1M42A

Solution structure of apocopc from pseudomonas syringae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein C
publication title Solution structure of CopC: a cupredoxin-like protein involved in copper homeostasis
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1m42A00
2UZXA 2WQWA 4AQ1A 2OMUA 2WQXA 1H6TA 1XEUA 2OMVA 2RA1A 2YA1A 4CC4C 3BC9A 1LYQA 4CILA 1OT4A 2C9RA 1O6SA 3FAWA 2UZYA 1NM4A 2OMXA 2WQVA 2OMYA 2OMWA 2C9QA 2OMZA 1O6VA 1O6TA 1M9SA 2C9PA 3BCDA 4CC4A 4AW4A 1H6UA 5ICUA 3BZ5A 1M42A 3FAXA 2Y5QA 3BCFA 2WQUA 1IX2A 2OMTA
chains in the Genus database with same CATH superfamily
2WTRA 2OMUA 4GT0A 3GBML 3GLDA 2LVCA 4NCDA 5I76A 5IOKA 1QA9A 3CDGB 1GGCL 4ONHA 4NWUH 3F8UB 2UV3A 5FYKH 2NY7L 1UZ6F 1BAFL 2DWXA 5L6YH 2GC7C 4X5RA 1A6AB 1EBPA 3IDGA 4LEXL 4PCYA 3WDHA 1A14L 3T4AB 4Q9BA 3MSPA 5BZWB 3NZUA 3UTQB 3VXUD 1RI8A 3CVHA 5BRZE 2VMDA 3MGOA 4X99A 5EBMB 1ZRUA 1CDBA 4FCAA 4AZUA 4K3EL 3TVMC 5HDOA 2ICWA 5IJKA 2FIKA 3MV7B 2CHZA 3NT0A 3I9IA 4PJEF 1J9CT 4LASL 4P9HL 4ZUUA 2O61B 1OB0A 4P2OD 3WEXB 5F9OH 3HHMA 4W68A 4N5EC 1TTAA 4FXKC 3TA3C 3D39B 3L3DB 3LS4L 3QEQE 4FFWC 5EUOA 4GKNA 1EFXD 2DJSA 3FQTA 4XGZB 2AKRB 5EO1A 4NQXB 3FQUB 5T8IA 2UVEA 4RGNE 1HXYA 3PRZA 1RD6A 1FLRH 3I2CH 2H6UA 3AUVA 2Z7ZA 2WLYA 1CE1L 2P5WA 3I6LD 5JXEA 3SDXA 5IQ7H 1A7NH 3LPPA 5E7BA 5HHOE 2JIXB 4TUJA 4DETA 2OULB 1SZNA 3EJRA 4HUUB 3BVNA 3ZYZA 2YPLB 2X70A 4S2SB 3PHSA 4ONGL 5D1QB 3QO0B 4UM9D 3OGCA 1FVDA 4O9HL 1OAKL 4IMKC 3RTQC 5KN5A 4Y16D 5B4MD 5FC9A 1NBVL 3CC5A 4G6ML 1XCTA 1UWXK 4Z7QB 2JKNA 2W88A 4OBSA 4OCXH 4XI5D 1QNZL 3JTSA 1GS7A 4N2DA 1HZLA 1RULL 3JZYA 4NHUA 3NIDB 4YVUA 5F88B 3FT1A 4ODXB 4AI7A 1BVKB 4E9QA 5JPNA 2WD0A 5AOKA 4M8UA 4UOW0 1VFMA 4XBPB 3Q48A 3KWUA 1B4JL 2F0CA 2FL5A 3GMLB 5D93B 4KX7A 1WF5A 4GSDL 3B2DC 2EIEA 4YHMH 2X4UA 3WXWL 3S6CA 1INEL 2YBGA 3ULSA 2J1ZA 3G6AB 2FEJA 2X3BA 1I85A 1SQ2N 2ZG1A 5K33A 2IXQA 3LSOA 1MJUH 4HCRL 1T7XA 2JJSA 4TNVK 1RZ8B 4ZZKA 4HIHB 1RUPH 4FJZA 1PLBA 3ALPA 3OPUA 1XIWC 3M1OA 4KXZH 4YGVA 3RU8L 3QDGE 1QFWL 2NNFA 1UWEL 4OCRL 4ZO8A 1FL5B 1UKQA 3TV8A 4ORZC 3WMSA 3H9SE 4PMEA 1TEGA 3CX2A 1MW0A 5JQIB 2Y07L 3ZTCC 1JOIA 1AO7D 1OF2A 4BM7A 5HXMA 4MYWB 1U3NA 2AV7A 3VYPA 1FZOA 1CL7L 1OM3H 4G43A 4MX7A 3D48R 1T6WA 4KI5E 2E59A 1DJWA 5DFAA 2OTUB 3AITA 4L0PB 4P2QE 4Z0XA 1BQHA 3BJLA 4MHHG 2NW3B 2ZAHA 3TT3H 2DQDH 4Y4FD 1VGKB 3MV01 1DZBA 1LDSA 4KDWA 5DMGC 5FCUL 5DA0B 1C5BL 5FYKD 4PPTA 4M7JH 1R0AL 1AQKL 1F11B 1QFWI 3QFGA 3VH8G 4WKZA 1RZQA 2UY7A 3TT1L 5I1DB 4NQDA 4PRPD 1GKOA 1I1FB 1U8JB 4EXPX 4OI8A 2E27H 1C16B 1G43A 1AHWC 2QVTA 1CFQA 4DKEH 3Q8EA 5F7NC 3RX7A 3ZE2F 1L9NA 4EDWH 4NQVA 2Q87A 4TF4A 4JM2D 5DD5L 1CL7I 1MKFA 2HFFA 2IVFC 2WKLA 1PZ5A 3MLWH 2JCCB 3JT2A 2A5UA 4PEEA 3B1TA 3ARPA 5C0CE 1OTTC 4OV5A 2WXKA 3DX6A 3TH3T 3WAKA 4OM1H 5JA9A 3GXIA 2RHEA 4R3SB 3SIKA 5TE7H 4YSAA 2EADA 5CCKL 3EO9H 4APXA 2C1OA 2F5AL 3QI9D 3PDDA 3N40F 1LNUA 2XQ0A 3JV6A 3T6WA 3G6DL 4LP8A 4CC4A 1Q94B 1JCVA 2Y06H 3NYKA 4QNPF 2QQNL 5D5MB 4TYUA 1NCUA 2Z64C 4F93B 3JV0A 5AAMC 4K7FB 3UGUA 4FNSA 5HY9A 5B38A 4A38A 4EDXB 5AQ0A 1D7FA 2XYCA 2YGOA 3IPFA 3EGSA 4KK8C 2P46B 4MNGE 4XN2A 5J1TC 5L2KD 2B0SL 5HHMD 1AJ7L 4NN6C 1DJGA 4K07A 5I23A 4HZ1A 4V1DD 1NMAL 5D96B 4PLKC 5KVFE 1EXGA 5GS1B 3KR3L 1A8JH 1R75A 4LIQL 5CF3A 4WWKD 4QRPD 4BCXA 4UNVA 3GXTA 2CGRL 1ZSDA 2DQCL 3I84A 5IFJB 3MGAA 2DWEA 2LLLA 3WYRA 2G0KA 1RIHH 2YKLH 3P30L 3KPSE 5FB8B 4AMKH 4HDIB 2X87A 4EI6A 2CGZA 3T0VA 2ZCLH 2ZPKH 2EDBA 3CN1A 2ZXEB 2XKNB 1AMYA 2D31B 2ZE0A 1U8PA 4PYGA 4TTDD 4Z8FH 2VLRE 4HLZG 1ZDSA 1U41A 2ZOLA 2V7NA 3T3PF 5C7XH 3EFDL 3C5JB 4K3HA 1FYTE 4XVJL 1K4DA 4OZHE 2EIZA 3TJHC 5F1IB 2V2TB 1MJ7L 3HA0A 4U1MA 1HSAB 4GRLC 3MYJA 4LQFL 1NUDA 3RZCC 4ZFOL 1EJOL 4R7XA 4K5LA 1YPZF 2P8MB 3U7WL 4U1KA 3HNSL 5AW8B 2FO4B 4LDCA 4W9GC 5I73C 2YMXL 3IJ7A 3WIAA 3FOMB 1ONQA 4OIAA 3SPVB 5I0ZA 5FDWB 3VI3F 1A2YA 2XDHA 4Y2OB 3BH9A 4PY8J 1YMMB 3HOGA 2X1XR 1JFQL 4HZAA 4DW2H 1NGZA 4K7PY 2HTKC 2CM6A 3BVTA 1R46A 4Q6IC 2IAMA 3BZEB 3FUJA 1X5HA 2NX5B 4PY8I 3BPOB 1EIBA 1O5PA 1ITCA 3NTCH 3E1ZA 2BO0A 4HGWB 3NSFA 2J1WA 1KLFA 5A6IA 2K6ZA 3GFUA 4FNLH 4PLNC 1M3JA 2HJFB 1HHGB 4DN4H 1DQDL 4LP5A 3ESVF 2XI9A 2YAEA 3CDZB 4BUQA 4Y19D 3QR1A 4HJUA 4P5SA 3C6LB 4Y2LA 4NWTH 5EZOH 5HBBA 3BAIA 2CKBL 2DBJA 4GQRA 1PLGH 2ICEB 4M7ZB 3APDA 2G2NA 5FGRA 4YWGL 3LEVL 5ITFB 1SHMA 3QG7L 4KZEL 4DZ8A 1NAKL 4ELME 2BSTB 1VAHA 2X89A 3KW7A 4GNKB 3H7LA 4OSUH 2FJHB 2AXJA 4PJIF 3LRLA 3IMTA 2CCLA 3PGDB 4HETA 3V6FB 4J1UB 3MCYA 3RWCA 1TQTA 2ZT9C 1KDJA 1QKZH 4JO2H 1NUNB 4NEHB 3FYEB 3IN2A 5FO8B 3LH9A 5HDWA 5IK3A 2I07A 1ZHBB 4LCWA 1KPRB 5CJXC 4N2FA 1DQLH 4A2DA 4OIBA 3RUGB 2VXQL 4QD2E 2ZWZA 3T0EE 1Q9WA 4PUBL 2KH2B 4HS6A 4PRAB 5GRWA 2J20A 2R15A 2R69L 3NZSA 3BPCB 3L3GB 5E8DH 1IT9H 2ZWNA 4ODBD 3UJTH 3OF6D 4X0NA 1MCJA 3UDWA 3W2DL 5LQBL 1LQBC 4LT7A 5F7EL 2BP8B 1ID5I 5T1KB 3ETTA 3H6AA 1B6DA 1UQSB 2NY5H 3UTTA 2AJVH 3AACA 4IRSD 2I27N 2WWOA 3ES6B 4RSYA 3UBXA 1JGUL 4N0UB 2P7TB 3ZUCA 4AEFA 3KXFE 3ILQC 1SHWA 2CBOA 3RIAK 1I7RA 3RWIA 4IU2B 1FVEB 4XX1E 1F2XK 4PI0A 3V4LA 1GMEA 4U49A 5IBUB 2J6EA 4Z3FA 