3VD0A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
202
Chain Sequence
b'HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
molecule tags Antitumor protein/dna
source organism Homo sapiens
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
total genus 37
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd0A00
2ATAA 4L18A 2WGXA 1YCSA 2J1XA 4IBYA 4A63A 3VD2A 2IOMA 4IBWA 4IJTA 4IBSA 4LOEA 5G4OA 2MEJB 4L0ZA 4KVPA 4AGMA 4LO9A 3D08A 2J1ZA 4L0YA 2PCXA 5AOIA 1H9DA 2X0UA 5LAPA 2J20A 4QO1B 3TS8A 1HU8A 3EXLA 3D05A 3Q01A 4MZIA 3D09A 1HJCA 5AOJA 5G4MA 1KZYA 4LOFA 3QYMA 3WTSA 1EAOA 3WTWA 2ADYA 1E50A 2IOOA 3WTVA 2XWCA 2BIPA 5BUAA 3US1A 1TSRA 5KBDA 2J21A 4XR8C 3D07A 3VD1A 2XWRA 1CMOA 2AC0A 4G83A 5ECGA 1T4WA 2H1LM 2X0VA 4IBTA 4HJEA 1LJMA 5ABAA 5AB9A 2J1YA 2J6WA 3Q06A 2BIOA 3QYNA 3KZ8A 3D06A 3IGKA 3KMDA 1EAQA 3WTYA 4MZRA 2YBGA 5AOLA 2FEJA 2P52A 2RMNA 4IBZA 2BINA 2J1WA 4AGPA 1UOLA 1IO4C 1GZHA 5AOKA 3D0AA 5LGYA 1EANA 4AGQA 4AGNA 3WTUA 3ZMEA 1HJBC 4IBUA 2BIQA 1GZHC 4AGLA 3Q05A 4G82A 5G4NA 2GEQA 4AGOA 4IBVA 2VUKA 4IBQA 2BIMA 3IGLA 2AHIA 3WTTA 3EXJA 1CO1A 2OCJA 4GUOA 1TUPA 2IOIA 3US0A 2X0WA 3WTXA 5AOMA 3VD0A 3WU1A 4GUQA 5A7BA
chains in the Genus database with same CATH superfamily
3KPMB 1DJYA 2WOBA 1TZHA 2IH9A 3QG6B 3KWUA 3QNFA 4NNYA 3L5HA 4O2CA 4X0KA 1IFHH 4N2KA 5CP7A 1NWPA 2HKFH 3WXVH 5LN8A 4QRPD 3C87A 1J9TA 2Z7UA 4H13C 5CBAA 4ZAKC 3EDFA 2IWEA 2WNWA 4BA0A 1DBMH 4W6XB 4MCZB 4QHKI 1JZEA 2ITDB 2UUDK 1NFDE 1RZGB 1GY1A 1FG2B 3BSGA 4MYPA 4YDVA 3PY9A 5F7BA 2R1WB 3CHXA 2VN3A 1EEZB 1FL3B 4PTTB 2AQSA 5BVJB 4N0UE 1A9VA 3SPGA 1T1YB 4D8PA 4GW1B 5F7UA 2GIYA 4D9QE 1GOFA 1IEAB 1W72B 4HPOH 3RBGA 5GRUH 1FI8C 3II2A 4FQ2L 5HD8C 5DHVB 5EZLA 4X6BA 2CBOA 5GGSY 4P2OC 4KQ4L 2OSLB 5FFLA 2DQUL 1TSRA 5KVMC 3EBGA 1MFBL 3U4EB 3F6JA 3VXSD 1G84A 3SGJA 2UV3A 5D7JD 5LO7A 4IS6B 1TZIB 4AYEC 1BMGA 1AO7B 3C6SB 3JWNC 4WSKA 3QARA 5KTEH 2DLEA 3T0EC 3TBYB 5FIEA 4D9LL 3SDYH 5I71B 1EAJA 2OSWA 4U05A 3SKNA 1W0WB 3KPQB 1X5KA 3SKOA 4RISL 5D7IE 3RVVC 3EGDB 3UP1A 1E7VA 4NAJA 1IC7H 1JPGA 1XD0A 4RWHA 4M43L 3CXDL 3CVHA 4CNIA 1RVFL 4JR9L 4F7TA 2XXFA 4TLKA 1ZPLA 2RMNA 3RDTB 4AKOA 1BZ7B 1ZLUH 3KJ6H 3MNMA 4DKFL 4OZFB 4CN1A 2OMTA 3C5JA 3MZTA 5DO2C 5BVPL 1RD6A 1U92B 2V7HA 2VDNB 1YAZA 3QB7C 3FULA 4CN6A 3FO2B 1INQA 1A0QL 1UD5A 3WYRA 2OM5A 2QQLH 3QNXB 1H8NA 4RMBA 3RWHB 3KYMA 4ANUA 1A4CA 2VLRD 3I50L 4HWEL 2A77H 3AW5A 3VFRB 4Z0BH 2ZKMX 5KSAD 2VXVL 4MMYB 2P24A 3GMRB 1JZ8A 4AGOA 1N8OE 2PKDA 3MKGA 3RZCB 2JXMA 2RB8A 1WFJA 4JM0A 4OIIH 4X0KB 3CSYA 3ARVA 2XVKA 2YJLA 3UYPA 2CPUA 2N7AA 1P7QA 3CXHJ 2FEEL 3SE4A 2WP3T 1NEUA 1ZJBA 2GCYB 2O1AA 2IBZX 5B3NA 3D69A 3SE3C 2R8SH 1H5BB 1UGKA 2EO9A 2GHWB 4IIQB 4J8RA 3FQ1A 3FRUA 4YXKH 1IBZA 5E08H 1J8HD 3EDKA 4XH2B 3D0VB 3NK4A 5MEPB 2EXSA 4LCIL 1F41A 3HNSH 4Y2DA 2ZCKH 4JM2D 4Y5YC 1P1ZA 3JV4B 4OTXL 4K55A 5K9JH 1FF5A 4PGCB 5F9WB 1BAFH 4A67A 4UOJA 1DR9A 4IJTA 4UM8B 5TK4A 3B56A 1OSPL 1U4EA 2VABB 4YDLC 3LAFA 1IBHA 3RWFB 3GMMA 2EDJA 4B97A 4X6EB 3MO1A 4K2UL 5B39A 3ARFD 2L4OA 4MDIA 2YQ2A 1OE2A 2HFGH 1EMTL 4NGHH 2HJLB 3KVQA 4QRTB 3PWUA 1T03L 5E1GA 1OGPA 2YQ3A 2VR7A 2WUBL 1IEBA 4HKZA 3EZ8A 3SD2A 2R0WL 5IIEB 3C5SB 1C8PA 1NIAA 4LOFA 4R7VA 4TNWF 2ZE0A 1MEXL 3WKMH 5C7XL 3QI9D 1MFEL 3LKQB 1VJSA 4PRHA 3D30A 2XWCA 2HKAA 2CLVA 2OTUB 3W57A 1RL1A 1Z9NA 1DUZB 3FU6A 1HEHC 3GEFA 3QUKB 2K6YA 4QXGH 3GSXB 4XC3H 1KXQA 2A9MH 4BUGA 1UASA 1DEEB 5I8OH 4JKPL 5D7IB 4JFWA 4GAYA 1XGPA 3H42H 3NSDA 3VFVA 3O2WH 1BVLB 2ZCHH 3FJTA 3CZLA 3L4TA 2FAUA 3QRGL 4JO2L 2BVPB 5F8RC 4DP1X 4P07A 4CMHB 1I7RA 3I02B 4K8RH 1UKTA 2WXIA 4YBHA 4GO9A 4K3JH 2XWBA 1KXHA 3QZNA 5B39B 1FL5B 3DLQR 3O3AA 4AUYA 3U0PA 1NC4D 3GBEA 3L3IA 3FK3A 3SDXB 2VLLB 4OZGE 1BVKA 3ZL2A 3IWVA 1ZSDB 4FXKA 3CZGA 2DM3A 4JE0A 4NUMA 5KYYA 1T5KA 4E9LA 1GXEA 2A9CA 4XRCB 5EEZA 4GBXB 5AZ2H 1JZHA 4AYFA 2Y1YA 4JG5A 1TITA 1U58B 3BGAA 2K7QA 5TQ2H 3VXMD 3EKCA 3WFZA 4KNSA 2HLEB 3FHQA 4WUUE 4BK8A 3ZE1B 3DBSA 4M56A 4LRIA 4R96B 5EOQH 5EA0H 4DUWA 2BIMA 4Y4FD 3CDFA 4YHOH 3ZDZB 2NUPB 4JO3L 5EEYA 3ARRA 4D0BB 4OY9A 5HI3D 1G9ML 2AZAA 3CZUB 4N0RA 3ABZA 1LO0L 4I0PB 3KEDA 3TO4C 4ZZFA 1I85A 5EU7C 2YRZA 3LEXB 3ZQXA 1RLBA 2ID5A 1AR1D 4AEIL 4X6FB 2ICEB 4OZHB 5E2WL 1NUDA 2DTML 4FG4A 1TLKA 2WO2B 1OWRM 3VXOB 4V33A 1HCFX 2XTJD 3WHE1 3U6XA 5DUBB 4JVPA 5FM5O 2Y1AA 2Z92A 1PGRB 4QRPA 1XH3B 2NYZA 3VFUA 1PD0A 1RXLA 4GIAA 4LO9A 3O3DA 1TF4A 1KGIA 4HKXA 4BCXA 3APMA 4HAFA 1XCXA 3LZOA 4J8QA 4M7KH 4RA3A 3RWCA 3MV9D 1FFOB 1JGEB 1I9RH 5FYLL 4DP8X 1AQKL 5MERB 1CYWA 5CJQH 4F7PB 4AI7A 2AI0H 3BX7C 5I1JH 2APFA 2XN1A 4HIXL 2OJEB 4LOVA 5EZJA 1PIFA 3MCYA 4G7YH 2R2CA 2XFXA 1HESA 2OYPA 1OGAD 2IH3A 5DD0H 1JSYA 4I3GA 3VMNA 3OAUL 1UJ3B 3JV6B 1IT9L 4XXCC 3INUL 1G7MA 3C8KB 3LSOB 1WZAA 5DFTA 5GRJH 3JZYA 1JBJA 5KBKA 1IVLA 3S36L 4YXKL 15C8H 3BAXA 5J1TC 4ZFZA 3EOBB 2UZXA 4OF5A 4HULB 4NNPL 1BVKB 4GRLA 3N43F 5JHLL 4JZJC 4APQC 1Z0MA 35C8H 3CK0L 4YWGH 1VLXA 2OJZH 3BUPA 1XF2A 3O41B 4JY5H 5IKCA 4FZEL 3ASNB 1INEH 1DUYA 2XN9E 3MA9H 1NGXA 1H15A 3SCMC 5IV2B 4CSTA 4BK5C 4RZCA 2X05A 1C1EH 4U6HA 2YN5A 