL 3O11A 3KNBB 3MACH 2AEQH 3TJHD 3BCFA 3T65B 3F7LA 4GG6A 4AQ1C 4HS6B 3P4MB 1XGQA 5E2VL 1UYWH 5FYLL 3UJJL 4G7VH 2AGJH 2YD7A 3E9TA 1KJMB 2WZAA 4J27A 1TZIA 4FDWA 4K55A 4XPFL 3KL3A 1P4BH 1YEJL 4OLWH 4PJCF 3OL2A 3MJGX 4U1GC 2JIXA 3WYRA 1QW8A 3QIUB 4IOFD 4PFEA 3QHFL 3U36A 5CD3B 7CGTA 3KLDA 3F12A 4ODTL 1B2WL 4I18A 3CQPA 4WV1A 5ENWA 3V52H 5CS7A 3PHOA 4FHBD 3EH5B 1GYVA 2JJTA 3GJEA 4KDWA 4EO5A 4F2MA 1UTDA 4OZGE 1BQHA 1GTFA 3TFKC 4ZW3A 4YZWA 2Y2TA 3STLA 2D4DA 2XV3A 1L6XA 5MERA 5F71A 1CXHA 3MAWA 5I5MA 3L3GB 4K8RD 1A4BA 4X6CE 3LRLA 3KLQA 4YHIB 3LKPB 4MCYA 1A6TA 5IF0B 4A2DA 4X6FA 1ZA3A 2VH5L 3LEXB 2P5WA 4W1TA 1MDTA 2BSRA 2PUQT 3UTSA 1G7JB 5KUMA 1TMQA 3UADA 2C9SA 3CTTA 1E4XI 2I60H 2OXGA 3PJLA 2AQPA 4HCGA 4XC1L 5DZJA 3FF8A 3V6ZB 4PRPD 5I75C 5ILTH 1NEZA 5K39A 1J7VR 1LDPH 4BE6A 4LVNB 2YRBA 4X5PA 4ODHL 3O3AB 2EDLA 5I1DB 2D0HA 3QIWA 3U46A 4N5UA 2VC2L 5SX5K 3HOGA 1S2EA 1RZQA 3GMLB 2OQJB 4IGBA 5AVVB 4AMWA 2VDPL 3JTSA 1JPFB 4A6YB 3F7VA 3OAZK 2VDRB 3CLWA 4A6YH 3KPLB 3RKPA 2VDRH 4X9GA 4IRZH 1KG0B 2VLKA 3KPSE 4B97A 5DJXB 5CLYA 2DI8A 3QT2A 4WI6A 2Q8AL 4MAYC 4HXAH 1KN4H 5DK2A 4ZX6A 3RBSA 5GRUH 4OZGB 2QDVA 1G6VK 3NCJL 1C12A 5DZPA 3I50H 4HJ0D 3N41F 3OXRA 1JXJA 2ZIDA 5IB2A 2VDNB 2YLKA 3X3GL 2VDNH 2F7PA 3S4SG 2HH0H 5IOPA 5FKAA 4ZFOB 1H15B 4D7BA 2G5RA 4Y4FA 5BQDA 1DLHA 3PP3H 4GAGH 4IRJD 5H94A 5HGDA 1Z9LA 1E27A 2Y69B 1JHTB 1FJ1A 4N0YL 4NQDA 1HCZA 5GS2D 5T5FL 4BRVA 1YMHA 3TU6A 2LLNA 3M17A 1JPSH 3BEVA 3WY4A 4ELDA 2YEVB 1FRGL 3NPZB 2IGFL 2YAMA 5H2BA 4GW4B 2BOCB 2APFA 2L7EA 1FG2B 1GMEA 4RRPA 5TQ2H 4M6OH 2OMYA 3RTLA 4X4MA 3PWJA 2ZP9A 2QGBA 1X5KA 1FH5L 4APQD 3MOBH 4FTVA 4ZD3L 5GHWH 3VFWA 3AAZB 