1M42A

Solution structure of apocopc from pseudomonas syringae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
b'HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein C
publication title Solution structure of CopC: a cupredoxin-like protein involved in copper homeostasis
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1m42A00
2C9QA 2OMVA 1H6UA 2UZXA 2WQWA 2OMZA 4CC4A 3FAWA 1XEUA 1OT4A 3BC9A 4AQ1A 3BCFA 2YA1A 3FAXA 3BZ5A 2UZYA 2WQVA 2C9RA 5ICUA 2RA1A 4CC4C 1LYQA 1M42A 1O6TA 2OMWA 1H6TA 4CILA 1NM4A 2C9PA 2WQXA 2OMTA 2OMXA 2OMYA 3BCDA 1O6VA 2OMUA 1M9SA 2WQUA 1O6SA 4AW4A 2Y5QA 1IX2A
chains in the Genus database with same CATH superfamily
1JRHL 3FFCA 5EDSA 5JIDA 4J3OC 1COBA 5J6HB 2RMNA 2BVYA 3UZVA 2ZYRA 2NXYD 4MQTB 1ERNA 2WBJC 3ZIYA 4GP8B 1SOSA 3KL0A 5LCVL 1NGQH 1QW9A 2CD0A 1DR9A 3K1DA 1J0YA 5DS1A 5ERWA 1AZBA 4BA8A 2YPKB 4BZ2L 1T04A 3BH9B 3O41B 1IJNA 4M6OL 3CAFA 3HE6B 4LIQL 4WSJA 1USQA 1JPGA 4ZUVB 2CJUL 3BAKA 3VXQA 2C3GA 2GJZB 1G9MH 2A9BA 3RX9A 3MLSH 2UWEA 2EIZA 1U3HA 2C8NA 4DO4A 1XCQA 1UA7A 2BMKB 4PJDE 3C6SA 1DYZA 5CSZA 5IQNA 1CYGA 1CO1A 2YGQA 3TTSA 3WDHA 4X5QA 3WN5A 3Q3GA 3FB5B 4EN2A 3M1BA 3TJHC 4HJEA 5D7JD 4HFUH 5DURD 5JMOC 1U8NA 2IPUK 3MRBA 2CXGA 4FFTA 4Z0BL 4M7KH 2H1PH 2Q87A 3BEWB 5JXED 1CD1B 5DJ0A 3ZMRA 2Z0UA 4I3SH 5BRZD 3QJHA 2AJSL 3CSTA 4ZTPH 4DHLA 4L9LA 1BHGA 4AKPA 1PFCA 1YHPA 1WT5A 2OL3B 5K9OB 5DRNB 4HEPG 4H88H 4DVBA 4P5SA 1FNSL 2YPLE 1A6ZA 5D2LE 1LM8V 3KGSA 4LPVA 3X11B 4HJ1A 4M48H 4GW4A 3MQIA 4ODVL 4PRBB 1J10A 3LMJL 2J7LA 2OM5A 3IDMB 3TO4A 4U1JB 3DMMA 1KPRB 1R3LA 4GI9A 5T1MA 1CDUA 3CDZB 4GSRA 1P4BL 4JFEB 4PRAA 1F1AA 5CCHE 4AV0A 5CBAA 3L2NA 5DTFB 5IREA 5D1ZB 5I8EA 3SY6A 3GI9L 4MA3B 3TEUA 2D4FA 3ASOB 4QUOA 3MLXL 4K9EL 1MFDH 2VJ8A 2XXCB 1E2WA 1VJSA 3OLDA 3RPIB 1DLHA 2QQKH 3PF2A 5KUKA 4OF8A 2AJZA 1R3IL 3OZLA 2WO2B 2V2TB 1LO0H 5GZOC 1TU2A 2DQFA 1MHCA 3SQOH 5EPMB 5G5DB 1PTZA 1IIIA 2OQJB 2V2WB 3SDDD 3VFUA 3CZFB 1DJYA 3IDUA 1WV7T 5DD5L 3QUML 4GY4A 1JIBA 5CNHA 5F3BB 3FQYA 3WGVB 3GSNB 3EO0B 1HX0A 4MD5B 3FO1A 2LFEA 2A83B 4Y19D 3U4AA 5J13C 4X4XA 4X80H 5AB9A 1NMCB 3O81A 1HKLL 4FFWD 2E7DA 3X17A 3QE5A 3J7HA 1JGLL 8CGTA 4Z77B 2V5TA 3QJQB 2Q8BH 1KTDA 4H0LC 1AR2A 4CAGA 3FU6A 4O5LL 3IKCA 4RMRA 3DX1A 2C4FU 3QGVA 5D2NB 2GBAA 2A0LD 3L4UA 4NQSA 3PGFH 4PRHB 3UTQA 3FHQA 4RMVA 2XA3A 1FYHB 1ZANL 3F12B 1MCFA 4I77L 4CW1A 4OCSH 1IGCH 2H32H 1R5WB 2YPVA 2GI7A 4EN3C 4RX4D 3D69A 3GS0A 4M8VA 1OM3H 2N3JA 2XTJD 4BE5A 1UM6H 4PRDA 4UT9L 4TRPL 5JQ6H 1TF4A 5BPPA 1XL4A 4Q2ZB 1NWOA 4L4TE 2ZF9A 3BWAB 2Q7YB 3VXUA 3HB3B 4MBOA 1DDHA 3BD3A 3KS0H 4NKIL 3PIQA 4GG6B 1QLEB 2OK0L 5L7XH 1H8LA 4NENA 3ME0A 4UQ2B 5A2JH 1OM9A 3IDGA 3ZE2E 1WGOA 4E9XA 3V6FB 3FU5A 4PWKA 3TO2B 2D7OA 2PYED 3IXTB 3K6FA 1NCIA 2LLNA 5CD3A 3EHBC 2Z4QA 3SE3A 2HT3D 3HUJF 2FGZA 4JRXA 2IMNA 2MNJB 3L5WA 5DQJA 2VXTL 1FIGL 3I9GL 4BWWA 3INOA 5J4MA 1JN6B 4FDWA 4LKCB 2BOBA 3CCHA 2Y0SA 5BRQA 2K45A 1F11B 4I1NB 4AYFA 1NKOA 1HXMA 5H94B 4CC4C 4ZX4A 5IUSA 1PEWA 4PTTA 1KIQA 3CZEA 2RJMA 2VWEC 3QS3A 1CYXA 1QHQA 2H4EA 3GMMA 2DBJA 2VXQA 4ZPTA 4AGLA 5D71L 1F1GA 1YMHA 2Z92B 1U58B 2MCPL 4Z3GA 5KBNC 4E0RB 5F8QC 1D5ZB 1UJ3B 3JTTB 4FQCL 4X6DA 5EIVA 2G4EA 2MMXA 4PJXB 1T2JA 5C09D 4P2QE 4LNVA 3P02A 2QHRL 5DJ8B 2VQ4A 3MV01 1P4UA 4QRBA 2CO3A 3BAWA 4G8GE 4KTEH 5LGJB 3SHSA 3HC4H 3QJTB 3V0VB 3WHE0 4F8NA 1EAQA 2XZQL 1GGYA 3QUKA 4LVEA 1PD1A 3EBAA 3N2JA 4GFXA 5IMMB 4LLDB 1G7MA 3HCVA 3Q48A 3LEYL 1JGEA 4L8DB 5EU6A 2IO5A 4MXQD 4HMEA 4GUPB 2GJ6E 3CHQA 4YSPA 4HIEA 2OTWB 1NTDA 1TT6A 2HKFH 3T2NH 5AKVA 5GS1A 1AIFB 2FZ3B 3APFA 3T0EB 3F2LA 1OAYH 4TQIA 4R90H 5JTWA 3PGCB 4HHAB 4KRMB 5C0RL 1B2WL 4LPWA 5ABAA 3HZYA 3F65A 1NSNL 4QXTB 4KROC 4W70A 3SN6N 1AGDB 1HHJA 4FJZA 4X99B 2L7JA 1PG7H 1H8NA 2D7PA 1MCEA 1F6FB 2YN3A 2E47A 2LVEA 1SDYA 3FQUB 3OSKA 4L5FE 4MCYB 4OF0A 4WCYL 1K6QL 5IB4A 4B5EA 3CSYB 1EQWA 1FL3B 1FZMA 2VLKA 1NBZA 4M62L 3WKMH 4W9DC 3MBWA 4FL4B 3O4LB 4WI0A 5DQ9A 2DYPB 1I7ZB 3L08A 1BZDA 2VISB 4HUNB 1J5DA 2G9KA 5CJQL 1NFIB 1NIAA 3LKRA 4S2SA 4XMPL 3JV6A 2H0JA 1PX4A 1A6VL 5F7LB 4IHBA 3RIKA 4E5XB 4F8PA 1JF6A 5BVJA 3EJZC 3TURA 5BS0E 3UTSB 2OJ1A 2X3BA 3FJTA 4JN2A 1I7UB 3J27A 4ZXBC 3UXFA 1FG2A 2AK4A 4NRXB 3CFEA 3PWLB 4MHHI 1UA6H 4PW3A 5EZOL 3P0YH 4MYPA 4WO4B 1OAQL 3II3A 2FVNA 3KLKA 1BZ7A 3ZTCC 3S88L 1AGCA 4WKXA 1CTNA 3V0WH 3T3MB 1I3GL 1OT1A 2XN9A 3LQZB 4P46A 3ARFD 1L0XA 5D5MB 4DP9X 1J48A 2ATKA 3IMVA 2ENQA 2DQGL 2XWTB 3L3IB 4JY5H 3HC0B 1MLCB 1ILUA 2JCCA 2XWDA 3L9BA 5EZLA 3VFWA 1KJMB 1JPSH 3P4OA 4JG1L 4JM2D 5EOQL 2BNQD 4NUJA 3QR0A 3WXWH 4BGDA 2IWGA 5B7FA 5EZIH 5IQLA 4KX9A 15C8L 2E6QA 2GCYA 1HI6B 3FTZA 3QCTH 1AHWB 3MV7E 3P3TA 2HRHA 5LBVA 3TFKD 1QUNB 4J7RA 1XO8A 1HAWA 4JZJB 4LEXL 5I18L 3Q6FA 1IC0A 3TTYA 3RRQA 4ZOBA 4PGEB 3JTSB 4P3CH 4FNLH 1UB5B 2VXUL 3S37X 4MD0B 4MNQD 3CFIC 2V9TA 2XQBL 2RCSH 1MEXH 1HHGB 1YNLL 4JJHA 4JM4H 4YQXH 4FQJL 1AZRA 1N64H 1VFBB 3HKZA 5EO9B 4NQDE 5I71C 2WD0A 3UTZB 3W0WD 2I27N 2D7QA 4OUUB 3BQUC 3CV5A 2N0MA 1AI1L 4NO0B 3FXIC 2VR9A 1EVUA 1N7ML 2NNRA 3QORA 1C08B 4DERA 5ILTH 1KUMA 1KGCD 2KKQA 5KW9L 4A63A 4N0UE 