3VD0A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
202
Chain Sequence
HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
molecule keywords Tumor protein p73
total genus 37
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd0A00
1EAOA 3D0AA 3VD1A 3WTYA 4L0ZA 5AB9A 5ABAA 4AGQA 3Q06A 2GEQA 3D08A 4LOEA 4L0YA 1KZYA 1UOLA 4G83A 1GZHC 4AGOA 1EANA 1LJMA 2PCXA 2BIOA 4LOFA 4AGLA 1YCSA 2J6WA 4IBQA 1IO4C 3KZ8A 5LAPA 4AGPA 2FEJA 2H1LM 1HJCA 3IGKA 2P52A 1T4WA 3TS8A 3WU1A 2AHIA 2J1ZA 5AOKA 2BIPA 3QYMA 3WTVA 4QO1B 5AOIA 1TUPA 5A7BA 4IBUA 2OCJA 1CMOA 2IOMA 1EAQA 4AGMA 2AC0A 4LO9A 3US1A 2J1XA 1HU8A 2X0UA 2X0VA 3D09A 3EXLA 3D05A 2XWCA 5AOJA 1CO1A 4IBSA 4MZRA 5AOMA 2BIMA 3WTUA 4A63A 4IJTA 5G4NA 2X0WA 4L18A 5AOLA 3IGLA 2WGXA 3Q01A 3D07A 1E50A 5G4MA 2XWRA 3US0A 3WTTA 2YBGA 1GZHA 3WTSA 2IOOA 4IBWA 2BIQA 2IOIA 2MEJB 2RMNA 4IBVA 4GUOA 4AGNA 2BINA 4XR8C 5G4OA 1HJBC 2J21A 4HJEA 4IBZA 4G82A 4MZIA 1H9DA 5ECGA 1TSRA 4IBYA 2VUKA 3ZMEA 2J20A 3VD0A 2ATAA 4GUQA 3VD2A 5BUAA 2J1WA 3KMDA 2ADYA 3Q05A 5LGYA 4KVPA 5KBDA 3D06A 2J1YA 3WTWA 3EXJA 3WTXA 4IBTA 3QYNA
chains in the Genus database with same CATH superfamily
3BPLC 3W56A 3UAAA 5E2TH 3LQAL 1NMCB 4LFHG 2OMZA 3CC5B 4EF3A 3C09B 1MRCL 1TZ8A 5AVYB 2A6DB 3T5WA 3CFCL 5B4MD 2F8XC 1RHHA 2YKLL 1QBBA 3PGDA 4EOWH 3UTSE 1UM5L 1J9SA 4LRNL 3BPCA 1P7QD 1EANA 4PWHA 1MWAL 3DKHA 4C56A 5CSZB 3UPRA 1IM9B 1IBGL 2IADA 4AQZA 4HAFA 1CI3M 1HNYA 2VR4A 4J8QA 1CJYA 2P48B 4P3DB 3CBRA 4RAVA 5DMGD 3QXVA 3B56A 2CHNA 3I6SA 1QYGL 1A1NA 2HB0A 1F97A 4NRYB 2E59A 3RX5A 2DYSB 5CGBA 3H9SB 2FBJL 3LIZH 4L48A 3ROOB 1SF5A 5T3XE 2Y7SA 3HN8A 3HLKA 1E6JL 4Y8AA 2DZEA 5K1JA 5MEPB 1LDPL 3QA3A 1W16A 4UTAH 2KZWA 4XN8A 5DI8B 2FH6A 2V17H 4MA3A 4NNYA 1JCKA 4NB7A 35C8H 3BAXA 5FKAA 2VRAA 2ZICA 4RMSA 4AEEA 3SHSA 2C1PA 3DTUB 2B3RA 4YSOA 4A55A 1VEMA 4Q6KA 1N4XH 5GSRA 2UWEF 1JPST 3CXHK 3FUEA 1H15B 5BW7A 1N0XH 2BNUB 4ZI8A 4LCYA 3H9SE 1PCXA 3D39D 4OJFH 2HKHL 5DZNA 1JZIA 2PTTA 5HHMB 1TCRB 2CXKA 3UTQB 4EUPG 4LSVL 3WYRA 4CVZB 3PNWB 3V10A 1PVHA 1QZNA 5CUSH 1KLGA 2H3NA 3FQTA 3OWRA 4RWHA 2DL2A 15C8L 3WXVH 3I85A 3MN8A 2NY1C 2OMUB 3EJUA 3QARA 4OLYL 1I3VA 2VDMH 3WS3A 1WWAX 2FHBA 4Q0XL 3DBXB 4JDTL 4L9DA 2CRIA 4ZUTB 1KPUA 2VABA 3MV9B 3A6OA 3SYAA 4Z3HA 1X6LA 2QLVB 5AAMA 5CBEA 4BFKA 5EB9A 4GO8A 1KN4H 3ARWA 2X4UA 3MRPB 3IWVA 2BY3A 1EQWA 5IKCB 4GQQA 1A6AB 3CD4A 2B3IA 2OYPA 3QEQD 3RWEB 1H5BC 2QTEA 5JXEA 4XX1G 4O2EA 4OZGE 2JKJA 1KIQA 1NCGA 4N2DA 4NC2B 4F57H 4YHKL 3DUSA 2AQTA 3S97C 4QRAA 4MMYB 4OLWH 4ODTL 4HIXH 2HN7A 4P3WA 3OPZL 2P8LA 4WK4B 5DD0H 3UC0L 3T77A 1SZNA 2WXFA 3NCXA 3F01A 4ICXA 5D93C 3INOA 3BT2L 3RIFF 4IOFC 3N6YA 5CGMA 3E38A 4NT6B 4ES9A 5D7IE 4XVJH 3RNKA 3ARBA 1QD0A 4DN3L 1F4XH 3KJ4B 4Y4KA 4CU7A 1ZLWH 1VCBC 2CO6A 3TA3A 3VQ1C 3N06B 3ASOB 2XWTB 1S9VA 1UWGH 3QJHA 2ZZUT 3RWCB 4QRQA 1GGCH 4LIQL 3P3RA 3Q44A 2FX8L 4LASL 4PWKA 1DSWA 1QHQA 2FATH 3O4OB 3ZTNL 1K5NB 2RACA 3MA7A 1RAMA 2AXGB 2J1KA 4QMEA 5LN8A 2WJ7A 3P30L 5AEAA 3MJ9L 4Z7QF 3F8UB 3UJIL 4N1EA 1HJCA 4ODSH 2BH0A 3HHSA 3LKPB 2F7IA 4PJGA 1IEBB 4PJIA 1MRDL 5E1AA 5FKPA 1SEBB 5J8OA 2B16A 3B5GA 4G7VL 3CZUB 1RPQA 4X9FA 1MPAH 4Y4KC 5CGYC 5DK2B 3FQYA 2XZAH 4K3EH 2DKMA 3P9LA 5I71C 3G6JF 4PJFF 1QLEH 1FNAA 1PNCA 4UQCA 4WKZA 1NCIA 1XH3A 5HY9A 1WWBX 2X3AA 5I76B 1CPUA 3OB0H 3U46A 4NQDD 1FNSL 3DJZA 4ZFFA 5I0WA 5K9KA 2A2QT 3B2VH 12E8H 1KCBA 3PXHA 4R2GD 2K9UA 1AXIB 1XCTB 3VCLA 2ALAA 2VC2H 2BIQA 2EZ0C 4YBLB 2JCCF 4CBPA 3PAVA 3WD5H 2D0GA 4O2FA 4F5CE 2Y22A 2DQUH 2YSSB 5BQ7A 1FE8L 2OMXB 3O41B 4BBWA 2FNWA 3PFUA 4QRPB 2ZWKA 1VFBA 3QRBA 1IT9H 4HZAA 4X5WA 5I5IA 3FU0A 1XCQB 4U3SB 1C5CL 2X05A 3I9IA 3D4CA 3WY2A 4N0YL 1JDAA 2G0KA 4FNUA 4Z9KB 4YDLB 2EO7A 3OAZK 4HJGA 3OJMB 4DK6A 1RL1A 3CBJB 1NKGA 3A3YB 4JPSA 4X0KA 2BLFA 2E7MA 1FYTE 3QFGA 3GBLA 1VSCA 2DTSA 2YBRB 3L08A 3M8OH 4X7FC 3MLZH 3WS6A 4MJ6B 1JNNH 1NBZA 4LOEA 3N04A 4FLRA 1NDTA 1G9NC 1R3JA 5CP7B 1NCJA 4XCFH 3O8XC 1FV1A 2EE2A 2VIRB 2Z31A 4HYTB 1T1XA 4XNMB 4ZPVB 5J0BA 3LKOB 3TJHD 1CLZH 4OFPA 4O58H 3GJFH 5T3ZE 3K8KA 4BGLA 5EDXA 4XX1E 4XP6H 2KHAA 4LEOA 1L9MA 3RWDA 2H4EA 2H2PD 5FC9A 4YQXL 3ZE0E 1CD1B 2R2BB 3E1ZA 3TEYA 1UKQA 3JTTA 4KVNL 1OAKL 1RZKL 4D9QE 5I6LA 3RL2B 3X14B 5DR5L 1CL7L 3I9PA 4MZ2A 2X2IA 3QDGA 4J4PC 4M6AA 1UURA 1HC1A 4KZEL 2XN1A 3OB8A 2R9HD 4JM2C 4U7KA 4IBUA 1C5BH 1D7CA 5FV2A 3LPGA 3IMWA 4Z7VF 2WQUA 2JKTM 3X13B 4JFFB 5C0DA 1I7TB 3ZR6A 2B8OT 2XPZA 3LTVA 4LRIA 2GI7A 4M7ZB 2EADA 3N1QC 3L1OH 5GSVB 4NQQA 5DJDA 3DC0A 1HH9B 4Y5VC 4A6YA 3L3GB 4Y19A 5CLYA 2EH8L 4LDEB 4NQDA 1Y7VA 2XWJA 3HLAA 2PWHA 2Z93B 5DHYA 1OL0A 3BWUF 4DPAX 4AM0B 4XMKL 3BLPX 2P7TA 2GIMA 4X7SH 3QUMH 1JK8B 3IPEA 1VACB 1ECYA 4XVJL 1W72A 3W9DB 1RURH 3GBNH 3ZRFC 2R15A 3FB8A 1OAYL 3P9MB 1DJXA 4EVNA 1E28A 1ORQB 4BZ1L 4E9RA 1S6NA 2QKSA 4P2YA 3MRMB 5JYMA 3FONB 3ASWA 1CZ8H 3MCYA 3PABA 4DH2A 2RQ8A 2WZ0A 2ZUYA 4LPVA 4OD3L 5BV7C 2AS5M 3QA3B 4D94A 3L7FA 2WO3B 2NY2B 1ACZA 43CAA 4J6RH 3WENA 3D9AH 3RE0A 3MV9A 2FVNA 4M7JL 2LLGA 3ROLB 3QIBC 3X3GH 3D4YA 4EPSA 2X1QA 1NCAL 3Q3GB 1OTSC 5GSRB 3T3PF 1DDHB 3EO1B 4Z1PA 