1M42A

Solution structure of apocopc from pseudomonas syringae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
b'HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein C
molecule tags Metal binding protein
source organism Pseudomonas syringae
publication title Solution structure of CopC: a cupredoxin-like protein involved in copper homeostasis
pubmed doi rcsb
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1m42A00
4CC4A 3BCFA 2WQVA 1NM4A 1OT4A 1H6UA 1LYQA 2OMYA 2OMZA 3BC9A 5ICUA 4CILA 1XEUA 2OMWA 2Y5QA 1O6TA 2C9PA 3FAWA 1M9SA 2C9RA 1IX2A 2OMXA 2OMTA 2WQUA 2YA1A 2OMUA 3BCDA 2WQXA 4CC4C 1M42A 2C9QA 2UZXA 1O6SA 4AW4A 3FAXA 2UZYA 2RA1A 1O6VA 2WQWA 3BZ5A 1H6TA 4AQ1A 2OMVA
chains in the Genus database with same CATH superfamily
2DQ6A 2OYKA 4XWGL 2X4UB 3HPJB 5DEGB 4PR5A 4AX3A 2B15A 3HE6D 4MA3B 5C0JA 3RZCD 1RZIA 3MRLA 1Z3GL 3E1ZA 1V05A 2MMXA 2OMTB 2WXKA 5JPMB 5HXMA 3LD8C 1GY1A 1AZZC 4M5YH 1T4KA 5IQLA 5DHVB 1SLWA 1HSBB 5FYJU 4KTGA 3BDYH 1XGUB 1L7IL 5CP3H 3CK0L 4IQHA 1F56A 3WS3A 1KIPA 4HX1B 1DLFH 4G1MB 1PIFA 4PRPD 3ZE1B 2Q3ZA 2AZUA 5JO5A 3AS2A 1UWXK 2EIMB 3GSWA 1QYGL 3HG3A 2WWKO 4HV8B 4H0HB 4FX5A 1IM9B 4XBEL 3ZDXE 5GJTL 4U1NA 1I1FA 1QEWA 1TQCB 3G9AB 5MP6L 3HS0C 2E9BA 3QWOA 3EBAA 1JZ5A 2EIZA 5BVPH 3U79A 2C5DC 3HZKA 5EIIA 1WTGT 2DQCL 5E4AA 5EC1B 4RFEB 3G6AB 4JRLA 1MELA 3V8CA 2BIOA 4EIGB 3TFBA 4EE2A 4TLSA 2DH3A 2Y2TA 2O5NA 2WN2A 3S35H 1JPTH 3GINA 4IMLB 1AIZA 2EIZB 4JREC 4WENB 1HEJC 5DS8A 3VI4A 1ZV2A 3QJZA 5LXGH 1PYWB 3K2KA 4L1TA 4XWGH 1ZHLB 4B9PA 5JHLL 5ID1B 4NKIH 3CTTA 4NRYA 4L1SA 3DTUB 1YNKL 5EC2A 2X2JA 1XR8A 1XWVA 2APSA 4AEIH 2KL6A 3GMPA 2OTWB 1YLBB 1PIGA 2V0AA 1MJJB 2XU9A 1CI5A 4A1RA 5E8OA 1EANA 4P3CL 1QABA 2BVTA 2TSBA 2VDLL 4MMXB 5DYFA 4EMZA 2FT7A 5I26A 1V10A 1BCIA 5JA9A 4ZMQA 3DETD 3BESR 3K74B 5PAZA 1I9EA 4K7PY 2PO6B 5KYWB 2CBPA 1N70A 2ZICA 4GW1B 1A6UH 4XPFL 1XQ4A 5FW6A 4BQ9A 4DO6A 1C12A 2WNGA 1YMHB 1EVUA 1YMMB 3N1PC 1BG1A 4R26L 4IBUA 1NH6A 1Q9OA 3GBDA 4MJID 5IB3A 3ABMB 4JZJC 4KNUA 2X4UA 1FVEA 3IN0A 4FI8A 4KROB 1YECH 2VABB 2IWEA 4QXTB 2CJUL 1GGTA 1B4TA 3GXFA 1RP9A 3WNJA 1OANA 4NGHH 3KBFA 3KPSD 4ODVL 4RMWA 3G6JA 5ICXB 1OB1A 1JNJA 4IU3A 4XNMA 4XP1L 1Z66A 2C26A 4Q0XL 3PWNB 3U36B 1TZGL 2HTLD 3RTQC 3GMNB 4OZ4A 4TQHA 1G4MA 4DKEL 3VXSD 5CEZD 1P5UB 2Y24A 1VACA 4CBZA 3FCBA 3FT1A 5EUOB 5BZDB 5EU5B 1YQ2A 3C5XA 3O2DL 4NKIL 1PFCA 2YUXA 4KK6D 5I76B 1ND0B 3QCUH 1NAMA 1CXIA 4R7XA 5DJYA 4WFHD 2NZIA 5FW7A 1D6EA 5HI5D 3TPKA 4LCWB 1QQDA 4X9FA 2Z91A 4DGVH 3TASA 4P4RA 1T20A 4MXVF 2Y7QA 2AV7B 3F83A 4NENB 3HI5L 1S7UA 1DFBH 2Y0SA 2F5AH 1OK0A 1PG7H 4D8PB 3L3KA 1S9WB 2O6CA 1KEML 5EIQA 2CDFB 4KQ4L 4XMTA 2X4TB 3V0GA 5DS8B 3VI4B 1LO4L 3ZZLA 5LLIC 3MBWA 4X80L 5D6DA 4Y2DC 5KBMA 1Z9LA 2CUIA 4DW2H 3G6AA 3ROOA 4H0GA 4NZFA 4F9LC 1UT1A 1SQ2N 2OMZA 2EDYA 5I1IL 3ZDXB 1FVCA 2CRMA 4WWOA 4PY8I 5HJDA 3V4VH 4PJ8A 2BXZA 1KJ2L 4JR9L 5KZCB 3BZEB 2W07B 4EDWH 3EXLA 4KBPA 2R7EB 5E8EA 4FQXD 5E1AB 2VDML 4C56A 4NZ8A 2UX7A 3WS3B 4M9PA 3BP7B 1X6LA 4N3TA 3ZE2E 2KZWA 4J3OD 2JI2A 3FTGA 4FRWA 5CLXA 4HH9A 5CR1A 2VUYA 1P7BA 1V8HA 5EUKB 4HG4J 1QTPA 1MCHA 3VUAA 2R1YB 5BRQA 3IGUA 3Q8CA 4X6DE 3HI1B 3WN5B 1N18A 5AWNH 3RWIB 4S2SB 3WFBH 3HOGA 5DUML 3UAEA 1BBJA 1YN7A 1BX2B 3R0MA 2J20A 1HCZA 1DLHA 1ZE3C 2AZAA 4LEOA 4AEHH 4Z3JA 1TQBC 5E8NA 5F0PB 1J8SA 4X6CA 4PGCA 1AQKL 4R2GB 4X99A 4PD4J 3RHWK 4GYBA 1R24A 3IDMA 1CFSB 5D1ZB 1DVUA 2GJ6A 5H35B 5F7YC 4G6AD 1UT2A 3LDBB 4RETB 2GEEA 1F4XL 2UZXA 5H94B 4MLIA 2Z4QB 1YEHH 3F58L 3M8OH 3B83A 3FB6B 4PCSA 1MFAH 5JPNB 2AITA 4PB0H 4U1IA 3IXAB 3ZKSD 3CFCL 4R2GC 5C08D 1FZKA 1U91B 3D2TA 4AYEC 3PL6B 1G7PA 3QQ9C 1LD9A 4L1LA 4ENEC 4B9FA 3BUYA 4KH9A 4MJIA 4FP8H 5FCUL 1VRSA 4QYOB 4NN7C 1N68A 3WLBA 3JTBA 4YHZH 1CGSL 3MNZA 2F19H 2W81C 1FFRA 4XPBH 1UWGL 3BVXA 5C0GA 2NY1C 4AXWA 5KBPA 3IDYC 4HZAA 1YZZA 2R2BA 3IGAB 1SJEB 3U30B 1I31A 3OC8A 2HX7A 1CLVA 3ALXA 3Q43A 3KWXA 4ALAH 3L4TA 2Y1ZA 4L4JA 4X7DC 3H4FA 4R7DB 1QRKA 4LDOB 3RGVB 1RAMA 2G60L 3QIUA 4LZKA 4FNLL 5DFWH 5TH2A 5KUKA 4JVPA 2PPDA 5CUSH 2UY6A 1MJUH 5L6YL 4K8RL 1VEPA 3FZUC 4ODWA 4IU2B 1PZSA 1L6PA 3IGKA 4FLHA 4RMTA 4D0BA 3VXQA 2VR8A 3QNXA 2WQXA 3E9TA 1NMAL 1MWOA 1AH1A 2BVOA 2XICA 3IFPA 1L9MA 1RPQA 4H1LH 2EDFA 4WI5A 5AZ2L 3E2HB 4G1EA 1G7QA 3GFUA 5CEYB 2A9BA 1KTKE 2V3EA 3HRPA 3BLPX 1UWXH 4K7PH 1HZKA 4LCCB 1XIWB 1HT6A 3O9WC 3D9AL 4XGZA 3MACH 3FT9A 4OZGF 4ZOBA 5ISZE 1H6UA 3QO1A 5A7EA 2Y5QA 3P77A 1SFDA 1J9QA 3SZ6A 2ZCLL 3D69B 1ZJBA 3FT4B 4Q6IC 3WFCH 5I0XA 2W9DL 1UXSB 4AE0A 4IKIA 5DZPA 4JPWL 5CGMA 5JW4R 3BKYL 4HOZA 1U8NA 4M4RB 3LXBA 4K73A 4AQZA 4ZX3A 3GSXB 1ADQL 2WQAA 3MCKA 2WVVA 1M7DA 1YRKA 4Z95H 3O81A 4Y5YA 4QLRA 1AR1B 3R7QA 3UACA 4OZHA 4G5AA 4PHZA 2P5WB 2EDQA 1HZLA 4X0KA 2LABA 4FKHA 1XZ0A 1JD9A 3KL0A 4OCSL 4YHKH 3FT4A 2EDJA 5TQ2L 3V7AE 4GAGH 2HRLA 4Q89A 1FP5A 5TF1H 4N6RA 1QVOA 2G5BB 2YXVA 1LEKA 5DEFB 5I1AB 3VGGA 4P46B 3IJHA 4F33B 5IB1B 2IXQA 4CNIB 1D9KA 3DHJA 3GZOA 3L7EB 4GMTL 4NS0A 4PQXA 5DJCA 2B4CL 4XCNB 1DJIA 2RFXA 1X7SA 2HN7B 3DK2A 2NNXA 2YD0A 4R3SB 3ARBA 4AG4L 4K7PL 3L1GA 1JGVL 2CR3A 3MJ6A 1BZ8A 2OCFD 1CZ8H 