3FPXA

Native fungus laccase from trametes hirsuta
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
499
structure length
499
Chain Sequence
AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase
publication title Structure of native laccase from Coriolus hirsutus at 1.8 A resolution
rcsb
total genus 144
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fpxA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fpxA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fpxA03
1M9WA 2YAEA 1ID2A 1JXDA 1CYXA 1ZV2A 2UXVA 4UAHA 2ZXWB 3S8FB 5LDUA 1GSKA 2BP8B 1XB6A 2EIKB 2J57A 3AG1B 3PXLA 3QJQB 1OCZB 3TBBA 4AKOA 2VN3A 4YSTA 2EILB 3FQYA 2DYSB 2FT7A 5EHFA 2FTAA 1ILSA 2YAOA 3UADA 3U25A 1NIAA 4YVNA 1AZNA 2QPDB 2AZUA 4HHWA 3T6VA 2GI0A 3X1EA 5F7AA 3CVBA 1GY2A 4BWUA 4BDVB 1AZUA 1SJMA 1X9UA 3NJKA 2IWEA 4YSQA 1SHXA 2YAHA 3TASA 2XVBA 1NICA 3BVDB 2FQGA 2AFNA 3IN0A 1AR1B 2AANA 4QLWA 1PLCA 3V9EA 4F7KA 1XB8A 1AOZA 4YVUA 2ZONA 5I5JA 1OCCB 1OV8A 3GDCA 2J5WA 4DP5X 1NIBA 1PAZA 3NJHA 2HRHA 3PAZA 1BQRA 3X2QB 2Y69B 4NERA 1WS8A 3NJLA 1ET7A 2IDFA 2OV0A 3OQRA 2PP8A 1BYOA 4DP0X 1WAEA 2UX6A 1IUZA 1KV7A 2BP0A 3IEAA 3AW5A 4GP5B 2QPEB 4CSPA 3AZUA 2JXMA 4DP1X 1V54B 4P5SA 3CDZB 5I5MA 2WO3B 1A8ZA 2VW4A 5I6PA 2PPCA 2BZCA 1BXVA 3AG3B 1A4CA 1BYPA 2YQBA 1CURA 4BXSV 5B1AB 4BWWA 2HLEB 1PNCA 2H3XC 2FQDA 1JERA 2I85A 5B1JA 1JZJA 1ET5A 4EF3A 1E5YA 1I53A 3DKHA 2PP7A 4BK5C 2VM3A 2XX0A 4DPAX 4AZUA 4GP4B 5I5IA 1E67A 2BHFA 3N2JA 1RZQA 1TKWA 4A2EA 4A2DA 3NJMA 2VSKB 2UXGA 2WO2B 2PPFA 1M57B 3NSCA 1WS7A 5E9NA 2HRGA 4G70B 5AKRA 1AANA 1RCYA 2IAAC 4HCGA 2HZHA 3ASNB 1MZYA 1ZDSA 3OM3B 1SFHA 3KW8A 1NIFA 1GS8A 4YSUA 3S8GB 2H5UA 4YSDA 2OJ1A 2GC7C 1J9SA 1GS7A 1AQ8A 2CALA 3UABA 2OCCB 3FYIB 4AI7A 5PAZA 1BQKA 3EH4B 1ASPA 2IDQA 4A66A 2PLTA 1N70A 1T5KA 2J56A 1J5CA 3TBCA 3FQ2A 1J5DA 1L9TA 1MDAA 4N8UA 2B3IA 1GYCA 4HHGA 2PCYA 1EHKB 2GB2A 4DP9X 2YARA 2AZAA 4TXVB 4X4KA 5D4IA 1RZPA 1L9QA 1URIA 4JHVA 4G72B 2XV3A 3S3BB 3ABMB 3NSFA 4Q89A 2NRDA 1IC0A 4DPCX 3WKQA 1KBWA 2GC4C 1ZIBA 1WA2X 4JKNA 1L9OA 2J55A 1L9RA 2EIMB 4N4YB 4UANA 1IKOP 1A4BA 4YSRA 1W6LA 3T71A 2YAPA 2GSMB 2CCWA 5I6NA 4HZ1A 4KNSA 4AKQA 2BO0A 2AVFA 4AX3A 3H56A 4M3HA 4BXVA 1ADWA 1GS6X 2FQEA 3ZBMA 3FT0A 3QJVB 2XV0A 1PY0A 1GR7A 2HXAA 8PAZA 3FSVA 1JVOA 3UGEA 5AFAA 3DTUB 3PLYA 3MX0B 3QJRB 2ZOOA 3H4HA 3ZDWA 4DP6X 2R7EA 3FPYA 3NT0A 4PAZA 1FWXA 2FWLB 4Q8BA 4KNUA 4DP7X 1KYAA 1IBYA 1VLXA 3SBQA 1GY1A 4YSSA 1KBVA 3T6XA 3X1GA 4JHUA 5B1BB 3FSWA 3NJJA 1OF0A 3X1FA 3D12B 2CAKA 2XX1A 1UATA 4DP8X 4KOCA 6PCYA 4E9VA 4FAAB 1OE1A 2JFCA 3ABKB 1CC3A 2IDTA 1WA1X 3ABLB 3FU8A 3S3DB 1BQ5A 1GW0A 2FNWA 4AKPA 2VMJA 4P5RA 1QLEB 1NWOA 2BP0B 3IBOA 2MRYA 4G7SB 1BEXA 4YSEA 1AZBA 1PNDA 1AG0A 1QNIA 2PP9A 3GXUB 3NP4A 1HAUA 2RACA 1SF5A 1W8EA 1OE3A 1MG2C 2DWSA 4E9XA 6PAZA 3WNIA 4UF7C 5B3SB 4GY4A 1NZRA 3ZIYA 1E5ZA 2H47C 5TK2A 2XUWA 1NPJA 3V9CA 5I26A 1AG6A 1M56B 1RKRA 4G7RB 1ET8A 1OCRB 2YXVA 3CZUB 7PAZA 4BWTA 3ERXA 1JZGA 1AZRA 3OMAB 5D4JA 3OD3A 1J9TA 4CSZA 1X9RA 3FPXA 5AZUA 2DYRB 4FA7B 1L9PA 2EINB 1DYZA 2GIMA 2PPEA 4KOBA 3NJNA 2Q9OA 1HAWA 1PZBA 1JZIA 1QHQA 1ETJA 2W88A 3FSAA 1DZ0A 1CYWA 2B08A 3QQXA 3EHBB 4F2EA 1NWPA 3PPSA 4WTQA 5A7EA 2UX7A 1PLAA 1SFDA 2IDSA 2QDWA 2XWZA 1JZHA 4WKXA 2BW5A 4HCIA 1N68A 2HX8A 2LLNA 3UAAA 4E9RA 1AACA 5B7EA 3WKPA 2A3TA 3X1BA 1PCSA 1CUOA 2UXTA 4HIPA 2MTAA 1NINA 4G7QB 1NDTA 4MFHA 3FU7A 3IE9A 4A2FA 2BP8A 5IY5B 3G5WA 4E9YA 2DV6A 3NJGA 5D4HA 1PF3A 4KO9A 2GHZA 2IH8A 2P80D 2TSAA 1J9QA 3KW7A 3UACA 3BQVA 1KCWA 2BW4A 1SF3A 4GXFA 3C75A 2CUAA 1BXUA 2UXFA 5I6LA 4A67A 1ILUA 3SQRA 3SBPA 1MG3C 3QJSB 4BDVA 2XLLA 1JZFA 4PCYA 2QT6A 3OMIB 1AIZA 4DP4X 2DWTA 3JT2A 3JTBA 1AZCA 1KCBA 2CBPA 4W1TA 2HX9A 1B3IA 1E65A 4W9ZA 2P80A 2N0MA 2E86A 4HAKA 1EZLA 1JXGA 5B7FA 1XMEB 2VM4A 3CVCA 4GP8B 1NIDA 2YAFA 3WI9A 1PLBA 3EH5B 4GYBA 4M4RB 2IWKA 4G71B 3MBWB 4YSOA 3AG4B 2FJSA 2Y1AA 3RYMA 1YLBB 1NTDA 3QJUB 1OOWA 1ASOA 2DY2A 3HEIB 2R7EB 4ENZA 5B1JC 1JVLA 3FYEB 1PZAA 2XXGA 1L9SA 5ANHA 3HB3B 3CDZA 3NSYA 2EIJB 2XXFA 3NJFA 2Q5BA 3DIVA 2BWDA 3PAVA 2XV2A 1A65A 1KDIA 4KO6A 1OE2A 3NSDA 1V55B 2JKWA 3S3CB 1JZEA 3OMNB 1AS8A 4QKTA 2PPDA 3N55A 5F7BA 1WA0X 4E9TA 1MZZA 4K9JA 1XB3A 5I28A 3ZX1A 3FQ1A 3UAEA 3PAUA 2YXWA 4ZK8A 1FFTB 2VSMB 4DP2X 2FT8A 1NPNA 1BAWA 2VW7A 3NYKA 4YSPA 1ZIAA 4KO7A 1TU2A 1A4AA 2TSBA 3WG7B 3QJTB 4KNTA 5I6MA 3NP3A 2GBAA 2BZ7A 4NAJA 2ZWNA 4E9QA 5B7MA 4A2HA 3GYRA 1AS7A 3T9WA 3ABGA 3FU9A 3TA4D 5TK4A 4F2FA 2PPAA 1ASQA 2FQFA 2X87A 1V10A 1E30A 3AY2A 4YSAA 1W6WA 3AG2B 2PCFA 1TEGA 1TEFA 3T6ZA 2IH9A 4A2GA 1SHWA 2I7SA 1KGYE 4HALA 2VW6A 1AAJA 1ZDQA 2HX7A 3H4FA 1F56A 1SDDA 1AS6A 1A3ZA 2QDVA 1JOIA 9PCYA 5I6OA 3TU6A 2FT6A 2CJ3A 4E9SA 4A68A 4NB7A 1J9RA 4YSCA 2IDUA 3EH3B 1NIEA 2XU9A 4HCFA 4E9WA 2XYBA 2BWIA 1HFUA 1KDJA 3CG8A 3IN2A 1SDDB 3WIAA 1BXAA 3T6WA 4DPBX 1ZPUA 3FS9A 1PZCA 2YAMA 3PCYA 3ASOB 2W8CA 3WNJA 5I6KA 2X88A 1PMYA 4YL4A 5B1KA 1JXFA 4RH4A 2I7OA 4KO5A 2IWFA 7PCYA 1SNRA 3QPKA 1OCOB 3X1NA 4L0PB 2WSDA 3EF4A 1R1CA 2YAQA 1IBZA 3L45A 3CVDA 3FSZA 3FU7B 5FC9A 5PCYA 3NJIA 3SBRA 1FA4A
