3VD0A

Structure of p73 dna binding domain tetramer modulates p73 transactivation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
202
structure length
202
Chain Sequence
HHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein/dna
molecule keywords Tumor protein p73
publication title Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 202
sequence length 202
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vd0A00
1EAOA 4QO1B 4MZIA 4G83A 3VD1A 3D09A 3VD2A 2BIMA 4IBZA 5A7BA 5AOJA 3VD0A 4GUQA 2X0WA 4GUOA 3QYMA 3TS8A 2P52A 2FEJA 4IBSA 3WTTA 2ADYA 2BIPA 3D05A 1EAQA 1TUPA 5LGYA 3D07A 2OCJA 3US0A 4L0ZA 3US1A 2AC0A 3ZMEA 3WTVA 2BIQA 3Q05A 2BIOA 5ABAA 1E50A 2PCXA 2RMNA 2X0UA 3WTYA 4IBWA 2IOOA 2J1ZA 1IO4C 4XR8C 4HJEA 4KVPA 4IBQA 3D08A 2IOMA 5ECGA 3WTWA 3WTUA 4IBUA 3KMDA 3KZ8A 5KBDA 2VUKA 4LOFA 5LAPA 3IGLA 1KZYA 3EXJA 2X0VA 4MZRA 2H1LM 1GZHC 2MEJB 1T4WA 1HJCA 3Q01A 4IBTA 1HU8A 5AOKA 2J1WA 4L18A 2J1XA 4IJTA 4AGQA 2GEQA 1CO1A 3EXLA 1TSRA 1H9DA 3IGKA 2J1YA 2BINA 4G82A 5AOIA 1HJBC 4AGNA 2XWCA 4AGOA 2XWRA 2AHIA 2ATAA 3D06A 5G4OA 1UOLA 4IBVA 5G4NA 1CMOA 2J20A 5G4MA 4L0YA 4AGMA 5AB9A 3Q06A 4A63A 3WU1A 2J21A 2WGXA 1GZHA 3QYNA 5BUAA 4LO9A 5AOLA 3WTSA 4IBYA 3D0AA 1EANA 5AOMA 4LOEA 4AGPA 4AGLA 2IOIA 1LJMA 1YCSA 2YBGA 3WTXA 2J6WA
chains in the Genus database with same CATH superfamily
2JMRA 2G2PA 1L5GA 3MNVA 4IOFC 1HCZA 4MXVE 5DUPL 4D0CA 4NO5A 3B7RL 1HAUA 3ARQA 3UBXI 5IMLA 5I15L 3ILDA 3QEUA 4DEPC 4LSTL 1GJWA 1QSEB 2ZSVB 3HE7B 2FEJA 4R7NA 4PM1A 1WAAF 3O6ML 5K1NA 5L4IA 4PUBH 3AB0B 2ZX8A 5KSUA 1ECYA 1UWFA 2AGJL 2VDPB 5C2UB 4OZGF 4YL4A 3FQWB 5GISH 5JORB 3FUNA 1PZUB 3PGFL 5B7MA 5JPMA 3ZYJA 3FQ2A 1FO0H 1F41A 3N44B 4ZTEA 1IGFL 1XR8A 5LN4A 4JFEB 1R4XA 3HS9A 1UM6H 2FWOA 1MHPH 4K2UH 4Z7QB 1U8LB 5CJQH 3OG4B 4QIRA 4HF5L 3TEUA 5C0IB 3MOBL 1PG7X 1FYTA 2MJWA 3TWCH 3BZ4B 1EPFA 3LJ3A 1JGVL 2HX7A 4WW1A 1U33A 1D3CA 1R5WB 1QBMH 1FLRL 3O3DA 5I1JH 5FIEA 3P4OA 3QDMA 3QDGE 1LD9A 3R7QA 1F4WL 1VENA 1OWWA 2CLRA 1HCVA 5CJXC 5E8DL 4DN3H 2X4RA 3EJRA 1SEQH 4Y1AE 2CR0A 1E7UA 4JAMB 1UQSB 2WLLB 3L5XL 4AV0A 4EUPA 1V7ML 2W9DL 3V0WL 1BV8A 3QPQC 4PRNB 3S34L 4JDEB 1T1XA 2ZAGA 2GSMB 1AQKH 1TENA 1INEL 1AMYA 4ANUA 3SQRA 2VTFA 1VESA 25C8L 1B4RA 2B59B 4S2SB 2X2YA 4JFDE 4XPHH 5JDSA 1EX0A 2X09A 3KPLA 3O6FD 3SKJL 1ZPUA 4MJHA 3KYOB 4YBLC 4F3FB 3VACA 3WKML 3S8FB 1IKNC 1VZIA 2WNKA 4I85A 2GHZA 3N40P 4MMZA 5C0BA 3WELA 5GRWA 1QO3B 2NY1C 2WQSA 3DUSA 3GZOA 5EIIG 1QD0A 3VFMB 3QJRB 4JFQA 3TT1H 3ZTJG 1P1ZA 1E8YA 4AQ1B 3MRQB 32C2B 4E36A 3RX5A 4JZJA 5E1HB 2Z64C 3ARFA 3QEHB 4OCWH 1BZ7B 2ZG1A 4O4YL 1N6QH 1BYPA 1RUQH 1U92A 2EKSB 3JV4B 4KOCA 5D2LB 3ULUE 1RUPH 5L4JA 5FC9A 3VSTA 2JJTC 2V3FA 3HJEA 3FU7A 2WINB 3CCHA 3ME0A 1S9YA 1KB5B 4BELD 4DKAA 1W8OA 3O3BA 2AQNA 2VW4A 5F9OL 4APXA 1X5JA 1MFBH 2BW5A 2XHNA 4OFKA 1JV5A 4PJDF 2W9LA 3UDWA 2JQMA 3OKEA 4HBCL 5KVDH 5EO0A 4LHUB 2MFNA 5C7XH 1KLUB 2VRAA 4Q56A 4AQOA 5IHHA 4GI8A 1OK0A 1UWEH 3PWJB 4OFQA 1OV8A 3UJTL 3SZKC 2YPLE 3U30B 3HC0B 3H1ZA 2ZONA 5CEZL 4XPBH 1OF2A 2UZYB 4QOKD 1H6TA 5LGYA 4BQCA 4NNYB 3G6DL 1P4LB 3VXRB 1AYRA 3KEDA 2IV8A 3QIUC 4GMSH 2HLFC 3VXUB 4N6RB 2HG5A 2J6EL 4OLYH 3U4KA 4DT2A 4U2YA 4CVWA 4U1JA 4FQHB 3GPEA 4J3SA 4PJ5D 3JWNE 1VIWA 4OT1L 3S97C 4HJ1A 1PYWB 5IHUH 2C3WA 5K39A 1MJ7H 12E8H 4W9JC 5D7IB 1HKFA 5B8CC 3K6OA 2GHWB 4FL4B 5ESQB 4P4KB 1PQZB 1VACA 2GT9B 3AITA 3B34A 4MSWB 5IOKA 3DOHA 1HWGB 2IBBA 2X4SB 5I74C 5EUKB 3UAJC 2EECA 1D5IH 3DO3A 1MCLA 1K8IA 3R18A 1T83A 4OIBA 4AQ8C 1EHLL 4MQXC 4Q7DA 4XH2A 3OLEA 2BMKB 3BGAA 1Q0XL 3AXLB 3LHPH 1NMAL 4LKCA 4K5OA 4ZXBD 4CC4A 2ZWYA 4XMLL 3B9KA 4G8GA 2G5BB 1QFUH 2FSDA 2WQ8A 4I0CC 4R4NC 1HYSD 3D7PA 2ZKHL 1U8QB 2AI0L 4WWNA 3U7YH 4NO3A 2YR3A 4Q0XL 3LKPB 3TFBA 4JFZL 3FHEA 4Z3JA 5CZXC 2BCMA 5E0FA 1UM4H 4RGOH 1YJDL 1QHOA 2J43A 3HE7D 4RFNB 1IVTA 2APVA 1AC0A 4DUXA 3U82B 1OIOA 2HZHA 3N04A 5GGSA 3R8QA 5BZWB 2F7PA 2GTWA 3L3IA 3DV6A 3GJFK 2BNRA 3CDGA 3RA7H 1B0GB 1VKXA 3MN8A 3SKNB 4FTVA 4PIBA 1KOAA 2Z92A 1SDDB 3HRZC 3BAYA 1BJ8A 4GRMB 4JY4B 4MFHA 5DWUL 1BZ9B 2H6PA 3AABA 1VERA 4PWIA 3RZCD 5DK3A 3JQOB 1SYVA 4XP4H 2C5DC 1TQUA 4HFUL 4JFED 4U0RB 4YPGA 5GGQL 1P9MA 3C60C 2XVGA 1AQDB 4XNXH 4PJ6A 4ZAKB 2JB5H 4CVXB 3ESVF 5BOPA 5HHOE 1U8KA 2NY6D 5DZOA 1VZGA 3RX8A 3L45A 5IBLD 3UP1A 4ZFGL 1ZHLA 5E1AB 1J9TA 2QDWA 2ZCKL 2X4TB 4X6CF 1FVEB 1QZNA 5JW4Q 4HS6A 3NCJL 4QLRA 1KGYE 4M1GL 2AJZA 2DIAA 3D69A 3F85A 3IFLL 1FPTH 2UXGA 1W9XA 1F56A 3HG2A 5IBUG 3CFTA 2WXOA 1RSYA 5HY9A 2OSYA 5J1AB 3UYPB 1DBBL 3WS3A 1MRDH 1RZ8A 2CNZA 3BWUC 3BP5A 3LPPA 3KXFD 4HHWA 5IJKC 1AR2A 1MJJB 4XN9A 2GITB 3M46A 3HZVB 4TSBL 2A6JA 5A2CA 2F8VA 4MD0B 3ZKMD 5DMIL 4F37F 1JRHH 4BZ1L 1KENH 1MNUL 2D3JA 4OU3A 3RPKA 3C5ZC 4PJ9B 3JV0A 4TSAH 1UFUA 1BAWA 2HH0H 3U0TB 3CZSA 2DQDL 4YIQA 5L9DH 5GGTL 3TV8A 3O8XB 2W0KA 1U91B 5ICYA 1SLVA 3MRDA 1SLUA 2IQ9H 2CBPA 3REWB 1QSFA 3VXSE 3QZWA 4X4YA 4OFPA 2HKFL 4OGYH 3NJXA 5JW4N 3IDJB 4WHCA 4A7SA 3I84A 3I6LE 3QUZB 5AWNL 4Z3TA 4YR6A 1MREH 1S7UB 3G9VA 5DS8A 4ODVH 2GJJA 1V3JA 4Z8FL 1PVHA 2V2XB 1V05A 4OJCA 3INOA 1RURL 1I1FA 3X1FA 1TZHA 1Z3GH 2XN0A 