1M42A

Solution structure of apocopc from pseudomonas syringae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper resistance protein C
publication title Solution structure of CopC: a cupredoxin-like protein involved in copper homeostasis
pubmed doi rcsb
source organism Pseudomonas syringae
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1m42A00
3BC9A 2WQWA 4CC4C 1M42A 3BZ5A 3BCFA 2OMWA 1M9SA 1NM4A 1H6UA 2OMXA 5ICUA 1O6VA 2UZXA 1LYQA 1OT4A 2YA1A 4CC4A 1IX2A 2OMUA 2OMVA 3FAXA 3FAWA 2OMTA 2RA1A 4AQ1A 2C9RA 2OMZA 2WQXA 2C9PA 2Y5QA 3BCDA 4CILA 4AW4A 2WQUA 1O6TA 2C9QA 2UZYA 2WQVA 1H6TA 2OMYA 1O6SA 1XEUA
chains in the Genus database with same CATH superfamily
4AH2B 2BIQA 4OZIE 2OX5B 1TKWA 4X4MA 1E7VA 2WO4A 3QJUB 1QUPA 1AOZA 2F18A 4OFQA 4C83A 4Q9QL 3ZE1E 2FX8H 2EXSA 1Z5LB 1MCSA 3Q6GL 2J12B 1BX2A 1HXKA 4X5XA 1ZLSL 3T04D 3AWEA 3PPSA 4OCSL 1AZBA 1KB5H 1TQSA 1YEKH 2C9PA 1V54B 3H9HB 1M2OA 2Y22A 1CDCA 2XQ0A 1UKQA 4PRDB 4RFNC 1KJ3H 4YSAA 4KH2A 5C1MB 3WNKA 3NSCA 4QRSA 1MCCA 3PV6A 2CLZA 5TDNA 4FFYA 3SYOA 4FX5A 1A6WH 4ENZA 2XNAA 1QRND 4NQSB 3RL2B 2AK4E 2HJKB 1CYGA 1EAOA 2EKSA 4M8QB 1G9MC 3RIAF 3FO0L 1LNUB 5KS9A 3GHEH 1I75A 3LN5B 4U6HA 1UWGH 4O9HH 3TBWB 2XZQL 2OZ4H 1J8HD 5EO9B 3WIHL 4WW1B 5C09E 3GMNA 1T0NB 4J1UA 4QY8B 5IK3B 3AWFA 4LKCB 3BVTA 4TUOB 1I1AA 2YQ3A 4XP4H 2HYMA 1J5CA 1JUFB 1SXAA 3EYSL 2WBJB 4X6EA 2QJDA 4H4NA 5ADPL 2LABA 5LVEA 1T1XB 1U42A 1WEJL 2JXMB 1SLUA 1ZT4A 2R2EA 2Y5EA 3QR2A 3QRBA 3UTSE 4OM0H 2OJZL 4YDKH 3GZOA 2X4OB 4QXGL 1MAMH 1NGWB 1Z7JA 3JT0A 1XTMA 4O02B 2JMRA 4KMTH 1YYMH 4I87A 2XOTA 1U8QA 1K5NB 3MKKA 1QLRB 3BPOC 3INUL 3U82B 4QXVA 2Y6TE 3MBWB 1EEZA 2Y7QA 4UQCA 2VDLB 1XSIA 4F7KA 3NPSB 3CHRA 5LCVH 2DKMA 3ME0B 1U8CA 5CGMA 2BVQA 4LPWA 1WCBA 4WSGA 3U9WA 2C4FT 1VGKB 4LASL 2C9XA 2G9HB 3NJJA 2E5EA 4GRWF 3OSKA 4DSYA 2CDFA 1AO7E 4KKCC 3FTVA 4J6RL 4J5VA 3PWLA 5J6GA 3VACA 2APVA 4X42A 4JFUA 2CDGA 2GSMB 3VWJD 1NFIB 3F7RA 1OSPL 1T80A 3GBML 4FI8A 2VABB 2K4AA 3HZYA 1DBAH 4M93B 4NS0A 4U6YA 5E5LA 3UXFA 1LO3L 4IEFA 2ITCB 5CHNB 5E6ID 4DP8X 4UAHA 2JI1A 2N56A 3QDMB 3K1DA 2JJTC 1K8IB 4BH8A 4NQEB 3L9EA 2EC8A 5JIIA 2V2XB 4F3FA 9CGTA 1SMOA 5K9QG 4KRPB 4OF5A 5A1AA 5JXAH 1DL7H 1D6VH 1OE3A 2ZG3A 3SJVD 1A4JA 4QXUL 5I0VA 3ZU8A 4DGIH 3T0AA 4ZUVA 1CD0A 1G9HA 4MTMA 3MRBB 1ODAA 5HD8C 1F11B 2DH2A 3IGLA 1AZUA 3KPPA 4G9FA 2WWOA 4CMHB 3FU3A 1DQMH 2DDQL 2NSQA 1HKLL 2Y4SA 4NUJB 4GKZA 4I48B 2AZUA 4UINL 4CW1A 3AQXA 4R5TA 2EIEA 2LFGA 2FO8A 5I8EA 4BZ1A 2ENJA 2YHGA 3IK2A 1MNUL 1TLMA 3R1GH 4HQQH 3WIFB 4XMKL 3ARDD 4XOBA 5ENWB 1WS8A 5GSRA 4TVPE 4OY9A 1FO0A 1OARL 2X4PA 4OU3A 4WW2F 1FSKC 4NHUB 3WG7B 4XC1L 3W0WE 2Y6SD 1EJ6A 5DK0A 3ULVC 1L6XA 2DMBA 3N9GL 1U2HA 4PJHA 5CILH 2XTSA 2FD6H 3OTTA 4NCC2 5IJKA 1J7VR 4QJ3B 1IZJA 4Y5YA 1Z1WA 5DD1H 2BHZA 4Y2DD 1LP9E 4M1GH 3ATDA 4LF3A 4MHHI 2YBRB 3UTQA 4WTQA 1FYTD 3VMPA 2OTWB 5F3BB 3STLA 1A7RH 5EDXA 4M5YL 1BLIA 4ZW8A 1HHIA 4NLHA 4UMSA 4NFCA 4D3CH 4N0UB 1GS6X 2DQTL 5MEPB 5JXEC 1XR8B 4UM8B 1DCEA 1W72H 4HZ1A 3L3JA 1RJLB 4MXVE 3WEOA 4B7LA 2XVGA 3FB8B 4MZ2A 3ZUNC 2YMXH 4BSWA 4QRRD 4ZX4A 1QBML 5IW1A 2WUBL 2XACC 1I7ZA 4BFEA 3SGJC 2XTJD 4IBVA 4ZNEA 2APFA 3NK3A 4JFDE 4OJEH 4D8PB 1LL1A 2O30A 5DVOA 3ZR6A 5MENE 1EANA 4KAQH 5DQDL 3ULUL 2IH3A 3NZ8A 4YXLL 4U3SA 1KB9K 1HAWA 4GAGL 4B9JA 3EOBA 1OGTB 1Q72L 5E2UH 5IB5B 2CKBL 3IDNB 3UROR 4L1DA 4JM2F 3IPFA 3QJXA 3Q6FB 4Y4FD 1XCQA 4DQOL 4RFNB 5D1QA 3KPTA 4HWZA 2NY2D 1CL7I 2X2IA 4QHNB 2EDMA 5BV7L 4ODWB 1G84A 4EZKA 1BIIA 4HETA 3MRIA 1JZEA 2NTFB 1R0AH 3JWNG 3E8UL 2A6JB 1GOGA 4MJIE 3PJSB 4PRHB 1TSRA 3RBSA 1E4WL 2NR6A 4DW2H 3HG1A 4BH7B 2EACA 2ZOKB 3MNVA 2DBLL 2VZUA 5E7BA 3BKYH 4S1QH 4MJ5B 2HRGA 3FT3B 1NWOA 1QLFB 3MRHB 4HJGB 1I3RA 4OB5L 1QTYT 2GJJA 3DIFA 1KBWA 1IBZA 1PG7X 5I30H 1VFOA 3NZSA 3RWDA 4ZMPA 4M3HA 4W6WB 4JZOA 1CF8H 2FB4H 1HCVA 2H32A 5TQ0L 2CBTA 1BVLB 1MLBB 1G5AA 4DWHA 3FOLA 2ZJSH 4JDTH 1F6FB 3SZ6A 3OKLA 2C9UA 2VQ4A 5I1CH 3KS0H 1EV2E 2W9DL 1HZKA 3BPOB 4LBEA 1E4JA 3TM6A 3ARRA 1M1SA 3THMH 1CL7H 4FYQA 3PL6B 3GIZL 1A47A 2Y2YA 4PJEA 3K2KA 2FUQA 2YPLD 1EUTA 2V9QA 2ADIB 4GFXA 3NABH 3UP1A 1FNHA 3MGOB 2AJXL 4HIHB 4LIQH 4XNXL 3VH8A 3I75A 3MCKA 1K8DB 3ZOAA 3GSNB 1Z32X 1DJGA 4YIQB 5LLIC 4W9FC 5K1NA 1E43A 1JTPA 4W1TA 2Y2WA 4HIXH 1MCFA 4GUPA 3GK8H 3QUYD 3EGDA 5JYMA 2UZYB 4ELMF 3DUSA 1OAUL 1N19A 4N0CD 4R4FL 3GYRA 2UX7A 5JQ6H 1F2XK 4BQCA 2K3HA 2KYIA 1B0GB 2WMPB 1ZEAL 3L2NA 4I3RL 1JGEB 4LO9A 4E9VA 5L6YL 1BF8A 3F62A 2BC4A 2V0AA 4JJHA 1CN4A 4ODUA 4OGYL 4CU8A 3PQYA 4ZG1A 4LFHG 3V5KB 4P2RE 5AWNL 3FFDA 1MWOA 2XN9B 5IM7B 2G5BA 4NBYB 1JCKA 3ILPA 5DMGC 5GHWH 3JSSA 3CXDH 1BXAA 3LVTA 2AXFA 2VJXA 3B4NA 1IJ9A 1KG0B 5GGSA 5FLVA 1JF1B 3B56A 4XNUH 1QSEA 4QMEA 4Y5VC 4BE6A 3QUZD 4FS0A 4KTEH 1J1XL 1YNKL 2W0FA 1NCCH 1UFGA 4LPXA 3HI6H 5EOTB 2MIZA 1NC4D 3GMRA 3A0OA 3GPSA 2EO7A 3MLWL 2X09A 3MVSA 1Q9OA 2HH0L 1T2QL 3ALXA 4JRXA 4P9ML 4X7EC 4YSTA 3FUNA 2VN3A 4HCGA 2P8PA 2YD6A 3L1EA 1KPUA 2CIIB 3L17A 4HXAL 4JO8A 4EQ3A 2FT8A 1NLBL 4LHUB 4K3JH 1AYRA 3IJSA 2Z91B 3UBXG 3HCVB 2UVEA 3L4YA 5IEKB 2K8MA 4HDIB 4BFNA 3EJYD 3QWRD 3EG9B 4LLAA 