1TVBB 5KSBE 5DA4A 5DMIH 1RY7B 2WWKT 4PCSA 5I16A 2XA8L 4NO0B 1YYMH 3RIKA 3S35L 3K72A 2CD0A 3U4BH 2R0LL 2K45A 3G5WA 3KPQA 4C4BA 2BIHA 3GPSA 4JZJB 1OW0A 1UG9A 1U8IB 2FATH 3SO5A 4NGHH 4ENED 4K9EH 3EGXB 1JDAA 4YDLC 3V79C 2BNQB 4PJ5A 5EWIL 2Y2WA 3VGGA 2O6FA 2G5BA 5L2JA 2GTZA 3BUBA 1YY8B 1UHVA 5J6SA 1L7TL 3NIGB 5AOIA 2V9QA 1T1WB 1DUZA 4HJTA 4LSUH 3QEQD 3VG0L 4EE2A 4EVNB 2ZXCA 3HMXL 2Y3AA 1KXTA 2CRIA 2CKNA 1WFTA 1CB4A 4RGND 1J5IA 1JTOA 1ETA1 4L1LA 4MB4A 4MQXC 2WWKO 4MMXB 12E8L 4KX9A 3DXAB 3RVUC 3WNPA 2YC1B 3S88H 3LNFA 5D6DA 2QPUA 4KHTL 1TJHH 4BFIA 5ERWA 1IGIH 1KJ3L 2DL2A 1RVFL 5JW5A 1OT1A 1UM4H 5AVVB 3BPNC 3ARRA 3ZDZB 2HKFL 4G6KH 3UO8B 4APQA 5AW1B 2Q8AL 4Y1SA 2H0EA 1IM9A 3BIAX 1E8YA 1PAMA 2J12B 4N2EA 2UYLB 3FFDB 4Y4KD 1X5FA 3M86A 4RFEA 4GXVH 3DDFA 1LP9A 3ZHFA 3BWAB 3QORD 4L8SA 3ULUF 1E4WH 2N7AA 3G5XB 4PU2A 4A6YB 4U3SB 2E3VA 1MW3A 1I3UA 2QQLH 4NQUA 4AM0B 5KTEH 1N59A 3EJPA 1J88A 3HAEB 4M02A 3UYPB 2EIDA 1TJGH 2O4EA 3GHEL 5KJRH 1YJDC 3OPZH 2WBJA 3N85H 3D4CA 4ZPVB 3PAUA 4BCZA 3RI5F 3S3PA 3NJHA 2XQYK 3QPXH 5AFAA 5HPMB 1H5BB 1TQWA 2PYEE 3LKNB 4IGBD 5JXAL 4HUWB 2JV6A 3HB3B 2QELA 3KM2A 3QDGD 4Q9RL 3UBHA 5ESVB 3UG3A 4JPVH 5DUBB 3ESMA 3LNHA 1RJYB 3H9SD 3SBRA 3KPLB 1BZDA 5D6CB 1D3CA 3HS9A 2BHFA 4RMRA 5D8JL 3FB5A 4HUCA 1E9PB 5EMYA 1N64L 3IN0A 5I1HH 4WV1C 4N4YB 4AV5A 5D7LB 4AZ8A 3QPQD 1EHAA 1T20B 5ILTL 2AC0A 4KI5D 3NP4A 4LCIH 2Y6SD 3IDMA 3MU3A 4AYFB 1P7QB 4BH8A 3GI9H 3T0WA 3GMMB 2MQCA 1HWGB 2XC8A 5I6LA 4P2QD 3AS0A 2DKMA 3VRLE 3ZY7A 4C83A 4QYOB 3LXAA 2R1WB 4YZWA 5KEZA 4XP9H 1OGPA 3PAYA 4AM0Q 1HOEA 1XSIA 3BP6A 4Y5YA 1JDDA 5CFAA 3KEDA 5J1AA 2XXGA 1I8MB 4ZSOE 1C5DA 4ES8A 1WA1X 2PO6C 3U30B 3EDFA 2BLFA 4ZW8A 2MPAL 4B9JA 3MREB 1EUTA 4ILDA 4JHUA 5HYJA 1PLAA 4GXUN 2WXPA 3RWFB 2RQEA 2XY2A 3K6SA 3M45A 4RLDA 2ENYA 4QRRA 3LHAA 4QXTA 3B2VH 2ZP9A 5FHBL 1L5GB 4JRLA 2JB6B 1MH5B 4NLHA 1FL3B 3HUJB 1DP0A 1H3GA 5E4EC 1DE4A 4X7SH 5AAWA 2YD1A 1F1DA 2A9NH 3CJJA 3S3BB 5C0CD 4GBXB 4YBQC 3CH1A 1XSKA 3VSUA 2ICWJ 1AR1C 1QSFE 1T4KA 1MJJB 2QKIC 5CBEB 1I75A 5C71A 4LBEB 2IFGA 1D5RA 2W60B 2G9HB 2ICWI 4KBPA 1ZHKB 1ILUA 2ID5A 2YGQA 3ZKXC 1NBZB 4GI9A 3LHPL 1LK3H 3ZSSA 1J86A 2ORBL 3SJVA 2PR4L 3IJSB 1FNGB 4ZFOB 3CFCL 4MJ6B 4ZK8A 4YZFF 1CQKA 1WFUA 3P1VA 1Q9OA 1QBML 3WJLA 5ID0A 4ZJ9A 5C09B 1NCCH 3BPLB 4GKZB 4PVNA 4S1RL 5DGQA 1TEYA 3QDMB 1M4KA 2B1HL 2XVLA 4IJ3C 4K71C 1N3NB 3O3BA 4U1LB 1RUQH 2FSEB 5DJDA 1H6FA 1NOLA 1TETL 3VYOA 4A7SA 1XF4B 4NLAA 3FQWA 3O8XD 3L3HA 2ADFH 4OKDA 3VWKD 1B0RA 4M5ZH 2DLFL 1MFBL 1YNLL 2FO8A 4PV9B 4HLJA 1MLCA 5K9OA 2P44B 5CD3A 4Y1AD 4PRHB 3OSKA 3ECBB 5ECJE 1RUKL 4HK3N 3KPRE 4YHPB 1QBLH 1P69B 2X7LB 2AV1A 1KCVL 3BP7A 4G7SB 3BYTA 4YDVB 3TH4T 3A24A 3PL6C 4AUUA 1CI5A 2JE8A 2XWBA 3OKMB 3JVFC 4TUOB 5B39B 3U46A 3LKPA 5DS2A 1PIFA 3VWJB 3PAZA 1B4TA 3H7BA 5IEKB 4AKQA 1F8TH 1S7RA 2ENQA 4UILH 3SCMB 3C87A 2NY3D 2XNAB 3F12B 4E9XA 1I8KA 1ZT7B 4BSVA 2AK4E 2YXVA 3GSXB 2FWUA 1Y0LA 3NACL 2NQCA 4U31A 3SGJA 4MCZA 3FB8A 2E74C 2AZUA 1SJEA 1LXMA 4EZLA 1JNLH 1FZKA 2VZVA 5L8JB 3TPUB 4LPCA 1KBGH 3HLAB 1IL1A 1HZKA 4N2HA 3QJFA 3JT0A 4K5OA 2ZXQA 4NPYA 3P11H 3T71A 1FC2D 1ZV9A 4N2OA 3H3PH 3SDYL 4IMLB 4I1PA 2Z3FA 3Q2NA 4QXVA 1TT6A 4JO3L 4JK0D 2BSED 4UF7C 2H1LM 1FF5A 4IBTA 4H5SB 1AQ8A 2HUEA 4I3GA 4DPCX 2KZ1B 4I2XA 2A6IA 4UQAA 3VRIB 5E2TH 1MHCB 4NC2B 1LGVA 3GMNA 1NDMA 2FQFA 1AGEB 3BN9C 5SWQA 1RZPA 2B5IB 4FA6A 1YECH 1K8DB 5FAAA 4XO4A 3CWGA 5TF1L 2A9ML 3HS0A 4RDQG 1YAZA 3QHFH 3JWDL 4PJHF 1F6AA 4YDNA 2ZUUA 3ZDXB 3OHMB 4HPYL 3OXRB 1BFTA 5LGHL 3NJMA 4PRNB 3T0ED 1QLRB 4LVHC 2G2RA 4OFQA 4BFKA 1OY3B 3D5OF 1OSZB 2DYSB 5E8PA 1IX2A 1IB5A 4Q9QL 1A6ZB 2N01B 5IBTH 1BX2A 4JCWA 5DU7A 1WD8A 4ICWA 2YOAA 1TZ8A 4ZTOH 5C07E 3HHSA 4JM2F 4F1SA 2UXGA 4QF1B 1KTJA 3U6XA 1ZGLA 3AXIA 1VACB 2XU9A 4XR8C 3NQKA 2P5EE 1P6FA 2C3HA 1N6QL 5GRJL 3VQ1C 5CD5D 3LB6D 1UXSA 4UM9A 4QLWA 3RX5A 4YBHA 2YMTA 2B7DT 4DQOL 4P46C 3B3IB 3PV7A 4I9WE 5DJ8B 3DROA 3FF7A 3OLGA 3T2NH 5EDSA 3D06A 2OYLA 2NCMA 4MJ5A 4M7KL 4X4KA 2GVYA 4F7CA 1CFSB 3AVEA 3K6OA 4XMUA 3K91A 3NCWA 2V2XB 4PJBF 4PJAF 1KLGA 3DK0A 1EANA 2VR9A 5E0QA 2GITA 3L1GA 2X6CA 2H0JA 2X2UA 2EKSB 1I7UB 4P9MH 3HVNA 4TXVB 3RJQB 4FQJL 4CW1A 5I8KL 3GQFA 3S5LB 1Z9PA 5IOPB 4MKTA 3HNVL 4HZLA 5IHZA 3BAWA 1JZHA 1IGJA 3VJ6B 3QEGL 2EO7A 1ZTXH 3QJHA 5ITBL 1BMGA 1LEKA 3MAWA 3WTTA 1BOYA 1AD0A 3DURB 3S98A 2ZKHH 4W93A 5FYJE 3S37H 4AIXA 4OLYL 1WT5C 1NLDL 2WSKA 4DP7X 4XCEB 1PD6A 2VSDA 3PWJB 3MTXA 3ZL2A 1ZHLA 4JRYE 1XR8B 4LDLB 3PHOB 1AI1H 1GAFL 1NSNL 2HLFC 2PW1A 1EZUA 3VI4B 3DMMC 1ZWIA 2UWEE 1SF3A 3IGAB 1YUKB 2BOBB 1F4XH 3IT8D 4LSRH 2RAMA 2R56H 1AO7A 4K23L 1VKXA 3MNZB 5EZPA 3QIBB 1P1ZA 1QPKA 2HYMA 1TZIB 1YN6B 3LH2H 3LKQA 4YK4C 5F0PB 3TO4D 4OFDA 3RA7H 3BC9A 2IWKA 1AGFA 2D9QB 2EE0A 3CN0A 3K71B 1UOWA 5E6IC 1EMTH 4U1JA 5KS9B 2XWZA 4HEME 5T5FL 1Z5LB 1NGWB 1WS7A 4YFDB 1YC8A 3GUTB 2KBGA 4KNUA 1BECA 4HBCL 3IXAA 4QKXB 1UB5A 3NRFA 2KERA 1BP3B 4JEGB 5FM5M 2QADB 3IDYC 5TE6H 3HI6H 2JNZA 4PVBA 3OB8A 4DP1X 4UT7L 1IILE 2WZAA 3KHQA 3PY9A 3LVTA 4A55A 1MCHA 2WTRB 2OMUB 5I0WA 4PRPA 1JWUA 1NINA 3BLPX 1HS6A 3T4AC 