1PKQE 2WJ5A 1NCDH 5C09B 5KVDL 1L9RA 4ENZA 3ULVH 2F15A 5I17B 4MAYC 3P9MA 3GTVA 5EDSA 5JW3L 3OF6A 3ALXA 4DO6A 2H6PB 2NY3D 1LDPH 4QAWA 1F2QA 5ADPL 4LCWE 2YAOA 1HHGA 1MFEH 3CDCA 3U30B 5LAXA 3QO1B 1BZDA 1LWRA 3CFEB 2AK4E 5DHMC 5L4FA 4UT9H 5DJZB 3VFOA 3N40P 1M7UA 1RH8A 1ASOA 3RFRA 1VPOL 4CC1A 3IDJB 3IGLA 1D5BB 4QNPE 1A02N 5I16A 2XIBA 2FJGB 4HK3N 4JO1L 4BD4A 2BJMH 1UA6L 1DVUA 1R24A 3QISA 1OF0A 2DS4A 3VSTA 1KTKE 3G6JE 5ALBL 2DD8H 3CCHB 1YG9A 1YEJL 4QJ3B 3VFMA 1J8HB 2X6BA 1F13A 3B9DA 4KK9D 3U30C 1R34A 2XV0A 2O6DA 3BKYL 5BRZA 2WWMD 3FHAA 2DI9A 5TDPB 2OW7A 5HGGS 2G75B 5IT2H 3OR6B 4AVJA 3UJJH 4EIZC 1FYTA 1IJNA 1K4CB 4XHJD 5HPMB 3SDAB 2B4CC 2J1XA 3PAVA 3ZYOA 2JJSC 1OK0A 3TPKA 4FQJL 4K5PA 1GYVA 4S1QH 2IOMA 4LAJH 5CFAA 2BRQA 5ACZA 3QUML 1ETB1 2R7EA 5F7YC 4J3OC 3PE9A 3QUYB 5DR5L 5HI4D 4JPSA 1ORQB 4NZDA 4PJGF 5KJ4A 1JZ5A 4XP1L 3V4PH 4YBQD 1U8JA 4M43H 4Q7DA 4C4BA 3CV5A 2DI8A 2FATL 4R0LC 2QL1A 2G4GA 3WN5A 4AVIA 2YK1L 4QT5A 3M88A 4I87A 1PZBA 4WWKA 1HHIA 4FI8A 1ZEAH 4X5RA 2E3VA 1EVTC 5LVEA 4Y5YB 3GF8A 4U6TA 1Q9KA 1F4AA 3ZDZE 1JUFA 1QAWA 3LH8A 4OKDA 1XR8A 2GT9B 4ZTPH 1AHWB 3J7HA 3BVWA 3VFPB 2A4ZA 4ABVA 1J5IA 2X4SA 4P2OA 5EO9B 5G5DB 3TT3L 3ZUCA 2G4EA 4ZMZA 3OKYA 3T6WA 1KDIA 4DP0X 2C26A 1F3RB 5JHBA 3K6SB 3AG2B 1VSCA 2ZXDA 1OTTC 4FXTA 4JKLA 4PVMA 3OHXB 2J6WA 4F37F 4G8IB 3T0EA 1QTSA 5CP3A 1ZHLA 5GIRB 3V8OA 2IADA 3CFCH 4OM1H 3C12A 3ENEA 3FF8A 1UM5L 2VZ1A 4NJ9H 3V6FA 1OSEA 5A2CA 1RZIB 3HR6A 3UADA 4Z7NE 2F19L 5AG9A 3CH1B 4ORGA 1RCYA 1S7RA 2R1YB 3FUKA 5EU4B 3VQMA 4W4OA 5BCAA 1SLXA 2EDHA 3UL4A 3TL5A 3ZDWA 2H1XA 4B7LA 1PDKB 4LLQB 1CFTA 1BQHA 4G8FA 5CEZD 4JZJA 4APQA 1V55B 2CZNA 4HF5H 3IJHB 4MJ6A 1OTUD 1OAYL 1V3JA 4JY6B 4QEGA 1JPFA 1LHZA 3KXFA 3BKJL 4OCLC 1MH5A 4Q9RH 3EYVB 5E2JA 4TS6A 1MDTA 3OAUH 4QWWD 1U8HB 2OI9C 1CXFA 2RACA 2K6WA 4UBDD 4M7JH 3EIFA 5G4NA 3INOA 4AQ8A 2GEQA 3G6JB 1F4WL 4WHDA 4E41B 3SPVA 1Z3GL 4KK6D 2FQEA 5E2TL 2Z4QB 1AC6A 2FX9H 3ECUA 4G80B 4HUUA 4K8RD 3CFQA 3D9AH 4OQTA 2IOIA 4FP8H 4QAMB 5AUMA 2XX0A 4PJXA 3AU1A 1I1YB 3B2MA 4NN6B 3LS5H 5EOTA 5C7XH 1N4XH 1PEWA 2V3DA 2X7LA 2Y23A 3NSYA 3Q6FB 1XQ4A 2AK1L 2Y5TA 3PIQA 2Q10A 2XDHA 4RBPH 2CLZA 4J6RL 2I26N 3UZVB 2BNQD 1JNLH 3WEXA 3JTBA 3A47A 3A6CH 1LO2H 3GUFA 4DVRL 1UGNA 2AJXH 2OXHA 2CR3A 1I85C 1EZSA 1CE6A 5CJ8A 5CBAB 2BLFA 4RFEA 3WEAA 3LV3B 2P45B 4P99A 1KLUA 1MVUB 4Y8DC 4ENEC 4ZX3A 5JA8B 1A1MA 4PRNA 1CGVA 5E6SB 3QPQC 4GW5B 1AGBA 3JTTA 3ALPA 1KULA 3MRCB 5AKSA 3DO7B 4M1GL 2ARJQ 1XGYH 2VJXA 4RCAA 4XCCH 1N6VA 2X6AA 4MD0B 5JQHC 1XGQB 4KHTH 5E8NB 3AQDA 2Q7AA 2IWGA 1RFDH 1DFBH 1GC1C 1LO3H 2CKBA 1FFNA 1XTLA 5J1AA 3UZEC 4ETQB 4GXUN 4JM4L 4X6CF 1YYLL 4GG6F 1G9HA 3PDDA 2BVQB 3N55A 4FLSA 3N42B 5FYJU 3U9UB 1I3GL 1RKRA 4G11A 4OGXH 4Y4HB 2VIRB 2XXGA 3RVVD 3OPZL 1IMHC 1UD6A 3ESNA 3IKKA 2GIMA 3W0WA 3T0EE 4KK8C 1RJYB 2WZAA 3RY5A 2IG2L 3VX1A 1IBGL 3ZQ9A 3HC0B 2R51A 1RULL 1F11B 1DQML 5T3ZH 1M4KA 4M61A 4W9IC 3FQ2A 5LGKA 1UD4A 2EYTB 4M3KB 4D0DB 2K4WA 3EOYG 1EO5A 2XX1A 4HS3A 3N1PC 5DD6B 1A66A 3L4XA 1U3HB 3GTNA 3KWTA 2JKJA 3DETD 5F3BB 4NYLA 2VLRE 3UTTB 2O5XH 3MODL 2JK5A 2OBGA 3DUHA 4NNXA 1AGCB 3UERA 4MD0A 5TE4L 4HCRA 4PY8I 2GTWB 3HRZC 4PN6A 2AJSL 1WH0A 4MA7L 5KZCB 3FBKA 2PPFA 3FUEA 1Z5HA 1L9TA 3BGFB 1EFXB 2VDQB 1OE3A 4Y4KA 3X3GH 3BZFB 1Y1DA 5F9JA 3QUXC 3DK0A 5GHWL 4LK4A 3I6LD 5E1AB 2GJ6A 2QVKA 4LVOB 2V9UA 4K94C 1WBZB 4H25A 3WY3A 4OI9A 4ADIA 4YHKH 2DIJA 4XXDB 4JQIH 1A7NL 1GZHC 2XHNA 3S2AA 3WSQL 4OZ4A 2X7LB 3PJNA 3CUPB 5LGJA 1NCUA 1KJMA 2ZKHH 5JW4M 1BGXH 3LEYL 2Q87A 4TSBL 1F56A 1IM9A 2WXNA 2VDLB 1Y0LB 1N5YH 3IE9A 4AW4A 1G9NC 5BW7A 2NY5H 1L0PA 5DSCA 3CH8A 3K2UH 3QEQB 4HDIB 4IRSB 1Z32X 2Y69B 1AXTH 3T2PA 2E7LA 5FCUL 4F1SA 4JFZH 3AITA 3KXFB 3UAJA 3EG9B 4ZMNA 4G6AC 4I3RH 3H9HB 4AY0A 3BQUD 3K2KA 3CFCL 1MHPH 4WEMB 1DLHB 1UKQA 4BIKA 2X6MA 1JF1B 3MLWL 5JR1H 3KWWB 2R56H 3RIAF 3ILQC 4G6KH 1FDLH 4M4PA 3GLAA 2V3FA 3VFNB 1SF3A 3KPLB 4JN1H 1ZXQA 3MV7D 5BO0D 4WI3A 3K0YA 3FT0A 1Q1PA 1WC7B 3GXIA 4JHWH 4Y19A 4YHLL 3BKML 2GK0A 1KXVA 2J1ZA 2WQRA 1A14L 4K3DL 5B8CC 3BZDA 4KGLA 1G7HA 2C3XA 1E4WL 2IADB 3PHOA 3L1OL 5AOZA 1F3JA 4UM9A 4M1CC 3B83A 3EF7A 3WMQA 5E0QA 4OCWH 4GP8B 1FCCA 2DQIH 4QOKB 2ADIB 4LPXA 5SWZB 5FA3B 1PQZA 1XGRB 4BQCA 2BP3A 2I7OA 2IH1B 2Y1VA 1OZTG 3RVTD 4ZTOL 2FX9L 3TNNA 4ZMAT 2UXFA 4OZIF 2VGLM 4MQ7A 5C6PB 2D31A 4LQFL 3P3TA 4FN0A 3PABB 5DJ6B 5IFJA 4WDIA 4HWZB 4L1TA 4QLWA 1K9TA 1OKEA 3ATAA 4W9FC 3RX8A 3GWJA 4JM2B 4HJIA 1TTBA 2A83B 4P2YA 3DECA 4CW1A 3LZNA 1T4WA 1PS3A 1JHLH 1KYDA 4JO4L 2IO5A 5ERWB 4L1BA 1ROWA 4W9HC 5IJCC 3RU8H 2MJWA 4H20H 4ZFOL 4A6YA 2GVYA 2DLTA 3ZHNA 2QSQA 1S3KH 3P11L 1KBWA 2B15A 5TJWK 2MOGA 1N2RA 4R5XA 5GGVH 3W9DA 1N0LA 3IETB 3QUGA 1M1XA 3MYJB 4EI5D 1F5WA 1F4XL 4L37A 4JJHA 1YAIA 4C54A 4QTFA 1S4IA 3IJYA 4AZ8A 1ECYA 2QADD 3FT9A 4GRWB 4RLDA 4ZBJA 2MOVA 4HPHA 4OGZA 1CT8B 4G59C 4L8BB 4FMFA 5BZDA 1J5CA 4TSCH 2EKJA 3M17B 1DL7L 5EU6A 3VH8G 1XIWB 2FE0A 2WLIB 1QLEB 2VL5A 4Y89A 3I6KB 3PYCA 2I07B 3BLPX 2IXQA 1U8CB 4OD2B 4JQXC 4UNUA 1AZRA 2BP0A 3IJ9A 2P5WA 5CSZB 4PG2C 2WUCL 1LXMA 2Z91B 1GAFL 4PWIA 5DF0A 2X9YA 4ELMB 