2CHDA 4S1QH 3S34L 4ZOEA 2ZP8A 4ALAC 5ID0A 3BD4A 4ODWA 3TBWA 1TETH 4UDUA 3I6LE 4P4RA 3QDMA 1BVKB 2IQ9L 2NTFA 4L1HA 5EO0A 3DX9A 1Q0XL 1AJ7L 2GITA 2VIRB 5IHZB 1C8PA 1ZJBA 1MY5A 5AYTA 3NRQA 2HLEB 1VZIA 2KLSA 4ODXB 3EYOB 4LSPH 4X9HA 2V17H 5GGQH 4TLUA 4NUMA 3MNVA 1NPJA 1S9VA 4F9PA 2OMUB 4TNGA 3UYRL 4FFYH 1FFOA 3NAAL 1IKNC 3AFLA 2YS4A 4UM8B 4PS7A 5LQBL 3FRPB 3RQ3A 1VGKA 3CHRA 4NO2B 4PS4L 4JGJA 4LGPB 1PL3A 4K5NA 2NUTB 2G3XA 4AW7A 1JZ3A 3C6LB 3KPQA 3OZ9L 4L5FL 4N4YB 3U4EA 2FLRT 4HG4K 1CR9H 2H2SC 2YEZB 1QO3A 4LKXA 3DHMA 3MYZA 1PG7W 3FN3A 5DSCB 3JZ7A 4UOQA 5JUEL 4IRSD 1JTTA 3ZSSA 2WQVA 2WYHA 2WIIA 3RZCB 5DJYA 2F18A 1OPOA 1X7QA 3D07A 3VI3E 4XP9H 1ZE3H 2CNYA 4XMTA 2EC9T 4WK2B 3X12A 3L2LA 4XC1H 3X13A 2F54D 4N90D 3MRDA 4MQXD 5CUSL 1TJIL 4M7LH 5IFAH 1CBVL 3BH8B 3VXSA 1BG1A 2VKXA 3ARZA 3C5JA 1T7YA 1PX3A 4WTZG 3E8UH 2WNXA 1RAMA 1CZ8H 2ZSWB 2AQQA 1TTRA 3N3EA 3ARDB 2P5EE 3QZOA 2K6YA 3U2IA 1GPOH 4PCTA 3IETA 4WWKC 5EBMA 4AI7A 4RVBA 3VMOA 4MLSA 1NAML 4JFZL 4U1MA 3QI9D 4G6AC 4KVCH 4XC3L 4PS3A 2RQEA 4R4NC 4L8CA 3MU3A 1I9IH 2XFXA 4G7RB 2FLMA 5DRZA 3V8OA 5IJKA 3BIBX 5CZXC 4JFOB 1WZLA 3O3AA 4JFPA 3CFDB 1BVZA 2HT2D 3AQXA 2YGOA 5CLWA 5B1AB 4UTBA 4BWUA 2YGPA 3TYGH 1NGWB 4W68A 1FPTL 4Q6IC 4Z7NE 4JFFB 5E2JA 1NJ9A 5HHOE 4KTYA 3SDCC 2WANA 2XY2A 2YA1A 2OSWA 5C0CD 2OX5A 3EOTL 5I2IB 5IUCA 2CLRB 4NUGL 4OGXH 4G11A 2F15A 1Y1DA 3EUUA 2G75B 2AS5M 2VDNB 1UQSA 1J7VR 1ADQH 3P40A 4J3OD 1EXHA 1N18A 1QFPA 4GQPH 3NJHA 1YZZA 4B9IA 2WBJD 2FJUB 4HMCA 1CLYH 1VPOH 5GJSH 2P24A 3ZR5A 1RPQA 5L9DL 2J21A 1U8HA 3AQYA 2R59A 3VDBA 2WKLA 2LV4A 5E8PA 2H6PB 3VXRB 3CZSA 3LZNA 4KZEL 3NIDB 1RIVL 5FCSH 3TVMC 1E4WH 5FM5O 4X0NA 3PABB 3ABZA 2WLIA 2A4EA 5IQ9B 4LLQB 3TNNB 2KMWA 4MB3A 1BQLH 3CVBA 4X7EC 4AUYA 5DZ9A 1ZHLA 3REVA 4ALAL 1C5BL 1NCCH 5HYSA 3OKOA 1KPVB 1IB5A 1ZHKB 3TJHD 4LBEA 4YZFF 1D9KB 5BZXA 2CBPA 1DLFH 1YY8A 3GKWH 2Q7AA 4C58B 2VM4A 3AU1A 5F1IB 3RDTC 1AANA 4U1HA 3QUZD 4HETA 4TOYL 5LXGH 4P2OB 1YMMB 4M9PA 1M7IB 3RFZB 2OI9B 4HA1A 4KHXL 5CD5C 3AG2B 4NAMA 1UENA 3LN4A 2YPLD 3HG1D 3SEPA 2F74B 3V0JA 2DWXA 4D8PB 1F6LL 5ES4B 1S7XB 1XAKA 2FYYB 2EINB 4MMXC 3BI9X 3STBA 1WEJL 2RFXA 2K0RA 4MKMA 4RNRA 4Y9FA 2WLHA 2H26A 4DP8X 3UYPA 4QO1B 3CWGA 1JV2B 1KGIA 4KXBA 3WS6A 2IFFL 2BHZA 3J8F7 2JF1A 5MI0C 3T65A 1DL7H 4KK8D 4MYWB 3BUBA 5GRJH 5HHME 4ZMNA 1GSKA 1RUKH 4RZCA 3ESOA 3KGTA 2DJMA 3HOGA 1PCSA 4LCWA 1O9WA 1FO0B 4PWEA 1KLFA 2AQPA 5GZOD 3FB8A 4L37A 1BDYA 3MA9H 2FJHA 3LNIA 1DBBH 1EUUA 3FQXA 1WAAE 3SE8H 4C83B 4YHNB 1RSYA 4WAFA 1NAKL 1DBML 1KYUA 4N1EA 3GPSA 1OW0C 3TA3C 4QJ3B 1SQ2N 4DGUA 1PVHA 2EUVA 1OCWH 3QNYB 2XPGB 3JUYA 1L7IH 2Y36L 3GJEA 4FFYA 1V7NH 4KGJA 4K5OA 3OF6D 4PJEE 4ZFOA 5DUJA 2ZSVA 1KEGL 2NTSP 2Q3ZA 2X1WL 1KENH 1WJ3A 2YSTA 4MMZB 5HVHC 2HFEA 1F3RB 2B7DT 1AR1C 5D7IB 1XCXA 4RFEA 3N04A 3SGDI 4JO2H 4HWEL 1A9EA 2A77H 1DHKA 4DPCX 2IJ0C 3D2UA 1LK2B 1MRDH 3O9WC 4W93A 4YAQB 5KS9B 4PJBB 4X9BA 4EN3D 5KZCD 3LV3B 4AQ8A 4OZIB 2X7LA 1G7IB 5BXFB 35C8L 2AEQL 2QADC 2V33A 1VFAB 3QPXL 5KVMC 1JZFA 4L4TD 4XP5L 2KUTA 3FMGL 5F0JB 3CIAA 3NIFF 5MENB 3BZFB 1MUJB 1HEJC 4BYHA 3OXSB 2BP8A 3VXMB 4XB3A 3M88A 4K4KA 5CM1A 2FH8A 2UV3A 2NYZA 4XO8A 1N6QL 1LEGA 5IMLA 3VFNB 3QH3B 3EHBD 4F5CA 5DFTA 5CCJA 1UXSB 1NC2B 3X14A 3TXAA 1KB5H 3R06B 1N10A 1EDYA 1DBKH 2YMOA 1KYAA 3MNDA 4GRWB 2PW2A 3PWPA 1FRGL 2B2XL 1TYRA 4AL8H 4OI8A 1C12A 4FNRA 3SCMA 3NPSC 2P46B 3HNTH 4GXVH 3TL5A 3FQTA 1YO4A 3EBHA 2DYRB 3ZHNA 4Q0XH 4DZBA 5EEZA 3IXAA 1W6WA 3ABMB 4KRLB 3QHFL 4ZS6C 5C2BL 2R4SH 1FNEB 1CL7L 3SYQA 5E6ZA 1RK7A 3G6JA 3VM5A 5EZJA 3QIUB 3D39A 2DWDB 1SHSA 3EOBB 1D7FA 4G8GD 2CNZA 4JFQA 4OW6A 4H1LH 4X5WA 1JXJA 1W72L 2FT6A 2B1AL 3DSNA 4LCYA 2YD4A 2AHIA 4FFZH 4JZOA 3LEVH 4M1DH 1ADQA 1MY7A 4HXAH 3ZXAC 5IB3A 2AJVH 3TEYA 3ZLQC 3HZVB 2XBZA 1P9MC 3DK0A 4AEFA 1XMEB 3FT2A 3BAEH 4CILA 2VM3A 2O6DA 2FX9H 1IMHC 2R2HA 3VW3L 2HYMA 4XWGL 4PREB 4JMXA 4DW2H 1T7ZA 4EBQL 2TSBA 4KH2A 5EUOE 3R1GL 5FYLH 4Z7WF 4M1CC 3CZNA 4MJIE 3ARGC 4TUJB 2FJGA 3S37L 3F7PC 3E7JA 3F85A 2LR4A 2EKSA 3NJMA 4QHNB 3PL6B 3U9PH 5D4IA 5I1LA 2YUZA 2DWTA 1QKZH 5AD0B 5LGKA 1IKFL 3FO9A 4Q89A 4OGAD 5KSVB 3AWEA 3IGAA 2DLTA 4HKZB 3DX8A 3K5RA 1OP3K 3RJOA 1Y6MR 4MFHA 4AYDC 4XB7A 4QRUB 3PHOB 5CR8A 3VFRB 5HGDA 3S35H 3MGOB 4NJ9L 1FZKA 4XNXL 3V5KA 1FV1B 1E5AA 2J88H 3QFDB 4GS7B 2ED7A 3N50A 3SOBL 2GK0B 1D5XB 1CBJA 3EJZD 4BKLB 3JBG7 5D93B 4XCFH 5BS0D 3LAFA 2W60B 2CIIB 3BKJL 1VFOA 3OKDA 4M8QB 5I82A 3W57A 4ZZFA 2OMYB 4DVRH 4PP2A 5EOCL 3AROA 3HHSB 1D5BB 3O6MH 3BEVA 4N8VA 5I6KA 4PGDB 1HL8A 1W91A 4ZI8A 2BVQB 4Y88A 2DMCA 5HYSG 1I3VA 2ZOLA 1ZWIB 4P2RD 3S36X 5E6IB 5MEPB 4G43B 2NT0A 1EHLH 2EDKA 3ARSA 3NIGB 1ES0A 3AB0B 4PJ7F 4BFOA 1HC1A 3VDCA 5MERB 3HMWL 4GQRA 1JHLH 4KY2A 3ILEA 1A0QL 1A4AA 3H6JA 4AYID 4Z7QB 5HGAB 1OSEA 1UKQA 3LHPH 4EJ1C 3OAZK 5I8OL 1NIBA 2O5XH 5ECJE 3QFJE 5E8EA 1FUNA 3WSQH 4TPRH 4DT2A 4HV8B 4IOIB 4GBXB 4M03A 1JZEA 2FL5A 2OMWA 2R0LH 1UH2A 4OKVB 4A39A 2V8MA 1LMKA 4Y4HB 2WYTA 1BAFL 3MV7D 1YEDB 3QUXB 5F7BA 4DPAX 2NCEA 1BVNT 5SWZA 1DVXA 1DVUA 3MLTA 4W9LC 2NXZC 2R2BA 2Y2TA 3RZWA 4HJ0C 4APXB 2WTPA 3IU3A 1GKEA 