2HX7A 5I76B 4HFUL 1QA9B 4PJDA 2AERT 2LLNA 2XZCH 4PLJC 1II4E 4ZUWA 4ONHB 4XVUD 3S35X 5EIIA 5DRNA 3KW8A 4JHWH 4ODVH 4RISL 1C08A 5A2IH 1X5ZA 2W65A 4YHOH 3IDGB 4J39A 1DJZA 3OKYA 5ADPL 2CK0H 4M1GL 1YEKL 1R3KA 1GJWA 3RKDD 3CVHB 3UXFA 3MGOB 1T6BX 4J3VA 4R97B 4DHLA 2VM3A 5B21A 4I3SL 4X99B 3IFOA 1PG7H 2N1KA 1NFDF 5BRPA 2ICWB 2FIKB 4XN8A 5C2UB 1GA2A 1TTFA 5ISZA 3RBGA 3QI9A 4LFHG 4ZUUB 4AGLA 5CO1A 4EOWH 2ATKA 4Z23A 2C9UA 5EUOB 4GKNB 1PTZA 3FQTB 2X4PA 5PCYA 1X4ZA 1XGRA 5EO1B 2IMMA 5AW2B 1HXYB 1WZ1H 1XGPA 3NAAL 4FQ1L 3O0LA 3RB7A 3FSVA 4MAZA 2VR6A 2P5WB 4QGYA 4F5CE 4Z7VF 3SDXB 3DPDA 2QSCL 4KGLA 1ED3A 3PXLA 4V1DA 2J6EL 3THML 2BVYA 4TUJB 2D0HA 5GZOC 3N9GH 4R84A 3BVNB 1AH1A 4RZCA 1SVBA 5BJTA 4WWKA 2X70B 1UACL 4B9YA 3OGCB 1FVDB 5DFVD 4EKXA 4DKTA 2Z93A 3CC5B 4I48A 4JY5L 2GJ6E 2DW5A 3RVVD 2CBTA 3JTSB 3JWOC 1BFVL 5I6XB 1T0PB 3TFKC 3QULA 4KH2A 4XNMA 2ADGA 5JPNB 2YUVA 4JQIA 4XAKD 3SN6N 1KB5H 1ZAGA 4LK4A 4WUUE 1X4XA 4TPRL 4N2AA 1KCBA 2FL5B 2BVOA 2OXGA 2X9YA 1CVSC 1MXGA 3D18A 4L5FH 3LN4A 4WI6A 1W6LA 2DYRB 3ARFD 4FXGC 2X4UB 4P2CG 4ACPA 1CLVA 3PHQA 1VEOA 1DBBH 2NXYD 4FQ2L 3ULSB 2ED9A 3H1ZA 1A7BA 2IOIA 3I50L 4JFPA 5CR8A 3UAEA 4JN1L 4K94H 3LV3A 5E8NA 2FZ3A 5D71L 2IXQB 4Z7WA 1H3UA 1V3JA 4JKPL 2VRAA 2NY2B 5F0LB 3CUPA 4WI4A 3DJTA 3BD3A 3VXRE 3H0TA 4D7PA 3MRIA 4QCIA 3ASWA 3NZ8A 4ONFH 2P48B 2KLSA 4YGVB 3ZZSA 4X8GA 4W4NA 3D8MA 1FNSH 3EUDA 5GHWH 1QSZA 1AXTL 2IPUK 2LT9A 3AMKA 3ZRSA 4Q6YA 5BCAA 1SYVA 2O26U 3MFFA 3QARA 5F1KC 3V0EA 1A7QH 1RZIA 3S3DB 4UQ9A 1DCEA 1OF2B 3D2UD 1S7VA 3CSTA 1ZLVK 3TGXA 4GKLA 4Y19A 5LJYH 1MPAH 3GKWL 2AV7B 4OZFH 1FZOB 4JHAH 4MA8H 4G6FD 4G43B 1NKGA 4MX7B 2VAAA 1RSYA 4Z0XB 1BQHB 3SKNA 5GGVY 1FPTL 5IT2L 1T5WB 2X10A 1WWWX 4AUJA 1DJXA 2QHRL 4HKXA 4XH2A 5JA8B 1N5YH 4F9LA 4XVSH 4GG8A 1NL0L 4ZD3L 1ML0A 1D5ZA 4NP4L 4WKZB 1AC6A 4HHWA 2UY7B 2VLLA 3DVNA 3OAUH 1EPFA 4JS7A 4NQDB 4OZGE 5GGSY 2W91A 5HD8C 3CU1A 4EQ2A 1CFQB 4NO2A 1JGVL 2BC4A 2J55A 2Z0BA 1AIFA 4NQVB 2Y5TA 2AK4D 2B3IA 4XPHH 4ZRGA 4YDKH 2HFFB 2GB2A 4JFWA 3K6DA 4OJAA 4RWYL 1PZ5B 4DN3H 2XN0A 5DHEA 4RZKA 1HNGA 4OFVA 5DR5H 3LZOA 4PTTA 4UNUA 1NFIA 5J12B 3AS1A 2J3SA 4DAGH 3GIZH 2BY3A 4OV5B 2EINB 5L0QC 4CC1A 1KF9B 1CFTA 4APXB 2C1OB 3OJMB 4LHUG 4RNRA 4OCYL 1LNUB 2E56A 1GYVA 5I8EA 4GRMA 5ACLA 2J88L 1OTUD 4R7LA 3LNGA 4MTMA 4X83A 3SQOH 1BZOA 3SOBL 2AEIT 3CNKA 2WQWA 1CICC 1YEDA 5HY9B 5B38B 5D96C 2VQTA 1NC4A 3EGSB 4PD4K 3G5YA 4EN3C 1KC5H 3QUXA 4XO9A 2N4IA 3CSGA 4BYHA 4KI5F 2JI2A 3SPJA 3C08L 3FT4A 1I8IA 3K8LA 2NYYD 2BCMA 3OM3B 2HX9A 1KULA 4FYRA 4IIQA 4O58H 3U6RA 2CCVA 1E5CA 3QJSB 1ZSDB 3FMGH 4WW2A 2DWEB 2PP9A 2QVIA 3BEWA 3QE5A 3AW5A 3QEQA 2EE9A 4KKLC 3REWA 1FFPA 3DSFL 4EI6B 4HAFA 4K3JH 2F9BT 2VERN 1HCVA 2VXUL 1JG9A 3B2UD 1U8PB 4ODTH 5IMOA 3MR9A 2MNJB 3H4HA 2ZOLB 3UTOA 5AB0A 2V7NB 1E28A 2ARJA 1C5CH 3LRGA 5CHNA 1K4DB 4B5EA 3TWYA 3DKHA 2EIZB 3VGHA 2E7LC 3WFEH 4U1MB 2BJML 1W6WA 3MYJB 3CZUB 1M1SA 1N6UA 2P5ED 1OARL 2OMTA 2OK0L 3MA9L 3I74A 4X5WA 3RG1C 1R9FA 3LMJH 1ONQB 4M5YL 1F3DH 3HN3A 4NUPA 2ED8A 1DJYA 1A2YB 1HKLL 3BH9B 3R06A 4YSRA 3MLSH 3PWPA 4TUKL 3CHOA 3Q3GA 3RY4A 1Q0EA 4JO1H 4KQ3H 1VZIA 3CVIH 4BQ6A 3QCVH 1FNAA 1S7XB 2IAMB 4HUXA 4WFGE 1VPOH 3FZUC 2H2SD 1ZV5A 2XPZA 4PWGA 4DOHB 1L0QA 4U4IA 1HDMA 3TJEH 1ZCRA 1BLIA 4U7KA 3QORA 3S7GA 1IC5H 4M7LH 2AF2A 3E0GA 4OF8A 1KLFB 2R0WH 3QWRA 4TRPL 5FM5O 1DQTA 2OMVA 1NMCB 3T3MB 3AROA 5I15H 3OC8A 1OB1A 3BKYH 2VCOA 3ZQWA 3HE6A 3Q6GH 1ZD6A 3FONA 3S2AA 4NHCH 3V6ZA 1XB3A 2YEVB 1BVLA 4KROB 5DTFA 4DZ8B 4ELDA 5A40E 1P7BA 1Z66A 2Q76A 5FYJD 4AQ8A 4ADJA 1U3YA 4FLSA 3WJJC 3BSGA 4BKLA 3RWCB 4JKWA 5JW4R 1KWKA 2GI0A 1INDL 4HU2A 1VERA 4HH8A 1OP3H 2OW6A 2W9EH 4LLVA 5D2NC 5IK3B 3WOVA 4CN4A 2PWFA 2I07B 4LCWB 4XTRC 1A3ZA 4A7GF 4OZHF 1MRDL 2XYBA 1Q9WB 3P4NA 4IIZA 4HS6B 4OLXH 4JG0H 1TU2A 4P9HC 2DLEA 4JCLA 5J1SC 5CEYA 1XH1A 5IFAH 1T03L 3U82B 3APCA 1KENL 5AZUA 3RNQA 2VLKA 4D0BA 5T1JA 3O9WD 1FG9C 1QLEH 4FFYL 3NCMA 2BHZA 4AYDC 2WLMA 3VCLA 1X5IA 2APWA 3UTTB 3GPEA 1EAPA 3UAJC 1FSKC 3UBXB 3ESUF 4U0QB 2EDWA 4F9PA 1SXCA 2HG5A 4FFZL 1W0VA 4J8QA 2WQ8A 1I7RB 2WUCH 2WXMA 4N3UA 3RWIB 5HI3C 4L05A 3T65A 5IJVA 4BRVA 1UENA 3CBKB 1IM3D 4F57L 1F6FB 4NFDA 3UZVA 3QZBA 4GMTH 4A66A 1XF2A 5I16B 1PKQE 2HFGL 1DJHA 3K72B 5DO8A 5FLUA 3KPQB 2G30A 3LQAH 3UL4A 5MP6H 2XWJA 1CK0H 4I0PC 2DQ6A 4PJ5B 4OCWL 5AVXB 3HZVA 4FQPA 4ELMF 4PB0H 3ZKNC 2G5BB 5L2JB 1OTSC 2GTZB 3UMNA 4CSSA 1G6RL 4X9GA 2J7LA 1DUZB 3DJRA 4XPAH 4IRJC 3US1A 1DL7L 4K5PA 1KXTB 1HESA 4JRXA 4QHMA 2VSKB 1HOCA 3LZFL 5BS0A 2BIPA 15C8L 2YAOA 5LKNA 3GHPA 3LNDA 2DM7A 3WIHL 3EYOA 3D05A 3T2QA 1KSRA 3D25A 5I0DA 5HHQA 4FFTA 4QOKE 3QQXA 4WEBH 4BFIB 2X6VA 5D70H 4Y5XA 5AYUH 3DX2A 4KOCA 1CO1A 1IV8A 1N0LA 5CJOH 5JW5B 3LS5L 3VWKA 1IGTB 5HVFB 1JSYA 5JW4M 1GGUA 1D9KD 1E8WA 2EJ1A 3J8F7 4IBVA 4APQB 4Y1AA 2JKJA 2VR4A 3BGAA 1QMUA 4AYID 5KVMC 3P0VH 1IM9B 1DR9A 2EABA 5IFHL 4JG1H 2MQ3A 4CU8A 1XXFC 1TSRA 1MZZA 2DWDA 1WDAA 4JQVC 4MXQC 4P57A 2NYKA 4ABVA 3BAEH 4RFEB 2WXIA 1ACCA 2JELL 5SV4A 5LAPA 2H6PA 4NAMA 1VCAA 4ANUA 4ANXA 1LP9B 1GGYA 1UVQA 5EU4A 5KSBF 4L8SB 1IGFL 5BZXA 