4ILDA 4UTAH 1AD0B 1D7CA 1DVFC 2WSKA 1TJGL 1GC1C 4BSVB 5L8KB 3L3OA 4N2OA 2ILLA 1NGYA 1ZSDA 2PLTA 1QSFB 3DSNA 1KYUA 3FAWA 3QZNA 3CLFL 4XX1E 5KYXA 3VI4F 1N2RB 3PS6A 3LTVA 3MRNB 3QFDB 2FH6A 5IMOB 3PRZA 5FUCE 3APNA 3RUGF 2XVLA 2QV2A 3LDBB 4U1GB 2AKRA 4WFEE 3LNHA 2E7LA 1BBJA 3F85A 1OP5K 2OMNA 2BVPB 5D1XD 2Q7YB 1J5OH 1S3KL 4WV1A 1YMMA 2FWSA 4XMVA 4M6OL 4M9OA 2JFCA 5E1AA 2F61A 5I15H 1JZ4A 4BKTC 3N50A 2HN7A 1AY1H 1RZJL 2CCWA 4TSCH 2H2PC 2ZX9A 2ATAA 2NY3D 2DZEA 3IWUA 3CLWA 3ZGHA 3WJMA 1F8TL 1I8KA 4LU5L 4RMWA 4GQPH 5KVDE 5CO1A 4PCKA 4ZUSA 3VGAC 2HKAA 5J3HD 3TN0C 4GUOA 1OGAD 3T0BA 5CD5C 2QPEB 3O6LL 1QZ1A 1YQ2A 2M26A 1XEDA 4Y9BA 1DQDL 5CZVL 3CPLB 4HCRL 5JQHC 3H8NA 2WLLB 3QUKA 1NLDH 4PD4J 4GXUN 1S9YB 3VXRB 5A2BA 4AIEA 4I3SL 3VXUE 1W6WA 2ZX8A 4RGND 1IEAA 3DX8A 3L7FA 1FNSH 3V9EA 2K0RA 3BH8A 4U0QB 2N0MA 2PXYA 3HS0C 4JQXA 2NY5H 3H2WA 4G6AC 2VXTL 4PJXA 4MXWH 1ZLWH 2H3NA 3GS0A 1AANA 3GQFA 2J2ZA 1IAKB 4ONHA 1WA0X 5IVZB 1F90H 3ULUC 1UZ8A 4ISVB 4G1MA 5B1KA 5J9PB 1HK6A 2X3AA 3VD1A 4F7TA 4XB3A 1N59B 4WJ5A 1NBZB 4D8OA 4KXCA 1S9VA 3MC0A 1BWWA 4XPFL 1PD0A 4LHUG 2D31B 4OLWH 1ZHBB 4PJ8A 1D5BB 3RI5K 4NM4H 4DN4H 3KPOA 3ZYZA 3UMTA 1CE6B 1FYHB 5IHWA 2HT3C 3S9DB 1CMOA 5BV7C 4ODVL 4H44C 4F37K 3GRWA 3DURB 4MA7H 2Y06L 4NKMA 4IM8A 5AL0A 1CB4A 4IOSA 5IG7A 3U0PA 1IT9H 1GGTA 2NXZC 5LWYL 3TBVB 1SF3A 2A73A 1WSST 4KKLD 4PMFA 4NBXB 1I85C 4IHBA 1IC4H 1BVKA 4WFGE 1M1XB 2F5AH 1A8ZA 5HHOB 4XAWL 4L0YA 4IJ3C 2VDLH 5BO1H 5GS0D 2XWEA 5CMAB 5D7LA 2CR6A 3LZOA 4TQPA 2Z31A 4NN5C 4YHOH 3RX9A 3F83A 3PGDA 1JZFA 1RZ8B 1SJHA 4Y1AD 2DQMA 1IFRA 3KMDA 3X17A 4CBZA 4JZJC 2EDKA 2EE6A 1TOXA 4UMGA 4JL1A 3S5LB 1IV8A 1ZLVH 3NFSL 4JDVB 1BVNT 1OXYA 4A37A 1R3KA 1TO4A 2XXCB 2GHZA 3M1CA 3VUAA 5ALBL 2X05A 4HJEA 3KJ6H 5IMKB 5I1GH 2RCSH 4KQ4L 1DO6A 4QHPA 1P6AB 3F7VB 5DVNA 1MREH 3QCTL 4JFYB 1GPOL 5F9JB 1IEHA 1FG2A 1U6AL 2AF2A 3MRCB 5C09D 5T3ZL 4GJTB 2DD8L 2W9LA 2VC2B 4N2IA 4EI6A 5DJDA 2EH8L 3QR0A 1RZPA 3D69A 1TMCB 3FCSA 1I8AA 1MEXH 1JWUA 1RUML 1KCUL 1GH7A 1HQ4B 3FZUD 3GJFH 3MOAL 4U6VH 1RUAH 2MQ0A 4LL1A 5I1IH 4HF5H 1HT6A 3S6CA 3S96A 4R96B 2VQ1A 5D6CB 1KEGH 2AS5M 2FJFA 4O4YH 3FTGA 3CUPA 1NCIA 1UZ6F 1WCQA 2NXYD 3F7YB 5EOCL 2RAMA 4ADIA 2MTAA 3WFBL 1AMYA 3FQUB 3SDCC 4PG9B 3DYPA 1BFOA 2CGRH 3OPUA 4K23H 3D39B 3X1EA 2HJLB 4DK6A 4W9DC 5J56B 3EJTA 3GMQA 3FT1A 1HI6B 3ZDYB 4HK0A 4Z3JA 3KBHE 1X4XA 3MRKB 4NZUH 4JN2B 1SY6L 4BD4A 3CTTA 1DVFB 4OUOA 5EF1A 3DVFA 4KX8A 5AVXB 4ANUA 3SD2A 4HUWB 3TASA 3HRZB 3IYLW 3OR6A 4F7MB 1LO4L 2ZWSA 4TMPA 5ICZB 1FFOA 5F9OH 2JTYA 2QL1A 5JW4M 4R7LA 1A2YA 2YUWA 2BY1A 3F5WB 1J8HB 3G6JE 5C6PB 3CC5A 2GFBB 1ECYA 5DJ8B 1GY1A 4KMQA 3L6FA 2QLVB 2A4CA 1TZIB 4Q8BA 3OX8A 5C0AD 4B9ZA 1T89A 1IFGA 3GKWL 5HDLA 3MRRA 1ES0B 2X9YA 4CVZA 4UIMB 3NQKA 5KANI 1BXUA 2C7UA 4KNTA 3T09A 1OP4A 5DUMH 4MB5A 2YXVA 3D2TA 3WOVA 4YGAB 2PPCA 1DBJH 2EIZB 3U6XS 1H0DA 5IB4B 3FTZA 3ESVF 5F0MB 2Q8AH 4MAYD 1T04A 3VGAB 3RU8H 3I9PA 3TN0B 1XXDC 4NKDB 4QTHB 1I9RH 4Z76A 5LN8A 4KZDL 1EHXA 1TVBB 1OAKL 5ELIA 1HH6A 1OCCB 4YBLC 4YZFF 1ZA6B 3JZ7A 1TQCB 1KJ2A 2R27A 4GBXA 1CFBA 1NKRA 3CZSA 1ACXA 3MLYH 3NEOA 4JLRB 5JHDE 4JKMA 5IT2L 4J3OH 3DJSA 4OFIA 3W0WD 4NO2A 2VR3A 2XIDA 4NQDD 2DMCA 3RKDD 4P2OC 1MLCB 4M43H 2HJFA 5GGVY 5L7XH 5HY9B 4LLMA 5GSVB 4AITA 3QDAA 1DQVA 4JMXA 1F3RB 1RZJC 3H3KA 3PFQA 3PGCA 1NTDA 3FCUB 3OWEA 3SCMD 4IBQA 3UFIA 1S6NA 3UZVB 1BQRA 3Q2CA 3FO9B 5JOFB 1GHFH 5CS7A 5T1LD 2F58H 4K3EH 1KN4H 4LBAA 5IQOA 1JNLH 1DDTA 1KLGA 3FRPB 3REWA 5DYFA 3VTMA 3V6ZA 5ICXA 1NBYA 2E6JA 2QPSA 2Z8RA 3OLGA 2N4IA 3E2HC 5DO8A 4XC3H 4YHKH 3SJVB 4YZWA 1J0HA 1JYNA 4JY5L 1UKTA 4GSQA 2ITDA 5IHBA 5IW6A 3K5SA 3R4DA 4J27A 4PTTA 2IMNA 3TA3A 1KTDB 2A1WH 1LO2L 2CMRL 4LCYB 1SXBA 3BEWA 2WQ8A 3KGUA 2XV3A 5IBTH 3WNOA 3BPLC 4DPAX 5MEND 5LUMA 5GZND 2X7LB 2CRMA 4HS6B 3QA3B 7TAAA 3LQMA 4IJ3B 1U8MA 1KB9J 1XF3B 4QJ5B 5HYJA 1A5FL 1R19A 4NN5B 2XWDA 1CR9H 2VLRE 2MCG1 2P46B 4OIAA 1D9KA 1WBZA 3BAEL 3O4LE 2A9CA 3MZTA 3MNDA 2V3FA 1QOKA 3HZ3A 4YFDB 1A6VL 2A6KA 4KHXH 5DT1L 5SWSA 2WKOA 3UDWC 3CMOH 4U1KB 3JV6A 5I1HL 4Y2DB 2YWYA 4XE5B 3SEPA 3C5ZD 4AYFA 4FFYL 4PJ9C 1A4KB 3BUDA 3L2MA 4XP9H 5I24A 1FP5A 3O8XC 4WK4B 1T4KB 3O3AB 3RWIB 4F92B 3VFGL 3HN3A 1OF0A 4JCLA 4I2XB 4M48H 3QIWD 4QXTB 5EZIL 5HYFA 1JK8A 2WBXA 3O45A 5FKPB 1YG9A 2H41A 2LE9A 3PNWB 3FU5A 4XVOA 2B08A 2EE0A 1V55B 1HJBC 1TIUA 2M2DA 4M3KB 3LD8C 5H94A 3HMWH 4KK5D 4MFHA 3RRQA 2XTJB 4IS6B 2TAAA 4JE0A 4Z9KB 2UWEF 1IQWH 3SKOA 3ZMEA 1MCEA 1E9OA 1RUKL 3GMLA 3QQDB 2FSEA 3OKOB 4YJZL 4HC1H 4LSTL 5I1KH 3BXNA 5IMLA 3FRPG 3SDCB 2BHYA 2W9EH 4MNGB 1KIUA 1FN4A 1ZTMA 4MXQC 2PMZA 3B2PA 1MI5E 2WY3B 3NCYS 3RPIA 3VVVA 2ENPA 2VSKB 3A67L 2BVEA 4Y4FB 1ZHLB 3QH3B 3BH9B 2EEDA 1L7IH 2NY2B 5DHVB 4YXHL 1JHKL 3CX5K 4AZUA 4KRLB 1CGUA 4M7KL 1UWXK 4JS7A 2YEZB 3FN3A 3L3IB 2SEBB 4WUKH 3UZQA 4Z7UA 2IBGA 4QCIA 3FFCE 3IDIA 2DWDB 3O2VH 1KIQA 2BWDA 3HZMA 1J0IA 2FYYB 4HKBB 3L54A 1QAWA 4F80A 3L3DA 4AV5A 4BKLA 2DWXA 3QO1B 4JDEA 4NGHL 1DEEB 4UV7L 5LN4A 4G83A 3T6VA 3ABKB 2DTSA 5GRWA 4EI5A 2ALWA 4IHOA 4OLYH 3QUXC 2DL9A 4NJAH 4Z5RA 2CIKA 3RNQB 2X70A 1VFMA 3CFNA 