1IGML 2B14A 1NAKH 3K91A 1BSIA 1S7VB 2NY4C 3H42L 4PYGA 5JW4M 1LLAA 3TA4D 5JHMA 2F9BT 5F0MB 3JWNE 3QUYD 3QDGA 2AK4A 2B1AL 4YXHL 3RPIA 2H32A 1IILE 1W8OA 1NFDE 3UBHA 4JRYE 5DRZA 2GJRA 4PJ7A 5JNYB 4HJ1A 2H32B 2ICWB 3L1EA 1G43A 4OAWB 3K2UL 2GJ6D 4Z0XB 4FQXB 4K71B 1E4KA 4YDMA 1BZOA 1NUNB 1BVOA 1FGNL 4TSAH 1XXFC 5I1GL 4QHLA 5E99L 1H3TA 1S7VA 5EO0A 5HPMA 3O6FD 1IC4H 2GC7C 2UY6B 5HBBA 2M26A 5FM4A 4QHLB 3BVWA 4N2LA 5D2LB 3THML 3VI3E 1YNTA 3F7QA 4BFFA 3UYOD 2R2CA 4R7DA 4N9GB 1PG7W 4MJHA 1KSRA 3K4ZA 1IAIL 3T0ED 4V11A 3TC9A 2RALA 3W3BA 1OV8A 3RA7L 1M05B 5JNYA 1F41A 1MRFH 1P4BH 1UB6A 3S4SB 5JLZA 1IL1B 3I84A 5I9QB 5I2IB 5LB1A 3TBWB 1SN0A 2FECI 4LCIL 1UA6H 3EFDL 3CH8A 3T2PA 1J05A 3JZ7A 1KELH 5DMIL 3H2QA 3UPAA 4ZFFB 1AFVH 3RVTC 1USQA 1FO0B 2Z3FA 1JDDA 2VDKB 1S9XA 5K9KA 3MXVL 4JKLA 1WFJA 3D2UB 3SE8L 2P5EB 3LKSA 2C3VB 2AJVH 2RMNA 2YD8A 4FFWC 5DC9B 1GHFL 1U41A 3L08A 1GH7A 3WDIA 1UD6A 2X70A 3CMOL 3TN0A 2XG4A 1J8HB 4FZ8H 5IKCA 4GKLA 5ITFA 3BHBB 2C9PA 2NTFA 1FIEA 1M9SA 3T0AA 1E9QA 3B37A 3OD3A 2XX0A 2BW4A 4JFFE 4FQHA 3TN0C 2YOCA 3P73B 4MB4A 5T8IA 2GAZB 2WWNA 3VD5A 3EOYG 5DK0A 2WXQA 3UYRH 2GYSA 5T33H 1SJVA 4YSCA 1HILA 5ALBH 1SVBA 2JKRM 1AO7D 1BIIA 1XX9C 4OBRA 3DJTA 4KVCL 4PS8A 1OTUC 3PUCA 5CSZB 4JE0A 4DHLA 5MENA 1PVHA 3L5WA 4UOW0 3C6LA 1CYWA 4ZDHA 4K3JH 4K94C 4YHML 3HHMA 4FFYH 4NNXB 2NY0C 4OKVA 4V1DB 3NFPA 4FXKB 5T3ZL 3SHSA 4B9GA 4JFFA 2HCZX 1TIUA 3DJSA 1L9SA 5FO7B 1Q9LA 4XO9A 1INDL 5DMIH 2Q8AH 3M1BB 2E4TA 4LASL 1RIUL 2DLFL 3BMVA 5IFJA 1DQLL 1K5NB 2H2PC 3A6BH 4ZMZA 1ZGLM 3UABA 3U1SH 5FOBA 2D03L 3L4CA 3X12B 2WXMA 5T3ZD 1IUZA 2ZYHA 3SKUD 4Y1AA 3E8UH 1GGUA 1NFDA 3T6VA 1NGYB 1L9QA 4I9WE 4TNEA 3HVDA 1X5LA 5SWQA 1WS8A 3BXNB 2WAHA 4IS6B 3RL2A 3QVAA 3WJMA 2Q76A 1T1XA 2VR7A 3WHXA 4AV0A 2O61A 1FWXA 1FLRH 3OVUB 1EDQA 4JHAH 4KXZI 1U91A 2YSSA 2OW6A 1R3LA 3TA3C 5CCKL 5INDB 2VDMB 2JKLA 2IH8A 3TH4T 1IEHA 2PWGA 3IT8D 1I82A 2IQAA 3MGOB 3MGTB 4HEPG 4WEEA 4BKTC 5D72L 2F18A 2WBJD 1WA1X 1NUFA 3DO4A 3WNMA 2TSAA 3TNNB 4FI7A 2VMEA 1QEXA 4PJAE 4X4YA 4YLCA 5AW0B 3EOTL 2VUOA 2FT8A 4ZW5A 5L2JB 2X9WA 3VTAA 1DSWA 2DQHL 3Q2LA 5E00A 2J43A 1M6OA 1BQKA 4F7MA 1D9KC 3V4LA 3SE6A 1HQ4B 1X9QA 5E08H 3QFJA 3T2NL 1D6EB 1BFTA 3MNWB 4JRYA 1T80A 3H0TA 4U6VH 4XMKH 1QFWH 3DUUA 1A6AB 4I3GA 3GXTA 4FABL 1D5BA 1VZIA 4YHNB 3A21A 3UYPA 3W9EA 2JELH 3CZSA 1X5IA 3QXUA 4PP1C 4BWUA 2C9UA 5CIPA 4MLSA 2N56A 1UGKA 3KBEA 4FXKC 3TBYA 1JXFA 4MXVE 1A6ZB 3N06B 5DVPA 4D9LH 2P48B 4FQJL 2QV2A 4GP5B 5AVQB 4IJ3B 2KKQA 3BH9B 4NUPA 2CJSA 3T3ME 4MDIA 2WYZA 4OCRL 5FGRA 3T77A 3NRFA 2AVGA 4TPRH 3DX0A 1MCDA 1F8TH 3OV6A 1XR8B 1Z5YD 1VHPA 1OGSA 4YUEH 4J8QA 4NO0B 3QJQB 1E9PA 1CFTB 1DP0A 1FH2A 4RMRA 4UV7H 1J0ZA 4Y88A 2LTQB 3DMMA 1J88A 1HH9A 1B0IA 4QEGA 1FYTD 5D7KE 1AQDA 4HAFA 4KK8C 5CR8A 5C1MB 2P80D 2JFCA 3O4OC 1GC1H 1RLBA 2ODIA 2YXMA 3O6FC 4LOUC 5EC1A 2VT0A 4HPHA 4MD4A 5KSBE 2ILLA 2CCWA 5HI3C 1QHQA 4QHKI 3V5DA 5GPRA 3NCMA 2ITDB 2ZWZA 1KXTA 3QPQD 2BVEA 3V0AC 2CU9A 1OGAA 4U1LA 4PRID 4HV8A 5F96H 2CD0A 4JN1H 1NBZA 5KOMC 4JFEA 1JPTL 1VZHA 1MLCB 3EF7A 4NQCE 2X2UA 2VXUH 1HHIA 2P9RA 3ZE0F 1ZT1A 3QIWB 3OJDB 4LSSH 2F8VA 5AAWA 3TNMA 2A6DB 3N1FC 4ELKA 3QSKB 2NQDA 1TTRA 1OLZA 5DZ9A 5GGUB 3NN8A 4DK6A 1TMCB 5IB5A 4PRHE 4PB9H 2CDFA 5EZPA 3EO0B 5KSBF 2O4EA 2J5LC 5HSFA 4TVUA 2PTTB 5C0AD 4ERSL 3MBXH 2FX7H 3UP6A 3LS5L 4X99B 2ZUQB 5ILTL 1CGXA 1XV8A 1G7JA 1OARL 3KPNA 3MUUA 4ZPVA 2ITCA 1PW3A 3ABZA 5IEKA 1N10A 1KBKA 1U93B 4Y2DD 4DOHB 4LPXA 2UUDH 3PY9A 4W9DC 4M62L 2PKDA 2JSFA 3M46A 5DRWA 4DJMA 2VABA 4NKMB 2A6JB 4L8SB 5EOCL 3F8UB 2OZ4A 4EUPH 5ID0A 4AQEB 3WFDL 1XF4A 2VDRB 3CSBA 2YPKB 3AU0A 1IX2A 2JKXA 3GI9L 4NUMA 4OZGE 1VACB 5HGGS 4E41E 4XVTH 1QR1B 3UGUA 5FGBA 2EH8L 2VLMD 4OF6A 5DRWB 3V5HB 4GH7B 1BDYA 1S5HB 3DVFA 1XT5A 2XN1A 1GYVA 2X0UA 2RCSL 2ZCHL 4PWFA 1H0DB 3QK0A 4OIFA 4XVUD 5ECGA 3RJDA 4A2MA 4OV5A 1N2RB 4NWUH 4DSYA 1EZUA 2WV3A 2G75A 2ALWA 3FQTB 4BQ6A 5B4MD 1JHLH 4IEFA 3V5HA 4E9LA 2IGLA 2BNRD 3GLEA 3K7UA 1T21A 1IAMA 2EE2A 4JCLA 3GUTA 2GT9B 2XPZA 1Q4NX 4LLWA 5F89A 4ZYKB 1ETB1 2DQUH 5L4IA 1EXGA 3NVQA 2DJMA 2FX7L 2OXHA 1AZUA 4M8VA 2OMVB 3RL1B 3SCMC 3ZT5A 1W9XA 1WZ1L 3AABA 3UTZB 3W38A 3SPHA 3GRWA 1J8HE 2VKWA 2P5WE 2QDWA 3DI3B 3C2SA 3CCHB 2NT1A 4MVBD 5AVWB 3T5WA 4HKBB 3QIWC 1AAJA 3IDGA 5AL0A 3T6ZA 4NAQA 5D7IA 1CFBA 2P8MA 4R0LB 1ZHNB 3W1ZA 3HZKB 5EIIB 2BLFA 4KZ0A 2EJ1A 1U2YA 3CG8A 2CHWA 5HD8C 1QEWB 1EO5A 2ZX8A 2UWEB 4Q9QH 1PZ3A 5F7LB 1DQTA 1XL4A 3CE1A 3ZDZE 4ZTEA 2Z64C 2OMYB 3P0YL 4GT7A 3VWJD 5EUOF 5BXFB 1MIEL 3NJXA 2VC2B 3CAFA 2VQUA 1UJTA 2D3NA 2O72A 3L48A 4K71C 1KIQB 4F7EA 5DUPH 4HKBA 2V9QA 4L05A 1SY6L 2CCLA 3NSCA 3QIWA 1T03H 2CKBL 4ODSL 1NCDH 1UACL 1H3WM 1KJ2H 2MOVA 1BQ5A 4JFFB 4JR9H 2VDRH 3BWSA 3N85L 3ILPA 2C34A 5C6PB 3KM1A 4LVOC 5KANG 3RIKA 1RUAL 4E9QA 5I24A 3VG0H 2A6KB 4UQ3B 5I18H 1A65A 2OSXA 1U8KA 3FRUB 4JANB 1X5GA 2YPLD 4H8UA 4N0UB 4I1NB 5BVPL 2GIXA 4O4YH 5F7NC 1TYEB 1YSOA 4IU3B 3BP4A 1GSMA 3MJ9H 4FHBD 2WQWA 5J6HA 2B1HH 5HVWA 4ZW3A 2FWSA 1SHXA 4P5SA 1GL4B 3LEXA 4OI9A 1R9FA 3INUL 1S5HA 2F8XC 2VXQA 3HBGA 5CEZE 4FXGB 2JQZA 1U92A 5LXGL 3MLXH 2P47B 