1N59A 2BHYA 2QFPA 1E9OA 4Y19E 5C3IA 5CJBA 4PV9A 1DJHA 4XBGA 4X2UA 4HOXA 1BJ1J 3BRFA 3IJ8A 4PBWD 1A7PH 1JDAA 5I75C 3F05A 3OWEA 2AJSH 4Z7VB 4TOYL 3WFHA 3WL9A 5A6MA 4FQCL 3KPRB 3ZL4H 1JK8B 3DRQA 1KYOK 5CHNB 3CN4A 3UPCA 5DRNA 1OT4A 1PZ3A 5IGXH 1H15B 1TVHA 4EOWH 3ETTA 4PY7B 4ZYKB 1CBJA 4WUUA 4BWWA 4C56B 4V2CB 5F7AA 4FEIA 3OC8A 3D08A 3K71B 2XJKA 3UCQA 3TVMB 1JXJA 1AGFB 1IV8A 1J0JA 2OR8A 3D18B 1UM5H 1D5ZB 4NJ9L 2W0LA 4QKTA 2RR3A 1W8EA 2OZ4L 3DVGB 4MA8H 3SYCA 3R1GL 4JDVB 3A21A 4YBQC 4GRMA 4JK0D 3U36A 2GW5A 2BSTB 4NCDA 4PJ7B 1UCBH 1ZLSL 3QCUH 4U3XA 3RHWF 2JF1A 3VD7A 5IFHH 4QRSA 4JJOA 4Z78A 4Y2DD 5B7MA 4A55A 1UB5A 2X4RB 4N90E 3HC4H 1MI5A 1BQLL 1G7MB 3L4WA 4IYKA 4TQPA 5JQ6H 1JPSL 3BP5B 4WTQA 5F88B 3QJHA 4PS4L 1F4WH 2QV4A 3FRPG 4PJEA 4XP4L 3TJEL 4X9YA 4ZO6A 4JQXA 4FE9A 2FD6L 4AITA 5FFOA 2O6EA 4K4KA 3ZUNC 2BIOA 1AXSB 3LQZA 4KV5F 4KUCD 1FA4A 2FO8A 3D39D 4LIQE 2CE6A 2XZCH 1N4XL 5C8JA 3ULUL 3CXDH 4RBPK 1CFBA 4MHHI 4OGAD 1IBFA 4JR9H 1KTLA 4U0RC 4A6YL 1ZVSB 5IVZB 4F33B 3QDME 1E4WH 4QHPA 2Z0UA 3PQYD 3TBSB 4ZMVA 2P8LA 4TPRH 4X6DE 5LBSA 3ULUC 3BQVA 1LILA 1M42A 3LRSB 1WEJH 1QUPA 1ADQL 5B39G 3PDOA 3S34H 5CF3A 1I1AD 3A22A 5GGQL 2ITCA 3FQWB 5CILH 2XQYK 3FHEA 5IVXA 1P53A 3AB0B 5AKRA 1HCZA 3FT3A 1GC1L 4KY1H 1DHKA 1DVFD 2JV6A 4GEIA 4OCRL 4QWWC 5SX4I 3VGDA 4DFIA 1O7VA 1BLNA 4AYDC 5D2NB 2QDVA 3DVIA 1MCOL 4JM4H 5LNEA 3VI4E 4DGVL 4OZIB 1QOKA 3LH9A 4J3OD 4XVUC 5AYQA 2H45A 4S2SB 1UADC 3LNFA 3ZE1F 4EUPB 1AFVH 2WBKA 4M4RB 3R7RA 2V5RA 2WGXA 1BXXA 4N2IA 1PG7W 3ZGHA 3MN8A 1AO7D 3DOHA 1OALA 1WFOA 5DUPH 5ENWB 5FGRA 4IK6A 3DIFA 1T5WA 2PYFA 4LOUD 5GGVL 2O72A 3BW9A 4NPYA 4NQDD 4XNQA 1NM4A 1IM9D 3F64A 3VD5A 3X2QB 1R3LA 1L7TL 1FL5A 2O5XL 3D39B 3MNVA 1KT2B 3DPBA 1KB5L 5EWIH 1V5JA 4UOQA 1YEIH 4GOSA 3DV4B 1UXLA 2BVPA 4XE5B 2PPCA 5B38A 2I9LB 3FW6A 2MHAB 5TDOA 2ARWA 4HJ1A 3SOTA 2PCFB 5FW6A 2HA1A 2WLJA 1QFPA 3ARDA 5D2NC 4AIXA 3D6GA 3GBLA 3BFWA 3GSNL 3NEXA 5D7JA 2BOLA 1MQ8A 3FQTB 5BQDA 3L7EB 4X6DF 4Z7NF 3U7YL 4YHYC 2YPVH 1U30A 1Z5YD 1JMXA 4TSAL 3K1DA 2IPKB 1GW6A 4Y5VC 4U7KA 5IG7A 2Z35A 3B43A 4PJ5A 5AL0A 1B3JA 3TBTB 3QIUA 2OTUA 5JLZB 3OZKA 1MWOA 1HWHB 2X53A 2HFEB 2L7QA 1V3LA 3BMWA 3NN8B 4KHXL 4PWGA 1JV5A 3QZBA 3RL2A 4KV5E 4BE5A 3MLZL 4I89A 2OK0H 4OKVA 1Q9LB 3SKJH 1M71B 1HSBB 3FPXA 4LL9A 1KCUH 1F6AA 1WBYA 1G9NL 3MLYL 2HWZH 4F2ME 4GO8A 3ESOA 3HE6B 4QRTA 2VSDA 2IFFH 3FB5A 4KVNH 1YHPA 3VWJB 1FG9C 3DETC 4WUKL 4MDIB 3KLHC 3P73B 3K46A 2PETA 3H8NA 4A04A 3RWGA 2EZ0C 4U0RB 1RP8A 5IHLB 1USZA 4ZOEA 1YECH 3OKKB 1J9SA 1FVCB 2NZ9C 5EUOB 1LP9E 4LCCC 3K5RA 2CPCA 2TSBA 2CAKA 2IDFA 3IN0A 4X8XA 5EUOA 3QUXA 2DICA 3OJDB 2YPKA 4IBUA 4NWTH 2ZP0T 4U1LA 1ZLSH 4W4NA 4JS7A 1KWKA 1I1CA 2C1OA 4KJPC 3VI4F 3LQMA 4PLJC 3WUWA 1CL7I 2VC2B 1EXGA 2FBRA 2HMIC 4RFOH 3A23A 1DN0A 4UT7H 1XSIA 4JFED 1TUPA 4Q4EA 1FVEA 2LQRA 3QCVH 1B9KA 1JERA 2Q76B 5GS1B 1VIWA 4ZPVA 2VM3A 5ICZA 2E7DA 2FSEA 1RQ5A 2F1EA 2PXYA 3QDAA 2XPGB 5LXGH 1M7XA 1TZGL 4WY7H 3ZXAC 4CUCA 4YDMA 1JV5B 3RL2B 2DN7A 1CLZH 1U95B 4G9FD 3BP4B 4X4MA 1ETZB 4PLKD 4UTAH 4NUGH 1MLBA 2F7IA 5DQDL 4EDWH 2OMVB 4HGWA 1B88A 4ES9A 1GGCH 5IG7B 1L9SA 3QXDA 1JWSA 2ED7A 4XNDA 1RK1A 1KCSL 3I75A 4QI3A 4X8GA 4F80A 1BZ7A 3GLDA 4LARL 1L0XA 2G2RB 4TLSA 3IKCA 4PRPA 4KVCH 4AV5A 3LNGA 3F65A 2UXVA 1NL0L 4MNQD 4JZOA 3IPBA 1S7TA 4TVUA 3DVFA 1VB9A 3A4FA 2LTQC 1PZAA 3EGDA 4Y1AB 3WNPA 4QRAA 1SOXA 1TPXC 3PGFH 3EXLA 4H8QA 1IM3A 4HXBH 2GC7C 2N59A 1W6LA 4HIXH 4OVVA 1S7SB 1YN6B 2W65A 4DK3A 2PTUA 3IAGC 3MC0A 2NY0B 4NUPA 4R97B 3K0WA 3F7QA 3SGDH 1S7QA 3GNMH 2QKIB 4GQPH 3T2NL 5IOKA 5D1XD 3WUWG 3MV9E 1WJ3A 4HWNA 3ATDA 1Q9WA 1HC1A 4CVXB 4M5ZH 3FQUA 2B16A 1RSYA 1JZFA 7CGTA 2ZWNA 2AC0A 2WVVB 1KJ2H 1NCIA 2NQCA 2X88A 3RA7L 3V6OC 3OQ3B 3QXVA 4OZIA 3FUDA 2Q3ZA 3GKWL 4YSOA 1T1YA 4D8PB 2BW4A 2X89A 4M48L 3RNKA 3QIUC 1GCYA 1KB9J 3ZYZA 2VJ8A 4ZO7A 2R1WA 4IU3B 5IWLC 4QMEA 3E2HB 5FO7A 1KGXA 2EIMB 2HH0H 4G70B 1JYWA 2C3VA 2BNRA 2KLRA 2NDFA 3VRIA 2EINB 3CFJA 3FN0L 5AVQB 5GJTH 5F3FA 3VXRD 1AYOA 4FQCH 1XVSA 3ZL4L 4Z3TA 2FJHA 3GI9L 1W6WA 1S7XB 3ZGIA 1NQBA 2AMUA 4LVOC 3WTUA 5JPMC 3V9CA 4GQQA 4PV8B 3FDWA 2R4RL 2VDLL 4EBQH 4ZNEE 4YN3A 1NM9A 3UJIH 4JPVH 2EO1A 1E9PB 2ENYA 4U6YB 2B9AA 2C3HA 1IGIH 1QR1B 2NW3A 3B7TA 1LO5B 1VPOH 2NY2B 2R2BA 2APXA 3HG2A 3P69A 3JWDH 3NJKA 2Q7NA 4HKBB 4PJIA 4S1DD 3K80A 4P9HC 1WA0X 3C6EA 4LSQH 2F54B 3L5WB 1BF2A 3ZPDA 5AAMC 4O58H 4WI8A 1T1ZB 3NCEB 4ZX4A 1I3VA 1XF3A 1AP2B 2P8MA 3WIHA 2OSXA 1NA8A 2IALB 4MXQC 1WP6A 4GI9A 4PG2A 5HDBF 4JRXD 1YEHH 2ZUSA 3OKNA 4ODWA 4X5LA 5C0AA 4QRSB 2EXWD 4FC3E 1EMTH 3BGMA 4KO9A 4M6OL 4YK4C 4Y1AA 1PX3A 5HHMB 1T3FB 1HZHH 4KKCC 2DQHL 4GRLD 4YLCA 1CJYA 4QRRD 4WW1A 5KN5B 5AVRB 1O6TA 3TH4T 4ANVA 2NY3C 1MRDL 3WG7B 4D94A 4YHIB 2F5BL 1P2CB 1FRGL 2VQUA 1AD9A 1H9VA 3ECWA 3HPJB 2C9AA 1GJIA 2NUTA 2DQCH 4QLRA 4OGQC 5H35B 3E80A 3KS0H 3WNIA 2E6JA 2G60L 2MCG1 2PABA 3EJRA 2X2IA 1NCAL 1SXAA 3ULVF 3OKOA 4UQ2B 4E41E 3KPRA 5M7QA 2HKFL 1S5HB 1XL4A 2FVNA 1T7VA 3KCPA 4X98A 1T20B 1S78C 5TD4A 1BFTA 1EAPB 1FVEB 1N59B 2DQUH 3ARYA 4D0CB 1ZGLM 4XGZA 2XKUA 4NUGL 4PJCF 4Z3IA 5J12B 