3VD0A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
202
Chain Sequence
HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
total genus 37
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd0A00
5BUAA 2ATAA 3IGKA 3D07A 4LO9A 2X0VA 3Q01A 1HJBC 4A63A 2PCXA 4QO1B 2J1WA 3ZMEA 2BIOA 2XWCA 4LOEA 1UOLA 5AOKA 4IBUA 4MZIA 2IOMA 4AGNA 2IOIA 3VD2A 3QYMA 4AGOA 2P52A 1CO1A 2BIMA 3VD0A 3WU1A 1TSRA 2X0WA 2OCJA 4AGQA 1YCSA 1LJMA 3EXLA 4GUOA 4XR8C 3Q06A 2RMNA 4G82A 4IBWA 4L0YA 1CMOA 5LGYA 5AOJA 3WTSA 5KBDA 3WTUA 2AC0A 5AOIA 2BINA 2MEJB 2AHIA 1EAQA 2J20A 2J1ZA 4IBQA 1IO4C 5G4OA 5G4NA 3WTYA 5G4MA 2WGXA 4IBTA 3VD1A 3QYNA 1E50A 2YBGA 2XWRA 5ABAA 4L18A 4IBSA 4LOFA 3WTVA 2IOOA 4IBYA 1H9DA 2J1YA 1KZYA 2FEJA 4KVPA 3WTWA 2J21A 2ADYA 3KZ8A 1EANA 4IBVA 1GZHC 4AGLA 3US1A 1T4WA 4AGMA 4L0ZA 1HJCA 5AB9A 4IBZA 4HJEA 1EAOA 5ECGA 3Q05A 1GZHA 2J6WA 3IGLA 3D08A 3EXJA 4G83A 2GEQA 3WTTA 1HU8A 2J1XA 3D05A 5A7BA 3D0AA 5LAPA 1TUPA 4AGPA 4IJTA 3TS8A 2H1LM 2VUKA 2BIQA 3US0A 3WTXA 3D09A 4MZRA 4GUQA 5AOMA 2X0UA 5AOLA 2BIPA 3KMDA 3D06A
chains in the Genus database with same CATH superfamily
2V7HB 3LVTA 3PUCA 5DEFB 5JORB 5CGYC 2FJGB 2OMUB 1FDLL 2MIZA 3MLRL 3ATFA 4LHUA 4ZT1A 4KQ4L 4OZ4A 1FYTE 2XBZA 3GMPB 3PHQB 3QUYD 4QOKD 5FB8A 2IV9A 2A9MH 2XN1A 4BKLA 1AGEA 2JI3A 4G70B 4KX9A 3Q2NA 3EYSH 1G9ML 2Q7NA 3EGDB 4WJ5A 4A68A 5KJRL 2E7LC 3QWOA 1ZHLB 1OVZA 3QNZA 1OTUD 1E5ZA 4JFYB 4NZRH 5T3ZL 2XPYA 3QK0A 2C9PA 4PREB 4R4FL 4UOQA 3RRQA 2X7LB 4EQ2A 4QJ5B 3QO1B 1WJ3A 4J1UA 5D7LE 2YN5A 3D18A 4C4UA 2H8PB 3Q8EA 4XODA 4ZS6D 3O45A 3CSFA 2UX6A 4G82A 1PG7W 3IJEA 3TM6A 3BZDA 1M57B 2ZP8A 3HZVB 2DQTH 4FCAA 5FO2A 1FJ1A 4LOVA 3RU8L 1CE6A 5LNDA 1YJDH 4QRAA 4H0GA 4X5PA 1JN6B 4WHTA 2LTQB 2GTZA 1CFVL 4JPIB 1JNNL 4NOBA 2CR0A 4MJ5A 4RISH 4JFTA 5E5LA 3NABH 2VB5A 5EHFA 3UBXB 2VLRA 1PFCA 4KMTL 2K6ZA 4WFHE 2P8LA 4TVPH 1CR9H 2Q8AH 5KVGH 1TNMA 2BIHA 1OE2A 3T6VA 5KVDE 4FE9A 1JERA 4GW4A 2JIXD 5E5MA 4BE5A 4LFHG 4WCYH 3LZNA 2R1WB 1MJ8H 3I3DA 1JHLL 4L8SA 2IOOA 2PXYD 3EF7A 2F68X 3HNTH 3KW8A 3WMQA 5JXAL 5AAWC 2IGTA 5ESQB 3QDMD 3BAXA 3FCTB 4HISA 3TJHC 2CHDA 2WQAA 2WCSA 2X4UA 5HI4C 1OM9A 4XMKL 3ZUCA 5BO1H 5I8CB 4M48L 4TSBH 2G9KA 1E4HA 1EEZA 5BOJA 2DBJA 3TCXA 4F7CB 2EO7A 1MH5B 1NBYA 2IIJA 3LZFH 3PWVA 8FABA 1LM8V 1JDAA 4N2HA 1ZWIB 4LLDB 5IHLB 2X40A 5ICZA 2AJVH 3KPRA 3N1PC 1HDMA 4XAWH 3RVVD 2B9BA 5DVKA 1CXEA 1U6AH 3T3PE 3MQIA 4YJZL 1UFUA 1CLVA 1CI5A 5F1IA 1YC8A 3RIAF 4P4KB 3DVGB 5AUMB 1H15A 5G5DA 3QAZC 3MTXA 1H3TA 1WUZA 3TZVA 1YSOA 2YPKA 4P3WA 3O6KL 4WO4C 2V7NB 5K9JL 1PZ2A 3K74B 1UENA 2P24A 3T6ZA 2OI9C 5BRZB 3BD3A 4J4PC 3BSZA 2PKDA 5L2KB 3AG1B 4QXTA 2VDRL 4A55A 5AKTA 2F7IA 1NEZG 2V3FA 4L5FL 1PCSA 1OZTG 1ZLDA 1XGYL 2NXZD 2EVIA 3MBEB 4IKLA 2HFTA 5K59E 1I7ZB 3FB7B 5IB1A 3RVXD 2H2PC 2NQ3A 3PV6A 5CM1A 2BWQA 3EH2A 3SDXA 4QJ4B 1VFBB 1R5IB 2P4AB 1MFBH 2JWYA 3ATBA 4N0YL 5GZOD 1JTOA 1UD4A 2ZOOA 1G7MB 2AEPH 4XNZB 4YSPA 3KLDA 4PVBA 4Z3HA 4NPKA 4L4TD 4HD5A 5I30L 1Q8MA 1UJ3B 3EH4B 1J1OL 2AZUA 4U1IB 2UVEA 3LEYH 2GTQA 1X9RA 1SN0A 3HUJA 3L4WA 4RGND 5IHZB 3A67H 5IHWA 1MAMH 1GIGL 3OKKB 2TRHA 3BT0A 3Q8BA 2X4PB 1ZEAL 1NCJA 5DK0A 3FTXA 4MMXA 4PG9A 2XN2A 5FIEA 4DKAA 3G5XB 1NGWB 2AJUH 5KOMC 5TPWL 3IVKA 4AEHH 5AW0B 5D7IF 1IKNC 1NC4B 4ZUTB 2HP4A 3TT3H 4B0MM 4M6ML 1FFRA 3GMOA 3NZ8A 4Y19D 2VDML 2C1OA 4IMLB 1S9WB 4KBPA 4ISVA 5SV3A 1FGVL 4KKAC 1G0DA 4YK4C 4X6EA 4XVSH 4OF3A 3OKNB 2HFFB 3PL6A 3US1A 4BFNA 1MJUH 5FHBH 4N0FB 3PGFH 2ZYIA 1FO0B 1AHWA 1MSPA 1N70A 5ENWB 1RPKA 4P2CG 1BJ1H 3T1FB 2I07A 3BVVA 4FFZL 1S3RA 4Q89A 2HT3C 2L7EA 3S3CB 2VDQL 2YKLL 1AIFB 3H9SD 3QB7C 1LO2H 4E0RB 1YEDB 2VE6A 2DICA 2H1LM 3OZ9H 1BF2A 1PLCA 1YUHA 2R2HB 4XHJD 3NCFB 5EIVA 3ZQ9A 3IAQA 4P5RA 2ZZUT 3CDCA 3ULUE 4IRZA 2FWOA 1W9XA 2IXQA 5F88B 3FT4A 4I48A 1ZS8A 1SMDA 2XWBA 4DVRH 2CJSA 5EOTA 3WNJA 3MKKA 3OKLA 4KAQL 5KVEE 1JXKA 2DL9A 2PYEE 3LQAL 5LUMA 4PJGF 2YD3A 4BKTC 1R3KB 4O9HL 3BJ91 5E1HB 4WW2A 1R3JA 3TBYA 2A73B 1DQJA 3D3VE 3K81A 3MACL 4P9MH 2P3YA 2DAVA 1Z5LB 3T2NH 4E9YA 2F8OA 1FLRL 3GSRA 4PJHB 3T3MF 5FR3A 3QYMA 2EVJA 1V7NL 1TDQA 1FL5B 5HYJA 1J8RA 1PZDA 5C0GB 3F6JA 1KG0A 1D7CA 3HBZA 1WP6A 4NQEB 1WIUA 5KG9B 5JA9A 1CE1H 2EZ0D 2VQ4A 2ICWI 2TRYA 4NN7B 4Y1AD 2NXYC 4Z7UE 2YBRB 4M1GL 1C9SA 3OB0H 2CIKA 1FPTL 4OZHE 5FX3A 2WP3T 3PWPA 3W11C 3VQ1C 3S88H 4XNMA 5D9SA 4WO0A 5EZLB 2WQRA 1D5BA 5DUBA 1GR7A 4PJCB 4Z7NE 2X10A 2ZYRA 5D2LB 2X4RA 2BNRE 2OPCA 1UXMA 3IKCA 2UZIL 3ZT6A 3GO1L 1OGPA 2DJSA 2Y36L 3FTGB 4HIIB 4JMNA 2EYRA 3C6SA 3QAZB 1G43A 4J23A 3E6FB 3FB5A 4KDTC 4WO4B 3F05A 4ONFH 1IM3A 1LTXA 1Y18B 3ARFC 2MKLC 4NS0A 5IEHA 3VFVB 3U48A 3A4EA 4HWBA 2OI9B 3TPKA 1KPUB 1K2DA 3LB6C 4LPYA 1OF2B 2B4CC 1UJTA 3AABA 3FZUC 4MMYA 1YMMB 3BZ4B 4U1JB 2WCGA 2WXKA 3VE0A 3K6OA 3U4BL 2XQBL 1G7HB 3KS0J 3QQ4B 3ZTCC 4S1DC 4Y5VC 1N0LB 4F7PB 2BSTB 4EBQL 4R4NC 4KK9C 1KTLB 2ZKWA 2R0KH 1XCTB 3A0OA 2KLSA 4OCSL 3HBQA 2LU5A 3CFBA 4OD1L 5JMRA 1IGIL 4JLRA 1NCCL 3MV9E 2YPVA 2QSQA 3HNSL 3P54A 4P23C 1A7PH 4A66A 2V8MA 4MD4A 5DJDA 2GI0A 1EZUA 5K1JA 1L7TH 5F6HI 3W39B 4NNXB 1UM5H 1U8QA 4ZFOL 