1TJGL 2IAMD 2XX1A 2APSA 1EVUA 3UJIL 3Q01A 4LHUD 1VEPA 3IAQA 5AOKA 2F74B 4GFTB 3RVTD 2DMHA 3RNQB 3SCMA 4X42A 3OV6A 4PJCB 2OLDA 4IRSA 4PRID 1JPFB 3RUGF 5E1QA 2A73A 1KACB 3N1PC 1ZSDA 1FNHA 1MFDL 3D39B 3D2UD 4FNLH 1DQLL 1J5HA 4WV1C 3TURA 4L8BB 4PFEA 2F1BA 5FO7B 4W4NA 3B8SA 2YO3A 3V5HB 4NWTH 5EU5B 3EJZC 3WEAA 5C08D 4GG8A 1HXYB 2ODIA 4OCLC 5D7JD 3NCBB 3KGSA 3CUPA 5HTSA 5FB8B 1YNTA 4ZX5A 1G6RL 4GPVA 1PZDA 1A3RH 3QXVA 3BUDA 5AVSB 2B0SH 2UX6A 2ZWSA 3HI5L 5T5FA 1UJ3A 2WP3O 2GBTA 4ZFOB 1C8PA 1RJZB 1PFCA 4A2HA 5KBPA 2MOVA 1FYHB 1HH9A 3TYFA 3B7YA 1G1OA 3HZKB 2P8MA 3FCTB 4OLEA 1I3VA 1AXTL 1FE8L 3DUUB 4U1IA 2ZXDA 4H2AA 4RFOL 1IJNA 2SEBB 4PP2B 1SHWA 2WD0A 3SGEH 1JJUA 4ANKA 4MDRA 3IYLW 4S10A 1XZ0B 3RU8H 5L8KB 1WE5A 2J25A 2QELA 2R69L 1E3FA 4C47A 2ZJSL 1CZ8L 1QA9B 4NQCE 3PGDB 4ONHA 4DP6X 1PEZA 2EDKA 1KJ2L 2VITA 1IC1A 4HUUB 5F3FA 1TLMA 4HPOL 4M8UA 4YXHH 4Z78B 2PWFA 5L4FA 1B4LA 3L1GA 5E6RB 4GIOA 4U6HA 1KTBA 2VXUL 4KVNH 4DO6A 4IK6A 3U46B 2PF6A 2CIIA 1MOEA 4W68A 2X2IA 5EBMB 2XU9A 3KLDA 4OKDA 1BFTA 3KJ6L 2Y07H 4UWQB 1MFAH 2D2CC 4MQSB 3VFNB 5I71B 1G7MB 3DO4A 3FOMA 3H4HA 4P2OB 3CDZA 4HFWA 4P3CL 1I3RA 4MAYA 3H53A 4ZNEE 2NX5B 5IZ7A 3FOLB 3WENA 3GI8L 4S1DC 2F8IA 2OJEA 4ZAKD 3K8KA 1RZQA 2J5LB 4M5TA 4Z7WB 4YGVB 5JOPE 2EIKB 1YRKA 1KZYA 1F5WA 2IEPA 1WLHA 1KGCE 4IGBD 2WCSA 2BRRL 1R24B 4TYUA 2VZTA 2H8PA 3BT0A 4L3ED 4X7FC 5DMKA 5ID0B 4G1MB 4RGMB 3ARDB 2QQKL 2GQHA 2Z31C 4K5NA 4PWKA 1CF1A 5I1DB 1WZMA 2PTUA 1P7QA 3RWHA 5LWYH 4OV6F 4S1QH 3QI9A 5FA3B 3QAQA 1UWXH 2XV0A 4A38A 1HJBC 2MHAA 3WLBA 4HIQA 4WNQA 1A3ZA 3MI6A 3BGMA 5IQ7L 1TQWA 4EN2A 2O72A 4PJ9D 5FGSA 4P46A 1HHKB 1M1SA 2C9AA 1QRNB 1FN4A 4QCIA 2NLJA 4JO4L 3THMH 4N3UA 2A0LD 2IIJA 4Y16B 1P7BA 4OTXL 1CGXA 4G8FA 5FUCC 1SJEB 3G04B 2OSXA 3FSVA 3SDAA 1VJSA 2VQUA 3IU3A 2C9SA 3WJMB 3F12B 3CZGA 4ZFFA 3L4WA 3JWOC 4MDIA 3ZDZF 4JANA 4P8QA 3V6FB 3S3DB 4YHOH 1HNFA 2IWKA 2ICEC 4Q2ZA 1A7PL 1WK0A 4WU5B 4ZYKB 2FJGA 2VR7A 4A2MA 2PYEA 1GW6A 1NA8A 2PO6C 4K7FA 4YHIB 3CSYB 1JFQH 1KTKE 3SQOH 2C4FT 2XY2A 2EXSA 4NM8L 1IBGH 3SQBB 5KTEL 1ZK9A 3MCLL 3CFDB 3QEGL 4OZHF 1R3IL 4WW2C 3BCDA 5EEVA 4FFTA 1W80A 1AGDA 5IVZA 3Q1SL 4EAEA 1CGYA 2Q7YB 2I60L 5F70A 3RTLA 3B2VH 3P4MA 3ROOA 2FO4A 3QEQE 1OAUL 4QKXB 1EDYA 1NKRA 4NJ9H 3ULVC 2WLIA 3EO0A 3K6NA 1HHIA 1LO2L 1PIFA 1ZS8B 1NBYB 3UBHA 1WC7B 4KY1H 2BSTB 3NCEB 4AMKL 4MJ6B 3ZL4H 2BERA 1MW0A 3HHSA 3C8HA 4LCCB 4Q6IB 5T1DH 4N2NA 1DVFC 3FB5A 3DSFH 3UG4A 2AEQL 2VR4A 4U4BA 4BSWB 2XWZA 3DTUB 3MA9H 7CGTA 3FQNB 3VXMB 1CD1B 4G43B 3ZRCC 4E9RA 4XXWC 5D96B 1U3HB 5HGDB 5FHBL 3GGWB 2VERN 1JGEA 4ZUTB 1S7QA 1NL0L 4A7TA 1G1KA 2H32B 3IVKA 4MXQD 5T3XH 3S3JA 4LCWE 1A4KB 1IILE 5EIIB 2CMRH 3J07A 1GC1L 2LQRA 3ILQC 4P2AA 4YHYB 1E4XL 1KXQE 5TK2A 4XMXA 2IXQA 3NDYE 4OZIB 3KL0A 1A1MA 2X7LA 1HCFX 4GQ9L 1P53A 4MA1B 2K8MA 1Y18A 1K4DA 1EJ6A 1WFJA 1DCEA 4JHAH 4Z77B 5DQ9B 5J1SC 3BZEB 2ZCHL 4XAKD 4MMYB 3WMSA 2YWYA 4PCSA 4YFDB 3K2UH 1GW0A 4OCSH 1J0JA 1S7SB 1TQSA 1BQLL 1WCBB 3GHBH 4JB9H 3ZDXF 5HVHC 1EXUA 5I73C 4Y9FA 3MRMA 2CGYA 2Q20A 2EXYD 3HZ3A 1CIUA 1U8CB 1TITA 1GGTA 4XMUA 4FEIA 2Y1ZA 2A6KA 3PGCA 2WHVA 4K55A 5D72H 1KTRL 3FDWA 4XGZA 3IS1X 2OKMA 3TBTA 4ATWA 5FYLD 4P2OD 3WGVB 5CGTA 3O2WH 2XUWA 1A1NA 4HPYH 3TJPA 3WL9B 1J1XL 1SM3L 1T2XA 4X2UA 3DMMC 5EU7C 2EDHA 1KPUB 3E1ZA 4YL9A 1U2YA 5GRJH 3LZFH 3V5DA 2YD2A 1IKNA 4OF3A 2XCMC 1WBYA 5TE4H 4FAAB 4WJKB 5BVJA 2YMTA 2DWXA 3CC5B 4LOUC 5DDHA 4WKZA 3IMBA 1I8IB 1ACYL 3F83A 1IFGA 3QIWB 4TSCH 3UBXG 3AB0C 4WO4B 3OMIB 3OLGA 4BINA 2OCJA 1G7HB 3QQNA 3GJFA 1L4IA 4KGLA 5FYKU 5JXEC 5KWYC 5IFJB 1S3RA 2V3DA 3ARDD 3DJTA 1GZQA 1OAYL 3PRZA 2XPYA 4ZOCA 2A99A 2J88H 2FWUA 2JJTA 2K45A 3LEXB 4PJFB 2QPEB 1S6NA 1SBBA 1PX8A 2CO6B 3CMGA 4ISVA 1S9VA 2CA3A 3EJSA 2DBLL 4L9DA 3T6ZA 2VDOL 4G9DB 4HDIA 3RHWF 1BCIA 2NYZA 1XB6A 4XB3A 5HYJB 3MUHL 2CUHA 3LKSA 5TE6L 4Y16D 2PABA 4NUJA 4F15C 5IVXF 4JFXB 1DE4B 2BCKA 3W9DA 1DDHB 1NMCC 1B9ZA 3UMTA 2CDEB 1S5IL 3KPRB 1KCKA 2F58H 5D8JH 5I1KL 1RIUH 3MRHB 2BVPA 2OI9B 3T3PF 5MEPA 1XGPA 2DI7A 2ZXEB 4YXLL 1H3VA 3QE5A 4ODUA 3ELQA 2MEJB 3BCFA 3BAKA 5LNDA 1CVSC 3TVMB 5DJYB 4LVEA 4JDZA 3FCSA 4IQHA 1B6UA 2WO2B 1G7PA 1NCAL 3LDBB 4FJYA 4KVCL 1E6OH 4W9CC 1SJHB 3TL5A 1YC8A 2FBJL 2YD7A 2YD0A 1IEBA 1SN2A 4FHKA 4ZTPL 1ZWIA 2G3XA 4KDTA 5FYJU 1EEYA 5I5MA 5E24E 1LWRA 2G30A 2XVLA 1ROWA 2OTWB 3T8MA 1EVTC 1SOXA 5KOVC 1UURA 4E9QA 3UAJA 4CJ1A 3V7AE 3H3PH 4D94A 3GPSA 4AQ8A 4K3JL 3OMNB 1JERA 1J05B 5D1XB 1UM5H 4BK4A 2XTLA 2X6UA 4D8OA 4WVRA 5E94A 4GOSA 2HVKA 1KYOJ 2E8YA 5IBUB 3HMXL 3K1DA 3UTSB 2QJDA 4LCIH 3ZW3A 5DD3H 2P49B 3KYNB 5K33A 2A6DA 4AYGA 4M5SA 3BVWA 3NSCA 1TNNA 2HTLD 2WQRA 2WANA 2ZAIA 3LEYL 5EF0A 4JQIH 4JVPA 4JFOB 2IG2L 4HMDA 5DHEA 4E68A 4OD2A 4DKFH 1UCBL 1AI1L 3FFCA 1RK1A 3MBEB 2B20A 4WWOA 3RGVB 4Z7VA 4MZ2A 6TAAA 4Q9RL 3O6LH 5FGCE 4LMQE 3U9PH 4Y5YB 4XZUB 4LCYB 3RL1B 4A67A 3HRZA 3K4AA 4ZDHB 3LIZH 4CMHB 3IKCA 2IPTL 4H0HB 4IRJB 4RWHA 4XBEH 4DK5A 4KDVA 2B1OA 1L7IL 2J57A 3MACL 4XO9A 2ZYHA 1HL8A 4NT6A 2K70A 3L9BA 5ANMB 3C60A 3LIZA 5CLZA 5IKCB 2Z8RA 2VZSA 4LSVL 5JIKA 4E9WA 3GMRA 4Z3FA 5K9QG 4Z6AT 2CXGA 3OGCB 