4P2RD 1MJUL 4FYSA 4X8JB 3U9UA 1J1PL 5DSCB 2IIJA 3BE1H 2BNQA 3PWVB 3GKZA 4J8QA 2B16A 4P5KB 4H8HA 4KI5E 2ZUXA 3QQ3B 4WKXA 1SFDA 3ECBA 5EH1A 3JV5A 4RAVA 3MKGA 2Z4TA 3C5XA 1KJVB 3QZBA 2BY3A 2H9GA 5E8OB 2A2QT 1OK0A 3QHFL 4MZ3A 1IKFH 2C8NA 1E65A 4JRFA 2YPLB 4BUQA 4R7VA 5T1DH 2CJ3A 4EPSA 3N40P 5AVVB 1QWUA 1HOCB 5B1JC 4H0GA 5IMMA 1DVZA 1U92B 1OVZA 2Z7ZA 4UT9A 3MUGA 3RDTD 2PCPA 2IPUK 3H9SE 3NIFE 3IJ8A 4PM1A 2IDFA 5B39B 1FO0L 1OPGL 3D4CA 3HHSB 3HJ0A 5FCSH 3FQTA 2IAMA 3TPKA 2YSSA 3QUYB 3QUMA 3OJDB 3GXIA 4OUUB 3X12B 3OKEB 1U33A 1MVYA 2OMYB 3C8DA 1KTCA 3H7BA 4JFPB 3CDCA 1MFCL 2N1KA 3U2SA 1RIHL 2D7MA 3WTSA 2F5BH 4Q56A 4RNRB 4TUJA 2CHDA 4KDTA 1S8DA 3UYRL 4GO6B 3WTUA 5CR8A 1IGTB 4PRAB 3RVWD 1KXHA 4WFED 3ZE0E 4JDZA 3UTPE 1RIUH 3R06B 3TCLA 5IUSA 3W9EB 5TE6L 4P59H 5DEFB 1PX3A 2K6WA 3MJGX 4LLUA 5F96L 4P4KA 3BPLB 4QRAA 4O2FB 3QUZB 3BIAX 2CLRB 2D0FA 2ERJC 3ZPDA 3K74B 1Z9SA 4Z7WE 5DRWB 3IFOB 4XPBL 5D2NC 1NC4B 5G4OA 1SN0A 1XGZA 5HI5C 3ULUE 4DIXA 4J23A 5IF0A 2WO3B 3GUTB 2PTTA 3PLYA 3EYFB 1RZKL 3AY2A 1JFQL 1NBVH 1BM7A 2O5ZH 3FUHA 2XI9A 3D0AA 3HUJF 3MRFA 4I77L 1QVOB 1CI5A 4AV4A 1RD6A 2ICCA 4J3BA 3VXTB 2H8PA 3NJHA 3WLBB 1BZDA 4MDIA 4PJ9B 3WV0A 1EJFA 2Y7LA 5IQMA 3B3IB 5LXVA 1R5VB 3TBYA 1AFVH 3FB6A 3S37X 3GI8L 5HI3D 1WAEA 2DI7A 4JFEB 1YEDA 2Y7NA 4GP8B 2OI9B 1INEH 3UIYA 2IANA 4ZW5A 1U4EA 5KVFE 3NBNA 3HG2A 1RMFL 3QQ9D 1YNTB 4UT7L 5ANMB 5B39G 2X3BA 4WHDA 4GIOA 5T33H 3KS0J 3LD8B 3TIDA 3R4RA 4WI0B 5D1XB 4XMZA 2JCCF 3ARBA 5F7AA 4X2UA 3P30H 2WW8A 1MFBH 2OMWA 2Q8BH 2XWJA 1FZJB 1MCIA 4MZIA 3LH8A 2FSDA 5C7XH 5L0QB 1GZQA 2NY3B 4Z7AA 3EO9H 3UGXA 2C1PB 1M2VA 1E40A 4I3GA 3U0TA 4N68A 1SEBA 5DA4A 4OD1H 3VRLE 2AEIT 2V5RA 3ESNA 5I0DA 5E8DL 3KLLA 2NUPA 4QRUA 3KNBB 5F7MC 3LZRA 4PJGB 4WFGD 5IROA 1LEGB 4L4TE 1G6RB 3I6GA 1EX0A 3NFPA 1FORH 5JHBA 3JV4B 3BFQG 4G72B 4RGNB 2QVKA 5DD6B 1V3MA 4CC1A 1I1AC 1A6AA 3ZE2E 4M7JL 4G6KL 4F9PA 2XV2A 4G3YL 2WCGA 1AP2B 1TFHA 3FN9A 1E30A 1KELL 1R3IH 4OGXL 3J07A 1DTUA 4LNVA 3HR5B 3RAJL 3M17B 2ZUUA 2EINB 2DIBA 4GMTH 1MVUB 3QUXB 1INQB 3IS0X 4JKPL 2LVCA 2KZKA 4J7RA 1GRWA 3X3FH 5IB3B 3B2DC 1HWHB 2XT1B 1UB6B 1OTUC 5BW7A 2ARJQ 2Z4QB 1T1YA 5CCJA 3QULA 1U8PA 1BQHG 2ESVE 2L8AA 3DX7A 5AVQB 1U41A 1ZHNA 3CFEA 1N0LB 2DS4A 4LE8A 3TPUA 1XO8A 3BKJH 3CVIL 5DFVD 4EUPG 3GSWA 4Z0BL 4NSKA 4PWIA 4JPWL 1U3JA 2RQ8A 4YHLL 2DIAA 4LCWA 3BUPA 3DDFA 4OLZL 3B9KA 5IEHB 2FUTA 5E99H 2C4FU 3KPRA 4P2AA 3SDXA 1DJZA 3QUGA 3QYCA 3W38A 1VEMA 3ZHLA 1C5CL 1ETZB 1FNEA 3BP5B 2ZAGA 4FLHA 1HCYA 1ASOA 2WQSA 1N8ZA 2Y72A 4JPQA 4KDVA 4S1RL 4UOQA 4AIZA 4WWID 4YBQD 2A38A 3B2VL 4GW4A 1P7BA 2OYKA 5BPPA 3UTTD 2XBTA 3G7TA 1SLXA 3FL7A 3MUUA 3KXFA 5C0JA 4Y1AB 1T03L 4LNRA 4FFZA 2BSED 3UAFA 3NACL 2ZCZA 3KWXA 3QEGL 4RESB 5C6TH 5C0GB 4F15C 4QYOB 3D85A 1SYSB 3WDIA 4B9PA 5D8JH 2YGVA 5KSVB 5AW8B 1J11A 4GI8A 2CWRA 4PBVC 3B7SA 3SDAD 5EU5A 4IMLA 1DFXA 2PCFB 4YNYA 4FZ8L 2MSPA 4XHJC 1E7UA 2OCFD 2LU5A 1XZ0B 3EGSB 3D6GA 4RWHA 3SE8L 1DE4B 2W8CA 4YSQA 1UHVA 1JZ2A 5IHZA 2P49B 2F68X 5B1BB 3S35L 1YZZA 3MOQA 4A63A 2QADC 5EBMB 3KBPA 5BVJA 5AB1A 3IU4H 1Z3GL 1IAIL 2EXWD 3QPQC 1TETH 1DVQA 1XH3B 3UC0H 1EXUA 4JPSA 4JPKL 2W65B 1VPOH 1ZJAA 2EVJA 5LAPA 4PS4L 2PP7A 1M71B 1TZAA 2VLJD 2WYZA 1TYJA 4I9WE 4NT6A 5F70A 4BQBA 1B9KA 4UNIA 5I1DB 3ARGA 2VXSL 4Y5YC 1KV3A 2X6BA 4L9LC 5AW7B 2EDQA 4QHKJ 5TGBA 1Z5HA 5ACZA 5SWZA 4P46C 1AD9A 2V8MA 1CK0H 3TBTA 2EDHA 4LEOA 1GTFA 2VIRB 2YAPA 4QRTB 1HESA 3RWEA 4N6RB 2CPUA 3O0LA 1MDAA 4XWOC 1MAKA 5JLZB 1QA9B 2L7QA 3WMQA 3QWOA 3GGWB 4JR9H 1NUNB 5GGRB 3GBEA 1R6VA 1PZSA 2GUOA 3NJLA 4DEUA 2IFGA 4NPYA 3G6DH 2Y0SA 4JHUA 4LSVH 5JHDD 3CBJB 4EQ2A 2BNRE 2JKJA 3BC9A 4MKMA 1O7SA 5IY5B 3KG5A 3GZPA 3DOHA 3JVGA 2B4CC 1UATA 2WWMD 5GJSH 4WUUE 1N6QH 3AGWA 3CDZB 4MB4A 5FM4A 1RVFL 5JUEH 4XBEL 2GTZB 1YEGH 2QQLL 1AQ8A 4M61B 3DVNB 1B9ZA 1GGIH 3FQWB 5CIPH 4CUCA 5C0AB 4WDIB 3KWVA 1S9WA 2AEQH 1WZMA 2VDNH 4X6FA 5GGTA 2DQJL 4FKEA 3OAZK 5AVZB 2C3HA 4A2LA 1I1FA 5IFHL 2CGZA 1HNFA 3F7LA 5H37G 4X98B 4FNLH 5GS1A 2CCVA 1YEEH 4OLUH 2AXWA 1CGSH 1PU0A 2P8MA 4JGUA 4U1IB 4CVWA 4Z7IA 5I26A 4Z23A 4D9LH 3GRWL 2XYBA 2GJ6E 2Z93B 5B38B 1URZA 2JKIS 5KJRH 1YEHH 2KZBA 1VFAA 4PJBE 1IGML 2A9NH 3SPGA 1JXGA 4IJTA 4WWOA 4DO5A 3GD1C 3U46B 3GWJA 4HBCH 3SE6A 1P53A 1CTMA 2Y23A 5IHUH 3VO0A 2VLRD 3NSXA 5I82A 3K8KA 5AOIA 4Y2OB 4WW2A 4NQDB 1XSJA 4XBPB 4YQXH 3D3VD 5DHVH 4H8WL 3O4LD 3GEFA 3SGEI 3MBEA 1P1ZB 1HHKA 5FKAA 3W82A 1BXVA 4N8VB 3SBQA 3IBEA 3NIGE 5C07A 2Y3NA 2PWFA 4MS8C 1G7HB 5T1LB 3GMPA 1E90A 2XU9A 2O61B 2XFGB 1E6OH 4HS3A 4ZTPH 1QWHA 5KZCD 3X3GH 4Z7VE 1I1YA 4X5PA 3RP1A 5DRZB 1IM3D 5TH2B 1LJMA 3MJ9A 5KEZA 1OE1A 1R5WB 4DF9A 1S7XB 3D30A 4HGWB 5IR1B 2VUYA 3B7TA 4M1DL 1E9PA 4AYBA 1TZ8A 1OB1B 4AMKH 5AW4B 3K46A 5I8CA 4OZFH 4AIOA 5HYSB 4ATWA 3D05A 1NJ9A 3VFRB 4KTYA 4JW3A 3VRIB 3UTOA 1YJDC 3S34H 5C0CE 3SGEH 1DZ0A 1FVCB 4L1SA 3OLEA 3FH5A 5KSAA 1H3UA 2HCZX 2QSVA 4JM4H 4N2GA 2LGNA 4FMKA 5FYJD 1NCWL 4AQ8A 1S5HA 2DMGA 4ZUUB 3BUTA 4JM2A 2ZG1A 2ZCKL 5HGAB 4F15B 1UEMA 5LQBL 1C5BH 3RTQD 4IU3B 3CX5J 4OZ4B 4PV1C 5B7FA 5F7EL 3SO3C 2EDBA 1UT2A 4PJIB 2NNAB 3ISRA 1XGPB 