chains in the Genus database with same CATH superfamily
4JG0L 4JO2H 1ETA1 4HUWA 4MASA 4QRBA 4UAHA 5FLUA 5ABAA 2CIIA 1TQBC 2Q8BL 5GGRY 1G5AA 1A6AA 3FC8A 3PREA 5MEND 4YDKH 2IGLA 4YS4A 5CLXA 3FQYA 4KXAA 2A9MH 3U0PB 4RFOL 4JKMA 1XL6A 1F3JB 5CUSH 1ESOA 1VFBA 1AC6A 1CS6A 1E43A 1NGYB 1TVHA 3B5HA 1MF2L 1S9YA 2IFFL 5DEFB 3V10A 4Z95H 5HYFA 3UTTD 4QTFA 2ARWA 2B2XL 2VO8A 5IT2H 3MLRL 3QRBA 4Y19A 3UO1H 4ZRGA 1GKOA 4KVNH 4E9LA 5DUMH 1LE9A 1A1OB 1T3FB 2QSCH 3WFBL 5IMMA 1QZ1A 3O3AA 4KKNA 3UAFA 2OW6A 4LHUD 2HB0A 4MJ5B 5LVEA 3M88A 3VFRB 3LPPA 3QR1A 1FL6A 3IAGC 4HEPA 5EB9A 2JKNA 3CDYA 3T0XA 1ETB1 1AOZA 3DMMB 1B90A 3ARYA 2P24B 1EX0A 3MXVL 3VGHA 3FQWB 3DXAE 5F3HA 1I1FA 5MHSE 1TPXC 4BM7A 2KL6A 4M1CD 1I3GH 1B4RA 4XWGL 1ZGLM 5F7LB 2YN5A 3LEYH 2P52A 4DW2H 4GBXD 1N2RA 3V4VH 4WIQA 3UBXI 3AZUA 1UM5H 5JHDB 4P5SA 3OTTA 4ZZKA 2AGJH 2R39A 3O6LH 5IMLB 3H54A 2W92A 4JFHD 1TDQA 1PU0A 1Z32X 1Y7VA 3OR7B 3AY4C 3GRGA 5D72L 1WBYB 4M5TA 3ATBA 1D5ZB 4RMWA 4EUPH 2HLEB 4ZW7A 2H3XC 5LGKA 3IETA 3MLSL 4NKMB 2QGCA 3FOMA 4B9PA 5DRXA 3NIDF 5I1KL 4WEBH 4ORGB 1MJJA 1NMCB 2XDHA 3QH3A 3ISWA 1CF8H 5DZ9A 4H0IA 5GISL 4F9LA 2DQIH 3QZWB 1NM4A 4IU3A 4XVSH 3X12B 3SGKC 3BP5A 1QBML 4UT6L 5I1HH 4JPKH 4M6OH 1PZ5A 4QI3A 4QD2E 4F57H 2UXGA 2NR6A 4LAQL 4UINL 5F93C 4PS4H 4NPKA 1CXIA 5C71A 1THCA 1UURA 2WO2B 3TVMB 5FYKL 1WS7A 4HVBA 1HSAB 5E08L 2OXHA 1M7XA 1V3KA 2V3EA 2VZUA 3B1TA 3JWNE 1S5HB 3TIDB 4AQ1B 4X2UA 5B21A 2R1YB 2XKUA 1MZYA 1NLBL 4QJ5B 4N2DA 1FVDA 3FB5B 5FV2A 3OM3B 1MCQA 4UOW0 2WXHA 3FQXA 5AVXB 4C83A 1DZBA 3HG2A 4M7ZB 3S5LG 1R3JA 4XOBA 1CN4A 4J4PC 5J11C 4M5YH 2NW3B 3QEQE 5ADOH 5LB1A 3VXRD 3BGMB 1HHJB 5D96C 4NNYA 5JYMA 1VKXA 2DMCA 3QUXD 3HZYA 4B9ZA 1Q9KA 1TJGH 5DS1A 1MNUL 1XHHA 4XMPL 4FZ8H 4KTDH 1KYOJ 3F01A 1F8TL 2W59A 2XNAA 4LOVA 5JXAL 4XMUA 1J7VR 1T89A 1BDYA 1EHKB 2DQDL 2HFGH 3IAQA 2MPAH 5IK3A 2YARA 3IRCA 3BH9A 1KG0B 2WTRB 2Z92B 5KZCB 2IPUK 5L9DH 3CHRA 4F8NA 3S3BB 2BY1A 3MA9H 2AJVH 1FG9C 4RAVA 1P9MA 4M1DH 4U1JA 5MERA 1I1AA 4G8EB 3NFPA 2VIRA 2Y7SA 5A2AA 2JQZA 5C0GB 1QI3A 2C3VB 1ROWA 3FMGH 3JV4B 3LXAA 3OKOA 4JKNA 1EXUB 4N4YB 4RMTA 4M02A 4HC1H 1AHMA 5TH2B 4B9IA 2DICA 1CG9B 2X4QA 1AD9A 4NHCL 2GJJA 4L48A 2K8MA 1CGUA 2NPLX 2OZ4A 4L4VE 1ZS8A 2NSQA 3U7YH 3WOVA 1RQ5A 1MFVA 32C2A 3KEDA 3QYNA 3QO1A 4JQIA 2ZOLB 1CFMA 3RDTB 1G7JB 3SPIA 4DEWA 3E8UH 1URLA 3TZVC 4JAMB 4ETQB 4GH7B 3C8HA 5CBAA 1XF2A 4AYBA 1E9OB 3RLSA 4QAWA 3GMQB 4P4KA 2QPSA 4YDZA 3QIBB 2F8XC 1IILE 3EJCA 5CEXA 4FHJA 4NHUA 5IJDC 2DKSA 2F0CA 3WNMA 3CC5A 5C0AB 1CICC 2VXSL 5E70A 3MN8A 3PHQB 4HYTB 3IKCA 4PIBA 1GY1A 3R7RA 3U9UB 4EKJA 3SDCC 1BFTA 3T6XA 4E42B 1QNZH 3V79C 1ZHKB 2WBWB 4WFFD 3PWPA 3X1FA 1MJ8L 3BKML 4KWUA 2GHWB 4CC4C 3T0AA 3W0WD 2Z64C 3Q0HA 1NEZG 2X89D 4CVXB 2DDQL 5FK9B 5TF1H 1EVTC 1AGEA 1BQ5A 2OMZB 5CIPB 4QIRA 3FXIC 3T0EC 4QTIH 1XL4A 4U0QB 3T3ME 5FYLE 4OZFA 4EI0A 3V0VA 2CHWA 1XV8A 3NP4A 4Q6IC 1FZOB 5C0RH 2CE6A 2G3NA 3VA6A 5AENA 1MXDA 4EI5D 4G7VH 4KDTC 2PW1A 3GSVA 4JRXE 5BUAA 5I9QB 2ZOTA 3EFOA 3VWJC 5IEKA 1AHWB 2QQLH 3BPCA 3JXAA 3KHOA 3QWOA 4IRSD 5AW7B 1P0SE 2KHAA 3V9CA 2ENYA 3DX2A 2ZG2A 4RA3A 1CD1B 5HI4D 3BQUC 5EUKA 1ET8A 1DBJL 5BRZB 4TLUA 5KVEL 3QCTH 2OX5B 4LPWA 2IPTH 3JBG7 4W9JC 3Q7JA 4PJHE 3CZEA 1BV8A 4LPVA 1F4AA 4AEHH 5ILTL 2YZ1A 4CSZA 1V7ML 2XWTA 2A73A 3ULVE 4AT6A 1PFCA 2R9HD 4ZSOA 3EDJA 3MO1B 4BCYA 3EYUH 1EANA 1HAWA 4PJGA 4IIQA 43C9B 2Z31B 1YY9C 1LD9B 1KOAA 5B4MC 5INCA 4WTQA 1AO7B 4EN3B 1JK9B 1JG9A 3AQYA 3ZDXB 1E6JH 3GF8A 4J6RL 3GZKA 4H1LB 4PJCE 4U6YB 3FONB 1SBBA 5GZNA 4ODVL 4IJ3B 4GXUM 4EOWH 1EEYB 2UXTA 1I7RA 12E8L 1DQKA 5KYYB 1R5IB 2XSKA 1J11A 4JFDB 4PW4A 4ZMNA 2BSRA 3MMEA 3QUKB 1ID5I 4BCZA 4V1DE 3EJSA 4L0ZA 4ZQTA 3LDBC 1DUZB 4YIQB 5D9SB 2A6DA 4JNXA 1MELA 4BH8B 3ETBJ 3ZR5A 1M4KA 4TNWK 4JVUA 3BKYH 3MTRA 4FADA 4NLAA 1R3IL 2VXQH 3O6KL 2P80D 4XPFH 3EUUA 4H5SB 4AYID 1A6VL 1NAMA 4JM4H 3SDDC 3M46A 5CGYD 3BQVA 3WNLA 2JI1A 4Y19D 4LEXH 3IT8D 4GXFA 4AMKL 1V3LA 1C5DA 2OJEA 5JW3H 2C3HA 1ZSDA 2WXRA 1B2WL 1RU9L 3ZDYF 3FCTA 2PW2B 1XBRA 2J3SA 4FD0A 1SDYA 1MJUH 3AU1B 2YRPA 5T5FH 1LILA 2ZXGA 3MGOA 4HGMA 5IVZB 3TPKA 4JG1L 3VVWA 1GZPA 3EO0A 4GAYA 1BW8A 2HTKD 2UUDH 1SMDA 1KTBA 1PLBA 5F7YC 4R7NB 4XNDA 4XRCB 3PY9A 2FRGP 3JVFC 1MHCA 1UB6B 4Y16C 3RYMA 3DDGA 3ILPB 3TH2T 4GG6F 1OZUA 4PGDB 1RZJH 2NY1D 2ZCKH 3JV6A 1YO4A 1D5MA 1U92A 3GMPA 4Z7UE 4HJ0C 3WFDH 1BFOB 5JHLL 4LCWA 3V4UL 2Z7UA 3QRLA 4ONOA 1IT9L 4DZBB 1C12A 2VDOL 3WS3A 1ERNA 1BBDL 3Q2LA 4ABWA 1CL7L 1DQLH 3IMSA 3NGBC 2BX5A 3P9MA 3IF1B 1VDGA 3D09A 2VDOB 3KCPB 5L4JA 1QR1B 1AGBA 1G9NC 4U1GB 4Z0XB 2A1WL 1AIFA 3HS8A 3RWFB 4Z7VA 1GAFL 2FUTA 2CXKA 2WXOA 1J9CT 2XZCH 1VCBC 2EXTA 2WUCH 1N18A 1IARB 5T3ZH 3B9AA 3GXIA 3JUZA 3MHZA 3LEVL 1KYFA 5JR1L 4JFPB 4YE4L 4QRRE 4F8QA 1HL9A 1EV2E 4Y4HB 5LNDA 1I75A 1PJ9A 3NP3A 3RRQA 3E9UA 1S7WA 3FBKA 4LIQH 3T9WA 4UQ2B 2N4IA 4I48B 4X6FB 5DC2A 3S36H 5AYUL 3VWKD 3BUYB 2R56H 1MFCL 4WKZA 3DBSA 4HJJH 4J3OF 4JRYA 2QR0A 2PCFA 4K23H 4LASL 4RDBA 3PAYA 3V0AC 4PMFA 5LGJB 3GB7A 2VLLA 3ZXAC 4HSAC 3CZFA 4DHLA 5CLWA 3RWDA 1I3RA 1G5GA 2HFEA 5FO7B 5LN4A 4XXCA 2X2JA 2EVHA 1ZANL 1QW8A 3R0MA 1YEJL 1JZ6A 1XGRB 1A5FL 1LO2H 2XKNB 