4PUBH 1X5MA 5HYIA 4NT6B 4PJGB 1EMTH 2O4EA 4EDWH 5JHMA 5DS8B 1IC7H 3D18A 3NRFA 5FUCC 2WXRA 1XGUA 1MSPA 4LRNL 5CKAA 1AXSA 3LXCA 4XPGL 3HRZA 1G6RA 1Z3RA 1INEH 2R7EA 3EBGA 2WBWB 3BQUD 4KKQA 2DQUL 5KYNA 4P2AA 2HVJA 5L0QC 3DO3A 1AO7B 1EXUB 2CDGA 3PWJB 4YHOL 2VUOA 4IU2B 1MJJA 3U0PB 4HAFA 4H40A 3X3FL 5EF1A 1Q72L 2L0DA 1BA9A 25C8H 4F57H 1OTUC 1YYCA 4QXVA 4U6VH 4AMKH 4NFBA 4GAGH 4XWOC 3OAZH 2HSIA 3FTYA 1ECYA 4OD3L 1FNAA 2C5DC 4W9GC 3DJSA 3B2VH 4IRJB 4KI5E 3UOAB 3E6FA 4OZFB 1H15A 1SHMA 4KI5C 4TUOA 1HWGB 3KVDD 3RUGB 2YJQA 2AERT 3LXAA 4TNFA 2KZBA 2LABA 1DO6A 3OJVC 3IE9A 1U2CA 4FFVC 2PETA 4FNUA 4TLKA 2F19L 1IGYA 1JYNA 3P73B 3CFCH 1MQKH 1D5IH 4ZODA 2I5YL 2A9MH 1UXLA 3PWVA 4WTXA 4I0CC 1X5XA 3MXVH 3U25A 3UJTH 1RVFL 3FUKA 3TC9A 3L54A 1ET5A 1SBBA 2H2SD 2K9FB 1ZHBA 4N0YH 4PR5B 1AGEA 2G2RB 3OL2A 3SPGA 1NICA 3OAYK 4QY8B 4Z95L 4PRNA 3EG9B 5E5MB 5ICZA 1ZGLP 4XVSH 5JIMA 4ZSOB 1CGYA 5I8CB 1MVUB 1HXYA 5KYWA 4OGYH 2AGJH 4PSRA 3KLAB 1X9LA 4YL9A 1J9SA 2YSSB 1SQMA 4YDLB 2VL5A 4KY1H 1TCMA 2IWEA 5AKSA 3I6GB 1H0DB 3IM1A 3WHE1 1CDJA 3KPPB 4ZMXA 2IDSA 3WTTA 1S3KL 2NW2B 3INUH 5F7DB 5IEKB 1XAUA 4FQLH 2HJLB 2DD8H 3KXFA 1FGVL 4A67A 1KXQE 3BWZA 4DPBX 5FO9B 2NRDA 3HG5A 4JDTH 2HA1A 4H1LA 5I6PA 3W2DL 3O3DA 5ISZA 3BVNA 2OMXA 4JFSA 4IBSA 2P5ED 4GB9A 4WWKD 5CGTA 5D1QA 3LH8A 3FSVA 3RPKA 3TV3H 4G6AD 4AG4L 4R4ND 3C9NA 1HHKB 3OGCB 3ZTJH 4K07A 3CK0H 3E3QE 4MXWL 1S8DA 4UDTA 2BVEA 3PWUB 4UBDD 4XCNA 4GO8A 3RNQA 3E3QC 1F90L 3HZKB 3LNEA 5CZXD 4QAMB 4OJFL 2R69A 3RE0A 2EIKB 1BFTA 4AYBA 3FB7A 2F1EA 3BWSA 1QWHA 3P4NB 3B83A 3ARBA 3WN5C 4G2AA 2KYIA 3H0TB 3FOMA 5ETUA 5GRUH 4E41D 3MXWL 1MFAH 3OAYH 3SDCD 4GJTB 4JPVL 4XVOA 5HHOD 1S4IA 4QYOA 3NACL 3OXRB 3UIYA 4Q9QH 5ESAA 5DVMA 1QTPA 4FG6C 4FD0A 2JH2A 1P0SE 5DVOA 1WCBA 4ZAKC 5FKAA 2XWBB 2AJYH 4XNYH 1FFNA 4K23L 4H25A 4L9LC 3B7UX 1YN6A 1WT5C 3KYKL 2BC4B 3NFSL 3QNZB 4Z7UB 4BBWA 4U05A 1TG8A 4F7PB 1PLGL 1R24A 2AV7B 5CINL 3MDJA 3QRGH 4OLVH 1JWMA 4LF3A 2X6CA 4RRPG 1F5WA 3GXDA 1CFBA 3TVMD 1IVLA 3TO4C 3LNHA 5L88L 1FBIL 4XNZB 3DMMC 4IIZA 3HBQA 1OF2A 5B8CB 2APBA 4YSSA 2GT9A 3FO2B 4L3EA 2QJDA 1X7SA 1A7OH 4DN3L 4NOFA 5LGHL 1H8SA 2CO6B 5E94A 1MI5A 1NOFA 4GO6B 1XH3A 5EU7E 3A67H 4LDOB 4X7SH 1FZJB 5EU7C 2R0ZH 4BDVA 4E42B 4AT6B 3T8XB 4APQA 2WQSA 2R8SL 2Z8VC 4N2GA 4OZHF 2IANA 3I6SA 4LNRA 4JRYB 1XTLA 3RDTD 4F2EA 1XF4A 4S1RL 2WVUA 4XXWC 5BV7B 4O9HH 4IQHA 3OPZH 4N8VG 2BNRA 3WTXA 4HS6A 2BCKA 4X6BB 3U9UA 2BP5M 2KPWA 3VJ6B 3ZZLA 4UOJA 1B0RB 4LCVA 1JGIA 1WG3A 4LSDA 4MKTA 3WS3A 1J5OH 4B0MM 3IAQA 5CD5D 4XN5A 1HOCB 1NEZA 3HI6L 3Q1SL 4QHKJ 4WSGA 1BBJA 3CZUB 1OLLA 3IFPA 2B16A 1P7KB 3UBHA 1Z0MA 2BSEA 4C59B 4J27A 2ORBL 1UZ8A 5GHWH 2QQLH 2VQTA 5D72H 1T89C 3IDXL 2WZ5A 4OJDH 4TQEL 3OB0K 3CQQA 4G8IB 2Y1ZA 4X6FB 4FP8L 5GGTH 1FYTB 4QKXB 2XCMC 4S1SL 1Y6NR 5HHMD 2Q10A 1FIEA 3T3PB 2ICES 1KMGA 1LE9A 3CX5K 2JCWA 3WY3A 1F4AA 1QI3A 2XI9A 4LAQL 2IQAA 1ZT1A 3CC5A 4PVNA 3WXVH 3GXTA 1U8MB 4MA1B 2DAVA 4X7DC 4NQXA 4JJ5A 1I3UA 2BVOA 2DMBA 2ZAGA 4QRRA 3LZQA 5BQ7B 2QVIA 3COOA 2ARWA 2DQCH 2WVVA 1B0GB 2AV1B 4RMUA 2NY2C 2UZXA 4XZUA 5CP3A 3V2AR 3C5ZB 3WE6B 5IVXB 3WTVA 3TA3D 2I69A 1SRDA 1V7MH 2VC2L 1FL5A 4HK3N 4XNQA 1KACB 3QZWG 5I8KH 3AC0A 2CKNA 1YUKB 4C57C 5E7BA 5CJ5A 4PRIE 5C0BA 1DN2A 3S3SA 3Q9QA 1IILE 2BX5A 3BW9B 4NKMA 4WI4A 3RVXC 3APDA 4PB9L 3NFPB 1AR1D 2CAKA 5CN3A 1ZVNA 4TVUA 5AWNH 2B0SL 3RVTC 3QJFB 4WZ9A 3F01A 3PV6A 4CBZA 3O9WD 3QPQD 1RY7B 3OB0H 3HAEG 4AH2A 3RGVA 5KSBB 2X4TA 1GAFL 1Y18A 1KCUH 3ELQA 2QADD 3D4YA 3F7QA 3DHUA 2X9WA 4MDJA 4ANUA 4ELKA 3BN9C 1UWEH 1WZAA 4HUXB 1HKFA 2WTRB 4IU3A 2YBRB 1F4WL 1SGKA 3MAWA 1W9XA 2QVKA 1QRNE 2H7WA 4K8RL 2X70B 4PBVC 2X4RA 1BJMA 3NJXA 1TUPA 2OL3H 5I6XC 1AS7A 2E6JA 4PD4K 2Q76A 1N4XH 1KJ2L 1JS4A 1MHPL 4FZ8H 4HPYH 4FQXD 4MAYA 3F58L 2MCG1 4PJ5B 3ROLA 2K1MA 2NY7H 2X6VA 3IDIA 2BIHA 2OMVB 4HSQA 5KYXA 5HXMA 3MV8E 2EYTA 5GS1C 2VT0A 5I1IH 4IS6A 1J11A 3ZHFA 3DPBB 3GUFA 4P4KD 5IT2L 1YYML 5I16B 2G5RA 3DGGA 3NCMA 5K9JL 4K5LA 1CICA 1NCBL 1NDMB 4H8VA 3IS1X 4KJYA 3OMZA 3QC6X 1NCUA 1TSHA 4ELME 5JOPE 3SJVD 5T3ZE 3LRSB 3AMLA 4F7TA 3CHOA 5DHEA 5K33A 1BQ5A 1EJ6A 1T22B 4OZGA 2ZAIA 1KGJA 4S10A 4EUPA 5ACZA 3US1A 4RBPK 2BS8A 3JWNG 3G5WA 2YWYA 3O2DL 4ZS6D 1CK0H 4WUUE 3RI5F 3S36L 3MRLB 1KBGL 3KBEA 2DDQL 1FWXA 2NX5B 4X0KB 5ALCL 3BXNB 3KPSB 5GRVL 5A6MA 3L4VA 1NA8A 1IGIL 1Y1UA 3CUPB 4ERSL 5IB2A 4MD4B 4BFIB 3K46A 1U91B 3HUJE 1IGJB 1WICA 4H20L 1XGTA 1F86A 3C8DA 2WGNB 1EJOH 3HZMB 4HWBL 3MRFA 7FABL 5GGRY 1OD7A 2JK5A 4TNVF 3BP4B 3NJFA 4I2XB 8FABB 2VDOB 1KLGA 5L4MA 3GGWB 4H26A 5B21A 1AS8A 3TONA 2QPFA 3OHXB 2IDCA 2WPGA 5F6HJ 1T03L 2EIBA 4NN7B 4M1CD 3TU6A 3ARGD 2GSIA 1TKWB 4KTDL 3BO8B 1YEEH 1CGXA 4WKZA 4MJID 3MOAH 3LH2L 4N0FB 1JBJA 1N0XH 2XN2A 4HUVA 3S3BB 2LFGA 2DJUA 2QLVB 2ZZUT 4GRMA 1FORH 4LSTH 4ZFZA 1OHQA 3VSUA 1RUAH 2OA9A 3KS0J 1I8LC 1CD8A 1R3JB 4UYQA 1UHVA 4NQEE 1E7UA 4RBPH 4D9RE 5T33H 4FLQA 4GSUA 2AXGA 4CADB 1E6OL 4NWUH 3RA7L 1MJ8L 1UEYA 4FI7A 1MCWM 1T7XA 2K3HA 3Q6GH 3VFSB 4BM7A 3CSFA 2FATL 4PRPB 5ANHA 4F8OA 1RULL 3GHEH 3CSPA 2P5WA 3KDMB 5JO5B 1BJ1H 3EF4A 3MRJB 5T3ZH 3ROOA 