2ZPKL 4J1UA 1JGDB 4L8SC 4MXWH 3FRPA 3MFFA 4AMXA 2BNQB 3EYSH 5C0ND 2WYHA 4P2OD 3VG9B 5HYSG 4HDIB 1OHQA 2FSEA 4NIKB 5DI8A 3MLTA 5DO8A 1FFOB 1DBAH 4OJDH 1LM8V 2LVCA 2HUEA 2VERA 4GIOA 4QRQA 3L3DB 2CWRA 5KVDE 2DQJL 4NPJA 3S36H 4WJG3 2ITCB 1LO3H 4N1HB 4QXVA 1TEFA 4WI2A 3OXSB 2CKBH 2CR6A 5DVNA 5EWIH 3L9EA 3GSQB 2EDNA 3CSTA 4OU3A 2YXWA 3HVNA 3QNYA 4R26H 4E41B 2F53E 2JJUA 1CE1H 4HIHA 2VJXA 1K8IA 3BQUC 3MRCA 4LIQL 1OAXL 1S7WB 2ED6A 3N5AA 5AZUA 3MLSL 2BINA 2X4NB 3G5YB 5EBMA 3VFNB 2FUTA 5FPIA 3CSYB 5IJBC 2DTMH 2CG9X 2NY5L 1QAWA 1Z7JA 1UWGH 3V4UL 1U3HD 3M1CA 1GOGA 4BFBD 3RZCB 4EI5B 4NQSA 5GZNA 4NXSA 3DECA 3U0TB 3KWUA 4MSWA 3D85A 1PLAA 3ZMEA 4G9DB 2F54B 1OTUD 1TZGH 4DKEH 3QCVH 3HG4A 2ZOKA 4GRWH 3FB8B 4QJ4B 1OP4A 4YNYA 2ZE0A 3B2PA 2MNJB 2ATAA 3CVCA 4L4VA 1UD5A 4P46D 4K23H 3QG7H 1AP2B 4L5FL 4LCWD 2KH2B 4LU5H 4HPOL 1RZKH 3CFTA 4BZ1H 4PJIF 2EYSB 4KKLC 1ZIAA 4G42A 4NM4L 5GS2D 2QDVA 3S37H 3S2AA 1KMGA 4POUB 4LPWA 1A4CA 3KEDA 1MRCH 2X4OA 2WJ5A 2YUWA 3BUBA 1LILA 2YKKA 1AQDB 4XC1H 2H1PH 3IB4A 1E3ZA 2WXLA 4XBPB 3W0WD 3QIBA 1J9TA 3V6ZB 3HE6A 3OHMB 2K4AA 4NN6B 4KWUA 3WGUB 4X5RA 2XDHA 2ZOUA 2W1NA 2GFBB 4IOSA 4PWEA 5DHEA 3CSYA 4C55A 5L7XH 4JKPH 3T4AA 1KF9B 4M48L 1BQHB 4TVPD 4LSDA 4JFTA 3DI2B 2ZX5A 4JRFA 4FGMA 1I8MA 3B3BA 2EUVA 2IDUA 4LCVA 1KN4L 1KCSH 5BZZA 3UBGA 4DP2X 5JQHC 5DS1A 2GG1A 1K5WA 5LWYL 3D51A 3RGBA 1HILB 3L3OC 3N42F 5DRNB 4Z77B 4X9BA 4KPHL 5L4FA 1UCBH 5BS0B 3HZYB 2VRKA 3MV7E 4LEXL 4M03A 1AS7A 2HKAA 4OLZL 4BK5A 4UAOC 5BZWB 1JZ7A 5JIKA 4OIIH 1V55B 2YGNA 3MXWH 5GS3A 1S7RB 4L4TA 1PLBA 3GMLA 4OLVL 4ZUTA 3QUZA 3L7FA 5D1XE 5KN5B 2XWXA 1WYJA 3EADA 1MCPH 1X4XA 1EH9A 5I1KH 1ZTXH 4ENZA 1R3IH 2IH3B 3JWNH 4Y19D 5DD5H 5EF0A 4IRZL 4G83A 2GJ6E 1I9JL 3HHSB 4N2AA 3UFIA 1EHXA 4FNQA 4IMKC 4F5CA 2RD0A 5IB1A 3L81A 1BOGA 2FR4B 4PJXF 4MXQD 2YPLA 3U4AA 1HXYB 4HSCX 4BRVA 1B6UA 1NQBA 3MLUH 2BHUA 1S2EA 4ODUB 3SEPA 2DI9A 1AY1H 2XETA 1UWYA 1JNLH 5AUMA 3EYFA 2HZHA 3VD1A 3RVTD 1ES0A 3NIGF 4I87A 3Q3GB 1LO5B 3KH4A 5G4MA 2ZAIA 2WCGA 2YQ2A 4KU1A 4OZFH 3BZ5A 2WZ5A 2BY0A 3OB0K 4D8OA 5IVXE 4L4VB 1EZLA 4BJLA 2NY3D 3I74A 5E4EB 1I1YB 4DCQB 1C7SA 1Q9KB 4S1RH 4Z7QE 2MCAA 1KCVH 3KVQA 1N64H 1PLGL 2AJYH 2ZONA 3VFMB 3D0LA 3ATAA 3OLEA 4KUCD 2BO0A 1EA9C 3N44F 5EU3A 3T3PE 1JK8A 5T5FH 2JJTA 2HT2D 3O4OB 4JHVA 4XH2A 3RWCA 4CU7A 2J88H 4FADA 1IM3A 2FECL 1OCOB 2FJFB 1S78D 5KANI 4BGLA 5CGBA 4NJAL 2OSLA 5EORH 1A7RH 3P1VA 3ZGIA 2UXVA 5KVFE 1FE8L 4W9EC 1FAKT 5HYSA 1R5WA 5DD6B 1G7QB 5CEYA 3RAJH 1M05A 1M56B 5DK2A 4C57C 1FCCA 3BQVA 2KLSA 1RSFA 3N0PB 4MD0A 3ATDA 3AM8C 3MFGB 1BMWA 1VEOA 4N9GA 5C07D 4NQTA 3ULUF 2I9LB 2PNDA 3HC4H 1NGQH 5DO2C 4DZ8A 4Z8FL 1T2JA 2XVLA 3ZDZB 3HNSH 3VU1A 5DCCA 1IGJA 1F42A 1YPZA 3DHUA 3VXRB 4BWTA 1ASPA 1HL5A 4KKCC 1ZCRA 4OLUH 4Z7WA 4NSKA 4Z78A 1JFQL 2IG2L 3BP5B 2VOTA 2HXAA 3BPCB 5DMGC 5IBLC 3VVVA 3GMLB 4ZUTB 1I3GL 3CFBB 5EO9B 3SPVA 3TEUA 1SXNA 5DVOA 4AJ0A 3BPLB 4P46A 2FJGA 4PRAB 4E42B 4HCRL 5DK0B 5D4JA 1F1GA 5C07E 1OAZH 4BFEA 2NUPA 1PZBA 3W39B 1IJNA 2L0DA 4UF7C 2HT4D 2HRGA 2BH0A 5I16B 2H4EA 3OM3B 5A2IH 3MX0A 3KL3A 3A24A 1NKRA 3FOMA 3IXAA 1LO0H 2P42B 4YDIH 5IMOB 3O2WH 5D93B 3OPZL 1ZEAH 4U7MA 2B9BA 1U21A 4OZIA 1OF0A 1LJMA 3D34A 1E7VA 2R0WH 3EJYD 2ENPA 4AC4A 1NBYB 1FDLH 4C47A 2XZCH 2EICA 2VN7A 3QUML 5HYIA 5KSBB 1LNUB 1WIPA 4ZSOB 3S88L 5E94B 4IRSB 5A7BA 4Y7OC 2GBAA 5CXPA 5D7IE 4YO0A 2XX1A 2JCCA 2WP3T 1KJMA 5CU9A 4RZCA 4X6DF 3JWOH 1EEZB 3PV6B 2XWEA 2XYBA 1ADQH 5CSGA 5E2UH 4X42A 3V5KB 4R4ND 3QISA 1IT9H 1I8IA 1KG0A 4BV1A 7PCYA 3CSFA 2QQLH 3IDJB 1A4JA 3NJIA 3G5ZB 1Z5LB 3RKDD 2NW3A 4Z3IA 4NNPH 1ZLVK 4PP1D 2ICWJ 5AB0A 2OK0H 4NC2B 5C0AB 5HVHB 2GEQA 3VWKD 1ITBB 3MLYL 2NPLX 3GEWB 2VDPH 3QRGH 1F2XK 1KYUA 1ZV9A 3AACA 5C0FB 2Z31A 3J27A 4MNGB 4OF5A 1MI5D 4PJHF 4U4BA 3DX3A 4U1SA 2Q6WA 1NC4B 2ZG1A 2B4CH 3PGFH 5EEWA 1DQDL 2CA4A 4UTAL 1JZHA 4FQ1H 5T3XD 2B2XL 2WXNA 4E41A 3X3FL 2VL4A 3TCLB 5EOTB 1O7DE 5JMRA 1TSHA 2NY0D 1NAKL 3BYTA 3S7GA 2RQEA 3KLKA 5GHWL 4HGWB 5F7KC 1U95B 4HU2A 2QLVB 4KROC 5FA3B 2BS8A 4XVJL 3IVKA 1VPOH 5CLYA 1NEZA 3QZOA 4GG8A 2H2PD 3M86A 4QHNB 2CSPA 2OMVA 2AJ3B 1QBMH 1P4LB 4FXTA 4WU7B 3LZQA 2D0HA 5IMMB 4UAOB 3AXLA 3BGMA 3UBXB 3V55A 3RBGA 2OW7A 3R8QA 5GGQH 4AWJC 3AS0A 2FNBA 2RB8A 1DBBH 3FQTA 1PY0A 3BDXA 3STZB 4LDEB 1GXEA 5T5NG 3I6SA 4O58H 4J4PD 5KJ7E 4J3OH 1PQZB 3V0JA 1T20B 4PJDB 5BVJA 3CDCA 5BOPA 3VXUB 3CDFA 1WISA 4Y5YC 4LHUA 2UY7B 5AB1A 1X9LA 2Z93B 1INQB 3I9IA 3FU5A 2QR0A 4LNRA 3QORD 4PJIB 1KJ3H 3GSXA 4TNWF 5FA4A 4C58B 4L3AA 1CWVA 4M1GL 4JFDA 2WNWA 1A2YA 4M7KL 1S8DA 2OSYA 2R1YA 4K0OA 1U8JB 4F7CB 2ICEC 4AIXA 2ZWNA 4MQ7A 4YHNA 2WSKA 1N5AA 5ERWB 3FT3B 1W0VA 3N1MC 4PS3A 5D1XC 1QW9A 3ASNB 5JIPA 2DWDA 2VDLH 3D5OF 3FPXA 5BVJB 5T1JA 5E8NB 5E4EC 4UMGA 1H3VA 5B3NA 2AGJH 3QFDA 3U0WL 5L2KB 1E4HA 1NCOA 2L8AA 4G5ZH 1C5BL 1UKTA 5ESAA 4WY7H 2JLPA 2JLLA 4F20A 3WKNA 2DLIA 5CZKA 4S2SA 3FAWA 4L8CA 1GPOH 4BWWA 4RFNB 3BZ4A 4YGAB 4CMHB 5E7BA 1KCUH 1XGTA 2ZNXA 3KBHE 4HWBL 5GGUA 1JYNA 2CO7A 1U58A 4NIYE 4WSKA 3CMGA 1KJVA 5IG7A 1N7MH 1ED3A 4KH2A 5K59F 1MAML 4K2UH 5B8CC 3VX1A 3TO2A 4JDVB 1JF6A 2GBTA 4LVNB 