1NGWB 2QFRA 1Z2KA 3GZPA 2FNBA 2FYYB 4LLMA 3I9AA 1HINH 1QAWA 5EHFA 4ABWA 4UT6A 4KU1A 3VNYA 4L37B 3BYYA 3G5VA 2CRZA 1X6LA 2YWYA 3RJQB 4TYUA 1U8JB 5CCHE 3V5HA 4ZMTA 5FYKL 4XMXA 3EYQC 1SDDB 1CGWA 1LO0L 1N5YL 3L5IA 4JFEB 4MD0A 2W81C 2XQYG 3IJ9A 4M48L 4TNWF 3DVGB 1FBIL 3C2AH 1ZSHA 3T0EB 4FQ2H 5T1LA 5BOPA 3WN5A 2UZIL 3GUTB 5JZ7C 5TDPA 1R5WA 5IGXL 1T1WA 2IAMA 4Y2DB 2MQGA 3K80A 1DN2A 2XKUA 4BWTA 1NDTA 4PM1A 2LU5A 2OAAA 3A67L 4OJFL 4YDIH 3DV6A 5H35B 3ROLB 5IB4B 2R2BA 5FUCC 3AFLA 2F2HA 3CBKB 3CSGA 3PQYD 3D33A 2JNZA 5IROC 3EOAB 2ZJSL 3P4LA 2WKGA 1QSED 2EIDA 5IJBC 1HK6A 3APNA 4OJCA 3DDFA 1M05A 2R59A 4OQTL 1JXDA 3GSUB 4HHGA 3LZFH 3F6IA 4JZOB 2ZSVA 5DHMC 1JWUA 4G6AD 1T22B 4PJFE 4FGMA 1MHHB 3ZHDA 3WEXB 1GS8A 3CZKA 5B8CA 4JY5L 3E2HB 3IVKA 2X0WA 3DGDA 5BRZD 4KHTL 4L0YA 3T6ZA 1ID5I 1A7PL 5CINH 3BSZH 4WHYG 1BVKA 1DJXA 5LNDA 5HXMA 2OM5A 4OZHE 5DUMH 4YBQD 4MDJA 1I9IH 1TFPA 4LBEA 4GI8A 4AK1A 4EXKA 1Z1WA 1IB5A 4JK0D 5E56A 2OMUB 3C6LD 4NNPH 3CHXA 4IK7A 3WKNA 3WSQH 7FABL 5JW5B 1R3HB 4CN4A 2IH3A 4CADB 4UNTA 3C6SA 4YVUA 4DGIL 2ZZUT 3G9VA 4Y16C 2ZF8A 3ZX1A 1JHKL 5FIEA 5C1MB 4R7LA 2EDWA 3HHSB 1ESOA 1EHAA 4LRIC 4RMRA 5E1AB 4AEIH 1DN0A 2E59A 3SDAA 1KGCE 4K7PL 3MUGA 5KSBB 1OF2B 3QIBC 2OR9L 4QHMB 1OALA 1XR8B 2CLRB 4AWJC 5I8EA 4AC4A 3GBLA 2FQDA 4DP2X 3HS0A 4WI0B 3VI4F 2Z8SA 3SDXB 1PKQB 5CCJA 4G6JL 3RWHB 5GGTA 1KXHA 5CEZL 3T0VA 1X9LA 3NIFF 3HPLB 3S3BB 4NRYA 3SOBH 1UG9A 3W9DB 2ENQA 4CKQA 4FFWD 1MEXH 1SJHB 1KYOK 2WO2B 5EWIH 1Z9PA 2H6PA 2NY2C 5ICXA 3RA7L 2EIBA 2GVYA 4J28A 1J8HE 2OMNA 3NT0A 4AYFB 4WUUD 4NQEA 5LXVA 3S8WA 1CYWA 3PWPD 1ASOA 3INOA 2FGWL 1UWXK 1JTTA 4PRDA 2LQRA 2XVGA 1EXUB 