3D4ZA 4X80L 3PFUA 3V4PB 3HZYB 3IXTA 3HLAA 1L7TL 2H4EA 2I07B 3RWGB 4BFKA 1XSOA 1IAOB 2D7QA 1UD3A 5FO8B 1IGJA 3ESUF 4P4KC 1SOSA 4M48L 4NQDB 2V2WB 1M05A 1G0XA 2KKQA 1X3DA 1DVTA 3GT6A 4ODWA 3SY0B 1EZUA 2DD8L 3T09A 2W88A 2HWZL 2HLAA 5T3ZD 5GZOD 5IJKA 3IJEA 5CUSH 4A39A 1OE1A 3N06B 4UF7C 2EACA 3WNKA 2FECI 2CHZA 3VGAB 4NO0B 4M8VA 3C5ZA 3GC3A 3QYCA 2BK8A 2YUVA 4GKSA 4JG0L 3PDDA 4K8RC 5MENB 1A3QA 2CJUL 3QJXA 3AG2B 3LKOA 2K4WA 4JM4H 5FKAA 4AH2A 5TQ2H 4DP7X 3IETB 4RFNC 4QT5B 4FQCL 3T0AA 2AK1H 2FUQA 4RLDA 2FH6A 3AY4C 3PXHA 1ORSB 2AQQA 1F4XL 4TUKH 3EH5B 4FMVA 4Y5VB 4XNAA 4JRFA 4WO4D 4UAOB 4GFXA 1WTLA 1GKEA 4EJ1C 3NACL 2N1KA 1DVSA 3L1OH 3DGDA 5TDOB 3JV6B 4V33A 4HWBH 3ZJAA 2IH9A 4YDKH 4LVHC 5M94B 5E23A 2IWGA 3L4YA 3TYGL 2XA3A 3HUJE 4RGNE 4XOAA 3TF4A 3HHRB 4G9FB 4HWBA 4KUCD 1BFVL 3ROLB 2EH7L 2QMJA 3VJ6A 1IGYB 3STLA 2FDBP 5FGBC 1YY8B 5KSBE 4TLUA 5E2UL 1OGAB 3QDGD 1DQDL 3VI3B 4U1HB 1E27B 5HYJD 4Z0BH 5I8CA 4GW1A 4Y1AD 3RKPA 2F7IA 3QB7C 2FYYB 2H1PH 1MPAH 4ACTA 3BGFC 1D5XB 4WV1A 4LARL 4YDIL 3DBXA 4K5PA 3L7FB 5GRVK 1WIOA 8CGTA 1DJIA 4MNGB 5E00B 2D3NA 3GBMH 3S96A 4FQQB 1DANT 1XF2A 5HHVL 4KRPC 4HETA 4FNQA 3HG1B 3UTPE 3GLAA 1M3JA 4YDLB 1E2ZA 2NOYA 4N0CC 4MLSA 2EIMB 2K7QA 2HRLA 1A9VA 4O51B 1KIRA 1B9KA 5BOZG 5J7CC 4XT1C 1YMME 2CCWA 2ZCLL 3K5RA 3SD2A 3G6JA 4LNVA 3KAAA 1GAFH 1XGTB 1DN2A 2NSXA 2BSSA 4CVUA 1FZKA 3H9SB 3HPJA 1SVZA 3LAFA 3PF2A 4L0PB 5HDBE 5IMMA 1R3KB 1RMFH 1T3FA 4MWFA 4ZUSA 3ULUD 1ZXQA 1HHHA 3SBRA 4D7BA 3HB3D 2N4IA 4UUJB 4J3BA 1I9JH 4Y5XA 5GGUB 1XCQA 2NXYC 1A7NH 2B9BA 2TRYA 4PS3A 4DH2A 5SWSB 5JQ6L 3FUIA 2DLTA 1DP0A 4G7QB 3QG7H 2K6YA 1SLWA 2ITEA 4TV3A 3HC3H 3TZVC 4JO5A 3QFJB 2VLJA 1S7WA 1WAPA 3DVIA 5DK0B 4YWGH 1HJCA 1HU8A 3AJ7A 4WLCA 2EEFA 2VAJA 3UROR 5LXGL 5DI8B 3SE8H 4MA8L 4M62H 4V1DA 5KUMA 4OCYH 2UY6B 3VRLE 1PMYA 3UTZB 4KJQD 1QNZL 4NKIL 3SJVB 1GPOH 1AY1L 5SX5K 1YDPB 3Q5OA 3NCFB 5E4EB 1G7JA 3I9PA 3P69A 4K3GA 4WTWA 1XD0A 2XRAL 2IDQA 2YA1A 1ZMYA 4HS8H 4W6YB 2C7FA 2RBLA 2IF7A 5F88B 1MCSA 4PP1D 4B60A 2IH3B 3KBHE 4YN3A 2MNWA 2GPZA 3KR3H 2VT0A 5I0VA 1AZBA 3Q06A 3SOBH 2OQJB 3HE6D 3T0EE 1FH5H 4H7VA 3JTSA 2XXMB 3M86A 3QPXH 5C09A 4HHAB 3FT0A 4C57C 2VDPL 2VQTA 1LO5B 3LOWA 5KZCB 3QG6B 2AK4E 2OR9L 2HFGH 3KLLA 3ERXA 3E1F1 5CGMA 2UWEB 4AEFA 4ZO9A 2GUOB 1JNHA 2MOQA 3OMZA 2K9UA 5J8OA 4YAQB 2CLVA 3GSRB 1VGEH 3MRLA 1KY7A 1OKEA 2OYLA 1IFRA 2ERJC 4LLWB 4XP6L 3VFWB 4DP5X 2XQYK 2AEWA 2GVYA 4JRXB 5AUMB 3UGUA 5EPMB 3OAWA 1J5OH 1YYML 2R1WB 4N5ED 3TFKD 4LLMB 5C0GB 3K6SA 2C1OB 3Q1EA 2HJLB 4N2LA 3S0PA 3WIHL 2NQDA 3ISRA 3ZKQD 4GG6B 1YC7A 3RWIB 1M71B 5MERB 3ZZSA 3QFGA 2O1AA 3D9AL 3JWOH 1KGUA 1DQQB 2VMFA 1M6OB 3OMAB 2FBOJ 4CKQA 1VF5C 2ED9A 3CLWA 4OGXH 5IESL 1BP3B 1WZ1L 4MTMA 3EYUL 4D9RE 4F8TA 1BAGA 1UB5A 3KE0A 4MBOA 3X13A 4QXUH 2R83A 3S6CA 2YMOA 1JGDB 4G5AA 4NOBA 3BIKB 5I1CL 4YNYB 1CICD 1F58L 2ICEA 4MCYB 4R26L 5T1MA 2KLSA 3EYFB 2XXFA 1S5HA 1VSCA 5GGVY 4L4TB 2Y3AA 4RCAA 2PO6A 4HUWB 5HHOD 2FD6L 4YC2C 4ZPVA 4R90L 4XP9L 1NGXB 1DDTA 2J5LC 3U6XA 4L1TA 5DHMC 3NIFF 5KANI 3WHE1 1JPEA 5CLTA 1KTLA 1ZTXL 4WW2A 3LKQB 1A6WL 4QRTB 2FCBA 4X4ZA 3ULVH 1WHOA 3A6CH 5F0PB 2APTA 4L18A 1OAQH 3IE9A 3M8OL 4HLZG 4TQEL 3DURB 3KYMB 2GEQA 1KEML 1YN7B 1N3NB 3QJHA 5FOBA 5A7EA 1SXAA 3FT9A 3MLUL 1PLGH 4WFGE 3VE0B 1KB5L 3GSXA 5DA0B 3F64A 1FFPA 3HG1D 4XRCA 3UZVB 1RZGB 1VPOL 5L0QB 2GABA 1TG8A 3V8CA 4WTZG 1DVFA 1SQ2N 4AGNA 4KO6A 3PWPA 1IE4A 3HNSH 1QTSA 4ORGA 4Y2OA 4DOHE 1O7VA 1Z7JA 3PDOA 2EAEA 3BUBA 3BPNC 5DU7A 5C6TL 2Y7MA 2DQFB 4TQIA 3KYKH 3OKMA 3CN2A 2PXYA 3MCYA 4X83A 3GSUB 2E86A 3VXSD 3WXWL 1NCTA 4N87A 1TFPA 1UHVA 4UV4H 2G4EA 3MGTA 2CCVA 2BZDA 4W9KC 5TPWH 1GVIA 3UBXB 2O93L 1XGYH 3I6LD 1RZPA 3E80A 1F18A 1CE6B 3UTOA 5EOQL 4A2FA 3VUAA 1AOHA 1A5FL 4R2GC 5CD3B 1WA0X 3QULB 4E9LA 5D1ZA 4D8PB 3EYOB 1JPSL 2P5EB 3QDJE 4NM4H 1J1PL 1OARL 2MQCA 3GKZA 4N6QA 1QR4A 2D31A 1E5ZA 4JO1L 1TO4A 1BQSA 5T5NF 2JB6A 3GK8H 4AG4H 1QRKA 3QFJD 2IH1A 4MQ7A 7FABH 2ADYA 3D85B 2G60L 4F7PA 1HIMH 3DOSA 4BZ2L 3C6SA 1NFDE 4Q4EA 5AB2A 2Q10A 4GAGL 2VLRE 3QUYC 1M1XA 5C3IA 3HG3A 2HPOA 3O3AB 3RLSA 4X8GA 2NY7H 5C0FB 5BV7L 5DJ8B 5L2JB 1JNLL 1GIGL 1N59A 5DS1A 1UYWH 3HFFA 2WVTA 2ZKWA 3P9LB 4MMXB 3X17A 2YD9A 3IDXL 4JREB 2QEJA 3ZGHA 1HKLH 5HGHA 3MO1A 4GKNB 1A25A 4FI6A 2JXMA 2X1PA 2Q9OA 3DMMA 4EIZC 2ICWJ 2IVFC 4OQTL 1YJDC 1CE1L 1DBJL 1DBKH 2IANE 3FTXA 5IF0A 4PV9A 1P4BH 1ITBB 3HCVB 3K2MC 5DHVB 1Z5YD 5JNYB 1UTDA 2VUOA 5EU6E 5HI5D 3FTYA 5C07E 5D96C 1U3HC 3EHBD 5FFOA 1QLRA 5KZCD 3RNKB 5JXEA 2H2SD 1LP9A 4CC1A 4F2ME 4RMSA 2X0VA 5J1TC 1XCXA 1JCKA 3QJQB 3H3BC 3UAAA 2XKNA 1FNFA 3D0VB 3UO1L 4WQOA 4OVUA 5LNEA 4U6TA 4ELDA 5KUKA 3S35X 4OJYA 4TN9A 5KG9A 3ATEA 2AXGA 2X28A 1IC5H 5AW3B 1HXMA 1MF2H 1RIVL 1KB9J 2J73A 2Q76A 2R29A 2D8KA 4NQCD 5I23A 1PL3A 5C0IA 1TKWB 2AJ3B 2YD6A 2AXHA 2X4OB 3O3EA 4BE6A 4YHML 4P2YA 4HJ0D 1YQ2A 1OQOA 5TFSL 5BQ7A 2PCPA 4U1NB 4LB8A 4ONGL 2E6JA 3IF1A 3NT0A 1ZTMA 2WLLA 1HHJA 2FGWH 3PWVB 4L23A 5DUMH 2EVFA 4XNUH 4YMPA 1BX2B 4JHBA 3WFEL 5K9KB 4LSPL 2LABA 4HHGA 2Y0SA 4JFWA 1INDL 3D3VE 1JF6A 2X3BA 4GNKB 4URTB 4W70A 1BJ1J 4ZQTA 1L9MA 2IOIA 4OZGB 