3VD0A 4Y8DC 2QHRH 3GPEA 4BE5A 4QHPA 4L1HA 4BM7A 2Z31C 1U3NA 1EZSA 2X1XR 1IFGA 4MQSB 1U8PA 2XNAB 2CIIB 4JQIA 5BRPA 2N7AA 4XAWH 1K8DA 3CHXA 1I8LC 4P23C 2CHXA 1G0DA 1EDYA 2J1WA 4K9EL 2E7CA 1G4RA 3CVIH 3ARPA 4M6AA 4WI3A 3LKNB 1ZPLA 3LEVH 4DKTA 1E2VA 3SO5A 4FA8A 3TEZA 1SN5A 1NOLA 1O6VA 4JDVA 4BZ2H 1JF1A 2A83B 3G08B 5C0IA 1RSYA 3BPLC 1RV6X 3V6OA 1PZDA 4JFYA 2I5YL 3B2XA 1NAMB 4OFDA 3VFRB 1TOXA 5IW6A 3N9GL 1E7UA 1XGTB 4ZTPL 1BWWA 2OYLA 1AI1L 2QQQA 4UT9L 2VN6A 3EKCA 4B97A 5C7XH 3CVDA 5E6RB 3W9EB 3ZBMA 5ID0B 3QQ4B 3SQBA 1MI5A 2JIXB 4EOWH 2Z0UA 3H2WA 4LXFA 3H0TB 4MCZB 1S7UB 4HWBH 4JJOA 3DIDA 3BVNA 3GSNL 2HVJA 2JKTM 2AQ1A 3EOAA 3HIZA 4HWNA 5JO5B 4AIZA 1XL6A 1CFQA 1BM3H 1KIPB 2HVJB 2E7MA 3EOAB 1E42A 4TYUA 2BXYA 1ZXQA 2O5XL 4PW3A 5AKRA 1MSPA 3PWLB 5HYEA 2EECA 1EAQA 1JI1A 3AROA 1H19A 3AREB 3DJ9A 2W65A 4HS8L 2AI0L 3PNRB 4RGMC 4TS6A 2ZKMX 1KIRB 2W9EH 1J8HA 4AYSA 5JHLA 4GKNB 5C0JB 1A8JH 5CLTA 2EEXA 1AYOA 4G6MH 4Y16A 1DBKH 4YBLB 4RQQB 4MXQC 1DUZA 4PGEA 1BD2B 2QBWA 3BWUC 3BKCL 3T0EA 4QXGL 1U36A 3FCUB 3KLLA 2KPNA 2W80C 1FV1A 5E8OB 1SEBA 1XD0A 2NLJB 3VH8B 3FQ4A 1UXMA 4PJHA 2EADA 4J27A 2XC8A 1BIHA 3IAGC 5A1AA 1M7UA 2O6FA 6PCYA 4JLRA 3V5DB 3DRTA 4LKXA 5H37H 1MCOL 3IRCA 2X53A 4B60A 5IQ9B 3OBAA 2WOYA 3IXTA 3KNBA 1Q90A 3KPSE 4RRPM 1JMXA 5MHSD 4JUSA 2Z35A 3ROOB 4JCWA 3F2LA 4X7TB 4U2ZA 3C60B 1YJDH 3NZSA 4GG6F 4WNSA 3PS6A 3GTTA 1B90A 3Q2NA 4IIQA 4GFTB 5LGHL 1U42A 1A3LH 1MIEH 5B39A 4ZDHB 3DARA 3F3HA 4KKAC 1GW0A 2AEPL 3DSNB 3H9HB 4WUUA 1N4XH 2XNAA 4F3FB 3GSUB 2XN9A 2NX5E 3O3EA 9CGTA 3ELAT 2NCEA 1VFUA 1FV1B 1EEZA 3PV6A 3WTXA 1QASA 3PWJB 3E1F1 2IGFL 4FERA 1SMDA 3CHRA 1T7VA 5IFJB 1DR9A 2ESVA 43CAA 2IDTA 1KGIA 4TOYL 4R5XA 3U2SB 1RUAH 2VLKB 3DO7B 5DJYB 1AO7B 3FOLB 4O2CB 5ITBL 1C5CL 4Q7DA 4MWFB 3NSXA 1E8WA 1F4YL 5MEND 1MNUH 5FWQA 3KVDD 3AY4C 3MV8B 3K80A 4NC0B 1MVUB 2B0SH 5IVOA 1ET8A 2G9HA 2QMJA 5D2LF 5SWSA 2R1WB 4EAEA 4MRCA 4KI5D 4X8GA 3L1OH 5HJGA 4EZLA 3LKPA 3RTQA 4KRMB 4B9ZA 2FATL 2RA1A 4O5LH 2OJZL 3NTCH 4HUVA 3PRZA 3JT0A 2ZWYA 5E00B 1QRND 1MJ8L 3FUMA 1RK0A 1T3FA 4WSGA 3HC3H 3D2UD 5ECJE 2MCPL 5FS5A 4KX9A 4KHTL 2P45B 1LMIA 3QUZC 1D5RA 2QKSA 4A7SA 3HN5A 1JGUL 1XGPA 2P5ED 2WLKA 1Q8MA 5J6GA 2UUDK 3H3PH 3K5SA 3S4SA 5JLZB 4R90L 2BWIA 4WZ9A 1FCGA 4E0RA 4KQ3H 4BSVB 3HE7D 2JI3A 4GRWE 3VQMA 1DFBL 2NW2A 6FABH 2CM5A 2CBQA 1IGCL 1O6SB 1VGKB 3STLA 2CRZA 3V7MA 4W81A 5TE6H 4CL7A 2R15A 3COOA 4TQPA 2XN0A 3MMEA 4RBPK 4XCCH 3ZKQD 4D9QD 3BEWA 3NZHL 1RZJL 4N2MA 1YUHA 2IVFC 4IW4C 2QGCA 1DANU 2ARJQ 4YHLL 4XE5B 5C0EA 2HH0L 3UAJC 3U6RA 3MGAA 1G1OA 4YGVA 1RUKL 3FKUS 4U2YA 4Y2DB 3MTRA 3PFUA 3AS1A 1J7VR 3QIBC 1VADB 4NQXA 2PXYD 4LFHG 4BK8A 2EDOA 2V2WA 3HN3A 3VGBA 2AEIT 4RDQF 3O3UN 3P11L 4NSKB 4F2ME 2H0EA 3O6FB 3SGDH 1U30A 1CFNB 3BO8B 4NQVA 4WK0B 1II4E 3D48R 4JFSA 1LL1A 2CGRL 4H8QA 1UM4H 1PZUB 3ZTDC 1H9DA 2GBVA 3UTTB 4JQVA 4FEIA 4ODWB 4X8XA 4NAMA 3EUUA 5JOFB 1QUNA 4JE4B 4MBOA 5IR1B 4ZUVB 2XG5A 3UJJL 2A2QT 3UTTA 1RZKL 4Y19E 5J8OA 4KQ0A 2I9LA 2W95A 4ES8A 1KV7A 1BMZA 3IRZA 4PRPB 2DDQL 4KKRA 5FR3A 2CDEB 2VLRD 3MODH 1CXEA 3H3PL 2ENYA 3NCWA 3QQDA 4KZEH 4Z3EA 1AG6A 2HSIA 4XP4L 1F11B 3U9WA 3DX4A 1E2ZA 4JPSA 3NSJA 4RBPH 5C2BL 3GK8L 1SYSB 2BC4A 3EJZC 1NCCH 4FQLL 1AP2A 3DX8B 3P9WB 2Y7OA 4PJEB 2NZ9C 1JGVH 3OAYK 4WFED 4E9SA 2JB6A 1YMMD 1FNGA 2E4FA 4HIXH 3P73A 3BJ91 1WCBB 3QUXA 5GJSL 3ZW3A 3IF1B 1N6UA 2BSTA 3NA9H 2YD2A 4UIKL 5DU7A 1IAKB 4Z0BH 2V8MA 3QDHA 5K1NA 2VGLM 5EDXA 2NW3B 4Y4HD 3SB3A 1BYPA 3B5HA 1NGPH 4JO1H 1L7TH 4K3HA 1BZ7B 1FZKB 3WTTA 4YC2C 3MCKB 3IFLL 3MRPA 2WXHA 2VN3A 5DJCB 5FHBL 4I1PA 3S6CA 2MHAA 4HZLB 4LL4A 3L54A 3O4LB 4JDTL 1FN4B 3EJPA 1HKLL 4CILA 1CICA 1Q0EA 5DD0H 2DEXX 4LMQI 5JHBA 3IF1A 1PZ5B 3FS9A 2QELA 4ODUA 4Z7QB 4NP4H 5E23A 1B9KA 4XO3A 1HIML 5D7LA 1MXGA 5DQJA 4YLQT 2XTLA 4KY2A 2ESVD 5H2BB 3CZNA 4LCCA 5DHYA 5ANMA 1NCIA 3B3IA 3DO3A 3GBNH 1AIFB 4OB5H 4RAVB 1L9NA 4Z7VA 4KDVA 2WBJC 3LH8A 2J73A 1GJWA 4KTEL 3BAIA 3CVHL 4LLQB 1HHJA 5JZ7D 3SDDC 5JDSA 3L7FB 4XX1E 5KN5A 3GDCA 4JHWL 4MQXD 3UIZA 5HHQB 3GIVB 4ILDA 3V0VB 4KOCA 3BSGA 3P3TA 3ERXA 1Y07A 4IGBC 3MBEC 2XVGA 3K8KA 3TJHD 1TF4A 1KOAA 1AXTL 1TJHH 1KELL 1X9UA 3BSZL 4PREA 4UYPA 5DJ0B 3LNHA 4Y9EA 3VXUE 1IEAB 3FU0A 2EE0A 2NMSA 3Q1SH 1XCTA 1OP9A 2QADB 1X5AA 1MOEA 4K15A 3R1GH 4XCFH 5TD4A 4ZNCD 1KB9J 5JUEH 1L7TL 5DRZB 5F21B 4FYRA 4UOQA 5IESH 2VC2L 2OL3H 4YPGB 4G1EB 2YD6A 2NX5D 5HJBA 3PF2A 4Z7NF 4UTBH 2ATPA 4TL5A 3QNXB 2CHNA 3SQRA 1IM3B 2H3KA 3O8XC 4WHTA 2A0LC 2XBTA 2ZUWA 5GGRB 1VCBC 3TO4A 3MRKB 5CGTA 5TH2B 4HOMA 5GGRA 4BSWA 1CF1A 1DVZA 4AV5A 5GIRB 4UT6L 2X7LB 2IPUG 3GKWH 2XRAL 3MACL 4IBQA 4QRAA 3R0NA 2X3CA 4TVSa 3O45B 3ALPA 1MCFA 4XBGB 4AE1A 4AYFB 1VZGA 3LNDA 3DVNA 1NCWH 4NCC1 1CPUA 2ZT9C 5GRZA 1NAML 4P5TC 3RWJB 3T1FA 5ELIA 1FAIL 3IJ7A 3KPSA 4OLXL 3WIHA 5B38A 2OX5A 3PXHA 1MCBA 5E6ID 1GR7A 2CK0H 2G3ZA 2QQKL 4UT9A 5T3ZH 4ABQA 4M8UA 5T1LB 4OQTH 3H1ZA 1M1SA 4JFQB 2AEQL 4JB9H 3NBNA 3RWDA 4AKPA 2MCMA 4YAQB 1A1NA 2H3XC 4OJYA 5I5JA 2WGNB 5F9WC 4P5MB 3QQNA 2C7UA 2DMCA 3FHEA 5IFAL 1FFOA 3QEHA 4YXLH 4AQ1A 1E43A 1WE5A 1IGTA 1A6WH 1VIWA 2Q86B 4Z7OF 3NP4A 