3PAYA 3ZBMA 5FUOH 2DYSB 4PJCE 4XVTH 1OAQL 3O6FA 3LXAA 4ZAKB 1P7BA 3MRQA 4A68A 1XZ0A 3ULUH 1N3NB 3TO2A 2OYLA 1KB5A 1OB1A 4PJ9A 3TPUB 2O5ZL 2X7LB 1SFHA 3HBGA 5KVGH 1VFAB 2YIHA 3QZWG 1P4LA 1Q0XL 3WFHB 4MDIB 4FG6C 4XNQA 3MODH 2ERJB 3GSWA 4OJAA 5KBKA 3F7KA 2RCSL 4I0PA 2FTAA 3P30L 4CU7A 5FO9A 3U30B 1QZNA 2WUBH 3O81A 4IU2B 2BS8A 3EOBB 2NNAB 4DQAA 2HVKB 2Z93A 5C0BE 4NNYA 3NA9H 3HFMH 4L4VB 3ILDA 4F8OA 4ZMLA 5I1IL 2IFFH 4HEMA 5CP3A 3SJVA 5I8KH 3AG4B 4JM4L 3ZTJG 1HXKA 3EYVA 2VXVL 1HHJB 4FRWA 1F45A 5EC1B 1OK0A 3U7WL 5IJVA 3MLSH 5FR3A 2VQ1B 4Y5YB 2ICEB 3UZEC 2H1LM 5G5DA 4M7KH 1E8XA 3SDDD 3QNYB 1I82A 1CZ8H 3FPYA 1S7XB 3SQOH 4N3TA 3D08A 5J3HD 5BUAA 1ACYL 1J8HB 4Y4HB 1Q0YH 4P5MA 5D7HA 1O6VA 1W91A 4WWKC 1SBBA 4K94H 1X4XA 1XX9C 3U4EB 1SUHA 3RY6A 3HMXL 1TQBC 1PPIA 2P7TB 3GDBA 3QCVH 1YG9A 4LKCB 1MVFA 3H9ZA 1VEMA 1MCDA 4LAQH 2BVEA 2K4WA 5AAWA 4R7VA 3U0WH 1WTGT 4DKDC 2ARJB 1VHPA 4PJCB 3DTDA 4XMLH 1P7QD 2C3VA 3ZQWA 4S0HA 1NWPA 3S5LB 3F64A 5DC9B 3OV6A 4PJAF 2AV7B 4JFOB 4Y9FA 4U3HA 3NZUA 5I71B 2YSTA 4XT1C 3T6WA 5D1XE 3UJIH 2CQVA 1N7MH 3NH7H 4HHWA 4PW4A 5E4OA 4AH2A 1CFNA 2ATKA 4Y4KB 2YMXH 3NDZE 5C0RH 1UOKA 4CN6A 4QPEA 4HIXL 5C0BB 3B34A 1U58B 1G7PA 2LVCA 3OB0H 15C8L 2X70A 5KSAD 3TV8A 3CZJA 2PCFB 4WGVB 4EI6B 5ADOH 4C4KT 4ZG1A 3GHBL 4OLVH 3I9PA 2VR9A 5DJAA 3EW3B 3TZVA 4A67A 1HU8A 3D4YA 3KPMA 4I7ZC 4N68A 2IDUA 3ZDYF 3A6CH 1RV6X 1NJ9A 5I1GH 4YHPA 4HIIA 5AB9A 3TTSA 2DW5A 1T3FA 2J2ZB 3WMQA 3AXIA 3H0TB 2WGNB 2AHIA 2V7NB 1EJOH 3RFZB 2Z8RA 3BCDA 3CVBA 4MA8H 1PS3A 3WO3B 5A6IA 1QABA 3OM3B 1CR9L 1BCIA 3GSOA 4NLHA 3ARGC 5J56B 3TBWA 4BKLB 4CGTA 3CXFA 3OC5A 5DK3A 4N2IA 4JY6B 1I1AD 3GC3A 4O58L 