4GO9A 2F9BT 1MFBH 1S7RB 3KBHE 3MRMB 4QXUL 4N2HA 3DXAA 5JPMB 1ZGLM 3CFJA 2BP0B 3CLEL 4KMTH 1L7TH 4OSUH 1NDGA 3S5LG 3Q7JA 2AZAA 1AKJB 1CLVA 4HOWA 1IL1A 5TDOB 1IBFA 1CE6A 2V7HB 5IF0B 4AEIL 5CFAA 1J8HB 2D0FA 2UXGA 1FVEB 2GYSA 4OKDA 2OR8A 3UAAA 4Z18A 2VDLB 1MREL 2OR9L 1OT2A 3V7MA 2BVTA 2A6KA 5IWLA 2J8HA 2BSRB 3UO1L 4ZX6A 4GEJA 5GSVB 1GC1H 1NEZG 1CFSB 4FQIL 1ROCA 6TAAA 1YEKL 1ETZB 2HCZX 4WSKA 2HX8A 3L9RB 5ALBH 4ODTL 3M46A 1NCDL 2EEBA 4KUZH 2NXZD 2XQ0A 5E2VL 4HJ0D 2NY3C 1JZ4A 2J43A 3S8GB 5J6HA 1S7TB 3OX8B 4U6HB 4ODBD 1WTLA 3KJ4C 4R97C 4N2LA 2ZONA 5FC9A 5TPWL 2AXFA 4G3YH 1TQCC 1EH9A 2YPKA 4G6KL 4LGRB 4LZKA 3B43A 1VESA 1DQTA 3BH9A 1IO4C 1MVFA 1EFXD 2JLLA 1AS6A 5SWSD 1HSAA 3QJOA 3HE6A 4AEHH 2GBVA 7PAZA 2F5AL 1YQVH 3VD1A 3HN8A 4L8BB 5I1GL 2EDOA 4YHLH 3H2WA 3ZDXB 2TRYA 3BDXA 2VLJB 1OTUD 3PP4L 3IJSA 1JZ7A 2BMKA 4X8XA 4XMWA 3H9SE 1L9SA 3FQ2A 4JANB 4V2BA 3MO1A 2V5SA 1UVQB 5D4JA 5F71A 1SZNA 2K9UA 5ITFB 1FHNA 3ULVF 1MCPL 1QTYT 3HI1B 1SXAA 2P43B 1FC1A 5F7MC 3GHBH 4KI5D 1URLA 3AXIA 1TZOA 3BEWA 1W6LA 1CD1A 1ULVA 3CMOL 4GQ9H 4X6CA 1F0LA 5HYJE 4F2ME 2P8PB 4JQVA 4N6RB 2N56A 5I6NA 4TQHA 4H0IA 1XD0A 5EZPA 1U8IB 2CWRA 2OL3A 4FFVD 4BH8B 5IOKA 5K9OA 4GG6F 1K4DA 4U1SB 1IFGA 2E27H 2JJTA 5DRNA 1KTKE 2K6ZA 2AMGA 3VXPB 4B41A 4U1LB 1V55B 1SOQA 4JZNB 2X53A 1JZ6A 5HPOA 2RBLA 4CNIB 1QUPA 2EKJA 4DKEH 4MAUH 4AYGA 1G1KA 3IDMA 2XXGA 3VRJB 5IJKC 4U1JA 1KPRA 3HNVH 1CFVH 3DX3A 3CDZA 4N1HB 2I9LA 2IV9A 1DJSA 3F6JA 5DTFA 4HKBA 3D9AL 3TCLA 1MCCA 4KO7A 2YAFA 1LEKB 2EDNA 3CX2A 3DVGB 3T6XA 2AJXL 5IB5B 4Q9CA 1LO0L 5TE6H 3GWJA 5MEOB 3QAZC 5FX3A 4JG0L 3QISA 1IGML 4I48B 2E74C 2YZ1A 3KPNB 3MRKA 5E9DE 5FKPB 5F7KC 3I9PA 3G7TA 5LG1A 2V2TA 4DTGL 3KLLA 1E9QA 5EPMA 2VDRL 5G5DA 2CCLA 4PJXF 4BCZA 1WWBX 2V2WA 4M43H 4R5VA 4Y16C 5F0MB 3GIVB 5LN8A 2PXYB 2MHAA 2ZOTA 4Q52A 5E8DL 5LHDA 3GSNA 2BRRL 3EO0A 4OJEH 3SE9L 3EH3B 4JM0A 3CFNA 4QTIH 2A83A 1WA2X 1T0NB 5DU7A 5MP6L 4Y1AA 3WFHB 2ZKHL 1E7VA 3NPZB 1P7QD 3ALXA 1O6VA 3A5VA 5DUPH 1PD6A 2WSKA 5K1VA 4OVUA 4KPHL 4Z77A 2VRAA 4EUPG 3SGJA 1IFHH 2QR0A 2WQWA 2FH6A 1KYOK 4C55A 5IIEA 3MV9B 1D6EA 4NZUH 2LW3A 3RX5A 1O0VA 5D2NA 3F7VB 3WCYA 4PRHA 2VXSH 1OM3L 3QJZA 1BQUA 1OSZB 4OLEA 1E9PB 3F12A 1P7BA 5FUOL 1WUZA 1XCWA 4BV1A 1R5WA 1CF8H 1BXXA 4U2ZA 2Z4TA 3V4VB 3KWUA 4FG6D 3E2HC 1X7TA 4HJJL 1TQBC 5IBTL 1HSBB 4ZAKD 3IFNH 1QPPA 1P2CB 1T5WA 4Q2ZA 3R19A 3BWAA 2YD0A 5LWYL 4BELD 3L1FA 4GG6A 1NBCA 1IT9L 3MYJB 4K8RD 4P48A 3S8WA 2JXMB 5CR1A 1E43A 4GXFA 2VO8A 3IXTA 3MFFB 3SIKA 1UKSA 3L3JB 4GKZB 3TO4D 3KYOB 1JGVH 3DMMD 3LIZH 4UZGA 1QPXA 3EDDA 3K80A 3RDJA 5D6DA 1J1OH 2PO6A 4YDKH 1BZEA 4NQVB 2UVFA 3C75A 1JN6A 4LKCA 5DDHB 4CRPA 1F11A 3WS6C 4I89A 3ZDWA 4ZNEA 4MB5A 5H94A 5FPIA 5KANG 3U0TB 3T3MF 4AGPA 1N5YL 3PDDA 1UACL 1U8PB 5D5MF 3PJSA 2OYLA 2VLRE 1RUPH 3CFKA 4DGVH 1CDYA 1JFQH 2P52A 1KTCA 4FXGB 2Z92A 4NXSA 4E0RA 1D5ZA 1UJ3A 2YD7A 5B1JA 2PCPB 12E8L 2TSAA 5ENWA 1PBYA 1BVLA 3RNKB 1TSRA 3JWOH 3MSPA 4R5XA 4WUKL 3WKPA 1JXDA 5LGJA 1HCFX 2JFCA 3FCBA 3S4SB 1QBML 5HYEA 1CT8B 1IKOP 1IC5H 5T1KB 5IMMA 4LLDA 1S5HB 5KVGH 4J1UB 1Q9LB 5J06A 1F3DH 3EJYC 4L8DA 5MEQB 1S7QB 2AF2A 3AUVA 3BPLC 3PAUA 1X6NA 5HHNA 3KNBB 4GUPA 2AW2A 2FQGA 4UTBL 5EFIA 2OTWA 3SB3A 3TA4D 3SPJA 1Z3GL 1AIFA 2FZ3A 3T0EA 4YZFE 2KZ1B 3CLWA 4HHAA 3RIFF 1BJ8A 4JG5A 3RWEA 3LZFH 3I3EA 3SKOB 3DO7B 4AQ8C 1AGDA 3BOVA 4Q58C 2FQEA 1MW3A 4PJAE 5F3BA 5ESQB 2V9UA 4DK3A 4Z3HA 1CGSH 2A73B 4NQCB 1FL3A 1GCYA 4XVJL 5A40E 4RGOL 3FCTA 4PLJC 1HL9A 5CILL 1T83C 3UPAA 1XR8B 2VDNH 3X2QB 3OAWA 4YX2H 1RQ5A 3O4LA 4R7NB 2DYPA 2VISA 3L8QA 2PPAA 2NY6C 3BPOB 1NFIA 2ED6A 4IBZA 3UTTA 4E5XA 4V1DE 2EDDA 4K3JL 3T6ZA 3UTSA 1JGDB 4N6QA 4ONFL 2VDKH 4AKQA 1VDGA 1I7UA 1MCJA 4YDIL 1UZ6F 5DO2C 3SYOA 4X9YA 5F9JB 4PRID 4NRXA 3LS4L 3PWLA 2IH1B 2W07B 3KWVA 1Q8MA 4WO4A 3RVXD 5E08L 4AJVA 2XZCH 2W0PA 4WLCA 3VGAB 2COVD 1XIWB 4JFWA 1OAUL 5HGHB 4HW6A 4CKVX 3VG0L 4YFDB 3RVTD 3LQZA 3DDFA 1QABA 3EJUA 4QOKE 5ESVB 1F97A 1YDPB 4G59C 2XWTA 4NNPH 1RK1B 3DURB 3L3IA 5DO8A 1MLCA 5AKTA 1MWAL 2KS0A 2NDGA 4OFPA 4XNAA 2Q9OA 3SPVB 1XSIA 1KJMA 1A14H 2VKWA 3BN9D 1D5RA 3DJ9A 3MRHA 5D7LE 2BHUA 1KBVA 4NWTL 2ZF8A 5T1JA 4Q6YA 4ORZC 5GIRB 1AD0B 4W6WB 1DCEA 2W0KA 3EDEA 5ANMA 1HI6A 2VLLB 5H37G 2ZXWB 2FT8A 5HTSA 4P3CL 3S8FB 1ASPA 3FQ1A 2J8UB 4X5LA 3CHPA 2FR4B 1QUNA 4A7GF 1MEXL 2CRZA 1GGCL 4L4VB 3H56A 1ZEAL 4ZX5A 3JTSA 4PGEA 4F58L 1J0HA 1WFTA 4MD0A 4OM1H 4OQ1A 3V4LA 1J05B 3NCYS 1ZDQA 1HHGA 3FONB 3MV8D 2RR3A 4MMYB 4HGWB 2OPCA 4UILH 3GZPA 3CTTA 1VFBA 5EO9A 4HS3B 3LKNB 2NY4B 3IRZA 3UTZA 1Q9OA 4OUUA 4DZ8B 5HBBA 2A6DB 4UUJB 4U31A 3LYRA 4N2IA 5I76B 3ZU8A 5E8NA 2DH3A 1VEMA 2F8IA 2NCMA 4L29B 4YSCA 4WVRA 1C08A 5FOBA 4YWGH 1KV3A 1ASQA 3NIFE 2Q3XA 1MF2H 1QQDB 3WIFB 2DRUA 1PPIA 1VRSA 5JHDB 4JFDE 4WUUD 1MZZA 1WC7B 3T09A 3ETTA 2CKBB 3WAKA 1A3QA 3K7UA 5TGBA 1ECZA 2DWEA 1KC5H 2FIRT 1BVKA 3OTTA 1NFDB 3DETC 3LQAC 4U49A 3AT0A 3HFMH 3PDOB 5IHZA 4WW1A 2DMKA 1ICTA 3DBXB 1DQLH 3VNZA 1XWVA 2AK4D 3EYOA 3Q8AA 5FF6B 3E80A 3CBJB 2YLHA 2J6EH 4TVPE 3US9A 5IFHL 3L7FB 2OMUA 4L1TA 4YHKH 3SKJL 1T6VN 2CO1A 4H8WC 4OB5H 4ODHH 5DD3L 