2GY7B 1YEJL 1CI3M 3C5ZB 2X1XR 4IKNA 1S7WB 4PJ7B 5I66B 2MKWA 2KPWA 2UY7B 4N5EC 2YQBA 2YKKA 4XB8A 2VL4A 3QAZB 5CU5A 4OD2A 3T4YA 1MHHB 4NENB 4MZRA 3WMPA 4ZMOA 2QADB 1FIEA 1PG7L 3HB3C 3QIWB 5HI3C 5T1KD 2W5PA 1UGNA 3V6OA 3PHOA 2VZ1A 2A6DB 4POYA 3HZVA 3EH4B 2PN5A 1X5MA 2AJ3B 2OW7A 2EE3A 1S5IL 1B0RB 5BRZE 4HS8H 1UT9A 4LXFA 3AUWB 2BXYA 3ARPA 4N8VG 2ZYSA 1UTDA 2A99A 3BIBX 3II2A 2Y07L 4HJJH 2KLRA 1E2ZA 3MX0A 4JFWA 3F84A 4L9LB 2OMTA 4KI5D 5EC2A 4H5SB 2BP0A 2ZPKL 3FTUA 3FU6A 3OF6D 3WS6C 4FXLA 1NBQA 5I16B 1Q0XH 2D4DA 2G30A 2ZKWA 1KFAH 4XO9A 2Q1EA 1MCQA 1AGFA 2G3MA 2WP3T 3WDHA 2J88H 5BVPH 4ZTOH 1W80A 3AWGA 3RWCA 3FT4B 3KLHD 2MTPA 3DECA 1SJEB 3JXAA 4OJFL 1D5RA 1VHPA 3SB3A 3VXOA 5ID1B 2YN3A 3H42H 5BQDA 4DEPB 2IBZY 2W0KA 5I17A 3WXWL 3CFKA 1N5YH 2E7LC 3LKSA 2YOAA 2NYYC 2OCCB 5AQ0A 2UZXB 4XNMB 2YEQA 2LHAA 4U0RC 1ZGLB 4ACTA 5DVMA 4DGVH 2J8OA 4WV1C 3MV7A 1Z6JT 4E2OA 5K9JH 1SRDA 4H1LB 4J3VA 4E9RA 3VFVA 5D2LE 1ZIBA 5EUOE 4AC2A 3DX9A 2QR0B 4QTIH 4WENB 1NFDB 4JGMA 1T5WA 1JRHL 2I60H 1A0QH 3T0VA 4I4WA 5D2NE 2MOGA 1C7SA 4UZGA 1ZE3H 5I18L 3FDWA 1HFUA 4K5NA 5AW3B 3M1BA 4M6ML 1XF5A 1UASA 4AMWA 3UTPD 2HRPH 1H3PL 2GABA 3CIQA 3APDA 1Q1JL 2PW2B 1U58A 1WICA 2BOBB 4WSKA 5DQJB 1BMWA 1NCUA 5A3IC 43C9B 3ARFC 1R3HA 4Z7OE 2DAVA 4YO0B 3T6XA 5TPWL 3VXSE 1S7TA 4GLRI 4M6NL 4YVUA 3VAEA 4I0PD 1EUUA 2ZG2A 2PXYC 4JQXC 4KGJA 4M02A 5EN2B 1JCVA 4YSDA 5FB8A 1EMTH 2F9BT 2IC2A 5AB2A 5IB1B 4L8CB 1EGJA 2FCBA 4H88L 4ZW3A 3U7WL 3RDTB 5B3JF 1NCNA 3S98A 4ZD3H 1NL0L 4HW6A 4X4ME 1UD2A 3DPDA 4LLQB 4JFXB 1FVDA 1NZRA 1OCOB 1JN6B 1DFBL 4PYGA 4PJ8C 1YPZB 2ZOUA 4YWGL 3HR6A 4X6DB 4HZLB 4IOIA 4NO3A 1DN2A 3U4BL 4MBRA 1G7JB 4LSQH 5BQ7A 5BS0A 5HHNB 2V7HA 3NCMA 4GKNA 4GNKB 4UYPA 3TOPA 4CGUB 3FQRA 1MUJA 3TO2B 4DAGL 1EEUA 3N2JA 1UA7A 4YSPA 1CD1A 2P24B 1IBGH 3IXTB 1BLNA 3OAYK 1MIEL 4UWQB 3TZVA 3GBNL 3T2NH 4BWTA 4JRLA 4V33A 3U9PL 2DYPD 1CLCA 2JELL 2N3JA 4GLRH 3L95A 5FAAA 5KS9E 4KTDL 3QEQD 3RUGA 3FSZA 2OQJA 3L4XA 1U91A 2VDMB 3P3SA 5AAWA 4H1LG 4HPOL 4PGBA 4M7ZC 1NSNL 3FTSA 2Z31C 5FFLA 3BZEA 1KLUA 3OZKA 4H8WC 1M56B 5J1TC 4CADB 4EDXB 2PP9A 4C4UA 1FL5B 2HLFD 3ETTA 1PY0A 2J8UB 4FJ6A 4RMSA 4X0KA 2XPGB 4NQQA 5BRQA 5TF0A 3G04A 5C0FA 2FATL 3WAKA 1LO5B 2QTEA 4OCYH 4ZPTB 4FXKA 4Y5XA 5HI4D 3ULSB 4EVNB 5LHDA 3ULVF 5IJCC 3QJFB 5FDYA 3UTZA 4AXWB 5AG9A 4K71C 3QR1A 3ZQWA 2QKIA 4RETB 3QIBD 2Y3AA 2NY7L 1RPQA 4DO4A 2BJMH 4YPGA 3SO3B 4L4TD 1ZV2A 1O7VA 5D1ZD 5F3FA 5AL8A 4G9DA 3ISWA 5GS0H 1GSKA 2CUIA 5I1LB 5E08H 1FG9C 1LVEA 4MQXD 5HTSA 4FL4C 4PY7B 1KV7A 4KU1A 3FU7B 3GSUB 4BFFA 2W1NA 5E0QA 4QLWA 5MHSE 1H15A 4OI9A 2R7EA 1UD3A 3B6SA 4YS4A 3DLQR 3LIZA 3QDGA 3F58H 2KT6A 1QBAA 3QK0A 1HHHA 4P05A 1DQJB 2JLLA 4HU2A 4NUMA 2WB7A 2EYTA 2ESVD 1AGCA 1XBRA 4A6YA 3ZXAC 2EVGA 4XPTL 4OM1L 5CZXD 1ZDSA 1LWHA 2ZUVA 4P5TD 3V52L 3VFWB 3HE7C 1SFHA 1AIZA 1IQDB 2NNFA 1XBDA 3W39A 1MF2L 1SVZA 3SDYH 3EFDH 1I3GL 1KDIA 1CLOH 1SYVB 2XYCA 5A7BA 5DS1A 2B15A 2CR3A 2ZTBA 4B9CA 3WKYA 3GIVB 3FW6A 3GNML 3VH8G 3VYNA 5IJVB 1KYOJ 3P4OB 4LRNH 4YUEL 4F33B 4G9FE 5IESL 2BFVH 5EZOL 1OPOA 4HV8B 1KYDA 3HZKB 1ZXQA 1PZCA 4PJDA 2CUHA 3C8HA 4UT9L 1X5GA 3ZTEA 1RFDL 1PQZA 3T0ED 3I2CH 1T89C 1P4IH 4KY1H 1HEHC 1KEMH 2XSKA 3N42B 2V5YA 3IETA 4NI6A 5FGBA 3QUML 4FG4A 4E41A 3QXUA 4OJCA 4BK4A 3UCQA 3H9ZA 1FBIH 5I5IA 3T08A 3SQBA 4PJHE 1Y07A 3WFEH 4R90L 3SKMB 3PWNA 1A6TA 1BBDH 4MBOA 4Z78B 1SBBA 5JPNB 3PYCA 3BQUA 5ESAA 5FS5A 2R2BA 5GRZA 4YHYC 4A68A 1HYSC 1U2CA 1KIRA 4JVWA 4Y16A 5DF0A 1H3TA 3T0DA 4GH7B 4RLDA 3EYVB 3OLDA 3ZTCC 3CK0H 1OP3H 1X5ZA 3LKRB 3ARFB 3MA9L 3P4LA 2FEEI 5SWQA 5J11C 2GC4C 2B2XH 3NN8B 4G80B 3QIUA 4GBXC 4BCZA 1OCRB 3TNNA 1VFUA 5LBSA 3FB7A 3BP6A 4A7GF 1AZNA 3HE6D 1FH5L 3T2OA 1JPGB 4JHBA 4M6AA 4I9WD 4KVCL 4ELKB 1H19A 4LLVB 4PVMA 2X4QB 3QYMA 1FIGH 1EFXB 1QFUL 1YNLH 1HSBB 15C8L 1NEUA 4MD5A 3CNKA 1JDCA 1P5VA 2NOYA 5EZLB 4I13B 3TO4C 3T2QA 1T22B 1VACB 2F15A 3UTTB 3V4PH 2VLLA 2O6PA 1AI1L 3JTSB 4OF6A 3O2WH 1JD7A 3F7PC 2GC7C 1E9QB 1V5JA 3BKCH 1M6OA 2CO7B 2J1YA 4XN9A 3VVWA 4PGEA 4GG6A 2IPTH 3HBQA 2W07A 4TVPH 3VQMA 3WKMH 3S8GB 3RX7A 3D9AL 2J72A 5D1QE 4GRMB 1IAMA 1EJOL 2B1AL 3TYGH 1W0WB 2JNZA 3LY6A 32C2A 1HQRA 4DCQB 3BX7C 1UA3A 3ZW3A 2FIKA 4EI0A 3QRGL 3WGVB 3G6JB 4G7VH 1GJIA 2OJEB 2VDRB 2AEOA 4UANA 3C60D 4V1DA 3RFZB 2DOCA 3MR9A 3P4MB 4A7VA 3BUQA 3SGKA 6FABH 2BRQA 2X9WA 3B2UC 3DTXB 3BCDA 5I71C 4AK1A 1MY7A 4U1JB 2VLJB 5BXFA 3FB5B 1EHAA 2E3VA 3P0VH 3RPBA 5I5MA 4FZEL 5D7KE 5IVOA 3AM8C 2GITA 4XB7A 3S2CA 2GJ6D 1CS6A 5FWQA 2FJHA 2XRAL 4K71B 3A6BL 2HX8A 3D2UA 3BJ91 2VXQH 2YAEA 1TTAA 2G75B 4C58B 5KN5A 4XCNA 5ERWB 4D9QE 4DGWC 4RFOL 4HWEL 5JOPD 3ZDYF 5FECA 5D96B 5H2BA 2J1KA 4KXDA 4PJEE 4Y2NA 2OL3A 1ETB1 1NA8A 4FL4B 3KYAA 2WHVA 2HA1A 4HJIA 1DUZA 1T2XA 2CA3A 5L8LB 4HIJB 3PWJB 4DKDC 5CF3A 3OKKA 4PP2B 2CLVB 2QPDB 4GOSA 2YPVH 2J3SA 3GMMB 4HWUA 4QRPA 5DD5L 1C12A 1QHPA 1YVLA 3UG5A 4WU7B 2WKLA 1NOLA 3WFHA 2XWTA 5B21A 2OM5A 1CICC 2I26N 2ZP8A 3LPFA 5IWLC 1NCAH 5JA8B 2IADB 4P2CG 3N3EA 2F7QA 3HE7B 3M88A 5IV2A 2GBTA 1AOHA 1KGJA 3FC8A 3MV9B 4FABH 3NDZE 5FF6A 4MCZB 3DHPA 1A22B 4Q0XH 4N3TA 2NDFA 