4OT1H 5KW9L 4KROB 5GGTA 2UYLB 1U3HB 2FHFA 3P0YL 5ISZA 3MQIA 4EQ2A 3PE9A 1A7QL 2QMJA 4M7KH 1UD5A 4NN7B 4P2RD 1EBPA 4U05A 1HU8A 2FJFB 2FX9L 4LKXA 4Z76A 4GPVA 5ESQA 1I1AD 2E74C 3N6YA 4OZGB 5K9KA 2I60L 3VXPB 3ATAA 2WWMD 4TOYH 1OAUL 3LIZH 2WVVA 3RNKB 1UM6L 5GS1A 4PWFA 4XO8A 2Z7YA 1D6VL 3L4CA 5AVWB 5CGMA 1XAKA 4HUKB 3VNZA 5I1JL 4LSTH 5HHVH 4U6HA 1GJUA 3IFLH 2OBGA 2D31A 4AQ8A 5IVXE 4MKTA 2NY0B 4GG8B 1E9PB 5D93C 5CP3A 3FRPA 1NLDL 2XICA 1BA9A 4I0PA 3W56A 3WSQH 2ZTBA 5TDNA 3U0TA 4GQQA 2DYPB 1AY1H 5FUCC 3ZL1A 4H0GA 4F7PB 5K69A 2YD4A 2EEDA 2JJTA 1MDTA 4TVPD 1DSFL 1X5GA 3J07A 1SEBA 2FWOA 1H15A 1NKOA 1CXEA 5KS9E 2R4SH 2YAOA 3S4SG 4P4KD 1CFTA 4FQ2H 2O5XL 1F4WH 3KYKH 2AZUA 4JFQB 2QPFA 2EYSA 4GI9A 1RIHL 2HKFL 4WU5A 5GIRB 2X0WA 4FYSA 2BVQB 4HH9A 2NDFA 2VKXA 4ZX4A 2EYRA 3SO3B 3PL6B 3NPSB 2CDEB 1ZE3C 3CVHL 4ONGH 1DQDL 1CTMA 2W0PA 3TASA 2YAHA 4CNIB 4G83A 1F6AA 2IADA 4JEGB 3LKRA 1QSFE 3KL5A 1FNFA 5JW5B 4A7GF 4KFZC 2WZPA 2AANA 3U4KA 1SJXA 4MNGB 2GJZB 3BPLB 4NQCB 1UM4L 1IE5A 2BJML 1WBXA 4JHZA 3IDMB 3BAXA 3GDCA 2LU7A 3UPAA 3QFJB 4IRZA 3VD3A 3OHXC 3QUZC 3CE1A 3CSFA 3D51A 4PRNB 4NERA 3OAUL 3KDPB 1GVIA 2CPUA 5DYOA 1NCCL 2GBUA 3OQRA 3UL4A 2F53E 1TZIB 2JI2A 2VL5B 2F58H 5FA4A 4FMVA 1Z9PA 5ACMA 4FFZL 3V9FA 3SE8L 2Q20A 4LK4A 4YFEA 4L29A 3VXOA 2BRRL 1ZY9A 1MEXH 4TQEH 3E1ZA 2O26U 2VZTA 4R3SB 4EVNA 4N9GB 4UM9D 1KACB 5CFAA 4ONHB 3S5LB 1B4JL 5FKPA 1CLZH 2H8PA 4BFRA 5B1JA 1QFOA 4U6TA 2YMTA 3KYAA 2E6JA 1I8KA 1D7BA 3RWHB 3EXJA 2DB8A 4BK5C 4YNYA 4DPAX 2QVMA 1LK3L 4RGMC 5F1NB 1J48A 1EHAA 1FJ1A 2JWYA 2ROXA 5E8DH 2ZOKB 5BQ7A 1RJLA 1G7PB 1IMHC 1S78C 4ZUWA 4TNEA 1LE5B 2WXFA 5E23A 1BECA 5DVOA 1VFMA 2G2PA 1DL7H 2CMRL 3MA7B 4OUUA 1YNLH 2MCG1 2NX5A 2Y7QA 4FZEH 1IGTB 3NTCL 4DSYA 1JZ2A 4MXQC 3KPRA 2IAAC 3O4LB 4QCIA 3ZZQA 3BC9A 3A6CH 3KPSE 4LSQL 3FN9A 1YMHB 2DMKA 2GTZA 4Z18A 1JK8B 4BSWA 3PGCB 3VE0A 3S8GB 5F2FA 3B2VH 2GC7C 4JG9A 2DLTA 5D1XB 3GKWL 1ZPLA 1EPFA 1BZ7A 1KGIA 4XC3L 1UT9A 3BEVA 1BQKA 2FX8H 1T04B 1RJYA 4XPGH 2Y1VA 1SXBA 2PLTA 3JWDH 3U79A 2A74A 1E3FA 2AEPH 4F7TA 2BOLA 4DKEH 2J20A 1MLCB 4NS0A 3ZQ9A 5A2CA 1SN5A 2XA8L 3FTVA 3LKOB 4AQAA 2OMYB 3HLAB 5E2UL 2W60B 1RZGB 4J3OD 5I1AA 1FYHB 3IDYB 1TCRB 1UGNA 1A6UL 1N4XH 4KK6D 5D2LA 3QXUA 3VVVA 3WYRA 3RPBA 3SCMD 1AYOA 1I85A 1OALA 2VXTH 3II1A 3VFTA 4N0CD 5CUSL 2LQRA 2NRDA 4TRPL 2QVTA 1WZKA 4LPUA 4M6NH 3NCJH 3GBNH 4X5XA 1GGBH 4HUVB 4KUCF 3GXDA 3RBSA 2IV8A 1YQ2A 2VLRB 4I13B 1PVHA 4PJEA 3FTZA 1O9ZA 4NUMA 4Q97A 2NY4C 3NCCB 4PWIA 1NEZB 3CSYA 3QDMB 4KNSA 4TUKH 5CJQH 4BXVA 3H2PA 3IJEB 4KKBD 5CILL 4AYSA 3I9IA 4PS8A 1QQDB 5ALBH 4BRJA 1CFBA 3GBML 5IKCA 5CZVL 4M7JH 1BPVA 2IPKA 1BAGA 1KCVH 4RIRB 3BGFB 4X5RA 5EPMB 1R46A 2DQTL 2XZQH 4ZFZB 4DWHA 3R06B 3FQ4A 3V4VL 3MX0B 3GFUA 4HUCA 3T3MF 1NC4B 3DGDA 2ENJA 3VSUA 3IPEA 4X6EA 2PYFA 4G9DB 3TLRA 2WPGA 2R23A 5GSVA 2MWCA 2Q6WA 2KUTA 3ISRA 4K5NA 4PV9A 3B2UD 1KBVA 5B22A 3FB8A 5B1BB 1DCLA 3MV9B 1ML0A 3TONA 2VDKL 2OJZH 2NZ9D 4N1CA 5F9AC 4XTRC 5F70A 4KOCA 3DXAD 4EUPB 1U8QA 5MHSD 1RVFH 4WI5A 3BLKA 3SKOB 1KNOB 1CF8L 2CLZA 4PJHF 4XGZA 2QFRA 1SJEB 1FYTE 3IFPB 3L9YA 5LUMA 4I2XE 3WFZA 4HIIA 3ZTNH 1PDKA 5FAAA 1JD9A 4JPKL 2YD6A 1AI1H 3FUMA 3MLXL 3WHXA 2G2NA 3IJ9A 4YHKH 3ULVF 3NABH 4RVBA 1JV5A 1EJOL 1O9VA 4W9HC 1ZLVH 1WFJA 2AMGA 3HKFA 4PS4L 2F74B 2J73A 4BE6A 1HZKA 4ZX6A 3FFOA 4Z3GA 2HMID 3X3GL 2VR7A 4ZS6D 3FUKA 2QHRL 2YD5A 4KXZI 3V8OA 2CKBH 4L23A 1T0OA 5DVPA 3BIAX 4HIXL 3KAAA 5DJDA 3U1SL 1HTYA 2B1HL 5DC0A 3BD3A 4PHZA 4PJCF 3V95A 4PB0H 4DPRA 4ES9A 1NOLA 4PYGA 1OAYH 3CZUB 4HX1B 4XC1L 2G5RA 3AY4A 3NZHH 2A4EA 2ADJA 1CBVH 3OKMB 4B96A 1IZJA 5I30H 3OKNB 4AJWA 4J8QA 2P45B 3D30A 4CKQA 4FA7B 2Y5TA 4UT7L 3SJVB 4LCUB 2WSKA 2FVNA 4OCNC 3C5ZC 1TLKA 1M42A 1KLGA 3BUPA 2LU3A 3KE0A 3SGKA 2B08A 3QQXA 2ICES 3ME0B 2MPAL 5E9DE 1TJHL 1KYDA 3FOLB 2AITA 2OZNA 1BYNA 3TFBA 4X6CE 5F88B 3MA9L 3ZKMD 4FERA 2WTOA 4UV7L 4XVTL 1FN4A 2LLNA 3FTUA 2Y72A 5FX3A 4GO6B 2NY7L 3WJMB 1LP9A 4HGWB 4DOHE 2XBTA 2ZG1A 3RI5K 2EP6A 4KZDL 4I0PD 4UBDD 5FUOH 4AJVA 4HC1L 1OM3L 4BINA 3PWVA 3WEBA 3GNML 1RI8A 5E5UB 1KMGA 3E6HB 5DTFB 1KCUH 4J4PA 2X4NA 3C5JB 1AP2B 3MV8B 4RQQB 4OD2B 3U7YL 1E8XA 4S1DD 3B8SA 2EIDA 2OSLA 3QJFB 3FT9A 5TFSL 2GHZA 5T1KB 3K2KA 3E8UL 3DV6B 4YHYC 5HSFA 1YUHB 1A7PH 4HXBL 3QO0A 1T20A 4PBDA 5BVJB 3EGDB 1FGNH 3VSQA 5BZWA 1KEMH 1KCWA 3T0BA 3ZHDA 3HKZA 5HVHC 4HT1H 4WW2F 4Z0BL 4LLUB 3RL2A 1O7SA 4FCHA 3K71B 1AMXA 3OVUB 1SQMA 2NT0A 4Z7UF 4LT7A 4WEMB 3V0WH 4JJ5A 4C55A 3NA9H 4PCYA 2QT6A 1AIZA 2WZPD 1XF3B 1XGQA 1A1MA 4TSBH 2J6EL 3KNBA 3D9AL 4L4VD 1QNZL 1OGPA 4J3SA 4FKEA 3GEWB 2R69H 3NSXA 5HYSA 4R8WH 4JLRB 2HVKB 3QI9B 5D6DC 4GP8B 1HEJC 1R3KA 5EZIL 4XMTA 3SE4C 1JGEA 4LZKA 1DN0A 4IMKC 4GQZA 4E41A 2VNCA 2X9XA 1TYJA 3VFWB 5JPMC 3S96B 3MRFA 3O2DA 2WCSA 5AOKA 4QTIL 4KUCD 1DSYA 1RURH 2MOVA 1SY6L 3BP7A 3FFDB 3WKNA 4MWFA 3WFEL 1PZAA 4HLJA 3KLHD 4UTAA 5E8EB 1AGDA 2UUDK 5C0RL 2XXFA 3IDNB 4H25B 3V0JA 3TZVA 4JDEB 2LVCA 2VAJA 3IGKA 2NT1A 5DJAA 3BUQA 3S3CB 1RZ8A 5J13C 1H9DA 2QQLL 5AAMC 1JWUA 4KKZA 3L3IA 4ZNEA 1MREH 2NYKA 6TAAA 4CJ0A 4NOFA 3UIZA 3B7SA 2YXWA 1CICA 3CU1A 5H37A 5JQIB 