4RFNC 3V95A 2BS8A 3ABLB 4AIOA 4XXWC 5T3ZH 1IC1A 1N59B 1HQRA 5H37H 4A2FA 5IP4A 1H5BC 1P4LA 1U95B 1T83A 5L88H 5EC1A 1FWXA 1PNDA 1YNKL 3BIBX 4GAJL 1ZLWK 3G5VA 2TSBA 2F8IA 4N2KA 2WBJB 4WCYH 2E0PA 2VM9A 5F96L 3ZE1E 3UEQA 2K1MA 4XAWH 5BOZG 2OSXA 5HGAA 4KWUA 2EH8H 2GK0A 3VXRD 5LXGL 1U8CA 4H8UA 2GFBA 4X6BA 3UTSB 2AXWA 1KACB 2DY2A 3ETBF 4DFHA 4J3BA 1M7UA 3CZFA 5HYEA 2QSQA 5FYKL 3P3YA 3B2XA 5L6YL 4JQXA 5TTRA 2X4TA 4DEWA 1J10A 3P2TA 5GISL 2EVJA 3FB5B 1I1RA 3E1F1 4FI7A 4KTDH 5KZCB 4GLRH 4AZ8B 4AQAA 3D50A 4NS0A 3MV7E 4M9OA 2YRLA 1CXEA 3IDMB 4BH8B 4IK6A 2ADYA 3MGTA 3MOBH 3PABA 5IQMA 4C83B 3WHE1 3DGCR 3Q1SL 2CDEA 2IOOA 3OZ9H 5EEXA 2FHFA 1AG0A 3BP6B 4Y5YB 2WXGA 2JJWA 4TM9A 5J1AB 1C5DB 2VDPL 2HMIC 4LKXA 1G1YA 2GIYA 3QP3A 3B5GA 1MCEA 4NX0A 5T1LD 5HYJB 1H6TA 5EH1A 2VW6A 2ZXDA 3HBQA 4XN7A 5CEZH 4K3DH 4R2GB 1MCIA 3KWVA 3K6SB 4J3WA 5SV3A 4QRRB 4GBXC 4Z18A 4XO8A 4YSOA 2YZ1A 2YPLE 4QXTB 1A7NL 1FI8C 3FUEA 3IJEA 5D1QE 5E23A 3CHPA 1DE4B 3U2JA 1ADQL 1WVZA 4Z7QE 2WXHA 3CH1B 5LDSA 4CL7A 1Q4NX 2WHVA 4H0IA 1KYOJ 3NIDE 1NC2D 4G5AA 2DAVA 1DHKA 3GZPA 3MBXH 1I9EA 1T4KB 5FUCE 3CN4A 5MI0C 2BHYA 4OCXL 5DVKA 3SE4A 4U33A 5TD4A 1J1OL 1L3WA 1R19A 2VN3A 3OXSA 2JI1A 5AKTA 4Z0BH 3SJVB 3BPLC 2VXVH 3CXHK 3IETA 4IOFC 4DUVA 3TO2B 4U1GB 4AX3A 2IBGA 3DX7A 2CRZA 2WNXA 4HT1H 1T1YA 5CN2A 2E7DA 4M1DL 3SE6A 4DKAA 4YHML 3EHBC 4XZ4A 1OALA 1Q9OB 3IMWA 5GRUH 5ID0B 1G0YR 4JQIL 3VW3L 4P4KC 2VAJA 3CFKA 5GZNC 3SB3A 4F8QA 3FQXA 5CINH 3O3BB 5G4NA 5DJDB 3GMPA 4M61A 4P2YA 2XV3A 4RAUA 1HXKA 4WK0B 2WXOA 2X4QA 1JNHA 3BX7C 3I6KA 1A0QL 1NM4A 3L3HB 5IB2A 1FC1A 5T5NG 1B0RB 4S1SH 3JSSA 4I18A 1S4IA 3T77A 5K9OB 1MLCB 1L6XA 1PJWA 2AJYH 5CD3B 1AVAA 1RUPL 1OP9A 4X5PA 3AB0B 5KUMA 5T3ZD 2R0ZH 3GLAA 3RY6A 4FQXA 2AV1B 3KG5A 5GS3A 5CLWA 4PHXA 1XTMA 2P1YA 5DEJA 2XWBB 3F7RA 4YFEA 3U46B 5K9QI 5ANMA 4KVNH 4LSQH 3H7BB 4Z7UA 2Q2LA 5C6PB 1S7RB 2WGNB 3TN0D 1CI3M 4Y9GA 1WK0A 1OM3L 5J7CC 3ULVE 3FQ1A 1CDYA 2X9ZA 1ULVA 4EBQH 1A3LH 3K3QA 4ODSH 4BSVB 3JUZA 1H3WM 4KFZC 3MA7A 1Y0LB 2AQRA 4Y2DC 3TT3L 5I8OH 5EOTA 4D9LL 3QQNA 3MBED 1SJEB 2AAVA 3PAVA 5KANI 4LDEB 3CLFH 4J4PC 1H6EA 1FZKB 4M7JL 4KK5D 3ARGD 1J1PH 3TZVD 4UIMA 5E5UB 4WU5B 1IL1B 3QJFB 2Z1PA 3DX9A 4NPYB 3ULAB 4I13B 4PVMA 2ZTBA 4X8JA 1NOFA 4M7LT 2E27L 3MJ8A 3E6HA 2KZWA 1GC1L 4QTIL 2X2JA 1LDPH 1E6OH 1GRWA 2JCCE 4YGAB 3TP4A 4EDWL 4NI6A 1NCAH 1RURL 4G7QB 2C5DC 4R90H 3MLWL 3RPKA 1I9IL 4I2XB 5HVWA 2A6IB 4HWNA 2E8YA 1TITA 5JUEH 1X6NA 1UH2A 1XZWA 4ZX4A 1HAWA 3AABA 2B9AA 2ZUSA 1NDMB 3O2WH 1F3RB 2DV6A 1MCQA 5SWQB 4U6TA 2KQMA 2XLLA 5D5ME 3MV8D 5TE7L 3U1PA 3BAXA 3EO9L 1JGDA 1JE6A 5INDA 3HS0B 4FS0A 1F6AB 2H6OA 2Y06L 3CVBA 2LU3A 3L5XL 1AZUA 2OZ4H 3UP6A 5F1NB 1F42A 4KK9C 4I1NB 4DQAA 4BGDA 4LHUD 2ZKMX 1T1XA 4JHZA 2YAQA 2CR3A 2ZSVA 3KM1A 3DO7B 1E5YA 1U3HC 3BZDA 4N68A 3D9AL 5E8PB 2WANA 3ARBA 4WZ9A 3PUCA 2BCKA 3QWOA 2CMRL 3SODB 1BX2B 5FEBA 3D6GA 4UT9H 4D7BA 2NLJA 2XA3A 1UXMA 4BV1A 3HHSB 4JR9H 1BMZA 2J1YA 1MCBA 5AW5B 1IFGA 4OGXL 1ZGLB 3HRZC 1MIEH 2ZAIA 5IBUG 2F18A 3BIKA 3BDYH 3DVIA 4XWOD 3LNEA 2NDFA 1HSBA 4HJSA 2DIAA 4OTXL 2YKLL 1KN2H 1UXSB 4PWIA 4NJ9H 4U1SA 4UM9B 4IKKA 3K2MC 4AKOA 4JY4A 1KGXA 2AJUH 3DROB 1BBJA 1Z3RA 4Z8FL 4KTYA 3IWUA 1CDJA 4BHUA 2A4ZA 4MJ5B 1FG2A 1K2DA 5C7XL 2EKJA 4F7CB 3HKFA 4OLZH 3ULUE 1U3ZA 4HU8A 4P06A 3PGCA 3R7RA 1MG2C 2GW5A 1UTDA 2FX9H 4WDIA 4PTUA 1KLGB 2QGEA 3N1MC 2GITB 2UXVA 5JR1L 3ZX1A 3TYGL 5I28A 2HTLD 3SO3B 2HFEA 3V2AR 3ARFA 2CG9X 3FDWA 1QG3A 4QXUH 1YMME 4MS8C 5TFSH 5BUGA 3S4SA 4MA3A 4CW1B 4GH7B 4NRXA 5AL8A 4HZLB 5IHZB 3Q2WA 1ZLDA 1T7WA 1IGJB 2NX5E 4UV4H 3QQ9D 4PG9A 3QJHB 4DW2L 4LLMA 2M83A 4WVRA 5AW6B 1AD0B 2VKXA 3ABKB 1IGCH 4X98A 1T2XA 1GXEA 5FW7A 1E2VA 2EVHA 3QJVB 3UJIL 1S9YA 3SYQA 2XTJB 4WI8A 5IB3A 2VZOA 3AREC 4PJCA 5BO1H 3ARDC 4MQTB 1TFHA 1ZHLB 4XNXH 3NDZE 5TF0A 5DD0H 1YQVL 2BOLA 1HHKA 2DM4A 4FG2A 2PW1B 4FNLL 4PJXB 4KH9A 3QDHA 1ZWIB 2WP3O 3DVGA 2HJLA 4FFVD 4DN4L 5C0ND 5AZEL 4QOKD 1TQUA 1VKXB 1AO7B 4NWTL 3D2UA 3A67L 3S2CA 5EBWA 1P1ZB 4MNHA 2WVTA 3F5WA 3LKQB 4JMXA 3FULA 1NGQL 4L4TD 5J3HC 1AGFB 1ZOXA 4OI7A 1Z3GH 4F33A 1E4XH 4U1JB 4OSUL 3GLZA 2CH8A 2XOTA 2NNCA 1QKZL 4XPFH 1GGBH 3IXAB 3RUGE 1UB5B 3HAEG 4ZAKD 4JFQA 3RE0A 3P40A 4MBOA 1N9PA 1MN4A 5DO2D 2VZ1A 3O6FC 3QNFA 2LW3A 1U8QA 1DQLL 4V2BA 4TVPH 5FUZL 1F58H 2ITCA 4F27A 2OSWA 1EJFA 3F2LA 4PRPB 4RBPH 5AALA 1JWUB 3K5SA 2FJFA 4L8DA 4WFFE 3EUUA 4X7TA 3KL0A 4PJDB 4ZUWB 3WAJA 3RWDA 3UZEC 5AUMA 4R97C 5EIIB 5DRNB 3UJTL 3LPWA 1IT9L 3B43A 4PJ7A 2RJMA 1C08B 4KVPA 3Q8CA 2A73A 2W65B 4HEPA 5M95B 3BAJA 1UD4A 1TQCB 2CO4A 4UI2A 1K6QH 4J8RA 1R3KB 4K8RH 3TONA 2LQRA 2F58H 3V52H 4ZW3A 2NY5L 3IU3A 4MVBD 3CSPA 2G3MA 4M6NL 4ZTEA 2LV4A 4CDHA 2XWCA 3QG6A 3DUSA 5ISZB 2DQUH 3FJTA 3QI9B 3RGVC 3RY5A 4JFVA 2ATKB 3MLXH 4ZPTA 3E2HB 4RGOH 1C1EH 4PB9H 1HHHA 4CUCA 2W0KA 5K69A 2X4PB 4ANVA 2YRBA 1XGRB 3MFGB 3ML8A 1PX4A 1DO6A 4OLUL 5JHDE 4DKFL 5DMIL 1XGPB 3W9DA 1GZHA 4ZNEE 3MV7D 3U4BL 1ED3B 2MEJB 3NIGE 3RLSA 4FA8A 4V1DB 3S3CB 3O3AA 3RP1A 3GDBA 4PREA 2W5PA 2DMKA 3Q7JA 4WNJA 1H0DA 2FX8L 5GS2D 1KTRL 4Y5VA 4RZCB 2MOVA 5BJTB 4WWKB 