5KSVB 1XR9A 4L4TD 4AXWB 2A3TA 5L2KB 2B14A 4UYQA 1Z5LA 2J6WA 3DXAE 4OLUL 4PY8J 1U8MA 5JOPD 4QO1B 3LS4L 2E27L 4TXVB 4JKLA 2AMUA 3N6YA 4AI7A 1KGCD 1PSKH 1JYVA 3MRIB 1AGFB 2HT2D 5KYWB 2G3ZA 2WXKA 2W91A 1FJ1B 3VFMA 3FC8A 4D0BA 3BH8A 5JMOC 2JE8A 4YHZH 1IEHA 2RFXA 1ZVSA 3CG8A 5T33L 5HGBB 1L0YA 3TEXA 2AABH 1BZ7A 1OP9A 4AJ0A 4YXKL 1UWGL 3ZKND 3P02A 1CCZA 4TQHA 2W80C 2JSFA 3P4NA 1T89C 4GSDH 1KTJA 3UEZA 2WINA 3UPRA 5EOTB 1E9PA 4JL1A 3B1UA 4YO0B 1RU9L 3BP7A 4XP1H 4AZ8B 1Z1WA 4TULH 4IIQA 2TRHA 5DQJA 4PBXA 1F6AA 4YSPA 5HDQH 3T2NL 1KDJA 1RH8A 1V10A 2A74C 3AGWA 3GO1H 2ZPKH 4HKBA 3F7VA 4Y4KC 3KZ8A 3RFZC 2YJLA 4FHJA 2JFCA 5JLZA 1DJHA 1YEDB 1YUHA 3AQXA 1P6AB 2DOCA 4AYSA 4L1BA 4ZFZB 1X9RA 2DQHH 1GL4B 1Y07A 2ENSA 1RULL 4OIIL 5C8JB 4KKZA 4OBSA 1JZHA 3KG5A 2IGFH 3GBLA 4JN1H 3BKML 3CXHJ 3WN5A 2XFXA 2F7OA 4XC3L 5F9JB 3NN8A 3LX9A 2ADIB 4KMTH 4RAHA 3L3OA 2W0LA 3D85D 4UIKL 5LGKA 3NK3A 3ASOB 3EGSA 3P9WB 1D5ZA 1F90L 2RGSA 4H13C 4H8VA 3G08B 5ESQA 4P4KA 5AW0B 5HXMA 1AE6H 1SBSL 4XN1A 4OZFH 4PJDB 5LGHH 1X7QA 1JRHI 4HOZA 4RA3A 3F65A 3NJLA 1XH3A 5C97A 4NQSA 3AXLA 3WI9A 3L4ZA 3L3HA 4OCMC 1NGWA 1OHQA 4K8RH 1Z9SB 4OZFA 3PABA 2QVIA 3V6OA 5I0XA 3QHFH 1NAMB 1XO8A 2FJSA 4RDQG 4M3JA 3SDYH 5D6DC 5HHXH 2GTQA 3CDCA 2ZZUT 3B9EA 2KZ1B 3OPZL 4NCDA 1AZUA 5ACZB 4PJAE 4DP0X 4I3RH 1YEKL 1OW0C 2EINB 3QRGH 3PWNA 4WY7L 3JZYA 3MOAL 3B7TA 2FH8A 3GMMA 3QWOA 4K9EL 4BYHA 1YEEH 4PRBA 3AY4A 1R34A 2XIDA 4RAVA 1NIFA 1N7MH 2OXGB 2Z1PA 3QNZB 2CGRH 3MBEC 1QYGH 2VDRL 3IDNB 4LCWD 1JUFA 3TO2A 4Y5YC 4NXKA 1BVNT 2WIIB 4I9WE 3VXQA 1O6VA 3IDYB 5DR5H 4JY4A 4CMHC 4GRMA 3B2MA 5ITFA 3WKYA 5JPNB 4RZCA 4HXAL 4NIYE 3S88H 2GY7B 4TUUA 4NJAL 1HSAB 2Z91B 3IMRA 2A83A 3P11H 1NDGA 3GZKA 1N2RA 3CFEA 2BP0B 5DFVD 3Q05A 2FR4A 4BEIA 2ENYA 3FB7B 4AK1A 3RJDA 5AW5B 2YXVA 4M3KB 4NEHB 1WA2X 2AXJA 5KSAD 2ODHA 3DROA 5FGBA 3EBIA 1EJ8A 2UXFA 3DX1A 4MZ3A 4XMVA 4WJG3 5JW3H 3WOVA 3MXWH 1DQJA 2BJML 4Q74A 5KBMA 1HQRA 1BOYA 3KPQB 3O4LA 1TTCA 1TU2B 3A21A 3A4DA 4PJXE 4D0DB 3B5HA 5KBKA 1F02I 4KI5F 4BUHA 3F5WB 4XVSH 1JXKA 3UXFA 3GS7A 4LLQA 1CBVL 2ID5A 4PJ8D 4UANA 43C9B 4Y4FC 2FL5B 1BPLB 3RAJL 2QVFB 1IKOP 4F9LC 3MV8B 4Y88A 1JZJA 4QRBA 5D9SB 5A6IA 3LPWA 3PV6B 1WFOA 2OV0A 2QGDA 2V7NB 1HEJC 2FQFA 3VGAC 4NENB 3KWWA 1UXSB 4UOZA 3B7SA 4AKOA 1BQRA 4PJGA 5E8OA 1MI5E 3FT2A 5FK9A 1IBHA 1VFAB 3MGOA 3SGEI 3S37L 4OFVA 2ICCA 2X2HA 2DQIL 2OMBA 2HKAA 4IU2B 2NYYD 2DBJA 4JN2A 2G75B 4GIPD 2V8LA 3TJEH 1UUSA 5IGXH 4KTDH 3BE1H 4X99A 5E6UB 4CU7A 3VFUA 3IDJA 1RJYA 4NZRH 4RGNB 3LEVL 4W9LC 4BH8A 3D8MA 4KKAC 4XAWL 2V2XA 5ENWB 3S8WA 1KV3A 2V5TA 4M56A 4NBYB 3TEZA 4PGZA 2X89D 4TLTA 2ITCA 4QRRE 4IEFA 2EYRB 3MDJA 4Y9EA 2ZUUA 5E70A 3TZVA 1C1EH 4AM0Q 3MRRA 4AYEC 4MA7L 3S3BB 4KROB 2BDNH 1T6BX 4H88L 2EILB 1AGBA 3H7LA 4YSEA 5FM5O 4UTBL 3LMJL 3Q2LA 2XWTA 3CQFA 4NGHH 4QY8A 1XF4A 1D5BA 3Q2NA 1YEGL 4XN2A 1TETH 5FYKE 4BXVA 1JP5A 4IS6B 2YARA 5DUPH 3D48R 4YBQC 4HUNB 4H5SA 1MFCL 1SY6H 2CE6A 3MCG1 4HEMA 4QRFA 4U7KA 1H19A 1J1OL 3CZKA 1T1YA 2GUYA 5A6MA 3GUFA 5D7KE 2VXQH 4FLQA 4J2QA 1SZNA 1E67A 3CH1B 5EU5A 5LCVL 2HYMA 3L13A 2VLKA 1SY6A 3RP1A 4YDLC 2ZWNA 5I6XB 2I9TB 4YSOA 3HAEH 8FABB 4R3SB 1FIGL 4QF1B 1CGUA 3U4EB 2VXQA 4HAFA 3F62A 2E59A 1BM3H 5GGVH 1IIIA 5FDWB 2R2BA 3LKNA 1BFOA 4JRYB 3HAEA 3BUPA 4J3XA 5AD0A 1RJZA 3SKOB 1RZ7H 1IGFH 4L8SC 4LRNL 4PS4H 5F1IA 4B97A 2WUBH 3LKRA 1J0IA 2JELH 4HKZA 1KCSH 1OD9A 3WTYA 2I5YL 1KXTA 3OLDA 1FG2A 3MV9E 4FDWA 4FP8H 4OJFL 3F58L 4P2RE 2F61A 1XFPA 2Y72A 3NSDA 3P3YA 3KH4A 4FNRA 5ECGA 3Q2CA 2G9HA 5MP6L 2YZ8A 4NO2A 1IQWH 1H15B 3QJUB 4RVBA 4DGIH 3RUGB 2VUKA 3G3LA 2OZ4H 3AM8C 5K9OB 1F4WH 5E8DH 1J9CT 4DP9X 1SXBA 2RIKA 5AYQA 4G1EA 4I77H 4O2CA 5CHNB 4B5EA 4JJ5B 1D6VL 1V7MH 3C6LC 3AWEA 1FZMB 2PWGA 1PZ5B 3P9MA 3SDCC 3I3EA 1KV7A 3SDXE 4P2CG 1T4WA 4D9QE 3CHQA 3FFDB 1LDSA 1HEZA 1INEH 4AWJC 1F6FB 2QV4A 2FEEL 4TF4A 1JZ5A 1II4E 4OD3H 1OSPL 3Q8EA 4PLNC 1HINH 2NY5L 3T77A 4EOWH 3KVQA 4JZOA 2LLNA 5T3ZL 1RHFA 1ZE3C 3QQ3B 1J8HE 5E4EC 2ZOKA 3V9CA 5ISZE 1CK0L 2O5ZL 3EYSH 2AVFA 3G5VA 5KVMC 2WB1A 4FFVD 3CVBA 1Q94B 1FYTE 1BGXH 3HPLB 4JG5A 1BMGA 1MHHB 2EP6A 4ZX3A 3TC9A 2FX9H 1NLDH 2ESVB 2AQPA 1YEFL 4NQEB 4L9LB 2OSLA 1KGXA 3AW5A 4J8RA 4UILH 1FNEA 3IPFA 4ZO7A 3QYNA 3K1KC 4ZUUB 2XWJA 5H94A 1OHZA 5F9OH 2EDXA 3X14A 4ACPA 4XX1E 3BQUA 4HBCH 5E7FA 2Z8VC 4L4VE 4UOQA 3VNZA 4OSUH 4PRHB 3K74B 2V33A 3TPUA 2YC1A 3RTQD 1PDKB 5BPPA 1NFIA 1QBLL 2APFA 3NVQA 3TV3L 1KN2H 4OF7A 1Q4NX 4L1DA 4FULA 4PI2A 2IBZY 1ES0B 4LFHD 1IX2A 3ETSA 1HHKA 5F89B 2WLNA 3GHPA 1GOGA 2FJFB 3V5KB 1AFVH 3MLWL 3IFPA 5CMAA 2OTUA 2XIIA 2AEPL 4NRXA 1KLFB 2P7TB 3RY4A 4BE5A 5KBLA 1FL5B 3RY5A 2WMPA 4OT1H 5BXFA 4HUXB 4KKLD 4EZMA 2J6EA 5B1AB 3MJ8B 1CR9H 3Q48A 2X1OA 1GS6X 3W5MA 4LXFA 2FWLB 4POZC 1A22B 3N1GC 4PWHA 4RGND 4XNMB 4MX7A 1A6VH 1KJ3H 4KVPA 3MCKA 3D08A 1M6UA 1SMDA 3L5WB 3GZPA 3W39A 4MDJB 2RR3A 5DJAB 3D4GA 1TTAA 1T2QH 2ADGA 3D51A 3CSYA 2EDYA 3Q9QA 4BRJA 2R8SL 5DEZA 3MZTA 5IBTH 4HXBL 4DNLA 4G7YL 5A6LA 4Y8DC 3QUYA 2OA9A 3BP4B 4P2QB 1U41A 2AXWA 2M2DA 3BKJH 5DRXA 4A6YL 4ZMNA 4JFZH 5CCJA 5B4MD 4WUUE 3ULUL 4U6XB 4IBLT 2H0FA 