2OTUB 3DDFA 3QCTL 2VSMB 2G9KA 2FT8A 2R0KL 2HT3C 3ATDA 1S9WB 1MFDH 1NBQA 3BN9D 1ZIAA 1OP3H 2Y3NA 4UU9B 4Q4EA 4AEHL 3KLKA 4DN3H 1FPTL 5H35A 5FYLD 1HHGA 1JYNA 2VLKA 3G6AA 2Q76A 4NQTA 3TBYB 4CC4A 5HHPA 1E27B 2ZJSH 2P8PB 1TQSA 1AS7A 2X2HA 3FO9B 2D0FA 3FU9A 3MKGA 1GMEA 4LPXA 4JRXD 5DHYB 2DIJA 1W80A 3OG4B 5AW4B 1WEJL 1LGVA 5H8DA 3VAEA 3T0EA 1K6QH 1WCQA 1WTGT 3DX6B 4XB7A 1YA5A 5HDRA 5ICUA 1TEFA 4N2BA 5E00A 1NC2B 1RK0B 1YSOA 4B60A 5JPNC 3T6ZA 1Q9OA 1JI2A 2ICWA 4Q6IA 4S1RL 1V3JA 5F8RC 1E6JL 1RJZB 4KDTA 4KZEH 1UWEH 1HXMA 3DSFL 1FFNA 3I3DA 3VWJA 4A37A 4IOIA 5E1AB 3CHPA 3KGSA 1J87A 2O6PA 3K6NA 5F9OL 4F7EB 3MR9B 5HYJE 1SDDA 3KPQB 3I6KA 3ULVD 1D2OA 1YEEL 4FQPA 1T0MB 1JOIA 1T7WA 1UB5A 1O0VA 5EBLB 3D4GA 3BQUA 5EU6E 4NB7A 4A68A 4OJAA 2A0LD 3SKNA 3P3RA 5BZZA 1LNUA 1Z0MA 1PKQE 2VMFA 4GSRA 4F92B 4YE0A 1GIGH 4XN4A 4LFHG 5KS9F 4JANB 1PZCA 4XNUL 3S88H 2VDML 3MJWA 4WRLA 1IAMA 4LLWA 1ZSHA 4JM4L 1IX2A 3TO4A 2NNRA 1WAAA 4JE4B 1R5VA 1IM9A 5DFWH 1JGDA 3HC0A 3QP3A 3ARDD 2EDFA 3RGVC 2MTPA 1IBZA 4WI2A 1GL4B 3CVDA 5INDA 2DM4A 4ELME 1Y1DA 3GSQA 3SPVA 3VTMA 5K9QI 4Y5VB 2D7TH 3AWEA 2X4TB 3L6FA 5M94B 5CP7A 4F37K 3O81A 4JO1H 3LRLA 1U42A 2W1NA 5CJOH 3RQ3A 1E5CA 1HH6B 1U8KA 2C3WA 1U3NA 3LPOA 4QKXB 4PB9L 4JGMA 2BC4B 2EDLA 3BFQG 4ZX5A 3G9VA 3PV6A 1O6TA 3KWTA 5CHNA 2QPDB 3UC0H 3NZ8B 2WP3O 1JNNH 3ZKXB 5HI3C 5JQ6L 3T6VA 4WV1C 4H88L 2ICEC 3CFDB 5F7AA 5KWYC 1WAPA 2XI9A 3V7AG 3WNKA 1T7XA 1GJWA 1FVCB 3K80A 4UYPA 4N86A 4YSQA 5CZRA 3RAJH 4R0LB 2JCCE 4AW7A 2VR8A 2I9TA 4KU1A 3NFNB 4PBWD 2JELH 2NY2C 1XD1A 3UJTL 4PPTA 1WUZA 4OD1H 3BZEA 1MWAA 5I1GH 1N67A 4Q2ZB 5I1CL 3D48R 4JS7A 4M9PA 5DHVA 1N0LA 1R9FA 3UOAB 5GZOD 4NOBA 1ZT4B 3PAZA 2WN2A 5BUPA 2XZCL 4H2AA 4KJWC 5BO1L 1RL1A 4JO4H 4IBWA 1YEDB 3RPIA 5EBGA 4PRIB 1D2PA 3O6FD 4L5FE 3AFLA 3VFNB 3K74B 1D9KC 2AJUH 4WJ5B 3VI4B 4JO3H 2CO3A 4XH2B 1LDSA 1KJ3L 1XTMA 1BIIB 2MNWA 1INDH 1BLNB 4I88A 5D7KD 3PJNA 1YCSA 2Y0SA 5D5MB 3P0VH 1T1YA 5E8PA 5DK2B 2YQGA 4BWWA 3U0WH 3GBLA 2XJKA 1CWVA 4IU2B 4U1NA 1KPRB 4MMYA 1MOEA 1QEWA 4WK0B 2DD8L 1A9BA 3DKHA 1OTSC 5DK0A 3Q8EA 1ANUA 4JGJA 1KCRL 4XMLH 1E67A 4QXGL 1RZQA 3IDJA 2E59A 3CWGA 4NENB 5EBWA 1FH5H 1MAKA 4PP2B 3ZSSA 3FFCE 3HI1A 5CEZH 4G6JH 5HPOA 5EORH 5TDOA 3DRTB 3LX9A 2BRQA 4ZBJA 3WDIA 2X6VA 4KQ4H 4MNQE 1BREA 3SBWA 5FGCB 1H8OA 4E5XB 2DTSA 1GOGA 5LCVL 4ZMTA 1MCKA 2Z1PA 3GSNA 1JAEA 3QPXL 5C0DA 4D0DA 1NMAH 5JHBA 1UUSA 3I9GH 1LK2A 3CFJA 2P5EE 3GSUA 2H5UA 1XCXA 3ZE2B 4YSDA 3FO2B 4TOYL 3LIZL 3NFSH 1X5MA 3VFUB 2BNUA 2J8UE 1KB5A 2C5DC 3NCYP 2NY5L 4NT6A 2XN9A 3FYIB 3WO4C 4Y4FB 4FF9A 4IQHA 3SD5A 3HG1A 1X6NA 2ERJB 2OK0L 1QLRA 3IFLL 4PJFE 4CKVX 3D0LA 3B9DA 3IB4A 4IKKA 4J4PD 1QO3A 5MEPA 4LEOB 4GG6B 3K72B 2V5YA 2HT4C 2R0WH 1J1PL 2Z0UA 3QUYC 3MODH 4S10A 1HH9B 2JQAA 2XVGA 1AY1L 3C9NA 5GGRB 5IBTL 5CCHE 1WTLA 1OW0C 4V11A 3I50H 4JFOA 2EZ0C 4AEFA 3L5JA 1U8LA 1JP5A 4R83A 1BWMA 1N6QH 4QXVA 2Y2TA 4WTZA 4MMXC 3W82A 1FO0L 3NSFA 3TYFA 3D85A 4U1HB 2PXYA 2X53A 3PRZA 5EDXA 3D52A 1OPGH 4ZOBA 4JZOB 4MJIE 1JF1A 2VQUA 1MCEA 4L3CA 4X4YB 1WZAA 1R75A 3G6JE 3QUGA 4ONGL 4XOEA 4LHQB 3WJLC 2E6QA 4CSTA 2CCWA 1FUNA 3NH7L 4H13C 3QRGL 4X5WB 2AVFA 4B3VA 5KSBA 4M3HA 43CAB 1YEIH 2FO4B 3CVIH 4FXGC 3VXME 3GSRB 1YZZA 3D39B 5IJVA 4UZGA 1PY0A 2NUPA 4HIHB 3QQ9D 3FAXA 2NTFB 4TUOA 3US1A 4ZDHB 1N5AB 3FTYA 4HIQA 1XGTB 2K4AA 3UZVA 3PLYA 4FQ1H 1BOGA 3DGGB 3TZVD 2FUQA 4ZUTB 1DVFD 4PJ7E 2FGWH 3SBQA 3I3EA 1XX9C 1QSFD 3WMQA 3U2JA 2ZWZA 3L3KB 2Z6FA 3EYQD 4RRPM 3BDBA 4GW5A 1BQHB 2SEBB 3X1GA 4XAWL 1P2CA 4HCRA 3AAZB 3FDWA 5I71B 4HKXA 4DH2A 3QEGH 1CICD 2YC1A 5DRZB 4DP8X 3H9YA 3B3IB 3HW7A 2Q87A 1NKGA 3UBGA 3SDCD 2JFCA 5L2KB 1CC3A 1XAUA 4HISA 5F89B 5KVGE 1V05A 1RERA 2DAVA 3MRJB 1GW0A 1VGKB 5T5NF 2F53D 3IBOA 3BP6A 1QPPA 4DFHA 2HJLA 1BJ1H 4JFEB 1LEKB 5GJSL 3ARRA 3VFGL 4LP4A 4X6BA 1WBZA 1JGLL 1YDPB 3LMJL 5CBEA 3OHXA 1XH3B 2N7AA 2DWSA 3PUUA 3WKML 3WNIA 4FZEL 3C60B 3DV4A 2EUWA 3NCYS 3ZYOA 2FNBA 4X8XA 2D4DA 2EAEA 3MJ9H 3NRPA 4XPBL 4IKIA 4D94A 4J23A 4I1RA 4RDQF 4X6CF 1RKRA 3BZ4B 1ZLVK 4H0LC 1PKOA 5KYXB 5EFIB 5J6HA 4UT6A 2UZIH 3B2VL 3P9LB 1VJSA 2R1XA 4PJDB 1T03L 4PJ5A 1JZGA 3S35X 5ITBH 4D0CB 5CO1A 5D4JA 4AXWA 2FX8L 3VYPA 3L1EA 3O3BB 3EOBB 5K1NA 2C4FU 3DO7B 1UG9A 4NXSA 4BK5A 3EYSH 4MZRA 4U3SB 3M17B 1YRKA 3MNDA 3MRPA 4M4PA 4X9FA 4PJAA 5HDQH 5L8JB 1UC6A 4S11A 3ES6A 1JPFB 4MX7A 2X9WA 1NWPA 3UZQA 2X4UB 4O2EB 4HFUL 5DI8B 4YXKH 5MEOA 1SFDA 4R7DA 4WNSA 1KZYA 1A7NH 1MHHB 3CBJB 5IB4A 2VXTL 1YY9D 3HLKA 4PSRA 3TOPA 2WIMA 1DHKA 1TJMA 2C9SA 5B4MD 3OKLB 3WAJA 2BMKA 1OSZB 3BZDA 5JUEL 1UA7A 2OMXB 2ZUYA 1AACA 3TEXA 4CU6A 1XR8B 4F5CE 1EHLH 4M6ML 3CH8A 3X1BA 2MCMA 5J6SA 3UTQA 3ZN6A 1P1ZB 1Y6MR 3ARXA 5KSUA 1KLFA 1NUNB 3IPFA 3LYRA 4HMCA 5J4MA 3N44F 4HS3A 1NFKA 4L37A 3VFOA 3FU7A 1IKFL 3L7FB 3MJGX 5LHDA 3N9GL 5EZJA 4L8DA 1C08A 1GZQA 1W91A 5A2LH 5LAXA 4TUKL 3P73B 2DQCH 5CJQL 5E5MB 1IZKA 3NJGA 2VQ1A 4Z78A 2WKGA 2WBJC 1T6WA 5ALBL 3AJ7A 2QADC 1PZSA 2M8XA 2VUOA 4LVNC 3CFBB 3MGTB 2UWEB 4AIZB 4OM1H 4Q4IA 1CYGA 3HMXH 2ZP8A 2XZQL 3ECVA 4HBCH 2FX7H 3QIWD 2ZUQC 4G1EA 4P2OD 2H2SD 3C75A 3DBXA 4OCSH 5E2VH 4DVRL 1WIPA 3SDDD 