1E28A 4GP4B 1EUTA 2DW5A 5T1LA 4WJ5B 3RIFK 3SO3C 1EGJA 3RZWA 1IRAY 5D4IA 4M5SA 2QQNH 1EAQA 1L9OA 1HHJA 3B7SA 4KTEH 3GXFA 2F53B 1AR2A 3HPLB 3PWJA 4UANA 5I8EB 2W0FA 5F9AC 4AL8C 5AL8A 1AR1C 1ET7A 2BK8A 3UBXB 2JB5L 3FUMA 2MCMA 1XCQA 2BOCB 2AEWA 2H2SC 3KYOA 4FI7A 2WN2A 3S5LA 5EBLB 1XX9C 3M46A 4TNVF 4CMMA 1ZS8A 2V2XA 2ESVA 4ZXBB 5CLYA 4HXAL 1OSZB 3QFGA 3VXSA 5E9NA 4J4PD 1HTYA 5D70H 4BGDA 4NZUH 1TZAA 2AJYL 3SIKA 1HQ4B 3EYQD 1LEIA 1A0QH 5C71A 4KKAC 6PCYA 5F71A 2QQLL 4CJ1A 3DX0A 2CCVA 3MCLL 1I1AC 4Y9FA 1RZJH 2AABL 1S78D 5B7EA 3X14A 4GUOA 2XQ0A 4WK0B 5CCGE 5C0RL 2QHRH 1DP0A 1NKOA 1YDPA 2X28A 3FQYA 5IW1B 4U3CA 2YPLD 2WSPA 3HTLX 4JJ5B 3C9NA 4LRNL 3VDAA 1KJ2L 5GSRA 4ANXA 5F1KC 4TSAH 1SPDA 2XRAL 4ODXB 1YN7A 2MNJB 5AQ0A 2VXUL 3B9AA 5FUOL 1B4JH 1J5OH 4E0RA 2IVFC 2Z34A 3BESR 3UYRH 3VAEA 3ALWA 4HU2A 3MU3A 1JXDA 4XWGH 4ONGL 1NOAA 1WQVT 1J87A 1PQZB 1XGRA 2VO5A 3U2JA 2LABA 3ZHKA 4KVPA 3ILPA 3LVEA 4W9LC 1MRCH 3NCMA 4N2AA 4YUEL 3HB3D 2D7OA 3HS9A 4JO5A 2FX8L 2PYED 3GSRB 2ZTBA 1PCXA 4AOFA 1XB8A 2FEDC 3V0EA 1LEIB 4EN2A 3U2SB 3F7PC 4KHTL 3PJSB 1DJXA 5BZWA 4K9JA 1T5WB 3INUH 4TUKH 4XN5A 5EO1B 3BQUA 2R8SL 3B3BA 4KAQH 4BH7B 4AIEA 4Z8FL 3BPOC 4X7DC 1WO2A 1EHNA 4YZWA 5FO8A 4NC2B 4ZO8A 1NIEA 2ICWJ 2Y7OA 4DP7X 5KYNA 4KQ3L 1NAMB 1ROCA 3NCYS 4N6RB 1UCTA 1AJ7L 5JZ7D 3HBZA 3TBVA 2FJUB 1BXVA 2C1PA 4WFGD 3SY0B 5IHZA 5KG9A 4WV1B 3EJCA 4E5XG 4P2AA 1E67A 3GSWB 3P02A 4FL4B 1INEL 3KW7A 1QFUL 4JPKL 5B1CA 2VDOB 3QZLA 5F7DA 4M6OH 1VFBA 3HFFA 4HD5A 5LXGL 4MA7H 2H5UA 3EW3B 3KPRD 2XY2A 3V2AR 4G8GA 1O5DT 3TBSA 1XF5A 3L81A 2E56A 3QPXL 2ORBH 5MI0C 1M6OA 1MRDH 1IC1A 3KBHE 4B9PA 3A67L 4XMUA 1GGUA 4TULH 4HG4J 2DQDL 3NBNA 4ESKA 1XF1A 2P8PB 4MAZA 3EOTL 1MI5E 3MRFB 2ICCA 3CSBA 2G60H 1UA6H 3AGWA 3HAEH 2F6AA 3SGJC 5GS0H 4PJGE 4N1EA 4JFDA 1E2ZA 3IYLW 3EXJA 1GHFL 2PPDA 3SN6N 5C08D 1MW2A 3L8QA 4FXGB 2VM4A 2A6JB 4BSWB 3CMOH 4QHMB 4Z1PA 5J6GA 4Q6IB 1N5YL 1JVOA 3ETBJ 1MFBH 2Z8SA 2R27A 1T2JA 4OV6F 5EBWA 5AVSB 1LK2A 5KOVC 3OKNB 3CG8A 1HIMH 4TL5A 4FTVE 4PJIF 2XA8H 5D1XB 2WBJC 4L3ED 3K8LA 1YCSA 3O6FD 2R0KL 2PWEA 1T0MA 3REWA 2O26U 1J1XH 2YHGA 4LU5L 4XNXL 3ROOA 3JBG7 4PRDB 4A2MA 1CZ8L 2DZEA 3F7YA 3U9UA 1D5ZA 2OMNA 3B2DC 4MMXA 5EPMA 1MNUL 1NKGA 5HHPB 1E4JA 1KEGH 5T1KB 1E5AA 3BJLA 5CR1A 3JV5A 3FH7A 3IJEA 3KYNA 4G6FD 4BKLA 3Q13A 4PJBB 3TO2A 1NC4A 2Z31C 1JHKH 2HVJA 3W1ZA 5IHHA 4PJ8C 3W81A 1E9PA 1WIPA 2DM2A 4GW5A 2VE6B 3WL9B 3JXAA 3D8MA 1G94A 4HJ0D 4ISVA 5MHSD 4RDQF 1QI3A 2BP5M 2AABH 4DGUA 4PBDA 2C9QA 1MY5A 3MPCA 4X5WA 3QAZC 4HJGA 4B9FA 4I88A 2NCMA 4KUZL 4WENB 3UAJD 1R0AL 3T1FB 2PCPB 4WCYL 5DURB 5F2FA 2YWYA 3KM2A 2IXQB 4RA0C 4HHWA 3BE1L 5EC2B 2XIIA 1XIWA 3N6YA 4J3SA 1I1YA 4KI5C 1KV7A 3WS3B 3VXME 4MJ4A 5INCA 1LJMA 1Q1JH 4PGBA 5TF1H 3AVEA 4JO4H 5EULV 1HFUA 3PL6A 1TJHH 2IDTA 2DKMA 1KIQA 4GKZB 1R5WA 4K3EL 5F93C 2XZZA 5A3ID 4Q4IA 4IOFC 2AQRA 2P52A 4AZ8B 5DK2B 3BT0A 2QFRA 1RUMH 4WI5A 4Z9KB 4X8JB 3WV0A 3BXNA 4LLDB 4FNRA 4GP5B 3PG2A 2ADGA 1MKFA 4X9GA 3KYOB 4J7RA 1PDKA 4LLQA 3AY4C 5DZVA 4FA7B 1LEKB 3LHPH 4PRAB 1DEDA 2CGYA 4Z7WA 4AE1A 5AYTA 3E6FB 3HZMA 1XGTB 2R2HB 2R4SL 4LQ1A 4N0YH 4F7MB 2JI3A 4OJDH 1GMEA 3HE7C 2CLRB 4PAZA 4ZUWB 1E4XL 3MLTB 4JGMA 4D9RE 4I77L 1WD9A 2G3ZA 4P4KB 3QQ4A 4S0TD 4PJ9A 1YNTA 1E28B 3H9SB 3MRRB 2VCOA 4I13B 4UB0H 1OTTD 1HE8A 2MNUA 1A8JH 2ZSVB 5C0IA 4JG9A 2FLBT 2UWEE 2WXRA 1HK6A 4GG8A 1IBBA 2PR4H 2HTKD 5FAAA 3IK2A 5JIQA 1GPOL 1AKPA 1C1EL 4L8SA 1DJGA 1XSJA 3BP4A 1V7ML 3CIAA 1E8WA 3RVWC 2HP4A 3WY1A 3FTXA 3B9KC 3QNYB 4R5VA 1GGBH 4H5SB 4LP4A 3ME0B 1JI1A 4XMKL 1NBYA 1DQJA 5C0DA 5LNGA 3RVXD 4EDXB 3AXLB 3FUFA 3TYGH 1Q94B 1P9MA 2EIZA 3BH8A 2E9WA 3LIUA 1CYXA 1URLA 4UU9B 5C1MB 3ATBA 3KGTA 5DVMA 3ARGB 4TVPD 2CO2A 5E6IC 2D4FA 5EH1A 5I1CL 2JIXB 5I1LA 3K8KA 4P2RD 3OTTA 3SBRA 3ROOB 2LLGA 4MA3A 5EEUA 2BVYA 5JW5B 1CDBA 1KNOA 3DX6B 4HIIB 3L16A 2JIXD 4YEFA 3NCWA 4WW2B 3WAKA 1YEJH 3QUYA 5MP6L 3GGWB 2MFNA 4NC1E 4KO7A 4C56E 1GHFH 5FF6A 4CC4C 5G55A 5IJBC 3VE0A 1URIA 3ABKB 5E00A 2ODHA 3CLWA 2G5UA 1CLYH 2N1TE 4XR8C 1RZKC 5SWSA 3RWGB 3H2WA 1CFVL 2QHLA 4ANWA 1XF3B 2UY6B 4QHKJ 4LCCB 3O3BA 5CJOL 1QW8A 4HLZG 5CBEA 3VWJA 2M83A 2ZPKH 5I75B 4JFDB 2W94A 5CLZA 2NXYB 4PH8A 4GPVA 4X98B 2WNGA 3FSWA 3P3RA 5C0RH 3ESUF 5I6NA 3NQKA 3RVXC 2R29A 3P4NA 4PJIB 3TEWA 1IC4H 3T1WA 2CGZA 4KKLC 1YEKH 4IRJA 4G6JL 1E90A 1KTRL 1P4LB 5D93C 3CDGB 4P8QA 1P5UB 2YUVA 4I0CC 4M6AA 4XVOA 1BOGA 3TZVA 4YHKL 3VXSE 4G43B 3SBWA 2E4FA 1U33A 5F96L 3HEIB 3IF1A 4OIFA 5K1VA 3WSQH 5B38G 1BP3B 1X5AA 2VH5L 5C09A 3UIYA 2G2NA 4FYQA 5HY9A 5JPNB 4N8VG 3O3BB 2W9EL 2D03H 4G5ZL 4JN2B 3GLZA 2ZG2A 2FUTA 1KC5L 4KK8D 3NRFA 4U1GB 3AM8A 5KG9B 2W0KA 2VZOA 3K2UL 4N2DA 4KWUA 1SFHA 2C1PB 2NRDA 1CO1A 2EYTA 4XB3A 1X5HA 2BNRE 3ARBD 1SXNA 1Q72L 3EAKA 3T0DA 3AREA 3TN0B 1LD9A 1N0XH 3EOAA 4NRZB 4M93B 4C47A 3PQYE 3KBEA 5TQ0L 2EIKB 5G2NA 4F8TA 1ITBB 9CGTA 3LS4L 3NJGA 4QTIL 5H2BA 4ZPTB 2J8UF 4U1HB 2BVQA 3QUHA 4TVPH 4JN1L 4BH7A 5D6CA 3W82A 4QRQB 4FGMA 5DTFA 4ETQA 1T0PB 5J1AB 1TLMA 2JMRA 5E8NA 1FPTH 5DUML 3OAWA 5CCJA 1AQ8A 5CMAA 2J7LA 3WEBA 2X87A 1VFOA 4NEHB 3X13A 1P69B 3O6LH 