3VD0A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
202
Chain Sequence
HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
total genus 37
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd0A00
3IGLA 5G4OA 2BIQA 3WTWA 5AOLA 3D08A 3WTXA 2OCJA 2J6WA 3Q01A 1CMOA 1H9DA 2BIPA 1EANA 2XWCA 4LOEA 2J1XA 1KZYA 2AC0A 3Q06A 4AGOA 4HJEA 5AOKA 1LJMA 2XWRA 5G4MA 2J1WA 2WGXA 4L0YA 3EXJA 1EAQA 1T4WA 2X0UA 2FEJA 4L18A 4IBWA 2YBGA 4GUOA 3WTYA 5AOIA 1IO4C 3KZ8A 4AGQA 3ZMEA 1TUPA 5AB9A 2AHIA 3WU1A 3EXLA 1CO1A 2X0VA 4G83A 4GUQA 4IJTA 4AGNA 2RMNA 2P52A 3TS8A 2IOIA 5A7BA 4IBSA 4G82A 2PCXA 4AGPA 3WTUA 2BINA 2J20A 4MZIA 2J1ZA 2H1LM 3WTVA 1HJBC 3WTTA 1HJCA 4QO1B 3QYMA 3US0A 1EAOA 4IBYA 3D05A 3D07A 4IBQA 2BIMA 5AOJA 4MZRA 1UOLA 2BIOA 4AGLA 3VD0A 3D0AA 3WTSA 1GZHA 4LOFA 4L0ZA 3D09A 4IBUA 5G4NA 4IBVA 2VUKA 4A63A 4KVPA 1TSRA 4AGMA 3VD1A 2IOMA 3D06A 5ABAA 5AOMA 2ADYA 2IOOA 4IBZA 1E50A 3IGKA 5LAPA 2J21A 3KMDA 3VD2A 3US1A 4XR8C 2ATAA 5ECGA 1HU8A 4IBTA 1YCSA 5KBDA 2MEJB 5BUAA 2X0WA 4LO9A 3QYNA 3Q05A 2GEQA 5LGYA 2J1YA 1GZHC
chains in the Genus database with same CATH superfamily
4HGWB 1TU2B 1BBDL 1ZHLA 1M6UA 3KM1A 1KBPA 2I7OA 4KHTH 2WXIA 5GZOD 3QQDA 1IQWL 3M1OA 5EO0B 5EG6C 1SJEA 2P5WA 3WIAA 1S78C 3SGEH 2YXFA 5GGVL 1K2DB 3DLQR 3MV7D 3O41B 1MZZA 4F33B 4Q97A 4LSQH 2E27L 3QRGH 3N9GH 4N87A 4Y4FC 3WFZA 2ZE0A 4UDTB 5I74B 3F12A 3L9EA 5B7MA 1GOHA 4DO4A 4KXCA 1K8DB 4CW1B 3T0EC 1W6WA 1NCWH 4DSYA 1P1ZA 4R7NA 3T6WA 2FEJA 1ZMYA 4AZ8B 2I60L 4LOVA 3P3TA 2OMBA 4OH2A 43CAB 4B9GA 2XVKA 3NRQA 4XTRC 4YXKH 3QDJA 3L2NA 2FJUB 5DZNA 5HI4D 4HS8H 2LW3A 1S8DA 5IOPA 1SPDA 4NQCA 2F9BT 2B9BA 4NJAL 3RZCC 2F19L 3GMMB 3TTSA 4ZXBA 1IARB 2AGJL 3G6AA 3WMQA 3JTBA 1TEGA 4U31A 1TQVA 4GRLA 3KYKH 2VDQH 2WQWA 3SDDB 1TTCA 4B95C 3FOLB 4GEJA 5H94B 3L9YA 3S97C 5DRWB 4N0UE 5KBNC 2V2TA 5EZIH 2GTQA 4K55A 1DBML 1DQJB 2CIKB 1AGDB 4GS7B 2IQAA 5FOBB 1DLFH 1E6JL 5EZLB 5BVJB 1ZVSB 1EO8H 4BM7A 3A67L 2Z31C 3QFJE 4JLRB 3VXPB 3ZKSD 4MMZB 2R4SL 1KPRB 3CFQA 3QUYA 4LFHG 1P2CA 1VF5C 4OLYH 2PCFA 4CDGC 2WLYA 2P5EA 4NQDB 4RH4A 5IQ9B 4A6YA 1J8HD 2DWEB 1IZJA 4UAHA 2YWYA 3OJMB 4U3HA 5JXAH 1ZJBA 1MWAH 2GUYA 4MDJB 5C6TL 1KFAH 3UYPB 2EC9U 3ROLB 4Y9CA 2A99A 1A6ZA 3FCGA 5DJ2A 5K9OB 1QBAA 2EXYD 3F05A 4HUXA 4MCZA 4PJ7E 5DUPH 2F7QA 4JG9A 5TTRA 2AAAA 3INOA 3WFDL 4WV1C 5IR1A 5JZ7C 1NM9A 2XYCA 4JJOA 4XNQB 4KKLC 3OKDB 1R9FA 3VFGL 4Z7WF 1P69B 5DQDH 3WE6B 4XPFL 5ES4B 4IK7A 4ICXA 4TL5A 2QQKH 4Z7NE 3GIVA 4XRCA 3VJ6A 5DT1L 4C56B 4YXHL 3DYPA 2JKRM 1CQKA 3NVQA 1KG0A 1HZLA 3OR6B 4CJ1A 4A7QA 4DN3L 1VDGA 2P24B 3GBEA 4F9LC 5BV7L 2OJEA 4M3JA 4HK3J 1IAIH 3MNWB 4MX7A 4MZ3A 2AFNA 2VXQH 1PPIA 1WFNA 1OP5K 1K8IB 3F3HA 5AW9B 1DVSA 1ZPLA 4LOEA 4MD0B 1WFIA 4AVHA 5IUCA 3NZUA 4WW2A 2F1AA 1EZSA 1BF8A 4JM2C 4OCXH 1BFSA 3PGDB 1DZ0A 4PJAE 5D72L 1CE6A 1DBBL 2ARJB 2DYPD 3OAZH 4HJJH 4IHBA 2AJYL 2Q87A 3AREC 3N43B 1NGZB 4FI7A 4OGZA 2QELA 1FAKT 5M94B 1JGDB 2WXFA 3CC1A 3BCFA 1WZMA 4GSXA 4PJ9C 5C07E 5EHFA 2VM3A 4X6DE 4QRBA 5AW2B 4EBQL 4KJPC 1PG7L 1EEQA 2V4LA 4YHKH 1F0LA 4PJCA 1MELA 1WSST 1NJ9B 1E8XA 1BAWA 3QFGA 4LLMB 1W72B 3VACA 2QBWA 4UM8A 2CR6A 1LO3H 2B0SH 4B41A 4G82A 1HH9B 2LOEA 2FNBA 4PRPD 4H8WH 3T3PE 4M5ZL 3UACA 1YMMD 2W88A 2YXVA 5E6IB 3QT2A 5FYKL 4S1QH 2GI0A 1JRHL 3AUVA 1YDPB 4HD9A 1ZLVK 1U3ZA 4ZO6A 3OR7A 5AYQA 1Z2KA 3US9A 4HG4J 4EI5B 2JCCA 3ZKNC 4FQIL 1SLUA 3KBFA 4XWGH 2E46A 1IJ9A 1ACCA 2ZOLB 4LCIH 1X5JA 1FN4A 3VCLA 3TESA 5I5MA 4UDUB 4L4TA 3TBWA 5F7MC 5BRZB 4B3VA 4WI3A 2XV6B 4IRZA 5DDHA 3V4PA 4JCWA 1JV2A 2AKRB 4LVHB 5CCKH 1BQ5A 4I3RH 3VGFA 1JGLH 2JJWA 1T1ZA 5L4IA 3UP6A 5ABDE 2X4RA 3E80A 3N40F 4OLZL 4TKWA 5IT2L 2VMFA 3BPOB 3VD2A 5I8EB 3GS0A 5BOJA 4RBPK 1UXWB 2E7HA 4JAMB 3VI3A 3ILEA 1I9JH 5GRYA 1J1PL 5HI3C 5DR5L 5D8JH 2AEIT 1H6TA 2X0WA 4ENED 1CK0H 3TBSB 1C16B 3QFDA 3H9SD 5EOQL 1KB5B 2A74B 4L8CB 1E28B 4GO6B 1CLVA 1JZDC 1CYWA 1JNHB 4M4PA 1CFTB 3CE1A 4TV3A 3WTXA 2ZXGA 1TQCC 2ADGB 3U4EA 2WLNA 3VGAB 1LQBC 1T89A 5HI5D 1UM6H 4KI5F 1RL1A 3PWPA 1D5BB 3QAZB 2X38A 4QOKD 1VEOA 5SWQA 1DBJL 3FCTB 1MCOH 3RURA 2MPVA 3RVVD 1J0KA 1J8HA 2GITB 2O5XH 2XPZA 3IJ9A 3OZKA 3ZY7A 2AC0A 5CF3A 3D3VE 4AGOA 3AG4B 1PMYA 4Y2LA 3S35X 2NNFA 2DQCL 4JQIA 1WBYA 4PRBA 5E7BA 2OJZL 1KGXA 3CK0L 4PB0H 4ZNCD 3RKPA 5CGMA 3HI5H 4JFZL 4G9FD 2XFXA 3L81A 2D0HA 4P4KC 2VR8A 1QEWA 2JKXA 1QZ1A 4AMKL 1CR9L 1R1CA 4JFYA 2O61A 3PYCA 1QQDB 1J05B 2XZAH 3QUZC 4MA1B 1U8OA 2WZ5A 1NMAH 4U4BA 1A9EB 2OQJB 1VZIA 3JWDC 1OSEA 2PW2B 1PZ5A 2G60L 3BUYB 5E6SB 4FAAB 1PGRB 4ZMTA 1UZGA 3CBRA 3SYCA 3HLAB 5G5DB 4GO9A 4ABVA 3DIDA 1Q0EA 4DPAX 1IZKA 4ZJ9A 3N0PB 1E6OL 4KNQA 4AOFA 5HDBE 1U8KA 4TLSA 2QZ5A 3IFOA 1JE6A 4B9FA 4A2FA 4GSUA 1HJBC 1EHAA 3PAZA 3N1GC 4S1DD 3H2QA 3DIFB 3T1WA 2NMSA 3QYMA 2GEEA 4F57H 4IBYA 2J72A 5F1IB 1DVUA 3UBXB 2E74C 5TF0A 4ZXBC 3TO2A 3OC5A 3LPPA 4QTIL 2VXUH 4YLQT 4BH7B 4I48A 5E6RB 3VGHA 3E9UA 5AAWC 3GZOA 3IDNA 5CGTA 2C9QA 3VMPA 4WO0A 4ONGH 1GZPB 4PMFA 5I1IL 3SHSA 1AGEA 2XZCL 3PJSB 4WK2B 5LAPA 5B7EA 3D0VA 3CZJA 3AXLB 4CKQA 3B3IA 3LNFA 4PTTB 3TOPA 1ZRUA 3FFDB 3BWZA 4JKLA 2OSLA 