4R5VA 3ZE2B 4F8OA 5FFOA 1QAWA 4HJTA 4P9HH 5E1GA 5GGRA 5FGRA 2EDLA 2OTPA 1RZGB 3H56A 3EADA 3GZQA 2CHWA 3BMWA 4FDWA 3Q06A 3VMNA 1RIHH 3Q6FA 4Z7VA 3LN9A 4JKMA 4X8JB 3I02A 1BVNT 3ESOA 4GW5A 1F3RB 4X4ME 3BD4A 3MLZL 2H45A 2JJSC 3L9RB 1EJFA 3X11B 4CVWA 4F7EB 4YR6B 1WO2A 3VXSE 1ML0A 2NXYB 4LCCC 4YWGH 5I74B 4AQEA 3T0EA 1IE5A 2R2EA 3AUWB 4YDLC 3AG1B 4NZDA 1R24A 2NY5L 4QTHA 5D1QE 4AXWB 1KCUL 4PFEA 2QELA 3JWDH 1P7QB 1QLRB 2FJSA 3W11D 1QBAA 4WRLA 5ALBL 3RUGB 4F3FB 1NAMH 3R7RA 3QEQA 1KGJA 3DX8B 4P2RA 4G1MA 4PG9B 4UDTA 5F96L 2QR0B 5C09B 3BMVA 5KVDH 4F33B 3IDGA 4XVTL 1IC5H 1BG9A 3FCSA 1WGOA 3HI5H 2WBXA 5EIIA 2XA3A 4RRPM 4YNYA 1J8HD 2Q10A 5C08D 4XOBA 5E2UH 4IKIA 3L9BA 1LDPH 3W9EB 2XJKA 5ENWA 5CR1A 4HLEA 1KIPA 3HHMA 1KTLA 5GGTL 1V3LA 2VN4A 3D05A 2O5YH 3N41B 5BRPA 1S3RA 1T4KB 1L9PA 2K6YA 1T2QL 1DQIA 4GUPA 1EGJL 2WZ5A 2OMWA 2V7NB 5KSBE 4YXLL 4CSZA 4NNPH 3SGKA 3RDJA 2X0WA 3V0HA 4Y7MA 4Y4KB 1SYVB 1X9QA 3L5WA 1DBAL 3D39A 4PWEA 1TZGH 4G3YL 3T4AC 1E0OB 1ND0A 2EDWA 4Y1AB 4EDWH 4B9YA 3LAFA 1GAFH 1J18A 2VAAB 2O4EA 3QIBD 2HVKB 1RUAH 4QR7A 1FSKB 1FNEB 3BAYA 3WUWA 3P9LB 4MDJB 3HG1D 4EAEA 4B3EA 3C5JA 5GGSB 4RMWA 4WO0A 2MPAL 5LVEA 2IIJA 3Q5YA 3EOYG 3MACL 5KJ4A 4PYHA 3O9WC 2G2PA 4NNXA 3T0VA 1EFXA 4LVNC 3SPIA 1DEEA 1P6AB 2Z64C 2VNCA 3ORJA 1MCCA 3BP5A 2Z9TA 1MCWM 2DQFA 4BHUA 4M3KB 4PJFA 1L7IL 1UD8A 2F2HA 5LN4A 1BD2D 1DQJB 3A6CL 4APQB 1QWNA 1RIVH 5B4MC 4YSAA 1A9EA 1NLDL 1WA1X 5TE7L 3DI2B 4LHUD 1RZKH 2O61B 4HXAL 3TYFB 4QNPF 3KEHA 3O6KL 5DEFA 1M3JA 5GGSY 4NI3A 5JPNB 3WY1A 2YN5A 4EI5C 1IM3B 2CE6A 2HX7A 3BHBB 3CN3A 3D08A 3ZBMA 2EVJA 1FFOA 1TQBB 2ZAGA 2VITB 3QDMB 3WG7B 3ZKND 3PG2A 4X6FB 2CIKA 1HH6A 2LU3A 3KYKL 4XODA 2JJSA 4PJXF 4H4NA 3MAWA 2XNAA 3ZE1F 1AGDB 4H0HB 2VDNL 3KL5A 3TA4D 4KK5C 3C60C 2DQJL 3G5XB 2Z91B 2IQ9H 3CHPA 3T0EE 4EZKA 2OMUA 1DVQA 4H8QA 3MX0A 1N7ML 1KXTB 1NINA 3QZBA 5ETUB 1U0QA 3HC3L 1UOKA 2YA2A 1UZ8B 4UANA 2RD0A 1FN4A 5T1KA 1KC5H 1TQSA 5D1ZA 3V0DA 3DVFA 1T2JA 1MCJA 5IOPA 4MWFB 5ERWA 1SOXA 3V5KA 3BCDA 5TGBB 3UTQA 2AGJH 3RWEA 1K4DA 1YN6B 1JWMB 3VGHA 3X12A 4BINA 4PJ8C 1V7MH 2EYTB 1VADA 4GRWE 1BOYA 1ZLDA 3AS3A 2IGLA 2HN7B 4FXGB 5CJXA 2ZKHL 1FV1B 5D1QD 5DMKA 5G4NA 3GSNL 2FX7H 1KGIA 5AOLA 3N43B 3IGLA 3O6FC 1YNTB 4L5FL 4F7TA 1D5RA 4MCMA 5DQDH 1XH0A 3ZHDA 2DYPD 4U3HA 3US0A 3FBKA 1QQDB 2C7UB 3CVDA 5SWSE 5I18L 5BZWA 5ISZE 3L1GA 3VWKC 1ZTXH 35C8L 4FG6C 4KMTL 1U8KB 3GBMH 1LK2B 2OULB 3LXAA 4O4YL 1LD9B 4DN4H 2ZUXA 1C16A 1UJ3B 5SX5K 3C9NA 5HDBE 5EHFA 3OQRA 1JGUH 2IALB 4LRIC 4UM8B 4IU3A 1ECZA 4NKDB 3GUTA 3ES6B 1Q1PA 3H7BB 1U93B 2WO2B 3S6CA 4YHIA 1Q9LB 1XF5A 4DGVH 5JMOC 1T0OA 4FAAB 3MNWA 1QFHA 4M29A 3SKOB 1CF1A 1TLMA 4HK3N 2K0RA 2WY3B 3BKMH 3E8UH 4Y16D 1T1ZA 2OS7A 1TMCB 2UZXA 4PRAA 4K0OA 1NDGA 4Y8DC 4W9LC 4KNQA 4ZS7L 3VD1A 1U21A 4I1PA 2VDMB 4W70A 1FPTL 5C0AD 2WK2A 2CDEA 1UT9A 2X28A 2JV6A 3BUTA 4M5YH 5F1OB 4CAGA 1JPFA 3KGSA 2XXCB 2J44A 3L81A 1JNLL 4J3OD 4Z7OE 1ASOA 2ENSA 4UDUB 3BPLB 4FQ2L 2WXRA 1AS7A 4TQIA 4WKZB 4DPBX 3SY6A 5IVNA 2EEFA 2HLAA 4U33A 5E2WL 2NY3D 3TBYA 4N9GB 1Q1JL 1Q9OA 2AERT 5CFHA 2R8SH 4NQTA 3MRCB 2DTML 2DLTA 1G94A 2FT6A 1U8LB 5FUCE 5DTFB 3LH9A 4GW4B 1ZEAL 4OM1L 4F57L 3EYQC 5LDUA 3QFJD 2J25A 3L9RA 3FL7A 1FZMA 2DBLL 3CK0L 4LSPH 5E8EA 2J2ZA 3PWUB 5I8KL 4JS7A 3B3BA 4QOKA 1ZHKB 5GS0H 2YAPA 3NIDE 2MH4A 5C0BA 3UH8A 5F7NC 3RRQA 1YPZB 4X0NA 5KSUA 4K23L 1MHPL 2BJML 2D31B 5C09E 2IANB 3IF1A 1B4JH 4LKCB 4N87A 3DI3B 4UMSA 3IE4A 1KBWA 3MBED 4KKBC 5IHLB 2YAOA 2AZAA 3AREC 4DGWC 2NYKA 2CBQA 4KX8A 4XBPA 3CZFA 1EO7A 4UAOC 4WV1A 1PGRB 3DX6B 3VG9B 5IHZA 2E9JA 1TENA 4L4JA 2J8OA 3PQYB 5T1KD 1JXFA 5I1EL 1I31A 1DCEA 3GZKA 2HAZA 1AD0B 1CGYA 1J1OH 4QXUH 5E6UB 4M6OH 4DF9A 2KLSA 2EH8H 1JN6A 2B1AH 4HBCH 4CADA 4URKA 4OZ4B 2ITDB 3QQXA 3A67H 3L4CA 3QI9A 3MV8B 4GXVL 5DHVB 1HHJB 2X4PB 2C3WA 3MLSL 1MIEL 5DD3L 7PAZA 2R23B 2IPTH 2VRQA 4UYPA 4M8QB 3ZQ9A 3OPUA 3QIBA 3ARDA 4Q6IB 1ICTA 2AJ3A 2Q6WB 1JGDB 3HBGA 1T03L 2AEIT 1KB5A 1XB8A 2QKIB 3RJDA 2OTUB 5T33L 4PJDA 4KQ0A 4PW4A 1YEIL 4JM4H 1SHMA 2V2XB 1D6VL 3DMMD 5B1JC 1INQA 1IKFL 4OZGA 1JYXA 2IGFL 3C5JB 5L6YH 1HE7A 1NM9A 5C3TA 5FDWB 1NBZB 1T6BX 1F58L 1CBVL 3EJRA 1TR7A 1OE2A 3KNBA 4W6YB 4YFLI 3BUDA 3WO4B 3ZMNA 2WP3T 3O8XD 2YMXL 3EFDH 1X7SA 3BSZA 5JPMB 4HOZA 1EAOA 3MNZA 4Y0GA 1OSPH 2QDVA 4WZ9A 3EYQD 1EFXD 3KGTA 3MZGB 2DL9A 2HT4D 3STZA 5FWRA 3JSSA 2NOYA 4MAUL 4JFOA 2FHFA 2QMKA 5JA8B 1GJWA 1IAKB 4PR5A 3LHPH 3V4PB 2Z34A 2C7FA 4M5YL 3HCVB 1FNEA 1MEXL 5IB5A 3QS3A 2Z65C 1XIWC 4JG1H 5GGSA 5E4EC 5L9DH 2ATKB 1CGUA 4DOHB 1NMBL 1C5DB 1T5KA 1E6OL 4BFFA 3SPVB 1PQZA 4KUCD 4EVNB 3SDDB 5C0FA 1VKXA 1OPGH 2KC0A 3MRLA 1RP9A 1KUMA 4HIHA 3MRDA 5IESL 3PP4L 4HX1B 2WUCH 3GMMB 5CHNA 1RU9L 4LLWA 4TPRH 1JHLH 2GFBA 3DVGB 3L4YA 3L3DB 5FA3B 3U4EA 3ULUE 1AP2A 4FEMA 1NBCA 1ETJA 1ZT1B 2ZPKL 4U2ZA 3FYIB 4FCHA 4U1LA 1ZT4A 3K2KA 3MCKA 4DGVL 3HA0A 1TTRA 4FE9A 6TAAA 1HXYB 5K9JL 2CO4A 2H26B 3OAWA 2P80D 3PREA 4YGVA 5E5RB 2WQRA 4N2LA 1JGUL 2KL6A 5C08B 3GO1H 2XVKA 4MDIB 1AYRA 2Z1KA 3TYGH 1ZRUA 4YE4H 1HKLL 3D3VE 4I18C 1MLBB 1F4YL 4KXBA 4K94L 3ZZ1A 4L9LC 1RI8A 