4BGLA 4H40A 3RGBA 1D6VL 1KFGA 3CLFL 2OSYA 2DDQL 4YFDB 3KLAB 3D4CA 4PJXE 1QFOA 4G8EB 3WUZA 4HKXB 3UEQA 3IDGB 3QEGL 4PI2A 4YGVB 5F0JB 4HALA 5CZXC 1QSFE 3SDDB 4ODXA 1KYAA 5HHME 1J05B 5DQJA 3ISWA 5D8JL 4YHPB 3TF7C 2Z93A 1WT5C 1NMCC 1P84K 1ODAA 2CMRH 4ZX5A 2EVGA 4KQ0A 2IV9A 4HSCX 2BJML 3CDGA 2VDPL 1YJDH 3O4LE 4LEEA 4KHXH 2FR4A 1SF5A 3NACL 5I6XC 5I74C 2IG2H 5ANHA 3HRZB 4MJ5A 1JD7A 2FSEB 2GHZA 1T1WB 3FH8A 5CU9A 5HVGB 4C4KT 5FECB 2D7MA 1CB4A 2DQFB 2JH2A 4G1EB 1BQRA 4J39A 1OD7A 3QUYD 4PJAB 1VFAB 3W39A 4H8UA 3GD1C 1GKOA 4CKQA 4GKLA 2XI9A 4WI7A 5L8JB 2ATKA 5DVLA 5B7FA 2B77A 2P9RA 5C86A 4F2MB 4OGYH 4LLMB 3VA6A 3BAEL 2F61A 3C5ZA 3MLUH 1A21A 4XCYB 3S5LG 3RFZA 5HDWA 5DJYA 5BXFB 3LRLA 4M6MH 1NEPA 1KDJA 1QEWB 2GQHA 4UDUA 1MHEA 5LDSA 4PRPD 1J0HA 4WFED 4M7LL 4XBEH 1SQ2N 3DSFH 4WZ9A 1R5IA 2UY7B 3C6LB 2HTKC 5CCKH 2KQMA 5HHVL 4P2QB 4R5TA 4MXVF 3HG1D 3RZCD 2GFBB 4XN4A 3L5XH 1M7IA 2K3HA 2PO6D 3WO4C 3GEWB 1UWXH 3OZ9H 3NFSH 2VLKB 4QO1A 1HSBA 4PRHD 1YY8A 2FJFB 1TTFA 1TZGH 4WY7L 1MFCH 5IOPB 4E9RA 2FJFA 4APXA 3F84A 1YC8A 1JFQL 1JNNH 5IGXL 4AVHA 2KLSA 5FW7A 4JHAH 3S4SB 1E9OB 4AC4A 1RZ7H 2CLVB 1P5VA 4IKLA 4IRZA 4JFZL 3L4CA 4ZS6D 4JFFD 1P2CA 32C2B 4PJ5D 1HINH 4RAUB 2BVEA 2AV7A 1U4FA 3IMUA 3BPNB 4TUJB 3PNWB 2K70A 4PCYA 3IMTA 1UQSA 1ZGLB 3C5SA 4MRCA 4PJ5E 3R1GH 4OCXL 2VL5B 4ADGA 5HDQH 3Q9PA 3QUXB 2GTQA 3REWB 1AG0A 2R7EB 1IC5L 3ISRA 1CICD 5L2KD 2ZX8A 3ZTEA 5KVDE 4KJPD 2D03L 4I18C 1VKXA 1KT2A 5G4MA 2H32B 1GGIL 5HYSG 5D7SL 3F00A 4PRPE 5FYKH 2NYYC 4LDLB 2VB5A 3WTWA 4YX2H 3DNKA 1G43A 2LU7A 4JN2A 4YLBA 4K0OA 1MIML 1D9KD 1QNZL 1VZHA 3CZFB 3P0YL 3P73A 2A9BA 4I3RL 5ALCH 3VGAC 5KBDA 5J0BA 3TJEH 5DK2A 2VISA 5ES4B 1W9XA 3VD9A 3BH4A 5FS5A 1ZANH 1ZWIA 2X09A 4HPYL 1LO5A 3CXFA 5F7EH 5AVXB 5KSAC 3HZ3A 3Q5TA 5LGHH 1AZZC 3D69B 5MENA 3ARDD 3EJYD 4YHLH 2HN7B 4X4XA 3FQXA 4OLWH 4AYMC 4XNBA 2AK1H 5DZ9A 5JLZA 1RURH 1XZ0A 3U7WL 1WFIA 2CIKB 4PJ5B 3SBWC 3WLBB 4KTDH 4IGBB 3QJXA 1ZDSA 2J8HA 5KSBF 3Q0HA 3H7LA 3OKEB 4O02H 3AWFA 4WK2B 3FU0A 3MRQB 1OO2A 2DDQH 5IW6A 4I8DA 4U1MA 2C3VB 1V7MH 3PGCB 3VRIB 4YHML 1P0SE 1LL1A 1NGXB 2MHAA 5TDOB 1U92A 2V7HB 5I30L 2PTTB 2Y0SA 2VLKD 3DGCR 5DJXA 3VA2C 4CA4A 3T4YA 2EDRA 2FQFA 2DIEA 4P2CG 4NZRH 1DZ0A 4P4KD 5D8JH 1RERA 5E4EC 4MNGB 1T80A 3DX9A 1AY1L 1G7HB 3IDXH 3SGEH 3MNZA 4J6IA 2WKGA 2BFVL 1I3GH 2WSKA 5IJVA 2E47A 4KGJA 3A6BL 1OGAA 3ILQD 2FL5B 1JZ4A 1RUQL 4B60A 5IB2B 4YDIH 1CLVA 5SWSD 4LLVB 5K69A 3ARGA 4N87A 3UTPD 1OGAB 2X3AA 5FXCH 2RTTA 1I75A 2LGNA 2IWKA 5IMMA 2I27N 4DP2X 4CDGC 1KCRL 2HRHA 4MDJB 1CTMA 2EC9U 4GMTL 2O6CA 4X9FA 3SDAC 3UACA 1F4XH 1I8MA 3N43B 1SHMA 4EN3C 2OSLA 1NPUA 4OT1H 4LPTA 2F54E 1B6UA 5D1ZD 2VR9A 3EYUL 4HSQA 3TO4A 2A2QT 4YDNA 4BZ1A 3CQPA 5E6ZA 4GI6A 2W1NA 4QGTA 1BPVA 4JFPA 1F4YH 2EXYD 3BWUF 3CSTA 1HSAB 4JDVA 2WK2A 2VERA 3GPEA 2NTSP 3G6JF 4HUKB 3QS2A 5FGBA 1H6FA 2CXGA 3GMPB 1IAIL 3D05A 1F1AA 2F5BH 2F7QA 3VXOA 2JLPA 2X4OA 1BBDH 3CDZA 3QXAB 3WLBA 2BSSB 2R2EB 4ZYKA 1K3IA 2XZQL 2X6CA 3GHBL 2AW2A 2HN7A 1U91B 2P26A 3DVNA 3QWOA 4FKKA 4WEEA 4K5LA 1T04A 3PUUA 3LQAL 4PTUA 5CHNA 2EEXA 5E0FA 3W5NA 1XH1A 3U0TA 4N25A 4EZJA 4OFYD 1LO4L 5I6KA 4LPCA 2FT6A 4FAAB 3BMVA 3PP3K 2J55A 5T3XE 4DCQB 4DQOH 5AG8A 1B3IA 1TZHB 3BVVA 3QA3A 4YVUA 5F7DB 4OF6A 4AEHH 1PZCA 2E9GA 2FWLB 5ABAA 4V1DD 1H3VA 4PS4H 5LLIC 2UWEA 4W81A 3BRDA 3D06A 3HZYB 1HINL 2PWGA 2R0ZH 1B0IA 4GQ9H 2DLIA 3WTYA 1N64L 2D73A 3STZB 3LIZL 4N6RA 1UWEH 1NAMH 5GZND 3ZIYA 1WCBB 4MJ2A 2ZOKB 5ESQA 2J3SA 1HDMB 3M1BB 4JUTA 1JNJA 3Q8AA 4S1SH 2BCKA 4YSRA 4PUBL 1YQ2A 3FB8B 1GGIH 2AITA 5DI8B 5F6HI 1HJBC 1MVYA 3O6MH 3PHAA 3OXRB 1MCWM 5I66B 2GAZA 3QDMA 5L8KB 3VG0H 3ARBB 4IK7A 4R90L 3NA9H 4NQDE 5KVEL 4U1KB 4HGKC 4U3HA 1MAML 2VSKB 1S5HA 3CVIL 4JE4B 2CJ3A 3NSFA 3MA7B 4LP8A 3SE9L 4ZTOH 3RVWD 3V4PA 5ERWA 1RZFL 4P5TD 5LDUA 4JREC 3H2PA 2V17H 4OUUA 1SDDA 3NVQA 2W07A 1KIUB 5DA0B 4U4IA 5E99H 3B4NA 1AG6A 1QRKA 3DYOA 1K5NB 5I15H 3KJ4C 1VFMA 1M7IB 1SOKA 3VX0A 3DUSA 1BZOA 4XCNA 2AKRB 5GZOC 7FABL 2ZICA 1KEMH 3DJTA 2J56A 3G9VA 2VXQA 2JWYA 2V3EA 3NESA 2Y24A 4DAGH 1IVTA 5JPMA 3TYFA 4KRPB 3UYRL 1OT1A 4N8VB 3CDYA 2DYPA 2CM5A 1HDMA 3M1BA 1QEWA 2GSIA 2E6PA 4Z7VF 3D2TA 4QOKA 5SWZA 3RFZB 1AHKA 4RMVA 4FFZA 4N26A 3C5ZB 4XCYA 3WFBL 1PKOA 3AXHA 3QORD 4KX9A 1XV8A 3F12B 4JFDD 1LK2B 2B3IA 4K9EC 4PRAA 1XD1A 4KY1L 1P7KA 3QRLA 5I82A 3EYFA 4XXCA 1E6OH 5E8DH 5IMMB 4RRPG 1MG2C 8CGTA 4HQQH 5LKNA 3VWKC 2ROXA 3QA3B 4UT6A 1MFVA 2DLFH 5EO0B 3ZRCC 4NI3A 4HUWA 1M9WA 4JFYA 5E4AA 4P46D 1ZHNA 1LEGA 3GZOA 5E5MA 2ZJSL 2E7LC 3WNLA 3KS0J 3LPFA 2FTAA 3NRPA 5I8EA 2LFGA 4X9HA 3S37X 1CXHA 2ZONA 1MJUL 3FTUA 2HRPL 4Z5RA 1WWWX 2ALWA 1I31A 3U4BL 4OLXH 2H1PH 2DMHA 2ENQA 3QDJB 1IGTA 2R39A 3R8QA 3UC0H 2X4OB 1H3PH 1J5DA 2Z93B 3PV6B 1CCZA 5DEGB 2P47B 3SHSA 1H8SA 2ED9A 4Y1AE 3U82B 2J1YA 4H2AA 1W72L 2BS8A 2HT3D 4N2EA 2AEIT 3MV11 1HHHA 1K5WA 2WXFA 4RGNB 2JELH 4YGVA 3RWEA 3E8UL 2MQ0A 4X5WB 2EVFA 3KCPB 3VNYA 4ZW3A 1FV1A 1TQSA 4NO0A 1PMYA 1NCOA 2ORBL 3AQZA 3LIZA 2Y7QA 1M6UA 2VAAA 1I8UA 5L7XH 1VGEL 1BM7A 4JFDE 3X13B 2F9BT 4PJGA 3WJJA 3JTSA 1BBDL 3T77A 4Y2NA 2VWEE 