1MFEL 3B9EA 4BZ1H 4H88L 5AKRA 4U4BA 5CZVL 3MCKB 4ZW7A 3WEMA 3ESPA 2FX8H 5F1IA 1B0GB 2AQTA 4F3FB 3V0DA 2IBGA 4PP2A 4ZX4A 2BHUA 1IVTA 1TZHA 2F1EA 3L48A 4NFCA 5DD1L 5DZLA 1U3NA 3OPZH 2DPKA 1OGAB 2DQJH 2IPTL 3ARFA 3SE4A 1HKLL 3RPBA 4L4TD 5EG6C 3LDBC 5CEYA 1TVHB 3JYBA 5D1XB 2R4SH 4V11A 3FRUA 5EU6B 2I7SA 3L45A 3EGDB 3S8GB 4YDZA 1GGCL 5SV4A 4O9HH 1AQ8A 3X1NA 2HLEB 1HZKA 4WAFA 3HZKB 2COQA 2VMEA 2VWEE 4UQEA 3THML 1V54B 4QRTB 3EJYC 3ZL4L 4JO4H 4YDVA 1QG3A 1N6QH 1UXMA 2DKMA 2YPLA 2W9DL 4ODWB 5HTSA 3AUWB 2IIJA 4PQXA 1S8DA 3QFDB 1PY0A 1VGEH 2Y72A 1IE5A 3VGAB 4DZ8A 4M7LL 3V0HA 4JPWL 4DK6A 1JNLH 4Y19D 2R7EA 4FC3E 5EU5A 3FOLA 1ZA6B 2X4TB 5FB8A 1HSAB 2E9WA 1D5XB 2EDHA 1RZ7L 3DIFB 5E9NA 2J5WA 1F90L 1KENH 3O41B 4LHUG 3C5SB 3RGVA 3RQ3A 5JORB 1QHPA 2R4RL 2PPCA 4OCSH 2W0PA 2RGSA 2YUZA 5I76A 2Q86A 1QFWM 2I07A 4AQ1A 1KXQE 2VKXA 3X3FH 2DI9A 3VXMA 3VFVB 1UA7A 4A2LA 4NHCL 4DPBX 3OLGA 2N59A 4LHUB 2GTZA 5K9JL 4NQQA 3FQ4A 1RUKL 2DQGH 3DSNA 3IJSA 2UZXA 4LDOB 3BVXA 3PL6C 1XSIA 3U4BL 4UILL 2P1YA 1X4ZA 4NZUL 3IPEA 1MJ7H 4NNXA 2OTUB 4LPCA 4G6FB 4LKXB 1V5JA 2J73A 1MI5A 2KMWA 4LSTH 5EH1A 4KQ0A 1Q94B 1PZAA 5AAMA 3TL5A 4BZ2A 4E9YA 1TUPA 4UM9D 3FQ1A 3D3VA 4NAQA 5I1LA 2KZBA 4EI5B 3PQYE 1DJHA 3R4DA 2XZCL 3B2XA 3VI4E 2XRAH 1SOSA 3F58L 1QSEE 1K6QH 5IVXA 3K3QA 4K5LA 4QHUA 3AU1A 2F8OA 3DX6B 3EDEA 1KGUA 5T5NF 4PR5B 3UBXG 3ULVC 3ZKQD 5CZXC 2EINB 1XV8A 3ARBA 2R0WL 4HEPG 2AJUH 4UCFA 3NIFE 5D9SA 2QQNL 1T5XB 4R4ND 1ACXA 1L5GB 2Q6WA 4L0PB 4XRCA 4LVHC 2R1WA 2B20A 4EOWH 5FLVA 4JGNA 1BAFL 2G2PA 1IC0A 4IKIA 1Q1JL 2MCMA 5BRZE 1KJVB 4MZ2A 1GKEA 3BN3B 3TXAA 5JXED 2PNDA 2VXQH 2X88A 4EI5C 1UM6H 4BCXA 3FQTA 4JANB 