2X40A 4OCRL 4PEEA 2JJSC 2GBUA 4UM8A 4EF3A 2YAEA 2XN9D 3B9KB 4MA7L 3FRPA 3LS5H 3BVTA 1U0QA 3LIZA 3FZUC 4NO2A 5GGRB 3F5WB 3OLIA 2NUTA 1QVOB 3PXJA 3NIDF 2VZTA 4FXKB 1BOGA 2OSLB 3C6LA 4P23C 2X4NB 5HD8C 5CZVL 2HWZL 1H3PH 3KMDA 5C08E 3EH1A 5KBMA 4IKIA 3KVPA 4KKZA 5DSCA 2OBGA 4QRSA 4AMWA 3FQRB 1M71A 4NQED 4ACPA 2NYYC 2WLNA 3RZCA 3FSZA 5DUML 1B2YA 3UACA 4A7GA 5JOFB 1KYDA 4Y5VB 3HS0C 2B1HH 3S3DB 2W88A 3MLYH 4YXKH 5HPMB 1A3LH 4ZYKB 1KBKA 3LZPA 5C0AE 2XWXA 4GOSA 4M00A 5DD6B 1A7QL 2ZSWA 1KGUA 5T1DL 2EVIA 2BDNH 5E8OB 4CN6A 1PSKH 4H4NA 4Z7WE 1PNCA 5DVKA 4Z5RB 3HRZC 1FGNL 1CQKA 3OBAA 1I9JL 2BINA 4G9FA 4IGBB 1QI4A 5KYUB 3SKUD 4PS8A 3NDYE 2HKHH 1T1ZB 3FFDB 1JXKA 3KW8A 2OXGB 1O9VA 5T1LB 3UPRB 1URIA 2X38A 4FKHA 3V4UL 2EH8H 4Y9EA 4JFOA 2NUPB 4TLSA 1YG9A 3RWJB 3BP7A 3CFDA 4GI8A 4PVLA 5IM7B 2WLYA 1SEQL 2BOLA 4MJ5A 5KJ4A 1NGWA 3DRTB 3UAJC 5DRWA 3QDMD 1E4XH 1QSFA 3VXNB 3BZEA 4A2HA 2J1KA 1EEYB 5I2IA 1NZRA 1Q0YH 1U8CA 5INDA 2VRKA 1FNHA 1RURL 5KSAB 1I9EA 2PP8A 3VWJB 3A6BL 1JNLH 2G75A 1OE1A 3IPFA 2NY3D 1QNZL 4YR6A 2GTWB 3O2VH 4WHCA 1MIEH 4H2AA 4R4FL 4QRPA 4DEUA 4FG4A 3BIAX 1MJUH 1XGYL 3GMRB 3W1ZA 4QTHB 4W9EC 1PF3A 2GSGA 3UZEA 2IFGA 1KNOB 3IGLA 5E9AA 3EYUH 5DGRA 2ICEC 4TSCH 4PJ7E 5JW3L 5IMKB 4HQQL 3HJEA 3NTCL 1DSFH 1NWPA 1DN0A 1XTMA 2W0LA 2VR7A 3D25A 1XSJA 3B5HA 3JVFC 4GI6A 2QKIB 4U6YB 2E9IA 5F88A 3PABA 5K9QG 5FO8B 1AP2B 1RV6X 5IQ9A 4LLQA 4EAEA 2PYEB 4AL8C 2Z3FA 5J89A 2O5ZL 3FFCB 1E4XI 3NEOA 5D7IF 5HHQA 1IQWH 3GFUA 2ODHA 2AEPH 3CE1A 4XPFL 5LBSL 3PYCA 3UZVB 3X1FA 1JZ5A 1QWNA 4F9LC 1BD2E 1KPVA 1ZHKA 4K3EL 5A7BA 1YY9C 3LQAL 4IOFC 4X8GA 4E5XG 5I0VA 1OQOA 4PJBF 1PZAA 1NDTA 4ZW3A 1KFAH 1AQHA 1DJIA 4OZIF 4M5YH 5J12B 2YWZA 2MFNA 2CGRL 3VXSD 3JWNE 3FTGB 4B3VA 4ZNCD 5HYJD 2EILB 4H8WL 3JWNC 4TVPL 3VXQB 3K4AA 2DKSA 1UB6A 4LCCB 1R0AL 2ZG3A 3FUIA 4P2OA 2EIZB 3LNFA 1YMMA 1M7IA 3BLKA 3PNRB 4FA8A 1XCQB 3LDBB 5D1QC 6CGTA 3RFZA 2ITFA 5C09B 2R0WH 2AEOA 2GIXA 3WD5H 1MCLA 5EWIL 3Q3GB 4G5AA 4AZUA 2P8MB 3H3PH 2EUXA 2B5IC 1NM4A 2AEWA 1U8NB 4D8PA 3LZLA 3QIWA 1S7XA 1W80A 3SO3C 3BUDA 2Y5QA 5DJ0B 2MPAL 4LU5L 3D1MC 3HI5H 4OCWL 1SOKA 4JB9L 4GRWF 4WFGE 3ZL1A 4QO1A 3QJHB 3UJJH 1JV2A 1YEJH 3ARBC 3BAJA 2LU3A 1ZTMA 4M5ZH 4P3DB 1JNHB 1OTSC 2HJFA 4PJ9D 5CAYB 4ETQA 2X2IA 4TS6A 4DVBB 2EEXA 1A6ZB 4DKFL 4LCIL 3NH7H 4FTVB 5E9DD 1S9WB 4YIQB 1S7UB 1TZAA 4GW4B 4AK2A 3NA9H 2IOIA 4QNPF 3D7PA 4Y16D 2EH7H 1R3LB 1ZT7B 5T1MB 3QG7L 1PY4A 2VDPH 3T0WA 3P9WB 2WO4A 5EA0L 1G6RL 2AQ3A 1L7IL 2JKNA 5ADPL 5CBAB 3ZKNC 2F8XC 3U7AA 4CVUA 2NNFA 1OAXL 2WZAA 6FABH 5IQ7L 2WCGA 4QWWD 3FF7A 3O6FA 2B3RA 2UZYA 3QNYA 1SM3H 1YECH 4U7MA 2XX0A 3KWXA 5T3XH 4JPQA 2AJZB 2BSBA 4YHML 4MMZA 1IEHA 1TU2B 2DQFB 5T5FA 1KN2L 4KKBC 3UADA 2ZUSA 2ZKYA 3KL5A 2C7FA 1AXIB 1A3RH 1TTUA 3G5YA 2WJ5A 4F20A 1Z5LB 4C56E 3WGUB 4UV4H 2VZUA 2QSQA 4JPWH 4YAQA 5KS9A 4PJBA 4LOFA 2XZZA 4K3DH 5DFWH 5C92A 4FAAB 3P3SA 3LV3A 4Z7IA 3FUNA 2CHXA 3FO1B 5FUZH 5BXFA 1WPCA 1WHPA 1U3JA 4MJHA 5AZ2L 2ZKWA 4ESKA 3R8QA 3GM8A 4GMSL 4LE8A 5CN2A 3FTUA 1A7RL 3HE7B 2DI9A 1S5IL 3ZDYF 5MENA 2E86A 3BZFA 2H41A 1CI3M 3C2SA 5BO1L 2YC1B 3FRPG 2ADJB 3OXSA 1SHWA 3RHWK 5J56B 4F93B 5AOMA 2BNQB 3LSOB 3VXMA 4NQSB 4J4PA 2PUQT 3ISRA 4DQOH 4A1RA 4KNSA 1TDQA 5H35B 3TT1L 1X5GA 3MODH 4RDBA 1BZQK 4UM9D 1UXSA 4OAWA 4N1CA 1TTBA 3LCYA 3R06A 2L7EA 1P4IH 1UM4H 4PRDB 3HBGA 2MCMA 4PJ8A 4ANVA 5AEAA 4HBCL 4TVSa 1GIGH 3C6EA 2W38A 4B5ZA 5D9SA 5CJXA 5F96H 1HTYA 5I1HL 5DJ2A 4NENB 4K94C 3ME0B 2X1PA 3Q2NA 5BZWA 4YC2B 3NIGF 5DC0A 3VFGL 3ZT6A 2VLRD 1WS8A 3FDWA 3IFLL 5CWSB 5I74C 5D4HA 3CN3A 4PWFA 4M1GL 3W0WB 3WU1A 2F1AA 5CD3B 2ZUQB 2DTMH 3D0VA 5IMOA 2WQRA 2CJSA 4BFEA 1GGUA 4DN4H 2GTZB 4JRXB 4R26H 1LDSA 4LEOB 3U0WH 1FNEA 1RK0B 3JTBA 5DQJB 3QB7C 3R0MA 1MJ7H 1VF5C 4M3JA 4MNGB 2DWDA 2ZNWA 3EOBA 3CCHB 1P53A 1NIDA 1VZGA 2PLTA 1TJHH 5J1SC 4I3GA 4EI0A 1MFVA 2J20A 3U6RB 4WI8A 1Y0LB 3FHEA 1N70A 2Z0BA 2OSYA 2VGLM 3KPRA 5DVPA 1JVLA 4IIQC 3EJYD 4H8QA 1MCSA 2XYBA 5JA9A 2R69L 3HZVA 4KNTA 1R17A 3P11H 4U0RB 1BFVH 3SYAA 4BEIA 1YMHB 5FYLL 4EOWL 4PJGF 4X6DB 4TSAL 3CVHB 4XX5A 2MRYA 1W0VB 4OZHE 3MLVH 3WY2A 1E3ZA 3BGFB 3DSFL 4ILDA 2YA2A 3WJLA 4F2FA 5L8LB 4LDLB 3RGVC 4QHNA 2XG5B 3TBVA 3MRNA 5GRWA 3O2WL 4HS8L 1PZDA 3QUKB 5AD0A 4ZW5A 1WFJA 4G5ZH 3W81A 2Y72A 2QGBA 2X12A 2ZUVA 4HKZA 4OBRA 4PLJD 4LXFA 5J1TC 2VO5A 2E4FA 2QHLA 2XVBA 5EU6B 2EVHA 3RY6C 2VJXA 3OC5A 4EE2A 3PXHA 2LQRA 2H6OA 4HIEB 1JJUA 2DWYA 3Q9PA 3VFRA 2NY6D 3MGOA 4Z6AT 2E7BA 3O3UN 3C60A 3QYCA 1EZVX 3OKYA 3IF1B 3JSSA 3NCJL 3WLWD 1D5XA 2Y6SC 3HZYB 4V1DD 4CN4A 2E8YA 5DO2D 3RUGF 3GSQB 2OMYA 3SE4A 1KB3A 1PU0A 1QI5A 1OSYA 2OTUB 3HHSA 5I15H 3GNMH 5FO2A 5LVEA 2PW1B 2AAAA 2WUCH 3P0VH 2V3FA 4PGDA 4TUKL 5IB4B 3WI9A 4KBPA 2VDQL 1CICC 2BVQA 2VLKB 1NBZB 4IBLT 3THMH 2XKUA 3LRHA 3CZLA 5FHBL 1CCZA 4L3CA 3JV5A 1G9NH 4W6YB 1ZWIA 4DETA 5JLZA 4B9JA 5A2FA 5D1XB 2HRPH 5E6IA 3LHPL 4XCCH 5MEPA 4G43A 4XP4H 4GUCA 1IBGL 1MN4A 3JV6B 5MERA 1A7BA 4K71C 3WIIH 5HGAA 4NDMB 3WMPA 3U7WH 1IFRA 4NHUA 4W9CC 1FG2B 2VDML 4ZMQA 5DD0H 3FUHA 1BM3H 2CO4A 4XCYB 1MELA 4GBXA 1QFUH 1UCBH 4OT1L 4WGKA 3RU8H 4OKVA 