1RK7A 1SEQL 2OXGB 5ALBH 4UQBA 1XMWA 5IJDC 1HNGA 5DTFB 1NBCA 1CFVH 2DYSB 2N3JA 1CU4H 3A6OA 5KYUA 3AFLA 4N25A 1S7RB 3Q01A 4F7TB 1OTUC 1CMOA 4Z77A 5DVMA 4MQTB 3BZDA 1ZDSA 4KROB 1UJ3A 4JRWA 1FNFA 4Z7UA 5E4EB 3CIAA 1AXTH 1BD2D 3U0WL 1GGIL 3EOYG 2QV2A 3TCLB 3IF1B 1FP5A 2XWRA 3ARGB 1X7TA 1BOGA 2ZICA 1KB5L 1OGAA 4GW5B 2X70B 1H8NA 2VR9A 5F0LB 5C3TA 1D7CA 1GR7A 2WTOA 4BCXA 1BECA 2ESVD 4M43L 3WHXA 1UACL 1HWGB 1JK8B 4XCEA 1J18A 1HHGB 1G1CA 3MUGB 2KERA 4NUPA 5E2UL 3U6RB 3LMJH 4GO8A 2YSSB 1D5IL 3T0AA 3V6ZA 3SKMB 2X4PB 3C75A 4R5TA 2LU4A 1YEKL 1PKOA 1OTSC 1AZBA 1H5BA 4AYEC 5IK3B 1ESOA 3H9SA 2AHIA 2WW8A 3BH9B 4WW2C 2R69H 5I75C 5AAMA 3LH2H 4YVNA 3FTGA 1N67A 3NIFB 3T71A 1S9WA 2Y1AA 3AXIA 2J8UB 1HOCA 1RMFL 1YUKB 5C0BB 4CADA 1YEIL 3PPEA 5GGVY 3RWJB 1X9RA 4YSRA 3B2VH 3PDDA 1RJLA 2KPNA 1NMCB 2FATL 3BKYL 4BZ1L 3JTTB 3R8QA 2XTJB 4ZBJA 2CUAA 4U6YB 3DJSA 1HFUA 1JGEB 3ZKMC 3QEHA 1D9KD 4X9HA 3Q3GA 4M1CD 4OIFA 2FECI 3VTTA 4KO9A 3QC6X 1DVXA 4X8GA 3TEXA 3I2CH 1OK8A 2CD0A 1D5RA 1PZAA 3L45A 3KLSA 2VXVH 3W38A 3VD0A 4EN3A 1NIEA 4FZ8L 4HOXA 5DFVD 2IFFH 2LU5A 2R56L 1U95B 4U1GC 3J8F7 1J87A 1T2QH 3L7FA 4FNLL 1DUYA 1A4JA 3C5SB 1VKXA 4NKQB 4FFYA 4G8FB 1CFQA 3U25A 5L8LB 4LASH 3VW3H 2EVJA 1QR1B 1VFBA 5I16B 1EIBA 1MJ7L 3FRPG 3U79A 3GBML 3B2UD 2DLFL 3NEXA 5KSBB 1OE1A 3N06B 3P30H 4MB4A 4PS4L 3SDCB 1RV6X 2CPCA 2MQCA 1IJNA 2W07B 2Y06L 4V1DE 5F7LB 2UY7A 5D2LB 3T77B 5F7AA 2XG4A 4B3EA 5KYNA 5DS8A 1JD7A 1JPGB 1HXMA 3CPLA 4DP8X 4NNXB 3R19A 3SGEI 3D08A 3ZTEA 5C0JB 2F5BH 1X5YA 3MREB 2FJFB 3TYGH 2QFRA 3QRGL 4MA7L 1N6VA 2JF1A 4PQXA 4HG4K 2W95A 4WO4D 4XAWH 35C8L 5H35A 2DLTA 4W9CC 2FBRA 5BUPA 1II4E 3L3GB 1NC4D 1LP9A 3U9PH 4X0KB 5F3BB 2MTAA 5BPPA 1JSYA 2GG1A 3VI4F 1UOKA 4X4ZA 4Q9BA 1JNLH 4M48H 2BSRB 2VLJE 4ATWA 4PRID 5BZZA 4CVUA 1TG8A 3MLUH 2E7LA 2UXFA 3I6GB 2MQGA 3G04A 3KLHD 5DYFA 1NINA 1Q72H 1QYGL 1T89C 2P8LA 1YLBB 5EU6A 2I24N 4APXB 4PV8A 3AXHA 1KELH 1DANU 1IL1B 3NJGA 4LGRB 3DHMA 3JVFC 3RG1C 3UTOA 5LVEA 4HWBH 3GD1C 1NCBH 2Y9RT 2NXYC 4U3SB 4YDZA 4YHOH 5GRVL 4FTVE 4JFDB 2FO4B 5EZIL 1TQBB 3GMOB 4OFDA 3S36H 1ZGLM 4N2CA 4JPSA 1A7NH 3OLGA 5EC1A 4GFTB 2ADFL 1DLFL 2ZCHH 4OZGA 2VLME 1NFKA 1KZQA 2PXYB 2BNQD 2K8MA 2R9HC 5IF0B 1PDKA 4L1HA 3Q8CA 1CCZA 3QWOB 4MJ6A 4OLYL 4A7UA 5DHYA 4F8QA 4I3SL 1FGVH 1N19A 1OE2A 1IBGL 4D7BA 3GSNB 1QP1A 3SDAA 2G2PA 2V3FA 1FAIH 1MWAL 5ADOH 1BQRA 3QDMB 2L4OA 3DSFH 3K72B 4BUHA 3HN8A 5PCYA 3P9MA 5DWPA 1TZHA 2G9KA 3SIKA 1I4FB 1GW0A 2XN2A 1MH5B 1TVBA 2WZ6A 3LXAA 4RGNE 3WUWA 4Q0XL 4M8RA 3OC8A 3MRLB 4EDWH 3RNKA 3BGFC 1U93A 3FQTA 3GF8A 3ILPA 3MBEA 1GC1H 5I18L 2IH3A 2QQKL 1GIGH 3NIGF 3OQRA 3VYNA 2QTVA 1TTGA 2F68X 2J44A 4U0RC 3GPEA 1FO0H 2Y0SA 2PABA 2UY6B 1B4LA 3ZT6A 4JQXC 4O2CA 2GK2A 2R1WA 1K9TA 4C59B 4LBAA 4PGEB 5FDWB 4YDKL 4NJ9L 1IAII 1LEGB 2WSKA 2BCKA 2I9TA 2D8KA 2SEBA 2XKSA 3FH7A 4P5SA 5EUOF 4EIBA 3DVGA 1XCTB 2FQDA 4LSSH 5HGAA 2XQBH 1WA0X 1C1EH 4BE6A 5HGBA 5ID0A 1G7QB 4MJIA 3ELAT 1WCBA 2PCYA 3EGSB 3G08A 4X6CE 3RYMA 4C55A 3N85H 5KSAB 4W6WB 3EH2A 4HMDA 2OMYB 5K5YA 4AXWB 2WVTA 1KLUA 1UUSA 1E5ZA 1LJMA 6FABH 2ZKWA 5KVGH 4K5NA 3APDA 2C4FT 1LWJA 5JPNA 3TASA 2HH0L 3MJ9L 4PV9A 4F7EA 4ANUA 2HT4D 1QEXA 1HXYB 7FABL 5IMKB 2J88L 1WH0A 4CRPA 1I3GH 4YHKL 1XCQA 2EAEA 4WI0A 1UB5A 4MAYD 4ODUA 3V6BR 4AIOA 1AO7B 1VGKA 4WVRA 4LSPL 2P45B 3SY0B 4PJXB 4FA7B 2JB5H 4O4YH 2VZVA 5DJCA 4Y19E 1LO3L 1AS6A 2R39A 4OLXH 3U6XA 4NZ8A 2DD8H 4KMTL 2GSIA 2ATKA 4OD2A 3X13A 3QDAA 1TSHA 4QHLA 1LTXA 3HAEH 4R26H 4NRZB 3OTTA 1B2YA 3FU7B 4JKPL 3PNWA 4YBLC 3MJ7B 4XWGL 2VIRB 3GRBA 3V6OC 1A3QA 3KDPB 4LCIL 4PY7A 2H0EA 2QPUA 5I1GH 4TRPH 2Y2TA 3D07A 1U3HB 3NJFA 1H5BC 1CF8H 3KBPA 1T0MB 3FBKA 1YYLH 4XNUH 3LIZL 4YDMA 3QNXA 1AHMA 3QCTL 4KRMB 1H15B 1U2CA 2YD2A 1ACYH 1RH8A 4PJIF 1JZEA 2YZ8A 5TQ2L 4NPKA 1C5BL 4F3FA 4GFXA 3SCMD 3TF4A 1I7UB 4XMKH 4AVKA 2XWTB 4QRPA 5D6DA 3FCUB 2V8LA 3NRFA 2IDTA 3TFKC 5I8OL 3VFPA 3C6SA 1CK0L 2VSCA 3BEVA 3EFDH 4HJGA 3LH8A 4AYFB 1C08B 4PJBF 2J4WH 5AL8A 2R0WH 1BLNB 2VTFA 3GSNL 4I18A 2J5LC 1MIEL 3GXIA 3RE0A 5HHMB 3MCKA 4KQ4H 1E4XH 5E94A 2I5YH 2BNQA 3CZUB 2ITDA 3DI2B 3QIWB 1ZSDB 4MQ7B 4EF3A 2FR4A 2F8OA 1DTUA 4TQHA 1MCOL 3TJHD 5K9QI 2YHGA 1U6AH 3BDXA 3CC5A 2HCZX 3LQZA 3D39B 3VXMD 1BGXH 1PF3A 2JLLA 5I8CA 2B4CC 1IC0A 2B5IB 3WKML 3ZHFA 4L9LB 5E6UB 4BHUI 4TNWK 1QRNE 4BH8A 3CZFB 5AALA 2MNUA 4HKBA 5C0IA 4WCYH 5L6YH 2RAMA 2VM9A 4PJGA 3QJHA 4FFVC 2NNAB 5I6OA 3QCUL 4PTUA 4IHOA 4JG1L 4XH2A 4AW4A 4G11A 5GGQL 4KY1H 4Q56A 1HHJB 1BAGA 3DX7B 3S3DB 5CEZE 3MUZ1 1I1AA 1NBVL 2C9PA 4TUJB 3BZFB 4G6AC 1D6VH 2MH4A 4NZRH 4YEEA 3SBWC 1EAPA 5JQ6H 4BBWA 2ZG2A 4HOWA 3O11B 5E2WH 2A77H 4LLYA 2AXFB 1A1OB 4H8VA 5KVGE 4EUPB 4R4BA 4DN4H 1UWGL 5DU7A 5BQ7A 3H3KA 4X6FB 1JZJA 1ORSB 4JFEE 5L9DL 1GCYA 5B1CA 2HJKB 2EP6A 2RFXB 2V9RA 3WXWH 4GAJH 1LEKB 1YYMH 4YZFF 5JPMB 2QLYA 1QSFD 4GNKB 4OD1H 3TX4A 2PYEE 3ZDZF 1E4KA 3PXJA 3T2NL 5KYXA 1FNAA 3LZNA 5IB3A 2OAAA 2Y7MA 3ELQA 1A7RL 4PHZA 1A21A 4HWZA 4L2LA 4NT6A 1MCPH 4RZKA 1WWCA 1GYWA 4PGCA 3QWRD 5FYJH 3CMOL 4NM4L 3NCYP 2ALAA 1DLHA 1NPNA 4ZOCA 3HUJF 4JPIA 4IMKA 4Y16A 