1W80A 2QVIA 2X38A 2Y2YA 4EI6B 4OFIA 4L4TB 1FJ1A 4R7NA 5E2WH 5FK9B 1FNHA 4G7QB 3D69A 2MH4A 2BFVH 2H7WA 2XKNA 5IBUG 5IHZA 2LU5A 1KUMA 1YEDA 2Y72A 1LP9F 2EDMA 4YDIL 3VYNA 2D0FA 1IC1A 3LD8B 3FBKA 4XXWA 1K6QL 1GGIL 1G7MA 35C8L 3MV8D 4U1JA 2IH3A 4WO4D 1NLDL 3QUXD 1D5ZB 3AU1B 2GTZB 5DI8B 3KPPA 4Q9RL 3S88H 4OI7A 2MQ0A 1MFEH 5BJTA 1OP3K 4XNXL 2PYEA 1ZSDA 3LQAL 4NEHB 4YXKH 3AJ7A 3HMXA 1CFMA 4JZJB 3KWVA 3Q2VA 5IW6B 2CK0L 5AL8A 4YZWA 3P30H 1AHWB 4Q6YA 4NO2A 2QKIB 2PCFA 4TUUA 2X89D 3HW7A 4EQ3A 1BQHG 1WBXA 4U0RB 5GS0H 5E08L 2DEWX 2FIKA 4CC4C 3DIVA 4PJ5A 2BS71 4NDMA 2Y07L 3GMOA 4G6FB 4TV3A 2PMZA 3JZYA 1XSIA 1K4DA 5BNXD 2WNXA 3KJ4B 4KK6C 2IAMA 2FH8A 3NIDF 5T3XL 3V7AG 1IAIH 2AFNA 4LLMB 5IROA 5KS9F 3TA3D 1KTJA 1JK8B 3UDWA 1PZAA 1X9RA 4Y4FD 2BM3A 2AABL 1FUNA 3MRBB 3ZQWA 1NANI 1UZ6F 3HFMH 2GUYA 3HJEA 3LQMA 3ZN6A 5I15H 3VFWA 1UA6L 2ZWSA 3EFDH 3G5YA 3TPUB 5HY9B 5DR5H 2KDYA 4QRRD 1R0AL 3QWOB 3WYRA 3GMRA 4HBCL 4GBXB 3FTSA 4DP0X 2CLRA 2VLLA 4YUEL 4CKVX 3PCYA 2XN2A 1MFBH 3KCPA 2NOYA 4QHKJ 3MNVB 4S1RL 3X13B 5J9PA 5E9DE 3RWGA 2CXGA 3CJJA 4I5BA 3LZNA 4URKA 3OLDA 1M6UA 1MHHB 3NCEB 3U6XS 3Q8FA 4ZO9A 3L9RA 2XZQL 2QGBA 1O5PA 4PG9A 4UWQB 1XBDA 3I2CH 1ZHNA 1F58H 3ZXAC 5FECA 5E1QA 2H6PA 3T65A 4LPVA 1TJIL 2F53D 5A2KH 4N2IA 4NJAH 5EORL 4ZUUB 1A7RL 5FYKD 5IB2B 3NSYA 4U6XB 5C92A 2AJXH 2PUQT 4QNPF 3A6OA 4UT7L 5E5LA 3QEQE 5EDSA 2YLHA 3ZZSA 1MHEA 4YSEA 5HPOA 2AXWA 1UWFA 3MJ8B 1W72H 3WO4C 3EZ8A 4Y1SA 3RWFB 4BIKA 1JTPA 1NLBL 3CIAA 4JFDE 4PJAF 1SEBB 1KJ3L 2R2EA 4JY5H 4XXCA 1IC7H 3FYIB 1KN2L 4XHJC 1OWWA 2I85A 3CDGA 1TVBB 2O30A 3P02A 5E70A 3CFJA 3QCUL 5D7EA 1INDH 2YZ1A 1R17A 2VM3A 5CZXD 1I7ZB 4PRPE 1UG9A 2X09A 1MCQA 3MFFB 4MX7B 2MCG1 4UIMB 3HB3B 5F1SA 2FO4B 4Z3FA 3UGEA 4IMLA 5GGTH 2CKBA 4BH7B 5EF1A 4OGQC 3TOPA 4Z7IA 3ARZA 3I2CL 4BCXA 1M53A 3GHPA 4IOSD 4MS6A 1HWGB 1KCRH 5TE4L 2XN9E 4CVXA 2JB5L 3ZZ1A 2FD6H 4U6HA 1V3JA 3MRMA 5EZJB 4N8UA 3S8GB 2H47C 1EHLL 2WPGA 3O2WL 2NR6C 3DSFH 4PU2A 3U25A 1BXVA 1X7TA 2LOEA 3QUMA 3UO1L 3IMRA 2C9VA 1CTMA 1E5BA 4HLZH 3HG5A 3F7VB 3FO2B 4PWKA 4TNGA 1VF5C 3RE0A 3TNNA 5ESAB 4QLWA 1JHTB 4XP9L 5DD1H 3V4PB 5AW5B 2PCPB 3SPIA 3QZBA 4PLKD 2BCKA 1AGEB 2AJZA 3HHRB 4ANVA 2TRYA 4P5TD 2QVMA 5C0IB 2WO2B 1NWPA 4OJFH 5DWUH 5GGSB 1YEEH 1IIIA 4NWTH 4M8QB 3K6SB 3NP3A 4WEBH 4PSRA 2GJPA 2VSDA 1KDJA 2VW4A 4W4OA 4JFDB 5CBAA 2VLJD 2K9FB 2MKWA 3F7VA 1TETL 3NCXA 4H44C 5BO1L 1KB5B 1OTTC 2DAVA 2YAFA 4M5SA 2CIKA 2AQ2A 2OMWB 3H53A 3DVIA 3D18B 2HFFB 3F00A 5I8KH 1G9NL 2GSGB 1IVLA 5AKTA 4OV5B 1OAKL 2NDFA 2XQBL 3WD5L 4YHIB 1WBXB 2VSCA 3PQYE 3BPOC 4JAMB 4JKWA 3I9GH 4KFZC 4NQQA 3STZA 1J8RA 1H6FA 2CXKA 3VB8A 1UZ8A 4ZQKA 2GCYA 4S0TD 5J13B 2Z4TA 5I1CL 5A3ID 3GSOA 2Y4SA 3CZLA 4OUUA 2F54E 4QAMB 2SEBA 4F80A 3GHBH 4NN6C 4LLWB 1RU9L 2YPKA 4W4NA 4OZIB 4Q9QL 3NH7L 4QXUL 1KTCA 3BZ4B 1T89A 2DJSA 1SJHB 3GT6A 1RIHH 2FEDD 2YOAA 2IH1A 4HOXA 5LJYH 1HESA 2R23A 2AQNA 2P7TA 4P3CH 5DSCB 5HDBE 4OSUL 2ZYIA 4APQB 5JHDB 3WJJA 3HC0B 1IGFH 1IBGL 2EH7H 1AGCB 3FJTA 5EZIH 3ENEA 1UXWB 5F7MC 4RGND 2C4XA 1E6JL 1MFCH 2IV8A 4ANKA 1EWHA 2GJZB 4NFBA 1I85C 3MKGA 3R4DA 4NQDD 3HCVB 4MQ7B 5EBWA 5CIPB 5E6ZA 2YEQA 2OMXA 5DJ8A 5C07A 2GTQA 2JKJA 4YR6B 5DQDH 2WLNA 1Y0LA 2G5RA 2OQJA 3DTXB 3MRFB 4Z5RA 5IP4A 4OW6A 4Y4FB 3P9MB 1YY8B 1CYXA 5I73C 1JF1B 2A83A 2OBGA 4PN6A 4E9VA 4LPCA 3EH4B 1OHZA 1G7JB 3KPNB 4RWHA 5IEKB 4W4OC 2XV6B 2GUOA 3NACH 5L2JA 3BXNA 4DP4X 5T1MB 1G6RB 3RFRA 3F7RA 2QADC 3H7BB 3Q9QA 4HXAL 4LSSL 1NCHA 2ETWA 4RX4A 3REWA 1IV8A 1FRGH 4A2DA 1NA8A 1UM5L 3DLQR 4GRLA 4NDMB 3HZVA 3MGTA 3MRQA 2ATKB 3MRRA 3NN8B 1H15B 2L04A 5GS1C 1FO0L 3FCSA 4G9FD 2JCCB 3FT2A 3H4HA 4P48A 4GP8B 5INDA 2YS4A 1MWAL 3JTSB 2RAMA 3FFCA 3K4DA 4BUHA 3L2NA 3X1FA 2NYKA 1D5IL 3QZNA 1T0MB 4NI3A 1LO3L 1X3DA 1A6VH 4ZPTB 3L8QA 4O02L 2NR6A 4ZS6C 4ABWA 2F5AL 4AOFA 5CJQH 2XWBA 2ED7A 4FDWA 3GIVA 2VMJA 3JBG7 1QSZA 3OZ9L 5DJ2A 3RBSA 1NDMB 4B3EA 3Q8AA 1W0WB 4QRBA 3ARFB 2MWCA 3PWVB 3TV3H 4G3YL 4EXPX 43C9B 4PJ5B 1MFNA 4QMEA 3RQ3A 3TIDB 1H8LA 2DQTL 1QNZL 2TAAA 3ARBC 5HDLA 2Q6WB 5CJXA 3GI9H 4GB9A 1PNCA 4L1DA 5C0DB 2J2ZB 4XP5H 5ETUA 1TVHB 1WIUA 3TEWA 3ILDA 4I18A 4YVUA 1F0LA 5HGBB 1DSFL 1HH9B 4J3OF 5EEUA 5SWZB 4Z95L 4M6NH 1D3CA 4Q14A 1QFUH 3B7YA 5KJRH 3QJVB 4HK0B 2Q10A 2PR4H 3FUKA 3EDEA 5C97A 2C1PB 1NINA 2G4EA 4U4IA 5JR1H 2W0LA 1ANUA 1FFTB 1GOFA 3VXMB 2EUZA 2V6HA 1RI8A 5AB2A 4E0RB 1BV8A 3ZDXF 3OMAB 5J5EA 3ARWA 5K9KB 3EYQD 1BREA 2FL5A 2A99A 1QFOA 1AQ8A 3SKOA 1MHHA 2BSTB 5I1HL 4N6RB 3N9GH 4NUJB 4PJDF 5DUJA 3OAUL 4NO5A 1E9QB 4JM0A 2IBZY 3D3VB 5IK3A 3O2DH 3BE1L 1SYSA 2BC4B 4Q6IA 4NX0A 4X5QA 5HDRA 2CRIA 1B0WA 4MTMA 3MKKA 1CZ8L 2JCWA 1JXKA 1QLRB 4ELKB 5LHDA 4HK3N 3E3QC 4S10A 3GXMA 4S1DC 2AANA 2QEJA 4RDBA 1RJYB 4J3UA 1QNZH 4IJ3C 2X7LA 3H85A 4ATWA 1HNFA 5EEZA 4GMSH 4MDRA 4F92B 3Q1EA 4WEMB 4O9HL 1AHMA 4ZXBA 4EN3A 1AMXA 2R0ZH 2X4OB 4TUOA 1NFIB 3GGWB 4PTUB 4OLZH 4PVBA 4KQ4H 3CBJB 2XY2A 4XGZB 1TQUA 1T03L 4LF3B 4OGYH 4EVNB 2XVKA 4BBWA 4QY8A 1I9IL 3C2AL 3U9PL 4HJTA 3UTSE 5L2KD 4HT1H 2WXIA 4PJ9A 5IEHA 32C2B 1ZWIA 1BD2E 3BWAA 1FL3B 4XNUL 4I0PA 4F3FA 1U3HC 1QSFE 2PP7A 2HRPL 1F2QA 