1DUZB 4KH9A 3QUXA 1IBYA 5B7EA 4MBRA 4P46B 5FYKE 3QUYD 5BZZA 4D7PA 2RD0A 1GTNA 3BDYL 4XI5C 1DVZA 2ATKB 3WIHL 3KEHA 1RL1A 2DIAA 2JCCB 2CGZA 4HPOL 3SOTA 5C0GB 4NT6A 4NM8H 4PJGA 3B2XA 3QCUL 4WIQA 3ZL4L 1WA0X 5DS8A 2DMGA 2FWUA 1JPFA 2O5NA 1G0XA 5IBLC 2YQBA 4K94L 3RHWF 5GGSY 5IK3A 4F57L 4UANA 5K9KB 1WD9A 1AO7A 1EXUA 4WI2A 4JFHE 1PKQE 5DEFB 3NJVA 4LSQH 2YZ8A 4PG2A 1ACCA 5AB1A 3Q6FB 1ZTXE 2FX8L 2GFBB 1U93A 2J4WL 3L3DB 1N5AA 3GO1H 3OSVA 2WY3B 3PHAA 4AUJA 4JFDD 1NC4D 5IBUB 3JQOB 3CC1A 2YD9A 3DETD 2JB6B 1R34A 2FO8A 3K91A 1WWWX 4ZTEA 2IGFH 4IRJA 4OZFA 4I85A 2W94A 1J1PH 3RUGA 1OAZH 2WTOA 2MTPA 2R4RH 3FSAA 3L1OL 3QORB 4N28A 2V37A 3K8MA 2VSCA 1RUQH 4TVPD 3DUUB 1RPKA 3NSCA 4JE4B 4NRYB 5DA4A 1ZPLA 1TVDA 4Z7UF 1QLRB 1N8OE 1KWGA 5EC2A 3QUZB 3P73A 4DP4X 3AWFA 1BBDL 3L95B 2H32B 3FZUD 5C07E 4ONGL 1IM9B 2DM4A 3RTQC 4FG2A 2I7SA 4UDUB 3EBIA 1MXGA 1HL5A 4P4RB 3QXDB 4CSPA 4ZMLA 1MKFA 1SOXA 3MJ8B 4P23D 5EO0B 1CVRA 3DX9B 4H8UA 3PREA 4P5MB 1XSOA 5HD8D 1I75A 1U33A 2XV2A 4DAGL 4XOAA 4PR5A 5D2LB 1Q0EA 4KDTA 4QY8A 1GHFH 1WD8A 3IJEA 3ARXA 4FKEA 3EG9A 1S9VB 3R4RA 5E5MA 3ATAA 5IWLC 1CXEA 4ZSOA 4BFKA 5I8CA 4UZSA 1FFOB 3WFEH 2P26A 2FBRA 4KNUA 3KLAA 2ARJB 4LDCA 3VYOA 2YSSA 4XN8A 5SWZD 3V4PH 5IGXL 2XFGB 3DBSA 1SY6L 4NBYB 2YEQA 2C3VB 3QEUA 4L1DA 1NGYB 1OPGH 3WEMA 4S0HA 2IBBA 2NW2A 4GIOA 5F7DA 5IEKA 1T4WA 5HVFB 5F8RC 3N0AA 1TPXC 5FO9A 2VCOA 5GSRA 4G70B 5C0AD 5CFHA 2B20A 1BM7A 4WENB 4UAOB 2OJZH 4O2FB 3RKDC 4EZLA 1K72A 5JHLA 4LKXB 4R7DA 2B39A 2W1NA 4PPTA 2EICA 2EDQA 2ZPKL 3HE6C 3BVVA 3GDCA 3MFGB 3O0LA 3OGCA 2EDXA 3PG2A 4B3EA 1X7QB 4G7YL 1UM5H 3PWUA 1EO8L 3DJZA 3RG1C 5BZDA 4A55A 1HOEA 1QYGH 3X13B 3WNNA 3MRDB 4ZO8A 1AD9A 3OB8A 5E7FA 1KN4L 5AVSB 1JUFB 3P4NA 4P5TB 4TLTA 2HH0L 5F97E 3C87A 3UAJD 4P8QA 1MOEA 4B95C 3DTDA 1WK0A 4U1KB 3L3OA 5EBMB 4ABQA 5F7EH 1KCRH 2KDGA 3ARVA 1E40A 1FCCA 4WNQB 4FNPA 5E24E 2GG1A 5FYKL 3T3PF 3H53A 4ISVB 5IVOA 4MS8C 3L1GA 3ARWA 4PD4J 4L8CB 4UQIM 2XWBA 2R15A 1RZ7H 4PSPA 3OAUL 4M5TA 3WTWA 2BWIA 2GEEA 3G5XB 4GMTL 4OLVL 2BC4A 3K6SB 3QNZA 3O3AB 4FMFA 1P4LB 4Z7UA 3NK3A 3QYMA 4HLZG 4RMWA 5IVXF 3FAXA 1BLIA 1G1CA 2AV7A 4Z3EA 2AK1H 4WU5B 5HGBB 1DBAH 3WFDL 4G6FD 1MAMH 2DOCA 1NBVH 1NJ9B 3HTLX 2ZUTA 3CH1A 4HC1H 4N2OA 4W6XB 4JFEE 2OX5B 1VLXA 2J5LB 4GRLA 2QMKA 3ZE2B 5B8CA 1ZTXL 1GGBH 1SYSA 3WNLA 3CDYA 5D1ZC 4E36A 3BSGA 5EORH 1UQSB 2CO6A 2UZIH 1J9TA 5FHAH 1FNLA 2AABL 1FZJA 4D3CL 2GUYA 4BHUI 2YIHA 4K5MA 5IHWA 1YY9D 2CK2A 1BD2D 4QR7A 5KUMA 2G2PA 4JRYA 4PJHA 1M7UA 3AXLB 5KSBF 5E8PB 5EU3B 1OK0A 3ES6A 3FCUB 2FD6H 2QSCH 4G6ML 2O5YL 2ZCKL 3VYNA 3QS2A 1MAJA 1P1VA 3K0WA 4FZEH 3QEHB 2WLIB 3DYOA 5ISZD 3VJ6A 1BJ1J 4NKDB 5EUKA 3ZY7A 2W81C 3EGSA 1B0RA 4HIXL 5D1QD 3VFOA 2DLGA 2IF7A 3TPUA 1ZHLB 1HOCA 3WUZA 4DH2A 4P2QB 3RY5A 1NMCC 2K7PA 3TNMB 1P7KA 4G8GB 1YY8B 4XNUL 4JJOA 1HNGA 5F7AA 2VR4A 2NY0B 3U1SL 3I50H 4FABH 4X7CC 5D2NC 5FYLD 3ARBD 4O58L 4WFGD 4XN2A 3CHXA 3ULVE 3C09B 1OE2A 4G8IA 3VVWA 3C8KB 5FECB 4X6FA 2VDLH 1WZ1H 2VN4A 1OTSD 2EDMA 1A1MB 1XCTB 2GJ6B 1EAPB 1PFOA 5IQMA 1FAIL 1MRCL 5A2LH 5AZEL 3VI4E 2XETA 5FV1L 5M94B 2F53E 4A2MA 1JG9A 1W0WA 4HBQA 3IU4L 4KVPA 4PBDA 1U8MA 2GC7C 3LD8B 4AE0A 3HB3C 3QDGE 4JS7A 5HP5A 5DEJA 5BQ7A 5AYQA 1B0GA 2AV1A 3WE6A 4YXLL 2F7PA 4Y4KA 1NCNA 2OXHB 1S78C 3C5ZA 3HVNA 4RNRB 3ZKND 3QEQE 4LP5A 5IVXA 3UYPB 1A8JH 3IMTA 4NZRL 4KZDH 3FK3A 2ADFH 3HA0A 1GYVA 4HDIA 1F4YL 4PY8I 4WU7A 1X9UA 2YK1H 2ENYA 5D6DC 4TNWF 2XPZA 5GZNA 2PWGA 1IBBA 2X0UA 2YOCA 1H3TA 1EO7A 4I18C 5ELIA 5EO1B 2JI2A 2CGYA 4NCC2 3ZUNC 1HAUA 4KKBD 1MFMA 4LMQE 5TE7H 4BWTA 1NCJA 1IARB 3N9GH 1XGRB 5J6SA 3VTMA 3QJFA 1AAJA 3UC0H 4YBQC 4C56D 1QSEE 4NP4L 4OZFG 5D7HA 4NZDA 5I0WA 1QBLL 2DQEL 3ULUF 4PJXE 3IMBA 2P28B 1UJ3C 5B1JC 5JZ7C 1SN5A 4U3CA 1WBZB 3EOAB 1V10A 4WHDA 2WTRA 2J55A 2YBRA 3CDCA 4ZFOB 4PBWD 1PDKA 2X70A 2HFEB 1OGSA 3EFOA 3KM1A 3V4PA 4DGIL 4RFEB 1DQJB 4UTAH 1BIHA 4BK8A 5DMYA 1OARL 1W8OA 1VGEH 4XPAL 1ET7A 2IPTL 3PHQB 1GYUA 3D85D 4FHKA 1SHXA 1IAIM 5FEBA 2DEWX 1JZHA 3QZLA 2BSED 3BKMH 3O45B 3EXJA 2OMVA 2UZPA 2G4GA 2E3VA 3DPBA 3IGUA 3RP1A 3T0EC 4FQ2L 5F2FA 2HG5B 3R7RA 1NDMA 3BGMA 4HEMA 3IRCA 1ZK9A 5E6YA 2Z8RA 5AAWA 1ZIAA 5PCYA 1O6TA 3G6DL 1OSPH 4UT6A 4A7SA 2BP8B 3CJJA 2WWNA 2ALWA 4JN1L 1GZPB 2ESVA 3EYVA 3Q8FA 3BKYH 3LRSA 1GZHA 3LRLA 4NQDB 1LEGB 5A2AA 1T22A 4HWZA 5IMLB 4E9VA 4LLWA 1HHHB 1PAMA 4QRRD 2VZOA 4YHPB 2PR4L 3X14B 3GSNL 1C7SA 2DLIA 3GS4A 4FL4C 3ESUF 2NSXA 4X0KA 5C9KA 3KPSA 4J23A 3O8XA 4G71B 2QMJA 2PW2B 5AUMA 2EE9A 3CUPA 4MD4A 1RJZB 1U91A 3WO3B 2FEEL 1IGJA 1NPNA 3WNKA 3N85H 1TENA 4HT1H 5C0BD 3BPCA 3CBRA 3S0PA 3SCMB 4NAQA 2OZ4H 2LAAA 1P69B 3V6OA 3A6CL 1HINH 3ALPA 4WO4C 3QWQB 4XOEA 1OAKH 4D0BB 1QR1A 3QPKA 1Q94A 2BVUA 4M6ML 3T3ME 3BP4A 8FABA 4I2XA 4EI5C 1NMBH 5F9DC 5D5ME 2E9WA 3ULVL 3UDWA 3OHXA 4HK3J 3G6JB 2YFOA 1H5BB 4CJ1A 1OGAA 4HC1A 4OFVA 2F8OA 4LSTL 1INQB 1Q90A 1TKWA 2GTQA 3BO8A 5FGBC 3RGVD 1U4FA 4JFQB 2GJJA 4MDRA 4X5WB 4PQXA 4BSWB 2ZP0T 4N0FA 1O7VA 1TQTA 2EO7A 4JO3L 3T6QC 4JZOB 1WGVA 4IW4C 1X5JA 4LSVH 3AITA 2ZX7A 1AKPA 2D2CC 2Y7LA 3ZDXF 1QLEL 2OFQA 4JO5A 1R3JA 2DQIH 3HLKA 