4JM2D 4OI8A 3O6LH 3QW9A 3GINA 5DWUL 5MEPA 2WBKA 1PQZB 4JFFB 5J12C 2NUPA 2GK0A 4KZEL 5CJOL 5CKGA 1T04B 3DO7B 4OSUH 3CZFA 1Z2KA 3ILQC 1DJWA 3SDDD 4DKEL 1DZ0A 1BG9A 2CKBL 2KI6A 4IHOA 4NZ8A 4GEJA 2DIAA 1XT5A 1ZANH 3LKSA 2C3GA 2DI7A 3L5IA 4K3JL 4LNRA 4GG6E 5T1DH 3ZE0E 1P1ZA 4UMSA 3FMGH 2EIZB 4WFEE 3OAUH 1E65A 3DUSB 4P46C 2OXHA 1UXWA 3MRJB 4Y4FD 4YK4B 5DLML 1KEMH 4PMFA 4HCIA 4XB3A 2GJPA 3UMNA 2H3KA 2KMWA 4F2EA 4PP2A 2A3TA 1XQ4A 2OP4L 3BN9C 4LKCA 5FW7A 5AW9B 4J3TA 4B41A 5GRJL 4DETA 1QI4A 1AKPA 3RWCA 3DA0A 4EUPB 5KYXA 3FONA 3JWDL 4EXKA 5EU3B 2WXIA 4QHNB 3RY5A 2VLME 2WBJC 4OZGE 5D1XC 4HKZB 1H3XA 2R1YB 4K8RD 5D2NA 2DQCL 1EEUA 1IILE 3O2DH 2EAEA 1WAPA 2G3NA 3LH2H 2UYLB 3BKYL 1H0DA 3AM8A 1IKOP 5I1LB 2WY3B 4I2XA 1WD8A 3JWOL 2DMCA 4OT1L 5CP7B 2W0PA 2JK5A 3ISRA 2YPLB 1Z9PA 2FQGA 1VEMA 4BGLA 4N3UA 2Z7UA 5DJAB 4NPJA 4FI7A 5DU7A 2OMZB 3W81A 3HBGA 1ZRUA 1VCAA 1WE5A 3OB0K 5C7XH 1KJ3L 4KTDH 3IT8D 1O7VA 1OHZA 4XGZA 5BVJB 3OPZH 4HUKB 2ZKHH 1JPTH 5JOPD 2JCWA 3COOA 4N2CA 1HC1A 3G5WA 4NENB 5DZJA 3ULVC 1UADC 1EXUB 4XP1H 4ZOCA 3IFNL 4AGPA 5C3LD 1GXEA 2IV8A 5FYLE 2V2WB 3BPOC 2XWEA 1NAMA 3IM1A 1BQSA 1U91B 3PQYA 2VUKA 3GZPA 3RZCD 3O2DA 2DYPD 4U4BA 3B3IA 5F2FA 1AC0A 2IFFH 4PG2C 4XXCA 2HRPL 1PPIA 4YIQB 3TX4A 4BSVA 2G5UA 3UYRL 2EYSA 1TO5A 4JCWA 5GS1A 3H6AA 4Q9RH 5I19H 1XF3A 3D06A 3TASA 2NXYB 3V7AG 1WZMA 5E8DH 3CFJB 4E42A 1KSRA 5HYQB 2YMXH 3FUHA 4WZ9A 3WNLA 4NYLB 1G9MC 4FQHB 2BOLA 1U3ZA 3BKJH 3EOBA 3FQWB 1ZK5A 4L37A 1SDDB 4UTBH 4GS7C 4NQVA 5CZRA 4N8VB 2C9XA 4J3OG 2H5UA 3FQTA 3ARFB 3AU1B 4D8OA 1CBVH 2J71A 3L5JA 4MJJA 5B38B 3PWNB 4TQPA 1KC5H 3EXLA 4LLMA 1DLHA 2V9RA 3D85B 5TDOB 4D7BA 3IDNA 2QKIA 3KDMA 4NP9A 4ZXBC 2CZNA 1SXAA 4Y9GA 3T2PA 3WHE1 4B9GA 2LW3A 4DVBB 2DWDA 3FU7A 4B3EA 2Y7SA 3HE6A 4FQXC 2Q6WB 1OP3H 3HNVH 4X8GA 5J6HB 3PGDA 2N7SA 1BXAA 1EGJH 3GSXB 3QH3A 4Y5VB 3RWFB 4B9JA 1OPOA 2HTLD 1HXYB 3MLVL 4TUJA 1HHJB 4PY7A 2HUHA 4LVNB 3BUQA 4S2SB 1J9SA 4OD3H 2NDFA 4I5BA 4P23B 5EN3A 4Z7OF 3ISWA 3P0VH 5L2JB 5CFHA 2YC1B 2NY0C 5ADOL 1TFPA 5DHVB 2AXHA 2YHGA 1VKXB 3WNIA 3LAFA 1RERA 4ZSOA 1TYEB 2E27H 3PCYA 3HZMA 2XBDA 3CBJB 3U25A 2YK1H 5GQBA 2DKUA 2OXGB 3EFFB 3SE9H 5FGBA 1MFNA 1F11B 4G5ZH 4PJ9C 3S36X 5J12B 4AGLA 4G1MB 2ZIDA 1XF5B 4GRLC 1KGWA 2ZXWB 1A7OH 1G4MA 3LN9A 4ZO9A 1NGYB 2JLLA 4NQDA 1OSEA 5K9KA 3ARYA 5ITBH 1C08B 1JUFA 2DWEB 1D2OA 1E3FA 2N7AA 2WN3A 4MTMA 4LKXA 5IQOA 4B9CA 5CCJA 2Y24A 3DHJA 1ADQA 4J6RL 2APFA 4X6CE 2J44A 1QSFE 3FT3A 2X9YA 2QKSA 5D1ZI 1KBBA 2GUYA 3W5NA 3HHSA 4P46B 2CHNA 1XB3A 4C4BA 1OM3H 2ZG1A 2X1WL 3SJVA 3V4PL 4CKQA 4IU2B 3QNYB 3IF1B 2VN6A 5KJ4A 4NI6A 3I9GL 4FLSA 2P5WA 3O3EB 1OTTD 3ARDA 3FT1A 5A3ID 4F57L 4XPAL 1BZ9B 3ARRA 3OJVC 2H1PL 3IAGC 3HG1A 2CO2A 1B3IA 4ADGA 2ZCLL 5INCA 5D70L 2G60H 5BJTA 3DURB 1JF1A 3O3BB 2DQDL 2R56H 3FC8A 2A4ZA 3UAJA 4NO5A 1VAHA 2WBJB 2Q3ZA 4UANA 3IXAB 5D1XB 2F8XC 3EF4A 4ODTL 2EXTA 3LXUX 3WUWG 4F92B 2FEEL 5ESAB 1SQ2N 4ZUVB 4AIOA 5ERWB 2F15A 2G4GA 3PWUB 4DP5X 2EYTB 3OKMA 2HN7B 3FB6A 3B7SA 3MYJA 5KANG 2AV7B 3ATDA 4QRRA 5TQ2H 1TETH 3U36A 1LEIA 4MNHB 1L0YA 4ZTEA 1DJGA 1M7UA 4FJYA 3QXAB 3FN3A 5JXEA 4HOWA 4CW1B 5HHNA 4AWJC 3RURA 5SX4I 4BFGA 1KV3A 4NLAA 5HHMD 4EN3C 2WTRB 3VXRD 1B4LA 1L4IA 3RFRA 1BD2A 5K9QG 4LP8A 3RWHB 5K69A 2XZCH 4B9PA 3OL2A 1NQBA 5I6OA 2NX5E 1P69B 4KXCA 5E9NA 5F7BA 1PLBA 4JANB 5F96L 1ZGLM 2H6PA 5ILTL 4PJ5D 2HZHA 4LASH 5C86A 3F62A 2JF1A 3BPOB 3ATEA 1UD6A 1JHTA 4FTVE 5EOCJ 3T0EC 3PGCB 4FX5A 1BZDA 3ZUNC 1I82A 5HY9A 1IC4H 3PHQA 4K9EH 4R5TA 2MCMA 4BFJA 3ZKSD 5EOCL 2C3VB 1D9KC 3PS6A 4HBCL 1BX2A 2E4FA 4CGUB 3NCEB 3TGXA 4B5ZA 1Y0LA 2QSCH 5JHBA 3OLIA 4JFYA 4PY8I 3ZGIA 2Q20A 3KWUA 4EDWH 5ALCH 1HX0A 4PJDA 2GEEA 1XSOA 4MZ3A 1OP3K 4AENA 1X6LA 2FLBT 1HSAB 3EFOA 2D7MA 3WFDL 3GJFH 3GI8H 1GAFH 4OD2A 4U6TA 1TQUA 1T1XA 1QATA 2YD9A 1T20B 4IS6B 1HCVA 3N42F 3HZVA 1XWVA 1OSPH 4CSTA 4GS7B 3ARGD 5L9DL 2WWMD 3ECUA 1D5MB 3DX9B 4IIZA 4K23H 3RDTA 3VRJB 1ZA3A 2YRPA 3POCA 5LCVL 4G59C 2OMWA 4JPIA 3CU1A 3KJ4C 3LKNA 2Q9OA 1JXFA 2XDHA 2JQMA 1NGZA 3DX3A 5DEGB 3LNDA 2XV0A 4QTIL 4XCEB 2VR6A 5FYKE 3UBXA 5DLLA 1JCKA 1MFEH 4ENED 2APXA 5EU6B 1F00I 4ZXBB 3LQAC 4JZNB 1PSKH 4XH2A 4YHKH 3EAKA 5J13C 4HIEB 4FQXB 1QR1B 4LCUB 2EUZA 1J8KA 1J11A 2G3ZA 3NG5A 4ONOA 5GGVL 3FSOA 5F9DC 1FYTD 5H4ZA 4DIXA 1D5IL 1BP3B 2RCSH 1K8DA 3KPSD 2YSTA 1G7IB 3RWJA 2MOQA 1YECL 2IBZX 3FCTA 4R9HA 5DURD 1FFTB 2WCPA 5LVEA 2B0SH 2ZP9A 2WLIB 1MCNA 2E75C 4PB0H 5TK4A 4E41D 3K80A 5I8CA 4Z3EA 5KSBB 2NY0B 4P9HH 2MCG1 3F65A 5D72H 4TVPD 1IKFL 5D7LD 2WVSA 4AGQA 3B2MA 1WYJA 1P4BH 2YGPA 3QUXB 4F7CA 2BOBB 3KLSA 4PJ9B 5IHBA 4LLDA 4BSWA 4NQTA 5DJXA 4Q6IA 1P7KB 4WUUB 3L17A 1HQ4A 1FFOB 4GRLB 1NCWL 5C9KA 4PR5A 1NMCC 1X5KA 1KN4H 3O2VH 5GPRA 1A4AA 1LYQA 1YEFH 1U8OB 4UV7L 3TYGL 3L3OA 2W95A 4W9ZA 4FABH 4UILL 3VXQA 1DUYA 4XBMA 2DJMA 3TFBA 2FO4B 5BRZA 1P7HL 1KV7A 1FIGH 5E6SB 5AD0A 3FU9A 5L2KA 2D9QB 3S35L 4M29A 4CU8A 3B5HA 4PWGA 2AXWA 4WWPA 4JN1L 3JYBA 2X4SB 3TBBA 3RFZC 2H4EA 2BVPB 3EGXB 4QRSA 1I7ZA 2ZPKH 3NJHA 4YXKL 2VT0A 4RGOL 4G9FD 5JHLL 4PJEE 4L1HA 3LQMA 3O9WC 1F4XL 1VFBA 2VJ8A 