4LSUL 4RETB 4CN1A 3IDIA 2A74B 5JPNC 4M4RA 1UWXH 3PCYA 4P5TC 2V5TA 1KB5A 4B9FA 2Z93B 4I48B 3T6ZA 1CS6A 4RDQF 1OD7A 1JGEA 3DXAE 5IWLA 3VB8A 5B3SB 2Q3ZA 1AZVA 3KPPA 2EZ0C 3QULB 1NIDA 5DT1H 4XCNA 2ADGB 1GCFA 2G60H 4YUEH 2YPLD 1A1MA 4QI3A 4F7EA 1BYOA 5D1QD 1I85C 4AL8H 5KYWA 4JRFA 2OXGB 4X6BB 1FFNA 2BVOB 1ZE3H 3D18B 4KTEL 3LN4B 4A39A 4WHCA 5DLML 4YXLL 3EO0A 3ZDZE 3NZHH 3PHQB 4UMGA 1UM4L 4JFPB 2NRDA 1QFOA 3ISYA 4S1DD 5B22A 5A7EA 5MENA 3LV3B 1G7LA 3OR6A 5E8NB 5KVFL 3WELA 4HJEA 2CJSA 2FZ3B 4NKOA 1VFOA 4G6KL 4KDTA 4BUGA 25C8L 4Z7WB 3WU1A 3C2AL 4POZC 1S5HA 1JZFA 2NUTB 3CUPB 5EBLA 4LEBA 4G83A 4KKBD 2O5YH 2XZAH 3H0TB 2GJZA 3HC2A 4QCIB 2NSXA 4GXVL 4OLVH 3AT9A 3NZ8B 5I6MA 5KYNA 3WS3B 4UQIM 4OZFA 2MHAA 1EGJH 2XQYG 4IKIA 2JKIS 2DM3A 4NZRH 4HOZA 2RB8A 2QQLL 5KTEL 1SYVB 1ZVSA 3MFFB 1HFUA 1X5XA 1RZIB 2IQ9H 3CE1A 1QX1A 1A5FH 4K73A 4QRQB 3RIFK 3RVXC 1MFMA 1FO0H 3A6CH 3VQMA 3ULUH 1NCTA 1S7VB 3V0JA 5IHUH 4Y19B 4O5LH 4UUJA 1T2JA 5KJRL 3OPZL 5B39G 2YKKA 1MHHA 4DO4A 1UASA 2VAAB 4MDIB 3GSRA 4XMXA 3QPXL 4H8WH 2HT3C 1CXKA 3SKNB 1J9TA 2ENSA 2KPWA 4XMVA 3RFRA 4HKXB 4XH2B 1YEIL 5I5JA 1THAA 3DIFA 4GG8B 4ZXBA 1NMBH 1X6LA 2FEDC 5D7LE 5C0RH 2PLTA 1CGVA 1D5ZB 5IIEA 3IKKA 5LWYH 4F8LA 3DVNB 4GEIA 4YSPA 1EZVX 2WJ5A 3HZ3A 5I1HL 3K81A 1MAKA 3JWDC 1BMWA 5J12C 4DGVL 2JKXA 3ZHKA 3ULVD 4G8EA 4NO2B 2BC4B 4LCIL 5KOMC 4BZYA 2X88A 1AIFB 3GI9L 5GRZA 3VFWA 2Y5TB 1QI3A 3BD4A 2HPOA 4DPRA 5HDRA 4EI5C 3D33A 4OT1H 2J8OA 3IAQA 4PTTB 4XP9L 1NFIB 2KMWA 1KELH 1OCZB 1KGYE 3MJ7A 1A8ZA 4YDMA 1QZNA 1I7TA 3NJGA 4HLZH 4AC2A 4AT6A 1S3RA 1CFTB 1MCPL 2BK8A 1M2OA 4RNRB 4TQ8A 3TJPA 5I8EB 3LJ3A 4EZKA 4AVJA 1RV6X 3P73A 1KB9K 4P59L 4MHHI 3ERXA 3HUJE 2P3YA 3NJJA 4M1CD 2ZX6A 4FTVA 1U4FA 4ZQKA 3VFOA 2R0KH 1HCFX 3B2VL 4YDZA 1YEDB 4AQ1A 4LCYA 1IM3A 3FO1A 1DVFA 1O0VA 3GXUB 1E4JA 1NC4B 4WJKB 5DS8B 3G5YB 1MY5A 4QRSA 2A9NL 3V0DA 4OIFA 3QUXB 2AEQH 1WBYA 3EXJA 3LQMA 3I75A 3BQUC 2XWXA 3FT4B 4FNUA 1I8IB 4FEIA 4YE0A 1SLWA 3U6RB 2OJZH 1QTPA 1KXVA 3TYFA 1F4AA 4LZKA 1EV2E 5DJYA 3DNKA 2HVJA 3J27A 5D1XA 4WW2B 3GSVA 4J6RH 1HINH 2WQUA 3BEWB 4NKMB 2LTQB 5FF6A 4JDTL 3QEQB 3REWB 1FFPB 2FJSA 4MCNA 4GKSA 1YO4A 5C09E 3CLEL 5I30H 3OX8A 4OZGF 1RSFA 3QDME 5IMOB 3FT3A 1RJLA 3L6FA 2Y1VA 3MR9B 2H26A 3H8NA 2HVKA 1PX8A 1E28B 4XBEL 4F5CA 4GUOA 1NCCL 5CHNB 3GJFK 3VD2A 4XNAA 4W81A 1F45A 3VX1A 1E90A 2OV0A 4N0CC 1PYWA 4NAQA 2B77A 4NBYB 1CDGA 4PRHE 3V6OE 5SX5H 3VG9B 2ADFL 2OMTB 3V4VH 4EJ1C 4UCFA 4YSTA 1KZQA 1AHKA 1GL4B 2DIJA 4X5WB 1SJHA 2UZIH 4YQXH 2DQIL 3LZQA 4N90E 5FKAA 5MHSD 6FABH 1AHMA 4XVTH 3B37A 4G6AD 3QFJE 1SF5A 4NUGL 3CFNA 3SBPA 1QBLL 3R06B 2KLTA 2GCYA 3S0PA 3GMQA 3PWPB 5AOJA 4I88A 2BNUA 3Q3GB 2BP3A 3ULUD 4WNSA 3S5LG 4Y4KB 2CO1A 3ECUA 4HUXB 4N0YL 3IDXL 1IZKA 1NUFA 1HDMB 4YSCA 2IH3A 1YEGH 2GI7A 4HXBH 5GGRA 4BIKA 4UILL 3QORB 4G7RB 5J4MA 3QUYA 1ECYA 4ZO9A 2XTLA 3QAZB 4CGUB 1YMMD 2OMVB 1UATA 3KBPA 4AYBA 5IJDC 1OB1B 5MEQA 3IRZA 1G7HA 1MSPA 2ZKWA 2NW2A 4GSQA 2APVA 2NY1C 2NX5D 5D1ZC 4AEEA 3V6ZB 1BVLB 3KYOA 3LEXA 4YE4L 2DM2A 4OGYL 2Q76B 3BUYA 1SDDA 3CSBA 4DTGH 4P8QA 3ETBJ 3P11L 5IW1A 4BKLB 3H3PL 3TBTA 2IIJA 5KVDH 1OAJA 1UZGA 3IMVA 2EUXA 3ENEA 1OCCB 4KDVA 3C6LD 1MAML 4BUHA 2Z92A 4FL4C 3TEZA 4LLVB 4XNZC 4WSGA 1RK0A 4PJFE 1QRND 2C9RA 1H9DA 4TVUA 1NJ9A 3SHSA 2ENJA 3P4NB 5JNYA 3HLKA 1TU2B 3T0AA 5E2TL 4KITB 1ZXQA 3WUWA 1XBRA 2L7EA 4U2ZA 2YK1H 5CEYB 3T0BA 4HWBL 4V11A 4PP1D 4EIUA 3ZDXE 4KJQC 4D0BB 3RNQB 2VLKB 1FORH 5CGYC 3QHFL 3VCLB 3G9AB 1ZA3A 3C5ZA 2JK5A 2W80C 4K5MA 2KL6A 3QQ3A 3MRCA 5BOJA 4TQIA 4PJ9A 5DVLA 3U7YH 4M9PA 3O41A 4A68A 3B8SA 2HG5B 2VJ8A 4G80A 1W0VB 5DJ2A 5G4MA 4Y8DC 3KCPA 2IV9A 2P80D 4WFFD 5ES4B 2WYHA 3T65B 4LOEA 3US9A 2KDGA 3MRRA 3OJDA 5T1KD 2W81C 5SWZD 2WZPD 5DZPA 3UZVB 1F56A 5I6PA 1H6UA 1IIIA 1XF2B 4YHZH 1F3JA 3UJJH 1GH7A 5JPMB 4GQ9L 5I74C 2JTDA 2MNWA 3II1A 2XWJB 2XV2A 3MRFA 3GRGA 3HZVB 3ZKSD 4UOZA 3ZHLA 2FQGA 4N8PA 5JIKA 4JVWA 1ZIBA 1XD1A 3T2NL 1WIOA 3W9EA 4NO0D 4AJ0A 4JRXB 4KUZH 3AUWB 2NUPA 4QHMB 4ZFGL 5JHDD 3ELQA 1HOCB 5F7UA 2A9DA 2ZJSH 1A6VL 4P23D 1A3RL 1GYUA 5GGQL 2PTUA 1DBKH 3W0WD 1AXSA 1MFDL 1Y1DA 2C7FA 4QUOA 4R4ND 3ARUA 3L4CA 3EYOB 3QIWC 3D25B 4P9ML 2QQKH 5HHQB 2Z6FA 3TF4A 1SVZA 4XP6L 3ZHNA 2IANA 1A7RH 4LPWA 3L1OH 4WSJA 4Y5XB 3SKMA 1N0LB 3WN5C 5DWUL 2VLJA 1P7KA 2NMSA 3O8XB 4NZJA 3VWKB 5HI5D 4HIXH 5E2VH 2ZKHL 3O3DA 5C2BL 1PW3A 5ALCH 4FQCH 3FN9A 2VXTL 4G8IA 3VI4E 4AH2A 3DXAD 1ASPA 4Y1AB 4H88H 2FLMA 2ICES 3MXVL 3N43F 1IFRA 3UBGA 1Q72H 5BZZA 2LHAA 1EAJA 1XT5A 1DFBL 3MLUL 5H37A 2DWDB 4P57B 5AB2A 2DF3A 4LSRL 1F4XL 3RDTC 4BHUI 1TF4A 2H6PB 3MROA 5CMAA 4YXHH 4PN6A 4WTQA 4BH7A 2R56L 5LUMA 1UVQB 5EU4B 3E3QE 5JIIA 2ODIA 4MB5A 2WIMA 3LH2L 3UZQA 2HRGA 2QHLA 2JTYA 3TN0A 4TL4A 3RA7L 5IEHA 1HQRB 2NY3B 3B9KA 4WTZG 1P4LB 3IFLL 1J1XH 1EMTL 2J56A 3AQXA 4HF5H 5DHVH 3MNVA 5EC1B 3G5VB 4XHQA 2DKSA 4U4BA 3CZKA 1P4IH 1VJSA 3GZQA 3POCA 3TVMD 2APSA 4GS7B 4JFYA 4MS6A 1HYSC 4KRLB 5EZJA 4JFZL 2GK0B 5TE6L 3HI6L 1KDIA 2ALWA 1U8CB 2WLZA 2GFBB 1E30A 4KUCD 4FFWD 4LVNB 4WFHE 5F6HJ 4R26H 4TQEH 2K70A 4L9DA 1BQHG 2KHAA 5A2LH 4AQOA 4IRZH 4MJ4A 