3GMOA 1JZIA 1AHWC 3AG4B 2XU9A 1RCYA 5I1CL 2YOAA 1NKRA 4JZJC 4HJUA 2A9DA 2Y6SD 3GTVA 5JR1H 1TXKA 5IJVB 1INDH 2JELH 2DLHA 2O30A 5A6IA 3RURA 3B9VA 1LP9F 3Q2VA 3JT2A 3VI3B 2EYRA 4JPKH 4F3FA 1Q1JL 3FO9B 1BF2A 5JO5A 1F2QA 2A4CA 1CICD 4JREB 2N7AA 3MRJA 5I6OA 3AZUA 1S7RA 3MRMA 1KTBA 1MQ8A 3AS2A 2VXVL 3GMQB 5EB9A 4DGYL 1SYVA 2ZWYA 1PGRB 3GYRA 4YUEL 5FYKU 2XA8L 5FLUA 1FZKB 2R9HC 4MZ2A 1XEUA 4WWKB 3HHMA 2V7HA 5E6RB 4XVUC 2R2CA 1J8HA 3SKMB 1U9KA 3OKDB 1FVEA 4PJCA 4M61B 4PP2B 2FBJH 5C6PB 2DEXX 1JPST 4H7VA 1HIMH 1NLBH 2BSRA 3Q13A 2WMPB 4QRQB 5EBGA 1CFSA 4Z76B 5AENA 2OCFD 2B59B 1UZ6E 1WBXA 3SZKC 3ZMEA 4XI5D 3BT2L 5FYKD 4LRIA 1F3DJ 4A2LA 1NCAH 4U0QB 5AYUH 3SDXA 5J9PB 1ES0B 1OK8A 1ZRUA 3TWCL 4Z7NB 1BQHB 2JJWA 1HCYA 1S7TA 4U6HA 2YMXL 4XMLH 5AOZA 4QT5A 4I8DA 1B90A 2BWDA 2ZX5A 4P2CG 4NEHB 1U8OB 1Y7VA 4I5BA 5CS7A 4JDVA 4JFTA 2WO3B 3BH4A 4HGMA 4QKTA 5E8EB 5IBLD 4QCIB 3STLA 2E9GA 4ZMTA 1D6VL 1QZ1A 3BT0A 4Y2DB 2IV8A 4O02H 1CDHA 3C6LC 5KVFE 4YO0B 4JEGB 4XMKL 2D7TL 4JFHD 4L8BA 4DJMA 2VLJA 4O4YH 2IG2H 3TFBA 2MQ0A 5JIIA 2R2BB 4JANA 2A1WH 3IU3B 3E0GA 3N44B 3M8OL 4PTUA 1I9RH 3IRPX 3RZCC 3HHRB 2A7BA 1E8XA 1LYQA 1C5CH 3D18B 3I74A 1XGUB 4XCEB 1AXSB 1UATA 3HI1A 3NA4A 4ZUWA 4FHBD 4WJ5B 3U79A 1RP9A 3WY1A 4AXWA 2GC4C 4UIMB 2HVJB 2P8PA 4N6RA 4TUUA 4OCXH 2CDGB 3WY4A 2P5WD 1A7NH 1M6OA 4PIRF 4PP1C 2Z35B 3ARDC 1U8IA 3RDTB 1FH5L 4EIZC 4U1SA 3VXPA 3P4LA 1F18A 1G7QA 4U1LA 1YEGL 3QFGA 32C2B 4C4KO 4JZNA 4G8FB 3F7YB 2RGSA 3RTQD 4YHZH 5C07D 2ZYIA 4AIXA 5FA3A 5EU4B 4AM0A 4MCMA 4CNIA 4LQFH 2NT1A 3Q2LA 3I6KB 4OF5A 4JQXA 4I3RL 2X2UA 3N42F 4AWJC 3U1QA 2GW5A 4JLRA 4OM0L 2X0VA 4TUOB 2LAGB 2V7NB 5E6UB 3UROR 1ROWA 1EWHA 2BFGA 3IJHB 4NZTL 3J07A 4L1LA 4NXKA 5CJBA 4YSDA 5F1SA 4LLYB 1L9QA 4JFFE 4UMSA 1LEKA 3K1KC 2AVGA 3MROB 3DVGA 4FA7B 5JW4N 1R1CA 5IB5A 4RQQB 4GKSB 5BOJA 3PDGA 2DW5A 1UC6A 5GRXG 5MEOA 1WAPA 3NZHH 4C8XA 2XWJA 3KPNA 2FGWL 5FKPA 1TZGH 1UT9A 1RIUL 3O3BA 4HX1B 2J57A 1K5NA 1KB5B 3VU2A 5CCKH 4WGVB 2Y06H 4UB0H 1KELH 3VD2A 3CN4A 2JSFA 2NSMA 4EQ2A 3DX7B 4KQ3L 4NKQB 2PXYA 4XP6L 3AM8A 4M7LT 1EIBA 3UZEC 3RKDD 3U2JA 1AGEB 2E9BA 3VXRE 3WUWA 4H2CA 4RSYA 1AXTH 3MJ9L 3NIDE 4JVUA 3O3EA 1AY1H 1T0NA 2OZ4A 2G0LA 1HXYB 3HE6D 3DUSB 4ZUTB 2G5BB 5DWUH 2XICA 3U4KA 3C5SB 3GK8H 2LVCA 1ACYL 3DIFB 4IKJA 5CLYA 1TYJA 1JGUH 4FYRA 4PJIA 3MV9A 4J3XA 4KXAA 3F7VA 3GXFA 2I32A 1XGPA 4BSVA 1OSZA 5FM8A 1E9PA 3US0A 4H1LB 4TULH 1KPUB 4UQ9A 1D9KC 3EFDH 4UTCA 5JNYB 2OMXB 3M1OA 4YE0A 3BD5A 3V4VA 4Y19E 1PZSA 4MLIA 3MLRH 4MS8D 2IAMA 3HC2A 3BKCH 1P2CA 5DC4B 3K2UH 2OP4H 2I60H 1A9BA 1VA9A 4J6RL 3QZPA 1S8DB 2VAAB 4UDTB 1ID2A 2WW8A 4P2OC 2YQ3A 1YRKA 2YKLL 3D05A 4YSAA 3RFZC 2OI9C 5HDWA 1UGNA 2GUOA 1P84K 4PGCA 2CQVA 2FK9A 5AFAA 1PZCA 4NNYA 3QDAA 4ZDHA 5A2BA 3FOMB 2X2HA 3L3JA 1XZ0B 4GKZA 2GJRA 3KYOA 5KVFL 4QYOB 2XTJE 1T6WA 2ZYHA 5ESAB 5I0ZA 4JFED 3CD4A 2KZKA 3ZQ9A 4OLZL 1JE6A 4OD1H 5D1ZD 5DDHA 1U6AH 5FKAB 3EJPA 1TJMA 4FQXB 1FFNB 3NCXA 3IDNB 1NEUA 1YN6B 2ZJSL 3U0TA 5A2CA 2HTLC 1NGPL 3AY4A 2JI1A 4W4NA 4P4KB 1S6NA 1R24B 4L0YA 4M9OA 1BPVA 1HEZB 4OLUL 1JWMB 1DUYA 2OV0A 4FXGA 4R9HA 3MLUL 5TQ2H 1YEFH 3FUMA 3IJ9A 2C3HA 2WXNA 2Q6WA 5F9WC 3V9CA 5K69A 1OF2B 3RNKA 1XF2B 3E38A 4L3EB 3BJ91 3L1EA 1K2DB 3C2AL 1SFDA 2XKNA 3S4SA 1L6PA 5JDJA 1CT8A 1XH3B 5IHUH 2H6UA 1MCOL 5BJTB 5T1KA 3MRIB 2J8UF 2FE0A 3V0IA 5HVGB 3BP5B 4APQB 1Q9LA 1A2YB 4NI3A 5MEQA 2QQNH 3ML8A 3LHAA 4LNRB 5G4OA 1FDLL 3KNBA 5D7IE 2R1WB 2OLDA 2R23B 1EGJL 4KX7A 4S0SD 1M3JA 3WEOA 2NY5C 2IOMA 4PRHD 1M4KA 1NOAA 5JXAL 2P7TB 3L3GB 2BNRB 1MCBA 1CLOL 2WNWA 2BCKB 3ULVD 4O02A 1RJYA 3U36A 3WS3B 4OZIE 3SKOA 3DO7A 2WKOA 2WXGA 2DQTL 4N24A 4XPBH 3RWGA 1S3RA 3QZBA 1Z9NA 1T80A 2A9NH 2BY0A 4P59H 4XPTH 3HR5B 1RMFH 3O6KH 2A73A 2F53D 2EADA 4N2KA 1NMAL 1XDTT 4NQCA 4EIGB 3BZDA 5BCAA 1SXBA 2EC9U 3P30L 1RZFH 3BRFA 1XR8A 3AUWB 1XT5A 3GT6A 2CBTA 1UZ8B 5IESL 1S78D 3PPSA 4R7NA 4L05A 1BMGA 1KGYE 1RSFA 1OCRB 1RHHB 1QOKA 2CLVB 1KCVL 4FLSA 1B4JH 2GB2A 1U3ZA 1ZGLA 4JRWA 1K3ZA 1GS6X 1JGDA 3KYAA 1G5GA 4B97A 2DEYX 2J3SA 4OLYL 1QAWA 2J5WA 4J3SA 5F9JA 1RFDL 1JHTA 4XAWH 3ARTA 1T2QH 4GRWE 2IH1A 1FLTX 3UJIL 1I1YA 5L2KA 1ZT1B 3JZYA 1XIWA 3RWHA 1N0LB 4M6NH 4OQTH 4TNEA 4NQXB 5CJXC 5DJCB 4JQIL 1J9RA 4YHYB 1A22B 3AG3B 5FR3A 1ZIBA 4XZUB 3JWDC 4YBQD 5ESVA 1NLDL 2DQHL 4KK6C 1MNUL 1YDPA 5KAQF 4NQUA 4PY7A 1RK1A 1FL5B 4OIIL 2HLAB 4XNQB 1A6UL 4XRCB 3RWIA 3ZN6A 4OD2B 5KJRH 3L48A 3MBXL 2WOBA 5HJDA 5JZ7D 3FFOA 3HNSL 3OV6A 4TV3A 4X7TA 7CGTA 1F3JB 5I30H 1QBAA 3QIUC 3NJGA 1AD0A 4BFGA 4X9IA 5KVEH 5JMRA 2V9QA 2VLLA 1P5VA 2B4CH 1G7PB 2ZWSA 4ONOA 3CMGA 1TTFA 4NNXB 2J8UA 1E8YA 1X6LA 2D9CA 2XUWA 4FI6A 4V2CB 4XGZB 3QFJB 1J1XH 3MJ6A 2HKAA 4L4VA 2VSKB 1KEMH 3D4ZA 4PJ6A 4UQDA 4KAQL 3RVWC 3B7SA 4Q4EA 3TLRA 4XXCA 1J05A 4BD4A 1WS7A 1ZA3A 3LN9A 3SZ6A 1MHHB 2HTKC 5A2IH 1MPAL 4BFFA 4Z78B 4KJWD 3T0ED 4HGWA 2EDEA 4HS3A 4OZ4A 2XIIA 3AVEA 3PCYA 4PYGA 4A37A 3LKNA 1GSMA 4U7KA 5IVZB 3CLFH 3TJPA 3WJLC 5DA0B 3QQ4A 1G6VK 4K7PH 2A6DA 4MJ4A 4UUJA 2MQCA 1A6WL 3PL6C 1FO0L 5FA4A 5I76A 4MCNA 1E4KA 4L29A 3N43B 1UYWL 2Q76B 3MACH 3EYSH 4G8EB 1CTOA 4ECNA 3ZDYE 