1MNNA 2A1WL 5CCKH 1T0MA 1YJDH 5EDXA 1XHHA 3UTPD 2O5XL 3VG0L 4B9CA 1NBYA 2PYFB 1FNSL 5F3HB 3CFJB 1A9BB 2PR4L 4MJ6A 4XBPA 3PQYE 3EJTA 1U93B 4JE0A 4FQPA 3G6AB 3ZDZB 1BIIB 3VWJC 2H32H 5G4OA 3ECBB 1T6WA 1YEHL 1OP5K 4ZFQA 1U3HA 4GXFA 1IBFA 4ODTH 1XB8A 2Y4SA 3ZTJH 2VUYA 1R33A 2H32A 4ZZFA 2ZF8A 4MJ2A 3CFUA 3O3UN 1AHKA 1A1OB 3L4XA 5K59E 5AAMC 1HEHC 3ARXA 3T8XB 2C4XA 4DN4L 4OI7A 4ZFGH 1DN0A 2D9CA 2GK0B 4NN7B 5DSCB 3QCUL 2BSED 2J12B 1I7ZA 2YPVL 4OZHB 4PRPB 3W0WE 3TONA 4DIXA 1OCCB 4QXTA 4X5QA 4G6KL 4AZUA 3BWUF 1WS7A 5I5IA 3H6AA 1G1YA 4MMYA 4EUPG 1BPVA 4HWZB 1XGUA 3KYAA 4LEBA 4LBAA 4N20A 4RWYL 4BDVB 1BBJA 3GMOA 5ITBL 2JCCA 2M83A 2DQGL 3L17A 3BI9X 1RP9A 3NFSH 3BC9A 2JKNA 3NSFA 4IK7A 1LEKA 4Y19B 4G5ZL 2GIMA 5ALCL 1ZT1A 1KJVB 1U8CA 2BOBA 2D3VA 3F04A 5DMIH 4I48B 9PCYA 1YEIL 4OLWH 2I9LA 3ETBF 3QQ9C 2R7EB 3D6GA 4OBRA 5D7LB 1XF5A 3LS5H 2WSPA 2UY7B 3BFOA 2FSEA 4HGWB 4YDJA 4BSVA 5FM4A 5LBGA 2KI6A 5LAXB 3L9RB 3MKKA 3GXFA 3N2JA 3LN4B 4BZ1A 3ZUCA 1C12B 3X3GL 5DS2A 1IBBA 5AYTA 2RD0A 3B2UC 4K07A 3T4YB 3UCRA 5C0JA 3U6RB 4RH4A 4F24A 3L9EA 1NCBL 3FQTB 3DTXA 3DYMA 5T1KA 4JHVA 4CVZA 1GY2A 1PAZA 5EU6B 4HUVB 2CKBB 3CC5A 3EOBA 4GBXB 3KBEA 4X6DE 2YGNA 4NQED 1KFGA 4B27A 2AK4D 5EU4B 3X1EA 1KXVA 5IW3A 4Z8FH 3FQ4A 5IFJA 3V4LA 1A7QL 5C0CA 1WZKA 5HVGB 4KRNA 1BEYL 4YSSA 2JIXA 2NR6C 1LO4H 3BDBA 4LDCA 4RA0C 3QO1A 3UJIH 4AV5A 1T89A 4K3EH 4Y9BA 3N1FC 1RK7A 3O6FC 4UTAL 4M4RB 4ZPTA 2L04A 3E6HB 3T65A 2IDFA 5AG9A 4GXVH 1HTYA 1MFDH 3I3BA 3MLVL 5F1NA 1DQLH 2A74A 3GXDA 4P5KB 4WUKL 3BXNB 3PHQB 4JDVB 4LCUA 2NW3B 2B2XL 3NZHL 4N8PA 4GRWF 5BRZE 4Y4KA 4Z7UE 3RFZA 2BM3A 4G42A 4D9RD 2FBRA 2ARJQ 2H0EA 3TIDB 3C5XA 5HPMB 5D4QA 3CXDL 4FQXD 2ZWLT 4QYOA 2E7LC 5DJDA 2X6MA 3I02A 3MRHA 1F4AA 1PCXA 3AACA 5E2VH 3VGFA 2EDBA 3GXNA 4AIZA 3M17B 3D33A 2XXCB 1LGVA 1HI6B 1NFKA 4S0HA 3KEHA 2DS4A 5HYIA 4L05A 1G6RA 3BVVA 3FRUA 4U1MB 1PY4A 2GBAA 4CW1A 2D2OA 3CSPA 4XO5A 4NZUH 1JTPA 5DURB 3DK0A 1I8LA 1GCYA 3N9GL 1X9LA 5C0AA 4AUJA 2RTTA 5A7BA 2BS71 2XN9A 1XSKA 4KBPA 3C9NA 2Y36H 1T04B 4RFOH 3DDFA 3TS8A 2QQNL 5T5NG 3VCLA 1XTLA 5I1AA 4P2QD 4ZMVA 1FORL 5CEZE 2B08A 2WTRB 1G7LA 3GMLB 3QR0A 4C83A 1I8KA 3DIFA 1E9OB 4EVNB 3VTMA 3TCTA 4WFGD 3EDDA 1S8DB 2CO7B 2L7UA 4BHUA 1E4WL 1U4FA 5EOCH 1RXLA 2R69A 5D6DA 3UTSA 3E0GA 5GS1B 4RQQA 5IVXB 5AW9B 3DHPA 4CU6A 1XT5A 4X6FB 1L6ZA 1G7QA 2CO2A 2OJ1A 3BHBB 3BLBA 1OW0A 4J1UB 1JI2A 1E50A 2NCMA 3QWRA 4NRYA 3FH5A 3T3PB 3A67H 3LQZA 3OAZK 3N41F 5D5ME 2QT6A 1ROCA 5T1LB 3MBEA 3RWJB 5J9PA 1D7CA 3VD4A 3FUFA 4XVJL 1ZLVK 3TCLB 4B9PA 1OWRM 3FL7A 4M1DL 2HAZA 4BFGA 4PVBA 1P1VA 1HYSC 3AREB 4YBHA 5KYUA 4HD9A 4M6NH 1ZA3B 3ARVA 5HYSA 2EEBA 2AAVA 1ONQA 2OX5B 2DDQH 3MR9B 3V4PH 1ZGLM 3QDJD 3GIZL 4FLOA 4L8DB 4LKXA 3U0PA 4PW4A 4EI6B 2JH2A 4DP4X 2QQKH 5D2NA 2ZUQB 5GJSH 1SFDA 3RL2A 2ZTBA 3VI4A 3MRGA 3U9UA 4ONFL 4JPIA 3V4PA 5C7ZA 1VCBC 2VLRD 5E6IC 5FHAH 1JGUL 3QNXA 1PKOA 2BP8A 4OFYD 3RWGA 2N7BA 2VC2B 3HI6L 2CUAA 4QRPE 3FQUB 1JNNH 4JY5H 3KLSA 3NOIA 3L7EA 4LLDB 1QEWB 3MLSL 3NZ8B 1EEQA 4R97B 5J11B 1HOCB 2BC4A 5HGAA 2F0CA 1DQTA 2N7AA 4Y4FA 4LNRB 3VFVB 1U9KA 5DEFB 1QWUA 3NA9L 4LBEA 4Q9BA 3JYBA 4YHLH 3S36L 4F9LA 5AAPA 5G5DA 4KX7A 1ZY9A 3TWYA 4ANVA 3JUZA 5K1VA 5KYXA 2VZUA 5IBLC 1KELL 1SDYA 2P42B 5AVZB 2IAND 4LSUH 1U8NB 4MB1A 4AENB 5BZDB 3QUXD 3SPVB 4O9HL 1R5VB 3QZWG 2Z0BA 1M7IB 5EU6D 5C07D 2DZEA 4OCXL 4FZEH 4GBXD 1PLAA 1L6PA 1A6UL 3VD1A 1CPUA 2IPKA 4U6VH 4WEBH 4X7TA 4K5MA 4PJEE 4FXTA 3VD3A 3VFOB 3SDDC 1KWKA 2YAFA 4O2FA 2P5WA 3SBQA 4U6YB 1EBPA 1W0YT 4G80B 4OAWA 2YEZB 4NM8H 3RY6C 1QFHA 1UCTA 4N2CA 3US0A 1X44A 1IGIH 1XDTT 4FZ8L 3MCLH 2AV7B 2EDLA 3QWQB 1H6EA 2CK0L 4B9FA 1O9WA 3RI5F 2QQLL 1IFHH 2EIZB 3IFNH 1BMZA 4FQJH 5I0ZA 3EH2A 4S1SL 4WJ5A 3W11D 4MNHB 2X6CA 1LHZA 4G7VL 5A43C 1YY8A 5C9JB 1ZLUK 4ZUWB 1UA7A 2OL3L 1E27A 2WBKA 1LO2H 2J7LA 5E4AA 2WLJA 3KPPA 3L6FB 4KV5F 2FYYA 2YK1L 4KO7A 4N8VA 4YDVB 2QKIB 3Q3GA 4O58H 1V3MA 1U8PB 4FS0A 1BD2A 4NZTH 2VSMB 2WY3B 3L7FA 4D9LL 2AEQH 2YXMA 3D3VD 1KCUL 3DJRA 2D0GA 1AKJA 4U49A 4OIFA 5EBLA 3BYYA 3WNIA 3CZLA 2PYEE 5DO2C 1N0XL 2VN3A 5EZJA 3DXAD 4J12A 3P30L 4LVNB 4P9HL 2NUTB 3IXAA 4HJTA 3RVTC 4PVNA 1ADQL 4FQIH 3WO4C 3V0FA 1WWCA 1B3IA 1NGQH 1E4XH 3DBSA 4ILDA 4XN5A 3VSUA 5A2AA 4PTUB 4L8SA 2WN3A 1XGTA 1IU1A 3FHAA 4JFFE 1LK2A 5JHDE 4XMZA 1OB1B 3CZEA 4LLYB 2WPGA 4QTHA 3APNA 4WFHE 4G8IA 1LYQA 3MRBA 1KYOK 4YZWA 2G2RB 1K8DB 1PKQE 5E4IA 4JZNB 4Z5RA 1R0AL 4O00A 1BQLH 2I7OA 4ODXA 4UUJA 1AO7A 1A4CA 3PCYA 5SWSA 2EIBA 3ZTCC 3GQFA 5E2TL 3C6LA 5E6YA 3SDCA 4R8WH 1BF5A 1C8QA 1MCQA 5HJDA 4K7PX 4KROC 5CGYD 3F8UB 4C56A 4E9XA 1ZE3H 4XPAL 3I85A 2WBJB 4ZS6D 4M7ZC 3AG1B 1MVUA 1S7RA 2HN7B 4M6MH 2A9BA 4DW2H 5EF2A 2W1NA 2VDKB 5E5MB 4CADB 1SYSB 2AQTA 5BV7C 3P0VL 2IV9A 1E2VA 3UTZA 4PV1C 4Z3GA 4PCYA 2OAAA 4HZ1A 1J88A 5IJVB 2Z7ZA 2ORBH 1NKGA 3STZB 1BLIA 4HSAC 4HWNA 3K5SA 1HZLA 3FSAA 4X7SH 3ZDYE 2Y23A 4A66A 3T1WA 1LP9F 3EDJA 4R9HA 4Z7OF 2E47A 2R56H 1TVHA 4XPFL 4YFLF 1T7WA 2CLZA 3IT8D 4WK4B 4EZJA 5KVFE 1PG7H 4R5XA 2APWA 1NC2D 5IB1A 2VRKA 2ATPA 3CLFH 2D03L 4E0RA 2IFFL 1OAYH 5FFGA 2R0WL 2CHDA 1F4YH 3TIEB 4QJ4B 3ATAA 