4W9EC 2XZCL 4NC1E 1NLBH 4KY1H 1KG0A 4JHWL 3L3OA 5DVOA 4I3RH 2X4TB 5F6HI 4MRCA 3C8DA 4GAYA 4E5XA 1ORQA 1XXDC 2V37A 4HA1A 4AQAB 2QV4A 2YPKA 1AG6A 5JTWA 5EZLA 4Y9BA 3FU6A 2EC8A 2W38A 3MGTB 3A4DA 4AC4A 3PABB 4EPSA 1PG7L 2B08A 3BKMH 3PS6A 4XXCA 5EUOE 1OP5K 3MV8A 3BRDA 3WEAA 2G3NA 3SBWA 1MCWM 4OJEH 4UNTA 3RTQD 1J05A 1DVZA 1OP4A 4A2EA 4OJCA 3PREA 2BIIA 3P9WB 8PAZA 2EE6A 4GYBA 3EH5B 4LKXB 5DYFA 1BOGA 4A2HA 5I18H 35C8H 3B3BA 2P5WE 1P7QD 4NJAL 3SDXE 5A2KH 2XQBH 4FERA 3FU3A 2EIKB 3T0EB 3GINA 2A6KA 4AGOA 1JHTA 4NENA 3WTVA 5IZ7A 3IJEB 3ABZA 1CTOA 4XP1H 1ODAA 4HMEA 4E9RA 1Z9OA 1CF8H 4PBWD 1BQKA 2IADA 5B38G 4JDZA 3ZE1F 2F68X 1SYSA 3O2DL 1SHXA 3GBNH 4R8WL 1BLNA 2MTPA 5EC2A 1CCZA 3LVEA 3VXTA 4XOCA 1ACZA 2BVTA 1NFDA 3E8UL 3TBWA 4GG6A 2RQ8A 5CJQH 3JQOB 2VUKA 2WW8A 3A22A 4U0RB 2IWGA 3OXSB 1G1OA 5ALBH 1KB5L 1MEXH 4OZIA 2OSLA 3IETB 4XBMA 5A2AA 1CGXA 3DX7B 3CFMA 2J8UF 5ABAA 1JZ8A 1T1YB 2HT4C 1HH6A 2XPGA 3V8OA 3QNZA 4PAZA 5HHNA 2XPYA 3PFUA 5KBNC 5C08D 2P42B 2DD8H 4B7LA 3CFKB 3FQXB 5DK0A 1IKNA 1R5WA 4M61B 4RAUB 5FYLH 4M6MH 2X4QB 4H25A 3I6KB 3UTPE 5IB2B 3W38A 3EJZC 3STLB 3FOLA 4I18B 3GWJA 4YSDA 3T77B 1UOVA 1DSWA 2HVBA 3UYRL 1WTLA 4NZFA 5C09D 4ONFL 4YO0A 5E8EA 3WFBH 5E6UB 5D2LA 4MD4A 1RFDH 4F7KA 4NERA 3QDMD 4FQXB 1ZDQA 1FNSL 5GHWL 4Y7OC 4EEEA 4ZFQA 1CGUA 1N0XH 2AVGA 3QS2A 3C6SA 4QWWC 1XL4A 3QHZH 1ZGLP 1EHLH 4MDJA 5ANMB 4Z7UB 2COVD 1YYLH 3FTWA 4MA8L 1KIPB 4U2YA 3GMOB 3F00A 1CQYA 1CIDA 4GAAA 3MUGA 3AM8C 4YHLH 4L4TA 3FB6A 3MA7B 3NIDF 4N90D 3NG5A 3KLHC 4UTCA 3QCUH 5EOTB 2WXLA 4ZZFA 4EAEA 2WNGA 3GXPA 3QFJD 3SDDC 3K5RA 2GC4C 1DO5A 5INCA 3VWJD 1U42A 1N5YL 5DD3H 1SLUA 1U21A 1U58A 4UIMB 4HJ0D 5E4OA 3SCMD 1QFPA 3K8MA 3TBSA 2DYPD 2FB4H 3DX9B 5HDLA 5FYJL 1V3MA 4MXWH 3VFMA 3CVDA 3RJOA 4X8JB 3O2VH 2OM5A 4BINA 3CU7A 3MJ8B 3E6HB 2A7BA 1PZUB 3ME0A 5I9QB 1CBVH 3MLTA 3C60A 4YDKL 3OKDA 4Z95H 4KNTA 4AG4H 3JUYA 4I9XA 5DR5L 1NIFA 5J5EA 2DJMA 3GK8H 1A64A 1K3IA 1DJSA 2PKDA 4DAGL 3GIZL 2OZ4A 4P2OC 2B3RA 4DP8X 3KS0H 1IMHC 2AJXH 4IBSA 4F15B 1OV8A 1T21B 3RDJA 1JGDB 5INDB 3QCTH 1LYQA 2WO3B 4XP4L 3WHXA 4TNWF 2L0DA 4X80H 1CC3A 5JIMA 4ELKA 4DP9X 2CXKA 3FTUA 3S5YA 1N4XH 2ETWA 3SQOL 4UT9A 2UY6A 4ABWA 3MLYH 1T1XB 1IEAA 1G7PB 2ZSVB 4WF7A 5I1EH 4DF9A 3DX1A 2Y4SA 1UD6A 3FUFA 1SPDA 2YJQA 3ARBB 4TLTA 1KC5L 2BCKB 3QWOB 4K2UL 4NUQA 3VXOA 4PS7A 5DD1H 1NDTA 3GSUA 2H4EA 3AJ7A 3ARXA 5IG7A 2NLJB 3Q0HA 5CFHA 3VMNA 2QFPA 1HZHH 4Y16C 5B4MC 2C9XA 5FR3A 4XT1C 3BIKB 4XI5C 1HSBB 5IREA 4F7MA 3L16A 3HKZA 2VOTA 3B34A 4U1SB 3OLEA 4ZSOB 5CNHA 1YLBB 4LLYA 2F1EA 3VFTA 2K7PA 3EH3B 4MD0A 4JY4B 5ANHA 1JPTH 1BBJB 2HTKD 3AZUA 4ODTL 2DMHA 4ABQA 1FG2B 1AY1H 3SO3C 2J21A 1K2DB 2Y23A 2JCCF 4NN7C 1C5CL 1NH6A 1XGZA 2G4GA 4NXSA 3PGCB 4LCCA 5ACZA 4WDIB 2GTWA 4PTUB 3WFEL 5FYLD 1TTUA 43C9A 2GYSA 4DZBA 2X6UA 4F2EA 2HFEB 4R5VA 3ARFB 2C4XA 1GW6A 1PZ3A 4NDMB 3QYNA 4G7VL 2BZ7A 5D5MF 4G5ZL 1B88A 4MA3B 3S4SB 4KZ0A 1MFAH 1I53A 2Y22A 4NRXB 2VC2L 1BREA 3M1CA 3FUMA 4DOHE 4PG9B 3MLSL 2C4FU 2XG5A 5D9SA 4LLMB 2FRGP 1CF1A 4X98B 5I1GH 4KQ3L 3PJNA 1HN1A 3QCVL 3BRGC 3MRPA 1VPOL 1S9YB 4UAOC 1YJDH 4EKJA 5IB3B 1C8QA 4DEPC 3GRWH 4UBDC 3T3ME 5FV1L 5G55A 4PJCB 4H2AA 5HJBA 1UXLA 4WWPA 2ZKYA 4XC3H 1IC5L 4M7LL 4KTGA 1HHKB 5CCHE 4I4WA 3WG7B 3VFNA 3DVGB 2R4SH 4H0LC 2HJLB 2WV3A 5I15L 5JIQA 5CZVL 3BKYL 1B2WH 2FR4A 2YUXA 5DUMH 3D2UB 4R96A 4MXVF 5EBWB 4MNHB 4TNVF 1MFEH 3F5WB 3Q6GL 4Y4FC 4ESKA 5LB1A 2QR0A 3QZWA 1NCOA 4NHCL 4HKJA 5KYXA 4RVBA 4QRAA 4F33B 1TNMA 3WFHA 3VGAB 1B3IA 2VABA 1OSEA 3R19A 3ALXA 2HLAA 3IYLW 4JPWH 4LCWE 1PZBA 2CBMA 5F0MB 3MRLA 1WV7T 1MJ8H 3DI3B 4L9LC 4JFQB 5T5NF 1OAXL 4YAQA 5C0EA 2QKSA 3FB7B 2W9EL 5E9DA 1GGIL 1Q0YL 3HPJA 1YA5A 5J8OA 4WUKH 3NQIA 1U8QB 3D34A 2BHUA 4JM2C 4B0MM 2WWMD 5IJBC 2ITCB 1FHGA 4OLXL 4JG0L 1FN4A 1TQCC 2J71A 2FJFB 4L8DB 4X7TB 3V55A 1TZHA 2EUVA 3RWDB 5AUMB 4E9SA 1RZGB 5IFAL 3ZMNA 1CWVA 4PJ7B 5A43C 1CPUA 2VDLH 1BG9A 2A73B 4P5RA 1R3IH 2QADD 3ZE0B 1QLEL 2CJUL 4WHDA 3MBWA 3CFDA 4NPJA 1YEHL 1CLZH 2YRPA 4J8RB 2D7QA 4J3OG 4FYSA 4O2FA 3E2HC 3OL2A 4BFOA 1GTNA 2JB5H 1FDLH 1LILA 2R7EA 3QG6B 5T3XH 2YO3A 4P3CH 1Z2KA 2AVFA 1WA0X 5IVXA 1FFOA 4WFHD 2WUCL 4ZPTB 2I24N 1YAIA 1BQSA 2D4FA 2DOCA 3NJFA 1A4JA 1HHHB 2PXYA 4AJVA 2WO2B 3W1ZA 1U2HA 3VXPA 4GMTL 4JFXA 3KDPB 5MERA 3TBYA 1VLXA 3W9DB 2E46A 4YS4A 3BJ91 2VDRH 3EYQC 3WFDH 3GXMA 4PIRF 1WFJA 2A74C 5MP6L 2WXQA 3QIUC 4WFEE 5E03A 3NJNA 3HZYA 3O3AB 1PKOA 2NY0C 4HKZB 4PB0L 4PREB 2R8SL 1I1AC 4HJJL 5DRWB 1H0DB 2XIBA 3BWUC 4Y5VB 4KXCA 3BI9X 1IBGH 3IAPA 3RUGF 4TTDC 5E4AA 3IDIB 4G7YL 4WGWB 4M4RB 4D0CA 3QZPA 3RI5K 1DQIA 1KB5B 1KEGL 1IEBA 3WKML 2WKGA 4FQLH 2V4LA 3E7JA 1JGEB 2PUQT 4PGDA 2WIIA 1JK9A 1FIGL 1V10A 1UM5H 1ZEAL 2QPSA 4GIOA 4XCNB 3OR7A 4UYPA 2ZX5A 4UQCA 4B9ZA 1A1MB 3CXDL 1Z9LA 1UT9A 1IC4H 2J5LC 4F7EB 2VXSH 5KYWB 3B5TA 4N0FA 3WNMA 4TOYH 4P5KA 1FFNB 3JWNE 3VH8A 5D70L 1KGUA 2NSQA 1LWHA 3ET9F 3WTWA 5CJOL 3GMRA 1E5ZA 3EO0B 5CLYA 3SEPA 2X53A 2FWOA 4LVOB 3KWTA 3ZL4L 5MENB 1G7LB 3OR6B 4F2FA 4NKOB 1RJZA 2F15A 2AQPA 4NZ8A 3MZGB 4WHTA 1EGJA 2DIEA 2WXFA 1S5HB 3P0VL 2BMKA 2IH1A 3DYMA 