1Z0NA 2QGCA 1R5IA 3HMXA 3IPFA 5C6TH 2OTUB 1YEEH 4KKCD 5EBMA 2XHNA 5DA0B 35C8H 3WJMA 1G7MA 2QPEB 2LU7A 2JCCA 3BAJA 2HMID 4OFYA 3U2JA 2A6JA 4LRNH 4ZOBA 2ARJQ 3NJXA 3KBEA 1UJ3A 3BGAA 2OCCB 3D05A 3D0AA 4GNKB 3P40A 1XGRB 4B60A 3GM8A 3I50H 4E5XG 4P4RA 1ITCA 2ZUQC 4DZBA 2FBJH 3KWTA 5IHZA 1FHNA 1F3JB 4RAVA 2E46A 5KW9H 2X4PA 5EZIL 4X9BA 1HILB 1Q9LA 3NJFA 1RUPL 5GRYA 2QFPA 4ERSH 3HN5A 2AAVA 3QFJB 4KUZL 4EN3B 5FFLA 1LO3H 3HLKA 1NC4A 1WAAA 4G8FA 4AEFA 2EIEA 3GJFK 3HE7D 4TKWA 3V6FB 5C07A 5AW8B 4K3DL 5D4IA 1I9IL 1LD9A 2WLYA 3N5AA 4GINA 1JTPA 3F64A 5FGCB 3ZZLA 4A38A 3U46A 4C56E 3K7UA 4A2EA 3C5SB 5MP6L 3I75B 3EOTL 5GRZA 2OBGA 3OKNA 3T0EB 4JRLA 2EDXA 4JFUA 3QJZA 4HWNA 2VDMB 4YHYC 5ISZB 2P80A 4JJ5A 2ZUXA 3GIVB 5DMIL 4FAAB 4AV5A 1FO0A 2R15A 2WUCH 2ILLA 2ZWYA 2XQ0A 1IGFH 5JR1L 2HT4D 4G7YL 1TJIH 1N6VA 1D9KB 4ZUSB 1SGKA 3MOBL 4NKIH 3HPLB 4ES8A 4YLQT 3WU1A 1S9XB 2NQDA 2IMNA 3FTSA 4MQTB 2DQFB 4O4YL 5ACLA 3CQPA 2EACA 4GG8A 3CMOH 4NX0A 3KYKH 2BS71 2H45A 4WW1A 3UO1L 2B1AH 1CDGA 2DLTA 2R2HA 4O5LL 5AOJA 1SXBA 4TSAL 2ESVA 3JWDC 5C0RH 2B77A 3CFEB 2IWEA 2VDQB 4I8DA 1MHCA 4I89A 3MV8D 1HHHB 3L3GB 2PLTA 5F88A 2XZZA 4B9IA 2W0FB 2FQEA 1A9VA 4YDZA 4EIUA 3L4UA 4UU9A 4M62H 5L0QC 1T5XB 5AG8A 1INQB 3SQOH 3OHXC 4ZOEA 4LLYA 4UOJA 1PYWA 3KJ4B 1I1FB 4OJCA 4XO5A 1SJHB 3AS2A 3WGVB 4ANKA 1TQCC 3I2CL 2WB7A 1G6RL 3F7VB 4HC1L 1Z5LA 2H0JA 3ZSTA 5J13B 4LMQE 3TVMD 4G8EB 4ODXB 4U3SA 5I5IA 4AE1A 1LDSA 1ZIAA 5EIIB 1PX8A 4AQZA 1M53A 1FL5A 3D9AL 2MNWA 4LIQE 3VXPB 5AAWA 2C3WA 2W60B 4L0ZA 3REWB 3LPWA 1EPFA 3DOSB 3GTTA 3M7FB 1PAZA 3N3EA 3PPSA 3KJ6L 4GKNB 4YHOH 4XNBA 4ETYA 12E8L 3HAEB 3NCYS 1WO2A 5FV1L 4CC1A 3BGMB 1SF5A 3ULUL 3FPXA 1SHSA 4IK6A 5E8EB 4G8IB 2R83A 2YD2A 3FF8A 4NI3A 1ET5A 4ADIA 1JWMB 2YBRA 2MQ0A 2FNWA 3K8KA 1IVTA 3RPIB 2F58L 2DLFL 3VFSB 1FL3B 1E3ZA 4ANVA 4ZMLA 1AP2B 1NSNL 5TQ0H 5JUEH 4HIJA 3S37L 4ZW6A 1QNZL 4B7LA 2KT6A 1F86A 1UTDA 4GIOA 4PJCA 5D2LA 3GI9L 1NMCB 2VRAA 2IAMC 2NY1D 1JRHI 1KLGB 2IWGA 2F53D 5CINL 4IOIB 2JTDA 1MCQA 4K4KA 4EIGB 25C8H 3W57A 5C09B 1IAIL 1Y18A 2HPOA 3UJIH 4PWKA 4D9RE 1R3IL 5I16B 2DM2A 2CPUA 5I74C 3D3VD 3QEHB 3E8UL 2W92A 2HJFB 2MKWA 4J4PA 4UT9H 1NAKH 1FNGA 2YWYA 4XNQA 3DJ9A 3IYLW 2JH2A 4JQIH 3H3PH 3HKFA 2WZPA 1QFOA 3I6LE 4U1JA 1I85C 2Z4QB 1I8AA 5IB3B 1MG2C 3RFZB 1G7HA 4JM2F 3EYUL 2ZG3A 2J8UB 2VZSA 1IVLA 1IMHC 1BQHB 4QPEA 1S7XA 4CN6A 5HYFA 2YEZB 1N0LA 3NZHL 2VERA 3WUWA 1M7XA 3O9WB 4D0BB 2R8SH 5FKPA 2KL6A 4FA6A 1KB5L 3VTTA 4RGMC 5BZWA 1YY8B 4L1SA 4F2FA 3RUGB 4LBAA 3BAEL 2GUOA 4HXAL 3JVFC 3W39A 3F7QA 3P9MA 1C5BH 4FQ2H 2YD8A 4NNXA 5HD8D 3UTTE 4NO2B 5A40E 3OGCB 4MB1A 3W56A 4AW4A 1O7DE 2VDPH 2YRBA 1UT1A 5E2UH 3ELQA 4GAJH 1I1RA 5AVRB 3OVUB 2BNRD 3BESR 3C60A 3CH1B 2WKLA 1AGBB 1UZ8A 4JN2A 4LAQL 4LDEB 4XMZA 4WEBL 5KSUB 4GQPH 4LSPL 4BV1A 5AZEH 3DO7A 1Z5HA 2GIXA 3MROB 4X9YA 4ABUA 3NOIA 3DSNB 3MRGB 2VZOA 3G5VA 4PV9B 4UM9B 2X2JA 3GRGA 4OCRH 1DYZA 1F90H 1OP9A 3K6NA 1QPPA 1RZFH 3N9GL 4YQXL 2P8MA 1JMXA 2X41A 3CCHB 7FABH 3ECQA 2CKBB 4D9LH 2BS9A 3SPJA 4YSRA 3BJLA 1U8PB 3L7FB 4XN8A 5E6IC 2WVTA 1RFDH 2Z93A 4JHWH 4L1DA 4FQLH 1TJHL 4YHYB 5BXFA 2IC2A 2VLKB 3A6BL 3KBHE 4G8GB 4KPHH 5D8JL 2OQJB 2QPUA 3MGOB 1T03L 2DDQH 4H8VA 1AFVH 1R9FA 5CFAA 4RH4A 1WTGT 3CFDA 3LN4B 4EUPA 4QKTA 1OGTB 4XC1H 4JL2A 3QHFH 2BFVL 4OQTA 3GYRA 5F3BA 2F54D 3RGHA 2R1YA 4PJ8C 4Y8DC 1UA7A 4V1DE 4PRHD 1HIMH 1LVEA 2ZCHH 2UYLA 2XQYG 3K72B 4M6NH 5BUAA 3UBHA 2NNRA 1MCPH 2YZ8A 2YPLA 3LNGA 5DRWB 5INDB 1NCDL 3C2AL 3BYYA 4XVTH 2K7QA 4APQB 5L0QB 3RX5A 3UTZB 1A8ZA 2R0LL 4YUEH 3OHXB 5IB5B 3IRZA 4QMEA 1KXQE 1F5WA 3NCJH 4AQAB 3WIFB 2XG5A 5BVJA 4PRBB 1EFQA 4WFED 2YGOA 2J8HA 4RAHA 1TQCB 3BI9X 2VH5L 4YHPB 1I7TB 2CBQA 5DD5L 4CC0A 1JPSL 2NT0A 3DMMD 5C08E 4NENA 3HJ0A 4NCDA 4XWGH 4IGBC 2G75B 2PCFB 2V2WA 3BYTA 4FDWA 5GJTH 2H26B 2EDEA 1U91A 5AZ2H 1KJ2L 1CDIA 4LEOB 2P5EE 1EJ8A 3PAYA 3E1ZA 3DK0A 4EAEA 1NMAH 1YZZA 2MMXA 3LRMA 2YIHA 2VLMD 4G6AC 1IAMA 4XBGA 1L6PA 4C4KO 3MNZA 3L3KA 4B97A 1FZJA 5FW6A 1NINA 3MJ8B 3CFJA 4DERA 1HL9A 2TSAA 1D5XB 3IDXL 4FQHA 4RZCA 3QC5X 4P3CH 2G3MA 2ITDA 4UAOC 1JFHA 2IAMB 2FSEA 4FLHA 1MCSA 3GIZL 3NSDA 2J25A 5KVFH 3SE3C 2L7UA 3AADB 1KXHA 2BRRL 4K7PX 4KDTA 3P4MA 2FGWH 4P48A 4N8VA 5FYLL 5BOPA 3GSNB 2NZ9D 3ARFA 3AU1A 3RGVD 2DMBA 4OJFL 4B9KC 3B2DC 1U9KA 2B1HH 5B38A 3UTPD 2JJUA 2VL5A 5I74B 2EIJB 2WLKA 3D85A 1DJYA 1JBJA 3CFIC 3CNKA 2Q1EA 3FQ2A 3P11L 1R17A 1FL6B 3NJKA 2ITCA 4I13B 5SWSA 4MD5B 4DVBA 5JA8B 2NYZA 3ZQXA 3V79C 1DQDH 2IH3A 1B4TA 4M7KL 3RBGA 3S5LG 2Q6WA 4CVXA 5IQ7L 1SPDA 5J6HA 4KQ3H 5LGKA 4Y5VA 2VC2L 4GAGH 1AKJB 2FATH 4QYOA 4HU2A 2X4TB 5LXVA 1Y6NR 2E9IA 1HXYA 3PREA 1HHJA 4RGMB 4BCXA 4L8CB 2A74C 4WDIB 1OD7A 3L3HA 3VSTA 2CHXA 4KH2A 1H9VA 1HOEA 4P23A 1RUAH 4UV4H 1RUMH 1IGYB 3Q9PA 1XD0A 1BG1A 3DDFA 2XXMB 2YC1A 5LG1A 1EZLA 5I8KL 2AJZB 2IDCA 5DHVA 1VKXA 1J1PL 1JZIA 5E2WH 1SF3A 2DLEA 3PIQB 1W8EA 3IDIB 5EF3A 2OXGA 3SBRA 1F11A 1OZUA 4XP4H 3OXSB 2HKFL 1DTUA 1FP5A 2OX5B 5K39A 3CLEL 4XB7A 2O5NA 4KK8C 1I8LA 3AREC 4PJBF 2VZ3A 1B9KA 4YSTA 3UMTA 5KS9B 5AWNL 4JPWH 2QADC 4DP0X 1UCTA 5DGQA 