3REWA 2L3BA 2G3ZA 2VE6B 2LQRA 3N50A 2LGNA 5C7ZA 2QSVA 4RRPA 5EZJB 2OTWA 1E42A 2CXGA 3BGFB 3K72B 2H0FA 5HYJD 2WYTA 4U2YA 43CAB 2FL5A 3K3QA 4S1QH 1IT9L 3TGXA 4PJAA 4ANUA 5GRUH 1TJHH 4G6AC 5D1ZB 1W72H 3WJJA 1QASA 3G08B 3IMBA 2C1OB 3V6ZA 1MWOA 5L8LB 3PL6B 5DFTA 5TDNB 1EO8L 1YA5A 4F15C 4F33A 2MCPL 3MJ7B 3MLRH 5FO9A 4XO8A 1LO4H 1Z3GL 3H9HA 1J5OH 4JKLA 2N7AA 2PYEE 2IO5A 1BXXA 3GMLA 2HT3C 2X44D 1A9BB 4D2NA 4E9QA 4QRUB 4KO9A 2EC9U 1I9EA 2K3TA 3TIEA 4NPJA 5EWIL 3RFZC 3VFGL 3B37A 1K2DA 2P8MB 2Q9OA 4XPHL 5JW4M 1I4FA 3NCFB 2FIKA 1PKOA 3MROB 4WW1A 3VGEA 3DHMA 4IMLB 2WXGA 1LE5A 3RYMA 4GSRA 4R7VA 1INEL 2Y36L 3NIFE 4JN1H 1WITA 2ZOLA 4X7TB 1OOWA 3P2TA 1TEFA 2QR0A 4FKHA 1Z66A 5ANMB 2QQKL 1SLVA 2YPVA 4IRSD 1UWYA 5C07B 3OAYK 4TNWK 5FO7A 1IGFL 2UXGA 4XHJC 2OJ1A 1AAJA 3GJFA 2CBTA 3EYUH 1NCWL 2OJZL 1KJVB 3SE8H 4ANWA 4MZ3A 4DPRA 1F5WA 1TZAA 4QHMA 1W8EA 4BQBA 4GINA 4DKEL 5IJBC 1W8OA 5I73B 2EE3A 1T89C 2NUTA 1OHQA 4J28A 4YHPB 3I84A 4M7LL 4ATWA 4XBEH 2GITB 1GW0A 5DTFA 1L0QA 4P5TA 1UADC 2DQGL 1IC1A 1CFBA 3CFBB 2EIMB 4N5EC 2ZD0A 2NCEA 3I6LE 3LN4A 2WN3A 5EUOF 3I75A 3ZT6A 3QEQE 1H3UA 1M7DA 2VISA 3HC3H 4MD5B 4K9EC 1C1EH 1RMFL 4NXSA 3MDJA 5I17A 2Q3XA 4MD0B 1I3GL 4BA0A 5JHBA 2PXYB 3EUDA 3HW7A 1DJSA 2P28B 2VDRB 3O3BB 1G7LB 1YPZA 4PG2C 4RISL 3RUGE 5DU7A 4R3SA 4AEFA 1UUSA 4XMXA 1K6QH 2FH8A 4RQQB 5E2JA 1WFMA 4YFLF 2X09A 3MRCA 1NBVH 4KJQD 1U3HD 1S7WB 1DEEB 2E76C 2FGWH 1A6VL 5CCJA 4W9KC 4L8CA 1B0GA 1J8SA 2DAVA 2AVGA 1DQJA 1KWGA 4OY9A 1QKZH 1Q0EA 1A9EB 2CDGB 2Y24A 3QIUC 5E00A 1MHEB 4YLQT 3UBXG 3OX8A 3S4SA 5EDSA 1IAII 4LZKA 1KXTA 3E3QC 3QI9B 4PP1D 2AABH 5HHVH 3MLVL 1K8IB 1MAKA 1U8MA 2C4FU 3QQ9D 4CSSA 2X4SA 1JZ8A 4X80L 1KJ2H 1YN7B 5JIKA 4WQOA 1YQVL 1KJ3H 5IV2A 1TKWA 3WKMH 2HX9A 3ZMRA 3RFRA 3W2DH 3WKYA 1IM9D 4DKDC 4ZS7H 4HKJA 3ZKNC 2X4NA 1MY5A 3LIZL 1ERNA 3APCA 3OQ3B 3HE6A 5EULV 4Q9QL 5E8DH 1R46A 1I1FB 3QJFA 3PQYA 5D5MF 1YUHA 2W9EL 1R0AH 3QDJA 4UM9B 2IAMC 3P3YA 3QWRD 3EG9B 1KFGA 2JQMA 3HZVB 1XGPB 2CO7B 3K81A 3QJTB 4NKMA 4CC0A 5E24E 1MI5E 2ZPKH 3H3KA 4FLHA 4BFEA 1G0YR 3P4MA 4ODVL 1I1AB 1W0VA 5JLZB 4L1SA 1TO5A 5JPMA 4PLJD 1VFAB 4KJWD 4BKTC 2V33A 4JR9L 3SJVA 43C9B 2ZAIA 1CICB 4N5ED 3KCWA 4PRNB 3D52A 1ZVNA 3QDMD 4M5ZH 5KVGH 2NX5E 1MCOH 5BZWB 1RP8A 1FVCB 2ED7A 3BVNA 1E3ZA 1P6FA 3MGAA 3MRHB 4TVPH 4XB8A 3R8QA 1P4LA 5I16B 4B5EA 1MQ8A 4OV6F 1U91B 4AIOA 3L7EA 4TLKA 4ZMZA 3VH8B 2A9NH 2ATKA 4JFUA 4HISA 4R7LA 4XN4A 1IFHH 1EAQA 4Y2DA 3TVMD 1F8TH 4KOBA 4PJ6A 1OPOA 3H7BA 4PMEA 1QABA 3DV4A 3O0RH 4L05A 4NM8L 2NX5A 5GS3A 4HWNA 4QAMB 3CQPA 4Y5XA 2X0UA 2XCMC 5E99L 1CIUA 4ELMB 1H6TA 3MRDB 3BUYA 5TFSL 1UD2A 5G5DA 2PR4H 2YAHA 2EIDA 5ACZB 1DSFH 2WKOF 2YPLE 3J27A 4H25A 1HOCB 3SD2A 3STZB 1XBDA 4Q7DA 5E6IA 5DI8A 2ZCKH 5LNEA 2WCGA 4TUOA 1B2WH 4I9WE 4RMTA 5T5NG 2F53B 3ZDXE 4U1LB 2RB8A 3HCVA 4H2AA 4U1SA 5EEYA 4ZXBB 2ZXEB 4Y5YB 1WS8A 4G42B 3U7YH 3O6FA 3G6JE 4XMPL 2DJMA 1KCKA 5CLWA 1XCXA 1KV3A 2OQJB 1A1NB 4FQ1L 1CU4L 2BX5A 1U8QA 4HFWA 5CJXC 3QRFM 5T33H 1KCRH 3GRBA 4HT1H 4QRBA 4BQ8A 2FWOB 4HAKA 1FFNA 2IWFA 2ZIDA 4P57B 2NZIA 4RMVA 4NP4L 1MCHA 5GRXG 1EIBA 2P5EA 4GLRH 4EMZA 1L3WA 1MJ7H 4HBCL 3LIUA 3T08A 2QQKH 3M1BA 1ODAA 2J1WA 1YEFH 1O7SA 1FHGA 4JREB 5K69A 1OVZA 3DVNA 4QUOA 3O45A 5HPOA 3WIFB 4YOKA 3T2PA 4I3GA 4L5FH 1NGYA 2VZUA 3G08A 5EOCH 3V0IA 3ESUF 4L8DB 1MF2H 1FL5B 3P40A 5DD6A 4C8XA 4N9OB 2VZTA 5MERA 4GKSA 1O9WA 1ZHNB 4I5BA 1H19A 1L9RA 4XHQA 5ABAA 3PNWA 2GEQA 3JQOB 2CUAA 4P5SA 1AC0A 2O5XL 2ESVA 4LIQE 4GI6A 3VFUA 2GBTA 4BXSV 5IHZB 5KN5B 3RA7H 3PWLB 2AV1A 1TTFA 1QRKA 2ENJA 4H8WL 3TESA 4B6ZA 2WC7A 4X5XA 2O5YL 5F2FA 2GW5A 2Y5TA 5DHVA 2NY0B 4DEWA 5AVSB 2CALA 3PIQB 3WCYA 1H3VA 3LD8B 3E8VA 4OKVB 5AW0B 5DYFA 2BMKB 4OIFA 1QLFB 1XT5A 4GW1A 5I1GL 3HPJB 5B1BB 1LM8V 3H4HA 3SE9L 1SJEA 2I07A 2NRDA 3OGOE 1DBAH 4MNQD 2XI9A 4RGND 5HD8D 3QYMA 3F6JA 4YJZL 2CR6A 4M43L 3RAJH 1BD2B 3VYPA 5D7LE 5ACLA 1A9BA 4XP9H 3IK2A 2ICES 4KDTA 4GG8B 1FYTA 4E0RA 1JN6B 2E86A 2EDMA 3IAQA 1FE8H 3CX2A 2L7QA 1RJYA 1T1YA 4L8BA 4PJEF 1CDUA 2LFGA 4D9RE 4Z3FA 1WCQA 1CFTA 3WHXA 5IB2B 1B3JA 3MV8A 5M94B 1FH5L 2N3JA 1RJZA 3MROA 3RTQA 1KB3A 4A39A 3VSUA 5HGAA 2BIMA 2Z8WC 2NDGA 3F7PC 3CSBA 2BW4A 4KXAA 4KWUA 4NENB 1NFDA 4WFGE 4GKLA 4TQEL 5D2LB 2OLDA 4OQTA 2O6EA 1U6AH 4YVUA 3BAWA 1N64L 5F6HI 3VMPA 5MEOA 1JUFA 4ZMNA 1SEBA 3EAKA 3KLDA 4IRJD 5I8OL 2JQAA 4ZMPA 4I1NB 5DURD 5B8CB 4NM4H 4JZNA 3D6GA 3ZL4L 1PS3A 5FX3A 4HWBH 4GSXA 5DO2D 4IBVA 1YLBB 4LKXB 4NN5C 2SODB 4JMXA 4AMKH 3VXSD 5C3IA 3QEUA 4HG4K 2UY6A 3HS8A 1NUNB 2DWYA 3VFTB 3T4YA 5F7MC 3MRLB 3IXAB 1JYWA 4HF5H 1U8IB 3AUVA 3W0WE 3FU5A 3VFOB 4CJ0A 3MOQA 3NFSH 4F2FA 1ADQH 3CFBA 5DHVH 4PJIB 1T7XA 2COQA 5BQ7B 4JLRA 3P0YL 1F86A 3NTCL 4KZ0A 4A66A 4NN6C 3NAAL 1IL1A 1PY9A 2H1XA 1KGCD 3OJVC 4B60A 4P46B 1R9FA 4HD5A 3QXAB 3QJZA 5F9JB 3O3BA 2Y6SD 2W9DL 4BCZA 4FN0A 4G6FB 4J12A 2X6AA 3ZIYA 5IW6A 3MKGA 4P9HC 2WSPA 5T3XL 5DLMH 3MV11 2QV4A 3D7PA 1LO3L 2RCSL 3FHEA 3UC2A 4QRPE 1XD0A 2Z4QA 2HG5B 5D4IA 4OBRA 4HIHB 4K71C 4X42A 1JTOA 5BRZD 4KFMA 1LQBC 2PCYA 2O1AA 4M4RB 5I75C 4N2GA 4UOW1 3E7JA 5CHNB 