4QT5A 5ADOH 3QFJD 3V0IA 5K9QG 2IAMC 4L9LB 4LHUD 2VR6A 3LH2L 4U1GC 4XNQB 3S5LG 3MLPA 4X4XA 4JM2B 4QHUA 5F7DB 1AACA 3A6CL 4IS6A 1CTNA 5F1OB 4F8TA 1CXLA 3LZPA 3PG2A 4FQLH 4MBRA 1F4WL 4AC2A 4X7TA 3MOQA 2YHGA 3CFQA 5IGXL 1MCCA 2EDLA 2EO9A 1RVFL 2HN7A 4P9HC 7CGTA 3W5NA 2R69A 3WL9A 2CGZA 3QCTL 2VXSL 3QNZA 5KVDL 3QUZB 1FI8C 2AQRA 2KERA 4IHBA 1YG9A 4AM0A 1L5GA 2NY3B 3KWWB 1NOAA 2OSLB 4G7VH 1P69B 1B3IA 2G5UA 3HN8A 4N5ED 3IJHB 2BZCA 5JDJA 4RX4D 4FNRA 6PAZA 2YK1H 2CUMA 3UTPD 2HLAB 2IANA 4KKAD 2YMOA 5K39A 4PEEA 1CDYA 1A3LL 1QA9B 1TCMA 4ORGB 4TULL 5EU3B 4G43A 3C87A 4ZFZB 1IO4C 3SO3C 4BKSC 2AEPH 5TF0A 3T0VA 3V0VA 5BS0E 2IH9A 3FU7A 4XXWC 1SY6A 2DM4A 4WI9A 3BUDA 4ZMTA 1DVTA 3RDTD 4PWJA 5EWIL 2WLLA 3CQPA 4HAGA 4U1MA 1OAUH 3T04D 5JOPE 4Y16B 2R9HD 4BSVA 5KBDA 2DQEH 4XTRC 1C1EL 3DK0A 4N0CD 4M43L 4X5XA 2P5EE 4M5ZH 3QPXH 3A4FA 3VGAC 4H0LC 4FXGA 2KZ1B 1VAHA 4Z7OE 4GUOA 1RURL 5D7SH 5BMFL 4JL2A 4PPTA 4DFIA 2DTML 2NY5H 3D0VA 4G71B 2A4EA 4UU9B 4Z7WE 4Y89A 3KWWA 4K5MA 1L5GB 3SBPA 1W8EA 2VL5B 5BS0D 1F11A 1A1OA 4PAZA 3V4VA 1M7DB 5GZOD 3HFFA 3TVMA 5EEYA 5FC9A 4UQCA 4IBTA 4OZGB 1ETZA 5KSUA 4MB5A 3ZYJA 4CW1A 3S97C 1UVQA 1F97A 1S7RA 2MCPH 1AO7E 2LR4A 4JO3L 3AT9A 2KS0A 4W9JC 2ZG3A 3KW7A 1R4XA 2XJLA 1EO8L 2O5ZL 4V2BA 1U3JA 2VLRE 2JK5B 1I75A 2X28A 4OQTA 4YFLI 4Y4FC 5FF6B 2H26A 5DVKA 3L5IA 2LVEA 1RUPH 2A1WL 1HAWA 3QG6A 5FOBB 4J28A 3M7FB 5HYSB 4F8NA 2IPKA 3LIZH 3DRTB 3WU1A 2EDRA 5E6SB 2OAAA 1IBBA 2WIIB 4I8DA 4WKZA 4IHOA 3V52L 4GQ9L 3WEXB 2CDEA 4XCCL 4XMLH 4E9TA 4Y2DA 2JK5A 5EZOH 3DGDA 1PY4A 3O8XA 3ZRCC 4KMTH 1RZJH 5FDWA 3BAEL 2JXMB 4GINA 4YHOL 2NLJA 3VH8A 5F7UA 1RMFH 1KB5L 4LARL 2FJSA 3FH8A 5HHXL 4YHPA 3NCYS 3SDXB 3VFPB 3WBDA 2C4FT 1OALA 3OJMB 4IIQB 4JM2A 4QTIH 3U2JA 3VRLE 1GIGL 1CGVA 3C6LB 2HJKB 5DQ9B 1NSNH 1J1OH 2B1AH 4YXHH 4L0ZA 1ETZB 4P3DB 3S48A 4H20H 2CNYA 4KC3B 4LSTL 5AYUH 1MHCB 2EDXA 5JPNA 1Q1JL 5IHUH 3PDOA 2EYSA 4JFPB 3WFEL 3P11H 5HJ3B 1H3PL 2BNQA 2YAMA 5DT1H 5J3HC 1FFQA 4ONOA 1TU2B 1A25A 3T2NH 2J1YA 1OEZW 3VJ6A 4TMPA 4RMVA 2X9XA 1UZGA 1PZ5A 1S9KC 2P8LA 2WBJA 3EO1B 5KVEE 4ZODA 4I0PD 4Y0GA 5ACLA 4TVPH 1OTTD 3MODL 2UX6A 5J1SC 5GRVK 3U9UB 3QS2A 4LCCC 4RISH 3ZUNC 1O0VA 5EA0H 3UTSA 1RUPL 2A1WH 2NW2B 5SWSB 4N2GA 3VWKB 3FB6A 4UI2A 1AD9A 1WC7B 3MV7A 4NRZA 3WHE0 1A14L 1JNNL 3SJVA 1W72B 2HA1A 5D1XD 4JRWA 5T1DH 1CICC 3U4BL 4F33A 5EUOA 3CSGA 3ATBA 4MWFA 3QNYB 4HJ0D 4KHXH 4YSSA 4PLJD 3QUKA 1IBHA 1NLDH 4HUXB 2ZX6A 2DQGL 3NPSB 5F7HA 2OLDA 1KPUA 3B9KB 2IPTL 2H3NB 1SXZA 2YMXH 1NSNL 3ES6A 4OT1H 1IQWL 1HEHC 2LQRA 3BAXA 1PAMA 1FNSL 2X6BA 3MJGX 1GZQA 1QBML 2VZOA 2CIIA 3KJ6L 4UM9B 1GJUA 3WI9A 2A9DA 4IBVA 4RIRB 1Y1DA 4JY6B 2X6VA 4YWGH 4OJAA 4N2DA 4XMWA 1VENA 3CZFA 1A7PH 4PMEA 1S5IH 3AITA 3RX9A 4PJEF 2BVUA 3ZTNH 2VZSA 4RMQA 5F9OL 1FYTA 3L3HA 3LMJH 4NBYB 4L4VE 2JJSC 4NZJA 1A7BA 3ORJA 4P8QA 5IIEA 4F1SA 4LLVA 1AANA 4KJWC 2GSGA 3AQZA 3M45A 4NAJA 1XO8A 1B2WL 2BHYA 4KK9D 1M71B 1KYAA 3MV9A 3U4EB 1KT2A 4JQVC 4U1LB 3K6FA 4ZMVA 1W15A 5C0CB 1K9TA 2FTAA 2NT0A 4OLUL 4K3DL 4XVUC 1QW8A 1ACYH 3AWFA 1T66C 4LESA 2BVPA 3ZT6A 2QQNH 1S3KH 5AVUB 4QPEA 2W9LA 1WSST 4JFXA 3OX8B 1P2CB 2BX5A 2F74B 2NY2D 1PY9A 3IBEA 1FZOA 2PXYB 1DQLH 5J1AA 4X7SH 4AH2B 5HD8D 1ZLDA 3H2PA 3U0WH 1MVFA 3L3JB 1MQKL 4LHJB 3GO1L 4PVLA 1C5BH 1GC1C 1KPRB 2XTJB 2ZOLA 2QLYA 4FG2A 2F58L 2WO3B 1QFWM 4RNRA 4FG4A 1A7OL 3EO9L 3RIAF 1KG0B 2VQ1B 3E3QE 1I1RA 2QV4A 2V33A 2Z8VC 3EYVA 3AAZB 1NCJA 2HT3D 2HG0A 1CFVH 1JHKH 3L4VA 3IMVA 4WWPA 2Y1YA 5EZJA 3UX9B 1N7ML 1JV2B 2FHBA 1E28B 1P1ZB 2GITB 4CU6A 2X4RB 3LNEA 3KVPA 1W72L 3B6SB 4XXDB 3GBMH 4MRBA 5IMKB 1KZQA 2PTTA 4JHZA 5T3XE 2W59A 2BY3A 1PGRB 5J0BA 4G11A 4A6YL 5E56A 3SO3B 4DGYH 4UV4H 1JGDA 4HPYL 3MJ7A 4GW1A 1WEJH 4JG1H 2EIKB 1T1WB 3CFJB 4PRHB 4QJ3B 5FCSH 5GJTH 4DP6X 2GY7B 3DHPA 4L4VD 4MMXA 4ZMOA 1DEEB 3ETSA 3V6FA 5AW6B 3TIDA 4WJKB 3EH1A 4EBQL 1RUML 1ZLVH 2OMWA 2OJEB 4N0RA 3BN3B 5J12B 5C08E 5MEOB 1LO2L 4NQCB 5KSVB 4S0SD 2XI9A 2YPVA 4UQBA 2FO1A 4YHMH 5FKPA 4KJQC 3QDMD 4UDUB 1YMMA 1FG9C 1YEKL 5TDPB 3UZEC 2P43B 3VO0A 2Z92A 4Z78B 4HKZA 3HNTH 3U7YL 4B27A 4QHNA 5E9DD 5GGSA 4N8VA 5HGDA 3LN9A 2J8HA 4GAJL 5FA3A 1XF3A 4H4NA 4FMKA 4IRSC 5IVXB 5DVMA 4QRRE 1YN6A 1PJ9A 4RSVA 5LDSA 1X7QB 1IEBA 1YC7A 4LOEA 4IIQC 3VXNB 3DV6B 4MMZB 5T5NF 5AW8B 1K72A 4JZNA 3KCPB 2V9TA 5T3ZE 1KV3A 4OJFL 2Z6FA 5DWUL 3VXNA 3RURA 3MROA 5IIEB 4NWTL 1SXCA 5B21A 1ID2A 3RI5F 4IDJL 1Y18A 4NHUA 4QNPE 1IAIM 3KLDA 1UA7A 4Z7AA 1N9PA 4PGEB 1GA2A 4L9LC 3RG1C 5GS0L 2EKJA 4G8AC 2LE9A 5C0AE 2DYPA 2CJUH 5LXVA 1UM6L 2DMBA 1BQUA 5DHVA 1E4XI 2J72A 5B1CA 4YR6A 4XPGL 5FW8A 4JFZH 2F0CA 3HNVL 3QDJB 5EU7C 1IGYA 4PY7B 4FMFA 1BAFH 4LLDB 2K1MA 4WGVB 3TVMC 3UERA 2ADIB 2X87A 2YA1A 3ZK0A 4P2CG 1C7TA 1PKOA 2QR0B 3CSPA 3MNWA 4JRYB 4XPHH 4YSRA 4S1QH 4ABVA 2AABH 5I1CH 3VVWA 3V5KA 3ZDYF 1SHMA 1IJ9A 3LPWA 4XBEH 3QFDB 5F88A 1OB1B 2L7QA 1Z9SB 1MEXL 3UGXA 3CN4A 3CH1A 1AVAA 1DL7H 4KJWD 4XN4A 1U8HA 5AYTA 1SDAB 2P8LB 3MREB 3GXPA 4K7FB 5E94A 4D0CB 1N19A 3BIBX 4UAHA 2IH1B 1HXMA 4ZOEA 1OPOA 5DYOA 3DDFA 4RWYH 4LVHC 5EU4A 3HRZB 1IGFL 3L2MA 1AD9B 1WC7A 3N41F 4PG2C 1G1CA 1Y6MR 5JIHA 