2KH2B 4FCAA 4K0OA 4ONGL 1YEGL 1JD9A 1OW0C 1CURA 2HPOA 4GKSB 2FJGB 4LLWB 1L9NA 1BZ7A 2EIBA 3AT0A 5DZPA 2C5DC 5I1AA 2WXOA 3GRWH 5FF6A 4HP5A 3RWIA 2VRKA 2PMZA 2EDOA 2XWXA 1EXUB 4MBRA 4EZLA 4UQ2B 3Q6FA 2VR5A 3HE7C 5FGCE 1ASPA 5ELIA 1XF4A 2NTFB 1SFHA 2X1QA 3QAQA 2D3NA 3HCVA 1HKLL 1GS8A 1S78D 4BZYA 1UCTA 1UURA 3GKZA 3N1QC 1M2VB 3S35L 3HHRB 5JLZB 3UMNA 5AW7B 3WFHA 1SFDA 2I25N 1UUNA 3VSVA 3WS6A 4IMLB 5C0CD 1I1FB 3ARDA 2P5WB 3RHWF 3IGLA 5C7ZA 3RTQC 1TCRA 3VH8A 4ENZA 3MLPA 3T0ED 3MXWL 4GAAA 1IKFH 4ZI8A 2J6WA 3U2JA 4ZS6C 3DROA 1LO4H 1O7DE 3FAXA 1H3PL 5GZNC 2ERJC 2EDXA 2MNWA 2B15A 2ZWZA 2J1XA 4QGTA 1P1ZB 3KL5A 2VZOA 5D2NE 2Q3AA 4R7NB 5FGRA 3W5NA 3Q9PA 3UZEA 4JL2A 3IJ7A 4XMPL 3AROA 3RZCD 4XNYH 3QEQA 4S11A 3T8MA 4GXVH 1A7BA 2QKSA 4K07A 1NGYA 5DD0H 2UX7A 1FDLL 4JRXB 5FV1L 3WGVB 1GTFA 4KV5E 3A5VA 3FRUA 5IOPB 4NQCB 1EEZB 1INQB 4Z7VF 1MAKA 4L4VE 3G6AB 5AOIA 2DQJH 3QA3A 3ARPA 3RWHA 5I1EH 2VRAA 5HGGS 6PCYA 2PPAA 4HT1L 2X4QA 3MV11 2J1KA 4U1IA 2ZF8A 3FB6A 1KYFA 4PYHA 2QQLL 3ZIMA 4XOBA 1W0YT 5C0AD 2V2TB 4UT6H 3DUUB 2Z31D 5GRVK 2NUPA 5IESL 3MQIA 1A7OH 3KS0H 4R0LB 5EO1A 5DHXB 1A3RH 4LPUA 1NA8A 2IQAB 2P7TA 4WUUA 1XD1A 1F4YH 2D73A 5HPMA 1CE1L 1PS3A 1MIML 1ZPUA 4U4IA 1P2CB 1YSOA 1EGJA 1X3DA 2VXVL 2OTWA 1RK1A 5A2LH 2P5EB 1ZVNA 3KL0A 1MQKH 1U3YA 4FADA 3QXDA 5HY9A 3Q7JA 5JZ7D 4FCHA 5D5MF 5EU3A 1UT2A 1KCVL 3IXAA 4JFPA 4KKLD 2OMTB 1AR1B 3QJTB 1H3GA 4AT6A 5DJ2B 4ZTEA 3VW3L 2GJRA 5F7NC 1LO5B 2E6PA 2V7NB 3FH8A 2I85A 2YEQA 4MCZB 4M8QA 1V7NH 4X9IA 3ESNA 4NP4L 5IR1B 1ZA3A 1T80A 3K80A 1J12A 3P30L 3PHOB 1HAWA 4JY5L 1J11A 2APWA 4KKBC 3TC9A 9PCYA 5FYJE 1PZUB 2APBA 3MLZH 2E86A 1A7PL 1WD9A 1QUNB 4BEIA 1XO8A 1K85A 5D7LA 5I1KH 3NFPA 2HRGA 2BLFA 2CR0A 4M5TA 4IBTA 2IGLA 5I1JH 3MLTA 4JRLA 5DD1L 1JN6B 4JM2D 4NFBA 1JTPA 4XAWL 2OJEB 4W4OC 1RZFH 4U7KA 3P11H 3VFNA 5FHBH 3DSNA 3V0AC 3O8XC 4TSBH 3QJFA 3U9PL 4PJHE 3VNYA 1S7QA 3K46A 3IMBA 1GTNA 3NGBB 1UJTA 3ARED 1JNLL 3P1VA 1KCSL 4PJDE 1S4IA 5KVDH 5E5LA 4KFMA 1H6FA 2VW4A 2Z0UA 3VQ1C 5D4HA 1F42A 3JV4A 3D51A 1YVLA 4KY2A 4RIRB 3VXSA 1XGQA 5B1KA 1BQUA 4PJ9D 1KN4L 3OAZK 4AM0B 5F9JB 3NJVA 5I0ZA 5AW3B 3GHEH 5GJSH 2KC0A 2V0AA 2H6PB 4I18C 2CK2A 4G8GA 3C2SA 1QFWM 1KXVA 1M42A 1Q72L 3FSAA 3B3BA 1A6AB 1T3FA 2ITFA 4YHOL 2WCSA 2QDWA 5I71B 1MG3C 2NY2C 1DSWA 3QIUC 4PJCB 1J5HA 1V8HA 4U1MA 3ET9F 4N3TA 3CHSA 2G0LA 3FUHA 2EJ1A 2DI9A 4XBEL 1Q90A 4H7VA 4TTDD 4LVNB 1DEEA 4UM8B 3OG4B 1Q4NX 5CEYB 4AW7A 4DPRA 5HD8C 3WNPA 3MV7B 2Y4SA 3F64A 5DRXB 1SY6L 3ERXA 4GG8A 3GMNB 1PQZA 2MWCA 1TEYA 4WWOA 4HXBL 4FG6C 3KLAA 2B16A 3W57A 1D5ZA 5KSVA 5EB9A 1KXQA 2ITCA 2JCCB 5ADOL 4AY0A 1JZHA 2OMVA 2BRQA 1NPUA 3DSFL 1IC7L 4XP4H 1EAOA 1FN4B 3VCLB 4X7SH 3WO3B 4WFEE 2OW6A 4OZHE 3SGKC 3SE9L 1B6DA 2VLKD 2AEOA 5DDHB 2FT6A 5EWIL 5F96L 2JJSC 1JV2B 3IDIA 3V4PB 4CNIA 3TN0A 2ICEA 4EDWL 4WUKH 4N5ED 2DBLH 5HI3D 2X4RB 3FO9A 4RMQA 1NCAL 1OWRM 4M7JL 4XXCA 1FO0L 3RIAK 5MENA 4ELKB 1E4KC 3PWLA 1KMGA 1BZ9B 2BFVL 4OGYL 1ZIBA 3WIHH 1SXAA 3UJTL 1I9RL 3TIDA 4MNQD 3QPXL 3NAAL 2C9UA 3VFOA 3UO8B 5K9QG 2EVFA 5DF0A 4Z3TA 1G4MA 1T03L 1NIDA 3N42B 4OR1A 2XQBL 5H2BA 2XQYA 4YC2B 3U4EB 1SMAA 5FECA 2WXMA 3IE4A 2YN3A 3L54A 1A4BA 4GT0A 4PI2A 4Q6IC 1I1RA 1MQ8A 2MKWA 4R8WL 5GJTH 5ADPL 1XSKA 2Z91B 2XNAA 1J8HB 1XF1A 3DX6A 2OI9C 1JI1A 4HFWA 2RH0A 2NDGA 2EXSA 1H3WM 3F7YA 3TNMB 5MI0B 2ZYSA 2O6PA 2FWOB 1UEMA 3ATEA 4MFHA 4Y88A 5IKCA 3MV8D 3QUZD 3V5HA 1BX2A 3AB0C 3BUBA 3H6JA 3ARFA 4IRJA 3IU3B 4LKCA 4XP5H 2XFXB 2AABL 1BQHG 4K73A 3BFQG 1VGEL 5IJKA 5ACZA 5ISZD 5KVDE 3NZSA 3QJQB 3N55A 5IVOA 1U8OB 4FQXA 1OAKH 2CQVA 2L3BA 5HTSA 1DQDH 5BS0A 2PPFA 1YPZF 2DQTH 5HHPA 1PZ5B 1ZLWH 2BMKB 1FL6B 3FTVA 2CCLA 4YSQA 4OLXL 2YKLH 4JDTH 4U1LA 3QI9A 3E6FA 4AGQA 4F80A 1ID2A 1B4JH 2ZP0T 4NDMA 2O6EA 4WGKA 5DI8B 5GS0C 1G7IB 4MCYA 1FFNB 1U8KB 2PR4H 2IQ9L 3Q2NA 4LIQL 4N6RA 4R26L 5DHVA 4QHNA 3UZEC 1E3XA 3IMUA 4A38A 2B1OA 1NFDB 4ANXA 1I3RB 1U8LA 5I1GL 4TRPL 1PFOA 1PW3A 1IEAA 3OD3A 1Y6MR 3T1FB 2BJML 3WTVA 3FONA 4XODA 1IC5L 2ID5A 2NQDA 1GYVA 3NPSC 1XGRA 3TO2B 5IEKA 2QZQA 3LN4A 4OGQC 5HYSG 4ACTA 4EZKA 3FF7A 4GSRA 1ACYL 4I48B 1DVFA 4JFOA 4R2GD 5EU5B 3ZKXB 1AGBA 5DLML 4Y89A 5G2NA 3RKDC 3IDNB 3VM5A 2ZCKH 1HS6A 4XC3L 2UZXA 4FFTA 4QRRE 2HVJA 5LGHL 4GRMB 1IVTA 1YQ2A 2ED8A 5IBTH 1FZOA 3RFZA 2PETA 3V4UH 2OSLB 1FIEA 3X1NA 3KXFA 1N64L 1E4XI 4PRPB 4OZFH 2RIKA 2BNRA 4TNWF 1YMMB 1V3JA 1OTUD 1MCBA 1GH7A 2WIIA 2ED7A 3BP6B 1YEFH 3G5XA 4NRXA 1A4KB 4IRZL 3V4PL 3ZDXB 1H8LA 1U6AL 5KYUB 3MMEA 3NSXA 1O9ZA 3HC3H 2CGZA 4Y5XA 3D48R 4MJ4A 4Z77B 2CDGA 1BD2E 1JNNH 1PAZA 1UJ3B 4KVNL 4Z7UB 3MFFB 4PGJA 3Q0HA 4NQEE 4NKDA 5DJZA 2WWMC 3EO1A 4EKJA 3SGJA 1IU1A 4F93B 4XP9L 1BOGB 2QVMA 2ESVE 4KY1L 4ALAL 1TVHB 1T7YA 1LE5A 3IMTA 3H3PH 1OTSD 4HEPA 5F0MB 4LPTA 3BWUC 3N0AA 3EBHA 1D6VL 1A6WH 1JGUL 5ANME 3V6ZB 3SKNA 2D7NA 1FPTL 3B9EA 5DYOB 4C4BA 5D1XA 4YBHA 4NPYB 1CB4A 5C71A 3MOAH 3GMQA 1KTKE 3H9SB 4YLBA 4NQTA 4DN4L 2JQAA 2FT7A 4PJ7F 4WAFA 5EN2B 3EW3B 4H4NA 4KMLB 1QPXA 2Y7NA 3FTGB 5JW4R 5CGYC 4CADB 1HOCB 5AB9A 1JYVA 4GAJL 1KWGA 3ZKMD 3BO8A 1CGVA 3PDOA 4OD1L 4QOKB 