3PLYA 1FBIL 3HBZA 1UXWB 1JWMA 1FGNH 4G7SB 4F80A 2UWEA 1SXNA 3GZQA 3MV9B 1ID5I 3WKPA 6FABH 2VISA 5ALBH 1XV8A 1TTUA 3VDBA 3CQQA 5F7AA 2V5SA 1OCZB 3CFCH 4QRSB 2VDOH 1D7DA 3MNVB 4R96A 1N5YH 5AZEH 4D0CB 4NO5B 5IMLB 3FUMA 4K9JA 5FO9A 5AUMA 5TE6H 3QEUB 3EJCA 2D0FA 1ORQA 1UH3A 3FO1A 4R7NB 5F97E 1WEJH 2C1OA 2XJLA 1ZLDA 2YBRA 2WAHA 4ETYA 3WE6A 3RWIA 5KSUB 4GAJL 3ZPDA 3KL3A 2X6AA 1T20B 4Q52A 4PGBA 1J11A 3APDA 5FXCH 5HYQA 5KAQF 2GJ6A 2VWEC 2YMXL 5EFIB 5JPMB 1NFAA 4O2EA 1PBYA 1ZV5A 4U31A 4I9WD 4EN3C 2FB4L 2FVNA 5DEGB 1XR8B 3O9WD 4YZFF 5I1HH 5I0WA 2Q86A 4U1LA 2NNAB 4F33B 4FI8A 4AGOA 1FYTB 1AJ7L 4XCCH 4HUWA 4WW1B 3RVWC 5C3TA 1F8TH 2WWMC 4HIPA 3O3DB 1XSIA 3DYOA 2VJ0A 1T1ZA 3P4OB 3QDMB 1LD9B 5DZ9A 3V55A 2ENJA 5JR1L 4NS0A 2ADFH 4EUPB 2J21A 1NCDL 5EH1A 3BVDB 1YN6A 1IKFL 4I3SL 3FW6A 3V0JA 4BA0A 1OTUC 1T1XB 4Z9KB 2ATKA 2O5YH 3M1BA 1F2QA 1GMEA 3KYMA 1Q0YH 3R4DA 4OV5A 4IHOA 5KEZA 3MUZ1 5JDSB 2YWZA 3KPLB 5KJRH 1X5IA 1FFOA 3UZVA 3IDGA 1N18A 1MXDA 5I82A 1IGML 4Y2DB 3GSOA 3DX7A 4Q9RH 2P45B 1NIDA 5D6CB 2NY2D 4MMZB 3CK0L 2G2NA 5C0BB 3VWJA 3I75A 2EH8L 3QORC 3LRSA 1MI5D 1CD9B 4RRPM 5SX4H 3MV7E 5A40E 4X9FA 4Y4HB 3ZIMA 2XX0A 4JFQB 3UO8B 1P1ZB 3AY2A 4GQZA 1L7IH 3TM6A 1CLZL 1WTGT 3CN0A 2COVD 4NFCA 3QJZA 4JZJB 3MACH 3ARFB 1D6EA 1EHKB 1NUGA 5IVNA 2R1XA 3GSUA 1NUDA 1U92B 1FFNA 4LSVH 5AAMA 3ME0B 3FU7B 3CCHB 4LVOB 2V9QA 1S9YB 3NIFB 3O3BB 1AR1D 1ZDQA 3LZQA 4HQQH 3LYRA 5A3ID 2HJFB 1CFNB 5ES4B 1UWYA 5HI3D 1JV5B 2NQCA 1R6VA 1A14L 4GAYA 3E7JA 3ZE1F 3OKEB 3MNMA 4QRRD 3EYOA 5EO0B 4M48H 1WVZA 3WTWA 4PWGA 1QUNA 2EDFA 3BUQA 3L4UA 5IG7A 5CZRA 3FFCE 3NIGF 4Z7VE 3LCYA 4K4KA 2B77A 1IC4L 4MXQC 4BUGA 1OF2B 1LDPH 2WBJD 4AM0A 4GI9A 1NWOA 5FYKD 3CSTA 5HHME 5EBWA 5I0DA 2HG5B 2Q3AA 3AADB 4DCQA 4ZNCD 4XVOA 4ZO8A 5ICZA 5L2JA 2F5BL 4U1JB 3D12B 4PJBA 3OX8A 1MDTA 1G84A 1AIZA 2NTSP 5D7KD 3WFCL 1NAML 4KZ0A 4OJAA 1JPTL 4R6UA 1I9RH 1B0WA 3ZMRA 5K39B 3A4AA 1XCTB 4AQAB 4ZMLA 3CLEH 4Q4IA 1LEIA 3BVNA 1VACB 3D4YA 4KJPD 5AW4B 1GSKA 3R19A 4N90E 4KNUA 2DV6A 4JFVA 3AGVA 1K8IB 3MYJA 2CWRA 3K72A 4PJIA 4XH2B 3LD8C 3PUCA 1FG9C 2Z1KA 4CSTA 3I3DA 3MV9D 4G72B 3MU3A 4YLQT 5LHDA 3B9KB 4G8GB 5D1QE 4P2RD 2K1MA 2NR6A 5I1IL 1JHLL 4ZMXA 1KNOA 3FO0L 3CFNA 4UT7H 4NO3B 4TVPH 3O6FA 4UV7H 1FZOA 2AVGA 4M3HA 1ED3A 2EDDA 3L08A 2V8MA 1B4JL 1FNLA 3DUHA 3MODL 1Q90A 4NOFA 5BCAA 3X11A 4GUQA 4WWKD 4FFWC 3DVFA 4YHPA 5EC2A 5GRYA 3REVA 3Q8AA 5GGSB 4WK0B 4D9QD 5BMFH 2GTWB 3HS8A 5E95B 3L3IB 2EDJA 3DV6B 3L3DA 3HMWH 2YRBA 5AVUB 2BNRB 1KY6A 2XG4A 3CDGB 4ODSL 5TE7L 2QHRL 1VKXB 2A6IA 4FTVB 2WZ6A 2ZWKA 1XL6A 4U1NA 1OM3L 3WD5L 2Z92B 4NPYA 3JV5A 2E7LA 3E2HC 1ZLEA 3EDKA 2H6PB 3RDJA 1SYVB 3QFDA 4YPGB 1J8HD 3NK4A 1M4KA 3ATFA 5ISZD 4Q6KA 1BXAA 4UQEA 4QHUA 1U8KB 1M2OA 4GS7B 4EQ3A 1FYTD 3FFOA 4DKDC 1ZHLB 4QPEA 2JQZA 3QCTL 2WQVA 1HWHB 3MV11 3WHXB 5BS0B 1NCCH 4HS6B 6PAZA 5D70H 4DVRL 2PR9A 2AJZB 3CFQA 3Q8CA 4TTDC 2VDNB 3D69B 1S4IA 5A2BA 4MS8D 3VXNA 2DLHA 4ELMA 3LQAC 5B7FA 3ZZLA 3EDFA 1TDQA 2V5RA 5HY9B 3U4BH 1BDYA 5EUOE 3WS3B 1RZ8B 3BP5B 5I6MA 4L4VD 1C08B 2A6JB 4PJ5A 4Q9QL 4GRLD 3ASNB 5LXGH 4NZFA 5ECJE 4DZ8A 1TQTA 3HR6A 1NPNA 2NCEA 4F5CA 1FH2A 2F54E 2ARWA 5DVNA 1MWOA 2OW6A 4KQ3L 2FGZA 2YQ2A 5F7MC 5C0BD 4YIQB 3Q6GL 4QWWD 3G6JE 4B9IA 2NNXA 3UPAA 4JO8A 5ICYB 2QTEA 3K7UA 2C3XA 4FG6D 2ZAHA 2EE9A 1QSFB 1BG9A 3QZWB 4AOFA 4UM9A 2YGOA 4DQAA 4R4FH 4PG2C 2YXWA 5TQ0H 4MAUL 4I2XE 4XPGH 3LPGA 4HU2A 1S7XA 1RUAH 4YR6B 4UINH 5DS8B 1YYLL 2DI8A 1QFWH 3LNGA 1JV2A 2G0KA 1O7DC 2WGXA 3VTTA 1I1FB 4DGVL 2KUTA 4BK5C 1H8NA 1H3PL 5EEZA 1A6AB 2VN4A 2HTLC 4XP5L 3K6FA 3DA0A 1DQIA 2E7MA 3RGHA 4ADJA 3F01A 1U3YA 1FFRA 3FS9A 1T2JA 2WWNA 1U3NA 3SCMB 4Z95L 4J4PD 4LASL 1C5CH 1AC6A 2D9QB 3SE3C 4Y1SA 1VFBA 3D09A 4IRSB 5E6IA 1W6LA 4I0PD 1BVKA 2A73B 5INCB 1NJ9A 1QBBA 2PN5A 1S7VB 1ZSDB 3NJFA 5G2NA 4XP6H 4XNYL 1NKOA 4HWEL 5GS0C 1ZANL 4WUUD 4PJDA 3PL6D 1T21A 2UZPA 3WIIH 3PP4H 1YYMH 2N1TE 2CHNA 1E2WA 2YKKA 2I26N 3K2IA 4GG8B 3I6SA 1YECH 2AXFA 1Q1PA 2X4PB 1OPGH 2L7QA 4LE8A 4B53A 1KFAH 1OL0A 2NUPA 1E6JL 3C08H 3KPNB 3PQYD 5GS1C 3FO2A 1UJ3B 3EYUH 5ACZA 1OD7A 2FJHA 2QVKA 4N0UA 5H4ZA 1S46A 4HISA 2OCCB 4NNPH 1SRDA 3KWXA 4HEPA 1HH9B 3TYFB 3UZEA 1UGKA 3HKFA 2V5MA 1X5XA 4R4BA 4XR8C 1XGZA 2CR6A 4R26H 1JZ2A 3I9IA 3EH4B 3KBFA 2P8MB 5IQMA 4GJTB 3DVNB 1A3LL 2DQEL 1X9QA 3U1SL 5I17A 3SDDA 2MCMA 2HMIC 3KXFA 4M7JH 1JPGA 2WSKA 3UFIA 3BKCL 3OZ9H 4R90H 4XP9H 4YX2H 1J10A 3RY6A 3X1GA 1I8MA 1BSIA 5HD8D 3IN0A 1XGQA 1V3LA 3W0WD 4ONHB 4EBQL 1KB9K 2Z91A 1MQ8A 4OF8A 3NQIA 1B90A 4DVBB 2FE0A 1CDIA 4U6HB 2ZUQC 5EA0L 1EMTH 2CIIB 5FUCE 4B95C 4DF9A 1RIHH 4WENB 3BN9C 4ES9A 1MN4A 1BECA 4LGRB 2JTDA 4U1GC 4RNRB 3M7OA 4P9ML 3RIFK 3FOMB 3CDZB 2HRHA 4HFWB 1I3RB 4YHKH 4XMTA 2EABA 3OKDA 1JZ7A 3BRGC 3BRDA 4AX3A 3QIBD 3CNKA 5F21B 1MAJA 4HIHB 43C9A 2ZOLA 4YSTA 4P23B 1WIUA 2OJEB 1MCBA 2XICA 3KGTA 1MCRA 2AANA 1UACH 1YNLL 2QPFA 2IAMA 1IM3B 3MV8A 3KPSE 4BQ8A 1D9KB 2YUZA 4DSYA 5JMRA 3RURA 2OMVA 4TQPA 4LSRH 1MIEL 1CDYA 3VAEA 2HFTA 2CO4A 4LAQL 3K4ZA 4KX9A 1ZHKA 3F7LA 4PSPA 2PTTA 1OLZA 2H8PB 5DMKB 3D2UA 2Y3NA 1I1AD 4F7MA 5C2BH 1A5FH 1RZFL 2YAPA 