2HWZL 4PWJA 4P06A 4WENB 1MFNA 3MROA 3VCLB 1J18A 3EBIA 4AY0A 5KJ4A 4IOSD 1XF5B 3EZJB 1SYVA 4H8VA 2FL5A 3I6LE 3L5XL 3ZKSD 2HKHH 4ALAH 1TXKA 3P3SA 4BSJA 3OWEA 3TP4A 2GW5A 3QNYB 2PN5A 4D7BA 2JKIS 2AJYH 4FKKA 1RZIB 2DM7A 2IOIA 2QELA 1XIWA 3ESMA 4M4RB 5DHXB 1WK0A 2CIKB 3CV5A 1B6DA 1CFNA 1U8JB 1DDHB 3BAEH 4MHHG 5IW3A 2FEDC 4NQSA 3TYGL 4JJOA 4IHBA 2F54E 5A2BA 2DQMA 3ZTNL 2P44B 1ASOA 1DVXA 3QXDA 1AI1L 2WINB 4LCCB 3K6SB 3V6FB 1L9SA 4P5MA 3HB3B 2IBZX 2XWBA 4FL4B 4X8JA 3UP6A 1CI5A 5TDPA 2NY3B 2BWDA 4Y16D 2B15A 1KDIA 2CWRA 3FQRB 2JKWA 1JPSH 3C6LB 3LS5H 1OGAB 2VC2H 3QDJB 4U0RB 2XN0A 3VD9A 2CKBB 2FYYB 1K5WA 1YNTB 4Y88A 3PAUA 5LGHH 2AC0A 5JMRA 1I3UA 3GPEA 1FYTD 5JLZB 1FNEB 1BM3L 2YPVL 3ML8A 3NZHL 5E94B 4F93B 1QSVA 2ZOWA 5FM5M 2VMCA 3PHOA 4PWEA 4Y9GA 5HDBB 5SWSE 5ABDE 5I30L 3LXCA 4NFCA 5E0FA 1PEZA 2QVIA 2BXYA 5C0FB 2KZKA 4NAJA 5DEZA 5IBLD 3OKEA 4WY7H 3TESA 4JHBA 3TA4D 4P99A 2NSMA 1EAQA 3KS0H 2ED9A 3R0NA 5I8EB 4RISL 1Z3RA 1OP3K 3TCLB 3V5KB 3SGEI 2NTSP 3VQ1C 3WN5B 4OCYH 1U8PB 1KLUB 4OAWA 4GAGL 1TQCB 5HTSA 3TO2B 3REWB 2ADIA 4GKLA 4LHUG 3HG1D 4MB3A 1ZDQA 2HLAB 5K33A 3U9WA 4G1MA 4OLVL 4IBUA 1IKNC 1BJMA 4ZUUB 2IBGA 2CJ3A 4ELMF 5FOBA 3TWCL 2NXZB 4ZW5A 4YC2B 2CR6A 3THMH 5HGDA 4M7LH 4LKCB 2GUOB 3P54A 5J12B 1T0NA 3D85D 3APFA 1NBZA 2WMPA 2QSQA 2RJMA 3STZA 3C5ZA 1B0RB 2Y07L 3CFEA 2QTVA 4LLYB 4QRQB 5LDSA 3BP4A 1MWOA 4H26B 1FI8C 4HJGA 1FGNL 3FUIA 2WSDA 2WNGA 3EF4A 2HRPL 1FFPA 3RWJA 3UEZA 5KBLA 2OQJA 1UXWB 1YJDH 4ZX3A 2JCCF 3NA9L 1TIUA 2OAAA 1M9WA 1UQSA 3JV0A 1Q0YL 5KAQF 4TSBL 3O2WH 3EJYC 3QQNA 3LZFH 4QYOA 3UYPA 2WN3A 4JHWL 1KJMA 4PJ8C 5FLVA 4U7SA 2BVPA 4HJIA 2AKRB 1REIA 2XTJC 1GKEA 4P3DB 2K7PA 4N90E 1NFIB 4ZAKB 2LTQC 4AQEA 1B0GA 4U1LA 1OIOA 3X1EA 3IMVA 1MXGA 5JXED 1RURL 2EICA 4KI5C 1G7HB 4XCNB 3CVBA 4NWTH 1NCHA 4PJXA 2P8LA 3RU8L 1UTDA 3LKPA 1ONQA 2LOEA 3QORC 4BZ1L 4JFZH 1PD1A 5L4FA 4MXWH 2FLRT 4JM2B 1AJ7L 3VXNB 1A6PA 2JJWA 2Q7YB 4EDXA 5DF0A 1ITCA 1CU4L 2X5PA 1ADQL 4V1DB 1MREL 3A67L 2FECL 4YHOL 5IOPA 5KYUB 1NIBA 2D0HA 3BVUA 1IJNA 4K94H 4NN5B 1F42A 2HTLC 1BF2A 4MD4B 4NQVB 5EU5B 3ULUC 5DVMA 4AQZA 2YD1A 2E9IA 1ACYH 5ABZA 3GM8A 2IAMB 4KK5D 1ZTMA 3QUZD 1BQUA 3BIBX 1Z66A 1RUPH 3QIUC 1UASA 1JUFA 2YKKA 5G4OA 5DJYB 3SE4A 3HR6A 4KJQD 3LRHA 4IMKA 4LLQB 1QWHA 1NFDA 4WFHE 5JPMA 4LDOB 4HUUA 1MAJA 1QRNB 3A47A 2V4LA 2EACA 4HJEA 4LCVA 2H32A 4XP4L 3U4AA 3BAIA 3ZSTA 4GW1A 3VXSA 3D2TA 1HOCA 3ZQXA 1QFWM 2RA1A 3DVGA 3JTTA 3QA3B 4PJ5D 4ZMPA 1BJ8A 2I26N 3O3EB 4KZEL 2J8UF 4BKLB 3ZTJH 4BZYA 1EFQA 4C56E 5ID0A 5AAMA 4AGQA 3MNVA 1T7ZA 1UA6H 2VERA 4PJFF 3L08A 3UAJC 1EEZA 1MCLA 4Z7OB 1IGFL 5D70L 2E76C 3P4NA 3LQAH 1I7TB 5I6XB 4OV6F 2PPFA 4YO0B 4ZS7H 3F7YB 3MLPA 3VXUE 3KXFB 4Z23A 4Z5RB 2C8NA 2XQYG 5E8NB 2Q7NA 1UVQB 5ANME 1R5WB 1L3WA 4HPHA 3DURB 2BIMA 4JZJB 3RFZC 2VISB 4MXQD 1SLWA 1ZD6A 4I3RH 5LNEA 2YOCA 1AQ8A 2D7NA 1FDLH 2F7PA 4FLRA 2VABB 4K8RD 4AI7A 5HYJD 2R59A 2G75A 5PAZA 2WGNB 1HK6A 3PV7A 2BVEA 2WIIA 4HWNA 3G6JF 4MXVE 3P3YA 5JPNA 5F7FA 3T4AC 2ADFH 5EU6D 4P5KA 2X3CA 2A83B 2ZNWA 3FZUC 4FQXD 5D6CA 3MUJA 2MQ3A 2VRAA 5DURB 5EZLA 2F2HA 1DBKH 1QUPA 4OIBA 3RFRA 3TJEL 4JO1L 1E5UI 5CJOL 3ULSB 5C0JB 4XMKH 2R83A 4G72B 2W80C 4WFGE 3SZ6A 4GT0A 4PM1A 2E4TA 1P5UC 4P5TD 3BXNA 2E7BA 2FD6L 4TSCH 2ZYHA 4FQHA 4G8GE 1XGPA 2J55A 5MP6H 2NNXA 2CK0H 1PY9A 1X5JA 4Q9RL 3CSBA 1VFAB 2VZSA 5C8JA 5J7CC 1NFDF 3K7UA 4IS6A 1M71A 1OVZA 4PJ7F 5D7IB 2FZ3B 2WLIA 5DGRA 1U91B 3VFMB 4HUXB 4XODA 1YEGH 1E7VA 3Q8AA 1NGXA 4TULH 4YDVB 5C08B 1SZNA 2F61A 5I0VA 5DVLA 5DMKB 5I1GL 3H42H 4WUKH 3ARFC 3HNSH 1C8QA 3ZBMA 3FU6A 1P7QD 3BSGA 3MRNA 4TL5A 3CFUA 3FT0A 2NUTA 3QRFM 3TCXA 1T4KB 4JGNA 3P30H 2BNQE 5K9OB 3FSVA 3N1QC 3H3BC 4XAKD 5EU4A 4JO4L 4NAQA 1A7OL 5FW7A 4JPQA 3CVHA 4KK9D 2OYLA 3ZDWA 4JCMA 1EVUA 2OI9B 3WXWH 5IBUG 4BFNA 4PEEA 2V8LA 2BXZA 1LEGB 1IM3A 2OZ4H 1H5BC 4PTUA 4NC1C 4X0KB 3L9BA 2EXWD 4MLSA 3W2DL 2CNZA 2AEQL 3E38A 1L0YA 4JQIH 2X44D 4M61A 2QV4A 1U8IA 2G60H 4DFIA 3NN8A 4OGYL 1QTPA 4P2QB 3NZSA 4TVPH 2WXPA 4WV1A 5IVXB 1OF0A 4FC3E 2ICEA 3U82B 1MCWW 1DFBL 4ODTL 4YH6A 1AKPA 4TMPA 2YQ3A 1B4LA 3U36B 3WDHA 3HUJA 2N56A 4I85A 3RA7H 2BS8A 2NLJA 5GRWA 3QG7H 1NCGA 3OC5A 1T1WB 1L0PA 2CLVA 3OL2A 4MJ2A 2IMNA 4XTRD 4FFZA 4NBXB 3C2AH 3K6IA 3IJYA 4NEHB 4QHLB 1AZBA 3QISA 5KN5A 1HKLH 3IU4H 5D7JB 2WKOA 5FPIA 3ARZA 1EFXB 3GSWA 4K7PX 5FKAA 2ZE0A 5CEZL 1U41A 3W39A 4IKLA 1BD2A 4X50A 3QDGE 1DBAH 5GS0C 3WTSA 5J06A 4F7MB 3ZIYA 2VQ4A 2VZ1A 3ZE0E 3MCKA 2BOBB 4G6FD 1D9KA 5TE4L 4RFEA 3Q43A 2R2BA 2WLNA 1KXVC 1MPAH 5HDLA 3I9GL 1IEAB 2ATPA 2TRHA 3GIVA 4H8WL 4HEPG 5AW2B 5JW4Q 4OZFH 1K8DB 1XCQB 3CN1A 3NFSL 3PWNA 5TTRA 5BMFL 2ZXEB 2PYEE 1S8DB 5AD0A 4X9IA 3W37A 1RZKL 4Y9EA 2EINB 3MV01 4B97A 4KOBA 1HHKA 2XHNA 4G6KH 1F2QA 4LNRB 1EGJL 1XF1A 3MREA 4XNYL 4Q9QH 4FX5A 4MNQD 5D71H 4TTDC 1SBSL 4QT5A 5T1MB 25C8H 4ABUA 2EH8H 1W0VB 4Q9BA 4CVZA 1CYWA 3TBVB 1YPZB 2HJKB 3N1PC 3QNZA 2BIHA 4KJPC 3C5ZD 3D8MA 3FH7A 2J25A 5C9KA 1NCUA 3QQ4A 2P5ED 4WGVB 3RUGE 1F5WA 1R0AH 3WHE1 2NXYB 3ARGB 2KDYA 1UZ6E 1OPGL 2AV1A 1J1XL 4G9FE 1RUQH 3BH8B 1J8HB 4OJYA 1M6OB 3BPNB 4YWGL 5AOZA 4GAJL 2OR9H 4PLKC 5A16B 