1RZKH 2AQNA 4QAWA 4MKTA 3C5JB 5IQ7H 4NKMA 2JJVA 2FD6H 1G6RH 4NAMA 3HNVL 5BCAA 8FABA 3PUCA 1KGJA 3QEHB 4Z7NF 4JPKH 3Q3GB 3MRRA 2DV6A 3IFPB 3L5IA 4BK8A 1ASOA 3MROA 3MGAA 1QABA 4EN3B 2PWHA 4G9FB 4O2EB 2GABA 3O2DH 1SYVA 3TT1H 1I7RA 2BS71 3L7FB 4JREB 3L7EA 2UVFA 1IE5A 1VKXB 2XBDA 2H41A 2UX6A 1QPKA 1EZVY 4KUCF 1CFQB 1CPUA 1USZA 4PJAF 3QP3A 4KXZH 4N2KA 1IBDA 4L0ZA 2HKFL 1VFBB 5E03A 4XGZA 4HH9A 3L95A 1KDIA 2EILB 2GSGA 4HUWA 3NFSH 3ZJAA 4MJJA 1LO2L 4NRYA 1NCDH 1NZRA 2JELL 2R0ZH 3CQQA 3GI8H 3CHXA 3HS0B 4BFKA 2XG4B 5DS8B 4F27A 1SN0A 4X6DF 4FP8H 3GI9H 5CU5A 3CPLB 3G5YA 2X2IA 3R7QA 4J12A 2LVEA 3RRQA 2WKOA 4LOUD 5FO7A 5DJ0A 1E9QA 4OFVA 3TN0C 3E2HC 3VUAA 5H35B 4ZPTA 2BIQA 2XA8H 3A6BH 1Y0LB 4DF9A 1LP9B 2VN7A 5EIVA 3X12B 3CVIH 4PRAB 2ICWI 4PRIE 1KC5H 3L3OC 3KYOB 4F1SA 5LGJB 3BLKA 2DQDH 5C0EB 3CAFA 5CLZA 1VESA 1Z9OA 4XNYL 3PRZA 3R1GH 3MA9L 1KPVB 4LK4A 2OMZB 2VQUA 3QUXD 4ZFQA 1J0JA 3LEYL 2CRMA 3DTUB 3BP7A 4MS8C 4ONHA 3KPSD 4NAJA 4PREB 1YJDC 1UQSB 4RAHA 3TFBA 3RI5K 3WN5C 5I8KH 2DQJL 2R1XA 1IGFH 2P8LB 5EU6B 5I1EL 4GRWH 4PV8B 5IFHH 1OKEA 3RX7A 2YXWA 1VAHA 3S3CB 1ZJAA 4N68A 3DX4A 5CZXC 1MW3A 2WANA 1ZDQA 5B39B 1ET5A 3CSBA 1MJ8H 3IAPA 1D5MA 1PTZA 2M1KA 5B3SB 2ZD0A 1A7OL 5C7XL 5JW3H 2DQUH 3LDBB 3KPRA 1CXLA 1GOFA 3NN8A 4DJMA 5IVXA 4PJFA 4FI6A 2EDRA 1A3RL 5EEWA 5EC1B 3KDMA 1ODUA 3M86A 4HF5L 4QEGA 2G3MA 4HSQA 2NZIA 5FLUA 4ZAKC 4JM0A 3SJVD 2IXQA 1PDKB 4HPYH 4S0SD 1LL1A 4HIEB 4U7MA 5E99L 1NTDA 3QUMA 5DHYB 2AQQA 1JXKA 3KGRA 3UL4A 4ODVL 4FQXC 1FH2A 3KAAA 3BOVA 4HDIB 1NBQA 2WCGA 3WKNA 3QR2A 5IB4A 4APQA 2ZWKA 1YN6B 2YIHA 1QHPA 2HWZL 3O6FC 4HD5A 1YECH 5D96C 1SHWA 1OSZA 3P9MB 3HG1D 4OCNC 1TZHB 2ICWJ 4LE8A 2A4EA 2QTEA 4H1LA 4DGIL 1TVBB 3WUWB 1XGYH 3QARA 1F45A 4A1RA 3U30B 3BN3B 5IROA 1L9QA 3RNKB 4HHAA 5HYJE 3FQTB 2QMKA 3CXHK 4P5MA 3MBEB 3ALWA 4FRWA 4NC1C 4DK3A 1WBXA 2IH3B 3D87B 3AUWB 4X9GA 5I30L 1ND0A 3VD1A 3N40P 5F1OB 3IS0X 3SEPA 4QXUL 4GKNA 1WTGT 2R1WB 5FGSA 1I8KA 1XXDC 2LU7A 5CINH 4Z78B 2JKIS 1BJMA 3RUGE 1SHXA 3P11L 5FHBL 2BCKB 3LHAA 2I9TB 2H26A 2SEBB 3EOBB 3DX9B 1DVFC 4FFYL 3VU2A 2WBXA 3DVGB 4ZMNA 3LRMA 1QLRA 5HGAB 5IBUB 5HGBB 3KS0J 4PV1C 5ID0B 2FX8H 8CGTA 1TVDA 4J4PA 2VN5A 5HDBF 3IS1X 3P0VL 4MLIA 1SN5A 5GHWH 2BIHA 2OL3A 2OTUA 1PZ2A 3MU3A 3SBQA 3BKJL 3TWYA 5GJSL 5GGRY 1JIBA 2JQMA 1KLUB 3SPGA 3PPSA 5LN4A 3W56A 1BWWA 5FO2A 5JPNB 3HG2A 4PV9B 4F7EB 1L9SA 4DKAA 3PF2A 1CXHA 1HYSC 3HHSA 4OJEH 2MFNA 3O4LD 5C6WH 2XJKA 5BRQA 3X1BA 4WI0B 5E2VL 1B0GB 3DK2A 4MQSB 2ATPB 4ODUB 1REIA 4N8VB 3FQXA 1E8YA 2J8OA 1VGKB 3HAEG 1AYOA 4Y5XC 4AL8H 4AUJA 4JFFD 2GHWB 1LNUA 2F53D 4YIQB 4JG0H 4JQVA 2X89D 3X14A 5EIIB 3LKOB 3FT0A 1PNDA 2NY7H 2K4AA 4HS3A 4WNJA 3I3EA 4ZNEA 3SBRA 5E95B 1CS6A 3SGJC 3X13B 1EZUA 1D3CA 3T3ME 4HC1A 4AG4H 4MAZA 5KANI 2F2HA 4GRWE 3WY2A 3WSQL 1IC1A 2IC2A 3PNWB 2BY1A 4ZSOE 4G6FD 3NCCB 1NC4B 1NKRA 4JFTA 4JO5A 5FCUL 4AYDC 1TEFA 1NEZG 3OG6B 1M6OA 1SM3H 3QUKA 4N20A 2ZX6A 4PY7B 4K5OA 4ZRGA 3GGWA 1Q94B 1XH1A 5E51A 1U92A 1J9RA 4HA1A 5AW4B 3D0LA 4I1NB 4JN2A 1NAMB 3TFKD 1DQLL 3LTVA 1E0OB 3MNMA 4PIRF 3ZE0E 3WFEL 2CO7B 1XL6A 3S34L 4P9MH 1G9NC 1UOWA 2VDLB 4F3FB 4KVCL 2Z3FA 3EYUH 3GFUA 2B20A 4KHXH 5EZOL 4X7EC 3HG5A 4YDIL 1OCWL 3A4DA 1AACA 3T0XA 4FQQA 3T8XA 3C6SB 3GBLA 3VFPB 3TEYA 4WI8A 3VFMA 2EO7A 1ZGLA 1CICA 1IT9L 4HJGB 3M46A 4LL9A 4ZO9A 1CF1A 3CVBA 3ZU8A 5JYMA 3H9HA 1DVQA 3M1CA 3U0PA 1KTCA 4HEME 3UTQA 4TLTA 3ARSA 3VXUA 4KI1A 1RZPA 4KK6C 4LPYA 1HE8A 2ITEA 5DURB 2AW2A 5E94B 2BNQB 4RRPG 2ITDB 2FH6A 2VOTA 4N9GB 2V2XB 5EF2A 2FR4B 3PABA 2LFGA 5JDJA 2W59A 3VXME 2E6JA 3UCQA 3WG7B 1JCVA 2Q76B 3CC5B 3AQYA 2DZEA 3HC2A 3LQZB 3GXMA 4FABH 5I8CB 3G7TA 3C5ZA 4GPVA 3LKSA 1TTFA 3B1TA 3D85A 4IKLA 1LYQA 5DUJA 1KIUA 1G7HA 3NCJH 5T1DL 4XCFH 2QGCA 2YPLA 3J27A 4KKRA 4NWTH 4BH8B 1IFGA 3F5WB 3HG1A 3FULA 3IDYB 4I85A 4XP5L 2BIPA 2CAKA 4HKBB 4LT7A 3ZSTA 1KTJA 4YHMH 3QJHB 1N5YH 4G6AD 3RA7L 4IHOB 4GH7B 4XH2B 4HPHA 4RSVA 2HN7B 4OCSH 1XV8A 4FI8A 3QPQD 3OZ9H 5JORB 1AMYA 2DQTL 2IH8A 5SWSA 4XE5B 1QAWA 1MY5A 2AK1L 1WFTA 2OCCB 3PE9A 2WGNB 4YOKA 1L6ZA 2WXNA 4L8BA 4LLYB 2BNUB 3ZYZA 3OKOA 3IXTA 1IEHA 4FQCH 4E9WA 5E9DD 4R4BB 4EOWH 4UTAL 5BQ7B 1BVZA 2BOBA 1Z7JA 3KPNA 2DLEA 5FB8A 3CN3A 3LX9A 1G7JA 4RFEB 4NIYE 2Y7LA 1QSFE 4ZUUA 3WKPA 4B7LA 4OJDH 3QG6B 2QR0B 3VWJC 5KYXB 4PJXF 4H0GA 3AW5A 3TS8A 2CIIA 4QD2E 2PP8A 1EFXD 2MTPA 5ICZA 5KVMC 1IEBB 4HWZB 4P23A 2VNCA 4AGPA 3RWEB 4OTXH 2CBMA 4PGCB 4N8PA 4PP1C 4CMHC 3HPLB 4IOIA 3QNFA 2Q1EA 3OAYH 3NABH 2E5EA 1KJVA 3S88H 4JPIB 3C87A 4BFNA 4Y16B 2OMUB 4ZDHB 3SN6N 5D7IE 3HE7D 4MCNA 1HC1A 1KEGH 1OOWA 3UTZB 4AJYV 1BZ7B 3NCMA 5IBTL 4QO1A 2NX5E 5I1AB 4MAYB 3K91A 5KS9B 2RALA 5CUSH 3NG5A 1MW2A 3DX0A 4JFFA 4FFWC 3Q6FB 3ZE2B 2F53A 1TSRA 1AI1H 1AIFA 1FE8H 1N2RA 1KTDA 1T2JA 4NO5A 1XF4B 3MA7A 3R8BB 4E41A 4JHAH 4G6JL 3HCVB 4IEFA 4UAOB 1WAAE 1ED3A 2F8IA 3RTQD 1UD6A 2F54A 1K6QH 3IGKA 2BSDA 4LL4A 3GYRA 3WFHB 1CBJA 1TMQA 2NY4D 4G3YL 5KOMC 3BUDA 1NAML 1S5IH 4U1HA 3VE0A 4ZS6D 2QKIB 3ARDB 3F2LA 4EVNA 1JAEA 4WTZA 3T0EE 1JNNL 1CT8A 1TCRB 2A5UA 4I0CC 4GSDH 2VDLL 2CO2A 3QC5X 