4PJ7E 2WJ7A 4QHNA 4XXCA 5CJBA 1RVFH 1X7TA 1DO5A 1P7QB 3RWHB 2P52A 2Z93A 3ULVE 3KDPB 4FC3E 1ZT4A 4KQ4H 3QI9B 4PJHE 4ZI8A 1FVDA 3KJ4B 2BNUA 2YRZA 1MUJA 3MLZH 3Q5YA 3QR2A 4X6CA 2NXZB 3S7GA 4DTGH 2MHAB 3WLBB 3VXPB 4WNQB 5EDSA 2PWEA 1BM7A 3BGMB 4F58L 2Y9RT 3WFDL 4P46B 1MCHA 2MCG1 3BZFB 3SGJC 2DQMA 2NLJB 2UZXA 3PNRB 4BZ2A 4D3CL 5BV7H 4YQXH 1ET5A 4GIAA 4G8FB 5LQBL 3SDAB 3IU3B 2VSKB 5LJYH 4UZSA 3AMLA 1IBDA 1R5IA 4HVBA 4ZFFB 3AUVA 3T6VA 1NUNB 4MDIB 2MQ0A 4JANB 3ULUC 3LXAA 1CL7H 3KS0H 3CMOL 1CE1H 4Q2ZB 5I2IB 5F0MB 4L37A 2FJGB 1RZIA 3DHUA 1QEXA 3ARGB 1KTDA 5DJXA 3CXHK 1RQ5A 1QP1A 4K7FB 3CH1A 4OQTA 3T0WA 3OWEA 2FLBT 3BIBX 4WI0A 3PE9A 3CPUA 4MJIA 5I8EA 2HUEA 4QF1A 5GS2D 5FV2A 5E0QA 1ZSHA 5C0RL 4LSQL 1CYXA 3FONA 5IVZB 1AGDB 2NZIA 2WB7A 5FDWA 1TQCC 5KS9F 1GHFL 3GEWB 3SKOA 5CEZD 2ALAA 3P4MB 3ROOB 2FO4B 1MWAH 4KTEH 4NXSA 1U42A 2XY1A 1KEGL 4PYHA 3WSQL 2F53E 3EO0B 1HHIB 2JCCF 3IRCA 5JA9A 3BEVA 1MWAA 2DQCL 1H15A 5EN2A 3HHSB 4FFYL 4YHMH 2PW1A 3RUGA 4PP1C 2E56A 2WZPA 3FB5B 4DEPB 4HJSA 3CE1A 3GSNH 5CJOL 5HHNA 5DRNB 2OJZL 5TFSH 5DHYA 5K9OA 3MLPA 2Z4QA 3JTTA 1RI8A 4FI7A 1KIQA 1DCLA 1QSEE 1OSEA 3DJZA 5L6YL 4A04A 1JGEB 1KIPA 1S7QB 2X53A 3GSNA 4RIRA 2W07A 3IVKB 5ILTL 1IZJA 4UIMA 4BH7B 2Y5EA 1JHTA 3E8VA 4Y7MA 3RX9A 5DZPA 2VAAA 1OAKH 5AYUL 4EN3A 2IXQB 3ETTA 3VGHA 2MPVA 4OLUH 3RQ3A 4AMWA 1FDLH 4RISL 1A1MB 5H2BA 4HS3A 2X7LB 3VD0A 2X9YA 4ZX4A 3B43A 1K6QL 2ZOOA 4H0IA 1Y18B 5BRPA 5I18L 1ERNA 4J5VA 1KUMA 4YE0A 4Z76A 3WTTA 4JRLA 3V0HA 4Z7QE 3DX8B 2DM7A 3QT2A 2GFBA 5IIEA 5J3HC 5F7EH 1F11A 3O2VL 3CHPA 3MYZA 1EXUB 4NP4L 5CFAA 3MRMB 5INDA 2CKBL 5GSVA 5JXAL 3QNYA 4YXKH 1B0RB 1F3DJ 1LMIA 1UWGH 2ESVA 4X8JA 3O11A 5IM7A 4IW4C 4AV4A 3PGCB 3MBWA 1O6TA 3ZQWA 5TGBB 4GKZA 4OD1H 1CI3M 4XGZB 3TBTB 3ZE2F 4DEUA 3M1CA 1S9KC 4NHUA 5TTRA 3V0GA 4MAYD 3ECQA 1A1NB 3H55A 1J0KA 5I1EH 2B5IB 4IBQA 5HDWA 5IJCC 1L9TA 4PU2A 3GXPA 4JKMA 4ZUVA 3V5DB 3I2CL 3U1PA 3EJUA 2BHUA 3UZQA 3QORA 4UT6H 5DDHB 5BVJB 1FSKC 3OXSB 2NY1B 3V0AC 4WKZB 8PAZA 1MKFA 1EUTA 3MLRH 1OEZW 4POYA 4JO2L 3LV3A 3CIQA 1LO0H 5F89A 2VXTH 3CIAA 3GJFB 2FJFA 4UT6A 5DFTA 1IJ9A 3V5KA 4PPTA 2MCAA 1GZQB 2KZWA 1MJUL 2L0DA 3GHEL 2EEXA 2BVOB 4I88A 1RUMH 3EOTH 4UT9H 1HL5A 1BZDA 1OK8A 5D2LE 1DQKA 3BT2H 3QI9D 1I8UA 3GINA 3JTBA 2NXZD 3INUH 3QS2A 4UIKH 4ISVB 4GMTL 3VWKD 4NFDA 1EBAA 4HWUA 4UT9A 3P73A 1TJIH 4URKA 4NAMA 4WI9A 4P46D 3P4LA 3SKUD 1RHHA 1LE5A 4HDIB 1MAKA 2B1HL 4PR5A 4KRLB 3LKSB 2DYSB 3NAAL 3EO9L 4NLAA 4R7VA 3W9DB 4LQFH 4I1RA 4OLXH 1NBCA 3ES6A 4KUZL 5FGRA 5MEPB 1XGPB 3OPZH 3VXRE 4ODUB 2CJSA 3KW7A 5B38A 2R9HD 4IBVA 2WKGA 3VXUE 4KZEL 5CILL 3FTGA 5DC9B 2D7OA 4JDZB 3MOAH 4DHLA 3FCSB 2PYED 1IAKA 4AYDC 2DJUA 2PYFA 1TQBC 1G7PB 4N8CH 5F3HA 4KXZH 1YG9A 4K0OA 2YLHA 2NY3C 4A68A 4ODHL 4FYQA 5AENA 3L16A 1OO2A 4Y2DC 1IEBB 5FUOH 4H0LC 1U93A 4XNZB 5D7IE 1ZWIB 1KPRA 1S3KL 1OCWH 1BIIA 1EEYB 5FYLH 3NTCH 4Y4HC 4IKLA 3BLKA 2APXA 4MJJA 5I74B 3NIDF 3C5SB 4JGMA 5HJ3A 4W9ZA 4JFFD 5JHDD 2DQUL 1USZA 3HG4A 1QPPA 4WFHD 1R3LA 2FECL 3R06A 3VI4F 4ERSH 1DUZB 2ZXGA 4JR9L 5E94B 2FT7A 2KLTA 5JOEA 1JNJA 4UDTA 1RZKL 2DWDA 1FFTB 3FUJA 1JD9A 3CC1A 1OOWA 5ICXA 4OF0A 3QA3A 4LPYA 4OD2B 1PFOA 4K23L 3TO4C 4E9TA 3WEOA 2KPWA 1F1AA 5HI5C 3BMVA 4NN5C 3EHBC 1ANUA 1EGJL 4MJ5A 4BDVA 1KJMB 2H2SC 1GYVA 2R4SL 5DJ6A 1A0QL 2GBUA 3IPBA 3IKCB 1JHKL 2Q3ZA 3T6XA 1UA6L 2E7BA 4M5YH 5T3XD 4S1RH 1CDGA 1MCIA 5HHQA 5KAQG 4NT6B 3C60B 1PZ3A 5ID1A 2ZP9A 4KJYA 3DDGA 4IU3A 2EDMA 3FN0L 3GMRB 2ICWA 3RIAK 2CUIA 3S37H 4BSJA 5EO1A 2DQIH 3LQAH 3U6RA 4BHUI 3IXTB 2XZAH 2J1YA 4AEIL 1UA3A 1WP6A 4G6JL 4F20A 2J5WA 1IGJB 4FD0A 2P4AB 2VABA 5SWZA 1M05B 1KGIA 2DKSA 3QHTC 4YUEH 3QPQD 2AJYH 4JG1L 3LEVH 4Q6YA 2MCPL 1BZEA 3ILEA 2HLAB 4IRZH 4X5PA 1DFBL 4Z23A 2L4OA 3IJEB 4AC4A 1NINA 3HNVL 4CC4C 4TNVF 1VFMA 4Z7NF 3B9KC 5JA8B 3LB6D 1EAPA 1EANA 1ZLWK 2F19L 3ZDWA 3MJ7A 5F9DC 4FFZH 3C5ZB 1YCSA 1DR9A 2B8OT 2EADA 4GKSB 2XWXA 3N85L 3F6JA 4UTBH 5FW7A 5FWQA 5TF0A 3LKOB 5TF1L 1B88A 4AH2B 3QZPA 1D5RA 5CIPA 2DTSA 1PIGA 3K91A 4ABWA 4FFZA 1GXEA 2EE3A 3CHSA 4MHHG 1MFCH 1TZOA 4N1EA 4P5KA 2OBGA 4UTBA 5I16A 2NW3A 2I7SA 4EF3A 4D7PA 4PG2A 3SKMA 4WHYG 3HVDA 5GRUH 2PPEA 5F7UA 1CGSH 1FRGL 3ISYA 4N0FB 4XWGH 3KDMB 5I66A 3RILA 5EB9A 3GM0A 3HZMA 3GTTA 2EXWC 5JW4R 2A77L 1MIML 3W5NA 2VE6A 4I8DA 2G5UA 2MNUA 5LCVA 4BK5A 5BW7C 2J8UF 1KF9B 4UB0H 1HI6A 2C8NA 2OYPA 1MHEA 3VJ6B 3UACA 3T6QC 1X5GA 5D7HA 4LRNH 3PJNA 3STLB 5F0LB 4GS7C 4KKCC 3NJHA 5D7SH 3GUTA 1Q1JH 5GS0H 4OM0L 3SE3A 4OM1L 2I5YH 1JZEA 5I8CB 4GW1B 4OJFH 5E5UB 4NHCL 4PJCE 4R7DB 4WV1B 4NYLA 4R5TA 4XC1H 1LO3L 3D39E 4W9FC 3QIUD 5EZIL 2WTRA 5KYYA 1XF2B 3GMLA 3GMPA 4KKBC 4N9GA 4IKIA 2J8OA 1YEJL 1D6VH 1YPZA 4AL8L 2KYIA 1S8DA 4GRWB 2Q87A 5F6HI 1C5BL 3BPOB 3I50L 3JVFC 5A2KH 2VDQL 3NABL 1TZ8A 3WE1A 1DLHA 1KIRB 3EBAA 5GS1A 5IVXA 3AFLA 4AC2A 4DAGL 4M6OL 2P24A 1NEUA 1IZKA 1WWAX 1I4FB 3MV7D 1MW2A 4J1UA 1XCWA 3B7UX 5JIMA 3QZNA 2BSSB 3OB0K 1FZKB 2AQRA 3HPJB 3VFGL 1OANA 5JW5A 3WUWA 4DQOL 5IMMB 3WNNA 1T3FB 4N25A 4MQXD 5F96L 3SEPA 1KN4L 1NM9A 3U36A 2GC7C 4ZUSB 3QS3A 1HHHB 1QASA 2K4AA 5GZOA 5IV2B 5FEBA 3PPSA 