2ALAA 2LLLA 5J1AA 3AACA 1A0QH 3VFWB 3FUEA 4Y4HD 5FA3A 5HXMA 2A1WL 2AK4D 3IMSA 1W0YT 4QRPA 4OW6A 4KVCL 3J27A 1HINH 2VLRE 4HLEA 2P7TB 3O3EA 3CFMA 2EUXA 4TN9A 2Q87A 3MRDB 4O51B 5E6IB 1NBQA 3BP6A 3JXAA 5DRXB 1BZ9A 1SBBA 3UZEC 5IY5B 3P2DA 1YEJL 3V4PB 3TEZA 4YHIA 4XCFH 4PJFA 4YSCA 5IFHH 1KDJA 4KGLA 3O3BA 3KPLA 5FECA 4YSQA 3NK4A 4PJXB 2Q8BL 2DKSA 4FF9A 4BD4A 1K4CB 1IU1A 3P4NB 2WBJA 4YE4L 5D1XA 2D7QA 3IXAA 5IJBC 3DXAB 2YLHA 2ZX6A 2WXJA 1FGNL 4PJ8B 3ZKNC 3R1GL 1A47A 3D12B 5ESAA 3V0GA 1OAZH 2Z7YA 2EE0A 3WD5H 3ZXAC 1F2XK 2XRAH 3KW7A 4IRSD 1DQIA 1CFQB 2HN7A 4IMKC 3VXNB 2DTML 4ZW3A 1URLA 1T2JA 3KXFD 4B5EA 5LQBH 4XAKE 4MXVE 2YAMA 1CPUA 1MW0A 3FT0A 4XVUC 3VU1A 1F1AA 5EF2A 1P4UA 5ALBL 5HYIA 3N41B 2QVIA 2ZXQA 3QXAA 3SB3A 1LP9A 4P2RB 3RPBA 3KPRE 2CDFA 3WKMH 5ELIA 5E9DB 1IX2A 4MNQA 4G83A 2X9ZA 1Q9KB 2Z7ZA 1CGSL 4FA7B 2WTRA 2HCZX 2HJLB 2FLRT 2Z91B 3PDDA 3C5ZD 3FQYA 1XH3B 3RWHA 1JZ2A 2M8XA 3OR7B 2AXGA 3SE8H 1KCWA 3O0LA 2YS4A 1TZHB 3MCKA 1KLUA 4KRPD 1URZA 2X44D 1O9VA 2ROYA 4OZIA 4DGUA 2NR6C 1P6AB 4IGBB 3QDJD 1PZ5A 2QHRL 1J5OL 2GSGB 2V2XA 3MRHA 1ROWA 4WI4A 2OTWA 4L3EA 1IGCH 5A16B 5ESVA 1RAMA 5HI5D 1RZJL 2DD8L 4NFCA 1OCRB 3DV6A 4PG2A 4WKZA 2WBXA 1AR1D 1QA9B 1QBBA 2C3VA 1BWMA 2DLGA 3D7PA 4LL4A 4NUGH 3WE6A 4JRYE 3KR3L 5EZJB 4U6YA 4ZZKA 1BCIA 2NNFA 1MLBB 1NUNB 1YEWA 5C0CD 3SDXE 1ZS2A 3S98A 2ED9A 4LL9A 3FF7A 4BQCA 2GPZA 4R5XA 5HI3C 5BV7L 5BRPA 1JZGA 5T1KB 1RMFL 3ZDZE 4QGTA 3T8XB 4UAOB 5ID1B 1M42A 1NL0L 1T20A 2VDOL 4R7DB 1AYOA 4PJ7E 2D7TH 2V2TB 3U6RA 4K7PH 4C4KT 1BBDH 1GCYA 2WIIB 1LJMA 3D4CA 3DVNA 4A37A 3B3BA 5GHWH 3QEQB 3WEAA 2EDHA 3HUJE 4X8CA 1JP5A 4MQ7B 5CUSL 3ABMB 3GF8A 4K9JA 1CMOA 4UIKL 5JW5B 3U6XS 3BXNB 5I28A 4YWGH 1OE1A 3AQZA 1UQSA 4NQUA 4BZ2H 1QSEA 3TO4A 3Q2VA 5BW7A 5CKAA 5B3SB 1EAQA 2J1ZA 5CU9A 4ZRGA 4HIEA 4YXHL 1X5LA 2O61B 3D2UA 4LCCC 4FTVD 1QWNA 2HTKC 4HS3A 2EVFA 3IJYA 1ZKAA 2OSLB 3LPGA 2P1YA 3T6XA 4YAQA 2VISB 2WSPA 3OZLA 3ZRCC 1C5CH 4FXLA 1WC7B 2WLIA 4WSGA 1DQVA 1ZLEA 3FRUB 2VQUA 5IROD 5I1EH 4FZ8L 1ZV5A 5F89A 3B9DA 3IPEA 1BZQK 1RZPA 3T71A 1CYWA 1GSMA 2V4LA 2MQ3A 1IE4A 3L54A 1OAQL 2COQA 4YDMA 4PJ9A 4LSVH 4PS8A 4TV3A 1G7JB 5D1QA 5DO2C 1FFOA 2XFGB 4GRLA 5FYKL 1UWFA 4ATTA 3HC3H 1QLFB 1V8HA 3LH8A 3BDYH 4OH2A 4BINA 4JFDD 1U8OA 4HIPA 1LQBC 4WU7B 3C87A 2HKHL 3FOLA 2QADB 3O0RL 1UWXH 1Y7VA 1HT6A 2R4RH 3KM1A 1B9ZA 2ZUVA 1VJSA 3GMLB 2AJYL 5I1IL 2IPKB 1ACCA 1I1AC 2AI0L 1AOHA 1PTZA 2ICCA 2ZSWB 4X0KB 3EYOA 3VG9C 4GMTL 4GFTB 4Z7WA 5BQDA 5K9OA 2X4SA 3LRHA 3PDGA 5EDXA 3D07A 3EGXA 3SBWC 2IPUG 4YH6A 2EUVA 4HZAA 4YR6A 4OKVB 4YBQD 3NACL 5KBPA 5C0JB 4FYRA 4P59H 3RVUD 2BZ7A 1PF3A 2IAND 4HV8B 5HYJE 3DJZA 1BW8A 1RZGB 3RI5K 1CYGA 4MJIB 2EDDA 2JLPA 2VITB 4HUVB 1AXIB 1A7QH 1AY1L 5DRNB 3CPLB 4WHYG 1Y6MR 4IIQC 4HJ0D 1KTBA 4I0KA 1HZHH 5D7IB 2WXQA 5I8EA 3U0TA 2A9CA 2B15A 2PP8A 3JQOB 3N1FC 4IU3A 5E6UB 3WFEL 4BH8A 4JFXB 1SOSA 2LAAA 5J9PA 2BVUA 1T1YB 4HP5A 3WAKA 3ZT7A 1XH2A 1MY5A 4NP4L 3IJSB 3QZLA 2H7WA 3QFJA 3BQVA 1ZVSA 2QQQA 2BWDA 3CN2A 1K4DB 3AGWA 4JKLA 2PF6A 2A38A 4JX0A 2EP6A 4DUXA 4DQAA 3ESNA 4OLVL 4AUUA 5E08L 2WW8A 2VLJB 3REVB 1SLVA 3CXFA 2W0KA 1E50A 3GHPA 3I75A 1I8IB 1UB6B 2XTLA 3HR5B 2BY3A 3T0EA 4RFNC 3K6FA 2V9TA 1N67A 5ISZA 3EJZC 3DECA 1VSCA 3MRCB 1W15A 3NFPB 1FZOB 1D9KA 4J7RA 3CXHJ 3HPLA 1AS8A 1S9XA 4M1DH 3ZDXF 1QD0A 1NCHA 2DQFA 4LLVB 1D5ZB 2YFOA 1DP0A 3PJSA 2CDGB 5HDBE 4JG0L 4N5EC 1DVZA 1KFAL 1M9WA 5C3TA 3DGCR 1M7DB 4PJGB 2VM9A 4PWHA 1BFOB 6FABH 4JFED 5FUZH 3T6QC 4YSAA 1TTGA 4GW5A 3L3GA 4M43H 5CGMA 3WDIA 3V0HA 1BOGA 3SDCD 2HVKB 4POZD 4Q6KA 3QFDB 4JM4L 3AAZA 4ZMAT 3T3MB 1INQA 3KEDA 1KLFA 1QACA 1TVBB 1KCVH 3WXVH 1CLZL 2WVUA 2AQSA 3BKMH 4JY6A 1INDL 1I1FA 2GB2A 2NSQA 3UXFA 3S5LA 4DTGL 3I3EA 3L2NA 1RZKH 5E8NA 4OM0H 1KXVC 4NJAH 2CCWA 2XQYK 4KHXL 1ZPUA 3F7VA 3IXTB 2EEFA 2NY7H 5LBGA 1KENH 1L6ZA 4PU2A 3IJHB 2A6DA 5MENA 4AMKL 4G8EA 5SWQB 4KHTH 1FVEB 4LCCB 2PUQT 4FEIA 5EIIA 1AS6A 3L8QA 3QEUB 3FNKA 2VXTH 5DUPH 1UWXK 1G6RB 2G30A 3BVXA 3EBIA 1NCOA 3DOSA 3LVEA 4GKNA 2FTAA 3G08B 5I8OH 3TFKC 3LD8C 1AR2A 1KBGL 5CNHA 2VERN 3NCYP 5E8EA 2VJ0A 4G8IA 2SODB 4WEEA 3NFNA 3SDAA 2TSBA 5JYLA 2WNGA 2JQZA 1K8IB 3LRSB 1GC1L 1KCSL 4YZFF 3RPIA 3VFSA 1FL3A 1Y6KR 1AP2A 2IG2L 2Q76B 5EBLB 4XP5L 5C0AA 4RVBA 1TU2A 3SODB 5D2NE 2FRGP 2P48B 3QHTC 2KDGA 3ESMA 3PHSA 4I0PC 4MS8C 5HDBF 3MV7B 3NZUA 4I2XE 1B3JA 1YA5A 1IBGL 2PYEB 2CM6A 2R29A 2GC7C 5T5FL 4IOIA 2ICWA 2QQLH 1A6UL 4HLZH 5C09A 1OT4A 4CNIB 3VWJD 4ZMQA 3MXVH 15C8L 3H4HA 1LEGA 1W0VB 4X7EC 1JFQL 4QHUB 5CSGA 1HCZA 3QEHA 4HJJL 1I1AB 4ZODA 2ZAGA 2HJFA 2OYKA 2VAJA 1MI5B 1T3FA 3G6AB 3B7TA 4IBSA 1E6JH 3GMRB 1H9DA 1F4HA 4ZMVA 2BXZA 3Q0HA 1JPFA 2Z4QA 1YPZF 1A9BB 1KIQB 3CD4A 3FQRB 1NDGB 5CEXA 2J8UA 3AG2B 1ET8A 1CICC 1BQHA 5DI8B 5FKAB 3TA3D 5E5UB 3GKWH 2BVOA 4D0BA 4AI7A 1IC1A 2NSXA 1MCRA 3PQYE 1D5RA 3NMEA 1JSYA 3PABA 2Y07H 1OP4A 4ZFZB 4OUOA 2BJMH 4PBXA 1GGCL 4MLIA 4LK4A 2BIIA 3M8OL 3RUGA 2NTFB 3U7YL 2W9DL 2O6EA 1RJLB 1UACH 4MAZA 4RFOH 5GZND 4IIQB 5IREA 4HK3N 1W6LA 4NO2A 3OGCA 5DCCA 4DJMA 4TLUA 4J3VA 1ES0A 5T1LD 2CGYA 4WTXA 1PW3A 