1HEJC 3FU3A 2F15A 3L3KA 4HIXL 3ZY7A 3MTXA 4UZGA 3VGBA 4NFCA 4DFIA 4EDXB 1NEPA 4NUMA 3KLSA 4U05A 2WBKA 3TNMB 3O3EA 2WNXA 3N43F 2J8HA 1F02I 3IN0A 3NJMA 1TVBB 3L2LA 3QR2A 4HJ0C 2XRAH 5DJXA 5I1LB 3PDOA 2NY7L 4LB8A 4N28A 3LKNA 1NCUA 2XTJC 1DBML 4WNJA 4B27A 5HYSG 4QKTA 4UYQA 2L7EA 1MFCL 3L48A 2X2UA 4YSPA 3X14A 5JW4R 4KNTA 3LEXA 4A2FA 4CUCA 3L3IA 3OKKB 1DFXA 2VN6A 3AADB 1N6UA 3MLTB 3RDTD 3ZKMD 2ZP8A 3MRBA 2P5WA 3QG7L 2KZ1B 1XH2A 3LKQB 3NABH 4G6JL 2WO4A 3K72A 3RX9A 1EPFA 4YS4A 5BVJB 5CP7A 5JR1L 4P49A 4NC1C 2J3SA 4X4XA 5EO9A 4V33A 4N25A 4JVPA 4OQTH 3JV5A 3GMNB 2GUOA 3UG3A 4ANXA 5CNHA 5INDB 2G9HB 3SE4C 3BUYB 2JXMA 4MAYB 3MFFA 5DJYB 1YNLL 4LEOB 4KRLB 2NY7H 2P4AB 4S0SD 2AXJA 3EGDA 5BO1H 4X8CA 3QR0A 3GXPA 3RFZB 2APTA 3H9HB 4YDJB 3N9GL 1VJSA 3H6AA 1E4JA 1WJ3A 2WLLA 1PIGA 3EYUL 3RQ3A 2Z0BA 2WNKA 1H6UA 4OCSL 4A37A 6CGTA 4KRNA 4F8TA 4UTAL 4N1CA 2VH5L 3GRGA 5DJCB 1AHWA 4R7DA 1TCRA 5KVMC 3V79C 4G6KH 3K80A 3AZUA 3CZSA 4PSRA 5T1DL 3JZ7A 2N0MA 4JCLA 4ELMA 4I1RA 1AFVH 4N8VB 4KDVA 5D1ZC 1TPXC 3G3LA 4W9CC 5C86A 3ZTJH 3FO0H 2DQIH 4H25B 5KTEL 3S5ZA 4AYSA 3QQNA 3UAJC 1YC7A 3DBXA 3AQYA 2BWQA 5EZLB 4JX0A 1U3ZA 4Q0XH 4ODUA 2ZOTA 1NC4A 1E2VA 4DGYL 4LSVH 2ENPA 2NW3B 2XZAL 3MGTB 5IVXE 4DSYA 3MVSA 4HJ0D 2WKOA 4L9LB 3VRIA 2XXGA 2YPKA 2COVD 1ES0B 2VDLB 2YR3A 1HDMB 3N5AA 1U3YA 4IRSA 4PRBA 4PU2A 4OM0H 5AFAA 2J6EA 4ELKB 4JVWA 2XN9A 1PKQA 5JOEA 5JHLA 3F7RA 1QUPA 2C9UA 4KUCF 3PHOB 3B2DC 4HUNB 4F92B 2ZCLL 4MDRA 3CPLA 2GKIA 1XHHA 2HJFB 4HULB 1KCVH 5LAXA 5C6TL 5A6IA 4HJIA 1EZVX 3SPGA 5IMKA 2Y23A 1J05A 3BKJH 3T0EB 1QFUH 1CTMA 4CSTA 3AT9A 5KJRH 4AXWA 1AQHA 2V3DA 4AEIH 1L7TH 4QJ4B 3GJEA 3BVDB 4JUSA 4N8VG 5B8CC 4XNYL 2DEWX 3DX8A 4P2RB 1OP4A 5CN2A 5GGRB 3N41F 3LKRA 1PTZA 4P4KC 5AOJA 2QPUA 4HKJB 5IBTL 3FCSB 1HXMA 1T5WB 1P9MA 1XCTA 4NLHA 5FF6B 1ZIBA 1B0WA 3CFQA 3CZLA 4PTTB 3SDCB 4DEPC 1VGEH 2BNQD 2B0SH 5G2NA 2YFNA 4JKWA 1X4XA 4G80B 3OZLA 2CDGA 4OCXL 4UAOB 2E4FA 2VXQH 1RVFH 1SOQA 3MGOB 4PRPE 4QGTA 4Z78B 1E50A 4N90E 5GZNA 3U2JA 2R2EB 4GAFB 5HYJA 4ELDA 2QPSA 3PAYA 4N2EA 2MNJB 5DZJA 3PQYD 4BH7B 1XCQA 3NJVA 1N18A 3BSZH 3BVVA 4HS8H 5JPMC 3QZPA 5E6ZA 3T2NH 5MENA 1I8MA 3HPJA 5IV2B 4G1MB 4PG9A 3RTQC 1ZJBA 1A4BA 3I6GA 1E90A 3TN0B 5TE7H 4JE0A 5TPWL 1J5IA 5FDYA 4TUJB 4G6FD 5K5YA 4WJ5B 3NFPA 1YEFL 2M1KA 2DQDL 2PWEA 3NCYP 3L2NA 2EVFA 5C8JA 2PYEA 4NQCD 4JFDA 4HIJB 4NRXB 2XUWA 1SBSL 5DJ6B 4IOIB 3OR6B 1YMHA 4Z3TA 5G55A 5K9KB 1R5IA 4FABL 4X8XA 3TCLB 3LS4L 5F7UA 1RJZB 3MLSH 3F7YB 5GIRA 4TNGA 1PZDA 1EXHA 5CMAB 4MAZA 5HVHC 5DRZB 4ANVA 4JFQA 3AREA 1RZ8A 3LS5L 5KTEH 2VQ1B 4J3TA 1BOGB 2UZYB 4RSVA 4ZUSB 1A1OB 2F53A 2WCPA 3JYCA 3UEQA 4FJYA 3ZRCC 2VYRE 2ZUVA 1IIKA 2D03L 1PZ5A 2VUOA 3Q2LA 4PJ5E 4RETB 2CM5A 5L6YL 2VWEE 1RURL 1JVKA 3X3FH 5IW6B 3QBTB 4G42A 4K8RC 2ADFH 3GRWH 4ZMAT 3DPDA 4HSCX 5FM5M 2FR4B 2VITA 3IT8D 4A68A 1QBLL 4P06A 4X6FA 1OP3K 2K7QA 2VLKA 4M7LH 1INDH 1QSEB 3VSVA 3SDAB 4ZSOB 2VJXA 1UJ3C 2K9FB 1SYSB 5T5FL 5DJDB 4YE0A 2A0LD 3S0PA 4DHLA 3G04A 2P5EB 3GZPA 4HD9A 4YX2L 4XE0A 5I19L 4FNQA 3SSGA 4KKAC 4LPWA 1ZS8A 4RIRB 2YWZA 3IDYC 5GISH 4Z7WE 4WU5B 4LCIH 1IJNA 4JFHE 3RU8H 1QEWA 3LRHA 4QXTB 4X6EB 4NNPL 2LOEA 1VACA 2K78A 2X7LB 1YPZE 3O6FB 4S1SL 1A47A 4UQEA 4R5XA 1JK9A 5L0QB 1WC7B 5C0AE 5EFIA 4HFWB 3MOBH 3FTUA 2HG5A 5IROC 4K7FA 5KSBA 1FPTH 1KPRB 3NZSA 1OW0C 4L2YA 2FIRT 5I1KL 1HCFX 4M03A 4PJIF 2TAAA 3BJLA 4JHBA 1ZTMA 4NRZA 3IDMB 5EWIH 2NXZC 4L37B 4B0MB 4ZBJA 4FNTA 2X3BA 4HKZA 1I7TA 4D9LL 4JUTA 3QORB 3F3HA 4NM8H 1PCSA 4P3CL 3B2XA 1AZNA 4Y5VA 3KPMB 1MH5A 4OF5A 2AMGA 2D0HA 3GHPA 1QO3B 5IVZB 1ZEAH 5I0ZA 3RTLA 4FQ2H 4NIKB 2DRUA 4K8RH 3FRUB 5C0AB 3EH4B 1PX8A 3L4XA 3LN5A 2F1EA 4F9LC 2DBJA 2ED8A 1ZLEA 3F04A 4FG2A 2C9RA 5TPWH 4Z7QE 1FO0L 2Y2YA 1WE5A 3AG2B 4PJDF 1MQKL 4JKPL 1ITCA 1RJLB 2BO0A 2XXMB 3PWPD 2BP3A 4AEIL 4GW5B 1CE6B 1NWOA 3QUZC 1YY8A 3LVEA 5I30L 3VH8G 2W9LA 3W57A 2IALA 4CA4A 4RFNC 1CT8B 1RJYB 3VFNB 1BM7A 1O5DT 1IZKA 2P5EE 5E8NA 4M3JA 3SZKC 1FAKT 3KPNB 5K9OB 5AWNH 3BQUB 1PG7X 2A4CA 1CR9L 4AKQA 2BCMA 1N0LB 3FMGH 3RGVB 3T0AA 2EVHA 2HLEB 2D3NA 2YUXA 3MFFB 4PGDA 1NFDB 4X5PA 4PJ5D 1ZJAA 3L7FB 3RVXC 4GMSL 1N64H 3T09A 4HOWA 5F3BA 3NCYS 1AGBA 1WQVT 3UOAB 4P23C 4GRWB 3KJ6H 2BOBB 4IJ3C 5IBTH 2KH2B 4KKAD 1IRAY 1RZJL 5DA4A 4OI7A 2QHRH 5B1CA 3U82B 5FCSH 1ADWA 3DURA 4CKQA 1BZ9A 5IQ9B 3SKJL 1CUOA 4NS0A 5A16A 1MXGA 3OWEA 2KPWA 3JT0A 3QI9C 2NZ9C 3DV6A 4U1NB 1JMXA 1KEGH 1GA2A 5AOKA 4AYID 2ICEB 1KXVA 2WB7A 1DBKH 4UV7H 4JL2A 3BLBA 3PY9A 2WQ8A 1RZJC 5F93C 1ITBB 3OXRB 3ZDYE 5TD4A 4GO9A 1A3RL 2XN9B 4F7PA 2ICWI 1YEEL 1TJGH 3BGMA 4GIAA 4ODTH 2APVA 3IAGC 3EOBB 1EEUA 4LL4A 5GZND 3A67L 2BSSA 1Z9SB 2X10A 3WN5C 4Z7QB 1NZRA 1E2ZA 5DVOA 1HKFA 4GS7C 2APFA 4OV5B 1FZJB 4P2QA 3GK8L 4MSWB 1KJ2A 4BH8A 1Z0MA 3CCHB 4JQVC 5K33A 3VNYA 1MI5B 2NLJB 3GSRB 3SKMA 4NN6B 4PCTA 5D2LE 2Z4QB 5EBMA 4PJAF 1ZANH 1A3QA 4UTBL 1C1EL 1RMFH 4MJ5B 3K1KC 1HWGB 3GJFK 2OR8A 4U1GC 4FA8A 2A4ZA 1SXZA 1UWXH 4J3VA 1BJ8A 1F11B 4BK8A 5IJVA 3H1ZA 2R1YA 3CQQA 5FB8B 1LE9A 1FH2A 2WIMA 3EHBB 1CE1L 3MLUH 4GSDH 2DQJH 1HZKA 2O30A 4HMDA 4APQA 1F58H 