5EBLB 3RGHA 5DJ6A 1I1CA 4Q58C 2GJZB 3CFIC 2EDDA 3BAEL 1G9EA 1FO0A 3ARQA 3EH2A 5TQ2H 2C7UA 3AU0A 5GS0D 3WKYA 4OZFB 2VUOA 2MHAB 4LLWA 2OL3L 5T3ZL 1EH9A 2MKLC 5BVJA 4PBXA 3P0YH 1P6AB 5F8RC 1ZVSB 1DDHA 1ZLVH 1E8ZA 1JRHL 2NY2D 4N2GA 5PAZA 1O6VA 5B1JC 1ZK9A 5KWYC 1PG7X 2BZCA 5DMJB 2A9CA 2YEZA 2OMBA 4UUJB 7TAAA 3E6FA 1RHHA 4P48A 3VU2A 1MHHB 1RUML 4GQPH 3UTPD 4DP4X 2W9LA 4XAWL 1GC1C 3GSRB 3S3JA 2NR6A 1N8ZA 2EH8L 1AZBA 3BZ4A 4C59B 1JZ3A 2XV0A 1G7QA 1W72H 5KVEH 4PSPA 3EOTH 3RGBA 4NNPH 3DIFB 1TZAA 3SGDH 2WB1A 4ZXBB 1QQDA 2R29H 5IIEB 3RFZC 4DVRH 4CU7A 5ICZA 2EDEA 1QRNA 3BSHA 1HH9A 1K72A 1JRHI 1T0OA 2E7HA 2A0LD 4G8EB 4N2IA 5IW6A 3VFWB 2OTWA 1QFUH 2F74A 4H1LH 1J11A 1E2WA 3MOBL 4GQQA 5I0YA 1RZ7H 1K8IA 1P9MA 4GAGL 4IRSC 3O9WB 2CPUA 2WGXA 1U8OA 3FS9A 3WTYA 3MJ7B 4XHJD 1OP3K 5HYJE 3TIDA 1I7TB 2BXYA 4ES9A 3K1KC 4AT6B 2PCXA 2YQ2A 3CDCA 4L8BA 1JD7A 4QRRE 5AYQA 1YEFH 3H3BC 4NOBA 2WOBA 1JJUA 4LGRB 1ES0A 3MJ9H 1P7HL 5F9WC 4RQQA 2X6BA 2P80A 2ZOOA 3VFOB 1PG7W 4FTVB 3GLEA 2QQQA 4ZQKB 2KUTA 1BDYA 2BVQA 5FWQA 5EU3A 1BAWA 3TBVA 3FHEA 5SWZA 1DN0A 1IM3B 3D08A 3FO1B 1P5UA 4ENEC 1DVFB 3ZL1A 4B53A 3VGDA 1WIUA 4QRSB 1TQBC 5CGTA 3ZKMC 1OWWA 1WBYB 1WCQA 1BXUA 5DMYA 2D2CC 2DN7A 3I75B 2LTQC 3KE0A 3T2PA 5B3JF 1WUZA 2ZXAA 2JKWA 3RIAF 5EEUA 4EMZA 1HIML 1SEBA 1LEGA 4ZMQA 2ZYIA 3CIAA 5F7DA 4X4XA 3QT2A 3SJVE 3TYFB 3F05A 4OF0A 4RGNC 3FUIA 2PMZA 5DJYB 2HVJB 4XWGH 1XH3A 5EEYA 3GSVB 2R2CA 4JDEA 4WO4A 5FF6B 1UD3A 1G7MA 4LPUA 4Z0BL 4POUB 1AKPA 2VXVL 3SPHA 4DNLA 1KCRH 4MZ2A 4GKSB 1A6UH 3PL6D 3DHJA 4GMSH 5TE4H 3OX8B 5JHDA 3SGKA 3FT3B 1RJLB 3L6FB 4P23A 2H26B 5F89A 4Q4EA 3W56A 2IPTH 3W0WA 2HVKB 3V4VA 5JYLA 4JN2A 4MA7L 1JV5A 1T89A 1MRFH 2D03H 5IM7A 4I0CC 3UPCA 4X6DF 5CINL 2PPEA 1PYWB 4NIKB 4WJ5A 1PPIA 4GFXA 1BBDL 3FFCA 4M48H 4OD3L 1IC0A 1X5AA 2DQGH 4KPHL 2G2PA 1SJHB 3DRQA 1MFCH 4Y4KC 5FKAB 2AJYL 3BAYA 2BH0A 3DTXA 1J5OH 5I1JH 3DTDA 4YH6A 5A3ID 1CLOL 2R0ZL 3TNMA 1R5IA 1ZXKA 2GCYB 3GMQB 4JAMA 2BNUB 3UC0L 2WKOA 2P45B 3HUJF 1LO3H 3OAWA 5DEFA 2EVGA 5ETUA 3V4UH 4LSQL 1CYXA 4DSYA 2V9TA 2IH3B 5GGRB 5F6IB 1CR9L 5EZIL 1MAJA 5HTSA 4X5LA 2AJSL 4XOAA 3VMPA 2WINA 2HRPH 5MEOA 4OAWB 1E5AA 2XACC 1B0GA 5MEQB 4WQOA 1GPOL 2VW4A 1G7HB 2VL5A 5I8OL 4IGBC 4MQSB 5KSAC 3BN9D 2EDKA 5FECA 3CLFL 3HEIB 3N41B 3TVMA 1J1PL 3KYOB 3LEXB 5KAQG 3N44B 2HPTA 1U8KA 4F8TA 5E08H 1SDDB 4A7QA 3L1FA 2HT2D 5IW1B 3TNNA 3TBTB 2F1AA 4FXKA 3TA3A 4YDIH 3NGBC 4FKEA 1USQA 3QPQC 5K93A 2VYRE 2DQEH 4XNYH 2Z92B 1AGDA 4KI5C 4HKBA 1RK0B 4JFUA 3WO4C 3LKOA 4R90L 2ATAA 1E65A 1KIRA 1NJ9B 1QLEB 1Z7JA 4JM4L 2H45A 2X89D 5BVPL 3LXCA 5JNYB 1DLHA 3WUWB 1EO8H 4ZG1A 3GSWA 4RCAA 1KCSH 3ABMB 1PZAA 4YX2L 3H42H 4OIIL 4R83A 2LU4A 4Y2NA 1AAJA 4GINA 3V0FA 1HJBC 1OGSA 5E2WH 5E8OA 5EIIG 5JIPA 4AIZA 4LAQH 5DHYA 5HHXH 1ZA3B 4FZ8L 1S3KL 4LNRA 4S1QL 4IMKA 2OZ4L 3C5ZB 2JK5B 1CXHA 5CLZA 5DMKA 5E9NA 3RTQA 1G94A 3QQ3B 4P46D 3NSYA 3MRCB 1TMQA 1SMAA 4PJ9B 4UQ2A 2N56A 5K1JA 4GUCA 3O41B 3I6LE 4G80B 5B7MA 4JKLA 5DJ2B 1X5LA 1EUUA 4NUJA 5T1LB 5I1AA 3IK2A 3KCPB 4B7IA 3GM8A 3KWWA 2FUQA 5JPMC 2EDLA 1XSOA 2P26A 3MRRB 2WLKA 1QWUA 2BVPA 3OJDB 3U4KA 3DV6A 3N42B 1FBIL 3PWNB 5EPMA 2IWEA 3JWOH 2P24A 4JREC 3DO7A 4X42A 1CTMA 1F3JB 2HWZL 2FX7L 1MIEL 3CMOH 3BDYL 1MFVA 5LNGA 5I1CH 3N91A 1AKJA 3U0WH 4NJ9L 3MRFB 2PPCA 4A63A 4TSCH 1NC2B 1RLWA 1MG3C 4Z7NB 4BZ2H 2AJUL 3HFFA 1AGCA 1S7QA 2H41A 4BK5C 2ZXGA 3BKCH 3MV9A 4JZNA 3W9EB 2CIKA 2FT6A 3NFPA 3O4OC 3B4NA 4ZTPL 4OLZL 1XIWA 3VXNA 2C3XA 2NUPB 2D7TH 4HPHA 3WE1A 3BUQA 2G9KA 4N8VA 1JPGA 1SFDA 2JKTM 3F62A 1JHKH 2F53A 3HC4L 3DMMD 4FMVA 1PX3A 1AXSB 2CJTA 3K8KA 3VX0A 4X2UA 2GHWB 3O8XC 1S9KC 4QXUL 3WNOA 4GEJA 2EDNA 5C08A 1XR9A 3ZDXF 2ZUYA 2FJUB 3J07A 2IANB 3OAZK 2IBZX 4KKRA 4TLSA 2ZUQC 4M03A 3SKMB 3ALWA 3N0AA 2XTJE 5F9JA 2VLJB 1P7KB 1JK8A 5EF1A 5DZAA 3L8QA 4PG2C 1IGCL 3O3DB 3EOYG 2VKWA 1W8EA 2WSPA 4AH2B 2R2BA 4G8IB 4EUPH 1IAOA 2VDOH 3UP1A 5JLZA 3HBPA 5KANG 4QJ5B 1KY6A 1IJNA 4X8XA 1AO7E 3APMA 3MRBA 1UKTA 1XH2A 3GNMH 3PHAA 4PS4L 3L7FA 4U3XA 5TDNA 2WZ0A 3GSQB 1YVLA 4UZSA 5DHVA 2DZEA 2IDCA 3ASOB 2VL4A 2ZP0T 3MROB 5CMAB 4BBWA 1K5WA 1AHWA 3PF2A 4BH7B 1NIAA 4LQ1A 5TQ0H 3UZQB 5KSVA 3TN0B 2OPCA 4JGJA 4APQD 2WSDA 5IEHB 2XN1A 3B9KB 1UA3A 1J9QA 2VH5H 1IM9D 1Z3GL 1ZLWH 2LOEA 5FYKE 2O30A 3PJSA 2BWIA 4NB7A 3MNVB 4WI3A 1YNTF 3RWEA 4LVNC 3QFJA 3F7LA 1GGBL 4ZMLA 4QY8B 2A1WH 1IVTA 4IRZA 4S0HA 3O45A 1GY2A 1BM3H 2WVSA 3G3LA 4JFYB 3NJXA 4LOUD 4PRPE 5EZJB 4PJDE 4ZMAT 1QBAA 3V5KA 3ECVA 3TIEA 3UC2A 4OCSL 1UJTA 4TVPL 5B1BB 2DYPA 3TASA 1F58L 1K85A 3QQDA 4V2CB 5D7JC 4K55A 3BH4A 3V5DB 2ZCKL 5AAMA 4AOFA 1KG0B 2WBJD 4QEGA 3L3OB 1KIUA 2BY2A 2D4DA 4GAYB 4E5XB 1ORQB 2DDQH 1L0YA 3KPTA 2YPKB 4UOW1 1MQKH 4M43L 5ISZE 2F58L 4HQQH 5EZLB 2P52A 3V52L 3B9DA 4F20A 2F19L 3ULVL 5GZOD 5IB5A 1SOSA 5JMRA 4JE0A 3UPRA 1GYCA 1NTDA 1RZJL 3MV8B 2DQUL 3VI4F 2BRRH 1XCXA 3T0EC 4DP2X 1J05B 3MLXL 3RAJH 4RGOL 5I71B 4PB9L 3VD3A 5KZCD 2F2HA 4X5XA 1HEJC 4LSVL 5D4JA 4AW4A 1BOGB 1JNNH 3I02B 2WNWA 1NCBH 2NXZC 4WAFA 1IC7L 2HH0H 2K8MA 3HI1A 2ZIDA 4HH9A 3C2SA 1IIKA 5D7HA 5C9JA 2Z4QA 4V1DE 3TEWA 