3WFCH 3ZTDC 4AL8L 1DR9A 1W15A 4KHXH 1O6SA 3TC9A 4MZ3A 4UDUA 1TSHA 4ESKA 4RCAA 3TNNA 1LL1A 5I75B 2OMWB 3GTTA 2AI0L 5FFGA 1MRCL 4IMLB 5EEVA 2OW7A 2WAHA 5SX5H 1JFQL 2ZXCA 5DJ2A 5DRNA 4D9QE 1Q9LB 4W70A 1OW0A 1T21B 1G0XA 4MJID 4TUJB 5LBVA 2F8VA 3Q01A 4N5EC 2WLLA 5F44A 2P42B 3CX2A 3QJSB 4YBHA 3KPMA 2X6AA 4Z7QB 4MMXA 2QLYA 5D8JL 1MUJA 1AE6L 4IDLA 2GJ6B 1DE4B 5AB2A 4IEFB 4J3OH 4M8UA 1KCBA 4KI5E 3O6ML 3PQYA 1J8SA 1G9EA 5K9JL 1NAMH 4K3EH 1EZLA 1I4FA 3SPCA 1H0DB 4FQLL 3VXMD 4G6AD 3WUWB 4D3CH 1W2KT 2EC8A 3H9SB 3IGFA 3L1OL 4PQXA 2D03L 2WQWA 4Z3TA 4AM0A 4XVJH 3V4VA 5IB2B 4AEIH 3AG4B 2OKMA 3IXTA 2Y1AA 5D1ZD 1H8NA 3GXMA 2BWQA 1OOWA 3IPBA 2R7EB 5AYTA 5BV7H 3RY4A 4FXGA 1JVLA 5A3IC 2XXGA 1C16B 4MCMA 5CNHA 3ULUE 3SPJA 3PAVA 5D1ZI 1Y0LA 2WXMA 4G42A 4ICXA 4AQ1C 3CHOA 5GRYA 5F7BA 1MHPL 3T3PE 3MJ9L 4OZIA 1EO8L 4GKZA 2JCWA 1MZZA 3J27A 2WYHA 1CDYA 2ORBH 4M7ZC 3VG9B 2WQAA 4YL9A 1WLHA 2V9RA 3GMMB 3QS3A 2XFXB 2WXJA 2JB6B 4GT7A 4TL4A 5LQBL 2XV6B 2DEXX 4ZUVA 3VRLE 4JE0A 1HHHA 3EHBC 3CXFA 1AH1A 4P8QA 1NA8A 1P6AB 2OTWB 1X6LA 4ZNCD 2HA1A 2ZWNA 3FTSA 4PG9A 4UI2A 3KG5A 3ABGA 2HT3D 2BM3A 5I1LB 3QQ3A 3WGUB 1QBBA 2LGNA 2XQYK 2ZUXA 2DQEL 1K8IB 5HDQL 1BZEA 2H6PA 1VCAA 4R4BB 2C4FT 1DTUA 3EFFB 3F5WB 5DYFA 5DD5H 4BGLA 2ATAA 2CUIA 3D0VA 4AV5A 5LLIC 4A2GA 3HG0A 5GGQH 4LSVL 4MB1A 3V0EA 1KGYE 3O9WD 1XXFC 4PSPA 2F8OA 5IW1B 3I84A 1EHLL 2YFNA 4L1TA 1ZA3A 3CFMA 4W93A 1G9ML 2ZUWA 1NGQH 4R90H 4L8CA 1FZKA 1XGYL 4YZWA 5GRJL 1KELH 3TU6A 5KANI 4C58B 3LEXA 1YYCA 5H2BA 3ECBB 4OZFG 3Q1SH 2DJUA 4MQ7A 1AQKL 1ZTXH 5DZVA 2J6WA 3D25B 3HRZB 4LQFL 3O8XB 3BWZA 5KBNC 4GRMA 3RDTC 5EA0L 6FABL 1QAWA 2VJ8A 2WD0A 1DLFL 5DWUH 5BCAA 2X88A 4N0FB 5B39B 4AZ8B 4S1QH 3MV11 4X4ME 5ALCL 5GRVL 4FKHA 4NNXB 3QIBC 2DWDB 1YN7B 1Z9MA 1T5WA 3I2CH 4HBCL 5DSCB 1KV3A 5GGTH 3JTSA 35C8H 1HSBB 5KSVA 2OM5A 3PJLA 4OCSL 4I3SL 3CX5K 3EO9H 5BXFA 1DO6A 4HZLB 2NW2A 3H53A 3HE6B 4APQD 2CO1A 4N8PA 2RFXA 4DKAA 1MW3A 2EE3A 1F13A 1JHLH 3JWNH 4FLHA 2UXVA 4FQCH 5EWIL 5I17B 1GSMA 4ZPVB 4PREB 2PCPA 1BQSA 2FYVA 2QQQA 4FNUA 4F2ME 3AG1B 3RGVD 4PVLA 4U1KA 2PTUA 4NRZA 5AYQA 3I9AA 4DKFH 1J5OH 1A25A 1K3ZA 2OS7A 3UADA 4EXPX 1IVTA 2P48B 1NIAA 2CHZA 3JWOH 3HE7C 4NO0B 3OR6A 1JV2A 4WUUA 1YMMB 3AXLB 4G3YH 5IGXH 4XBGB 4Y4KB 5CP3H 5C7XH 4QRTB 5E6RB 4MMZC 1L7TH 3UYOD 4W9KC 2EDBA 1GY2A 5DZLA 3O2VH 2FH8A 1K4DB 2XWEA 4QF1B 2J6EA 3IRZA 2R29L 1SHXA 3MLYH 2ZAHA 3JYBA 1I8IA 3I6LD 4U1MB 5I9QC 4HMEA 3T4YA 3KPNB 1JPSL 4YEFA 1MI5E 1SMOA 2HLFC 2YA1A 5IROA 2ARJA 4YVUA 2J5WA 4F58L 4X6DB 1KIPB 4JFXB 4DP5X 2VC2B 5BVPL 4AITA 4BFIB 1D5IH 1LEIB 2DS4A 1FSKC 2NY2D 5LGHL 3FSOA 4HFWA 2IANB 2VDRL 5FO9B 1J1OL 2AJSH 1T2QL 2GFBA 4NM8H 1XSIA 1SY6A 2EO9A 2PP8A 2XPGA 1CCZA 4J3OG 4KQ3H 1KV7A 1E3XA 3TBWB 3AW5A 2EVJA 2XG4A 4LCIH 1R24B 4KJWD 5DUPH 5TE7H 2IH1B 4UQDA 5AWNL 2C26A 1W0WA 2YD7A 4FTVB 4HJSA 3WBDA 3H0TB 5KSAC 2P7TA 1IGJB 4Y5YA 1X7TA 1BYPA 1ZVSB 1VADA 2C7UB 3RVVC 3O11B 2V7HA 3N44B 1JI1A 2IQ9H 4ZTEA 2CO4A 4EN3C 3D3VA 4LMQI 2BDNH 2YGPA 3BEWA 3MV7A 3L4TA 4OCYL 3FJTA 4ODUB 1QLEH 4D8PA 4YR6B 2JKTM 1I53A 5AVZB 1UZ8A 3B7UX 5AVQB 1R3HB 4L4TA 2J5LC 3QNXA 4JM0A 4BIKA 1H3PH 2KQNA 3X13B 4IJ3C 5SWSD 1OTUC 4GUOA 5F7MC 3P1VA 3E6FB 4EI6A 1CGSL 4N8VA 4A2EA 2WSPA 1OTSD 4MXVF 3GMOB 4H20H 3W9DB 3QQDA 3ZYIA 3CCHB 2K70A 4MAYD 5E4OA 1EEQA 1U36A 2G2RA 1FNGB 3R8BB 2AK4A 4DIXA 4POZC 3F58H 4OZ4B 5EOQH 1LDPL 2YKLH 2A6IB 4K2UL 3ZO0A 4LOUC 1OLZA 2JB5L 2O5YH 5IHBA 1HDMA 4LSUH 3TPUA 1LTXA 4JQVC 3QBTB 1MFAL 2O30A 1WPCA 5GSRA 4N6RA 3STLB 1QR4A 1SYSB 2D7QA 2EE9A 4K9EH 4MQSB 1WDAA 2V2XB 1BFVL 5DDHA 3S4SA 4G6MH 3B83A 1CFVL 2IGTA 4IRJB 3SY6A 3ULAB 2XN2A 5J9PB 3HN8A 3TCTA 4F8OA 2OCFD 3FULA 4M7LT 3MZGB 1SM3L 2XWDA 4PI2A 1ETZB 1OZTG 2JH2A 3FTGB 3LRSB 4QHKI 1NAKH 3GUFA 3LZFL 4S1SH 4DETA 5IMOA 2R2EA 5SWZA 5JOFB 3QUYD 4JO5A 4S0HA 1QA9B 4KVPA 1HL8A 5DEGB 1M7DA 4G80A 1CFSA 2WKLA 3HR5A 3WUZA 4MRCA 4GMSL 3SPGA 2JK5A 4FQQA 3R1GH 1SJHB 1FV1A 2ZCLH 2XWRA 4XNBA 4PUBH 4HUWB 5C07A 5IW6A 1E2ZA 1QI5A 4JFFA 2CIIB 2X9YA 5JHDE 1NBCA 4LRIC 3RHWK 1A6AB 3VX0A 5GGSA 4JUTA 4N3TA 4U1GC 3LS4H 5D2NC 3LQZA 2HFTA 4NQEA 3AT0A 3VB8A 4GLRI 4DKTA 5FYJE 1TCMA 4XNQA 1GR7A 2DEWX 1VFBB 2O5ZL 4N90D 1TVHB 3JWNG 1QFWI 2P3YA 1ZEAL 1MSPA 4P46A 3NQIA 4K7FA 3VSTA 1CR9H 4Y19B 2APVA 1FCGA 1LE9B 2YPLA 1OTTC 5IMMB 1FZMA 3O3AB 4JFVA 4KNUA 1PX3A 2CG9X 4EZKA 4Y8DC 2EEFA 5F9WB 4Y8AA 4OLXL 4WI7A 1OKEA 1FP5A 1MW1A 1NPUA 3HNTH 5DHMC 1FL6B 5DD1L 2YK1H 3N04A 5BJTA 4AVIA 1FIGL 3ZE0F 3F8UB 1HILA 3D12B 4XMVA 6PCYA 2ITFA 5F3HB 1I9RL 1I1FB 3UJJH 1P4LA 3QORA 2VXVH 2IDTA 3S8WA 4P2YA 3MJ8A 2NY6D 2ZYSA 3H3PH 4IHOB 1U6AL 1BPLB 4P23C 2D3NA 4TSAL 1UA6L 3ZRCC 1UA3A 2VYRE 3RZCD 4OCMC 5T3XH 4FQJH 3O41A 3L9RA 2Q8AL 5EOCH 4ZS7L 1U3HC 3GM0A 1I9IL 1RZKC 5KYWA 5L88H 4OIIH 4YHML 1MRFH 4Y2DD 5TK2A 1GJIA 5E5LA 1T66D 3IETB 1X5LA 5BS0A 3FOMB 3KPTA 5DRXB 1MJJB 3GXFA 3QH3B 3RUGF 3QIUA 5AB1A 1KN2H 3L13A 1CLYH 7PAZA 4GEJA 3FHAA 4IU3B 4Q6KA 3ERXA 4N2EA 3BP5B 1UZ6F 4C56D 5IUCA 1CFQB 1HI6A 3GS4A 1PZ5B 3QJOA 1NDMA 2V8MA 2DYRB 4ZD3L 4WI0A 1HC1A 4DCQA 5FHAL 3L1GA 3VXUD 5LCVA 3RIAK 2G0KA 4EAEA 5EEXA 5F71A 