2G0LA 1FZMB 1UXMA 1NFDE 1QUNA 2ZP9A 2BNRB 3FULA 4RGOL 5E8EB 3GGWA 5I6NA 2GJRA 4OZ4A 4XPFL 2VH5H 2R69L 3TYFA 3ULVH 4NAQA 2PF6A 3QJRB 4B53A 3QXAA 1EXGA 5F9JA 1EHLL 1MJJA 3DMMB 4R9HA 5BUAA 4JPKH 4M62L 3GI9L 4KVCH 3GIVA 4HGKC 3ZOAA 3CDGB 3A6BH 5C0CB 3WN5A 4P23D 4IRZH 1IGML 3LKNB 4YUEL 2R1XA 3QWNA 5BO1L 4S2SB 4ONFH 3WTXA 4P59H 4FHBD 2FD6L 2BP0B 3VGAC 2XZCL 3AACA 3R1GL 4BFIB 1XEDA 4GSDL 1UXWB 3MLTA 4L0ZA 2V2WB 5FDWA 3N40P 4WWOA 2EEAA 2FJFB 4O5LL 1GZHC 3OJ2C 4G8FB 4UQ9A 1YNTF 2X4RB 3ECBA 4G8IB 4EDXA 5CMAA 3E9UA 2XQYK 3CVBA 3HVNA 1RZFL 4FI6A 4PJAE 5FYJE 3QXDA 4ZMVA 3GPSA 5BOJA 1BWMA 1IC4L 3QIBB 4I3RH 1A6ZA 1T0NB 1DSFL 1G6RL 2FYYB 1T04B 5L2JA 5GZNC 1E8WA 1KB5B 5DC4B 2MRYA 5J9PA 3SIKA 2H2SC 3DX4A 4P99A 3U0PA 1MCQA 4X4YB 5EF2A 5EA0H 5F7BA 1IGJB 1AQDB 2CUMA 2W9DH 1DR9A 4HIJA 1GGIL 3NJNA 3EYSH 5B1KA 1OY3B 1FFOB 4JPQA 5IIEB 4NHCH 4XMPH 3VWJC 1KBGH 1PQZB 1B0IA 2FZ3B 4ZUUA 3HNTH 3US1A 2FWSA 1DQQA 2HPTA 3RL1B 3GRWA 1LVEA 4P9MH 4S1RH 4KI5F 2A6KB 3WNPA 2EUVA 4PIRF 4S1DC 5DJAB 4PWIA 3D2TA 1S7UA 2IPKB 1WAAA 4NPYB 4J8RB 1DJHA 3PHQB 2O5ZL 4MXWH 3PGDB 1E9QB 3RVWC 2GC4C 5FA3A 2VXQL 3F7VA 3H42H 1C12A 5CSZA 3V4PA 2YJLA 3GFUA 3WXWH 1NMAH 1L5GB 3V6OC 3VI4E 2MTPA 3C9NB 4L9LA 3WTTA 4FCAA 1OK8A 3K8LA 1KYDA 4UM8A 2ZG2A 4LT7A 4Y9CA 6PAZA 2PP8A 3SDDA 5K1VA 5C0FB 4ZT1A 4FRWA 1N67A 5AW7B 4E41E 4XWGH 4IOFD 3TU6A 4TSAH 4EIBA 4GP4B 1Q9WB 4UT9L 5D1ZD 3MJGX 3LJ3A 5C08E 2VE6A 3JWNH 2GTWB 4OSUH 4RMUA 3BW9A 4W9ZA 5KYUB 3GHBH 2GK0A 4GUQA 5JIHA 3V8CA 1AP2B 4JZJC 1XF2B 4EI5A 1AY1L 2CDEB 3U0WH 1OM3L 1DQML 3FO1A 1KMGA 3CX5J 4EIUA 3JBG7 2NZ1A 5IMMB 2X7LA 1ROWA 3ATEA 4P5MA 5DJ8B 4MJID 4RWYH 2FO8A 2NTFB 3P77A 1WA2X 5I1GH 3ENEA 4ZYKA 2IQ9L 4WCYL 4AYMC 3VUAA 2J88L 1A8ZA 3QHFL 2CKBA 3HJEA 4R0LA 1EUTA 4TQHA 1KLFB 4XN2A 5LBVA 3A22A 1LO2L 3B5HA 4PVNA 5FYKU 5EOTA 3DRQB 4OD2A 4PV8B 5E9NA 2CJTA 3KPSA 2FQGA 3QQ3A 1EA9C 4F37F 3WSQL 2R56L 1HSBB 3SE8L 4Z7IA 1KPVA 3KWWA 4P5RA 2FGZA 3TTSA 5JZ7D 4J6RL 5HYJB 3QH3A 4Y1SA 2FIKB 4JHWL 4WW1B 3EF7A 1EHKB 1DN0B 3UEZA 3CVIH 2I9LA 2W88A 1DE4A 3QRGH 5CBEB 1E8XA 3NK3A 1XGUA 4JG5A 4PUBH 4MQXC 3PWNB 2X4TA 3EYOA 1A2YB 3IRZA 4IIQB 1JWSB 1MJ8L 3IKKA 2PLTA 3KPQB 3HBPA 5ISZA 3RVWD 1IILE 3JWOC 4R8WH 3TBSA 4OLUH 1HXMB 2VJ0A 4ODWB 4TUJA 3LDBC 4P2QD 5FO9B 1G9EA 1AGFB 1CICC 2W0KA 3ILQD 1MHCB 3ISRA 4MB3A 4WI2A 5JW3L 4Z7UA 5IJCC 4JRYD 3MNMA 4JG0L 4TYUA 5A43C 3E2HC 3QDJE 3I9GL 5L88H 4IRJA 1QYGH 3TCLA 1I4FB 2VTFA 3ESMA 1JFHA 2LAAA 4K9EH 3WL9A 3U36A 3IMTA 1OSPL 3LSOA 3B43A 3P11L 2O6CA 3AY4A 4Y2NA 2OYLA 5IW3A 2MOQA 4EEEA 3AREB 3PP3H 1LEKB 2G60H 5AYUH 4J2XA 2G2NA 2HRHA 2O72A 5DZOA 2X3CA 2VQ1A 5C07A 2GHZA 2OTUA 4MD5A 3KR3L 4V1DA 4QOKB 4WJ5A 3WFEH 3F58H 1IM3D 4A2EA 4OF8A 3U6RB 3AM8C 3VFVB 1IQWL 4TSCL 5DJ6A 4BH8B 2BINA 2R0LH 4WHCA 4AMWA 3QE5A 3UZQA 5DS1A 4TTGA 3ZE2F 2Y9RT 3V6FB 4OJFL 2ZXDA 4KVNH 5EBMB 4U3XA 3CZFB 1CXKA 1R5WA 2BNQE 1OSYA 3NP4A 2XX0A 2AV7B 4BE6A 4F7PB 5IR1B 3BFWA 2FO1A 1NGZB 3DXAA 3GZOA 4PJGB 5CM1A 2AJUH 1HYRC 5DHMC 4R4ND 1IAOA 3G5YB 3T77B 4MD4B 1SQ2N 3KS0J 2WOBA 1LMIA 2R8SL 2XVGA 4KXZH 3ULVC 4DJMA 3RVTD 4FZEL 3BH4A 5HTSA 5FR3A 2E4TA 4DWHA 1WZMA 5EO1B 3MTRA 5DEJA 3ATBA 1TKWB 5HHOD 1G9HA 5I9QC 1OT4A 3AG4B 5C6WH 1VIWA 1SEQL 2ZCKL 4JFPA 4UV4H 2RALA 2PCXA 2V9TA 3HE6B 1RUML 4LQFH 2V9RA 3RI5K 3VDAA 2ZUWA 4JQVA 1WBYB 3FN3A 3ZTJG 2FT8A 5JHDA 1PYWB 4ZMTA 1CF8H 3MV9D 2XFXA 3KNBB 2JKIS 4L37A 3OX8B 3S4SB 4JCMA 1NCNA 1ZT1A 4YBHA 4BFRA 1YY9D 1R3IL 1K8IA 2VDNB 1ZT4B 3MCKB 4FYQA 1J8HA 2HWZL 2HYMA 3K4AA 4ONGH 1FYHB 3DHUA 2JK5A 2ZXWB 3IDJB 3TBVA 4WGWB 3QXDB 3HHSB 1W15A 5AOIA 1HHKB 4GAJL 4WO4D 3HJ0A 1NEUA 2X4QB 4JPWL 4NC1E 1MG3C 3TLRA 4GG6F 1CGTA 1T0NA 2V5SA 3LN5B 2W1NA 2EH7H 3PV7A 1KSRA 1WBZA 3MO1B 3QNFA 4GUCA 4F80A 5DFVC 1KPRA 1Y07A 5A2FA 4L4TE 5D96B 3FT1A 4HQQL 4BFIA 4HV8B 2X2HA 4DTGH 4LSTH 4NO0A 4GY4A 1CE6A 2V2WA 3VWKA 3SPVA 1ZSDB 4GAYA 1CT8A 3VFNA 4PHXA 1VKXB 1S9YB 1GHFL 4N0UB 4LLQA 4PJ7E 3RWJB 3EJPA 3FQXB 4HC1H 4JJ5A 5EEUA 1D7BA 2CM6A 1YEIH 2J55A 1EVTC 4K7PY 4K9EL 4PJ8B 4HPOL 5EUOE 5TE6L 2YUVA 1OCOB 5J56B 1EV2E 3K46A 2HTKD 5AW6B 5INCA 2XV0A 4KHTH 4MMXA 2J8UE 1S9WB 3GSNB 5F1NA 3V4LA 4F2ME 5I1DB 2J88H 4JGJA 4P2RE 4F15B 1WBXA 4WK2B 2R69H 3OVUB 3MV7E 3OKNA 4YLBA 1R3LA 2AEPH 3RBGA 2K4AA 3MLYL 3R19A 4ZAKB 1YEGL 1CG9A 2BSCA 2X70A 1H15A 3QIUD 5B39B 1MW3A 2F9BT 2YXWA 1K2DB 1G6RB 2P8MA 2XWZA 4I0CC 4PWFA 5F9WB 3CZJA 1A6UH 3LDBB 4L8SA 1RKRA 1ZANL 3U48A 2EINB 2GC7C 3DTXB 3JV6B 1TQTA 4ONFL 3WNLA 2WXIA 4IMLA 4P8QA 4PY8J 4ORGB 4KKNA 5JMRA 5DQDL 4FTVD 4P5TD 3A6BL 4KHTL 2V4LA 2EXYC 2GK0B 1J11A 1ZHLB 2FK9A 4BZ2H 1AQKL 1JGLH 2AQ1A 1UEMA 3C2AH 2NY1B 2VIRA 3C6LD 4EBQL 4HH8A 2DIJA 2OMNA 1JPGB 3O2WH 3TWYA 3ULAB 1EZLA 4QT5B 3ARSA 3NPSB 5AKSA 2BVOA 4M48L 5J1SC 1MCBA 2X4UB 3MRPA 4ELME 1NMCC 1KJVA 3OTTA 3HS0A 3V4UL 1MI5A 2NLJA 3JTTB 3HHRB 4JRXB 1G9NH 5TE4H 2HFGH 2C3GA 1F4WH 1IQDB 3NA9L 1XH1A 1FP5A 5EU5A 4ECNA 5ABZA 4FG4A 1SXAA 3BGAA 3KPSB 1NUDA 1L9SA 1Y18B 2CD0A 5EUOB 2ZUSA 3O9WB 2XHNA 1D5IH 2OXGA 1FNGB 2IBBA 3QUYB 2VLME 5HHMD 2WYZA 4Y89A 3ZTEA 1KBGL 3IMUA 4EN3A 1LWJA 