4WEUD 5GZND 3Q05A 3AG1B 5AKVA 2CHXA 3DRQB 4LSTH 3QULA 4X9BA 1MI5D 5EEUA 2WPGA 4L1SA 5ALCL 2JSFA 2F7IA 3Q5YA 5CZVH 5FUOL 2GPZA 4OFQA 3IJHA 3O6MH 4HZ1A 4PUBH 3KEHA 2HPTA 5T1KD 5DK0A 5SV4A 3SCMB 1Q9LA 3QEQB 1ADQH 2GB2A 2P80D 3BP5B 3KNBA 3L08A 3FRUB 5JIIA 2YN5A 1E30A 1YC7A 1G7PB 5AVTB 2ZF9A 4Y2DC 1JGIA 2YC1A 5HDRA 3MHZA 2B1HH 4DQAA 1CDJA 1T04A 3GWJA 3NP4A 5CM1A 3KYMA 2Y7SA 1UA3A 2X4QB 4ODTH 1IRAY 3CVCA 2WTRA 3D9AH 4U1IB 5C0AE 4F2MA 1RZKL 3RY6A 3GSWA 5CAYB 1T66D 2VW6A 3BKML 3IGUA 4DP5X 1G6RL 4B27A 1AGCB 1TCMA 2XN9E 5EO1B 4JPKL 3SOTA 1AO7E 3II2A 2P7TB 3QZOA 4WUUB 3B2XA 5IHBA 3G9AB 3QR1A 2Y2YA 4BQ9A 5AD0B 4U1JB 5DHDA 3AZUA 1AC0A 2CMRH 1E7UA 2WLHA 3UERA 4MJ2A 5AUMA 5AG8A 1CGXA 3O2DL 4CILA 3H7LA 3Q8FA 8PAZA 3O2WH 3QXDB 1BQLL 1U91B 3QS3A 2CCWA 1KV3A 2Y69B 5CKAA 3KVPA 3S4SG 5EU3B 3IXAB 2YWZA 5HVGB 1BVLA 4ZW7A 4KXZI 3Q1SH 3BPLC 4XVTL 4X6CF 3VD7A 5DUMH 2WUCL 1OGTB 3CUPA 4FHJA 3D4GA 3UP1A 2R0KH 4OFIA 2R0LH 3A24A 1EO7A 5F44A 3U83A 4BK4A 1QFUH 4QYOA 5ESVA 2EH7H 4M93B 5CJOL 4Y1AA 5D7LB 5DMGD 3T6ZA 2PO6C 3HPJB 4P2RE 5CSBA 1KJMB 4DOHE 5IB1A 1HEJC 2HLAA 2CM6A 3O8XD 4OCRL 4X8XA 3SPJA 1L4IA 4MRCA 3V10A 2Y36L 4LDEB 1I7TA 3RB7A 3ZMRA 5L0QC 1FNLA 4JZJA 3IDGB 3JWDH 3ZYJA 3WO4C 4LFHD 3RY4A 4YQXH 4JCMA 3VFNB 3CG8A 3DSNB 3A6BL 3PQYA 4DGVH 2G3NA 3QJFB 1S7QB 5D1QE 1JUFB 3RI5F 1QNIA 2ETWA 2DQDL 1PU0A 4LLAA 2BSTA 3QZBA 4FFZA 5FKPA 1LDPH 3JV4B 5D6CA 2EDTA 4NCDA 1K4CB 4L3EE 4PS7A 4E5XG 3FAWA 4GQZA 4YSUA 1GL4B 3T5WA 1XT5A 4J3XA 2W0FB 4YX2H 1D2PA 4WNQA 4OU3A 2UVEA 4OCWH 4G8GB 1YEHH 1Z9NA 2DM2A 5FW6A 2X3BA 1AKPA 1AKJD 1O6SA 1IGFL 3WN6A 4GOSA 2XKUA 5IFHL 3QIUD 1YEJH 1FLRH 1XFPA 2R2EA 2ZOKA 4JR9H 1NIFA 3EO9L 1LHZA 4HJ1A 3AS2A 4BFIA 4EIGB 5KJRL 1IAIM 1MJ8L 3LRSB 5ESQA 2J7LA 2EACA 1R5VB 4X42A 1FZMB 4U1MB 5JW3L 1OF2A 5KANG 1JP5A 5D7EA 2AQSA 5C0CB 1DEEB 5LCVL 5CR1A 2EDHA 3K0YA 4KKAC 4PEEA 3S96A 2F18A 5E8OA 1WITA 1A65A 4L3FA 1S9KC 3B5GA 3GLEA 1RLBA 2VN3A 1YUHA 3UO1H 3FQRA 5JHBA 1LD9A 1D5ZB 3E1F1 3ZE1B 5KSVB 5CIPA 5J57B 2V33A 3WLBA 4NO0D 3CBKB 5FKAB 2F7OA 4F2EA 3FO0H 2OX5B 2OMVB 4MASA 4NS0A 5SWZD 4A6YH 3MRHA 2HFTA 3SYPA 5T1KA 2NSXA 1YNTF 2Q3ZA 2PWEA 2VLKE 2A9NL 4JDVA 1UXLA 5BXFA 1UKQA 4AQAA 4ZX4A 4XCNB 4XNMA 5JOPD 3GK8L 3TCXA 4CNIB 1Z0NA 4LHUA 2NXZC 2ZNWA 2ICEB 2CDEB 2GKIA 3QO0B 1E67A 2Z9TA 4YUEH 4NM8H 4JFQA 3OSVA 4WFHE 3Q5TA 3QIBA 4QYAA 4YE4L 1BEXA 1Q0YL 2FBJH 1THCA 1SJHA 5T1LA 2P46B 5IM7A 3QWQB 3QQNA 5FA4A 1OB1B 5MENB 3FT2A 3PWLB 4OB5H 4X6BA 3RL2B 3I6SA 5E24E 2P48B 4DTGH 3TIDB 4NNYB 3HA0A 4NIKB 4R3SA 4LDLB 5DJYB 5C0GA 2Z31B 3QNYB 4GAYA 2NLJB 3D25A 1CFMA 4LLQA 2CKBA 2DLHA 4TVPH 2VXTH 4TQEH 4OLUH 4XN8A 4ELME 4D9RD 5F0PB 5H2BB 1I1YA 4Z5RA 2AXGA 1NL0H 2A83B 3ECBA 4NPJA 5FECB 1QFOA 3CFCL 3EYVB 4K7PX 4BA0A 1QNZL 1D2OA 5ITBH 2O5NA 4XNAA 3MFGB 2VR7A 1YEEH 1R19A 2QT6A 4C47A 2XNAB 1JWMA 3B9KA 3MZTA 4FJZA 4U1KA 2LLGA 3ULVC 5BRPA 1EJOL 3V95A 3SODB 3CSFA 4KRPC 1PEZA 5IKCB 5C09A 2MOGA 2XKNA 4RAUA 1BX2B 3V5HB 4FG0A 4AQ1C 5DO8A 3ARFB 4IRJB 1AC6A 4M1DH 4LKCB 4XMUA 2CGRH 4YSDA 4RGMC 5ISZE 2VITA 2H1XA 2YK1H 3LIUA 4Y5VC 4J39A 2GJ6D 4GP8B 4NERA 4MWFB 2VAJA 1G7LA 3KGSA 2WWKO 4ZYKB 4AL8L 5BS0B 2OCFD 1DBAL 3N41B 3ZTCC 3HFFA 5GS0D 2Q0ZX 2O6FA 4XMLH 1XF2B 1GSKA 2WV3A 1ZLWK 3BX7C 3ULUL 2KQMA 3QI9B 2FB4L 3E6FB 2HLFC 2ZWLT 3QDJE 4PU2A 5CMAA 2CLZA 4JM2B 1A4CA 1AD0B 4NO3A 4N6RB 5D55A 5DHVB 4N26A 3WXVH 4N6QA 1ZSHA 2Q9OA 3FFCD 3GKWL 4QHNB 2AMGA 2ZOOA 1VEPA 5JXEC 1JHLH 1SM3L 2P1YA 4NKIH 1RJYA 1U2YA 3MUJA 4LU5L 4PVMA 4X6EB 5KEZA 1U8LB 1U8QA 2BW4A 3SO3B 5B21A 1AOZA 4XXWC 1IEAB 2ORBH 4DGWC 5IMMA 3FONB 5JHDD 3NJXA 3RKDD 3SBPA 1SDYA 1XGRB 2YRZA 3GSOA 3LN4B 4M7LH 3U1QA 5IEKB 1KY6A 2EIJB 4MNHB 4PJ5A 1Q8MA 5E8EA 3LPWA 5BO1L 4JCLA 4P9ML 5JHLH 4KX7A 1AGBB 1ULVA 4S10A 2PLTA 4LGSB 3IRPX 5F2FA 4CVWA 1HESA 2VDPH 2J56A 1OL0A 4GXFA 2UZXB 5DVNA 3NSCA 3PCYA 1AG6A 2CJ3A 2P5EE 1DN2A 3MNZA 4OZFG 1PLGH 4D8PA 4ORZC 5FO9A 3RFZB 2OZ4A 3NH7L 3B2PA 3UJJH 1L7IL 1J48A 2JQZA 2P3YA 1MHEA 4CBPA 3SPIA 3FXIC 5ESAA 1ZVYA 3V52L 4QHMA 5T8IA 4Z0XA 5EUOA 4YFDB 1CDIA 4NXKA 4KV5F 4HXAL 4LEOA 3ZRSA 3UIZA 2L7JA 2WIIB 2DOCA 3SDXE 5F1NA 3G5XB 1RK0A 5A43C 2GW5A 4EI0A 4AE0A 4E9LA 4P46C 5K9JL 2WYHA 4UT7H 3MRQA 2VL5B 2XXCB 4BFOA 4J3BA 5K9KA 3G6JA 2CDGB 1VCBC 1P84J 5D4JA 3NCJL 2RD0A 3AU0A 1J86A 2C4XA 4NWTL 3GM0A 5AWNH 5BOPA 4NKDB 1FVCA 4X8JB 3OKYA 3HNTH 5DJZB 4OM1H 3RVTC 2IH9A 2RHEA 4JQIH 4Y4HA 3DGGA 4XI5D 4TVPE 5H4ZA 3BIKB 4TOYL 1XCWA 5D7SH 1LE5B 3GTVA 4XVUC 2IPKA 4MA3A 4MDIA 2KT6A 2FLRT 3SDYL 4O02H 1HKFA 2ZUTA 3WNIA 1KCKA 2WK2A 4M9OA 3SKNB 1FL5A 4ODWB 5D1XB 3RIFK 5CGYD 1Z0MA 4X5RA 4HW6A 4EOWL 1XEDA 2WGXA 4IIQA 4MNQB 5C86A 4PLJC 4QWWC 4PJ8D 5IJVA 2VMCA 2B59B 5CHNB 5CEXA 2NY0D 4I9XA 3DMMC 2WC7A 3LXBA 5C0DA 3VXQA 4HHGA 5HGHA 3BO8B 5CP7A 5GS2D 4W9KC 4XB8A 3PDOB 4DHLA 1DSFH 1P4IL 4NKMB 1TZAA 1TUPA 3TPKA 1QSED 2BVPA 1WYJA 4YHYC 3MRRB 2X4SA 4JRYA 4OTXL 3W9DA 1KT2B 1U8HA 2M8XA 5JW5A 3FUIA 4BKTC 4HULB 4PJIA 4GIPD 3S88L 4YHZH 1SYVB 2Y5QA 2WKLA 4JB9H 1I7RB 2X4OA 2ISDA 1AHWC 3WENA 2K78A 1JPFA 4PJHF 3H7BA 3L7EB 2KQNA 1R24A 