4U3CA 3L1FA 4URTB 4JFFD 4P4RB 5CP3A 4AGNA 3DPBA 4XVSH 4ZS7H 2VISA 2J56A 2VQTA 5KUMA 1RK7A 3KYKH 3LKPA 3PG2A 3PWUA 4Q89A 5KYUB 3VXQB 2X4TA 4TSBH 1FVEB 1TLKA 2YD8A 1G7IA 3BO8A 1WH0A 1EWHA 1KGYE 1A7PH 1OLLA 2QGBA 4J3SA 4AZ8B 1DP0A 4HUNB 4EI5C 2RALA 5I75C 2CK0H 4JREC 5L4JA 5KTEL 2VZSA 5EOQH 3TVMD 3SPVB 1K2DA 4PRIA 4OZGF 1G7MB 1HILA 4MLSA 3IVKB 5FYJU 3HLAB 3D3VB 3GF8A 1NGQL 4F58H 3NPZB 4MWFB 3ES6A 3HC4L 5DJ0A 3OKDA 4JRXE 1LTXA 3RIKA 4FA8A 1WTGT 2PPAA 5DD3L 5CEYA 5FO8B 1H5BA 1O6VA 3L5HA 5IOPB 1OP3K 3FO1B 4NKIL 5CN2A 2OMXB 4YHYB 1B0IA 3GSQB 4R3SB 3CVCA 3AY4A 3BWZA 2MNJB 1PNCA 1RI8A 5E8EA 2BVOA 5KZCB 5JPMB 1BQLL 3I02B 5J11B 5KSBF 5K1VA 4KUZH 4UV4L 2I9TB 2BS9A 4NKOB 3OSVA 4FLQA 3LV3A 4F7EA 3EJRA 5CEZD 2VR4A 1U4FA 3ZYOA 2XCMC 2GT9A 2ZKHH 3K72A 1JHTB 4FFTA 5HVHC 3QJTB 4H25B 3VTTA 4TUUA 4KH9A 4RDQF 3PABA 1NINA 3WY2A 4N8UA 1B4JL 3BSGA 1YMME 4ZPVA 2WLHA 2UWEA 3TO4B 1QTSA 3EDJA 4H8UA 3MNWA 5F8RC 2P5WA 4M4RB 2Z35A 5C9JB 1QKZH 4LL9A 4Y2LA 1AVAA 4KXZI 1G43A 1HXYA 4A39A 1WWAX 4OQTL 2R83A 1TVHB 4KDTC 3QEHB 1IBYA 5DWUL 1LK3H 4I1RA 3QQ4B 3KLKA 4APXA 3QHZL 1N68A 2YD5A 1W0VB 3RTQB 3QXVA 4BHUA 3QCVL 3SBWC 4QF1B 4Y9CA 4XNZC 4APQD 2VMEA 4P2YA 4WKZB 4X5WB 3UPCA 3ULAB 1OAXL 3BP4B 4M8RA 3UADA 4K8RC 4XXDB 4NOBA 1AQKH 2QQKL 4MQXC 4NFDA 2FWOB 2HTKD 3ZRSA 5I0XA 4F8PA 1FF5A 4G43A 4MD4B 4OKVA 4JB9H 1X6LA 2OSLA 1RJYB 5T1KB 3KDPB 1JZIA 4DH2A 4HLZG 3HI1A 2ZXEB 4Y19A 1TQTA 2VM9A 1OM9A 1MQKL 1UFUA 2YS4A 4WHTA 5I71B 1Q0YL 3EFOA 4FNSA 2D2CC 2VN6A 5EWIH 4M03A 3Q44A 4KQ3L 2V7NB 3AMLA 5GGTL 3LEYL 2QBWA 2Q6WB 1SEQL 4KXZH 4L3EA 2PYFB 2X6UA 5EA0L 1A02N 2VDPH 5GIRA 2XY1A 5HJDA 4B9IA 2D03L 5IKCB 4R9HA 3DXAA 2WQAA 3VXSD 4HH9A 5GRYA 5D70H 3CFIC 5DU7A 5FX3A 3T71A 1WFNA 4R4BA 4PJFB 5ETUA 1A9EB 1E6JL 1XXFC 4IBZA 1ACZA 5KVDH 5E0FA 5MP6L 2LTQC 1JDAA 4JG1H 4KNQA 1EO8L 1RP8A 1LQBC 3NIFB 4HBQA 2BCKB 4UBDC 3V0EA 1CG9A 2P5EA 2QVFB 1UM6H 3ARBC 3T0EC 4OD3H 1KXQE 2D0GA 1JK9A 3FQ4A 2R9HC 1XV8A 1AG0A 3FSAA 4WGKA 1ITBB 1J8SA 5EU4B 3VFPA 3WLWC 1QHQA 4D9RE 4WEBL 5D7EA 1S7SA 2QQQA 1CICB 5CEXA 5MERA 2HUHA 2IGLA 1W72A 1U93A 3HHRB 1I8IA 3LNIA 3X2QB 2ZP9A 3PAZA 4AK2A 4OCRH 1YECH 5B3NA 1G1CA 4TUKH 1GZPB 1GW6A 3WXVL 1S7QA 1MFDL 1UQSA 2DKSA 1THCA 5B4MD 2BNUA 1QI4A 2BMKB 2ZONA 1LD9A 3FS9A 2AJUH 3MJ9L 2VXVL 5E94B 1Y6MR 2AGJL 1E3XA 2XG4B 1OALA 1WT5A 3MBXH 4NDMB 1MZZA 3I85A 4P2QA 5EORL 2DM4A 3CBRA 4FQIL 4R26H 2V3DA 3U6XA 4F9PC 2JQAA 5DTFB 3D5OF 5LG1A 2Z1PA 2X2YA 3BSZH 3FH8A 1YA5A 3DRTB 3EO1B 3JTBA 3VB9A 4AKQA 3KCPB 4NWUH 5KSUA 4RFEA 3SQRA 2HFFA 3ZTJG 1MIMH 1LYQA 3UBXI 1JL8A 2EEAA 3PP3H 4M56A 1IM9A 4R2GD 1G9MH 1NMBL 4FE9A 3CSYA 1BM3L 1JMZA 3DX2A 4KJQC 5C6WH 1OTSD 2HLAB 3HUJA 1J86A 1E27A 3DTDA 3WE6A 2CXGA 2AEPH 2HTLD 3ILDA 5GRJH 3S37L 4G8EA 3VYPA 2EZ0C 5JORB 5DJYB 3B9KC 4ZNCD 4YGVB 3F04A 4U6XA 1KTKE 3BEVB 3MV8A 2YD4A 4XNYL 2X4RB 4UDTA 1GGCL 3IN0A 1IGYA 3QNFA 1NCTA 1OD9A 3K7UA 2DYPB 3MO1A 5B1CA 3QDJA 1AKJA 4KWUA 2IAAC 3QEQB 2AJVH 2VITA 4TL4A 2GCYA 1D5XA 3VE0B 3ZTNL 2NYKA 1XGRA 3MRGA 1USZA 2XLLA 3FOMA 3NGBB 1QYGL 3GFUA 4E9WA 4R7DB 5KAQG 1FFPA 5DJZB 2JCCA 2OTUA 2ZNWA 5INDA 2I7SA 2WM0A 3KWTA 1LM8V 1JV5A 4L0PB 4KKPA 4AEIH 4XH2B 1QQDB 2OS7A 3TV3H 3S3BB 2DQIL 3LRKA 3MNZB 1M53A 5A6MA 1BJ8A 3IJEB 4TVSa 2PWHA 3L1OL 2BVTA 2WD0A 3QIBB 4G9FD 5DJ2B 5DLML 4OCXL 4XNZB 4L4TB 4AYID 5EO1A 5D1ZB 4QHMA 1CFVH 1COBA 1URIA 1ZT1B 5F6HJ 1VKXA 1E8YA 5E6ZA 4CL7A 3CCHB 3P11H 2EIDA 3DJRA 2Q3XA 3DK2A 1KCBA 1ACCA 5C0BA 5G4MA 4G6JH 4F8OA 3PREA 2HT2D 4HMEA 4IRJA 4KJYB 5CKGA 1J05A 4NWTL 2NT0A 3LOWA 4PS8A 5EU6D 1B90A 3A47A 4K73A 4ZFGL 2DQFB 1OSZB 2BIIA 3V4UH 1YNTF 3ARGC 4FFWD 1A66A 3ROOB 2IFFH 4UT6A 3JWDC 3MXWL 1Y0LB 1ONQB 1F1GA 1AGEA 5KBDA 3U7AA 2AZAA 2ESVB 1DDHA 3U0WL 2OK0L 4OZHA 3VRJA 3FQXB 4XZUA 2H2SD 1U8IA 5HJ3A 3WN5A 2P80A 1L9NA 4HT1L 1BA9A 3VQLA 1YUHA 4AQAB 3GUFA 4KK8D 3ARWA 3DIVA 5I8OL 5CWSA 4PBWD 1SLWA 3I9GL 1U8OB 3DROA 5DJXB 3TJEH 1I53A 2YEVB 3VD5A 3BWAA 3E6HB 3GXUB 5CCKH 1QNZL 1JZHA 3IGKA 2I24N 1E5CA 2C1OA 5DJAB 5FC9A 4M7LL 2BIMA 3DI3B 3TWCH 4F8LA 4HLEA 3IGAA 2D7TH 4WCYH 3IDMB 4HGMA 1CIDA 3F2LA 4PJGF 1A7QL 3T0XA 4O2CA 1RULH 1FC2D 5I8KH 2J44A 5D72H 5CLXA 4NQCA 2ZKYA 1EGJL 2PO6C 4GW5A 2ITFA 5HHPB 1NCDL 5LNEA 1HTYA 4XN4A 4L0ZA 3SPCA 4FP8H 3T0EB 2XKSA 5E2WL 4KK9C 4G5ZL 5AOJA 3MXVL 5HYJE 5F2FA 1AIFA 3TP4A 3BZ4B 3U2IA 1R9FA 3MRDA 3T6WA 2LT9A 4QHLB 1IBDA 4UM9B 3HW7A 4AQ1A 3DRQA 4Y7MA 1RIVL 5D1QD 6PCYA 4OW6A 4S0HA 2ODHA 1ILUA 2GJRA 5LGHH 2MFNA 3IU3B 4FNQA 1RK0A 4EXPX 3DOSA 4OKDA 1LEIB 1BQSA 3AQZA 5AVYB 2F6AA 5CJOL 2F53A 4ZDHB 3MLXL 4LCCC 4RRPM 4YHIB 4E42B 1Q94B 2NR6D 3FUFA 2JJVA 2WNXA 3CVHB 4HIEB 4XMLH 1F4WH 5HHVH 1D7FA 2NY0D 3V0GA 2XZAH 2HG5B 4H7VA 4W70A 2O5XL 5FK9B 5DMKB 2IDTA 1HL9A 2CGYA 3V0FA 5ISZA 2FQEA 4FADA 3JQOB 3MBEC 1IC5L 5DR5L 4AH2A 3MLZH 2OX5A 5D7KD 1E4KA 2FX7H 4FJZA 5E6SB 1H3VA 1PJWA 1BGXL 3FFOA 3UC2A 4NQTA 3TIEB 1Z5LA 3IDXH 4GP4B 1UWEL 4Z0XB 4D9QD 1JGVH 2JTDA 1FFRA 3U4AA 1I7TB 1AH1A 3UJTH 2VDOL 3CFBB 1EBAA 4L9DA 3H4FA 4PP1C 3T65B 4DOHB 4EIGB 3H9HA 3K6SB 1F4AA 4XI5D 4Q9QH 4PRDA 1QWNA 5JNYB 1OKEA 1CE1L 5LO7A 3A6CL 