3NJNA 1QPPA 4QYAA 1IGIL 5L88L 3OSKA 3ZRSA 1GPOL 4GW5A 2FT6A 2DWTA 2EABA 2A0LD 5BRZA 3TYFB 1RUQL 7PAZA 1JXGA 3QEQD 3TT3H 2L7UA 4EIBA 1SLUA 4PCKA 1GZPA 3RPBA 3IMBA 1AZNA 1S7XA 5F6IB 1GMEA 2BIPA 5EOCH 5GRUL 3VJ6B 2NY1B 3W11D 1FVEB 2XUWA 3MN8A 4G8GE 4KRLB 4OF3A 2IPUK 2Y7MA 5I74C 1IL1A 1BAFL 4MNQE 4PSPA 5I6OA 1MCLA 3US1A 4LO9A 3A67H 3SDCC 4KXBA 3L1OL 3MLVH 1A5FL 3ARYA 3BISA 4O5LL 4PJBE 1KGWA 1KN2H 4FFZL 5HHVL 5K9JH 4OCWH 1KJVB 1GGBL 3GI8L 3W9DA 5GS1B 3FK3A 1KIUA 4UBDD 4BSJA 2RACA 5EO0B 5I17A 4LVNC 3CVIL 1NEUA 3KYNA 4GBXD 1W0YT 1U3HA 4I0PC 3ULSB 2H9GB 3S5LA 1XCQA 1ZGLA 1RPUA 2NY2C 1T7WA 1ASOA 4MA1B 5B8CA 2Q0ZX 2WOBA 3UJTL 5AW7B 5KS9B 1Q94A 4OD3H 4CMHC 4I77H 5ESQA 1BFOA 3C08H 5A2JH 2R0LH 3VW3H 4LCWA 4W9FC 4PJ7E 4KAQH 4Q8BA 1SZNA 4GKSA 1KTLB 5L7XL 1J5CA 4A04A 1D5MA 1FH5H 1A6TA 5I1JL 3RWEB 2AK4E 5ERWA 5DZJA 3G9VA 4NKDA 5JPMA 3MA7A 1UVQB 1RUKH 3RZCA 2AJSL 1I1FB 4GKZB 1LMKA 1P5UA 3FO0L 4Y9BA 4DN3H 2X44D 3PP3H 5KSAD 1B9ZA 2D2OA 3VFNA 3K3QA 4PBDA 2C3VA 15C8L 4X6EA 5BV7C 1WFTA 1TZOA 3QT2A 5F3BB 3ZIMA 3MLVL 1BLNB 3QH3A 4PH8A 3HEIB 3OKOB 1UJ3C 3PAUA 3D0VB 3D25B 4AM0Q 1MY7A 2HTKD 2IDSA 2CBTA 3GJEA 5DFTA 4XX5A 5SV4A 4U1HA 3CFCH 3VXRE 4JPKH 5DURD 3SKOB 5I1KL 1BJMA 3BUTA 4X0KB 1Q9OB 3H3BC 3HI6L 4MDJB 4IRZH 5C71A 2XTSA 1XR9A 3MLWH 2Z1PA 5IMLA 4W9HC 3N40P 1M2VB 5LCVA 3TEXA 3UTTE 1IBDA 2F19L 3QEHB 1BP3B 1AG0A 2FVNA 4GXUN 4HDIA 3GRWL 4OD3L 3GXNA 2WP3O 3NCYP 4WI8A 4WNQB 1YPZB 3FH5A 1MCWW 4PBWD 3VXRA 1GRWA 2VXVH 4KO7A 5BZWA 1F90H 3EH5B 3REVA 1MCOH 4HIXL 5IVZA 1ZPUA 2PETA 1U92B 3OAYH 2WKGA 5LUMA 4QRRB 2YBRA 3F12A 1OCWL 3T3PB 4QXUH 4NPKA 3FMGL 2PYEE 4G42B 4KUCF 2B1OA 2WIMA 3GMMB 1A8ZA 3E9UA 3W0WE 2WXFA 2QSCH 1Q0XH 5LNDA 2WWOA 4PIBA 5ISZA 2AQTA 1CDGA 3BQUB 2B5IC 4DP9X 4ECNA 3P2TA 4MA7H 5GSRB 4M6OH 1VFMA 1XB6A 4N0UA 4C8XA 1HE7A 1MCWM 5EZLA 2VXQH 4LQ1A 2A6KA 5JXED 3UJIH 4JDTH 4WK2B 1N26A 1G7LA 2PP8A 4IU2A 1T1YA 1N12A 2YKLH 2Q76B 1MIMH 4AMKH 5F8QC 4AZ8A 1WCBA 3VFGL 3ZY7A 1KPVA 2HFGH 3BWAB 1AQKH 4E2OA 5BUGA 3VXSB 4AVJA 2ZCLH 3OXRA 2DKSA 4KO9A 4GQRA 3CVHH 4LF3A 2OTUB 3K2IA 1INEL 5H8DA 1R3HA 1T6BX 3SDCA 1HQRA 2PCFB 1J0IA 2VXVL 3B2UD 3TBVB 3VRIA 5GRXG 1VFAB 4ZMAT 3OXSA 3GTNA 1T22A 3QORA 1CK0L 2X88A 5AVXB 5SWSE 3VRJB 4C4UA 2VISA 3FO9A 4A7VA 5C9JB 3TJEL 1RZIB 4QTFA 2EXYD 5IWLA 1WWBX 5L8JB 4FP8L 3RIFK 2WVVB 1SM3L 1SMAA 2YUZA 3LPOA 3P3UA 4MNQA 1QLRA 2C1PA 1YEJH 2UZXB 3QYNA 4RAVA 3MCYA 1NCBL 2GT9A 5KTEH 1AGDA 3FRPB 3RPKA 1XCTB 4JO8A 1MPAH 3BDBA 3DJRA 1OP5H 5E1HB 2DKMA 3FQ1A 1OT2A 4B95C 5HGBA 5DJ0A 4PG2A 3QAZC 4J3XA 4X8JA 3BH8A 4N8VG 3U6RB 1XBRA 3ZTEA 3JWOC 3DGGB 1CR9H 2VDNB 1I7TA 2D31B 5FYKH 1C1EH 1AGDB 1CT8A 2NY4D 2EEDA 3OKDA 2PW1B 3QDJD 3QPXL 4BFRA 1RHHB 1DLHB 5D8JL 4HC1H 3ZSSA 2IQ9L 1FSKC 3DBXA 4LLQA 1F1DA 2BNQE 3KM2A 5DZVA 2L7JA 2YJLA 1KJ2A 1F4HA 3VCLA 3WXWH 4UUJB 3RILA 2VISB 3ET9F 2X40A 5IW1A 3NCCB 4M02A 2WZPD 4DVRH 1IMHC 5E2UL 4HH9B 3D3VE 3HZYA 4YZFE 3EUDA 3GYRA 5CHNA 3QIUB 4LEXH 1IT9L 4G80B 5LO7A 4TSBL 3WEOA 4WTZA 3P2BA 1YQVL 5EO1B 1X4YA 4Y2OA 4OFYD 4FS0A 4KKQA 4G6JH 3NYKA 4Y5YB 3MRRB 4HQQH 4B96A 1H6TA 4P04A 5C70A 2OCJA 2W9DH 4DW2L 3C75A 4JM4H 4C56E 1S4IA 1J9CT 2VDPL 3BKYH 3OWRA 2GFBA 3FFDA 1JZGA 3MOAL 4UDTB 3QA3A 4LEEA 4PGDA 4YNYB 4A6YB 4YHYC 1GW6A 2PTUA 4C59B 1BZQK 1ZLUH 3SKMB 4XP4H 4GEJA 3V6ZA 3OWEA 2D7TL 1H6EA 4X4XB 1H5BC 5CJOL 3DO7A 5EN2A 4RAHA 3LZFH 1ZSHA 2ENSA 3CXFA 5DJXA 2BSRA 5C0RL 4GAGL 2Z4QA 3ARVA 4KMLB 4P49A 5D8JH 4BQ8A 4ETQA 3MRQB 3FTZA 5DA0B 5HHOB 3QJUB 5C3IA 3HPLA 4TUJA 1ES0B 2I26N 3A3YB 1T5XA 1JPSL 3GSUA 4XNXH 5I6MA 4GMSL 5EG6C 3LEYL 1XGRA 2WZ6A 2AJVL 4OR1A 2WD0A 4JQXA 4B9KC 4OUOA 5FUOH 4P9MH 1BWMA 2R0ZL 5IHUL 4QUOA 4Z18A 2K4WA 1YEIH 4AG4H 5HI4D 5C6TH 3MVSA 4WWKC 1U4FA 2VKXA 5HI3D 1J8HD 5JDSB 3EF4A 4P5RA 3UPCA 4Y9GA 1WPCA 3AXIA 5GSRA 3WMSA 4FD0A 1PPIA 4R96B 2QSVA 1Z5HA 2Y07H 3E7JA 1SXSA 5C08A 3V6OE 2E59A 4XVSL 1B88A 1HHKB 4PD4K 3LHAA 3ARGA 3GBNL 4OB5L 5I1DA 2DIAA 1K2DA 1S7TA 4N86A 4NJ9L 5E2TH 5IVXF 3UG4A 3C8DA 3T9WA 1A64A 4JDEA 4DKAA 4Q2ZA 1M4KA 4ICWA 4W93A 5IT2H 2DM3A 2G0LA 1E0OB 3F58H 1KBPA 3M8OL 4U3SB 1B4LA 4EXKA 4BFGA 1C08B 2AQPA 4PB0L 1A6ZA 4PUBH 1T2QH 4BK5C 4PP2B 4AQ8C 1R3IL 4JN2B 1OSPL 3ESVF 3G6JE 3VXMA 2GKIA 4JDZB 1EEYB 3QR1A 2MOQA 1PF3A 2JJWA 3OKYA 1X5HA 3GS0A 3L3OA 3QC5X 1KDIA 4L5FE 3RA7H 3LQAC 3RKPA 3QWNA 3AG3B 4LK4A 3DUUB 3PP3K 3WOVA 4PS4H 5C0BD 5TQ0L 1J87A 2ZJSH 3QO1B 1R1CA 2B59A 4KK5C 4P5KA 1FYTE 4ODXB 4QGTA 4WNJA 3D25A 2X4RA 5AAMC 3DX8A 3ULVC 5DEJA 3WEAA 3HUJF 1QSFA 2OL3B 2HG5A 4LEOB 5KYNA 5HHMB 1MFVA 4N1EA 5LCVH 1IRAY 4L1BA 5C0BE 1ZANH 4NRYB 1FYHB 4CN4A 1SBSL 3ETBJ 3KGRA 4FNLH 1WFUA 3EZJB 4FULA 1J5DA 3MLZH 4UOZA 1LDSA 3QDJA 4D3CH 5L6YH 2ITDA 2EE6A 4ZX6A 1T04A 5IY5B 2BCMA 1NKOA 2KMWA 1DANT 1XF2A 1NLBH 2HVKA 1CVSC 1E9OB 2LLGA 3EGDB 4XNDA 1OGPA 5E8DL 1DUYB 3DVGA 1X5MA 1RFDH 2X6MA 1EFQA 1Y18B 1I7UB 2JJSA 3KPQB 3UDWC 4M7LH 4DK5A 3FQNA 1GS6X 4R5TA 4F7KA 2ZP0T 3D9AH 3EGSA 5IROC 4YBQC 3QR2A 1O6TA 3ATFA 4HIPA 3FO1A 2O26U 2K6ZA 1X5ZA 4UINL 3I02B 1D5XB 2IF7A 5IJVB 1WA0X 2FIKB 2JQMA 3FQRB 1DEEA 1TVBA 3EFFB 2MOGA 1QFPA 2HFEB 5JHDA 