4OFQA 4PJBA 4FAAB 1S4IA 4IEFA 2QQLH 3KDMA 5KOVC 2LVEA 5DD5H 1R34A 3MLXH 3E8UH 4UMSA 1R3KB 2ZNWA 4Y5XB 1GOGA 3TEWA 3IS1X 3HG1E 3WXWH 1QO3A 2ZWLT 3US1A 2HG5A 1T1ZB 3LB6C 3QBTB 3QDMB 2VE6B 1TMCB 2BOBA 4Y2LA 1F58H 5JHMA 4F7PB 2ARWA 3D4GA 4OGYH 1CMOA 1BD2B 4QWWD 3BE1H 1OARH 4C4UA 2PYFB 3MGTB 2CGRL 1QEWB 3OKDB 1DJGA 5HHNB 3LKNB 5I1HL 2B4CL 4IJ3B 4KKAD 4MAYA 2EIEA 1RIVH 3MJ8A 2YRZA 2WLIB 3D87B 3EF4A 1EGJL 2XA3A 1QLEH 1A4JA 3BZDA 4GSDH 1U8QB 3HFFA 2FWUA 5TE7L 1TEGA 4F9PC 1QFUL 4OKDA 3G6DH 4HV8B 4B3EA 5I15H 4M1GL 1JCVA 1HL8A 4OGXL 5EBWB 2J5LC 1WFTA 3QEQA 1F11B 4Q2ZA 1UH3A 3HG5A 4N2HA 5AZEL 2OSLB 2ZWZA 4HJEA 4DP0X 2NY4D 2KDGA 3LIZL 4ISVA 1AGBA 4G43B 3V0JA 1YMMD 2XY2A 1D5BB 1B0IA 3IMBA 2PP9A 5KS9F 2ICCA 1PW3A 4JR9L 5EOCJ 4Z3EA 4W81A 4XOCA 4I3SH 3KM2A 3ZLQC 4KKCD 4NT6A 4C54A 1IBDA 2UV3A 4QXWA 1FLTX 1YNTB 3M7OA 4QRPB 4DAGL 3S5YA 4B41A 4JG0H 1CDJA 1KEMH 3FTZA 4WUUE 1FZKA 3TNNA 3PWPE 3C60D 1HEZA 1LO3L 2OCFD 3FRPA 4XNUH 2XBZA 5AD0A 3LNEA 2CD0A 4WCYL 1EMTL 5C7XH 1I3RA 3HG1B 2CO6A 1JNJA 4U6HB 2GJPA 2UY7A 2NW3B 5ITBH 2ORBL 3OJDA 4NCC2 4Y2OA 5T1MA 2ZOTA 4DGVL 2HKFH 4HLZG 1EAOA 3FB6A 3JUYA 4NO0A 3CVHA 4KVNH 4PJAE 1QKZL 3ASOB 2ZCZA 4ZW8A 2VUYA 4OJYA 1S7WA 2QPFA 3P9LA 2KQNA 2W95A 1DJSA 3MMEB 1FVDA 3JV4A 5F89B 3SGJA 4Q97A 4PYGA 3IAGC 1BF5A 2R1YB 4XE5B 1X7QB 2WTRB 4Q74A 1CL7H 4IDJH 4LF3B 4TPRL 3ABZA 3RVVC 3TONA 2X6VA 5DRWA 2Z91B 2NCEA 2Y9RT 3T77B 3VFUA 2NY3B 2PW2A 2ZYHA 4L9LB 5A43C 4BH8A 5D70H 1W72B 2B7DT 2J71A 4ZPTA 1PCSA 1W72H 5F7DB 3RIKA 3ZDYE 3HE7D 5IROA 4MNQD 4P2OB 1MNNA 4IBLT 4TQHA 5IESH 4OCXH 4HJSA 1SVCP 1HEJC 3MNWA 3HKFA 3N1PC 4UYQA 3LQMA 1WS7A 3UGXA 4Y88A 4I3RH 3L3KB <