4PRHA 4MJHA 4PJDF 5CUSL 2JCCE 4WI6A 4F5CE 4PJBA 4WFFE 4OZ4B 3S3PA 4XGZB 4GI6A 4HH9B 3M07A 1P7KB 4WWKC 5BZDB 1ZEAH 4PB9H 3T4AA 3GNMH 1OPGL 2EYTA 2GSGB 4G8EB 2KZBA 1OT4A 4HUWB 2YOAA 4JHAL 1P5VA 4L4TE 5CJXA 4HSAC 3U4BL 4KC3B 3S5LA 4NQXA 1B0RA 1K6QL 2FGWL 4NRYB 1OM3H 5GS1C 3LNHA 3CLEL 1MFAH 4B9IA 3BEWA 4FEMA 4RWHA 4S2SA 4Q2ZA 2ZUWA 5EOCH 4N2FA 3G5YB 3HMXA 3D34A 1T6WA 3VI3E 3K2MC 1CN4A 3BAYA 3FMGH 3V4VH 1Z3GH 5DJ0B 1E9QB 1HU8A 3TPUA 3CHOA 3BI9X 1MRCH 1OWWA 3M1BA 2L0DA 2CO1A 4K15A 2VLRD 4UNVA 2JIXD 3JVGC 4XNZB 3CDCA 3O6ML 2AQRA 3X17A 3PL6C 4R2GB 1RZ8B 3DJ9A 4W9ZA 3PWPE 3GB7A 4JN1H 4NQQA 2X1OA 4D0CB 4N85A 1NGPH 2V17H 3BP7B 4UV7H 3V7AE 4ONHB 4O9HL 3I6LD 2VABA 1UWFA 5CZXD 5D1ZC 5FIEA 1KLFA 2BP8A 3H3BC 2FJHA 1WIPA 2R1XB 3U36B 3DWTA 3O45B 1JCKA 4WSJA 2NY1C 2AF2A 1SJVA 1B2WH 4OZHF 1O6VA 4EMZA 5IEHA 2E76C 2XVBA 3D9AL 2J73A 3UPRA 5E2JA 2ENPA 1NGQL 2BC4A 3EDEA 3F7RA 4ZAKD 1D5MB 2DM3A 3STZA 4X80H 3TO4C 5IVXB 2O5ZL 3KPRB 3NN8B 4IDLA 4PJFB 4GQPH 3KDMB 3SJVE 1QFPA 2WLIA 1AVAA 4XPGH 5HHXH 3KPOB 3PGFL 2DLIA 2WHVA 2IXQB 4IW4C 4EJ1C 3B6SA 4NLAA 3OJDA 2FQFA 3HE6A 4W4NA 3QUMB 4D0BB 5K59E 4IRSC 4QHKI 3FBQA 3O6FD 5HHVH 2R27A 4E9RA 2JJTA 1N4XL 1CTNA 1AQKH 5EO9A 2ZX7A 4KK9D 3MR9A 3VYPA 1U36A 4LSRH 4KMQA 6CGTA 2B8OT 5F88A 1HSBA 4APQB 5IB4B 3L2LA 1JPTH 3DVNA 3Q6GH 2FEEI 1FG2A 4FEIA 3MLSL 2O30A 2Z93A 3MV9D 5AVWB 5C08D 2EDNA 2FX9H 1GKOA 5DUML 3REVA 2DQEL 5D7JC 1BG1A 4BSVA 2G2NA 2B4CH 2H4EA 4OZIB 2VLLA 4HHAB 4NQVA 3KW7A 5FV2A 5FM8A 4UTBL 4MZRA 4TTGA 2IVFC 1IGTA 1KJ2A 4ETQA 5TDPB 1ND0B 2ZG1A 1YQVH 4UM9D 3TZVA 4TSAL 3M88A 4UUJA 4YHPA 1I8KB 3CFNA 3ARBA 3JWDL 2CJSA 3NUKA 1F4XH 4R7XA 1KIRA 4YQXL 3WKQA 1QSEA 1BAFH 3QNZA 5EEVA 3UTTD 4DGVL 1XGUA 3PP3H 2COQA 5T5FL 1QLRB 5I9QC 3QO1A 3II3A 1WC7A 4FXKA 1NBZA 2G4GA 2AJUH 1D7BA 2QPEB 2DQHH 4FQ1H 1LDPL 4Q9QL 3N6YA 2NY6C 1E9PA 2HT2D 1QI3A 2OTUB 1AFVL 1OAJA 5C0ND 2R4RL 1IGCH 4YDLB 4YX2L 3EYOA 3NCXA 5IB2A 4QHKJ 3U9UA 1HYSD 4WU7A 2J6EL 2WYTA 3TBYB 2V7HA 1L7TH 1YY8B 5TH2A 5DO2D 4Z7UE 1XTLA 1HQRB 3SKJL 3O4LE 4HUNB 4LLVA 2X1PA 2WZ0A 1BDYA 4HZAA 3UTSD 4N0YL 4RX4A 3WE1A 4P2QE 1RIHH 3FQXB 2GIXA 4MXVE 2E0PA 1S7XB 3HB3C 1OGAE 4L05A 1Z9LA 1WQVT 4OD3H 4NBZB 1LNUB 3AM8C 2KMWA 1DSYA 5H37H 1T5XA 2HMIC 2WVVA 4FQHA 4QNPE 4J1UA 4R6UA 4HS3B 4P5KB 3K6NA 4PJ6A 4Y4HC 3VQLA 3MRFA 4B9PA 1KB3A 2IG2H 5I0XA 4LVOB 1C12B 1I85A 3FB8A 2X2UA 4HH8A 1RUAL 3IDMA 1I8LC 4DQOL 1P84K 2VLRA 1HH6A 3VA6A 3RU8L 3TGXA 2DH2A 1RXLA 4RQQA 2CALA 3ESUF 3QUKB 5D5MA 4OFYA 1TJHH 3WYRA 2ZYHA 4LXFA 2EIKB 2AJXL 5TFSH 1OP3H 5CD3A 3QUXB 1IBHA 2LE9A 1IV8A 3GQFA 3AGVA 3FRPA 3D0LB 3KPSB 3D2UA 4K3GA 5IFAL 4JN2B 1UA6H 1WEJH 3RX5A 2H1LM 3DDFA 5KVFL 3PWUB 1PY0A 5KOVC 4Z7WB 5DFAA 1OLLA 2WBWB 4QXGL 3UBFA 2OXHB 2NY5L 3LZQA 4HKZA 3FHQA 5HVFB 4OLVL 4UF7C 4OB5L 3T8XB 1ZLSH 4WI9A 3QUML 5C9KA 4XP6H 1ZGLB 4DTGL 1WZKA 1CICB 1EEYB 1VPOH 2ZUSA 4P2OD 4GT7A 3C9NB 1TFHA 3H9HB 2HJFA 4X5XA 1OZTG 3F58H 1U8CB 2V5YA 3UTQB 3C60C 1WA1X 4TQEL 2GT9A 2Q5BA 1HIML 3UYRH 1QRKA 1NL0L 4BQ8A 2ADJA 5EU4A 3TA3C 4KRNA 1TU2A 3SPHA 2D0FA 1HSAB 4I9WE 5FGBC 3PABB 1YEEL 2VZ3A 3SZKC 1F4HA 5KW9H 5EO0A 2CK0L 4Y8AA 3C6LA 4FNSA 1EJ8A 3F7QA 4RMSA 3RDTC 4YWGH 3IWUA 3IBEA 4QRSA 32C2A 3ZZ1A 3D85B 2BY3A 1KIUB 2L8AA 3G6DH 2VZTA 5C08A 3LN9A 5CJXC 3HG1B 3P54A 4NYLB 3L4XA 1F90H 1FRGL 1RU9H 1X5HA 5IW3A 2YD5A 4YXLH 4Z95H 1CD1A 3S2AA 2UXGA 4P4RB 5SWSB 3CZKA 4FZEH 3MNDA 2VZUA 1O6TA 2WBKA 3EGDB 1S5HB 3L3HB 4Y2NA 4QDGA 1NCJA 3QDGD 3WAKA 5E9DE 2ZOTA 2RCSH 1PYWB 4OF3A 3NRPA 3IXTB 5IV2B 4HYTB 2FH8A 3FPXA 5C2BH 4K94C 4WGWB 4ZX3A 1ZLDA 4RRPM 3VWJD 3PXLA 2BOBB 2AEPH 2IFGA 3KPNB 3S0PA 3W0WD 5FB8B 2A1WH 2YMTA 5D9SA 4ZUUB 3JV5A 4NKIL 5H94A 5GRUH 4A7VA 4D7PA 1BPLB 3W9EB 2XIDA 4KO7A 5GIRB 3D12B 4WY7L 4PP1D 3ZHKA 3C2AH 4XPAH 2Q10A 1KB9K 2CIKA 5AL0A 2CIIB 4LPCA 2W9DH 1WE5A 2YAHA 1KTRL 4UYQA 1R3LA 4P23B 2NR6D 5EZLA 4XVJL 2BX5A 2AK4D 1XBDA 4JLRA 2PW1A 2NTSP 4IOIB 5JHLL 3CBJB 4OZGE 4DP9X 2UWEE 1O5PA 4KH2A 5F6IB 1KJVB 4HIXH 4NQDA 1UD5A 1WJ3A 3OAYK 4N24A 2DWEA 2N59A 4X9FA 4YBQC 5KSUA 3A4FA 4MDJA 5F7DB 3O3EB 2W9EH 3UYPA 3ZUNC 2NZ9C 4QO1B 1OP9A 1XSJA 4F20A 4ZFGL 4BFJA 3AS3A 1R3HB 4U6HA 4JFFB 4BIKA 3BCDA 4K7PL 4UBDD 2F53B 3P4LA 1KTDB 2YS4A 1RIVH 3I3BA 1E65A 5ABZA 4FX5A 4JHUA 4IEFB 2VAAB 4QKXB 5DWUL 1ED3B 5EOTA 4A2LA 3LPFA 1FNHA 2F54B 1MF2H 3FU3A 1EDHA 4J6RH 2AV1A 1QFWH 5I17B 1G6VK 4YPGA 4P9HH 4EVNB 2APTA 4RMRA 4FC3E 3VMOA 4H88H 1A5FH 5MERB 1KIPA 5HXMA 1MI5E 3D6GA 1F8TL 3WCYA 3MX0A 3QULB 4OM1L 4PHXA 2UZIH 4DEPB 3S37H 1QBMH 3GJFH 4G7YH 4B9YA 3MOBH 5BUAA 2EIMB 3T2PA 1GGUA 5FK9B 4X4XA 1ZT4A 2I07A 4XO9A 1GGBH 4NN6B 4EI6B 5KJ7E 4KUCD 2YA0A 1INDL 1Q9LB 1YPZA 4O02L 4MJIE 4Y2DD 5LNDA 1CGSL 2OS7A 4P5TA 2EDQA 4G8IB 2VQTA 4W9DC 4FNPA 3LRHA 1BVKB 4XC1H 3FN0L 2N1KA 3U7WL 3VB9A 1DQQA 5EEXA 1TETH 2YC1B 3K7UA 4OFPA 5E2TH 1SLXA 3L3DA 5EN3A 1T04B 3Q06A 1X7QB 3I6KA 3KVDD 4FXKC 3KYMB 1MREH 5B38G 4EIUA 4RSYA 1IM3A 4NWUH 2WTRB 5DJ6B 4GBXC 3ZDYE 5JIMA 3GSWB 4Z3JA 5EH1A 1NJ9A 4ZTOH 3R06B 4F91B 3COOA 4ESKA 4M7KH 4UIKL 4BK5A 1W8EA 2NQCA 1CGYA 5E6IA 4TL4A 