4BKSC 3CH1A 2WTOA 1AGBA 3FUJA 1FN4B 1IFGA 1EDYA 4MJ6A 5HYSG 4O00A 4ELME 3L3JA 3MROA 1WV7T 3DSNA 3MRGA 5E1GA 1ERNA 3STZB 2RTTA 2YLKA 2GYSA 3GZKA 2X6CA 4FZEH 2HRHA 3E6HB 1QKZL 3VFNB 2CK0L 4Y7MA 1C7TA 3CCHA 1B0WA 3O4LA 2BHYA 4HFWA 1DBML 2H2SC 3NGBC 1U8PA 4XXDA 4JGMA 5CCHE 5BOZG 3BH4A 4ZG1A 5IBTL 1SY6L 2VLKA 3INOA 3F2LA 1CG9B 4WEUD 2OW6A 4M7LH 2X1XR 5HSFA 3QRBA 2BCKA 4XMLH 2OK0H 5IQ9A 4MAUL 3VFRB 3KEHA 4ODUB 3T08A 3MV9B 3QORC 1N59B 2GIYA 2SEBB 2VXSH 2ZAIA 5CS7A 4YPJA 4FNLL 2GY5A 4DKDC 4P2YA 3BKCH 1KGYE 3CZSA 3IU3B 4GXVH 1C12A 2R69H 1Z9SB 2Q3XA 4KK5D 3WMSA 2IH1A 3C8DA 3K72A 3QCVL 3VI4F 2R2BA 3MAWA 1G7PA 1Z9LA 2LGNA 2WGXA 4ZSOE 1LE5A 3A47A 4DZ8A 1CK0L 3EJSA 4LQFL 2BSEA 2X53A 5AKRA 2FT8A 4G72B 4BDVA 1T0MB 3VMOA 5L88H 43CAB 5IIEA 4MDRA 1CLYL 4NQDE 4AQAA 5D6DC 4JO4H 1HEZA 4PRBA 1Q1JH 2JJTA 2J21A 2WZAA 3TV3L 1F6AB 4HA1A 2WO4A 5F1NA 3ARBC 2J6EH 5HDQH 2G75A 4AXWB 1VESA 3E3QE 2VXQH 5LWYH 3SJVE 3L3DA 4F2ME 2OJZH 1BSIA 2ZYHA 1LK3L 4BWUA 4LEOA 4A6YH 2P5WE 4U3HA 3FSAA 1TKWB 4MA1C 4Q9QH 1A1OB 3LD8B 2DTSA 2ZJSH 4ODBD 1MVUB 3QG7L 4YDVB 2PPFA 4YBHA 4QHLA 4E9XA 3DTXB 2Q7YB 2L3BA 4KO6A 2XZQL 1U42A 3TS8A 4NO0B 5JQ6L 1Q9OB 3E1F1 5EOQH 4FMFA 2FJSA 4DCQB 3STBA 1RZJC 3LDBB 3MJ8A 3Q1SH 2QPFA 1LMIA 1BQ5A 4WKXA 1DUZB 4EIBA 5IESL 3LPPA 1U2HA 1DJZA 1GS8A 5F97E 4WHYH 4XCNB 2VWEC 2QVMA 2B5IC 2I24N 4I0PB 2J55A 1IC7L 5DK2A 5J11C 2IAMA 4Z7AA 1BVNP 4MBRA 1U8LB 5DQ9B 1XGUB 1MVFA 3AQXA 1UCBH 4TRPL 3FQNA 4QRRE 1CZ8L 2E74C 2K3HA 4OIIH 5GGQL 1NGQH 3GSNA 2YEVB 1XCXA 2VXUH 3DO4A 4GI8A 5BZDB 6CGTA 1WWAX 1FH5H 3KM2A 3GHBH 2DEXX 1A6TB 3KGTA 3SPVB 5I17B 2CRZA 4ZJ9A 1CGTA 1PBYA 3RVVC 4DAGL 1AXTL 1ZTMA 4Y1SA 5C08D 4EZKA 5JPMA 3U1SH 5EUOF 2GFBA 4PV8B 1G6VK 2WLJA 1BD2E 1XL6A 1I85A 2EDNA 4Z7OB 4P3DB 3WS6C 4BEIA 1WPCA 4Y8AA 1CICB 1TR7A 1HKLL 4DW2H 1AKJA 2P5ED 3WEXA 1BECA 2O6PA 2X4TA 4LPVA 1WISA 1R3HB 3VWKD 2C9SA 4AK2A 2YARA 2L0DA 4H88H 4ZNCD 4L8CA 4FKKA 4NHCH 2W65B 5CIPB 5B7MA 5C6PB 2RH0A 4WDIA 4CJ1A 4ZPVB 4X4MA 3O2WL 5FK9B 2YAQA 5GS0H 1OF0A 4I3SL 1MQKH 2VC2B 2NY3D 3EYFB 3UTSB 3W2DH 3EO9L 2NY2D 5AYUL 1JCVA 1NCBL 3JV5A 3PIQA 3U1PA 1IM9D 3N55A 4K15A 2DQUL 3RVXC 4D8PA 2HG5A 1XH0A 4PJDE 3MRMB 3RHWK 2I9TB 1MWAH 2IWFA 5LN8A 2NW2B 4KTEL 3SIKA 3OXSA 1DJHA 3CSTA 3NH7L 1FV1B 4ZTPL 3V9FA 1IGJB 3F58H 3IN0A 3QXWA 4U6HA 5E1AA 5KS9A 3W0WB 1KYAA 5GGTL 2VGLM 2DRUA 1PLGL 3E7JA 3GBMH 4H8WL 4ELKA 3Q05A 4RRPA 3BQUD 5EU7E 3BFOA 3BP4B 4TS6A 2H3NB 1XGQB 1YO4A 3MZTA 4F5CE 1N0XL 5GRVK 3NGBB 2P7TA 4DUWA 1DJXA 1QAWA 2J5LC 3MRDA 5E6IA 3BWUF 1NDTA 4LP4A 5HDLA 3G7TA 1NLDL 5A6IA 1CS6A 3UZQB 2DQGH 2HFEB 1DQLH 2DF3A 2IMMA 2JB5H 1JI2A 3FTVA 3NFSL 4WTZA 3RTQD 4AEIL 4PYGA 4P5TD 4N28A 4DWHA 3WIHA 3APNA 4P2OB 2BNUB 3QORB 4HT1L 5DUML 4ECNA 1MHPH 1T21A 1RVFH 4JHAL 2ADFH 2WXMA 5F9OL 3FRPG 3SSGA 2H32B 1HXKA 3VH8G 2X4OB 4KFZC 1INEH 5SX4H 2Z1KA 1IE5A 3VACA 1CFBA 1FNSL 2QMKA 1QUNA 3KVQA 1CFQA 4UM8A 2GABA 4AYFB 3T0VA 3FHAA 2IPUK 5SWZA 4NZUH 5F0PB 5KBNC 3U9PL 5F7AA 1IBZA 3O6FD 4K3EH 1F45A 1K9TA 1MPAL 2W9EH 1JD7A 1LE9B 1NTDA 3D50A 4QJ3B 4GKZB 5IJDC 3MLUH 2A9ML 1Q9KA 4X6CB 4PJDF 1N7MH 1V5JA 4OFPA 2HAZA 2HJLA 2Z91A 1KPRA 1UZGA 5DFVD 2RQ8A 2GJ6A 1YYLH 4FYTA 5DJ8B 4AQ8C 4MNGB 4UINL 1CIUA 2ENYA 4KOCA 4HHAA 2IPTH 4LBEA 1XR8B 3ARBB 2VLRD 3BWZA 4IGBA 4PRIA 3WTSA 4S0HA 4X7FC 3AFLA 5BRZE 3R7RA 5L2KE 2CDEB 4QRUB 4GT0A 2H6OA 3ATAA 1EXHA 3FU8A 4MA1B 1LDPL 2AAAA 2LABA 3ZYOA 5CN1A 1D6VH 2N59A 1QA9A 2AEQH 2DQTL 1W0WB 2K0RA 4HWEL 4QXUH 2JIXB 4H26A 4ORGA 1BAFH 5LN4A 3QXDB 1MLBA 1T1WA 1N26A 3N42B 1ACXA 4JG1L 2CGRL 3V10A 4WWOA 3NJLA 4H4NA 1VDGA 3KL0A 2N56A 2JCCE 3MCLL 3CSYB 2F5BH 5IHHA 1Z9NA 4XAKD 2B5IB 2OMVB 5ID1A 1SYSB 2WUBH 4XN1A 3SBPA 4UQ3B 4R7DA 4B9YA 5J11B 5I1JH 5DT1H 2BLFA 3MOAL 2EDLA 1HAWA 2WIIA 3SE3A 4JUTA 1IT9H 3IK2A 4F33A 1Q1PA 4GSDH 4IHBA 3HNTL 1BHGA 3QEQA 2BWIA 4YXLL 1JI1A 3LY6A 3MO1B 5IOPB 5C2BH 5PAZA 4I77L 2VDOB 3BSZL 3B83A 4XPFH 2NX5B 3UPRA 4OLXH 3QDGA 4R26L 1F97A 1XB6A 2X1PA 3QJXA 1GJUA 4HWZB 2I5YH 2IADB 1WAAE 5LCVA 1D6EA 1AGDB 3QPQC 4H8PA 2UUDH 5C07E 4NQCA 4NN5C 3Q44A 4XP6L 2O61A 2ZKXA 5J6GA 1H5BC 3QARA 4JFVA 4KQ0A 1J12A 1S8DB 1R34A 3K46A 3K71A 2YGVA 3BEVA 4OY9A 4N4YB 4D7PA 2FT6A 2A4CA 2HG0A 3DJRA 1YEGH 1NIEA 1HH6A 4PS4H 1E4JA 1I8UA 3M17B 4AKOA 1GGTA 2A74A 2WYIA 2UXGA 4JRYD 3Q8CA 2K8MA 1WC7A 4JHZA 3MFGB 3AXHA 3AZUA 4QXWA 4BXSV 4HS8H 3MA7A 4F20A 1QNIA 5HYSA 3F6IA 1UWEL 2FECL 3G04B 4YOKA 2VQ1A 1IC0A 3P9LA 1VPOH 4ANWA 3UEQA 1VIWA 3D25B 1V27A 2XIIA 3FUNA 2EEXA 3F12B 4JO1H 5C0BA 1GC1C 1GKEA 4Y4KA 3DX6B 1VFMA 5IFAH 1MY7A 4L4TB 3AREA 3EYVB 2JCCF 1M2VA 2EH7H 3VW3H 3FS9A 1E8XA 4JM2C 1ZHNB 2E56A 5DHXB 5LGYA 5E2TH 4CSZA 5I1DB 1LK2B 4M5SA 1NGPL 2IPKA 3BUYB 1VENA 3LXAA 5I1AB 3TBTB 3WEMA 2AEPL 3QC6X 2MEJB 3CXDH 4NQXB 4HQQH 4W9CC 2E3VA 2J5LB 4ZX5A 5AL8A 1RZ7L 5EU5A 2C4XA 3LS5L 3SDDC 3JWNC 3C5XA 1MW2A 4H20H 1A6VL 3LEYL 4YL4A 3MX0B 3G6JF 4HJ1A 1T4KB 1DSFL 1WAAF 3A67L 3BP7B 3TJPA 2YMTA 4GIAA 4HV8A 2OZ4H 1N64L 5D7JA 2UWEF 4BZ1H 1DSWA 3U9WA 1RZGA 2VDLB 1SXSA 3X2QB 4MJIA 2A9NH 1KZYA 1BOYA 3UP1A 2CUHA 4AEHL 4HUVA 