1CD1A 5I66A 1I7ZA 5KS9F 2A6KB 1JHTB 4NENB 3GJEA 1IKFH 3L5HA 2HA1A 2CCWA 4QT5A 5CILH 2VDQH 5D7IE 2Z91A 2AEPL 3LB6C 2HP4A 3NA9H 3RZCA 4NNYA 3ABGA 3GF8A 4Z77A 2IADB 4JDZB 2A83A 4XNDA 1MVUB 1SYSB 4R2GD 3AWGA 4QXGH 1BLNB 1JMZA 2EXSA 4MAYC 1H3TA 3VXTB 3AT8A 1NFDB 1G9NC 3D0LA 4LAJH 3TBWB 4GG6B 4M6OH 2VT0A 2EVFA 4HC1H 4XPTH 4WIQA 5C0GA 4B95C 4Z3HA 4Q6IA 2QGBA 2H1PH 2G60L 1OQOA 4YC2C 4OZIB 2OSLB 2QDWA 1VIWA 5CSGA 2CDGA 3N50A 3ARYA 3EDDA 1HH6B 3EYSL 2XPGB 4FD0A 1HHIA 3QNZB 5E56A 5HHNB 4JO8A 3NZHL 1FE8L 1PFCA 2HRHA 4Z7WE 4G42A 5C97A 1FRGH 4AYEC 5FS5A 1CLYH 5DK0B 2PETA 5EUOF 1R5WB 4GXUM 4PRIA 5J9PA 2RBLA 1FH5H 2I60H 4H25B 2ZCHL 3U0PA 1IAMA 3ZIMA 3OHXC 5HGHA 3FOLB 4HCIA 4HHGA 4B60A 5H2BA 2XZAL 2WTPA 4YL9A 2UX6A 1R33A 4BK4A 5FLVA 5E8EB 5ESAA 3SDXF 5D2LB 1YEWA 1SBSL 1CFVL 2WC7A 3MX0A 4MD4B 3HI5H 1GGCH 1WH0A 3QPKA 5J89A 5LGKA 2NQDA 3TO4C 4LGSB 3CFUA 5EN3A 4AQEA 3C6SB 3BAKA 3EBGA 4G6JL 3ULUL 4MDJB 1E3ZA 1A14H 4QOKB 2YA1A 2F7IA 2O72A 5IHUL 1UCTA 4RA3A 1YCSA 4DK6A 2MIZA 4RGMC 2FBRA 2LFGA 3KLAA 2QL1A 4K3EH 1W15A 1XGTA 3MUGB 4H8WL 5FK9A 4PRDB 2RCSH 4B9IA 1QUNA 4L4TB 3FB6B 2XXCB 2R59A 1QSEA 2F61A 3ZKQD 5J13C 4XB7A 4P9HH 4B3VA 2Y5EA 1AR2A 2A99A 1ESOA 2OBGA 4PV1C 5INCB 2C8NA 1A65A 3ASNB 3D4ZA 1NMBL 5C0RL 1U58B 4AGQA 4MWFB 5JW4N 1AZCA 4LOFA 3TBSB 4XVUC 3KDMB 1SUHA 4PS8A 4MMZC 3VFMB 4OGZA 3D85D 1ZVYA 3MJWA 3VXMD 5AKSA 3IS1X 1RUAH 1P4BH 4DGIL 5JQ6H 4XCCL 1B6UA 4PJGA 1XL6A 5DJAA 1PZ2A 7PCYA 1F41A 3ME0B 4AWJC 4JFFD 3NK3A 3RKDC 3MLTB 1L3NA 1KXQE 3C60B 3VACA 1NICA 3OKDB 3O6LL 5I75B 2VDML 1DSFH 4OT1L 3QAQA 5FX3A 1KUMA 1VF5C 3P9LA 2IG2H 5DJ0A 4O9HH 1OAKH 4IM8A 5AOLA 1NBVH 3GI8L 2O5ZL 4RAHA 2V5YA 1ZGLM 4XNUL 2D7NA 3MODH 3FSWA 3GO1L 2WJ7A 1L9SA 4ZMPA 1RULH 4RBPK 1S5IH 6CGTA 3W82A 4ELKB 3MNWA 4FHJA 5DZNA 2GSGA 1J0IA 1E6JH 2F54E 3MRQA 2UY6B 3STZA 5C70A 4HJ1A 4JHVA 1IEAB 4YHNA 1V7NH 3UERA 3T1FA 1PD0A 4YXKL 2RACA 4GSDH 3WXWH 3MRDA 2VDKH 1INEH 4LSDA 2I25N 1YY9D 3VXOB 3A0OA 3FTSA 4N9GA 3GSUB 5DWPA 2IJ0C 1W2KT 1R3JA 2GSMB 2P43B 1IQDA 4L3FA 4N24A 5IG7B 4IBLT 2IV8A 4U6HA 5L4IA 5DFVC 3Q44A 4NI3A 1G7IA 2XBZA 4HCRH 1JGLH 2OJZL 1B4RA 2JKLA 4FDWA 4Q4IA 5FOJA 3RVVC 3WIIH 4IJTA 2ESVA 4ACTA 5T33L 4J6RL 3KYKL 1CYGA 4F7MB 1QRKA 4OBRA 3BW9B 2WLJA 3DWTA 1CGSL 1PY4A 4E41A 1J18A 4LLYB 2VLME 3N3EA 4PLOB 3VFTB 4MD0B 4IK7A 1BJMA 2PF6A 4OCRH 4BDVB 2DLIA 1DANU 2B39A 2Y2TA 3D0VA 3L4TA 5L7XL 3ARFC 2Y07H 4LCCB 4LVEA 2NXYC 5ACZB 4YBLB 2GTWB 3CVCA 5EB9A 2X6AA 1CL7H 1BEYH 3RVWD 43C9B 3BWSA 1OHZA 2YD8A 2AQ1A 3KBFA 4AEHL 3GXNA 1FJ1A 4DZBB 3ZQXA 4P07A 1MFNA 3HAEH 3SE3C 4YQXL 1FGVH 2E76C 3PWPE 2FD6L 5ENWA 3A5VA 2AMUA 2WAQA 4DWHA 4HFWA 4G8FA 4ZQTA 3IU4L 3GRWA 2WZ5A 2JKRM 1OEZW 2L04A 3V0VA 2W0FA 5D9SB 2XG5B 1AQKH 1HC1A 4BKTC 4AKPA 1UT1A 3C09C 3KVPA 2X1OA 1XEUA 3DLQR 3LKSA 3TT1H 4LOVA 3MRPB 2P28B 3GRBA 4BE6A 2CGYA 2XT1B 5SWSA 1XTLA 4KRMB 2YAHA 1YEGL 4HXBL 2ADIA 3E80A 2JKSA 5CLXA 4DP6X 3KAAA 1Q1PA 3IEAA 5DD5H 5EU5A 3WY3A 3QEUA 4I4WB 1NGYA 3VFNB 4B96A 4XMLH 1O9WA 1JXGA 3KJ4C 4WO0A 2FR4B 3DDGA 4ISVA 1AP2A 1QI4A 3IF1A 4R96B 5DQJA 4CJ1A 3LDBB 4N8UA 4PJ8D 1JXKA 2XTJD 5FHAH 1KCUL 3QZWB 5DFTA 5EBGA 5KYXB 5CCKH 3K1DA 2I85A 1F86A 2F5AH 4DTGL 1OK8A 1SOQA 1Y6NR 1TYJA 2VABB 4N8CH 2JH2A 2HLAB 1MNUH 3OQ3B 3QUKA 3X1EA 2PO6A 3MRLB 5KYYB 3RL2A 4YAQB 1NZRA 5C0EB 1QTSA 1SFHA 5E9DB 5FFLA 3HPJB 4RAVA 5F7MC 3SPGA 1YEJH 4BWTA 4ONOA 4A6YL 3TCLA 3IMBA 4HG4K 2B0SH 2CIIA 2VLKE 1AJ7H 4L1TA 1D7DA 1FN4B 4UQ3A 5FKPA 2R39A 2UZXA 1ID2A 1TZHB 2YK1L 3KJ6L 1NMAH 4LKCA 5DUPL 1P6WA 1AS8A 3PP4L 3BMVA 5IMKA 3KR3H 1JZGA 3ZTJG 4EIGB 2Z9TA 3BDXA 3V0IA 1P2CA 3MBWB 3KYMA 3N6YA 4X4MA 2E7BA 3CFDB 4CVXA 3Q5TA 4O2FB 5FFGA 3P30H 1OTUC 1J5CA 1D5IL 1OTSD 3VM5A 2QKIA 1N6VA 3U7YL 1OSPH 2R7EB 3BEVA 3U6XS 3QDJD 1IJ9A 3V0WH 2VN5A 1JVLA 5IVXB 1FFOB 5BV7C 3P9MA 3NCJH 3T3MF 4NPKA 2PN5A 2YQGA 3EFDH 3G08A 3W5MA 2CO7A 2Q7NA 4XVJH 4O2CA 2PXYB 1A7PL 2WUBH 4EI0A 2DLTA 4FXLA 2VQUA 4JFXB 3AY4C 1PLCA 1R47A 3OKEA 2NYYC 5MERB 1QNIA 3TBYB 4YHZL 1CIUA 4EZJA 5ISZD 4XO5A 3HNSH 3NSXA 1XMEB 3ZW3A 4JANA 2YEQA 2DLHA 2EEAA 3QXDA 1MREH 4HJGA 2D2OA 6TAAA 3HZYB 4HUVB 5GJTL 2X6MA 3K2UH 3P54A 5DRXA 1GMIA 1W16A 4JRXE 2DJ4A 2A6JA 4M3JA 1URLA 5BS0E 5CU9A 5IBLC 4D0CB 1IEBB 2YD6A 4KUZL 2IDTA 4PGDB 3ATFA 1FIEA 4G1EA 2WIIB 3PL6A 4RFOH 1JK9B 5IQLA 2X2IA 4WENB 2E5EA 2BFVH 1JZ4A 1DBKL 4JO4H 3L9RA 4OFKA 3MRJA 3OR7B 2W94A 4RRPM 3SDAC 2F6AA 3FCUB 5D4QA 5CR1A 1Z9MA 2IAAC 4NQQA 3ZMEA 4NN5B 2QQKL 4OD2A 2WTOA 4N0FB 5CP7A 3NABL 4U05A 4Z5RA 4P5KB 3VH8B 2CKBH 1EZLA 5FUOH 3L1OL 2KLRA 4H26A 2ZD0A 4XX1G 1DQVA 4YWGH 5EV7A 3GTNA 3GMRB 1KEMH 1NAKH 1Y1UA 1CN4A 3ECQA 4Y1AE 4HPOH 3SDCC 5CN3A 5F3HA 3ZT7A 4HIXL 2FWOB 3SD2A 5HVHC 4AE1A 4BXVA 5ALCL 3L4WA 1RJZB 4WHTB 2H2SC 2OS7A 1JDCA 1UWGL 3APNA 2MPVA 3HBZA 4H88L 4K0OA 4NRZA 2BMKB 3LD8B 4X4YA 2PR9A 5CBAB 2IH1B 1WGOA 3TLRA 5AAPA 5DJ6B 3QUZC 2LAGB 2VXQH 4PUBH 2YUZA 1FO0B 5F1OB 2C7UB 1ADWA 3P3UA 3UEZA 4M56A 4LLWB 5SX5K 2EEXA 1T2QH 3MUY1 3ZIYA 5BVJB 1PDKA 1KYFA 3L9EA 4GPVA 3PPEA 2FYYA 4H40A 1DDHB 4BZ1H 5DVNA 5FPIA 5CXPA 3BGFB 3O6ML 2R2HA 1W72A