3WFCL 1U8JA 3S8GB 1KGYE 1YDPA 2EE6A 3JT2A 5AUMB 1EDYA 3RUGF 1HAUA 1KYDA 2HJLB 3BAIA 3QHFH 1GYUA 3ME0A 4V11A 3VXRE 4MB1A 1WF5A 3QISA 3QORC 4W9HC 3JT0A 4KX9A 1M57B 2ZOLA 1BVLB 2VUOA 2Y2WA 3L48A 2YSTA 2JI3A 4WFGE 2EDEA 2YRBA 1UFGA 3WJJA 4RVBA 4M5YH 3AABA 4X4YB 3QWNA 3OLDA 4NLHA 2C26A 2YUXA 3HRZB 3CUPB 5DVOA 2PO6D 3ATAA 5I1HH 4LHJB 2KZKA 1USQA 2J25A 2WTPA 4OUOA 5AVXB 4B9CA 2A2QT 3VFTA 1JBJA 4QYOB 5ESVB 3P0GB 3P3YA 3OXRB 4HALA 3ARXA 5I8EA 1KSRA 2Q8AH 1IFRA 1UXWA 4JFSA 5GGTL 1YY9D 3UH8A 5E6ZA 5DJ8A 2IAND 2N1TE 1Q1JL 4QRPE 1RUKL 3TBSA 4N2MA 4QPEA 1C16A 4JZJB 4Y1SA 1ZA6A 2VL4A 3RGVC 4N0UA 1JNHA 3CSYA 1EFXB 1CFTA 2ZJSL 4IBZA 2ZX8A 3II1A 4LPVA 4FL4C 3PQYB 4UYPA 4UMGA 1UWXK 4BZ2H 1X6NA 5BV7C 1D5BA 1JVKA 3VSUA 4N2AA 2BSTB 3FYEB 3QFJA 3T3MF 1QVOA 5FKPB 2VDNH 2AXHA 2BW5A 2EE9A 3FCTA 4HCFA 2HB0A 3OB0H 2IAMA 4GRWF 5GSRA 1JPSL 2VDKH 2V17L 1RHHA 4UV7L 3HE7B 4FMVA 4WNQB 5G4OA 3MRGB 4W70A 5J13C 4K5LA 1O6SB 1S7TA 3QW9A 3KJ6H 5DVPA 5DS1A 1BA9A 1H9DA 1HINH 4OCYH 4BZ1A 3V0VA 1NUNB 2ZOKB 2GBUA 1B2WL 1KCUL 4X7TB 1U4EA 4BFIB 5C70A 1M56B 1OSPH 1CXEA 1QQDA 1U2HA 2X87A 1CDYA 2H32A 3V6FA 1ROWA 4PJGE 3IETA 2OQJA 1BZDA 3ZE0F 3L9BA 4DIXA 4QJ4B 2PW2A 1OF2B 4BWTA 3IJYA 3M8OH 3BUYA 1Z5YD 2NY4B 1SHSA 3VFRA 5CJQH 1EVTC 4G6MH 1XIWD 4XPGL 3UPCA 1CBVH 4L5FE 1EHNA 5LXGH 2EQDA 2HG0A 5E8OB 5I74C 1TPXB 1K5NB 1WA2X 5HHVL 3HEIB 5EOCJ 5JA8B 3UZQA 1YUHB 1AQKL 2Y07L 3FQRB 2DJUA 1RZ7H 4LSRL 1DQVA 2G2RA 3WLBB 1JPTL 4BYHA 3Q6GL 3DETC 3S3JA 3O9WA 1RZIB 1IB5A 1NEUA 1HZHL 1N6QH 1AXSA 5LBSH 5T1KB 4PJAA 3MDJA 3RP1A 2Q2LA 4JDVB 5BXFB 1GHFH 4L0PB 4AQAB 1G5AA 1FCGA 1U41A 1SZNA 1HK6A 4LHUB 4I77L 3TH2T 4MQXC 1QBBA 2Y5EA 1WO2A 4QKTA 3TBVA 2YA2A 3V79C 4J2XA 3KPLA 5EORH 4FYTA 3SDDC 2BCMA 5DJDA 3QRLA 2XIBA 3TBTA 3VO0A 2EVGA 5T1LB 4AQEA 3TEWA 4HIQA 5IM7B 1A7QH 1YQVL 1IC4H 5C07A 1GZPA 3MGTB 1V3MA 4YHLH 1VSCA 4X6DA 4X6BB 3PJSA 4XX1E 1CLOH 4DAGH 3UJIH 3AXLA 3ROOA 4AUUA 1BXVA 1OAYL 4GS7C 4R3SB 1F13A 1MCJA 5C0GB 4GAYB 1HWHB 3H53A 3ZK0A 1HEZA 2H1PH 5F7EL 4JO3H 4KPHL 4MMZC 2CLVA 2FWSA 5E08L 2OXGA 3S48A 2V5TA 2XRAH 4YZWA 1I1YB 4O51A 2CJTA 3GLDA 3ECBB 1URZA 5DTFA 4F7CB 2AJUL 3VI4B 3ZZSA 3ULVD 1GPOH 3LS4L 4W6XB 3BPCB 4KRPD 3IPFA 5ILTL 3L6FB 2Q86B 3ZO0A 1P4UA 5LBGA 2M2DA 1IGCL 4GLRH 1JWMB 3B9KB 4KAQL 3QQ9C 2R15A 4N22A 5EZJB 5BW7A 1T7XA 1JV5A 1A6UH 2RACA 1IGJA 3WY3A 4FKHA 3P2DA 5L2KD 4EAEA 1X5FA 1LK3L 4IIZA 3EF4A 5CNHA 3O2VL 1MCHA 4UIMA 5E8NA 3IF1A 1KTLB 3ISYA 5GS2H 3ARGA 2VITB 4Q9RL 2GJ6E 5BMFL 4K23L 3ZL2A 1NIBA 1X5AA 5T3ZH 4GW5A 1UENA 2X70A 1JYWA 4DP1X 5EPMA 1G7LB 2HLFD 2YQBA 3VSTA 4ERSH 1JK8A 3A6CL 3MUGA 2YSSA 1R6VA 2DICA 3SKMA 1AD9B 2X4PA 5D7IF 3CD4A 5CFAA 2GIYA 4I0PC 4FFZL 5DQ9A 4H8HA 3IPEA 5IK3A 4DP2X 4CU7A 5BVPL 3K6SB 4KQ3H 1MWAA 2IG2L 7PAZA 5B1JA 1HL9A 3FFCE 4NO3B 1FL3B 1N26A 2PF6A 3T04D 4WSKA 4TPRL 2DL9A 1NCUA 1RJYB 3ABLB 4C58B 2WAQA 2CRIA 3VRJB 1WAAF 1U8QB 3FUEA 3JTTA 5D70H 3AWEA 1W9XA 3IWVA 3ZMEA 5JHDE 5MEOB 1PG7X 1F4WH 4U6YA 1Y18A 5CJ8A 4MMXA 3JWNC 5FYKU 1W16A 3GSOB 2KLTA 1T83A 1GGCH 4C54A 2OJ1A 1WEJL 3D3VA 3NIDE 1UADC 3WI9A 2A9BA 1PX3A 4YGVA 1JHKH 3QQ4B 5E8EB 4PJ5B 2DQFA 1EXHA 5L7XL 2EYRA 1L9TA 2PTUA 4ZW3A 3AU1B 3CX5K 3NIGB 1CL7L 2C4FU 3C5SA 4XP6L 3MNZB 1CI3M 2APSA 5E1QA 4BK5C 5L8JB 4NHCH 4KTDH 1WP6A 5FO9B 1QR1A 3VWKA 4UU9B 1E8ZA 1WWWX 3LYRA 4GKZB 4HVBA 3UYRL 3M7FB 4NENA 4P46D 5EUOB 3V7AG 1KGWA 2ZPKH 3KPMA 5I2IA 5F7KC 4Y8DC 1YJDH 3HFMH 4LEOB 4N90E 4ILDA 4EI5C 4X5LA 4UQEA 5D2LA 5F1NB 4JVUA 2PPCA 1RK0B 2CJUL 3NACH 1RZQA 1XR8B 4KDTA 5DEZA 3W39A 3MJ9A 2Z6FA 4YWGL 3RVTD 4LP5A 5K9KB 4NO0B 5C0JA 4AEIH 1LO0H 5SWZB 1J5DA 3THMH 2DKMA 3G6DL 2AV7A 2FJFA 4LVHC 1WIUA 3BPNB 4KJWC 4C57C 1FVCB 1WT5A 2IWFA 1ZLUH 2N0MA 4M7LT 3U48A 3WY1A 5GISL 3U7YL 3BPOC 4YO0A 4NP9A 3GZKA 1DJHA 1L0XA 2BSRA 2IPKB 3K5SA 4MDIB 5CZKA 5H8DA 4XN4A 2VLJD 2JB6B 4B96A 4PLJD 4JO1L 4QWWD 2H2SD 1NH6A 2A74C 2O1AA 5I1LB 1E2VA 1A2YA 3H6AA 3VXSE 1FL5B 3OKEB 3DMMD 2XWCA 2EDJA 3L1OH 1A0QL 1KBGH 3BXNB 4A7GF 5M95B 2N7SA 5C2BL 3VGAC 5GRZA 1KZYA 4P05A 5IJVB 5CEXB 3QAZC 3IDXH 5AZEL 1SUHA 1SYSA 2A1WL 1AE6L 2VDRH 4FQLH 3HLKA 4F8PA 3VXQB 1TJGL 3H2WA 3JBG7 3LIZA 3L17A 5T3ZE 5HGHB 4U3SA 5CP7B 5LNEA 3JTSB 2NT0A 2X0UA 4UNIA 2WXKA 3GMOA 2IBBA 4KXDA 3D2TA 2NYZA 1G9MC 3QG7H 3FQWB 2W9DL 1TF4A 2A73B 1DJIA 1ETZB 2PXYA 4YDVA 1FVDB 4JM2F 2VLMD 3QWOA 5DVLA 5JW5B 1T5WA 4PJIB 1EEUA 3CH8A 4JBSA 5AKTA 3N1MC 4A2EA 1FYTD 5E4AA 1M7DA 4MA1C 1X4YA 2VR6A 3EO0A 3GSNA 3K6FA 3MSPA 4WWKD 4PRHB 1AY1L 4GQRA 3QDMA 1KXQE 5FPIA 5IP4A 2EIEA 2VGLM 2XI9A 4UQIM 4DW2H 2Z7UA 5J6HB 4JO4H 4G7QB 1RJZA 1SNRA 4PJBB 4H20L 1L3WA 4OV6F 4ZW5A 4FYQA 4U05A 1NDMA 1I4FA 2FHFA 2DRUA 1MH5A 4G7SB 1GY2A 1AQDB 2CO4A 2EYTB 2XY1A 3E7JA 3T4AB 3TV3L 4GG6E 3MKKA 1P5VB 1UB6A 4R5XA 3U6XS 2OMWB 2Q7AA 4RZCB 2QHRH 3DX3A 4NUMA 1FV1B 3CFEA 5AW1B 3INUH 4HLJA 4XO3A 4HWEH 1MHPL 4KOCA 4N8CH 4TNVF 4XWOC 2IMNA 2VDOH 1QFWL 3HKZA 4S2SB 4E2OA 1QFWI 5DCCA 5DEFB 2CDFB 4QRUB 1M3JA 4DUVA 2IF7A 3NPSB 2YD4A 4H88L 2CUHA 1MPAH 1HL4A 1S9YB 4PPTA 4E9SA 2DW5A 4JPVL 2UZIL 4BWUA 4JL1A 3TPUB 1LEGA 2FL5B 