2H8PA 4OGAD 3WE6A 3QH3B 1WS7A 3CXHJ 4EKJA 5B3SB 4Z7WA 1MRFH 3FO1B 3FUFA 4JL1A 7TAAA 1J0JA 1CLVA 4N85A 4U1IA 2LW3A 5A40E 4PREB 3BAEH 3Q5OA 3K71A 4U6TA 1DVFB 4BFJA 4DUWA 2YD3A 1RPUA 4MTMA 3HLAB 5D1XD 2EDBA 3K4DA 1EAPA 2DQ6A 2PW1B 1KIUB 5J3HC 4UOZA 4OFVA 4KJYB 3U4AA 1QATA 1RULL 4GBXB 1JE6A 3QQ3B 1FNHA 2BY1A 1A7RH 3AAZA 4PGCA 4Z7UB 5HGDA 2Y36H 3NIGF 5LGHL 1JV2A 3AWFA 1IGTB 3B7RL 4BKLA 4KK9C 4R7NA 4MXWL 5F7YC 4F7EA 1L3NA 4MHHI 1CDYA 1CFTB 3HN3A 1PEWA 4G8FA 1A4AA 3PNRB 1CYWA 3QJQB 2DDQL 4LCWB 3S36H 2DEYX 4Q8BA 5GS2H 1OE1A 3UBGA 5FCUH 1M53A 3I50H 4F2MA 3WELA 1WZKA 4OD1H 5CLTA 1MI5D 2VL4A 4W4OA 1T04A 2VW7A 1I7ZA 3DRTA 4S2SA 2NYYC 5F7DB 4MD0A 3SDYH 3D9AL 5DK2A 1QNIA 1CTNA 1HZHL 3GM0A 3ESPA 3H2WA 5I30H 2Q8BH 3O2DL 1KIPB 1ZGLB 1QPXA 5I74C 1XCWA 4JFZL 5I76A 4KK8C 5IEKA 4GAAA 2EJ1A 4F9PA 2MQ0A 2FJFA 5LNDA 3KDMA 1LP9F 1QTPA 1A14L 4ZW6A 4H8VA 3EDEA 3WHE0 4IBTA 5JQHC 2KS0A 3GKWL 5D4QA 1EJOH 4PJGE 1WWCA 1D7FA 3RA7L 3VB9A 4WHDA 4G8GB 5E00B 3WFDL 3UROR 2EE0A 2WBJC 4L1DA 2ZX7A 4NWTH 3PJSA 4AGOA 4YXKL 3TX4A 1Z5LB 3C12A 4OGXL 5SWSA 3KPSE 3UAFA 4XBEL 3VFVA 2GK2A 1QRNE 1QR1A 1BAFH 2IV9A 3RUGA 3WGVB 2R29H 2JKRM 3TPUB 3IDGB 1SVZA 1UVQB 2KBGA 3HR6A 2UY6B 2UX6A 3V4VA 1U58A 4YFDB 3VD5A 2LU7A 4NO5A 3VG0H 4NJ9L 4BFGA 4U3CA 3H0TA 3L45A 1VEOA 2YBRA 3OMAB 2ZUQB 3GMQB 5HGHB 1T83C 3DOIA 2BZDA 3C6SA 3OSKA 5G5DB 2WINB 3DXAB 4HHAA 4DQOL 5I6OA 5I6PA 1ZLSH 2FX8H 4LASH 4RGNC 5HD8C 1M7IB 2EXWC 1DCLA 3UBXI 2VDKH 3Q8CA 2FWLB 4JHWH 4AUJA 2JB6A 2D3JA 2XN2A 4XC3L 2BSBA 5IFAH 2UV3A 4YSUA 3L13A 2VDPL 4HGMA 1VFOA 4MJHA 4ZXBA 3OXSA 1IM3A 4JY5H 5DJXB 5AOMA 3AJ7A 4K3DH 3TJEH 4LF3A 3FTSA 2OKMA 5AYUL 1CYGA 3FN0L 2CA3A 2VRKA 3X1BA 5F7EL 4AVHA 4YK4B 3HC2A 5AVUB 2WGXA 5FOBB 2XNAB 1A7BA 5D7LD 5DWUH 4GBXC 4Y16C 5IK3B 4MJIA 1PYWA 1I8IA 4XP4L 3MRBB 5CIPH 2EIEA 5HI5D 2JLLA 5J7CC 4PJCA 4YSEA 1OQXA 1SLWA 1F42A 4TOYH 2X6VA 1ZE3H 5GSVA 3BUQA 1DLHB 2VDPH 3IDJA 1NGYB 4PJFB 3G6JB 3MRQA 4G8EB 5DJ8A 2C8NA 2Y7LA 5EU6B 4ZYKB 2BOCB 2WBJD 1RIVL 4R8WL 5CFAA 3RNQB 4C4KO 3VD2A 2ADJA 2D7MA 3CHSA 2CR0A 2A9ML 3MODL 4AIXA 4DVBA 1KN2H 4L8SC 4ODWA 5DA0B 2EXTA 2NY4B 5ECJE 3V7AE 4G1EA 1NFKA 4KXDA 4HWBL 1D5BB 3R06B 1JHTA 2F61A 2BK8A 2VDPB 3CDCA 4XP6L 3V5HB 4CNIB 2C26A 1NGXB 2A73B 1EHNA 3T6VA 1OM9A 2ZOKA 1EO8H 2G75A 1OAUL 3SO3C 4FP8L 2B2XL 4QHLB 4DZBA 3G5ZB 3FQXA 1UCBH 4JZOB 2VZVA 1ZA6A 2Y6SC 3U1PA 4PJ8A 3BZDA 3M17A 5FS5A 3ZDZF 3KPSD 5C7XL 4XNYH 1TETL 2EYRA 2YD7A 2XVLA 4P2OC 4QHNA 5IQMA 1ZPUA 4LESA 1NBQA 4HGWA 4JFFD 1DQDH 2BZ7A 3UBXB 1QFUL 4V1DB 5DK3A 4UIMA 4ODUB 1PU0A 4LVHB 2DS4A 5IT2H 1V54B 2DI8A 2BVOB 3VYOA 1TT6A 4HOXA 1XGZA 4CADB 2XTJB 1MCKA 5F1SA 2VZ1A 1OSZB 4X8JA 3ARRA 1VERA 2CHDA 4XP1H 3ZUCA 4ZNEE 2IF7A 4Z18A 1JS4A 4UT6H 3IXTB 5AOZA 4GMSH 1FORH 1M7UA 1TXKA 4OLXL 4PRAB 3CPLB 2XTJD 2OXGB 1WAAE 3DSFH 4M1GH 1LEKA 4FXGA 2XWCA 1VAHA 1NC4B 1IE4A 4RH4A 1O75A 5IT2L 4IOSA 4Z7WB 5EPMB 5L4IA 5KVEL 3L5XL 1EX0A 3SYOA 2WVUA 1ZLUH 3CXFA 1YMMB 1SPDA 3LNFA 1ES0A 1FC2D 4B95C 3CFCH 1OB0A 1QACA 2G30A 3FFDA 4LP4A 3ARQA 3AXHA 4JFEE 3SE9H 2K8QA 4GXFA 3MRJA 2WQWA 4P59L 4X99A 3F05A 4W68A 2OSYA 1MZZA 4DK3A 3RZCA 1T83A 2DYPA 1QFWM 2VXTL 3WV0A 3BP6B 3IBOA 2F19L 3B3IA 4LIQH 1P53A 1I9JL 2HJFA 2NX5D 3FRPG 3G5YA 3KD4A 3MLWL 4BIKA 2JE8A 2OP4H 3OKMB 3F65A 3NACL 4DKEH 3Q6GH 2DH2A 4MZIA 2D2CC 4UAHA 3X3GL 1S5HB 1INDL 3RVTC 2VUKA 2OR9H 3RWGA 3DNKA 3ZUNC 2ESVD 5B1AB 2GJJA 2UWEB 3O6MH 4O4YH 4QRSB 3T3ME 5J06A 4LKCA 4QWWC 1ILUA 3C5ZD 4LDCA 1Z9LA 1AGEA 1J0HA 3ZGHA 3C75A 4C56E 2IFFL 3LRLA 1EEZB 3Q5TA 4GT0A 3T6QC 1VLXA 2PW1A 3I6LD 4H1LA 2QPFA 4PGZA 3NZ8B 2Y25A 1W91A 3P73A 4FI7A 1NAMA 2IDTA 2GSGB 3VFSB 5KBPA 1TF4A 1A7PL 1JFQH 1F18A 1JI1A 2ZJSL 4L3AA 5TQ0H 4U6VH 4GIPD 4GXUN 1NEZA 1BECA 4IHOA 3S8WA 5J6SA 3ULSA 3TNMA 5DVPA 4OZFB 1K4CA 1O7DE 5HXMA 1TVBA 2VLJE 4PJ9D 4YC2C 5I1LA 5INCB 4BD4A 5IMLB 4LNVA 1FBIH 4U31A 2D7OA 1N59A 2X89D 4IS6A 3TN0A 2VXSH 3C2AL 1SM3H 1WBZB 3D0VA 3MO1A 4HAGA 4UIKH 5HDRA 3K6IA 4QLRA 3SYCA 3T0WA 5HGBA 3F7QA 3NAAH 4YL4A 5AW9B 1BMZA 1A1OA 2YD2A 1T66C 4LP8A 4E5XG 1E2WA 2AJXH 3LEXB 3NH7L 3U1QA 3ARGC 4LSDA 1QR1B 3QYCA 3QJUB 1K3ZA 2Y7NA 3U9PH 4NYLA 5EN2B 1KACB 1BJ1J 1IC0A 3IFLH 2ZUUA 3W1ZA 4XBPB 6PCYA 4JNXA 1X9LA 4APQD 5JW4Q 1HU8A 2Y1ZA 3V6BR 4JJOA 3OR7B 4WNSA 5HGHA 3GMRB 1YC8A 4X7EC 2HTKC 1JXDA 5CEZH 1IFRA 3BAKA 5MEQB 4OCXH 5I1DA 2ITDA 5DD0L 1E4WH 3CFEA 5M95B 1Z5LA 4D3CH 2PYFA 1OTUC 5AWNL 1BZ7A 3CSYA 4TUUA 2RQEA 4HWZB 1ED3B 4K5PA 2BC4B 1QI5A 3QUMA 2FEDC 3OXSB 3ZLQC 2NR6D 2Y07L 2F54E 2V2TB 3LZLA 3PLYA 2FQFA 1EMTL 2RA1A 1JK9B 1OAUH 5F1KC 4EDWL 3TZVB 4Y4FB 1U8CA 5LGJB 5BW7C 4H88L 3VVWA 1L6PA 4WI3A 1A6TA 4OIBA 4HX1A 4DTGL 2WGNB 2WINA 4HJEA 2ZSVB 1G4MA 1AXSA 1QTSA 3E80A 1CIDA 1XVSA 4JREC 2O5ZH 4TV3A 1KCVL 5C6TH 3P3TA 1IJ9A 2VKXA 1CD8A 1RZKC 3OAUL 4ONHB 1FZKA 4OB5L 4A7GA 3SOTA 5KYWA 3RDTB 4WWNA 3CFMA 5KSAD 1ZGLP 2V5MA 4F7TB 3ZHFA 2V8LA 3MGTA 1P84J 3TNNA 4E41A 3WNMA 2PCPA 3O2DH 2A6DA 1KT2A 3D0LB 1A25A 1I8UA 3FUHA 5E1QA 2BOCA 4FJ6A 1WC7A 5DRXA 5GGUB 3BEWB 4FHKA 3TBWA 3UAJA 4PR5B 3CSGA 3UPRB 4QXGH 1PG7H 1LK2A 