1PG7H 2NUTB 3O4OC 3ELAT 2BNUB 4WRLA 1IEHA 4U2ZA 2BP8B 1LEGB 1BJ8A 4XCEB 4YO0B 3FMGH 3HI5L 3TV8A 4DN3H 4UCFA 1MW0A 2RQEA 3WNOA 5I8CA 4IBQA 2ZX5A 4X7SH 3D87B 2LAGB 3V6OE 4NFCA 4AM0A 4MNQE 4WNSA 4LOUC 5KAQF 2FT8A 1RZKL 5JIHA 3SQBA 3DX9B 1ONQA 2V5YA 3MZGB 4FFZL 2YLHA 2CK0H 3AREB 1FLRL 3UBHA 1IU1A 3BP7A 2XNAA 3QFJD 1U2YA 4S1RL 2W9DL 2N7SA 1GS7A 3L3OB 4IRSA 3KYKL 1UWYA 4F8OA 2WCSA 3KPSD 2BSTA 4PJ7A 1AE6L 1J8HE 1FO0L 1WS8A 3QORA 1N64H 5KOMC 1QLFA 4XC1H 1FC2D 1T0NB 2CK2A 1HXKA 2CO3A 4LU5H 4PPTA 4RVBA 4WI6A 3D33A 3S3DB 4UOZA 1ZLWK 2ICES 4AGMA 1F1DA 2GABA 2AEPH 4BE6A 1QSEB 3NH7L 2VN6A 4J28A 3QWRA 1D5BA 3S4SA 4GY4A 3OX8B 2O5ZL 3MTXA 1TVHB 3HW7A 2A38A 2VDQH 4K7FB 1JHKL 1CDHA 2C3GA 1J0IA 5LAXB 3I74A 2GEEA 3QG7H 4HUCA 1X9LA 3T0BA 1CD1B 1UFUA 2KDYA 4NO2B 3K6NA 3DRTB 3D3VD 2E9IA 3LV3A 3IBOA 4G7VH 2Q1EA 4Z3FA 3ARQA 3THMH 3WEXB 3U0WH 2XU9A 3CHQA 1EEYA 4N2BA 3VFTB 5CSZA 2JI2A 2ESVB 4KDTA 4RGNE 5FO7B 4E42B 5AZEH 4DW2H 5KTEL 4NQCD 1J9RA 2X12A 5FX3A 2P5EA 4OV5B 5HYIA 3STBA 2YMXH 2ZOLA 4DAGL 4UIMB 1ZE3C 1QRNB 4AT6A 4PJXB 3D1MC 1MJ7H 4OFPA 4G80A 1TFHA 1RJYA 5HI3C 2ODIA 4NPKA 3I85A 3STLA 4UI2A 3C5ZD 3HZYA 1UZ8A 5IY5B 4LAQL 4Y4HA 1ZA6B 1Q0XL 4HXBL 1MWAH 3O6FB 1PU0A 5LBSL 3ZDXB 32C2A 1B90A 4JY6A 3V5KB 4B9CA 3IS0X 3PWVB 2HYMA 4M6NH 1WHPA 2YUXA 2VXQL 4K15A 4EDXA 1U8QA 5C07D 4OFVA 4G8AC 4M02A 3ROLA 4EZMA 1FNFA 1RK0A 5KVGH 2BIQA 4Z0BL 5D7EA 4GH7B 4NQTA 1M2VA 4H0GA 4KXBA 4WVRA 4PRNB 4YDKH 2EVIA 3VXRB 4KJWD 3RY6A 2Z64C 2WKOF 4N8PA 2Y72A 1WA2X 1N3NA 3MX0B 5DURD 3OKMB 5KANG 4A38A 2DKUA 4DP5X 2I85A 3D2UB 4ZRGA 3PABA 3BAYA 4N0CD 4WFFD 1UACH 5IFJB 4GSXA 4UYQA 1LP9A 5D96B 3QCTL 3RURA 3Q6FA 3GIZH 3F85A 3IDGA 5KN5A 3QHTC 4XPTL 1THCA 4XPFH 2HH0L 5BOJA 3CZSA 3SKJL 1CUOA 4QYOB 4UV7L 1ETZA 1EQWA 3DI3B 4N2MA 5C09E 5ABDE 4FLOA 4UAHA 2NW2B 4TQEH 5IK3A 4NRYB 5CGMA 5AW3B 4DQOL 3GRGA 4R8WL 1G6RA 1TTCA 1NOFA 1OSPH 3QR1A 5IMKA 3WY2A 2OYKA 4EBQL 5KVFL 2XTSA 4TQ8A 1B0GB 2LLNA 2IF7A 3FT2B 3UTSB 2PYFB 2HFGL 5A2AA 4TUKL 2RALA 1MCWW 4NGHL 4K7PX 3LN4B 1QX1A 1E6JL 4KKBD 4Z8FH 4U1HA 5HYJB 1SEBB 5L4IA 5IQ9B 1FZJB 2NLJA 2XWDA 5I1DB 1DBBH 3UABA 3WHXA 4P59L 2KKQA 2OULB 2FR4B 2C7FA 5ICYB 2DKSA 2MQGA 3CH1A 2VDMB 4ORGB 1E50A 5INCB 1FVDB 5JA9A 4HBQA 4ZFOA 1SMAA 3V6FB 2NY7L 4F93B 3F8UB 3RI5F 3RKDC 1OL0A 2B08A 1SEQL 2K8MA 4FFWD 2N01B 1F02I 2WZPD 4GAFB 3OM3B 3D0LB 4GKNA 2VN7A 1KJ2B 2ITCB 2F58H 3FQWA 5HGDA 4U31A 3VWKA 5I5RA 5EHFA 3BZEA 4YC2B 4LFHD 3P3YA 7TAAA 2PW2B 3H7BB 1WZKA 4Y4KC 4C4KO 4NO2A 4BWTA 4OKVB 5A43C 1MFAL 3QQ3A 3QPQD 2BM3A 2OPCA 2YBGA 5AOLA 4PVBA 5FDWA 1FRGH 2BX5A 4U0QB 4Y5YA 5IESH 5E1AA 1C9SA 1CR9H 4WTZA 3MBED 4YE4L 4ONFH 1DUZA 5L2JA 1JTPA 3B3IB 5F9JB 2HX8A 4HC1A 5I9QC 4L0PB 5MEQA 4NHUB 2Z65C 2ZUTA 3B1TA 2H2PC 1MVFA 4MX7A 4R4BB 3DUUA 2BC4B 2IMMA 2WMPB 3ELQA 4AMKH 3GXNA 4ONOA 5LQBH 1EV2E 2JB5H 5DMIH 4LBAA 3CZFA 3LKPA 1GYCA 3O0RL 4GFTB 2QADB 5SWSB 3OLDA 5E23A 4WSJA 3D39E 4ABUA 3UYOD 4N2GA 4J3TA 1J1PL 3QJOA 4L4VA 2WSDA 2OZNA 5D7HA 3GINA 3BP7B 3I3EA 5HGAB 1SN0A 5IROA 1NCNA 2K0RA 5LJYH 1QVOB 4X6DA 3HS0B 1MSPA 3GT6A 4BSWA 4KTEL 1JV2A 5B1JC 3EOBA 2J57A 4IRSD 5E08L 2A99A 2R29H 1MFDL 4N0UB 5D4HA 1J8HA 2ENJA 2JIXA 4GG6A 1CZ8H 3AG4B 3LXBA 1Z0NA 1SJEB 4OFDA 5DHXB 5F7NC 4N28A 4CSPA 4WKZA 3FT4B 4MX7B 2C4XA 3FU8A 4S11A 2VDRL 3B2PA 4Z3EA 4ZZKA 5K59E 2MPVA 3WIAA 4RDQG 1DSFH 5E2UH 1COBA 2PUQT 1MLBB 3FYEB 3ESPA 3CFEA 4OLUL 3AS1A 1DQLL 4K23L 2HPOA 1UH4A 1ZTMA 4YPGA 1PF3A 5DRWA 2NSXA 2Q8BL 1WPCA 2DBLH 4WGWB 4BQ6A 3E6HA 1SN2A 1WGOA 4NZFA 2R15A 2H6OA 3HC2A 4QO1B 3ZRFC 5JW4Q 3GMRA 3QJQB 3TT1H 4IIQC 1O6VA 4GYBA 4XODA 3UPRA 3NIGB 2CO7B 2ZWYA 5D7LE 5F97E 1JI2A 3ARXA 1VFBB 1WIOA 3L2MA 3BVNB 4NAMA 4G1MA 2P5EE 2XVBA 4LRNH 2A3TA 3N42F 2AAVA 3IU4L 4L5FL 3RVUC 2EXYC 1KTDA 2F2HA 2ZKWA 4G7QB 4OD1H 4QXWA 4QUOA 1GVIA 3GRWA 5E8EA 1I7TB 4KAQL 3I3BA 3RNKB 2X1PA 1S8DA 3PNRB 2DRUA 2V5MA 2X2HA 4KMQA 5D5MB 5KYXB 1JXFA 1ADWA 2MWCA 2EE0A 1OP3H 3CFKA 1QI4A 1KF9B 1PNCA 3ILEA 3MXWH 4Q9QH 1U6AL 2NCEA 5E4OA 2ZKYA 3KPSB 3G6JA 3GJFK 5I1HL 4GW4B 1EK3A 3DROB 1ETA1 4HZLA 4JFYB 1KJ3H 4U1SB 3BRGC 3BLBA 5BOZG 3I9PA 5KSUB 4EUPH 4F5CA 2IAAC 1YEWA 3W39B 1HYSC 5D72L 3H53A 3HE6A 4F7EA 3JV6A 1Q94A 1TZIA 3BEVB 3SY6A 3SGKC 1AHMA 4H5SA 4NN7B 3HNTL 4KJQD 4XTRD 2HLAA 3KR3L 3WKPA 2N3JA 2NW2A 2Y6SC 2QZQA 3NIDF 4N9GA 1DBBL 1DQTA 1MZZA 2AV1A 1W72A 5E51A 5LG1A 2VRKA 2DYPB 1R46A 4MNHA 4OBRA 1GJUA 3RVTC 2X70B 1AOZA 1CDIA 1OK8A 3G5XA 4HWZA 3Q9QA 4Z7WE 3TVMA 4PJ9B 3OG4B 1SNRA 4HVBA 3HG1B 1D2OA 1O7SA 5CCHE 3BAJA 1N3NB 3MX0A 1K5NA 4Q89A 5C2BH 3V6OA 4JJ5A 2PR4L 4NKDB 3WXVL 3NFSL 4OUUB 3K4ZA 4ODTH 1NGYB 1BJMA 2ZZUT 4ODSL 1WBXB 2PXYB 3WIFA 2KH2B 4IW4C 4UM9B 4NQSB 3GK8L 4J4PA 3P1VA 2K1MA 3PHOB 2OP4H 4G2AA 3QDJD 4PJBA 4O2CB 1CD8A 2XPZA 1FZKA 3SE6A 4JGJA 1Y6NR 2VXTL 1TR7A 3DMMB 3QDMB 3V5KA 1JE6A 3VVVA 3DGGA 5IESL 1OSZA 3C08L 2BIIA 4YE4H 3LZQA 2EAEA 5JIPA 2YAFA 4CMMB 5DJCB 1BG9A 4BK4A 2FH6A 1P4BL 2VR8A 1MJ7L 2H41A 3BCDA 3H3PL 1HAUA 1KTJA 4MB1A 5HI4C 5BZXA 3BDXA 4PHXA 4NQDA 4PGBB 1IC5H 1ASPA 1UZGA 2BSED 3BGFC 3GSUA 3DMMC 2WIMA 1D7CA 1KPRB 4N2HA 5EDXA 