2CM5A

Crystal structure of the c2b domain of rabphilin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
144
Chain Sequence
MALYEEEIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RABPHILIN-3A
publication title The C2A-C2B Linker Defines the High Affinity Ca2+ Binding Mode of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 38
structure length 144
sequence length 154
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2cm5A00
2N1TE 4QJ5B 1E7VA 4TV3A 3W57A 2WXRA 2B3RA 3PFQA 4FADA 1WFMA 2NQ3A 2NSQA 3QR1A 4OVUA 4Y1TA 1DJIA 1QATA 2R83A 2WXJA 2ZKMX 1RLWA 2NCEA 2WXOA 3TL5A 1W16A 3R7RA 1BDYA 3F04A 2K4AA 3FDWA 2LHAA 3ZIMA 4NPJA 4TS6A 4EZKA 3L16A 2UZPA 3NZSA 4L1BA 3SD5A 4KZ0A 4Y1SA 3CSFA 4NP9A 3F05A 4WEEA 2Q3XA 3QARA 3L08A 5T8IA 5JHBA 5KJ7E 1DQVA 1DJZA 2WXIA 1UOWA 2DMHA 2ENQA 3R7QA 3GPEA 2JQZA 4FJYA 4ANXA 1A25A 1RH8A 2YRBA 5CCGE 2Q0ZX 1HE8A 4GB9A 3NSJA 4HLEA 4DK5A 4A55A 4FLHA 1W15A 2CJSA 4MJJA 3TJPA 2ENJA 3W56A 3CSTA 3L54A 4PS7A 4QJ3B 3TWYA 2WXNA 1DJXA 1DJHA 3B7YA 4XE0A 2K45A 3IBEA 4G11A 3L17A 2K3HA 3KWTA 1BCIA 4PS3A 4ANWA 2CHDA 1CJYA 3M7FB 1TJMA 4WWPA 4ANUA 3QK0A 4WWOA 5G2NA 4FA6A 2CM6A 2CHZA 4XX5A 3S2AA 3PREA 2WXGA 3PRZA 1E8WA 3ENEA 1WFJA 1E8ZA 4F91B 4ICXA 1E8YA 4FHKA 1QASA 2WXLA 1RSYA 3ML9A 2KI6A 1DJGA 4LCVA 4AOFA 2Z0UA 1V27A 2CHWA 2FK9A 4OVVA 5EDSA 3ML8A 3DPDA 2ENPA 3ZVVA 2K8MA 3RDJA 1E90A 3OHMB 1TJXA 4TUUA 3JZYA 4L23A 3HN8A 3MJWA 3RPBA 4IQHA 2WXPA 3ZW3A 2WXFA 5CCJA 5JHAA 2RD0A 3APCA 3P2BA 2WXKA 3APFA 3PYCA 5CCHE 2V4LA 3L13A 2FJUB 4EZJA 4ANVA 2X38A 3LJ3A 4WAFA 5H4YA 3IM1A 4KZCA 4EZLA 3QR0A 4IHBA 4V11A 2A5UA 4WWNA 1E8XA 2WXMA 4F1SA 4NPKA 4F92B 2QZ5A 1UGKA 4QJ4B 3NZUA 3QAQA 2A4ZA 1GMIA 2QZQA 1DJYA 4GNKB 2WXHA 4XZ4A 4BFRA 3DBSA 4URKA 2CHXA 3L4CA 3QJZA 3T8MA 4KITB 5H4ZA 2CM5A 4ICWA 4BGDA 2BWQA 2Y3AA 2YOAA 3L9BA 4L2YA 1YRKA 4L1LA 4LDCA 1E7UA 4LT7A 2CJTA 4NS0A 4AJWA 1K5WA 3F01A 1DSYA 4FULA 3PS6A 1DJWA 3HHMA 2WXQA 4QAMB 4FJZA 3HIZA 3FBKA 4JPSA 3F00A 5G55A 3KWUA 4J6IA 4DNLA 4PS8A 2ISDA 4HVBA 1BYNA 1UOVA 3APDA 3N5AA 3OAWA 4F93B 2EP6A 4FHJA 2DMGA 2D8KA
chains in the Genus database with same CATH superfamily
5L0QC 1OT1A 4QHMA 5ILTH 1VF5C 4F2ME 5JA9A 3WFBH 3RBSA 1A7PH 2WCSA 4JRLA 4PD4K 3L4ZA 5BJTA 2JJVA 1MQKL 3V0AC 1S9KC 3G5VB 4N0RA 5F1OB 4CC4C 4BZ2H 1NGXB 4X98B 1KOAA 4P3DA 3CVIL 3S5ZA 5F7NC 4JY4B 5AEAA 4R7XA 4XO8A 4QD2E 3ZDYF 3IYLW 3UJTH 4B50A 5CD5C 4Y16C 1MG3C 4U3SA 2BVQB 3GNML 4HBCH 3AQZA 2YKLH 5BZWA 1RJYB 5C0GA 5MENE 1MHEB 3NUKA 4L5FE 2EDDA 1SXSA 2V3DA 2XKNA 3K2UL 4XNZC 1B9ZA 1MFBH 