2RHEA 1CFQB 4HIPA 3WV0A 2WSPA 4MNQE 3WIFA 1QQDA 3IDIB 3W9DA 5J6GB 5JHBA 3H7LA 3KLSA 3V8CA 2C9XA 3O4LD 5HDQH 2DYPD 2EYTB 2N1TE 1WC7A 2CKBA 2QZQA 4I0KA 4QXGH 1M1XB 2YJLA 5FWRA 2E7HA 1C1EH 1YYLL 4M4RA 4GS7C 3BE1L 3DO4A 5IP4A 1JP5A 1DFBL 1NFDA 4XVTH 3C08H 1A6TB 3PDOA 1SNRA 4BZ1H 2NQDA 5D93C 4CU7A 2P49B 4KJYB 3QXUA 5FF6A 1JHKH 4LIQE 4WO4D 1F8TH 2XIBA 5T5FL 2ZWKA 1IAOB 4F7TB 2NY5L 1A1NB 3B2MA 4AM0Q 2XVLA 1DJXA 1PLCA 4OZGB 4WV1B 5BMFH 3V7AE 4EI5D 5ACZB 5JXEA 4R4BA 3B9KA 5BRZA 4DUVA 3NIGE 4KKNA 4PJFE 5E6IC 2WZPD 5GGRA 3CXDH 5B39A 3F5WA 5JOEA 1P1ZB 3AB0C 1H3PL 3ABLB 3CQFA 1QVOA 3EO9H 3SBQA 4FXKA 4E2OA 3CFQA 2EDYA 3A47A 3Q2CA 2BM3A 3LPFA 1F02I 2UYLB 4JRLA 3FYIB 4XTRC 2C1OB 5HYFA 1KWKA 5DK2B 1XGTB 4QD2E 1A25A 3MRFB 4GBXC 2XIDA 1B0WA 3FQRA 3WFCL 2JK5B 3QVAA 4BUGA 3QHZL 1KLGB 4Y4HC 4H26B 3ELAT 3QUXC 1LVEA 3CVCA 3K71A 4HF5H 3MUHL 4NN6B 1BGXH 2CM6A 4Y5VA 1AFVL 1D2OA 1HHIB 4R8WL 2MCAA 2GSIB 1V3KA 4WKZB 2EVGA 4WFHE 1G7LA 4HIHA 5F9AC 3KGUA 2JKJA 4Y1TA 1JMXA 5ITBH 4NP9A 5DT1L 5I23A 3FT4B 1CU4H 4ZFZB 2Y24A 3GRWA 3B7RL 1UTDA 3LOWA 5DK3A 3JWDL 1X3DA 4XAKE 4Z5RA 4Z8FL 1E6JH 2E4TA 3SDDA 5I1EH 3GBDA 4IGBA 4NO0D 4LFHG 4ADJA 2R9HD 1JRHH 3FFDA 2AXGB 1UUSA 3L6FB 4PG2C 5CHNB 4N87A 2Z65C 3AU0A 2F54E 2PMZA 4XVUD 1NCWL 4R7LA 1H6UA 2NUPA 3FQ4A 4ZD3L 2B9AA 3RWJA 5IM7A 5LCVH 2D73A 3TPKA 4N2CA 1JVOA 5E5UB 1Q0YL 3BVXA 3DRTA 4BZ2H 4M6OH 4Z9KB 3VXNA 2BIQA 3S4SG 3UTPE 4LIQH 4O51B 4IRJC 4W9KC 2CJUH 1EZSA 2P4AB 3BSZL 3DXAB 5ADOL 3GZKA 3ETBF 5KSAA 5LKNA 4JBSA 1NDGB 4WWPA 5F7NC 1CS6A 1LL1A 4D9LL 4P9HL 2C26A 3EO1B 2QGCA 3ML9A 3E1F1 4NGHL 4N2AA 4HVBA 4GIAA 5C0EB 3TN0D 4ZAKB 4QTHA 3V0DA 1VKXA 2XXMB 3EGDB 2HZHA 4Z0BH 1JRHI 3LRGA 3U7YL 5IMKA 5KJ7E 4CVZB 2JV6A 2X4UB 2ZKMX 3C6LD 1SBSL 2KL6A 2AJSH 3HZ3A 5FYJL 4U6YA 3QULB 5BVPL 3FH7A 1FN4B 1R5VA 4FOMA 5FO8A 4AVIA 1AP2A 4OQTA 2E6PA 2PYEA 1N67A 5I5JA 3MZGB 1KJ2B 2XYCA 3EZJB 2FT7A 1FNSH 1I82A 2X89A 2AKRB 1H3GA 1MRFL 2NNAA 4LLUA 3MVSA 5HI5C 1EHKB 2ILLA 3DROA 1BSIA 3MZTA 2PF6A 4ZO7A 4U1IA 2YRZA 4ODVH 3LPPA 4YDLC 4QHKI 3VD4A 2AXFB 4FXLA 6PCYA 1REIA 3RIAK 1P4BH 3QWNA 5DZAA 4X4MA 3V6BR 4Z3JA 5K59F 5CJ8A 2GK2A 3VRLF 1M2VA 1J8SA 2Q2LA 4GKLA 3FTGA 4YXHL 1HSAB 2W9DH 3GI9H 2X28A 4TSBL 4PP1D 3MLZL 3ARDD 3ZYZA 3MLXH 4LCCA 4JKPL 2N7BA 2BIOA 2NNCA 3DJTA 4K9EH 4KITB 1BV8A 3MUUA 4Y2OB 2WNGA 3MBED 4KK5C 1MXDA 1A7PL 3IJSB 1KJ3H 5B22A 3UIZA 3HS9A 5C09A 3DK2A 5H8DA 1J9QA 1KBPA 3BUYB 3QO1A 3MO1B 1GY2A 3BCFA 2P8MA 5ABDE 2F68X 3DGCR 3HMXA 4N5ED 5DD5H 4F8LA 3QUMH 4CVXB 4J5VA 1SUJA 2BK8A 4X6CB 3QHTC 1HYRC 2R2EB 4PWJA 5GS2D 3TT3L 3EYQD 4JFFD 4G72B 4RFNB 4P3DA 3NH7L 4FHJA 1HDMB 2QQQA 5D7EA 1HKLH 5C2UB 1JNHA 1KDJA 3LQMA 1K4DB 4LK4A 3SYCA 5B3SB 1TMCB 1RZKC 4GYBA 4FKKA 1JGLH 3HG1E 1AZZC 2AXHA 4FTVA 1S9WA 4YIQA 1S7UA 3U48A 4O5LH 3I3DA 3KG5A 3NQKA 5KBDA 4HSAC 1ZT7A 1ZANH 3O4OB 1AZCA 4I77H 4OCYL 4ZTOL 2I9LB 2X2YA 1SJHB 3NBNA 4BZ1A 5E2TL 4HKBB 2I9TB 3TCLB 2OMTA 3B5GA 3VXRD 3CPUA 4UT9H 4EVNB 2FX7L 1GZQB 1TFPA 4TRPH 4J3OH 4XNZC 4IBYA 3TV8A 1DBJL 3BYYA 3QRFM 5B8CC 4FG0A 4NKIH 5F72S 3FTXA 3MRKB 4IKLA 4GUOA 1KIRB 1Z9SA 4M3HA 2OK0H 1G9NC 3SGKC 1E9QB 2PNDA 2Y1AA 3KHQA 4X6DF 4PRIB 2A3TA 5GRYA 1Z5LA 1D9KD 3WKQA 2MHAB 4KGLA 4E9SA 3ZGHA 4UIKL 3BAXA 1Y07A 3CU1A 2VXTH 1FIGH 3I9GH 1YC8A 2BFVL 1I53A 4P5RA 4Y1AB 4Y5YA 3U0PA 1FVCB 3ARFA 3H55A 5BV7C 3O11B 1W2KT 4XBEL 4LVHB 5GS0C 3HE7A 3FRUA 4MJ6B 4HK0A 2O1AA 1YMMD 3AY2A 2QR0B 3TCXA 2YC1A 2ADJA 3LH9A 5ICUA 1X4ZA 4JM2A 5CEZL 1D6EB 2HJKB 4GSXA 5IIEB 2BNQA 2WVTA 3LSOA 2A4ZA 4HAGA 3EZ8A 3DUHA 3MNWB 4KZCA 5KAQG 5D71H 3WJMA 3QSKB 1WFMA 2MCPH 3QNXB 5H35A 4FQCH 3QWRA 1J8KA 3ZYIA 1U8KA 4K15A 1BIIA 3P2BA 2QHRH 4X7FC 1QRNB 3VH8A 2AJUL 5F96L 2YUVA 3ATDA 2VRQA 4R0LB 3WBDA 4X4YA 5GGVL 4IK7A 4WEMB 4XP1L 4LSSL 1T5WB 4X6EA 3GBML 2IH3B 5ICYB 5TD4A 1BWMA 3FB6B 3DV6A 1EDHA 1FYTE 2XZQH 4WGWB 1BXAA 1FSKB 2HTLD 2HPTA 2C9RA 3T3PE 4B9CA 3HPLB 3TH2T 3KR3L 3LEYH 3TEXA 5LJYH 3PHSA 1RD6A 5CWSA 1U92A 1V5JA 5TE4L 4QAWA 3W0WA 4MA1C 5DFVD 1FLRL 4XXDA 4BZ2A 4X2UA 1JOIA 1HS6A 2GTZA 1A02N 4LEOA 1K85A 1KDIA 4ELMB 1B2WH 1RK0A 4G1EB 2PO6B 4N9GB 4WEEA 5C0RH 3C5ZC 3JXAA 5JHLL 2IVFC 1UASA 1NSNH 4MNGA 5KVDE 3EDKA 3CZKA 3OHMB 2AEIT 5F6HI 1LO3L 4KX8A 3U6RA 4NI6A 1Y0LA 4WCYH 2VWEE 1K6QH 1ORQB 4WUUB 1JF5A 4M62H 3BVDB 5GZNC 3NP3A 3PJSB 2ZKXA 4FLOA 4KO6A 3CFKB 2Z31B 5CKGA 2ATAA 1T0MA 3B2UC 2EVJA 2JCCF 4KJPC 3V6ZB 5CJQH 4D9QE 2D0GA 2DI7A 4XMPH 3NCCB 3WDIA 3D33A 2KERA 3CVHA 1A6VH 4KV5F 2CBOA 5ENWB 1BVLB 1W0VA 2AI0L 3HC3L 4OUOA 3ZZSA 5KSBE 1G0YR 1T20B 3DWTA 1RZKL 2XG5A 4CA4A 5EZOH 2DLEA 3ZBMA 5AW1B 4B53A 4PB0H 3S88H 1DSYA 3IJ8A 3TZVB 4AQOA 4EIBA 1D7DA 1I3GH 5MEND 4JFYB 5HHNB 2W80C 5EFIB 4XB8A 1BECA 5KTEH 1XBRA 1EBAA 2DQGH 4FS0A 4L2LA 2W65A 2DH2A 3IF1A 4PJ5E 3RWEB 1F00I 4QRAA 3NK4A 3S5ZA 4JG1H 4IRSA 1NC2D 5EOQH 4CN1A 3GSQA 3VQMA 4UQ3B 1QATA 2OTUA 2O6EA 2PW1A 4W4OC 3Q5YA 3V5DB 2WYIA 15C8H 4FYQA 2D9QB 2HRPL 4IJ3B 2EE6A 1R3HB 3FCTB 1KCSL 4XN1A 5AAWC 4LEXH 5I18H 1FA4A 5D1XA 4LHQB 3FN0L 2VXUH 1A4KB 4OJYA 3UTTB 1GZHC 2XQBH 1G7HB 5BV7L 1YNLH 1ZLVK 1AE6L 4FQJH 4JHWL 2XVKA