5J0BA 3K6NA 2OW6A 3Q6GH 1ZLSH 1QHOA 4NQSA 3RL2A 1IC7L 2HJKA 4AVJA 1LNUA 3LZPA 5HGGS 5BOJA 5AKTA 3LN5A 4Z7UE 1HAUA 1RP9A 4K9JA 3TBWA 2OYPA 1N6UA 3C60B 5EO9A 5PCYA 4CSPA 4WW1A 3LIZL 3WFDH 1UD4A 1T0NA 3DVGB 3QP3A 4QY8A 5IK3A 4HHGA 4PGDB 4FNUA 4KJWD 4LKCA 4TUOA 5DFTA 1KGIA 5KSAC 1JUFA 2VDQL 3LHPL 5EV7A 1JI2A 2WBJA 3FO0H 4A6YL 1G4MA 3KPLB 4AGMA 1T1XA 2EDLA 2JXMA 3TFBA 2IDUA 2XZQH 3GO1L 1UVQB 4JM2C 3AGVA 2X4OA 3D0LB 5AZ2L 5EFIB 5G5DB 4M4PA 4PIRF 1NGWA 1UUSA 4O02A 2NW3B 4DKFL 3MLRL 1TU2B 4TN9A 3MU3A 3EYSH 3JT2A 1K5NA 4G70B 1QLRA 2AQ1A 3L3KB 5ADPH 1A1OB 1WEJH 3DHUA 1UKSA 2YQGA 3MBWA 2OJZH 3CZKA 4PIBA 4QXGH 1UACL 4XOEA 3FYEB 5CKAA 5L9DL 1MFMA 3ME0A 4J4PC 4BEIA 2Q86B 3KYNB 4XP6H 3WY3A 3GMOB 5GRUL 1MCBA 2XXGA 4HULB 4G82A 1DQQB 1VGKA 3V6OC 2G9HA 3INUH 3VG9C 3HNTL 2K6YA 2VWEE 3LZNA 1KBGL 1TEYA 4ZAKD 2FNWA 2F7PA 1NFIA 3VD4A 1M42A 1MG2C 2NY4C 2P26A 4LASH 1U0QA 2VABA 1UWYA 3CDYA 4P06A 3CXFA 1EQWA 1MJ8L 5F7HA 5K33A 2EYSB 2DMHA 1P0SE 2ITCA 3QVAA 5CHNA 4J6RH 2EUVA 2GJZB 4ZZFA 4PLKD 3QDMA 2X6VA 1K8IA 4NQEA 4LEEA 4C8XA 1OSPH 4K3DL 4UCFA 5DRNB 2V2XA 3GBMH 4JFHE 2RMNA 2ID5A 3UP6A 4TLTA 2FRGP 1WBXB 1LO3H 1RPUA 4JFFB 3EUDA 1ESOA 3MRBA 1RUQL 3GLDA 1F11A 4Y8DC 5ABZA 5LBSL 4NP4L 2BK8A 2M8XA 4N9OB 4NUJA 5E5UB 5C0NC 4I48A 4QGTA 1YMMD 3FSWA 4QXUH 1MPAL 3PIQB 2FQGA 2PO6B 2BOCB 4IRZA 4P04A 2NY1D 4NO0B 3T3MB 3EBGA 3SDDA 4FQ1L 3WIFA 4B50A 4Y8AA 3NEEA 2WQUA 5ENWA 4WY7L 2DDQH 4JK0D 1HKLH 1JZ8A 3D25B 2EVIA 4NHUA 2PYED 4UINH 3BZFB 1ORQB 4LGPB 4BCXA 1KT2B 1MNUH 1OAYL 1FAIL 3IMVA 3EF7A 1B2WL 2QVIA 1EEQA 4GAJL 1SUJA 4AL8C 5BOZG 2F7OA 4ZI8A 1OARH 1XGYH 5E8PB 3TJHD 2YBRA 2MH4A 4XC1H 4GXVL 4LCCB 5F3BA 2OTWA 3CH1B 25C8L 3N9GH 4N85A 2Y9RT 4FHKA 4N0UA 5MEPA 3SE4A 1XR8A 1QLEB 2DM3A 1HNGA 4UM8A 3EJZC 2JKXA 3OAWA 4PW4A 1RJLA 4FC3E 1TT6A 4Z3GA 2G4GA 2IANE 3FB8A 3EHBC 2APSA 4D0DB 2OSXA 4IBTA 1H6EA 4KROD 4M5YH 1BZ7B 5IQ7H 4J39A 5FYKL 4RAUB 4DFHA 2DQTH 3MRQB 4Y9GA 3TLRA 4RGMB 2X6CA 4UDUB 1Z66A 4D8PA 1TNMA 4FQQB 5IQNA 4PUBL 3B2MA 1UXSB 1WITA 3AS1A 4EN3D 3GXMA 1OGTA 3KPSB 1MCWM 5IB5A 3IDNA 3VWKD 3BN9C 2FYVA 3TTSA 1RZ7L 3EYUL 3Q6FA 4IOSD 3MRPB 2BO0A 1CFQB 2GUYA 2WXQA 1KTLB 5D5MB 3DX3A 5DQDH 2XY2A 3FO2B 3TZVC 1ERNA 3MRLB 4YXLH 3WYRA 4AV0A 4APQB 2VW6A 3AZUA 2OL3L 4QHNA 5B7MA 2VTFA 4PJIF 3QAQA 2WNKA 4GAGH 4ODWA 3CVBA 4D0CB 1Q72H 5DVPA 2NTFA 4PJ7F 5AAWC 4XMPH 2Z65C 2NSXA 2A6JA 1Q38A 4N1EA 3PJSA 4PRHA 3O3UN 4LMQE 5F7DB 5C92A 1JVLA 4DQOH 5D7LD 1E8WA 3HAEH 3VSVA 3IF1B 1A21A 4BH7A 1IGCH 2ZOKA 2HT2C 4D9RD 1JNJA 1YYCA 4XVJL 2DIEA 4MJ5A 2YRZA 1FHNA 1ICTA 1UH4A 3FT3A 1YCSA 3E8UH 1ETJA 1QLFA 3MRHA 4HJGA 5HYQB 3F64A 4PH8A 5F7KC 3K4AA 1EDQA 1E4WH 2IOOA 2F19H 2FWLB 4MLIA 3RVXD 2UXFA 5KVFH 12E8L 1HEZB 2DBLH 2QKIC 5AVSB 3NTCL 4XO4A 3QRFM 1IFHH 1BVLA 2MRYA 5HJGA 1MLBA 2HT4C 4U1MB 3TH2T 5AB0A 2BH0A 3BRFA 2FEDC 3EJQA 4FG0A 3UACA 3IXAB 2ZP0T 3QJQB 3SKJH 1LLAA 4GKSB 3PL6A 4FTVB 4LCWE 5HDOA 5TQ0H 3SODB 4HJTA 3SDXE 4JY4B 2GKIA 2H1PL 2ADIA 4N8CL 4BFGA 1E4XH 1M9SA 3ZQ9A 3MGOA 3BAJA 4WK2B 5JIQA 1KB5L 4HIHA 1YEKL 1QR1B 3EH5B 3KEHA 3GIZH 4NZTH 1K8DA 5ESVB 4OFKA 3GSNA 2VMDA 3RBGA 4YIQA 1DBKL 4CILA 1OK8A 2RBLA 2NYZA 3KXFE 3AU1B 1DSFL 1NCBL 1PKQB 2UZYA 3DHJA 2C3XA 1NFDF 4WFFE 2AJXH 4LLDB 4N6QA 2K4WA 1BOGB 2QFRA 4XNXH 2JJTA 4O9HL 4XVUD 3OVUB 3EYQC 4O5LH 1B0GA 1JGEA 3NFNB 1MCJA 1MWAB 5IOKA 4XP4L 4QWWD 1KBPA 4ZFZB 3HBGA 4DN3H 1HHGB 4ZFFB 1XF2B 3JYCA 3V5KA 1ZA3B 1OAUH 1C5DB 2XN9A 3JZYA 3PDDA 4PJ5D 4R4FH 1TTFA 5IM7A 3A4AA 2FQDA 5F6IC 5GGQL 2O1AA 1KXTB 1ZEAH 2A9BA 2ENQA 2NY0C 4D94A 2L3BA 1K5WA 2APTA 1KG0A 1CZ8H 4OGYH 3MJ7B 1JF1A 1GZHC 3CHXA 1TUPA 2AVFA 3U1PA 1BZOA 5J12C 5I23A 5F9AC 4DKEL 4UILL 4L5FE 4ETQB 3RZCD 1AC0A 4X99B 3E3QE 2R1WB 3KVQA 2X9XA 3O2DH 3KL3A 4OAWB 4XZ4A 2F54B 2FWUA 5I6NA 5EOTA 4IYKA 1Y1UA 4AIXA 3WAJA 1TJXA 4PI0A 1BCIA 2DV6A 5SWZE 3BQUC 1J1XH 1YNKH 4B41A 2R51A 1YPZF 3BPNB 3O6ML 4FI6A 2CIIA 4X6DF 1T83A 4N8PA 5J13B 4A2EA 2YD1A 2H0JA 4XPHH 4LHUA 1XFPA 3DX1A 1E3ZA 2Z91A 3HCVA 5IEKA 3LEXB 3MLWH 4HDIA 4PGJA 2HH0H 3EG9A 1T2QH 2X4UB 1AD0A 3ZDZB 1OLZA 2PPFA 2DQEH 4BSVA 4MKTA 2UUDK 1H3WM 4GRWE 5LAXB 1QSFA 4F8NA 1NLBH 4FCAA 4JO1L 1H8SA 4MQSB 2R8SL 4QRQB 1N2RA 2D3VA 5IMOA 3MRNA 3QFDA 1PGRB 4LEXL 4PTUB 3EHBB 3QWNA 3KJ4B 4JRYB 1OW0C 4KQ0A 4FG2A 4YX2L 1SM3L 1DL7L 1TJGH 2BVPA 4X6BB 4DGIL 2Q7YA 5CGYD 2VERA 3EIFA 4P8QA 3LYRA 43CAB 4A2DA 3CLFH 4WFHD 5KVEL 2QSCH 1BP3B 1I3VA 3CVHH 1IARB 4OVVA 2N01B 1U8JB 4NLAA 4DZBB 4DVRH 2J8UF 3ZZSA 3IMBA 1MW3A 2VL5B 4RZCB 4NCDA 3LVEA 5E2TL 2Z64C 4ZMVA 1S3KH 1VAHA 1U30A 4JFOB 4M6OH 5HHXH 4HQQL 5KVGL 2QZ5A 1G7LB 4I18C 4JFQB 3TA3D 1OQOA 3GSXB 4H26B 1RZJH 4PVBA 2YFOA 3D08A 3CPLA 2WLLA 3AVEA 1S9YA 5CILL 1F8TH 3VXRA 4PCYA 1BPVA 2G60L 2QHRL 3PHAA 4UQ3B 1RPKA 5HYJD 3ENEA 4IQHA 1T66D 3SGKC 3O6LH 3VXMD 1KWGA 1UD6A 3CQFA 2KKQA 1JGDB 2WANA 2D7OA 4U1NB 5CZVH 4HCRH 1ZWIB 5EU6B 1IAKA 4ZMWA 3G08B 4O51B 5IVZA 1D9KD 5DUPL 3RZWA 2K1MA 2HMIC 4Y4KD 4ISVA 5J9PA 1SBSH 3D33A 4K94L 1W72L 1N59A 3UAAA 1NBZA 4JKKA 5C07E 1EXGA 3ZT6A 1GOHA 1QPPA 2VXTH 1IIIA 3ARED 3N1MC 1EXHA 2D31A 2WLZA 1OANA 1ZHBA 1D5BA 