3W11C 4ONOA 4YE0A 4LARH 2VISA 3DGDA 4G7YL 3MOBL 1SJMA 3M1BB 1N7MH 1QI5A 5LXVA 2CO3A 2Q3XA 3UG4A 2HFGH 3P0YH 1KFGA 4MXWH 3JUYA 1FNEB 2OZ4L 4AEHH 3V5DA 2WN2A 1WG3A 3EGSA 4UINH 2MEJB 5D1ZD 5IGXL 3GBDA 2WWNA 3UTPD 3L5JA 3ARTA 2DEXX 2X4TB 1XB3A 5IOKA 1T7VA 3C8DA 4AXWA 3OAUH 4RESB 2X53A 2FIRT 4M6NH 4NFCA 5TDNA 3DHUA 1KLFB 2BP8B 4KITB 1TETL 1E9OA 1MKFA 4QXWA 5IHZA 2FJHB 1MLCA 5E2TL 1HXYA 2CO6A 3ZTNH 1MREL 3TO4D 3CFMA 1MFDH 3VG0L 4ODSL 4IGBA 1OQXA 1ZY9A 3NJLA 1T21A 5EBLA 1IGIH 1SLVA 5BW7C 5LKNA 1G9NH 3RGBA 3ZDZB 4GW1B 4V1DA 1FIGL 4PJXA 4IRSD 4M7KL 1RQ5A 2E7DA 5E4EC 4HIIA 1X9UA 3OXSA 3LCYA 1CVRA 2HRLA 5HYSA 4OCMC 3GHPA 4GXUM 4C4UA 3BVTA 3OJDB 3ARGC 1AP2A 3HE6B 3ZR5A 2B2XH 1ZHNB 5LN8A 1FC2D 1M2OA 2X09A 3HUJB 4NRZA 2EUXA 5EO9B 1JVLA 4HUUA 3V5KB 4U6VL 5AYUH 5E8PA 3ZYOA 1JDAA 3MJ7A 3MR9B 4JPWH 3QBTB 2VIRA 5IBLD 4CU6A 4ELMF 1H3XA 1HSBB 3DVNB 5D7JD 5A2KH 2XPGA 3TEUA 3IM1A 4NC1E 4OT1L 4QRQB 2Z93B 3R4RA 2VLJA 3L1EA 5L2JA 2C9SA 1T0MA 3CHPA 3QJVB 5F9WB 4LSUH 3UG3A 3REVB 4FLSA 5KTEH 1O5DT 5AB1A 3NOIA 3MUY1 2O6CA 4BSVB 1TO4A 2VLLB 3CX2A 2E9WA 1Z9SA 1I75A 4JO2H 1LWRA 1IGTB 1SXCA 5ICYA 4PJ8B 4NQUA 1KJ2B 4QRFA 1I7UA 3B7TA 5JIKA 4ETQB 3TF7C 2NY0B 1CLYH 1JNJA 4HFUL 4K8RL 1DFXA 1AYRA 1OAZH 5K33A 3TZVB 1TZGH 2XTJC 3N44F 4JHWL 5T1MA 3GSUA 4UUJB 4BGLA 4M6OL 4AYFA 1BCIA 1C08A 3ARBB 2O4EA 2WZAA 4ZUSA 1SVCP 4FTVA 2O5YH 3QXWA 2FHBA 3S7GA 6PAZA 1QSEB 4KZDH 4XPTH 5HSFA 4LLUA 1AG0A 1NDTA 4CKVX 3BT2L 3I9AA 4BZ2L 2WLLB 3N91A 3I50L 3D06A 1DDHA 1SJXA 4N8UA 2C8NA 1WC7B 1NPJA 3KXFE 5GS0L 2DL2A 3QIWA 1G1KA 1TQSA 2BNRE 1E9PB 2NOYA 4PG2C 4XOEA 3NCBB 4HV8A 3QDHA 5TE7H 2R69A 2IGFH 1OD7A 5FHAH 5IB2B 2K9UA 4WU7B 1QKZL 4Z7VB 3CFDA 5IQNA 3NTCL 3KJ6L 4E42B 4XT1C 1QRND 4CBZA 3SDCC 2VE6B 2Y7QA 3CZSA 2ALWA 4W9JC 3HB3D 4OY9A 4Z3HA 2NNAA 1H8OA 2IIJA 1OSPL 4X0NA 1NLBL 2AJSH 2GBAA 3HIZA 3V0HA 2HMID 1Q0XH 3NQKA 4MKMA 1SN2A 3LQMA 4ANWA 5M7QA 1BIHA 3M8OL 5CEZD 2ZWSA 4MAUH 4QR7A 1YYCA 4TUJA 5HHNA 3R0MA 3VRLE 1UXMA 1T4KA 3O11A 4FQHB 4J1UB 1WT5C 4JS7A 4YDJA 1ZHKA 1LLAA 5CO1A 1DJXA 3MRFB 1RPKA 1C8QA 5I6NA 2E75C 1P5UC 2YRLA 4O5LL 4NZTH 3L4UA 3PV6B 4AK2A 1F2QA 2HJKA 2VLRB 1HH6B 4JE0A 4Y4KD 5GS3A 3ZL4L 4JFED 4G1MB 1LEKA 5JNYA 4JGJA 3WMSA 5JPMA 5D5MB 5LBSL 1P7QD 2OMXB 3K6OA 4OUUA 3SDXF 5JOEA 2ZQKA 4IOSD 1RVFH 1GHFL 1ZAGA 4DO5A 5CD3B 1FFQA 1RSFA 2R7EB 3FRPB 4ONFH 1XAKA 2W9LA 4B60A 3FOMA 3OLEA 4H1LH 2IWKA 5EULV 1JXDA 2EEFA 3L9RA 1A7QL 1TQBC 3DTXA 5HJ3A 5DGRA 3QH3A 4LLWA 4RMBA 2QVKA 3EJYC 3LQAL 4L29B 3P4NB 3EYSH 3QZMA 1WWBX 4G7VH 3MPCA 4WJG3 3TA3D 4LMQE 4X5XB 2PXYC 4WW2F 3V4LA 3WFBH 2GT9B 1MRDL 2XRAL 2NTFA 1TKWB 3HTLX 4OSUH 1PIGA 4MNGE 3LH9A 1OB0A 2ADJB 4Y19A 5EU4B 3RDTD 2R1YA 3B9VA 3T0DA 3FTWA 1GPOL 3DNKA 5DC2A 2F58H 3GMRB 2OYKA 1M2VA 5JLZA 1QBLH 4GLRI 4IMLA 1I1FA 3C6LB 3UEZA 1URIA 4QRSB 32C2B 1A6UL 1XB8A 4G2AA 2OL3H 3US1A 5J11B 1KJ2L 4AX3A 5I24A 1PCXA 3MV9B 5C08B 1SXZA 1M7IA 3MRPA 2O26U 1I1CA 2PP7A 3ZMNA 3EH4B 1JZ5A 4ZMOA 4S1SH 1CD1B 3PWJB 4K3DH 1F18A 1SY6A 3CSGA 5K1JA 2BVYA 3QDGE 3TM6A 3ZTJH 4JRXA 3ZDWA 4UM9B 1JWSB 2D7QA 2X88A 1INQA 1EEZA 4P06A 5C9JB 1E5YA 1ECZA 4KQ3L 5E5RB 2WLMA 1UWEL 3MACL 4NN7B 5J89A 4OIBA 3W0WE 1A9VA 2EO1A 3AVEA 1OOAA 3UGXA 5HVHB 4L4VD 3UTTB 1GW6A 1AAJA 4OCLC 2PWGA 5HHOD 3E8VA 2WBJD 4HC1H 1VFAB 3V0WH 5D9SB 4HCRL 2X3AA 5KSAC 4L8SA 2MMXA 3DXAD 4X5PA 4PCTA 5GGRA 4BSJA 4R96A 2PP9A 4ZD3H 2FK9A 3DUUA 4NZUH 3C5XA 5D70L 2MHAA 4M8VA 4A37A 1F4WL 1YNTA 2YBGA 4Y7OC 4R0LA 4PY8I 4H5SA 2AK4E 1R3LB 4P07A 3QZWG 2QHLA 1COBA 1FO0A 1JHKL 2PW1B 1WPCA 2Z7WA 5DA4A 2VMEA 3SPVB 4BCYA 2UUDK 5D71L 1DVZA 4G83A 2BWIA 2EDMA 3HZKB 5KSUB 4OAWA 4FYSA 4HIHA 4KJYA 4RCAA 2D31A 2OMTA 5JIQA 2X2JA 3IFNH 1LO5A 1NC2D 2PYFA 2V7NA 1C9SA 4U6HB 2A0LD 2ROYA 2JK5A 3T9WA 2YMOA 3KHOA 3AITA 3PHOA 3GO1H 3HFML 2XXFA 2XICA 2Q6WB 5CBAA 5EOTB 1KEMH 2ZKXA 3BLPX 4BQCA 3UC0H 3KR3H 5FYJD 1QUNA 4TQPA 3M6DA 3ZRFC 1EUTA 2LQRA 1ICTA 1IBZA 1PD6A 2AV1B 4YPGB 2FAUA 4AI7A 5IJCC 2D7MA 1U3HC 4IYKA 4AEIL 3AY4C 1QTPA 2BRRH 1KIPB 1JN6A 2YQGA 3CFUA 2QPSA 3MX0B 5FFGA 2WZPA 5J4MA 2PYEA 3UDWC 2XJLA 3IRZA 2X9XA 4PLOB 5IHWA 2JTYA 2FJSA 3MRMA 1ZK5A 3GJFK 4X4XB 1ZT4B 2I07B 3BAXA 3CFKA 3L1GA 4PY8J 4X98B 1RZJL 5EEYA 5IVNA 4TQ8A 4J3TA 5K59F 3ILQC 4RIRA 1YPZB 4DNLA 3L16A 5LGYA 4AM0A 4P5TB 5F9JA 5JHMA 4WKZA 4FNUA 1EV2E 3VD4A 2H6PA 3SKUD 1ZANL 4W68A 5D1QC 2X42A 5A2BA 3L1OL 1PVHA 4HMEA 4P2OB 5FXCH 4A68A 1DQQB 4GBXD 1V3LA 1F6AA 3IDJA 3UAJD 3L3DB 3IDXL 4I87A 3I6KB 2V37A 1X6LA 3MCLH 1GAFL 1A6AA 1ASQA 2VERN 1IM3B 3TH4T 2QSCH 2GBVA 3MRDA 5DA0B 4G5ZH 1NEZA 2XG5A 1GYAA 1MJUH 1DFBL 2OMNA 1CD8A 1OARH 3QG7L 2B5IC 2I27N 5GZOA 4L9LC 5J3HC 2FRGP 3WJLC 2Z4TA 4GAGH 3L5XH 5A2AA 5CEYA 3H56A 2FWUA 1P1VA 3BE1L 3MV7A 1TYEB 3Q44A 2XA3A 3QORD 5DRXA 2KZ1B 4IBWA 4UT9L 2Y23A 3GMNA 3VXOB 1U8JB 4NUGH 1M05A 5HDQH 3BZ4B 3MCYA 4ZNEE 4HJTA 3ME0B 4R7LA 1MCWM 3MJ6A 4FD0A 3L4VA 1ZS8A 1MCIA 5I28A 5J12B 4ZFOL 5FOJA 4PMEA 2G5BA 1V54B 3ETTA 4M5SA 5D2NA 4UQ3B 4HETA 4KX8A 1FHGA 3MLVH 3ECWA 4WFED 4ODXA 2X2YA 4OIIL 3VRIA 1GJWA 4OGXL 1FORH 3ULVH 3P3UA 3I85A 4XN1A