4G11A 1FVDB 3IDGA 4OFVA 5B1CA 4AL8C 3VRIA 3FQXB 4XCYA 2YO3A 2O72A 3ZUCA 4C83B 3PG2A 2NQCA 3SDXA 3ZRFC 3MRQA 1R3JB 4XP6H 5C09A 2QKIC 4YZFE 3UAAA 4Z8FH 2YMXH 5JIQA 4NNYB 3PL6C 1SVCP 2B4CC 3HZYB 1LQSR 2CK0L 5TQ0L 5KVFE 5IB1A 1KTRL 2ZKHH 1NDTA 2A7BA 3N85L 4RZCA 4BQ8A 4ECNA 3VD7A 1OD7A 3QCUL 1QD0A 2XNAB 5JIDA 4KI5F 4G5AA 3BPLC 3BRDA 5IK3B 5IY5B 3L3HA 5C0AE 3BH9B 1IC7L 4BYHA 3N41B 3H42L 4WUKL 1FO0A 4LEBA 2DBLH 1FG2A 4L1SA 3M8OL 1VIWA 3ZRSA 3T4AA 2V3DA 4WFGD 4RAVB 3S97C 5J0BA 5IQNA 4U1JB 1I1RA 1HYSC 4WAFA 3NFPB 3H85A 2DM2A 2VIRB 3UACA 4CL7A 5DXWA 4EO5A 3OKOB 4YFLF 4LSPH 2BW4A 2WBJD 3WELA 2QADD 3SGDI 3QE5A 2UXFA 2YUWA 5AZEH 1ILUA 1UH4A 2XBZA 3SBPA 1DUYA 1MCSA 3ULUF 1PGRB 2H1PL 2X4QB 5SX5K 1AGCA 1AD9B 5DVKA 1P5UA 1K4CA 3K1DA 3JTBA 5ELIA 5FEBA 3RIFF 3CU7A 1KSRA 1ZS8B 1TTFA 4TVPL 1KUMA 3WXVL 1VSCA 2EDJA 2YPKA 3T3PF 2P46B 3HZVA 32C2B 5C6WH 2XETA 3QO1B 4QDGA 1LQBC 4F2MA 2BFVL 4YGVA 2KDGA 5HHNA 5CBAB 3VU1A 5EF3A 1S6NA 2KERA 3GJFA 1P4IH 1XH2A 3OJMB 1PG7H 1PG7W 2BNRA 1PY4A 4UM8A 3VRLF 5CEXB 1JBJA 3C2AL 4GKNA 1OAXH 1OCWL 1FNHA 5DZAA 5BRZE 3ARFA 4WGKA 5I1IL 1A22B 1DVTA 3CC5B 4Z1PA 1TTGA 4OZHB 5EC2A 4K3JL 3U1QA 4QRPA 3NJFA 3IKCB 2P26A 4AH2A 2IGFH 5KVEE 2OMVA 3ETBF 2H1LM 1IAIM 4KHTH 3VX1A 4YPGA 2D7MA 4MZIA 2DH2A 3PWPB 3MV7D 5DHEA 4LLDA 4E9TA 4NCDA 1V7NL 2WP3T 1ES0A 4N2AA 2WWKO 4AUYA 4ENEC 3I02A 4HOMA 2E46A 1H5BA 3O2DH 4N2OA 1BJ1J 5D7LB 3V0GA 1AGEB 4OGXH 1AO7E 3TT1L 3WGVB 2B1AL 1G7IB 3EZ8A 4UTAH 3KMDA 2VW7A 4HEME 3CQPA 1UH3A 1MQKL 3QGVA 4OZFB 4PG2C 3ZDXE 5C0CA 3SE6A 2G9HA 2P5PA 3V0VB 1WHPA 1U93A 4OFYD 1S7RB 1KF9B 2CA3A 4G6KL 2RCSH 4U33A 4IBLT 5HHOA 3GSVB 1IB5A 2GSIA 3QDGD 3VXQA 5IEKB 3F05A 2FEEI 5DR5H 2EH8L 4ZQKB 3KLAA 4HJUA 5H37H 3IDYC 4JFDE 4ZTPH 4ZMXA 2DWEA 1J5IA 1JWSA 1B0WA 4ONFL 3OKDA 2Y1YA 2AQ2A 1QVOB 4RAHA 2E9GA 3B9VA 5EUKB 4YN3A 4ZFGH 1Q0XL 4OJCA 1H3VA 1JL8A 3EOTH 3QYCA 5L6YH 2O6FA 2EQDA 4H8HA 5HGBA 1SXSA 2PYED 2VWEE 3IWUA 5JO5B 2XWTB 2A73B 3DJTA 1NCAH 5T1LD 1KB3A 4HP5A 3D50A 1J0YA 4ZSOB 2GKIA 2H4EA 1KXVA 1J05A 5ESVA 4QHMA 4PJGB 4EKXA 3WFCL 1JZ5A 3QUXC 3WTWA 4HS8H 4IIQB 2W9EL 4FCAA 3CZJA 1HFUA 5E8OA 5INCB 5E03A 1P7HL 2VLJA 5KTEH 2Y24A 4U7KA 4LQ1A 4UNVA 3ASOB 4NZTH 4P9MH 1U95A 2BP5M 2VZVA 2Y2YA 3UC2A 2E7DA 5DJXA 4FXKA 2IXQA 2A9CA 4RH4A 4F3FA 3CBKB 3S6CA 2J44A 1EIBA 4NGHL 3IRPX 4G9FD 1I7RB 4NUQA 3U6RA 5FF6A 1SUHA 2BSRB 3MMEB 1LXMA 3NJIA 5ESAA 2A6JA 3OZLA 5FCUH 3AMKA 1VZGA 2BY0A 1TETH 2EEAA 1GSKA 2A6DB 5TGBA 4CRPA 5L4IA 4K3EL 2FBJH 3QG6A 2ZPKL 4D3CL 5D1QA 1FNSL 1NAMB 4TNVK 2ZXAA 4K7PH 4D9QD 5G5DA 3EJYD 4XVJL 3ZUNC 7TAAA 5IJBC 4YK4B 3UTSA 4PJ8D 4PI0A 1JDCA 1C5DB 1O5PA 2OJEB 1ZSDB 4F15B 3MACH 2XTJD 1NBYA 1L0XA 4IBVA 5DZJA 3LB6D 1NL0H 3L3OC 3VW3L 5BV7B 1RK1B 3K8LA 4K71B 2BPBA 1QZNA 4J3TA 4KI5D 4NO2A 3MGOB 4EIGB 4RWYH 5I1EL 3AM8C 5F0MB 1GZPB 2B9AA 4FDWA 3EO0B 4GAYB 2Y4SA 4O58H 3U7WL 1Z1WA 1TO5A 3AUWB 4PJ6A 3T65B 2ZWLT 4PCKA 3UTPE 2H26A 1ET7A 2B3RA 1MHCB 1N6VA 2OV0A 3D69A 5K39A 3LVEA 4OSUL 3RWEA 1WAEA 1IUZA 1ZJAA 5HHQA 2ZOUA 2K6WA 1D5MB 5L7XL 3GJEB 1U92B 3GMPB 1Z3GH 1U8HA 4LCWB 3ULUD 1MWAH 5DA0B 1T80A 1C12B 5F1OB 4EZLA 3C2SA 3WS3B 1FRGH 5DHVH 2F5AL 3FO0H 3BMVA 4FG2A 4YFLI 2CLRA 3TIEA 3DJSA 3P9MB 5DMIL 1G6RB 4QOKA 4EI5C 3II3A 3B7YA 3QIUD 4OTXH 4JK0D 1AGBB 3HG3A 5HGAA 2KT6A 1AIFB 4Z7VB 2R0ZL 2Y1ZA 2YPVA 4NI6A 5GGQL 3ZZSA 2ICWI 2PP7A 3GHPA 4X7FC 3EUDA 2XX0A 5HYSG 1UWYA 4PGEA 3OLDA 4AQ1A 5HI4C 1KN4L 2R1YA 2ZX8A 3WY1A 1ZCRA 5JIHA 4OLYL 4NZJA 4OZGE 3BPOC 2BCMA 3GLZA 1Q1JH 2XA3A 4X42A 1J0HA 4X4XB 3BWUC 1S7WB 5IHHA 3KS0J 5T33L 5LAPA 1J86A 2GT9A 5E9NA 3VI3A 2QZQA 4RX4A 3U4BL 4WKZB 2AJXL 3KR3H 3HA0A 3Q1SL 4JRYB 1OL0A 1RCYA 2I5YL 2QR0B 3ALWA 3UAJD 2XZAH 2PCFB 4DUWA 3HI5H 4UDTB 2NZIA 3GB7B 3GS7A 1SFHA 1OAJA 2VLLB 3P02A 1NIFA 1THAA 3QUHA 4FMFA 3CBRA 3CZFB 4OGAD 1SLUA 1G9NH 3RWDB 1I3RB 1W8NA 2JE8A 2HFEB 3WNNA 5A40E 3KVQA 5HD8C 3P40A 3MRBA 5JA8B 3L3GA 4GQRA 4PRHA 4TKWA 5GGTL 1WISA 5KVDH 4UZUA 3MNWA 5AOMA 2QGBA 4LGRB 1PTZA 4DJMA 1KGJA 1DVQA 5J6GA 4LF3A 3GSNH 1F90L 3AS2A 3TA3D 5ISZB 3CX5J 1L9TA 3BSZL 2B3IA 2V2TA 3EBAA 5J5EA 2GTWB 4KXBA 5AAWC 3T8VA 4LKXB 4Z76B 4X4KA 3QI9C 5G4NA 1ZLEA 4XNMA 1CIDA 1KB5H 5ESQB 3B2DC 5K9KB 5DA4A 5F97E 3LRKA 1KGCE 1O9WA 2WVVB 2X7LA 4NQCE 1IC0A 3QWRA 3BUIA 5GS1B 3TL5A 1CDHA 1Z9LA 3KBHE 4RMVA 3OGOE 5B38B 1KPUB 1L9OA 4IDJH 3QFJE 4U6HB 2Q3ZA 5CGYC 3BKJH 2D31B 2PO6A 3NESA 4YSRA 1YYMH 3T71A 1BM7A 3FRPB 5A7BA 2XG5A 4M9OA 5TDNB 5C6PB 1NCJA 5AB9A 1Q1PA 1XEDA 2QPUA 3QEUA 4HPOL 4FOMA 1WZ1H 2E5EA 4AX3A 2P28B 1SEBB 2FWOB 1H15B 1WE5A 5I82A 4XHJD 3S35L 3WIFA 3K8KA 4LGPB 3WNOA 4XMZA 1D5IL 1ZWIA 4URKA 2EYSB 1S7SA 2HXAA 2MOGA 3GSOA 4WU5B 2GQHA 3C5SA 2AJSL 3O45A 3MBWA 3ARFD 4HH9B 7FABH 2EYRB 3GS0A 4RSYA 5BW7C 2MCPL 2V5TA 2FH6A 2Q8BH 4JPVH 4BZ1A 2PR9A 4LCIL 1AQHA 1WIOA 1RIVL 4RFOH 2P9RA 3TNMA 2Z91A 2A9DA 3HE7A 3KD4A 1ADQA 2I27N 3MGAA 2P47B 1MI5D 1MF2H 3NJJA 2IFFH 4MMZA 4YXLL 1QMUA 1WBXB 2B2XH 5I0XA 1MJ7L 2BDNL 1FZOA 3PWLB 2W91A 3L5WA 3MUY1 3O4LE 1WA1X 3WFBH 3KWWA 5DYOB 1K5NA 1JNJA 5T1DH 3DX0A 1HNYA 1QLEB 4I7ZC 5A1AA 5FA4B 3P2TA 1B88A 5HHOD 3APCA 4AOFA 1QNIA 