4FQQA 4HMCA 4QRPE 4KKLD 5EC2A 1CL7H 3MUUA 4WHTB 3NGBB 5D71L 43CAB 3KG5A 3LXUX 4Z3GA 3G6DH 2Z8WC 4WJG3 4HWBL 3O3AB 3HUJA 1OP5H 5AVTB 4NIKB 1BWWA 1FFRA 4NO3A 4EMZA 2NNXA 1I1FB 4F8LA 2EH7L 1BIIB 1V54B 3E9UA 4P9MH 1IE4A 3GIVA 1R24B 4RIRA 1VZGA 3VM7A 1PFOA 4ISVB 4OSUL 3IDJA 5H4YA 3CZEA 3P0GB 3TVMD 1NDGA 1BSIA 1WFUA 5C08A 5CWSA 1IQWL 2XT1B 2AJZB 4OH2A 1YUHA 4Y1SA 1P7QB 4ZFFA 4E9VA 3QIUB 1OAZH 3HPJA 2XACC 4OB5L 1Y18B 3NK3A 3HZKA 1HEZA 3RWJB 3F7YB 1HCYA 5JHDD 2BMKB 1QBLL 3I9IA 4IOFD 3EYOB 3C8DA 5E6RB 4BEIA 2F7PA 4G5ZH 4XMXA 3S35H 3RWIB 1L4IA 2YGVA 3VFGH 3B34A 3U25A 1XF4B 3DV4A 4LB8A 5IVXE 3TO4B 3CVHL 1G7QA 1ET5A 4LLUB 3KEHA 4LL4A 2GSMB 1NGPH 2UZPA 3RWFA 1VACA 3UTOA 1Y7VA 4UOW0 3FBQA 3HC0A 4JGNA 1KSRA 5CLTA 4AQAA 3WTTA 3K5SA 4PCKA 4DPBX 4UBDC 3BAIA 3RAJH 4ZNCD 4ZFZB 3VTTA 3A6BH 1PVHA 4QGYA 4PYHA 3M6DA 3DX4A 4LCIH 1DQDH 3HCVA 3T65B 1RK7A 2K78A 4V2BA 3UG4A 2IQ9L 2F54A 2ZWSA 3HKFA 5FOJA 4V1DB 2YWZA 3BDYL 4GNKB 4TTDC 5BZWB 3TBYA 5FLVA 3BSZH 2EIZB 4W9CC 3VNZA 4J3OH 5JPNC 2E7CA 3HAEG 1FORL 2ESVE 2G2PA 3O6KH 4MQXC 5D72H 4PJEE 1AGBB 2D7NA 1CWVA 4JY4B 3FONB 5IFAH 3MUGA 1VF5C 1N9PA 3FAWA 1H6UA 5DVKA 2FJSA 1MCCA 1EBAA 2R0WH 1U2CA 3D12B 3QEGH 4XCCL 4FQXD 2D9CA 2ZX6A 2EE3A 4L9LC 4HW6A 4KX8A 3SO5A 3PIQB 3CUPA 4TULL 4UT6H 4GSDH 1USQA 1KJVB 5IHZB 5IBLD 3EOTH 3BN9D 3EO1A 3T9WA 1MREH 4K7PY 4X6FA 3K7UA 4Z5RB 4IMLA 3CFIC 2KBGA 2XCMC 4L1SA 4MAYB 3FTVA 4ZQKB 4Z7WB 5MENB 3LQAH 3IAQA 3D85A 1QYGH 4ZTPL 4OLEA 1IBGH 3VVWA 3VXTB 4TTDD 4YXLL 1RUPH 1FH2A 3MJ9L 3SKOB 4LHUD 3V0IA 4E9YA 1IGMH 1JAEA 1U3YA 3BQUB 1A6PA 1NGZB 1YPZF 4K8RL 5T3XD 5FHBL 4EN3D 3RI5K 3MBWA 4NC0B 2FGWH 5BRQA 2QQQA 3TX4A 1S7SA 4NM8L 3KMDA 2Z1PA 2WY3B 3L6FB 4K5NA 4AJ0A 4LKXB 2P5WE 1DJSA 4L1DA 1UWEL 2V5SA 3ULVE 3H3PH 4OI8A 2FQGA 3PL6C 2FYYA 5JXEC 2CGRH 1WRFA 4N8VA 3A4AA 3EHBD 1AGEA 4RMSA 4YOKA 4FNSA 5IBLC 3TYFB 4ENED 5FYKU 1JRHI 2NY0C 4AIZA 3FSZA 4S0SD 4WDIB 4B9KC 5J89A 1F6FB 4J23A 4PWJA 2J43A 5BVJA 3QEQD 1ZSHA 2MOQA 3IXAA 4GUCA 4JRYA 3T3PF 4HV8A 1EEZA 4DGIH 1XBRA 4L9LA 3T5WA 3JYBA 1CFQB 1CXEA 1J0YA 3L7FB 1LMKA 3TASA 3VFVB 2EYSB 2VDKL 5FA3A 4EZLA 1SN5A 2W07B 2ICWB 5EFIB 5D7IA 4UQ2A 4ILDA 5MEOB 3L4ZA 2BDNL 4KZEL 3NIDB 4LLWB 4BUHA 1JNNL 1HI6B 2WLMA 3DTXB 1YEKL 5C0BB 2XBDA 1INDH 2C7UA 2IBZY 3PP4H 5JW4R 2VMJA 3IDYB 1WC7A 2B8OT 2VMDA 4GLRI 4PJBE 4Y19B 4PFEA 1JZ2A 4POZC 5BOPA 2HLFC 4PBXA 1WZLA 5FCSH 5EBLA 3GRBA 5CINL 4AVKA 1VEOA 3GO1H 1MAKA 2ZYRA 4NFBA 3ARWA 1XAKA 2EEAA 1NUFA 4Y2OA 1B2WH 3ZTNH 2RH0A 2WJ7A 4HIHA 3W9EB 6TAAA 1RIHL 4I3SL 4NP4H 4IDLA 1GCFA 4F37K 1CDUA 1OE1A 4H8WC 4OZFG 4FERA 4LLMA 1WUNT 1H5BC 4WJKB 2WCPA 3S9DB 4WJ5A 1U8HA 3VQ2C 3RLSA 1AP2A 2P8MB 4NJAH 2DWXA 1HJCA 5IQ7L 1LO3L 3AADB 4I2XE 1QQDA 4D0CA 4Y2DB 2JKRM 3HAEB 3S36H 3VTAA 2VC2H 4P3DA 3W11C 2NX5B 4P5MA 3Q44A 1S9YB 2CHWA 4TV3A 5FECA 4WFHD 2BIPA 3US1A 5DEFB 2QELA 2WXHA 4XMPL 3IMWA 4Y4KD 5DO2D 4A6YB 2P48B 2QEJA 5D4JA 3B9KD 3DX3A 5F7EL 4CGTA 1L7IH 2XTJB 2QR0B 2XN2A 4FHBD 1U91A 5J3HD 5HP5A 2X1OA 3EO0B 3QH3B 1KG0A 1JGLL 5LHDA 1A3RH 1DSYA 2ZQKA 3CC1A 3LZFL 5AKVA 2XFGB 4C58B 3RJQB 5EC1B 5J4MA 4DKEL 4NN7C 2CXKA 2XZAH 1MJJA 5AW0B 3O6LL 4CAGA 4ODVH 3S3CB 4JFOB 2AAAA 4G6FB 1MDAA 1QUNA 5TH2A 1NLDL 1PYWB 2D31B 2JKIS 3F58H 4S1DC 3EH4B 1Z9OA 2WCGA 2ZWKA 5EFIA 5C0AE 3SDDA 2J72A 2I32A 3EH3B 5FYLD 3RTLA 1XR9B 4Z77B 1AGCA 5KVDH 1HT6A 1SYSB 2BNRD 3DJSA 12E8L 4QTHA 1ZK5A 3BO8A 5FYLE 2Z6FA 2BINA 1L9NA 2GT9A 1OIOA 1XR8B 1TIUA 4NOFA 1JYVA 3EJZD 2BIHA 4MXQD 5E2VL 4PJDF 3VWKD 2EDNA 1TCMA 3G5ZB 4IOSD 2H0JA 2FZ3A 5BO1H 3D4GA 4IOIA 2IGLA 1S3RA 3JT0A 2UZXB 4WIQA 2VIRA 3V0WL 1CURA 3WN5B 1EHXA 1CE1H 2HKHL 4XVJL 2GJ6E 3L95B 5F1IA 5IF0B 4HSAC 3OBAA 1ZRUA 5I1KL 2FL5A 4KXAA 3UDWC 4HD9A 4FHJA 3C8KA 3LSOA 4RFNB 5JIIA 3OLEA 3MNZB 4H8VA 1I7ZB 1ZA3B 1RZKH 5EOQL 1CL7L 5E6IB 4GMTH 1G0DA 2NY5L 4C83A 5A7BA 5FHBH 2WZ6A 4W9ZA 3FCUB 2GC4C 2CRMA 2G0KA 1O6SB 5DSCB 4Z7OB 2JI1A 5JO5B 3GSNB 4LPUA 3QHFH 2H26B 1NEZG 3P2TA 4EPSA 3L3HB 3MRHB 4HJJH 5D6DC 2WQVA 2HFFB 3IGFA 2VRAA 5IW6B 1DCEA 5J6SA 3PQYA 2BNRB 2SEBB 1EEUA 2YD3A 3UJTH 2X4UA 1JK9A 1K72A 1KLGB 2HTLD 3K74B 3NJHA 5GGUB 4OZ4B 1WDAA 3IF1B 3EUUA 4KO5A 1OV8A 3W0WE 4L4VE 2FJGA 4PIBA 5GSRB 5ABZA 1GY2A 4OCSH 2ICEA 4OZHA 2J20A 2F8VA 3I6LE 3L1OH 3SDDD 3FO9A 1NCWL 2LW3A 4OB5H 3C60B 3Q6GH 3ZR5A 3LKOB 4NWUH 5DD5L 4NQUA 1B4RA 2ZOTA 4YNYB 3D48R 4W9JC 2ZCLL 1LO4H 4QDGA 4YSQA 2ADYA 3VB9A 1K8IB 2W9EH 3O4LA 3LXAA 2GY7B 2ARJB 3BH9B 3ARFC 7PCYA 4L3CA 4U6HB 5C0CB 2NX5D 5DWUL 4FMVA 4ZXBA 3FUIA 3B8SA 3WUWB 2JQAA 5K9KB 4R96A 4LNVA 3BT2H 3C60D 2W65B 3SDAD 3H85A 1EJOL 3N3EA 3EH2A 3IT8D 2H32A 2R0ZL 4GQ9L 2FD6H 3VE0B 3NJXA 4MRBA 1UEMA 1F90H 4OR1A 4LEXH 2TAAA 3OZLA 2KT6A 4N3UA 3W0WB 3HS0C 1CDYA 1ZHLB 1DQKA 2Y36L 3SDXA 3TN0C 3ETBF 1OAYH 2VT0A 3I75B 2GITA 3O6KL 4GKOA 1GZPB 4YX2L 1BFOA 2LAAA 5DFWH 4PY8J 4C56A 3T0AA 4H0LC 2RFXA 3BUDA 3MRCA 4EXPX 4LZKA 1BA9A 5CO1A 1AKJB 1A3LL 2EYRB 5I1EH 1MVUA 2WC7A 5KSVA 1A7OL 5EZIL 3EBHA 3BUBA 3G04B 1OP3K 3ZKXB 2J73A 1JGEA 3GSXA 2CDGB 2QTEA 3LKNA 4W9KC 3GBMH 4HT1L 3U4AA 2GBTA 2X3BA 1KBKA 4BFIB 4IGBD 2WWNA 