4G72B 1UB5A 2V9UA 4L8DA 1BZ9B 1LQSR 1XF3B 4HUNB 4L3CA 4LP4A 5IJCC 2DF3A 2R2EB 4FFYL 4KXZH 2K45A 4WWKB 1HE8A 1RIVH 3C5JA 3VI3F 3N43B 2QKIA 1JFQH 2IG2H 1IQDA 3AS3A 3ML8A 4G8EA 4UTAH 3G04B 3KDMA 4LSPH 2VAAA 1XGYL 3X3FH 4FQJH 4N8CL 3DSFL 3E6FA 3D06A 3UO1H 2PYEB 2VAAB 4RMSA 4KMTL 5K9QI 3EGXA 2GJ6B 3NEOA 2XV2A 4JN2A 4OCRH 5H35A 4PTTB 2PYFB 2QPSA 1CIUA 2ZSVA 4LSVL 1D5ZA 3AU1A 4HJGA 1YYMH 4XXDA 4GRMB 4QTIL 1PNDA 3SGKC 3MRJB 1KLFB 1ZD6A 2DWSA 4L8DB 5K33A 1NEZG 3CDGB 3V0FA 2V3FA 5CN3A 5TFSL 4GAYA 3ARRA 4PM1A 1XF5A 3OKEB 2E5EA 4RSYA 5KSAC 3RX5A 1DO6A 2ZF9A 1G6VK 4WO4B 3RTQB 4HUXA 4WEBL 4KUZH 4ADIA 4WFFD 2J56A 4OZFB 4PJ9D 1ND0A 4FN0A 3EIFA 3W56A 1EMTH 1BHGA 4P0DA 2R83A 4PJHE 1MHPL 4H8WH 5FAAA 3S34H 4A38A 1HXKA 4UINH 1D5BB 3HBQA 1N67A 5ADPL 3MOBH 1CG9B 3UC2A 1OGTB 3KR3L 3SYAA 1NCAL 4MJJA 4E9RA 1RZ8B 3Q5YA 4HMCA 2BOCA 4MZRA 2ICWI 2J55A 2WXGA 4YSPA 1OAKH 3JWDC 2BP8A 3WD5H 3ARGD 3HMWL 3ZHKA 5KAQG 1SUHA 2VLRA 1BEXA 4H2AA 1D2OA 5JPNC 4Y16D 5SX5H 3PWUB 1SHWA 2B3RA 1KGXA 3LNGA 2B9AA 3CLFH 1DBML 3LY6A 3QI9D 4KTDH 1E5AA 4WUKL 4LEBA 1KT2B 2VYRE 1E8XA 5CBAB 1HCVA 4KHXL 3EGSB 3BRFA 4LLVB 3U0PB 3CD4A 1UB6B 3N40F 3H54A 3VFRA 1NBCA 4JY4A 4AUJA 2HPOA 3HBPA 4RLDA 4FL4C 5B3JF 3NJKA 4J6RL 2F74A 1ED3B 3D39D 2V9RA 2AK1H 1MRFL 3ALWA 1P4BL 1E27B 2DQFA 5I30H 1PDKA 2EIEA 1SVCP 1TYRA 4XC3H 5HDQL 2AHIA 5A43C 1AD0A 1A7NH 4HC1A 4LLMA 5SX4I 4BDVA 3TBBA 5EC2B 3PWPA 4OH2A 4UTCA 1AE6H 1OAJA 3QXAB 4TOYH 1KEGH 2EVHA 1KXTB 4YEFA 1O7SA 4R7VA 3RJQB 5KVEH 1BBDH 2P24A 2Q3XA 3FQ2A 3T0XA 3T2OA 3SCMA 3VGHA 1CLZH 3GJFB 3RPIB 2F1EA 3QQ3A 2XN9D 1PSKH 3PJSA 3EYOA 3B5TA 3LMJL 1KBGL 3PXJA 3ML9A 3QHTC 3DHMA 3QJXA 1YDPB 1EK3A 5FO8B 2X6UA 4GW4B 4UZSA 3FB7A 2JH2A 3I50L 1DSYA 2ZXDA 1T1ZA 1YJDC 4M93C 5C09B 5FKPB 4YDLC 2Z34A 3C6LD 3AWGA 4I13B 1I7ZA 2VNCA 3SDDA 5EU6D 1PS3A 1NMBH 1FRGL 3OGCA 1UM5H 5IMKA 4AGPA 8CGTA 5E5RB 4WSJA 2FYYB 4MAUL 5GRJL 3L7EA 3V6FB 4U6YA 5FGBC 3H9YA 1KGJA 2NNAB 3H9SA 1EZVX 3O0RL 4NQCD 5CKGA 1G9EA 1A3RH 1JDAA 2FBJH 4RGOL 1TDQA 2DKUA 3RDTB 1JAEA 3SKJH 2AK1L 3WIIL 2XWZA 1KC5L 4O00A 3IDNA 1DQML 3ASOB 3GHEH 3GSVB 3TBWA 4M7JH 3OZ9H 3MYJA 1KCRL 3IAPA 3JXAA 4Z6AT 4K3EH 5TE7L 1ZA3A 3P54A 4ZX4A 3MGOA 2X2YA 4A2HA 5GGTA 3A23A 2BHFA 3TPUA 3TV8A 1JHKL 3PAVA 5KVEL 3ZDYB 2V5RA 4RRPG 5KYYB 2OZ4H 1DJWA 1DQJB 2ROXA 4ZT1A 1D9KD 1ZK9A 1LDPL 3IK2A 4I4WA 4R6UA 1RK1B 5D1ZD 3BP6B 3F01A 3BEVB 5D5MF 4P2AA 1DSFH 2F5BH 3GTVA 4HSQA 5C0CA 4ZMWA 4AYDC 1U8LB 4I3RL 2IADB 1FQ9C 3VD4A 1C16A 1OQXA 5EO9A 5MERB 3GMRB 1G7IA 3PABB 3SDYH 2G3MA 2VDLB 4X4ZA 3AXHA 1O9WA 5F1NB 1F3DH 2XHNA 5CIPH 4NCDA 1HNYA 4AYGA 2PXYA 5JQ6L 4WW2B 4J39A 2EDHA 1W91A 5C09D 3LH9A 1WDAA 2B4CC 4UCFA 4RFEA 4HJJH 1T6WA 4TLKA 5AEAA 3TBTA 1H5BB 4RFNC 3DMMB 1UH2A 1I9RH 5I8OL 2CJ3A 4J8RB 1ROWA 3OF6A 4PW4A 1LQBC 1LO2H 4OF7A 3GS4A 4B53A 3CXHJ 1FA4A 1J0JA 4LQFL 1Q72L 1QI4A 3S3BB 3K1KC 2V5MA 3O6FA 1QYGH 4GLRH 4DGWC 5GISH 5LGYA 3BD3A 5L9DH 3DYPA 1JPGA 3NJMA 3P0GB 4LPUA 4XCEB 3MLXL 5DUBA 1VCAA 2J1KA 3FUEA 2Q3AA 3UMNA 5IQMA 1QI3A 5BV7L 1YJDL 2IBZX 1BFSA 12E8H 4OD1L 1F86A 1E8ZA 2XIDA 2OP4L 3BLKA 4QWWC 1ETA1 2ADFL 5DF0A 3R4RA 2GW5A 2R2HB 2OMTA 3B9AA 3IU3B 3ULUC 4LGSB 4IBSA 2PYED 4BFOA 4N0CC 3K2MC 3KGTA 5ACZB 3D39A 3FSVA 3HRZC 3IDJA 2M2DA 4KJYA 3MRPB 4HUUB 4QKTA 1HYRC 5I0WA 2NXYC 3RWHA 3X1BA 4P5MA 4E9YA 3TEYA 2LFEA 2YMTA 5H94A 4XNZB 1ZA3B 3HI6H 2BSEA 3I6LE 1LEIA 4YC2B 4PCTA 3L95B 3R06B 4X2UA 3TBSA 1G6RL 4XN7A 5D7LB 5DDHB 3SBWA 1DLFL 2ZYSA 3SDAC 5CMAA 4H5SB 5EULV 1NBVL 1TFHA 4LAJH 4KNSA 3HUJE 4PJEA 2FR4A 1ECZA 1CICD 5FK9A 4C4BA 1RZGB 2Y6SD 4HJIA 2OJ1A 1WBYB 4P05A 3ETTA 3ARGC 4GIPD 2GK2A 4I18C 3GPSA 1OSZB 4JPVH 2N0MA 1M1XB 4OLYL 5DLML 4HWEH 3LKPB 4NQED 4LE8A 1BX2A 3GLAA 4HEMA 1GC1L 3CHQA 3MRNA 1KPVB 3AY4A 2A9NH 2GIYA 4M7ZC 5D96B 4MAZA 1OT4A 2HAZA 3F62A 3WE6A 1W16A 3ILQD 4WW2C 4D9RE 4Z76B 2R2HA 4U7SA 4KKLD 3PHAA 1EXUB 1TJGL 3KYOB 5AOMA 3SQOH 3VFPA 2ADYA 4OD1H 3FOLA 4O2CA 5K39B 3RZWA 5SWQB 3FDWA 2X4PA 3VGDA 2ICES 1KXVA 2BHZA 1SDDA 1TQWA 1ZS8A 1B4RA 5ESQB 1FVDA 1CL7H 1JCKA 4BQCA 1QBAA 2NY5C 1QP1A 2WTPA 1E30A 3WFHB 4IYKA 1G7IB 3HMXH 3RNQB 3UBXI 1G94A 3ESPA 3QZLA 3S8FB 1L9RA 2FB4L 4BQBA 3K5RA 4MXWL 1NTDA 2W60B 1F02I 4UT6H 3UOAB 2ITEA 2FSDA 1DDHA 4U1GB 4PREB 4Y2LA 4Y9CA 4P59H 4DZBB 1P7KB 4AIOA 1OM9A 2HVBA 5CUSL 3V95A 2A73B 8FABA 4JW3A 3VRJA 1WP6A 3MRKA 1H5BA 5AZEL 8FABB 1VFAA 3S4SG 1G7LB 4BXVA 3WUWG 4F57H 4EUPB 5CAYB 1Q9KA 2G2PA 3O6MH 5KUMA 1XIWC 3AVEA 1O6SA 3STLB 1SOQA 1AZRA 4W6XB 3DBSA 4XMVA 5FGSA 1MW0A 4G6KL 4GSQA 1NIBA 1A1OB 1A5FH 2D4FA 4OQTL 2YAEA 3TXAA 4BZYA 5MERA 4JFUA 4MASA 3L16A 4FFZH 2ZKHL 1HS6A 5JXEC 4HWUA 4NGHL 1QWNA 3C6LC 4NO5B 3RUGE 1MFDH 2C3HA 5ITBH 1K3IA 3ESMA 4GUCA 4QAWA 5I8EA 2X0VA 4AV4A 3GJEB 5C0EB 2F54A 3T0EC 1ZK5A 3D0LB 3SN6N 4N0YH 4AYMC 2AKRA 5D1QA 5E5UB 5HHQA 2J5WA 4XBMA 4Y16C 1DTUA 1RJYA 2XQ0A 1Q9WB 2NYZA 2V2XA 3QZWB 5DFVC 3TJHC 2FATH 3CN0A 1JI2A 3GK8H 3RWIA 3FU9A 4JRXD 1BD2D 5I16A 3CC5A 1HEZA 1MJ8H 5B4MC 3V6BR 3D52A 2YLKA 3AREA 1MREL 2G2NA 4HC1L 1J0KA 5DDHA 1T89C 1YEGH 1U33A 2H0PA 2NSMA 4KZDH 1AGCA 1KCVL 3WNIA 4M1DL 3RRQA 4MMYA