1LD9A 1PKQB 2JTDA 3L1FA 2QSTA 1VCAA 4LLDA 2NQ3A 2YA0A 3PUCA 4MJIB 4UB0L 4WUKH 1FUNA 1UFUA 5JHDE 1WWWX 1HCYA 5FYLL 1YECL 5E5LA 3QUYA 5HYEA 2WJ5A 3PXJA 4HKZB 1NDMA 1M2OA 1BBDL 1UQSA 5K9OA 1Z3RA 4OCWH 3IDIB 5AKVA 3T8MA 2XFGB 4GRLD 2FGWL 4Z5RB 2C1OA 3MRQB 4G8EA 1GYWA 1MVYA 3CBKB 2CWRA 4LLWB 4GKZB 1Q0XL 3U4EB 3SE3A 1AGBB 2DQUL 1UTDA 3GMOB 5I28A 2WLMA 3V5DB 1CXIA 2J56A 4I0PA 2MKWA 1NCTA 2CLVA 4FFYA 3VWJA 1DJGA 1J9QA 3L3JA 3BSHA 4JDEA 3CV5A 1CN4A 5E56A 4IHBA 1PLGL 3JWDL 2OCFD 1FZOB 4FNLH 2A73A 3OSVA 1YZZA 1KF9B 5I18H 5GJSL 3RX8A 2VL5A 3G5ZA 3L5HA 5HHNA 1OLLA 1U95A 1A4JA 5CZKA 2E27H 5JA9A 4OIIH 2Y7OA 5I0XA 5LLIC 4ZX4A 2DQCL 2XVBA 2L8AA 1NWPA 4BQCA 4BQ9A 3QEHA 4OFDA 5D72L 5F0MB 1J8KA 3IRCA 1J05B 4OLVH 2R0WH 2FECI 3EOBA 3KVQA 4QTFA 3PJSB 2NYYD 4PS3A 1GZHA 2DWDA 4HBQA 5C2BH 3WFBH 1R5VB 4YZFF 4JFDB 3TL5A 3UPAA 2NXZD 4JFEB 5CINH 2BY0A 8PAZA 5ITBH 2ICEA 4LSQH 5F7EH 2IDSA 1KTBA 3VGGA 4JRYE 1BXAA 1WIPA 3WIIL 4ODHH 4DW2H 2GITA 2OL3H 2ZOUA 3HC0A 4GQ9H 5MEND 4GEIA 4WV1C 3U7AA 3B3IB 3FJTA 1SJXA 3BI9X 4Z78A 1AKJB 5C0CE 4FL4B 2VDKL 2YPLA 4P05A 2BSSB 1G7QB 4NDMA 1JXJA 1TQCC 1NA8A 4WNQB 1F1AA 3QUZD 4G8GE 3BD3A 7CGTA 2BNQA 3WY3A 1J7VR 5IUSA 1NICA 1YG9A 3CCHA 4UQDA 3WN5B 3NJHA 4OLWL 2XV6B 1O6SB 5I8OH 4LGPB 1BZ8A 2R1XB 5TJWK 2OMVA 4X6CB 3UDWC 5CUSL 5T1MB 4F58L 1YCSA 1LWRA 3EJTA 2ZCHL 4LBEB 1DTUA 4FXKA 2XBTA 4OM1H 4BXVA 3D50A 5DHDA 4AVJA 4CC4A 1B4RA 4HXBH 1WIOA 1JZGA 4P46C 3SCMA 3RWIA 1E4XH 1NCHA 4H2CA 1EZUA 4N20A 3D48R 1GHFH 1TJHL 2YD8A 4G9FB 5ELIA 1NOLA 1CR9H 1UB5B 1RUMH 3KGUA 2AHIA 3UJTH 3ULSB 3II3A 3IDNB 3RGVD 1SDDA 2YOCA 3EHBD 4PY7A 4PM1A 1A02N 1FL6B 2HZHA 1DQTA 2TSAA 1CGSL 1NC2A 1E5YA 3CVHB 3RNQA 1LHZA 3TJPA 2YPVH 2BWIA 2BY2A 2EE9A 5D7JD 4ZTPH 3KW7A 4LLMB 1MQKH 4JKPH 4N3UA 3SGEH 5EIVA 5HDQL 1JGIA 1ESOA 4EUPA 4GG6A 1SVBA 1OTTD 1AO7A 4E41D 1JBJA 2F5BH 4NRZB 4HUKB 3BDYH 1XH3B 1KGYE 2GIXA 3UACA 5HY9B 3UBFA 5I1JH 4DVRH 3O3UN 1YJDC 5EU6E 4KY2A 5CAYB 1R34A 2VLKB 1R3IH 1UCBL 2VN7A 4QHLA 3FSOA 4K94C 3L6FA 3GXFA 3B9KC 3GMRA 4BJLA 3DVIA 3SJVB 4CBZA 3ZDWA 1FG9C 2EYRB 1QNZH 5IFHH 3EH1A 3QNZB 4FMFA 2JJWA 2IOIA 4H20L 4ANKA 3GEWB 4MVBC 2X53A 3L4UA 4DFHA 5IVXF 1J1XH 1JGVH 5LWYL 2CRMA 3X1GA 2H32H 3V0FA 4LCIL 4JFSA 4YXHH 2NCMA 4HWZA 4LL1A 3V5HA 3G5VA 4LHUB 4KZDL 1KB9K 1UA6L 2Z6FA 3THMH 2BP8B 2IMNA 4JQIA 4S1SH 2ICEC 3QORC 5HI3D 2G75B 2O26U 2FZ3A 3QWQB 3AG3B 3RI5F 5KSBB 4O02A 3EOAB 2W92A 4G8GD 5FIEA 4PJEB 3OR7A 1J1PL 3P0GB 4KK6D 3R1GH 3WD5L 1S7UB 2IPKA 5GJTH 2IBZY 1GGCL 4QF1A 4XP4H 1PD0A 1XGPA 1Z9OA 4Z7NF 2Z7ZA 3QIWD 2FATL 4WK0B 3PHAA 2K45A 4XRCA 3D33A 1AHMA 4UIMB 1EFQA 2HMIC 5CP3A 1D3CA 7FABL 3CSYB 5E2TL 1BFOA 5GS0D 5A16B 2EDYA 1RZFH 4FFZA 3JUYA 2EVGA 3BQUC 5C0AA 3RWDB 2BERA 2JJVA 4HSAC 2R2HB 4KKZA 2W94A 3RVUC 3QG6B 1KBPA 5LBGA 1JD7A 1NBVL 2DMCA 3MRJB 1HHGA 1T20B 3KR3H 4JVUA 4GMTL 4KTDH 4JO8A 3VD7A 1MELA 3GMLB 4DKAA 4KQ4H 2ITFA 5EZOL 1BCIA 1NFIB 3VXRE 1M6UA 3T65A 3I9GH 4K5NA 4RGMC 4ZUWA 5E8NB 5C97A 3SE3C 2CIIA 3DV4B 4NOBA 2GTZA 5BZDB 2APXA 3I2CH 3ZZSA 1SLXA 3B9KD 5KVEE 2NY6D 1W8NA 2ZWLT 2BOLA 4Z5RA 2QBWA 1HH9A 5SX5H 4K3DL 5TH2A 4FTVE 1FL5A 5ISZB 2WB1A 5GGVL 2B4CH 3CFTA 3TA3B 1A4KA 3BXNA 4PRPD 4F20A 5E6IC 2BSEA 3NSCA 4JM2A 5E4EB 2OJEA 4LLDB 1LE9B 4R97C 4PJEE 1XIWA 1MUJA 4U1NA 1WAAF 1DVZA 4HU2A 4N6RB 1URZA 3CLEH 1TFPA 3NQIA 3TN0D 2AAVA 4Y2DC 4YHLH 2DV6A 1OGAD 2NY2D 3B9AA 4DP7X 1OARH 4NGHL 5DZVA 3PABB 4KK6C 3L1OL 3CPUA 3NOIA 2BMKA 4WEEA 2H6OA 4NQEB 4ZG1A 1MREH 1Y1UA 1Q0YH 5LXVA 1SY6L 3O4LA 4A7GF 3M1BB 1SLUA 1EEZA 2GJZA 4KFZC 2PO6B 2FQDA 2VW4A 3FF7A 4NAJA 4S1QL 5KBKA 1I9IH 3I74A 4OGXH 1Q94A 1NMAL 1OM3H 4JDEB 3LH8A 2MNUA 2B08A 4KKLC 4AV0A 1BAFL 4ZOEA 3FO2A 5TDPB 5FCUL 4MXVF 3WIHA 4E9TA 3MPCA 2QKIC 3UTTB 3MBWA 4ZFFB 2NY1D 1ZHNA 3B83A 3C6LB 1KCSL 3NSXA 4L4TD 4NUJA 3BCFA 4OFQA 5JIIA 2VL5B 2QPDB 2ZXGA 2JJTC 2MQGA 3VCLB 1XL6A 1PG7L 3HC4L 3BH9A 4BRVA 2AI0H 4PRHD 1XF4B 1G9ML 3HUJE 2QVFB 1BLNB 3FO9A 2GY7B 4PJ9C 3TV3H 3F7KA 4FADA 5DYOA 3HZKB 2WAQA 1C9SA 1BD2E 3SKNB 1A14H 4QXGL 5AW4B 3ARYA 1HX0A 2WQVA 4XC1L 3P3SA 4X6BA 5DHEA 1JPTL 5HVHB 1QLRA 4J7RA 3WMPA 2Q8BL 2F7PA 2HSIA 4JB9H 4OAWB 4F3FA 1OEZW 4HUVA 3JTSB 1CURA 2ATPA 2D7NA 5HJBA 1WVZA 4ZFZB 1GCFA 2F58H 3V6FA 3T0EC 5GS1B 1JDDA 5GRVL 2XU9A 1MFAH 4JFPB 1XL4A 1NCBL 1BD2A 2ZG1A 1PJWA 2QFRA 3MLPA 3IXAA 4J1UB 4ZS6C 2OMYB 5ADPH 2RH0A 4L23A 4POZD 3TO2A 1T1YB 5C0NC 4Y9BA 4UINH 3U6XS 3ZE1B 3EBAA 5IB2A 3JWNE 1XR8A 4PJIE 1Y6MR 3LH2L 3RTQB 4G8IA 2QPEB 5EORL 3VQLA 1DO5A 1JP5A 3OMZA 4JB9L 1TZIB 2WZPA 2BNQB 4JO4H 1L9OA 2F7QA 2VCOA 4NX0A 2PCPB 5T1LD 3KGRA 4WWID 1ETA1 1Y1DA 5MEOB 2OK0H 3VRJA 5JXAH 1QP1A 4PRID 1RUQL 1U8JB 4G7YH 2X2JA 4Y4FA 4KBPA 2OMVB 1R3KA 3BH8A 2A9MH 4JZNB 3UFIA 3WJLC 4GRWH 5FA4B 3WO3B 3BD5A 4JY4A 5T1MA 3RJQB 1BQHG 4DGYH 4Y7OC 4R97B 3HFFA 4LLUA 4LLYA 3TC9A 3WUWB 2DOCA 3ISYA 3U9WA 2DQCH 4BRJA 5L9DL 1UD3A 2AP2A 1CGWA 2K7PA 2UVFA 3UBHA 4AENA 4AT6B 3DUHA 4Q2ZA 4GAYB 4JFFA 5JIMA 1YJDH 5EBLA 4A7SA 5AB0A 2J5WA 5TE4L 2XKUA 1UXSB 5BO0D 5EOQL 5KSAC 3QULA 3VM5A 4WY7L 1REIA 4W4NA 3WLBA 3TO2B 2BSRB 4APXA 1KIRA 