3DOSA 2K3TA 3D33A 4OF6A 4QYAA 3MXVH 4HCRH 1DP0A 4L29B 4L8SA 1JGIA 4L1BA 5D1XE 3VXOB 4ZYKA 3VSVA 1HEZA 4MD5A 3EXLA 2K8QA 1CDGA 1ZE3H 4EVNB 5EOQL 4AK2A 4XWGH 1U33A 1P7KA 2HH0L 3GHBH 5FKPB 4FNLL 2H8PB 1WICA 2AXJA 3F65A 5IV2A 4ZXBC 3VWKC 4AMWA 4L1HA 1XD0A 5C2BH 3NDYE 1I8KB 4E36A 1AG6A 3NRQA 5GS0D 1JHTA 2MHAA 3MO1A 1RP8A 4B0MB 4YNYB 3NACL 5L2JB 4FA6A 2R1WA 5KSAA 4YZFF 3NUKA 1FJ1B 5D72H 4FNSA 5FYLL 1KGWA 4GNKB 1DVSA 5BQ7B 1J9TA 2FO1A 3P77A 5HDWA 1RJLB 4EN3A 3FPXA 5AZUA 3K6OA 1L9PA 3LRGA 4ZUWB 3MLSH 5EO9A 2PETA 3WCYA 5I1KH 3LXBA 1WWBX 2CDGA 4MJHA 5FYJU 1TTBA 2NX5B 3Q1EA 1YQVL 2Y7QB 3D6GA 4WCYL 4BZ2L 4L3EA 1ZKAA 2FJGA 3KPRB 3R4DA 4MQTB 4QCIB 2FSEA 2ITDA 4U3HA 5HYEA 5LKNA 5B8CC 1QBMH 4UT6H 2VLRE 2EC9U 5F7DA 4NZUL 2GTZB 1HS6A 2XY2A 4BSWB 2EE6A 4U1IA 4TTDD 4GS7B 3QDME 3VE0B 4UINH 2P4AB 2XWZA 4XCEA 2APFA 3QULA 2BW5A 4HCIA 5FYKH 1O7DC 3AQDA 3ZKXC 5E08H 2VN6A 5F1IA 4E9RA 2BINA 1BZ7B 3ULVL 3BEVB 5DC9B 4HIJA 1PCSA 5IG7A 1RJYB 4HIPA 1IL1A 3R1GL 2F1AA 2A74B 4F7TB 2B77A 1NLBH 3FN3A 4PGZA 3MLTA 4LO9A 4KGLA 1MW2A 2ZCLL 4H5SA 4MFHA 3IVKA 2WQVA 4JQVA 3T2PA 4AQAB 3UG5A 4QEGA 3MRCA 4MDIA 3UJIL 2VDLL 1LYQA 4ICWA 2B59A 5D2LB 3OZ9L 3QZNA 5D4HA 4PLKD 3AGWA 3II2A 4PVMA 4PGJA 3VFTB 1PSKL 3G6DL 2TSAA 1MNUH 3MV9E 1MIML 4XMPH 3DX7A 3ZT5A 4HU2A 4X5XB 1F8TH 5JXAH 5H94A 1IRAY 4HOXA 1IGCL 2P5WA 3OPUA 4LSSL 2CUAA 1BXUA 1CR9L 2DQDH 3GRBA 5T8IA 2E3VA 2EUVA 1H3XA 3SQRA 2Q3XA 3PS6A 3GXNA 3G5VA 2XLLA 1MCFA 3ECQA 4NQDA 4PJEB 4F9PC 4ZMLA 1RUML 4WU7B 1PW3A 1GCYA 3PDDA 4XRCA 3CSYB 5IHUL 3HNTL 1IBFA 4KY1L 4N5ED 3K5RA 4WO4A 5JHDD 4AGPA 4W1TA 1MRDL 1JGUL 2BVUA 5FGSA 3DRQA 4F1SA 5IKCB 3UTZA 5FYJD 3WI9A 5C0BE 2IPKB 4GYBA 3UJJL 1UFUA 5C9JA 4YDJB 5LXVA 5SX4I 2OL3L 4NHCH 4R2GC 3IF1A 4LRIA 3DPBA 3ZDXF 5KVMC 2BSDA 3FRUA 3KCPA 4WSJA 4Z0XA 4X6EB 5D2NA 1PJWA 1HL5A 2C9QA 4IKJA 4PWKA 4RDQG 4TPRL 3SQBA 1HZHL 2R23B 2EIJB 2NCMA 2ALAA 5GSVB 4G8GB 4K5OA 4QOKD 2JIXA 4PV9B 4KO6A 4NZDA 4Y1SA 1PLGH 3FB8B 3OXRB 3J2PA 2ESVE 4CBPA 2X2UA 4FQIL 5C3IA 3SJVE 4YXHH 4NLHA 5DWPA 3TVMD 8FABA 5IF0A 3S7GA 1U8QB 1JWMA 1KN2L 1NKRA 4WWKA 2DW5A 4XGZB 2O61A 3BUYA 4JPIA 4W9IC 1CLYL 1F6LL 3C6SA 1X5IA 4N2MA 3NYKA 3W81A 4HIIB 1PDKB 1X5HA 1MVYA 4KO7A 4ELKA 1U9KA 2EDWA 2KKQA 3WHXB 4WTWA 3BKMH 1JV5B 4RX4D 1TPXB 3BHBA 2Y23A 3B2PA 4QO1A 1JE6A 3M1OA 4XP1L 5HPMA 2PPAA 4NN6C 4ATTA 4JQXC 3IGLA 2PWFA 5DJDB 4FXTA 4P23A 4GMTH 4PJ9A 1PFOA 1QYGL 4J3WA 4P3WA 3L5IA 3HBZA 3LY6A 2E8ZA 5CN3A 1QW9A 2VMDA 3MV8E 1DN2A 4OGZA 3HZKA 3LZRA 5KZCD 3UBFA 2ADJB 3Q3GA 1A7RL 3NJVA 1ZLWH 3T2OA 1P4BL 2BIOA 1C9SA 2FJFA 1NH6A 3FQUA 3KVPA 1EGJA 1OK0A 2Y5TB 3EOAB 1CQYA 4CN4A 2ZKHL 3D2UA 4QHPA 2AVGA 1DBJH 3M86A 1KLGB 3DOIA 3VD1A 2Q2LA 3RTQB 2ZT9C 3AWGA 1RHFA 2X10A 5ILTH 5F6IB 3T6WA 3TS8A 2C1OB 1V7MH 4QXTA 5KOMC 2DBLL 3WNJA 2BSSA 4MJ4A 2C9XA 1S7QA 1FN4B 1AKJB 1WVZA 4KK6C 4N6QA 4P0DA 4Y1TA 1FFRA 4B5ZA 3GPSA 4M8RA 3SCMC 3RDTD 2ZCZA 1LP9B 5IJKC 1IC1A 3DK0A 3QPKA 4AYGA 4FHBD 3G3LA 4XCFL 3O0RL 2QZ5A 1FL3A 3JQOB 3NEEA 5AZEL 1N7ML 3PWVB 5FC9A 3TTYA 3QIBD 3G5ZB 1WRFA 3B9KC 2AABH 4J6RH 1CYXA 5IQOA 2X4NB 3L95B 5LDUA 2QKIA 2HP4A 1A3RH 2MKLC 4ODVH 5C0AD 1IAII 1HOEA 3PL6A 3KHQA 2OSLB 1JTPA 3VG0L 2DYSB 3WJJC 2BVOB 2XKSA 4GXVL 5CJBA 1FBIL 1O7VA 4A63A 1EHXA 1OAKL 3QO0B 1GHFL 4EDWL 5DQDL 4WVRA 3BO8A 3ZHFA 5HYQA 4CMHC 5BZWB 3EH1A 4PCTA 4MNGA 2ZP9A 3RL2B 5AB0A 4W6YB 3IDMA 4Q9CA 3EG9A 4ZMYA 4JJ5B 2GABA 2MEJB 4BFFA 1XGQB 1A1MB 2IGFL 4NPYA 5MENA 3D7PA 1A6VH 3KNBB 2F1BA 4TVSa 1MVUA 2AFNA 1AR1B 3TBTA 1UKSA 4F7KA 4AMKH 3B2UC 4TNWF 1R3KB 3MZTA 2I07A 1B2WH 1E2VA 1RU9H 1JGEB 3EF7A 1DN0B 3UTTA 5CKAA 4JKWA 1WS8A 4E41B 1RH8A 1KULA 2IDFA 4R3SA 1OB1A 3MRFB 1SOXA 4GP5B 4OZGF 2M2DA 3BP7B 4YHPA 5BRZD 4MWFB 4G5ZL 3VO0A 1V54B 4JG1H 4LHUA 4HK0A 4O51A 1AGDB 1N10A 2J4WL 1JZ7A 4XXDA 1OB0A 3TZVB 4IGBC 5DJAB 1RZ8B 1X5FA 3UBXA 5HGHB 1I31A 3M7FB 5DR5L 1JWUB 1V8HA 2BVYA 4G43B 3L3IB 2ZOKA 1SMAA 1UXMA 3VJ6A 2HMIC 4K5PA 3CFCH 4ZS6C 3CFNA 2JXMB 1ET5A 3QK0A 2CNYA 2L0DA 4FI7A 4OBRA 5AL0A 5F3BA 3CIQA 1CICB 1T1ZA 3BH4A 2FIRT 4LXFA 3GSXA 3MA7A 3T1WA 5I8KL 3RVVD 1AO7D 1IGTA 4EN3D 5HHMD 1KXQA 4ZUSA 4N1HB 1BBDH 3U6XA 5H35B 1CL7H 1HHGB 2DTML 1BVLA 1IIIA 2VLKB 3G6AB 2Q76B 4PJIE 3BUTA 1BWWA 5HHPB 1HCYA 4NO3A 1OWRM 3DX8A 2A1WH 1QUNA 1OTUD 1GAFH 2H32H 4R4ND 4HS8L 1UT2A 4P4RA 3IFNL 3T0EB 4FYRA 1WIUA 4JFDD 3UERA 3LNFA 1Q72L 2HZHA 4HWEL 3LEVH 5JR1H 5E00B 5KTEL 4YE4H 1VGEH 1ZDSA 4LL4A 1JD7A 2ICWB 1U21A 2MJWA 1FE8L 4ODXA 4Q6IB 4CC1A 4POZD 4DVBA 5ICXA 4M8QA 2X1WL 2OJ1A 1HXMB 1GC1L 1FFNB 4HS6A 3VWJB 1A4KA 4LOUD 4IOIB 5AYUH 2AEIT 1TNNA 3UABA 2OCCB 3ASWA 4FEMA 4M62H 3I6KB 4L8BA 2ZNXA 4A66A 4LASH 1W72L 4KKAD 3BQUB 3TFKD 2EDYA 1BBJA 3OLEA 5K5YA 2VJXA 3F3HA 2A9AA 4P59L 2EKSA 3OF6D 3SKNB 5F7HA 3D4ZA 3GXPA 1LNUB 4LGSB 3ET9F 4H0HB 4MJJA 2E0PA 2PCYA 2GB2A 4OR1A 5GGVH 2AXFA 2FBJL 4DUXA 1RZPA 1X9QA 1JS4A 1ZANH 1YEJH 3VXRA 3D87B 1A5FH 3UCQA 4LLWB 1GYAA 3HCVA 1BVZA 3ILDA 4K7PL 4QJ3B 3O0LA 4S1DC 4WQOA 3TO4B 3QUXA 5KW9H 3KJ4C 1KBWA 2GC4C 2P5WD 1X44A 3MBXL 5CJ8A 1R5VB 3P0YH 1IM9B 2YJLA 4X99A 1JGDB 3ZE1B 3VD2A 2WJ7A 3HC0B 1A7QH 3IJEA 4KBPA 4N2LA