1GGBL 2KZBA 4LSSL 4KAQH 4Y5XB 1DL7L 1AD0A 4OLZH 1DBAH 5E99L 3OGOE 3ARWA 1NQBA 5B1JC 1BVNP 5CZXD 2I69A 3MBXL 1TJMA 1UZGA 3IK2A 3U7AA 1XB3A 3S35L 4AVIA 2D4DA 3MJ9H 2VLJB 1S7WB 3DYPA 1IC7H 3ZIYA 2OP4L 1ZDSA 4MA3A 1XGRA 4MB3A 1YA5A 1NZRA 1OAXL 3L1EA 3TTSA 4Z7IA 3B9DA 3ARPA 3CBJB 3DPBA 3FFCD 4RBPH 5I8KH 4V1DB 1N5AA 4LU5L 3MJ9A 1AACA 4IRSC 1K85A 1KC5H 5BOJA 1QQDB 2LFGA 1OE3A 4FQ2H 3FQUA 4CN4A 3WDIA 2YQBA 3SBPA 5HHMD 4F57L 4Y1TA 1KBGH 2B1AL 4LLDA 1ND0A 1G7JB 1E42A 4XHJD 5IFHL 1ZHNA 4OKVA 2KZKA 1MRFH 2NX5E 3C60D 3GDCA 4H2CA 4WI4A 3TN0B 1A4JA 3WFBH 2BVUA 3KPTA 2LLGA 4J3OF 5CN3A 5B3NA 3WXVL 1NSNH 3QISA 5KSAC 2B3IA 3LZLA 2GJRA 3QXAA 1FNAA 3CPLA 4Z7WE 1JK9A 4M6AA 3JTSB 1UJ3C 3FN3A 3QDGA 5C09B 4EIBA 3MA7A 1NGPH 1KBWA 1OVZA 2H3XC 4Y1AA 4N90D 3UTQA 4DJMA 3OWRA 3PNWA 1GTFA 2ZUXA 5F7DA 1JNHB 3RBSA 2CLVB 3U1QA 3FAWA 3MRLB 1G7IA 3T2QA 5D1QD 1DTUA 2CRMA 2OXHA 5GISL 2ADJA 2WVVA 2LVEA 4JFDA 2A7BA 2E4FA 2VXVL 2R8SH 4BWTA 4NRZA 2WLZA 4OCRL 1CS6A 4WFFE 1FO0L 2YQ3A 5DUBA 3CVDA 3K6SB 3CGTA 1OP4A 1A65A 1A8JH 4AYBA 4PVMA 5JO5A 1TZIA 3SGJA 3FQ1A 1MHPL 2Z7YA 4K2UL 3R0MA 5CJQL 5FCUH 2HTKC 4LP8A 2VJ8A 2WTPA 3GRGA 1QRNE 2P5PA 3TWCL 3OSKA 2XETA 2DH3A 4FKKA 3ZE0F 3FK3A 3FF8A 2VW6A 1DSFL 4H20H 2O5XH 4A6YA 1OLLA 3VMPA 3X13B 3VG0H 5I1JL 3H0TB 4I1PA 1RP8A 4DN3L 3CTTA 5AW8B 3X3FH 2ICEB 5JUEL 5T1MB 3LTVA 4F7EA 3I6GB 4FABH 1S5HB 4XPTL 3GDBA 5CZVH 4QAMB 2ZKYA 2QSCH 2PO6B 1AQKL 2FEDC 4XMPH 1JWSA 3LRHA 4NCC2 4P23C 4ZPVB 4DEWA 3OHXC 5LN8A 4GY4A 3HAEG 4MKMA 4ZG1A 1U8HA 2ZXCA 1D9KC 1DQVA 3EYQC 1GJIA 1B6DA 2YPLA 1AD9A 4OFIA 4GB9A 4F27A 4WW2B 3ZRSA 1JGLH 4AGPA 3DK2A 4KZCA 2C9UA 4DN4H 3V4UH 3FCGA 2WYZA 3QCUH 5K9JH 3Q5TA 3L3JA 3TT1L 3KCPA 1JWUA 1U2HA 1QLEB 3L2MA 3QJHB 4DPBX 1XZWA 5FOBB 4Z3EA 3QXTA 4G6KH 1UKQA 2WBXA 3GSXB 4AVJA 2FX7H 2QGBA 1FFPB 4OCWL 4XRCB 4XN4A 1T1WB 5JYLA 5IT2H 3ZZ1A 1N6QL 1RUQL 4JZNA 4WIQA 1SJMA 1RUPL 1DVFB 4TVUA 4L8CA 3PWPB 2DICA 2VSCA 3CZJA 3PDOB 3HE6A 4OVVA 3RZWA 1HT6A 1MFBL 2ZOWA 2M1KA 3AT8A 4PJBF 3VXME 1K5NB 5KVDL 4JVWA 4PGJA 2PXYB 5C7XL 1YVLA 2WO3B 3NJNA 3GSVA 5IB4A 5IMKA 3SDAC 1UWEL 1JF1A 1E3XA 2HX9A 4RDBA 1D7FA 4EEEA 1EO5A 2YJQA 4JY6B 2DH2A 2JF1A 4CADA 1SYSA 4XPBL 3EIFA 4QXWA 3G9AB 4WNJA 1U8IA 3GNMH 1NCBH 1U3JA 1I53A 1GS7A 4GP8B 3T3MF 1MDAA 1ILSA 4JMXA 2UX7A 4IJ3C 4AT6A 5D1ZB 4GMSL 1VADA 4PJIF 2EUVA 4OLYL 4XBGA 5LBSL 2D31B 3FU9A 3ARGC 2JB6B 1PNDA 1G9NC 2XKUA 1Z5HA 2IH1B 3APCA 4MQ7B 1E65A 2Z7UA 3BQVA 4F7PB 5HVHB 2Y24A 5I73B 4FXLA 4BV1A 3C6SB 3BZ5A 5ADPH 1LEGA 5E8PA 3COOA 1M1XB 1MJ7L 1XIWB 4U3SB 5JYMA 12E8L 4V1DD 5EIQA 3DETC 2EYTA 1M53A 1Q9OB 2XV3A 3TNNA 3L95A 2X6BA 1GA2A 5KSBA 1N59B 3DLQR 2WLHA 1NCNA 1D5IL 3E38A 1H9DA 2CALA 4KITB 3DX9A 5SX4I 5HGHB 2WXHA 1UD6A 3MO1B 4I5BA 1XEDA 4EXKA 2JXMB 3MLXL 2GCYB 3VG9C 4WUKH 1P5UA 3V0DA 5HHOA 3VDCA 1PD1A 3RVUC 2R4RH 43CAA 2DAVA 4FFVC 4GW5A 3NZHH 1QFUL 4D2NA 1PJ9A 5IF0B 3U7YL 4PV9B 2QSVA 5D93B 1AZRA 3KVDD 3HN3A 4BJLA 3UG5A 1CMOA 4BWWA 3TEWA 3CXDH 5C09D 4XMWA 5JQIB 3FTSA 5IHZA 1UM4L 1QLRB 4RGOL 1AOZA 2C26A 1LP9B 1QI5A 3OKKB 3NYKA 4TLSA 4E42A 4Z7OB 1T20A 5J6HA 3L3KA 1AYOA 2CSPA 2Z31D 1CXEA 2IBZX 2XKNB 3QWNA 4GKOA 5EFIA 1FVCA 1IGCH 3BLPX 1LLAA 2DIBA 4IOSA 1ESOA 3N0PB 5DEGA 5KG9B 1Q9WA 2AXGB 4PJFE 4ELMF 1HXMB 2Q76B 3RTQC 2KLRA 3LNIA 4IIZA 4KTGA 4APQB 1MAMH 4XI5C 2NNAA 1KCBA 4F33A 4XP4L 2QQNH 5E5RB 3US9A 2BIPA 1T4KB 4MXWH 4FE9A 3O3EB 4EUPH 4XNXL 2JB5L 3WFZA 3QR1A 3QDAA 2ZXAA 3EBGA 1FNGA 4F15B 5DRWB 3ZMEA 2PCPB 5BQ7B 2CO3A 2FATH 5HYJE 1NMCB 3F84A 3VXSA 3IF1B 2B15A 4N85A 5I19L 1HHJB 4ANWA 5F7NC 4OJDH 2ZYIA 5KVGE 4NDMA 2HLEB 5C1MB 3UC2A 3KPRE 5E5LA 1FPTL 1Z0MA 3ZKXC 3MRCA 4KNSA 4M7KH 1IO4C 4LPCA 1XR9B 2IFGA 3CD4A 5JHAA 4X9IA 2E0PA 1MRDL 2PO6D 2B5IC 4QXGH 5I8OH 1Z5LB 4Z3IA 3KPSD 1U8MB 3A47A 4Y2DA 3CN3A 4FJ6A 3V0VA 5D6CA 1JRHL 1KENL 3DVGA 3OVUB 1LMKA 3MLYH 4JKWA 3NZSA 4DGYH 5K5YA 4Y4HA 2J2ZA 2JJUA 4TSAL 4D0BB 3BH8B 4GT0A 3MUGA 1K72A 2RFXB 2VDMB 4OZ4A 1ZVSB 4H8WC 4JPVL 4MZRA 2HX8A 4E41A 4B9GA 5L9DL 4WI8A 3QGVA 5ANHA 1MCEA 5D1XE 2IQ9L 1ZEAH 3HTLX 3ULVD 4K5LA 2ZWZA 4WU7A 3P4NB 1OM9A 2VQ1B 5FA4A 4OGYL 3UPRB 2ED7A 3NSXA 1E9PB 4HJJH 1MEXH 4PGCB 3UTSE 2FO1A 2HJFA 1CFNA 3BUYA 1DVFD 3EGDA 3TBSB 1MREL 2QLYA 1UG9A 1EJOH 3BP7B 4AW4A 2QHLA 5IEKA 3IGKA 1INQB 4IIQB 5DQJB 1F6AB 2NZ9D 4U3XA 3TO4A 4GKLA 1Z3GL 3IAGC 1IMHC 4Q8BA 4Z7QF 2FNBA 4HKBB 4W81A 3IMTA 3KLAA 1HH6A 2FRGP 4G6AC 3F7VB 3TP4A 2ZUWA 4HGMA 5H37H 3BWAB 5I1GH 2HKHH 5JLZB 2YEVB 5L88H 3T4AB 4DK3A 2VR6A 1TNMA 1YUHB 1UVQA 2OCFD 4JG9A 2EEDA 4PLKD 3W57A 5K9QI 5C70A 1P6WA 1ID2A 5BUAA 5H37A 3HR5B 2VH5H 4ENEC 3PP3H 4FNLL 3VQMA 2E9GA 1SFHA 2R0ZH 3MJ6A 1LJMA 2WCGA 4NQCA 2NDGA 5ANME 2XFXB 4C8XA 4NQVA 4NWTL 3JT0A 3KPMA 3O2DH 3NN8B 3FZUD 4B3VA 2R27A 5E9DA 3C2SA 3L3OB 1XCTA 4AQAA 3AWFA 3EGSB 1D5ZB 3RGBA 1KGJA 3OAUH 4XNZC 5EZPA 4ZOEA 3O2DA 4JQXC 1A3RL 4KDTC 2B0SL 2OMNA 4DP2X 5B3JE 2W94A 4AITA 1X7QB 3T2LA 2P8PA 2VDLH 3VSQA 4PRDA 3ZE1B 1G9ML 2EO9A 4NQDE 5EF3A 1JL8A 1WFNA 1XH3B 1ZVNA 3SYAA 3NH7H 4ZS7L 4WF7A 4NQSB 4ZNEA 2F53D 2IPUG 3L3HB 4RRPA 1NGWB 2FHCA 1SEBB 2LT9A 3PABB 4OZFB 1ML0A 2A5UA