4M5ZL 4TVUA 1WAAA 2AXGB 1CE6A 2DLTA 4CSTA 4HJUA 2OJ1A 3FRUB 3HG0A 5GGUB 4L2LA 4NNPL 3P2BA 3DURA 4HUCA 3NRQA 2FNBA 5EULV 5EZJB 1IX2A 1YAIA 2HFGL 4A7GA 4BSWB 5A2FA 1TTCA 3PE9A 4ANXA 3TBVA 2AV1B 4ODVH 3K6OA 5KG9B 3ESPA 1M1XA 1R5IB 2Y06H 4X7CC 3DTUB 5HHOA 3MODL 2BSDA 5A2LH 3Q05A 1KIPB 3MLVL 1RZ8A 2X88A 3N42F 2ORBL 2WLMA 1NIDA 4ZMQA 1E28B 2R1YB 2WZ6A 3BAIA 4R0LC 2VO8A 2EXYD 2JKSA 3FHQA 3S5LA 3VJ6B 5KUKA 4XAWH 4JDVA 3BAXA 5CJQL 3QC5X 2LVEA 1URLA 3AXHA 1M05B 1KTJA 4R7XA 3QZOA 3MRIB 2KH2B 1KN2H 5IMKA 2FEJA 2R4SL 4BBWA 4PLJC 3F7VA 3V4VH 1RZGB 4JFYA 4B6ZA 5F9JA 3QDHA 4DP1X 3PV7A 3MRCA 3NFSH 4HEPA 5D4JA 1ZGLM 3B9VA 1CF8L 1JF5A 2NY0B 5D71L 5ALBH 3Q1SL 4KX7A 3IGFA 2YGPA 5IQLA 3V6OE 4X9HA 1HQ4A 5LXGL 4PJXF 1MH5B 5J12B 4AVHA 2CJSA 2JKNA 2PWDA 3QCTH 1GPOH 2APBA 2JV6A 1U6AH 5IGXH 3VXNB 1AS8A 5T3ZH 1SJVA 4JANA 1I31A 4R96A 1JZ3A 5D6CA 5HDQH 2GK0B 1U8HB 3CFJB 3DUUB 4AJYV 2I9LB 5F89B 4CU6A 4XN1A 1RUMH 3F7YA 1KCUH 4E9XA 5G2NA 1O6SB 5DZNA 3MCLL 3FQUA 1HWWA 4PG9A 4PWFA 3D39A 2HJLA 1NAMB 5JA9A 1YY8B 1MAJA 4KK6D 1TYEB 1HI6A 1FGVL 5JDJA 3KDMB 3MRKA 4W4OA 4JN2A 5EOCH 3GK8L 1DVFA 3WFBH 4OLEA 2QPFA 5CU9A 1GL4B 4HUWA 1D7DA 1RJZB 3HRZA 2P8LB 3VMNA 1Z9LA 4BUHA 4F7MA 3V0IA 1M7DB 1M7IB 5ICZA 5JQ6L 1A3ZA 1IZKA 2IAMD 3F5WA 1XF4B 2CO3A 4IBYA 1SY6H 1J8HA 4GUPB 1FH2A 2ADYA 2GFBA 4EXKA 1G0XA 3F65A 5HPMB 2V2TB 4EEEA 1T1WB 5E7FA 3KYOB 4UT6L 1ED3B 3GBLA 1CUOA 4NQVB 2L04A 1TZIA 2I25N 4YDJB 4B9GA 1LO4H 2YAHA 4ELME 3S2AA 4ZRGA 3KCWA 2G3NA 1ES0A 3V0AC 3VD7A 3ZIMA 4UIMA 2ZT9C 1OHQA 4PU2A 4RSYA 4F1ZA 3MROB 3TONA 3UH8A 4CNIB 2EIZA 4XAKE 3OV6A 4FLSA 4LEBA 1T0MB 5IB4A 1ITCA 1QX1A 1V3LA 1BZ8A 3GKWH 4MRCA 3OB0K 4I18B 3TN0A 5TQ2L 4NKDA 1JFHA 3ETBF 2YBGA 4QTHA 1XCXA 4XHQA 1XB6A 3WJJA 1YEIH 4GSXA 2NZ9D 1TVBA 4QOKB 4W81A 1SMAA 2WWKT 4WGVB 3ECVA 3GHBL 1ZA6A 2FX9L 1CLZL 4OF3A 1LO0L 3JUZA 1XDTT 1P6WA 1XZWA 4FTDA 4JLRA 2QHLA 5ITBL 2ENYA 4K3JL 1B4TA 1UA6H 4NAJA 2HPTA 4KZDH 5LGYA 4ZAKB 1YDPB 1OAKH 4YK4C 4N2DA 5L2KD 4NJ9L 5F0JB 2FHCA 1I3UA 1MLCA 1UXLA 4P07A 5HY9A 1X7QB 5GSVA 5HHME 3WO3B 2B0SL 2GIYA 4JG9A 4Y4HD 3UZVA 3FO9A 5JOFA 5IT2H 3S3DB 5TK2A 4FQ2L 1JOIA 1FGNL 4I88A 4RZKA 5DZOA 1OE2A 4BK8A 4LSRL 3FRPA 2J1ZA 3KHQA 3WHXB 4R97B 3SJVA 1G9EA 4GAYB 1T6BX 2X1OA 1XGUB 4AQOA 4AGPA 5EDSA 4RQQA 3VI4E 4LP5A 3RUGE 2WZ5A 2E9WA 2QT6A 1KTDA 2DQHL 4YDVB 2G0LA 4LCYA 1I85A 1CYXA 2ATKB 5EBWB 1W0YT 4H8VA 1I8UA 2NY1B 4HS6A 1BFVL 1RLWA 3QA3A 3X1GA 2OP4H 3N43B 1XF3A 3RWFB 5JR1L 4K94C 1SUHA 1J5HA 3AG1B 2ZUQC 2CMRH 4QJ4B 2PYEB 4F24A 1S78C 4R0LB 4DO6A 4UAOB 4LSDA 4X7DC 3IN2A 1K4CB 4HH8A 3WSQH 3OG4B 4ZMYA 3MJ8B 4QYAA 4U1KA 1QO3B 4Y2DA 5C08E 5AOMA 4F57L 1Q9WB 5BUAA 2VAJA 3NSJA 4XMUA 1WT5C 3U2JA 1A4KA 4G8FB 5HDBB 3BAEH 4GPVA 1T4KA 3O3AA 3BMVA 4N0FB 3RWIA 3X1BA 5DT1H 2DI8A 3CU7A 1A6VH 4I2XA 2E7MA 1KB5B 2CO6B 4QXTA 4HWNA 2Q3ZA 1SJXA 3A21A 1WVZA 2WOYA 3AFLA 4FFYH 5FKPA 3QDGE 1ILSA 3PNWA 2D8KA 4AX3A 3MUY1 4H40A 3VFGH 4IS6A 3BAKA 1DSWA 5EZIH 3IGUA 3U6RB 1P6FA 3QQDA 4IK7A 3OKOA 4O02L 1N3NB 5TFSH 2JLPA 1U2YA 4U2ZA 3SDCA 1HZLA 1W8OA 4MNGA 4EN3B 4LCWD 4HOWA 4ZUWB 1WIOA 2F5AL 3VWKB 4B7IA 1MJ7L 5CLTA 4ATTA 2VDLL 4Y4FA 1ZHLA 3QH3A 3WTTA 4FLOA 3BH9A 1RUKH 5I6PA 1FZMB 4GRLD 4YPJA 4LSTH 1BPLB 3WUZA 3LXCA 3W2DH 3NMEA 3TEUA 2AQQA 3OHMB 4RRPA 1WC7B 1BEYL 2YEZA 3WY1A 3L3IA 2SEBA 1EAJA 5FA3B 1REIA 2I5YH 5H4YA 3A67H 3GJEB 1CFNB 1JPSL 3LNDA 2DWDA 3KXFD 2EDTA 1X9RA 2FYYA 4HKBA 1SXSA 3UGEA 4YXHH 3BT0A 1JHKH 4WFFD 5D4HA 3QO1A 1DEEA 1XGQB 5I1GL 5ACLA 4M7KH 1MREL 1MXDA 1RKRA 2R56L 3K2MC 1WZ1L 2BSSB 5EC1B 3LSOB 3VI3B 5ALCL 2KDYA 5DZLA 3JTTB 3MFFB 4YFLF 2KS0A 3RNQA 2BIOA 1Y18B 4NGHH 1X4ZA 4U6VL 4UV7H 4X8JA 5DSCA 5CD3B 1DQKA 1K3ZA 4AKOA 3OPZL 3PWVA 1OY3B 4P5KA 3QQ3A 2FECL 4WI9A 3N41B 2WXLA 1NDMB 5E24E 3NRPA 4BGDA 3US0A 1KEGL 1KJVA 3LPGA 4O4YL 4JFZL 4TXVB 1JNHB 5E8OA 2Q2EB 1MJUH 4XPAL 3SQOL 1J1PH 1MJJB 4LZKA 3I9IA 4PJFF 2DLHA 2YPLA 1KACB 2FO4B 1HOCA 4IRZL 2GBVA 3H6AA 1DANT 1MHPH 1U92A 1B3JA 2AEWA 4F7CB 3T4AC 4NZUL 3LRSB 4E9YA 4YK4B 4KFZC 5B39A 5JQIB 3HHSA 2E56A 2OFQA 1UZ6E 4ZZKA 4HG4K 4FQXD 4KJPD 3WN5C 5DCCA 4M9PA 3QUYA 5FO9B 4BZ1H 5KAQF 4OTXL 3OJDA 4OUUA 5D7IB 3X12A 3OKEA 3BT2H 4PVNA 2GB2A 1YQVL 1KTRL 3V5DB 2OMYA 2OR9L 4JFPA 1PFCA 1XGTB 5B1AB 1JZ7A 1GSMA 1R17A 4ANWA 1FO0H 1OPGH 2WNGA 4RNRA 3D18B 1RLBA 4MJ4A 4I1NB 2JJSC 2KPNA 3ESUF 4LCVA 4MCYB 4BZ2A 1IGTA 3HNSL 3X11B 4PRAA 4CC4A 4PJ5B 3WEMA 3A22A 1MFCH 3R06A 5CZRA 2CO2A 1RIHH 1P2CB 1QW8A 3B37A 3W9EA 3C87A 5LBVA 2E6QA 3RVTC 1N4XL 4TOYL 4V1DE 1JSYA 3UYRH 5AAPA 3KLDA 5DEFA 2YQ2A 4A66A 5F88B 4ZFQA 2ZKMX 2Q8AL 5IVXB 2X1WL 1BAWA 2AQSA 4O2FA 3QUZA 3GTVA 1X7SA 2CLRA 1U3HC 4EOWH 5FYKE 1NUGA 3RZCB 1I9RL 1VDGA 2HX7A 4BFJA 5DRWA 3IFOA 4AQ1C 1KJMB 3K2UL 3RA7L 3UG3A 1NC4A 2ZUQB 4FOMA 3QZWB 2BSCA 2WVSA 4ZTEA 1IC1A 3W11D 5D7JC 3GUTA 3LNGA 5GJTL 1A6PA 3EYFA 3OD3A 4P49A 2Z3FA 2OSWA 2WJ7A 3UDWA 2CBPA 4U1SB 4XPBH 3JWOL 2IV9A 1QVOA 4MYWB 2IDQA 1JNNL 4M43L 5AW0B 3VXTA 5GGRY 3QNYB 4AJWA 3UAJC 3WLBA 1TO5A 1PTZA 1KJ2B 4PJ9A 1LE5B 2WXHA 2VLME 3PHQB 4YZFE 4EUPA 1RZKH 3VFOB 1JFQH 2GYSA 3B3IA 3GM8A 1R5VA 