5E6YA 3WDJA 5DRNA 2PPEA 2B16A 2LU4A 4IRZL 1A6WL 4ODHH 3CN0A 4TUOB 4ZPTB 2Y5TB 1T4WA 4O2FA 1GGIL 2JXMB 2PWHA 5D7IA 3ZYZA 4XRCB 5AVXB 2D3JA 1QRKA 2EIKB 1B2WH 5I6MA 3IAPA 3N2JA 3OF6D 4JFXA 4U1HB 1MJUL 3WKPA 3UPAA 1BJ1J 5E99H 3PGFL 4K8RC 4AEEA 3IJSA 4ILDA 4PJCE 1AZCA 5D2LE 1CF8L 5H37A 4NWUH 2IQAA 3T2OA 5FHAH 4AJVA 4U6XA 5DS1A 1WFOA 4IDJH 4IKIA 5CJBA 3E8VA 1AMXA 4TUKH 2ZXGA 1QABA 3MXWL 2VLJA 4D3CH 4J3OF 2P45B 2BNQA 4HW6A 5I5RA 5DHEA 2MSPA 1UB6A 4LSDA 3DBXA 1E6OL 1U3HD 1CU4H 2V5RA 4F3FB 1LGVA 2IWKA 3ARSA 1EHXA 4L0PB 4EKJA 3P3SA 3K2UH 3DSFH 3VNYA 2Y6SD 3MRCA 3U2IA 4LARH 1CL7L 3ME0B 1VFUA 1MF2L 2XX1A 2XXCB 3BUBA 1ZGLB 1T7XA 1E4XL 4LLVA 4M4PA 3BAWA 3RKPA 4Q8BA 1SXNA 3GFUA 3F7RA 1C5DB 2UUDK 3KLHD 4XPBH 3TCTA 4MA8H 1XF1A 2XWJA 5FM5O 4D0CA 2FBRA 2BP8B 4MRCA 1WBZA 4HCRA 4P9ML 1BF8A 1O7DC 1EEYB 5B22A 2IALA 4S10A 1KCUH 4R2GC 3FO2B 4ZS7H 5HGAB 1MREH 1YMHB 4N2BA 4PGBA 2FX7L 3AT0A 1T89C 1NUGA 1YYCA 2HVKA 3R8QA 3QFDA 1KPVB 3N50A 1J9CT 3JV0A 1TMQA 3CIQA 1RUKL 3EFDH 4HWBL 3GK8H 1VZGA 5K1VA 3RY4A 4R4BB 1JZ3A 5E51A 1QWUA 1RPUA 3ORJA 3ARXA 2MPAH 4AIZB 1I8KA 2D0FA 3ECBB 2YQGA 3A4DA 1I9EA 4ZNEA 4WWKC 4C56B 3IJHA 4NN5B 1YY9D 1LO0H 1KTJA 5SWQA 4FP8L 5I1GL 4OJEH 5LNGA 1H5BB 4DKTA 2NYYD 1JGVL 1FRGH 3QEUA 3VSUA 4YNYA 2L7QA 1AOZA 3CWGA 4I3RH 1AC6A 2NMSA 2FR4A 5C0ND 5C70A 2W07A 3G08A 4JQXA 2YPVL 2D03H 1U8JA 1G7LA 4OGYL 1GGBH 4WFFE 1RZIB 4R84A 2GHZA 1IFHH 3QQXA 1JRHH 4WI5A 4ONFL 3T4YB 1BM3L 1SBSH 4K5MA 2DL2A 1OGAA 2Q76A 4OB5H 5EBLA 1MFDL 5E56A 2GY7B 4OZFG 2IQ9L 4DGIH 1Q90A 2CIIA 3QI9C 4FNPA 4Z8FH 4YX2L 4Q14A 3VD9A 3EH1A 2DWTA 3ABKB 4U6VH 1EJOH 4HUXB 3EYQC 2J4WH 4OLZH 4AQEA 2YPLE 2ZOKB 1HL8A 2X88A 2ATKB 2Y7LA 3LPFA 4N0UA 3VB8A 1X5IA 4JM2B 3CLFH 1EFXA 3WJLA 1W0VA 1FORH 1XSIA 3DIVA 5EO9A 2IDQA 4TQEL 4B96A 1I1AA 4R97C 1PY9A 2I7SA 1Q0XH 1QFUH 3O41B 4NUQA 2D8KA 2CO7B 4AQOA 3QJUB 2A83B 2KHAA 3BD4A 4I87A 1BPVA 1JYWA 2B9AA 5FFOA 4FADA 1RLWA 3H55A 1KIQA 1UM5L 1J86A 2H3XC 1ZTXE 3O6LL 3TJEL 3SBWA 5SX5H 1YN7B 1HXMB 3CGTA 3CZEA 3P2TA 3BISA 4KTYA 4HKJB 4DGVL 1O7SA 5TE7L 4JREC 4LSUL 4M7JH 1NZRA 3BEWB 1MLCB 5J1TC 1J0JA 1TFHA 4PFEA 3AMKA 4MDIB 2E4TA 2EE3A 5A3IC 1ZANL 1TZGL 3PRZA 1I4FA 5EO1B 3FMGL 4KZDH 4IBWA 2O5ZH 4G6FB 3H0TB 3S8GB 4ZDHB 1UD3A 1J5DA 5F7NC 3FFCD 3RVTC 3W9DB 4AG4L 1FN4A 4NCC1 2NNAA 4JZOB 4JDTH 4L4VD 3TPUB 3UYOD 5JZ7C 4EVNA 3X14B 4XWOC 1JNHA 4N6RB 1FSKC 1DJIA 1TVHB 3WO4B 1R5VB 3GT6A 5F7EH 3W1ZA 2HFGL 4A7QA 4DP1X 5FEBA 4BGDA 4ZFGL 2AGJH 5MEQB 3MHZA 4JR9H 5FGRA 1NWOA 5IB4B 3QIWC 2PYFA 3QIUA 4G3YH 1NAML 3KGUA 1LL1A 2BW4A 3NJNA 3QRGL 3VFOB 4FXKA 1CVSC 1WCBB 1K3IA 5AL0A 4DP6X 3O2DL 2P42B 2YUXA 3LH2L 4ZX4A 5CJQH 3VXTB 4W9HC 2DKMA 4TYUA 5SWSE 1P7QD 5E03A 4S1SH 4A7SA 1AI1H 3CUPB 2MCPL 5B1JC 4F7EA 1PFOA 5CGTA 3HG4A 2X2IA 5EBWA 1T2QH 4HSCX 4ODUA 5DJ6B 5TE4H 3OD3A 3C6LA 3PJNA 1SMAA 2WAHA 4KTDL 5KTEL 4KKLC 4PJ6A 3UTTB 3B2VH 3LIUA 3IU3A 4HLJA 1IRAY 4Q97A 1XZWA 1Z9SA 3MGTA 4R2GB 3NVQA 5JO5B 3H3BC 5IT2H 1AH1A 4IQHA 4XP1L 1C1EL 3ZIMA 1X5HA 1NPUA 2JELL 1UXLA 2F61A 3RJQB 4FQIL 2WZ0A 2W91A 5FDYA 3EJPA 3QULA 5EC2A 1OCWH 43CAA 2Q3AA 2Z31A 1QRND 3Q2WA 3IGKA 3LHPH 3VM7A 1DBBL 3G9AB 3MNWB 3BIBX 3O3UN 3I84A 3VD4A 4M7LT 1TQBB 4MBOA 5GGSB 5I19L 3L1OL 5AQ0A 4WWKB 1F6AA 2Y2WA 1TZIB 3PDOA 3TIDB 3SCMD 1UOLA 2XX0A 3ULSB 3A3YB 1HYSC 1F58H 1ADWA 5E8DL 1QUPA 1MRCH 2YMXL 1HL4A 1WBYB 2ZOTA 4RNRB 4QRPE 4NNPH 5IW3A 4HEMA 2X6BA 3QUMA 1S3KH 4XC3H 3H85A 3HC0B 1MCJA 3FTWA 5CCKL 2Y3NA 4UQDA 4KH9A 3DTXA 3GRWA 1OK0A 1X5GA 2Q7YA 4I88A 2CRIA 4NO0A 4DP2X 2KLTA 3IMRA 1CBVL 3C08H 4PJFE 4V1DB 3I9AA 3FT2B 1KC5L 1VADB 5SX5K 4IEFB 4ZUWA 3V9CA 4N26A 2Z8VC 5D1XE 3RKDD 5JLZB 1LMKA 4IOFD 5AFAA 1YJDC 1MJ7H 4XCNA 3QI9B 4WLCA 4X98B 5L4MA 4HKBB 5G4MA 5FPIA 2W8CA 1YNLH 4KROB 5DQ9A 1GCFA 1ADQL 5DFTA 3G6DH 4U31A 3CHPA 3EDJA 1HH9B 3OG6B 5HHPB 3WHXA 2HUEA 3ZU8A 1FG9C 2QT6A 5CILL 2VIRA 5T3XE 1CWVA 3F7YA 3HAEG 1ASPA 1QW8A 5BZDA 3HZYB 1LP9E 4UF7C 3OKOB 1E90A 5IK3A 4KKNA 3WY1A 1KNOB 3GDBA 2IDTA 5I17A 1SEBB 4GI6A 4KU1A 4MNQE 3TZVC 3HJEA 3ILPA 4F9LA 3KZ8A 1TXKA 4PV8A 5IOKA 4X7TB 2JFCA 1DQQB 5DJZA 3QSKB 4N2EA 4P3DA 3TH3T 1J9TA 2W5PA 4M56A 3ULVE 1W72H 3APCA 1CICA 3SGJC 3IGLA 1GMIA 3TP4A 3ARDD 2K8QA 2VDKL 1R3HA 3LIZH 3N1QC 3B1UA 4OU3A 4JREB 2W65A 5CIPA 2RALA 2MTPA 2R0WH 4ZPVA 3ZDYF 4Z0XB 1ZMYA 1EUUA 3LNIA 3AY4A 1KIPA 3ZVVA 2EDOA 3II1A 3RWGB 5IV2B 4HGKC 2NQCA 2M1KA 1FBIL 1CDJA 2VR4A 4PJBB 4TNVF 3UTSA 4OM1H 3EJQA 5I18H 2N1TE 2O6FA 3MRMA 2I9TA 2IVFC 3KMDA 2Z92B 5BVPL 1PAMA 5AVQB 3DX8B 1QVOB 1DL7H 3SGKA 4JFQB 1RK0B 4PJFF 3HW7A 1FV1A 1QX1A 1SM3H 3DVFA 4X7SL 2DN7A 3HI6H 1FSKB 5FYJH 2ATPA 1EAJA 3W0WA 2DM4A 3PYCA 3ARTA 2UX7A 3EJJX 5TK2A 1S78C 4QR7A 1XHHA 3QIWB 3WLBB 4OGXL 3MLRH 1FDLH 4OF7A 3HZKB 4KQ4H 1XGQA 4PTUB 3JV4B 4GP8B 1X3DA 3KPPB 2O5XH 3LNHA 2IFGA 3U9UA 3L7EB 1LHZA 4LCWD 3T4AA 3L5WB 2D7PA 5F7WC 1QSEE 4UQAA 1G9MH 2COVD 1CURA 1AIZA 1TQTA 5D7SL 1G9NL 3CZUB 4LHUB 4R83A 5T3ZH 3K6DA 2R39A 5E4AA 1J0IA 2OR7A 1AHWC 4N24A 1AGEB 2D4DA 1F6FB 4WJ5B 4OZIF 3INUL 1E7UA 2X4OA 3FCUB 1ED3A 3CK0L 3QUYA 4I9WD 4QOKA 3CHSA 