4XNZC 3TTYA 5CEYB 1GYUA 3MRNB 2BP0B 1L3NA 3QQ4B 1UB6A 1TSHA 1J12A 3ARDB 3QUMB 5IIEA 3NCJL 1CF8H 1PLGL 1QYGL 1FNSL 2XKSA 4WO4D 4QRUB 1TFPA 3CFTA 5D9SA 3SBPA 4KZDH 4Z0XB 4KKCD 3F2LA 5C3LD 4I18A 1KCRH 3OJ2C 3LD8C 3VG9B 5F8QC 1CT8A 1NH6A 4F2MA 4X5QA 2V2TB 1R5VA 4N1CA 1JNHB 2HMID 1SY6A 2FGWL 3GSOA 4OT1L 1RFDL 4DSYA 2Y07H 5I6XB 4JM2F 1JPFB 2J4WH 1BF5A 3UTQA 1YY9D 5DC2A 3KAAA 1KB9K 1RPQA 1E6JH 4IRJD 4LBEA 4R2GB 3T8MA 4AH2A 2EADA 1FNEB 4P2RB 4C4UA 3VFWB 2DWYA 4UNTA 2UYLB 4HUMB 2J5LB 3O81A 3RGHA 3MREA 4KKPA 4BDVB 2DM4A 3FTGA 3QO1A 5IFHL 5JOPD 3LTVA 2FECI 1HXYB 5AEAA 2KDGA 3FT3B 5GIRA 3L3IB 3SPIA 4M8QB 4XPHH 3RNQA 4AG4L 1M2OA 5DQJB 3WIFB 4NQED 1KLFA 1QTPA 5IVXB 1G87A 1A6TB 1H3XA 1JPST 1SJMA 3VFRA 3NJMA 2CO4A 5DD3L 3KGSA 3GMLA 2GBAA 2JELL 4R3SB 5GGRA 3BPCA 5FGSA 2CIIB 4R0LB 1FYTE 1DQQA 1HNFA 5E56A 2P5PA 3C6LC 4R3SA 4OAWA 1NGWB 4UILL 3S37L 2KMWA 4X5XA 3FFOA 2XZCL 3ULUH 4QJ4B 1PJ9A 5HVHC 2WXPA 3L3DA 3B2UD 1O5PA 4MDRA 1YECL 3CVHB 4YXHH 3ZKQD 2Y3AA 4ONFL 1TO5A 3S8GB 3GHBH 1XIWC 3VXNA 1AC0A 3LIZH 3MI6A 1KENH 3FMGL 3FAXA 4BUQA 1XMWA 1UKSA 1V3MA 1FNGA 3DGDA 2EH8L 1I7UA 4JHVA 4PMFA 1ADQH 4XMLH 5GRUL 2O6PA 4P46C 1E2WA 3IDNA 4AH2B 3S88H 3QJHB 4FRWA 2YSSB 1NFAA 3T6ZA 4JVWA 3L08A 1R3IH 4F7EB 2AQNA 1A9EA 2F54D 1BMWA 1QO3A 4QXVA 5K93A 3VGBA 3NJIA 4NRXA 3SYQA 5D2NA 1PSKH 4IBLT 2OCJA 4UF7C 3L1EA 1AZBA 1QP1A 3DOIA 1MIMH 4LF3A 3TA3C 1X6NA 2OV0A 4BXSV 5CAYB 2BWIA 1RIVL 5AVWB 1A8ZA 3US9A 4GAGH 3NPSB 3O3DB 4FP8L 2OMYB 4KXCA 1AFVL 1KMGA 3TA4D 3TEYA 5DQDH 4YSCA 1A65A 3BFOA 3D0VA 4S1SL 2PN5A 2Q86B 5I76B 3NZUA 1KEML 1ADQA 1P7HL 1PZDA 5AW9B 3MGOA 5CUSL 4X5PA 2JB6B 3LH2L 4RZKA 4HU8A 4KH2A 2OKMA 2O30A 3KL5A 1M7DB 1DVFC 4OCWL 5CD5D 3L3GB 4ZUUA 1SYVB 4OF7A 4N8CL 4U33A 3LOWA 2EIJB 4RMTA 3E6HB 3RIAK 1H3WM 1MRFH 4R6UA 4ZUUB 4XN2A 1UTDA 3GFUA 3L3OC 1J9CT 2O4EA 4RDBA 3VXMA 5HHXL 2J8UE 1AHWC 2V4LA 3KE0A 3I3DA 4LCCA 1U2HA 1I9JL 5IBTL 1OGSA 4ZX6A 5TGBA 2D3JA 3TU6A 5BMFH 5CP3H 2NYYD 4OJAA 4HS3B 3F7VA 3QI9B 1OB0A 3FT4A 3O2DL 4ZDHA 2B14A 4G8GE 3T2NH 3T4AB 4WI9A 4AQ1A 2XVLA 5D1ZC 3T3ME 4ZFQA 4E41D 4N0UA 2VR5A 5F1NA 4DZ8B 2ZJSH 1KXTB 3FU5A 3LRGA 3L9YA 5JIKA 1KNOB 3DX6A 1F4HA 4HIIA 4AK2A 4OTXH 5I1LB 1IAOB 4MHHG 1OCOB 3IGUA 4ZTEA 2Z3FA 4FQ1H 1TJMA 4A2LA 5IJKA 1G6VK 4UV4L 3T08A 1AIFA 3H56A 4RSYA 2WTRA 4F8QA 2PP7A 4JRYD 3CFUA 1Y07A 1NBYB 5C0DB 4XNAA 2ARJA 3BH9A 4OBSA 3VCLA 2Z0BA 2YFNA 5FUCC 1SJHA 2EUZA 1DBML 3ILPB 3KVDD 3KLSA 2OXHB 1UFGA 4IKIA 3B9EA 5B1KA 3AACA 1FSKC 1N10A 3FCGA 5FDWB 4GW1A 1WISA 4YEEA 3WEMA 5E95B 3H9SA 1VCBC 4XN8A 4JFEB 4WU7B 2EDYA 4XPTH 3UZQA 5DZOA 3QFDA 1KLGA 5GGUA 5FA4A 2SEBA 3WS6C 1UHVA 1F6LL 3NA4A 3B5TA 3E8UH 1RMFH 2PTVA 3U1PA 1KLFB 1YMMA 5EB9A 1CLZL 4W6YB 4OLZH 3HI1A 4Q0XL 5D7LA 5FM8A 4ELKA 1F3JB 5JHDB 2XTJE 4XP5H 3NIFB 5CP7B 5IBUB 4BFKA 1VGEH 2H3XC 4AL8L 5INDA 2AXGB 4HK0B 3UAEA 3GSQB 4AJWA 4Y9BA 4M93C 3VXSB 3SE3A 4D9LH 1BEXA 1O9ZA 4WW2F 3OHMB 5E6IA 4NZTH 2KYIA 3CSPA 1P7QD 4ZD3L 4JZJB 1TOXA 4KVCL 4APQB 2R56L 4FEMA 1GSMA 1NAML 4MYWB 3FRUB 1JZIA 1SEBA 2L0DA 3HE6D 4PRHE 1H9DA 4NP9A 4P5TC 3IMBA 1D5XB 4KI5F 3V6ZA 1UCBL 4PLNC 3S88L 1D6EA 5FUZL 3ARGD 3OB0K 3IGAA 1MFUA 1HNYA 1HNGA 1KIPB 1T6WA 2IANB 1MIEH 5BJTA 4JM2A 4AK1A 5CEZL 1SEQH 1TEGA 4G8IA 1JYNA 3UGUA 5D93B 5T1LB 4HLJA 3D85D 1YEFL 1KCLA 3A6OA 4AQOA 3KYKH 4KMTH 1I7RB 3I02A 1E43A 1DBJH 2AXFB 2G3MA 2KHAA 2F8OA 1I1RA 3TIEB 4A39A 1KJMB 2XTJC 1CVSC 2CJUL 3JVFC 2OYLA 3ZKMD 1IAKA 2WOYA 2FQDA 3B2UC 3CWGA 5T8IA 5CJXC 1SRDA 2H3NB 1AHWA 3NCYP 5F7WC 1E42A 4JFOA 1JUFB 2DTMH 2HZHA 1UWGL 2JJVA 3GKWH 5B3JE 4JANB 4F7TB 2YARA 4N0FB 1HCVA 1B0RB 3MAWA 1LQBC 3GDBA 3ZKSD 4G42B 2DBJA 5HDBB 3U7AA 1EFXA 4DGWC 4TPRL 1AKJA 1WE5A 3MQIA 5SX5H 3RL1B 4AMKL 3P0VH 3WIHL 1UXSB 2XN0A 1RK0B 3KPRE 1J1OL 1BOYA 3K6OA 2QVMA 1YEDB 5IEKB 3K81A 4Y1TA 2AXHA 3S6CA 3NTCL 1PZSA 2X4NA 4ZK8A 2F74B 4HUVA 3JWDC 4ZXBD 3MROB 1UM6L 4P3CH 1XO8A 5IBTH 1E6OL 2G5RA 4A7SA 2PP9A 5BMFL 4FZ8L 3QJFB 4R7DB 3AWGA 4P5KB 4Y4FB 2OQJB 2BS9A 5IJDC 5DJ2B 3ARSA 4GS7C 1RZJL 4QHMA 5I0XA 2BXZA 1MPAL 1XHHA 3FF7A 1DL7H 4HIHB 3JWNH 2Q9OA 4DP9X 2DL9A 2NXYD 3X1NA 1P4UA 4XAWH 4XH2A 3K71A 1WSST 1U93A 1U42A 1KPUA 1IL1A 2EXTA 5C07E 3TOPA 2B2XL 5T5NG 2FNBA 1TKWA 1OAXL 5J11B 4XB7A 3I84A 2IGFL 3TFKC 1LE9A 1S7VA 3G5YB 3P4LA 5F3HB 3DX7B 3RX9A 2QDWA 3TA3A 4XWGL 4U1JA 4FQHB 2JVUA 4WF7A 2VITA 5DJ8A 1C5BH 2DLGA 1KPVA 4QCIB 2ZYIA 4XPBH 2FJHB 3L3GA 4MVBD 2ZCHL 1OAQL 2Z91A 1OCZB 2OL3B 3GRWL 4ADJA 4ELMA 2ZUYA 4K7FA 4GSUA 1JOIA 5LNDA 4EI6A 2X6UA 5CZRA 1LDPL 4CL7A 1PIGA 3UTTA 4LHUB 4UT6L 3FB6A 3T0XA 5ID1B 4ATTA 1U3HA 1WK0A 3MLVL 3SY0A 3UPAA 2FB4H 4ZI8A 1O0VA 4GKSA 2VMCA 2WIIA 3FQNB 1NAKH 2MCPH 3GM0A 1JPEA 3S48A 3M17A 2IOOA 4GRLB 3U48A 1NCAH 4HUUB 4I0PD 4HOMA 3SYOA 4P59H 2Q5BA 5TE6L 3VMOA 2ZCKL 4PRIA 4YK4B 3L48A 4IRSC 4E41A 4A66A 1N70A 1NFDA 1UOKA 2F7OA 2NY5C 3WIIH 4FULA 3DC0A 1BAFL 3EYVA 2PMZA 4QY8A 3MROA 5IT2L 2ZNWA 1M3JA 3MV8E 2CK0L 2YGQA 2ZKXA 5C0EB 1FLRH 1W0YT 1NLBL 1TQVA 3IJ7A 5HJ3B 3PAZA 4L3FA 2Z7YA 3U2SA 3VRLE 3WNKA 2YSSA 1XGQA 4OZIE 4MQSB 2W95A 2F58L 4MQTB 3UDWA 3WN5C 3QJVB 1MCEA