2F54D 2YMTA 4RSYA 5I0VA 1DZ0A 4OLYH 2FJHA 1RPKA 4H8UA 5C70A 4M1CC 3EDKA 3K6OA 1A1MA 2HP4A 4H8HA 3BPOB 1TG8A 3VQ2C 5ALCL 3IU3A 5DJ0A 4WWKD 3TT3H 5BV7L 1K5WA 3BHBA 3NVQA 4H8PA 2QVKA 4XZUB 4C56D 4BGDA 3P9MA 1IIIA 2BNRD 1OCRB 4DP6X 4D0CA 4R83A 1Q1JH 4N0UA 1FFRA 5HHNB 4JJ5B 5F7FA 5B7MA 1AGDA 2Y3NA 3O2VH 2N7SA 4GRLC 4PCYA 2JXMB 2ITCA 3V0AC 2EC9T 3ETBJ 5CZVH 4X7SL 3B2UC 1MHPH 2BJMH 4ALAL 5TDOA 4PB9L 3VFGH 4M6NL 3HMXL 5DLML 5AALA 3M6DA 1ZXQA 3GBDA 3FB5B 1UKSA 4GXVH 4I0PB 5KYXB 4YDJA 2GSIA 2V9UA 4MNGA 3WIHL 2HVJA 1NFDF 4TSBL 4B97A 1FZOA 1OO2A 1TEGA 3PDOB 3ZDZB 2BVQB 2Z8RA 5KANI 1Z5HA 4XH2B 5AD0B 2JIXA 2VLJD 3UZEC 1YY9C 4G9DB 1KLFA 4TVPL 1T20A 3FB6B 3LEYH 3FK3A 4PJEA 3EKCA 3RB5A 3WBDA 1PX4A 3NPZB 5IOKA 2ED9A 3RTQD 4PLKC 1MFVA 2J1XA 2MKLC 2R2CA 2VLJB 4UQBA 1ZHLA 1KEGL 3OV6A 3VXUB 1J10A 4JRXE 4HCGA 1SOKA 4L4TA 5D4JA 3S8FB 2H8PB 1I53A 3MZTA 4PY8I 1GGBL 3VXOB 3QUXD 4QTHB 1PLCA 3CDYA 1NIBA 4WFGD 2VR8A 2LVCA 2OSWA 4XNUL 2HT2D 1ZLVH 1AQ8A 3VXMB 1QQDA 2C7UA 2HTLD 3EF4A 1QNZL 4JM2D 5IFHL 1DVFA 1MW1A 5DD1H 4I2XE 5F6IB 5L2KA 3EGDB 1LO0L 3ZZQA 2APBA 1F3JB 5CJ8A 4DP2X 4JRXA 1VGKB 2ZKHH 5IF0B 2DLHA 1JRHH 4LCWD 2DWEA 2CU9A 4YHOH 1P4UA 3MFGB 1C16B 1UJ3A 2K8MA 3IWUA 4ABQA 1FYTB 1FORL 4OLXH 1CF8L 4HPYL 4KO6A 4JFFE 4TTDD 3GUTB 4IRJB 5GRYA 2YPLB 3VFWA 5D8JH 3B2VL 4CC1A 2LFEA 3WL9B 4MLIA 3UG5A 3QHZH 4PN6A 4WNQA 3KBPA 3LQAH 4X6CE 1TTBA 2ZXBA 2PKDA 4WI4A 5D7SL 2ZKMX 5EO1A 3DX7B 4U1MB 3OG4B 1BW8A 3WDJA 4RBPK 5EZLA 3DO3A 4RGOH 4EXKA 3UYRH 1CD0A 5LBSL 5KWYC 3KAAA 1OPGL 1J88A 1H6EA 4HMCA 3L4TA 3ZQXA 3OC8A 1NSNH 1AFVL 1AJ7L 4CL7A 3X2QB 1XIWB 4K71B 2GJ6E 2KKQA 2YPKB 4P9HL 1COBA 5B3JF 4XPBL 4TQEH 3ZT7A 2OXHB 5CGTA 4N0UE 4PJ7B 3SCMB 1CLCA 3SDXE 4WF7A 1BREA 1UD4A 3QIWA 5I2IB 5JOPD 5FECA 4S0TD 5C0CD 5E94A 3MLXL 1THAA 1XF4A 1NTDA 3DUUA 3VFOA 3WFHB 1B0RB 3V0EA 3IKCA 1WG3A 1U36A 3HR5B 3CHRA 2V3EA 3FB7B 5LGKA 1DUYA 1LO5A 3NGBC 4DUVA 3OJDA 2DB8A 3QEGH 1G0XA 4XPFH 4GAGH 5F7DA 3UADA 2OAAA 3U2SA 4JGUA 4OLZH 5T8IA 3TS8A 4JQIL 4TOYL 3RILA 3LRGA 3ZPDA 1O6VA 4X80H 4X6BB 3RZCC 1JZEA 1YEGH 2D31A 3B8SA 3H55A 1NKRA 4J27A 3FO2B 5TDPA 4PRPB 3Q1SL 3P3UA 4MNQE 4RGNE 5D7IB 4IEFA 1AR1B 3KDMB 4NJAH 5ICUA 3WFEL 4ETYA 1HH6B 4Z0BL 2NPLX 3DX6A 1UM4L 5PAZA 3EOAA 1GJIA 2XZZA 3FOLA 4PJ7F 5EC2A 4HH9B 4AQ8C 5DJZA 4JRLA 4MGXA 1RZ8B 4ZW8A 5JXEC 3L3KB 5BS0A 3MX0B 2R4SL 3AABA 3FCGA 5D5MB 1D5MB 2DM3A 2IDFA 1BOGA 4ZUSA 4IDJH 1P7BA 4MKTA 4ZOCA 5F9DC 2WVVB 3P9WB 4HUMB 5GRZA 4ZNCD 1M71A 1X5GA 5J1TC 3ZHLA 3UIYA 1CG9B 5B39A 2OW7A 4R26L 2P43B 2XN9E 5L2KE 2IOOA 3DGCR 4NZUH 5ERWB 4ZAKD 3O0LA 2IBZX 3QG6A 3HKFA 3HIZA 5AG9A 4JM0A 4DW2L 4QHKI 4XR8C 1QSEA 4J1UA 1U2HA 5K39B 1FAIL 1GGYA 5I6XB 4YHKH 5FAAA 1I8IB 4HJUA 4LSRH 1ZSDA 3L4WA 3H7LA 4PJFE 4JAMA 1AR2A 2LTQB 3APFA 3ZYJA 3S35H 1AG0A 3P4OA 4IGBD 3HNVL 1PEZA 3DARA 4HUWB 3WNJA 4HT1L 4D7BA 3UGEA 3CN4A 5CF3A 5BV7B 2FX9H 4NO0D 1JG9A 5E0FA 1K8DA 1J5CA 2M2DA 1QSFB 2E3VA 1L7IH 2X6CA 2OL3A 4MMXB 1TQWA 3STBA 3VRJB 4LOUC 4F7MB 1WBXB 1X5LA 1FGNH 4JY4B 5EU6D 3HBQA 3FTXA 4LLUB 2H3KA 1W9XA 2Y06L 3SQOL 4KV5F 3NMEA 4FFYH 3VGDA 2EQDA 5E8OB 4OSUL 4BELD 5A2AA 4JFZH 5AKRA 4ENEC 2XA8L 4ZDHB 2ZOKB 3M7FB 5CEYB 2CCLA 2RFXB 1MRDH 1DBMH 1MFAL 3KPLB 3L8QA 2GCYB 4DZBB 4JCWA 5DF0A 1MLCA 4Y5VB 3UTPE 4F8QA 4YDKH 2KDYA 4N2BA 3FDWA 1M2VA 1P1VA 3ZTCC 2BVUA 1QO3A 4I8DA 4I77H 1DYZA 3FRUA 1NDGB 4MQ7A 2HCZX 3O4LB 4HGWB 2YRBA 4WUUD 1TJXA 3KLAA 5I19H 2VXUH 2IXQA 3IPBA 2FB4L 4LEEA 3ZJAA 2VLKD 5CEZE 2PO6A 2EDRA 3OZ9H 4Q56A 1KIUA 2QGEA 5EU7C 3LKSA 4OCWL 3Q8FA 2C3VB 3FFCD 4JO3H 4GBXA 4LEXH 2CJUH 2NSMA 5IBLC 1N8ZB 3AAZB 4PGCB 1CI5A 2P24B 1I8LA 4QYOB 1L9QA 2IG2H 4ZAKC 1HHHA 4NQEE 1KFAL 4FG0A 1YQ2A 4XH2A 3Q2VA 3WKML 3OLIA 2DQIL 2BHUA 4GQRA 5EFIB 2HLAB 2F53D 3N55A 1BDYA 1F45A 1CO1A 1QSVA 2Y2WA 4TN9A 3S2AA 1P4IH 3BQUA 4PJBE 1BQLH 1FCCA 3D34A 1IEAA 2WXPA 3OZKA 4MFHA 4XGZA 5EO0A 1ET5A 4XWOC 1NIAA 3EFOB 4ZXBC 3WFCH 3RU8L 5FYKH 5I1IH 4KXCA 3MMEA 4PJHA 2XTLA 3FHQA 3FO9B 1CLYL 5TDOB 5DUBB 2CUHA 5DZPA 1YRKA 3GO1L 1MVUB 3UMTA 4GNKB 3KPMA 4IBWA 3MKKA 1S7RB 5CCKL 1QW8A 4MBOA 3VI3A 3LX9A 3BP4A 1DSYA 3ECVA 1VFMA 1IBHA 2CHXA 2OZ4L 4DAGH 2ATPB 2WVTA 4JO1L 3MBWB 5FM5O 1J12A 5D96C 5E2VL 1QBLH 2GSMB 4OZGF 1EAPB 3MOBL 4OLUL 2WNGA 4IBZA 5F97E 3EGSA 4L4VE 3D4ZA 3LNEA 1GSKA 2VDOB 3LMJL 4JJHA 5SWZB 1Q9KB 1N5AB 3BESR 5TF1H 1JV2B 3CDFA 4ZODA 3BGMB 2ZX9A 3TONA 4ENED 5AAWA 3FPYA 4FFVC 3FT3B 2P8LB 4AQ1A 4G6KL 2JI2A 3TT1L 3O2WL 2WYIA 4L3EA 1FDLH 2QQLH 1XZ0B 3RWGB 4BUQA 1TU2B 4JRYA 5MENB 1I8MB 3CFKB 4M8QA 4N2OA 2WZAA 3CFDB 4ZW5A 3VWJD 3FTZA 4WUUB 4I0PD 2XV3A 3BFQG 3MNVB 1VDGA 1M05B 3MHZA 4Z0BH 3QGVA 4CGTA 3NZ8A 4HU8A 1MFNA 2IAMB 1NFAA 4ONOA 3G6DL 3H0TB 4N24A 5IBLD 4X6DF 1PL3A 2J72A 2QQNH 1BSIA 3C6SB 1RK7A 2F1BA 3FU6A 4NWUH 1OD9A 3OR6A 5AB1A 2ISDA 2WUBH 3MXWH 4FS0A 1CB4A 4AENB 4AT6A 1CK0L 1XR8B 4WEBL 4BZYA 4IHOB 4OT1L 2Q20A 4I85A 4X5RA 1ZLUK 3QZMA 1P1ZB 2VUYA 2Y0SA 1E9OB 1FIEA 1QRNB 4FQLL 5MENE 1IAIM 3VD4A 2MWCA 2OMZB 1BIIB 5D6CB 4FXLA 4ODXA 3DX7A 1RZ7H 1CVRA 4APXB 3KS0H 1AOZA 1NCWH 2OJZH 3O4OC 5T3ZD 3P02A 3D0VB