3N06B 1MHHA 2Y06L 4AYFA 1EBAA 3RU8H 2HT4C 4QKXB 4J1UB 4RMTA 1SVCP 4F58L 4LASL 3P4OB 3D18B 4HUMB 4QAMB 3U7WL 4A39A 3UAEA 2Y6TE 4OZFH 1Z9OA 3UP6A 3VFGL 2DLHA 1JNNH 4QHKI 4ZUUA 4WY7H 1N2RB 1FFPB 1F8TL 4HUCA 4NN6C 2EDKA 4KMTH 4YLBA 2WKOA 5FYJU 1JHKL 1FJ1B 4N8UA 3RX9A 4NOFA 5D6DA 4UTCA 2ICES 4AVJA 2NY5L 4NUJB 1YQVL 4WHTB 5DJ8A 5JHMA 4MNGA 1V54B 3DARA 4NKDA 4MJ5B 3BRDA 4KO7A 1BFSA 5JXAH 3BLBA 2P8LB 3SKOA 4NWTL 3ZIYA 2BX5A 3RI5F 4F8TA 3R4DA 1BQLL 4JY4A 4UQ2A 2CDEA 4NAMA 1U3JA 3UCRA 1YRKA 4NZFA 4XMKH 1G9HA 1BJMA 4Z7WE 1V3MA 4M48H 4PRPD 1OSPL 4QNPE 1A9EB 1JXDA 2QSTA 4R3SA 2AS5M 2JIXA 2Y22A 4N1HB 5I23A 3QXDA 4JCMA 3VRIB 3TVMC 4A67A 1T6VN 3B34A 2PXYA 5DC2A 2GT9B 4Q7DA 2ZUWA 2CMRL 4FHJA 4WI7A 5CZVH 2F74B 5ICXB 1F6LL 3CSYA 1EEZB 3MC0A 3QDMA 4C54A 2VRKA 5DURB 1W6WA 1NBYB 2ZD0A 1T66D 4UQ3A 1KB3A 1A6PA 2WLLA 3BT2L 1GYAA 3RILA 3KPRB 3O6KH 1UWGL 2OS7A 2WQWA 1MAKA 5K9JH 2NDGA 1CGWA 3C8KA 5JPNC 2E7HA 5IOPA 4W9LC 4KGJA 3M1CA 2VCOA 2X89D 4P4KD 2D9CA 1WFMA 3ZTDC 2VDRH 5G5DB 3GWJA 4ZX6A 3L9BA 4PB0L 1AQ8A 3TZVB 2YPKB 3QFJE 3O3AA 1BEXA 4L5FH 1XGYH 2IADA 1AGDA 4NDMA 2DWSA 3KYNB 4M00A 4U1LA 5D72L 2QLVB 4GRWE 3WS6A 2BY0A 3UROR 3S36L 3KVPA 4CBZA 5L2KD 1GYCA 4JKKA 4QXTB 5FGCE 4UZUA 3HMXL 4N0YH 3T0EE 2NZIA 3MBED 5SV4A 1KN4L 5ISZE 4LF3A 4CMHC 3VGHA 1DEEB 3PV6B 3DETC 1OAUL 5I30H 1MKFA 3SPIA 4PBDA 1J1OH 4XPHL 2ZG2A 3AWFA 4G6MH 2HLAA 3CVBA 3MJ7A 1V05A 3LYRA 3D87B 5GRUL 4Z7WF 2O26U 4G9FB 4H0HB 3NJIA 4F80A 3UG5A 1SEQL 2H9GA 3BUTA 2DJUA 2EDRA 4AIEA 5H4YA 3D25A 3TEUA 1TT6A 5HPOA 3QHZL 3EHBC 3GMNA 3HUJB 1G0XA 4L4TA 4M6MH 2GSMB 2VDMH 4GH7B 4AT6A 1EX0A 1BVOA 4WFGD 1Z1WA 1FGVH 4BUQA 1P2CA 4KKPA 4PG9B 3QJFA 1LK2A 3C9NB 4JZJC 5DMGD 3IVKB 3BUYA 35C8L 3CBKB 5F8QC 1T7VA 3NZ8B 3SKJL 1WEJH 1IEAB 4S1QL 1PNCA 2C1OB 3LHAA 4L1LA 4ISVB 1FO0L 4P2QB 4QLRA 3BGFC 1TEFA 5LXGL 3C5JB 4X6EB 3S3JA 4U1MA 4K7FA 3I50L 3VA6A 5MENE 3QQDA 2Q2EB 2WJ5A 2VDQH 1T4KA 4Y19A 2FBJL 5CGYD 7PAZA 3BP7A 3OXRA 3MPCA 1JE6A 1QTPA 3GHEH 4GRWF 4YZWA 1AHWB 3VU2A 1MIML 3QPKA 4AVKA 3QT2A 2CRYA 2YQBA 2LLNA 1U8HB 1LXMA 1NCGA 4DGWC 4BE6A 4LOEA 2F1BA 4TUOA 2GG1A 4Q0XL 2Y5TA 4JGNA 2JXMA 1M1XA 1S7TB 3SPCA 2VE6B 2QELA 2BXYA 4KAQH 1YUHB 4JDZA 3C75A 4GLRI 1U58B 2VR3A 4U1HA 5C0AE 3WNMA 2BIMA 3MRKB 2C8NA 3H9SA 2FWOB 5L4FA 2IXQB 1WFIA 4NN6B 4UB0L 1ZS8B 5E8PA 3MACH 2WUCL 3SE4C 5EOTB 4LSSL 4Y5XA 4YGAB 5ADPH 1TJIL 3GC3A 3HAEH 1ORSA 3UGUA 4Z1PA 1FLRH 3MV8B 3NA4A 5AALA 4AQ8A 5C09E 4KJYB 1V7NH 4CAGA 5ANHA 1R3JB 3TBYB 1IGMH 2EIMB 1DQJB 3ZDXB 1I3RA 4UBDD 3F01A 4XN2A 4EO5A 3S34L 4F3FA 3GSRB 5E2VH 1AXSA 2OSXA 3ZR5A 4U4IA 5HHXH 1KULA 1G4RA 5HYJB 2OULB 3ME0A 1EMTH 2J8UE 4M1GH 1ZHKA 5C0IB 2AKRA 1HHGA 5B7EA 3V0JA 3NAAL 3PAUA 1EZVX 2V33A 2DQHL 3Q5YA 2CO3A 5HJBA 3WIAA 4AUJA 3OG4B 1C5DA 1RJYA 4QTHA 3L81A 5DD3L 3TVMB 4AYID 4HBQA 3ZX1A 3H9YA 4NQED 4ENZA 3JZ7A 3QIBC 4XBEL 1MNNA 5GS1C 5HI4D 4F24A 1RZQA 3RUGE 4POUB 1JGEA 4APXA 4HVBA 4NXKA 2UZIH 3QWRA 3GO1H 3FO2A 1MW3A 3NPSC 3MRBA 4XN9A 2Y36H 2CIKB 2KBGA 1YMHA 3V52L 3X3FL 3ARQA 4HOZA 3PWPB 2JE8A 3LKRA 3H7LA 1CFTA 1N5AB 1KPVA 4YVNA 3VXSD 3DX7B 1QI3A 3MNVA 5DUBB 1QI5A 5DSCA 2AP2A 5JPNB 3IKCB 2EXYD 4GQRA 4YHOL 4Z18A 3D33A 2GAZB 3C6SB 2WANA 1H3PL 1K72A 4GOSA 3ECBA 4LMQI 4GQQA 3AB0C 4KVNH 4WO4D 2XQBH 2ALWA 5IEHB 1OY3B 2C3HA 3SY0A 1CVRA 2YEQA 2F53B 4OCMC 1K2DB 5AOMA 2X0UA 5EA0L 2ISDA 4EBQH 1H5BA 2FNBA 5JHDB 2ATAA 5LDUA 2NZ9C 3O4LE 1YMMD 2WNWA 4TVSa 3UABA 3VE0B 4OD1H 3HE6C 1BLNB 1NCCH 2CBOA 2WBWB 2YKKA 2NPLX 3HNSH 4J2QA 4JE4B 1ASQA 1HJBC 1KELH 1NBVL 1HI6A 5EH1A 5L7XH 1WA1X 1G7QA 4YBLC 1TQWA 1PIFA 2WLMA 4W4NA 4CMHB 2VLKE 1KMGA 2HYMA 5HDBB 2RBLA 2MOGA 5DWUH 2L04A 5F21B 4HH9A 3CFBB 4TQHA 3T4YA 2IOMA 1VZIA 2Q5BA 2YGNA 5AW7B 3Q5TA 4M1CD 4U1KA 1AZNA 4KZEH 3L4YA 3MRFA 4MD4B 5J57B 3WN6A 5AKSA 1NAKL 1ZJBA 4WHCA 2QQNH 4PS7A 1E9OA 3QQNA 1U8QB 2DIEA 2IO5A 4DKEH 2CKBH 3LKOA 5C8JB 5FGBC 4K3JH 3WXWL 1TJXA 3EHBB 4HUXA 1C8QA 4JFFD 2ZOKA 3PHAA 4YEEA 3S0PA 1YPZB 1W91A 3KVDD 3AWGA 3PY9A 2R8SL 2B7DT 4JM2A 3CZFB 2OYMA 5AOIA 3SOBL 2XWDA 5DLMH 3EKCA 4H1LA 1AZVA 4JZJB 4XMVA 2WHVA 4BRJA 1KGCE 1ZLSL 2CO7A 5B1KA 3W9EB 2OP4H 5IMLA 2WINA 3T6WA 3RJOA 2H47C 2OXHB 1UXWB 2XCMC 3GMMA 3SDDA 3BGFB 3DX4A 2XNAA 5GRJH 4KXAA 2OL3A 5DUJA 1NLBL 1HEJC 3JWDH 1WDAA 1M7IB 2AJ3A 3E38A 5EZOL 5EF1A 4HKJA 5EN2B 5B3JE 4PP2B 4O58L 4OQTL 3CQQA 4Y4HC 5DJ2A 3BZEB 4WFFD 5KJ7E 4LKCB 2DQCH 1IBBA 4WAFA 1MLCA 4MDIA 2ED8A 3JWOH 4OT1H 1QHQA 3RWCB 1BAGA 4OCRL 5KYXB 4KNTA 2HT3D 4B50A 5AVSB 4OCYL 3VI3A 3H0TA 4ZDHA 2OMTB 5LBSH 5JNYA 4UTAH 5IF0A 1H0DB 3KL3A 2WO2B 1XBRA 5KAQG 4JPKH 4JG9A 4OF6A 5DD1H 1RJZA 2JK5B 1FFNB 4JHWL 3TPUA 1IAKB 4QRQB 4TLTA 3UGXA 4XI5C 4N6RA 1DBAL 3OMAB 1AVAA 4IOSD 3BWUC 5JXEC 3BLPX 2DDQL 4KUCD 1HK6A 4XZUA 4KK6C 3LN5B 3DIFA 3IFNH 4LP5A 3F3HA 1JYNA 1M3IA 2PCPB 2QQKL 5MEQA 1L7IL 4PI2A 5H94A 4OLYL 5IB4A 1FG2B 2J7LA 2AABL 4N5UA 3VFOA 1HIML 4URKA 1D2PA 2ZCHL 2JKWA 1IL1B 3VXTA 2HRPH 3UYRH 2XWCA 2XXFA 4F9PA 1RP8A 4AKQA 5D7EA 1KCLA 1NAMB 3FUMA 3I6KA 3PQYB 4BYHA 3VI4B 1WIPA 4XVTL 2GTWB 5DJ6A 4M9PA 5LBSA 2EEBA 4UTAA 3B3IB 