3PDGA 2H3KA 4JFEA 4I77H 2A9AA 3RJOA 4AEHL 4BWWA 4NYLB 4ADGA 1YNTA 3EUUA 5ANMA 1M7UA 4FQHB 2QVTA 2PWGA 5C07D 1QSVA 1X9QA 4WI0A 3DIDA 4P3CL 5D1XA 3GI8H 5AKRA 4JVPA 2XQYG 3QNXB 3DK0A 1AR1D 3L7EB 5DD0H 1FZJA 2NY5C 5C2UB 5IBTL 2QGCA 5HVFB 1MFVA 1WBYB 2C1PA 4W4NA 4PRPE 1IGFL 1XD0A 2P28B 3E1F1 3KNBA 3MGTB 4PJGA 1AMXA 4HWBA 2JB5H 1LEGA 5FA4B 2ICEC 1G6RA 3Q2LA 5F0LB 3PPEA 4EBQL 3LXBA 1T3FB 4DEWA 5DD6A 1A3LL 1RY7B 4XBEH 2VZ3A 1C8QA 1GGBH 2X0WA 2ATPB 2CHNA 5E8DH 3GSNL 3VXMB 2WBJC 3LQZB 4XO5A 1ZAGA 2TSBA 1AP2A 3QZWG 3HR5A 3M17A 1X9UA 2VJ8A 4LOEA 1AJ7L 2FHFA 4Y4KB 1MVUA 1JPTL 1INQA 3QUXA 1L0QA 4PWGA 5IB3A 4M48L 4WNQB 5LGKA 1UB6A 4G6KH 2Z4QA 3TV8A 4L29B 4BQ6A 4HHAB 3AREB 3WNIA 2CSPA 2EEBA 4HJ0D 3RAJH 4OGXH 3O0RH 1RURL 4LQFL 1X5IA 1N0LA 2IALB 4ZS6D 4M00A 5SX5K 3NPSC 1B4LA 4JKPH 3RVUD 5I6OA 4P3WA 1ZT7B 2APXA 2N7BA 3GI9L 5DK2B 3HC3H 3AG3B 5IEHA 3EF4A 3L3GB 3CV5A 3VGDA 4WWKC 2XFXB 5BNXD 4LSUH 5AKSA 4TULH 1ETZA 3CVIH 4QI3A 3BP5A 1EEYB 4Z0BH 3HKZA 2JK5B 4JPWH 4YHLH 4DQAA 2Z1KA 4OBSA 3T4AB 1KCVH 4M93C 4L4VB 4PCTA 2UWEE 5TTRA 1A25A 2FR4B 2P5WE 3D12B 4KV5F 5DS8B 3V0WL 4ODTL 2GSIB 3ULVL 1IEBB 4Y1AA 2FJSA 3O3DB 2A3TA 1IAII 5HGHB 4TLKA 4S1RH 3WKQA 1UB5B 4UTBH 3F6JA 5C0GA 5DURB 1PAMA 3VGFA 3CFDB 2XA8H 4KRPC 4QYOA 4BFIB 1SYSA 2CJUH 4NI3A 5KSVA 1JYXA 3P69A 3S4SB 1BG9A 5H37A 4L8SB 2HWZH 2PCFA 4JHAL 4F2ME 1CLYH 1T03H 2OMZB 4NPKA 2NPLX 3P2TA 4CMHC 3ZJAA 3V2AR 1J5DA 3EGSA 2UXGA 2LAGB 1XZ0A 4CSZA 5KJ7E 4KKRA 4KI1A 5E4OA 4XGZB 4PD4K 1CT8B 1BOYA 3TEYA 4M62L 5EBMA 3T5WA 3S3CB 3BE1L 4JUTA 3QPXH 4FZ8H 1XH3A 3N1FC 1OSYA 2XN1A 1U3HB 3SE8H 2IQAB 1PW3A 1MCPL 2W65A 3S3PA 3K1KC 2KERA 1ZS2A 2VH5L 1EZVX 3TBSA 4NRZB 1M71A 5I1DA 5KVEE 3HG5A 4XAKD 3ROLB 5EF0A 3V79C 3U9UB 1H6TA 3DV4B 1Z3GH 1IAIH 4UNTA 4FRWA 5EBLB 4L3EE 5D7JB 3FQNB 4FFVC 4MA8H 2NX5E 1H8LA 2VIRA 4HX1B 4QRTA 3VSUA 1B88A 4JPKH 4N6RA 2C9AA 1J9RA 2MNUA 5JLZA 2YFNA 4PS4H 1QA9A 3UO8B 1JXDA 5KVGE 2ZE0A 3GGWA 1XH1A 2DB8A 2YC1B 2VXSH 5GGRA 1DVSA 2MCMA 3AQDA 2RTTA 3P9MB 2W0LA 2DJUA 4F2EA 3AB0C 7FABL 5FHAL 4R8WL 2VR6A 1L9OA 1FDLL 2G9KA 2IH1B 3F6LA 2GG1A 3H0TB 4FMFA 2E74C 4S1DD 5FOJA 4NO5B 5EG6C 3PY9A 4WI5A 4AM0B 5HHMD 1OGSA 3S5YA 1KDJA 2P5EE 2D3JA 2GW5A 3TH4T 4MMZB 3CDZA 5DMIL 1PD1A 5E51A 2GTZA 1XB8A 2ADJB 1IAOB 3EGXB 1DQLH 1PZ5B 4M61A 3DVNA 5DDHB 3QFJD 3FQWA 4Y7OC 5CUSH 3WNNA 5C0AA 3ZUCA 3EO0B 4WDIA 2A77L 4XO3A 2F1EA 3X1FA 2Y69B 4WEEA 1GYUA 5G55A 1UUNA 1BXXA 2P52A 4J3OC 2R29H 3S4SG 5EHFA 3U36B 3JWOC 3I6KB 1RVFH 4XCEB 4X98A 3OAUH 2QGDA 4R4ND 2Y36H 4WVRA 2GTWB 2QQLH 2R0LL 3NCJL 5FHBL 4AENB 2BWQA 4K4KA 4U1IA 1MW2A 1ZLUH 1NCJA 4RISH 2Q10A 3EFFB 3KYMB 2YD7A 1U21A 2YA2A 2DQJH 2Z93A 1A7OH 4IKIA 4BINA 5B38A 5C3LD 4M1CD 5D55A 3WKPA 1PLGL 2DQDH 2GEEA 4PI2A 2AJYL 1YN7B 3F6IA 4JAMB 3RWGB 2ICEB 3LS4L 4P2QE 4M5TA 4GB9A 5MI0B 3CLEL 4YSCA 3U46A 3ARUA 5CJ5A 1PKOA 3SIKA 3I84A 3GRWH 2HVJB 3MNMA 3BESR 2D9CA 3WCYA 5I1JH 1AZCA 1E2VA 3DA0A 4FLRA 3S35X 8CGTA 3O41B 4Y2OA 1MCHA 4HMCA 2V17L 3QORC 4NQDA 4XBPA 5IBUG 1BQUA 1DBBL 5L2KB 1QR4A 4ZQTA 5F1IB 1P1ZA 2B7DT 4ES8A 3VX1A 2QVMA 4N8VA 3C9NB 4Y4HB 2NLJB 2LU3A 1OO2A 5C08D 2JIXB 2RH0A 2AABL 2X1QA 1INEL 1G7HA 3HUJE 4G8GD 5AW9B 5T1LA 1CGXA 5E23A 1EHLH 2O61A 2E4FA 1T7ZA 3UG4A 3L8QA 3PL6C 1VEOA 4FG6C 2YGOA 2H0FA 5DRZA 2DWEB 1KZQA 1RH8A 5TH2A 5AYUL 3L5XL 3K0YA 3CPUA 2VC2L 2ZX7A 1R5WA 1S7XA 3RDJA 4HGWA 5IR1A 4WWKB 3QDJE 4I8DA 4ZUTB 4Q6KA 1EZVY 4HAGA 1OB1A 4X80L 5DO2D 2WN2A 2WVVB 3QNZB 4N24A 5HYSA 2BRRL 4LDEB 1HL5A 3VFRA 4BFBD 4OD1L 5GZNA 2B9AA 3T3MF 2CNYA 2JCCE 1PDKB 3VRIA 4Q4IA 5BRPA 3WTYA 5TK4A 3SKUD 4HUKB 2Z92B 4ZXBD 1FVCA 4GO8A 4K9EH 5EOCJ 1NH6A 2H3XC 3BGMB 5TDOB 1FE8L 1L0YA 4ODSL 3CHPA 3QXDB 1LMIA 1ET5A 3GJFB 3W11C 2ZUYA 4ZUUA 4DESA 5HGAA 2UVFA 3IDGB 5E6RB 1I7UB 1NWPA 4XWGL 3SE3C 2NNRA 4X7FC 4OZ4A 3RWHB 2Q7NA 2YPVA 1PG7W 3F00A 4IOFC 1PYWB 4GINA 4Q6IC 5GS2H 1NIBA 1R3IL 4PJIA 2NNAA 1XGPA 1NCWH 3C5ZA 1GC1L 1CGVA 1S7WA 1Y6NR 4PJ7A 5I66A 2UY7A 2BINA 2Y2TA 5GRXG 5FGRA 5L88L 2VMJA 2ZCKH 5LQBH 5D7HA 5GGSY 2DBJA 1MHHA 3CJJA 5GISL 1FUNA 3QT2A 2BERA 4NENA 5F7EH 3QIWA 2EYRB 3OKNB 4NNXB 3F01A 5KBPA 1CGYA 1YEJH 2A6DA 4YR6B 3BKJL 1BD2B 4P3DB 2AJ3A 4MNQE 3X13A 1B0RA 4OLXL 1X5LA 3NA9L 5E9DB 4BGLA 5LDUA 2GI7A 4A2MA 5ESQB 4L9LA 1OTTC 4Y16D 1T83C 4Z7NB 1BZ9B 4P46A 1D3CA 4DGYL 4OJDH 4H5SA 1S5IH 4TRPL 5EU3B 2AJSL 5I16A 3DMMD 3ZX1A 3QIUD 4NUGH 4MA3B 4GEIA 1JRHI 1N0XL 2Y07H 1ZS8B 3F12B 3FT4A 3BP7B 2HKHL 4K07A 5HHQB 1SJEA 5D5MF 4GRLB 2X9ZA 2ZXAA 5ID1A 2ZPKH 3AB0B 2E7HA 1KGWA 3LDBC 4U1GC 1F97A 3H55A 2UZXA 4XNMA 4NQCE 5K39B 1ZGLA 3CZJA 4HG4J 3CG8A 5J6HB 3MHZA 4H1LA 1RHHB 1BZQK 3B2XA 3WHE1 3KR3L 2QR0A 1CTOA 1SHWA 3WXWH 1KJ2H 1NFDA 2BVYA 3WI9A 3FU9A 3MQIA 2WZPD 4KITB 1UCBL 3FTWA 2X53A 3HC2A 3KL0A 3FPYA 4Z1PA 3EJUA 3IFNH 1ZLUK 1HZHH 1BMZA 4ACPA 4MD0B 4LK4A 1TETL 2OXGB 2XN0A 4PV9B 1KSRA 3IAPA 4BRVA 4HIPA 1Z0NA 2F53E 2J6WA 1FJ1B 3E80A 3EH1A 2PW2A 2HSIA 3EXJA 2BOBA 2L0DA 5DQJA 43C9A 1BYNA 4YO0A 4U7SA 4JM0A 4M6MH 3GXTA 1WDAA 3ZTDC 4N22A 2YRPA 5K9KB 1H3PH 5EN2A 1EERB 1Q1JH 1T5XB 3C6LD 1GIGL 5IB1A 3U4KA 4L8CA 3MLTB 3FUIA