3RHWF 3VG0L 2KYIA 1ZK9A 4G71B 4BSVB 3P4LA 4YS4A 1SHXA 2GJZA 3QIBB 5GS1B 1G9NC 4UT6H 3RNKB 1RU9L 1XF3B 3RZCA 1MNUL 2ICEC 1T0OA 2CUIA 4X4ME 3ROOA 2DYPA 1TQSA 2NXYD 3H9HB 1SHWA 3NPSB 5JO5A 3KPOA 1AR1C 3UBGA 4KV5E 4O02A 3W11D 5GJTL 4LL1A 1AQKL 3N40P 1NICA 2OFQA 3CX5K 4IBQA 4AYGA 3MUGB 2X3CA 2Y7NA 3QAQA 2XVGA 2JKRM 3MNWA 4NQVB 1WITA 2F6AA 3RDTC 1UA6L 2EO1A 3DI3B 4HAGA 3AB0B 5GGSA 3FQTB 4X6BA 1NEZB 2EILB 3ARFD 5KS9E 1TZIA 4LLMB 3LEXA 1IQDA 2HKAA 3IDNB 3KDMB 3LB6D 4MX7B 1YAIA 3HCVA 3AWEA 1WBYA 2DBLL 3MLVH 4RNRA 3FZUD 4M7ZC 4P3CL 4UT6A 2DWDB 1UM6H 1T6WA 1ZLWH 5IJVB 3EGSA 2VL4A 3HE6B 3V95A 2QVFB 4NPYA 3ZBMA 2Y7MA 3ZL4H 4YBLB 1JPEA 4S1DD 3A4AA 1DQTA 1R75A 5DXWA 4KK9D 4Z7VA 3HRZC 4TUJB 5EC1B 1A5FL 4FNRA 5TE6L 3L16A 3JSSA 3NRFA 4IYKA 1TUPA 1VADA 4I5BB 3B43A 4DHLA 1NFDF 2DY2A 4FULA 4QXGH 2XG4A 1JWSB 4JPVL 4PI0A 2YXFA 5CJ8A 2BSBA 4FERA 3H9ZA 3CSPA 3NZSA 4X98A 4ZSOB 3TL5A 2ORBL 1DQDL 3FN9A 1S7RA 5EUOB 5B1BB 5SWZE 4Q6IC 1HH9A 5HHPA 5J3HC 4AYMC 2CLZA 3V4PH 1JUFB 1ESOA 2X0VA 4LKXB 1KNOA 1L9TA 4A1RA 1S9VB 3L3OC 1SEBA 1DQMH 3HG2A 3OQRA 1Q0YL 4G43A 3FT3B 4QEGA 4XPAH 2HSIA 4TQ8A 2H1PH 4X7TA 5EBGA 1DQQA 3V4VH 3K3QA 3ZZSA 4P46D 5CO1A 3VAEA 2ZCLH 3SJVB 1R24B 3RA7H 3ALWA 2YD5A 4YHML 3RIKA 2DQDH 3IGFA 4PRIE 5K93A 2I25N 3BWSA 2MWCA 4BH7B 4Y4HB 4AV0A 5FUCC 4ODTH 1X4ZA 3V0FA 3HG1B 4AM0Q 3V5HA 4KITB 4Z0XA 2X4QA 4YN3A 4ZMPA 3HA0A 1JF1B 2ZF8A 5IV2A 3UERA 1WGOA 2RA1A 2VDKB 4A2HA 4PJBA 1MWOA 1A4KB 2WBJD 4GPVA 5D1XD 4XVOA 3QUHA 4YBQC 5T3XL 3L4XA 1Z32X 3A21A 2BSSB 3RVUC 1NBCA 4YFLI 2YJLA 3DX8A 1IQWL 1QVOA 4JHBA 3OKMB 3S6CA 5EU4B 3MYJB 4QRRB 3FHQA 4LOUC 3CZJA 3FSVA 1X6NA 3DPBA 1LEIB 2ENPA 5CJXC 4HJ0C 4OCXL 5FO8A 1T5WA 5HHNB 2ZCZA 3ULVL 4BBWA 3EDEA 2YD6A 5F96H 5ILTH 1ZVHA 2CR6A 3WN5C 1WS8A 3QEQE 1I1CA 1IBDA 3RE0A 3THML 3N1GC 2CLRA 3VTAA 1LWHA 3ASOB 1BD2B 4YHLH 1MHEA 3JV4A 3RWDB 3QDGE 3KPPA 1L9QA 5B39A 1MXGA 3ULVD 1A6AA 2H6PB 1C16A 3VXRA 1E9QA 2FEDD 1GOGA 4M3JA 5B1JA 1JHTB 4NQCE 3L6FA 1RUQL 2CLVA 5HY9B 5GSVB 3P77A 5FYJD 4P07A 2CE6A 2FLMA 4NO3A 3SDYL 4ABVA 4BQ9A 1OCCB 4PJ5A 3WKML 2FZ3A 5DZNA 1BM7A 1XZ0B 3QDJB 4U7KA 1AQHA 4ODVL 4X99A 2WV3A 1KEGH 1BX2B 1V10A 4JUSA 3FFDB 1TNNA 3GZOA 1Y0LB 4U2YA 2ICEB 4JB9L 5TF0A 4PJDB 3B6SA 4GFXA 3N91A 5L9DH 1KGJA 4KMLB 4AENB 3A6CL 1X5MA 6PAZA 3EFOB 1J9QA 4HMDA 1OXYA 3P4OA 5AYTA 4OD2B 3V4UH 1IBYA 1T1XB 1SLXA 1N2RA 2MQGA 2NZ1A 3BO8A 4J3OC 3OR6A 4MCYA 4NB7A 1FFPA 4R7NA 5T3ZD 2R4SH 4QTIH 3PU7A 2I7OA 1KTKE 1HSBA 3S4SG 3PF2A 3DGGB 3RDTB 4OLEA 1NEUA 1ZA3B 5C0BE 2F5AL 1N68A 4NUJA 2O6DA 4FG6C 3LZLA 2OMWB 4ICWA 3ASWA 4LHQB 5E1QA 3LKNB 1WZLA 5GGVH 5JIPA 1NGZB 4MCZB 3ARGA 4POZC 1D5IH 2V6HA 3US9A 4AW7A 4AMWA 1JAEA 3UTQA 4P5SA 4BFIB 5EU6D 3D2TA 4XH2B 1YECH 4M7ZB 4ZXBD 4PLNC 2CQVA 1OAYH 1KN2L 4FQXD 4OR1A 4OIAA 1PKQA 1ID2A 2D7TL 2UVFA 4ZFFB 1XF2A 1A9EA 2IEPA 2VKXA 4C47A 1K8DB 1IKFH 2HT2C 3GJFB 3GSWB 4CSPA 3RWJB 2WP3O 3LOWA 2XWXA 3HRZB 2E7BA 3VRIA 3FPYA 3P3YA 4DEUA 4Z3IA 1UOKA 2GT9A 5EEYA 3KPSA 2QZQA 5BQ7A 1NCWH 5ICXA 3S37X 2F74A 4YWGL 4MJIE 3ZMNA 3UCQA 4CMMB 2NY0D 4BZ2L 5GGSY 4B95C 4JRXB 5KVDH 1ZXQA 4UV7H 3K5RA 3QUXD 3TBVA 4E41A 5DHYB 5D7IE 1YEIL 1CXLA 32C2A 3FCBA 4PJ9D 3JUYA 2E76C 4UILH 4Q6IB 5DJXB 3ZGHA 4WUUD 1HQ4B 3EZJB 4GRLD 4PR5B 5DD6A 5CWSA 3NIFE 1TTUA 3GTNA 4YDIH 3GXMA 4AY0A 1NCNA 1SHMA 2WIMA 5F7FA 2DQEL 3S35H 4XX1G 4UDTB 3L3OB 1UG9A 3NP4A 4L8DB 3VJ6B 4JN1H 4HAKA 3VXQB 1DUYB 2BVEA 4X4KA 2J88L 3KYNA 1UZ6F 1DO5A 2Y4SA 4YXKH 5GXBB 3L2LA 2FT7A 1IEBA 4U1SB 5JHLH 1JZ6A 5AD0B 5ACZA 1RULL 3MFFA 2VLJE 3SGJA 4EI0A 2BNQE 4YDNA 2KS0A 4YSDA 4LSVL 2VMEA 2BY2A 3BDXA 3BPNC 5F7UA 5C0FA 3TN0C 2A5UA 4QRSB 3LZQA 4LSTL 1DEEA 4IDLA 3VFUA 1KTDA 3EBGA 3VQMA 4HIHB 4HYTB 4QYAA 3VFMA 5IVXF 4NSKB 2R4RL 3R4RA 1YC7A 5EBMB 3L08A 3WJMB 5E0QA 1NIFA 3H7BB 2JCCB 5C1MB 4G9FA 4LQ1A 3TA3C 1WCQA 2A6JB 5J06A 5F1SA 5EZIH 4EN2A 5C71A 3SE6A 4JHVA 1F42A 1RUPH 2BSCA 4PJGE 1AQDA 1CDBA 2AVGA 3ZYIA 2YAFA 1B0RB 4KUZH 1NDMB 4X8JA 1WHPA 4P4RB 5IBUB 2AFNA 4DZBB 3C60C 5GZNC 2XY1A 4NFBA 1I9IH 2QGBA 4RAVB 2HJKB 1FVCB 1X5ZA 4P59L 1Q9LB 5E00A 3WN5B 1OALA 1XTLA 3C9NA 5MP6H 5JDSA 3T3ME 5A2FA 5A2IH 3G6JB 4F1SA 1UKTA 4EN3D 3EH3B 2VO8A 1BREA 3EOTH 3JTSA 4G8FB 3NIDF 2C5DC 5C07B 2QTVA 1IEAA 3K0YA 5DMIH 3NIFF 3QXTA 1LD9B 4P2QA 2ZOWA 4ZNEE 5JR1H 1OP5H 4PIBA 1PY0A 3MOBH 3U46B 3C5JA 3D4GA 1RL1A 2AQ1A 2BDNL 2ZUSA 5DZ9A 3V5DA 4O4YH 4IKKA 2KZBA 2VSDA 4PGJA 1TYRA 3IFLL 3NCWA 4JJ5B 3KE0A 3ZR6A 3RB5A 3ZKQD 5AVUB 5KZCB 5ISZD 4TXVB 3W82A 1O6SA 3D34A 4DKFL 4DQOL 3UO1H 3LQZA 1CTNA 2FB4L 4O5LH 1BQUA 3VD1A 1D9KD 4FQ1H 1JZHA 2XN9D 1JZ7A 1CL7I 3RQ3A 1U8HA 2XWRA 3CIAA 4JFHD 3B7RL 3O3DA 4JFOB 1MVYA 4G1EB 5D5MF 5IKCB 1S7TA 5CP3H 3S5ZA 2UY6B 1N6QL 4GG8B 1HTYA 4WW1B 1ZJAA 2XIDA 2L4OA 3EJYC 1OGAE 1U58A 2ESVB 3MLZL 1EANA 4XOCA 4ALAH 3MRKA 1K3ZA 1MHCB 2X6UA 3NCMA 1BLIA 4X5QA 1P9MC 2APWA 4HJEA 4PJHF 3I2CH 3MV7E 1G6RH 5J1SC 4HC1H 3WNPA 4UU9B 3IEAA 4N0CC 1IARB 2O72A 4RQQB 3MV8A 4KJWD 4LLYB 1PYWB 4FHKA 2NUTB 4KJYA 4N0UE 3BZFA 3D9AH 1DBJL 3Q8FA 1JZJA 4M6OL 1HESA 3VXUB 4BFKA 5CLWA 1K5WA 1WK0A 12E8H