3L3KB 3LKOB 1NIAA 3FU7A 1LNUA 4L9LB 5GQBA 1A6WH 1Z9OA 5KSAD 2XACC 2H1XA 3CLWA 3P9MB 4LARL 4U49A 1USZA 7FABH 2A6DB 4ZNCD 3QUXD 1WQVT 4ODXA 1ONQA 4HXBH 5DUJA 4YDKL 4NKQB 1N68A 4QTIH 5CEXB 1D7DA 3MJ9H 5B39A 3GM8A 2OW7A 4ZYKB 3TT1L 4U1GB 5C2UB 5FO8A 3I75A 1Z6JT 4YSTA 4JM4L 5GRZA 4P2YA 3OKEA 1SLXA 4AQOA 3CHPA 1JGUH 3JV5A 5FUCE 3HHSB 3IS1X 4NNPH 5I82A 3HS8A 3ARVA 4LAQL 1FCGA 5ACZA 4Z8FH 4PREA 1MCIA 4RLDA 4UIKL 3FRPB 3RL2A 3X14B 3ZDWA 1NWOA 2BP3A 1YQVL 4X5PA 4BKLA 3P1VA 5DT1H 1RZFH 2F58H 5DF0A 3V0IA 1FFOB 1QPPA 4LSQL 1DQQB 3P9WB 1QBBA 1RMFL 2CDEB 3B5TA 4S1RL 4YH6A 5CWSB 2ENSA 3O3DA 4F80A 5B38B 2HJFA 4QJ4B 2YSSB 2J4WH 1H8NA 3TFKD 4K15A 3CFIC 1H6EA 2HH0L 3HC0B 3TBTB 4EJ1C 4RISH 1TO4A 1CLVA 1HQ4B 3BUQA 3A3YB 3L9RA 2E9JA 2QPFA 4M6NH 1FH5L 3V7AE 3IDIB 4JFZL 3QNXB 4OQTA 3UDWA 2E7MA 5ACMA 3GHEH 2NR6C 4LCIL 5I1CH 2LFGA 1FGVH 3O6ML 1C7TA 4DEPB 3G5YA 1W9XA 5IVZB 1WBZA 2WQSA 3GQFA 1BFTA 1IAIH 2G2RB 1YUKB 5FWRA 5DJ8B 1EJOH 1R3JA 1AMXA 1MJJB 1CI3M 3KWVA 4OZHB 4C59B 2EVJA 5EA0L 2H0PA 1AC6A 3APDA 4UQ3B 3ARUA 3LPOA 5E5LA 3NZ8B 1QA9B 5FM4A 4IGBA 1BZ9B 3AWGA 3UC0L 3KPRB 4P2AA 5A6IA 3TT3H 2B59B 3RJDA 3C8HA 5MEND 4MMYB 4RGMB 2L04A 4QHLA 2E9GA 2DMCA 2F5BL 2J12B 3N40F 4BKSC 2OK0H 4K9EL 3KM1A 3H4FA 4MQ7A 3S37X 3CLEL 4HEME 5LBSL 3K91A 4UQEA 3BZ4A 2DI7A 4K5MA 1FV1B 4OAWA 1U8JA 3CFJA 3BLBA 5ITFB 3SDCC 3SD5A 1M2VB 3MV9B 4HIJA 1PTZA 5DHXB 3S3SA 4D3CL 1AIZA 5HHQB 1HYSD 2AANA 3DYMA 5T8IA 3L4XA 4FMFA 1DQLH 3RGVD 1XHHA 3O8XA 5BW7A 2COQA 4X80H 3BZ5A 1D7CA 3C5XA 3EDKA 3GSWB 4G8EB 4MASA 2M2DA 4CAGA 1K5NB 3A4DA 4AV0A 3KCPB 4M7LL 2R0WL 3MV7E 4X9FA 4BM7A 2YBRA 2C5DC 4X6FB 5GSVB 1UUNA 2PWFA 2BSSA 3BVVA 4OCNC 4KY2A 4PJCB 3QO0B 4I3SH 3B7TA 4NKDA 2BM3A 3OSKA 1TFHA 3DV4A 3MLXL 5PAZA 1W72H 3M7FB 4X8CA 5AVQB 5DYOA 1M4KA 4ZUUB 4CN6A 5DJDB 5GS0D 4QKXB 1KY6A 2N7SA 3W81A 3KPSE 2P48B 2ZKXA 1G7HB 2EQDA 3IU4H 2M26A 2N01B 3WN5C 4E5XB 4Y9GA 5C08B 4LF3B 4K55A 5C0FB 5F21B 4Z78B 1HZKA 4PCTA 3VI3E 3QIUB 3GGWA 1NANI 1PNCA 3FXIC 3KJ6L 2IPKB 3PE9A 1MWAA 1IGIL 4PJAF 5C0CA 4H2CA 2AMUA 1HILB 4BDVA 5T1MA 2R56H 4FYRA 3TFKC 4F3FA 1HHGA 1I7ZA 1ZHLA 2WXFA 4ISVA 5I1JH 2BNQE 1BG9A 3DSFL 4KKPA 5FW6A 1HINH 3FT3B 3OXRA 3ULUH 2B08A 3P9LB 5DGRA 3IJ9A 3QQDA 3OZ9H 1QO3B 5IJVA 2WGXA 4LB8A 1F8TH 2KYIA 2CU9A 1VGKA 4UTAL 5I75B 3W0WA 3DO4A 3RWJB 4X6CB 3EGDA 4IKKA 4MS8D 4OZFG 4GBXC 1G9EA 5GRVK 4AG4L 4XRCB 4BGDA 3O2WH 4TTDC 4L2YA 2P8MA 3NIDE 5DD1L 3D0VB 1NGQL 3R0NA 4WU7B 1A5FL 3SZ6A 2B4CL 4B0MM 1YY8A 5AYUL 3LX9A 3QSKB 3LXUX 1P7BA 4DVBB 1DQTA 3ABLB 2R0KH 4MNGE 4HC1L 3DUSB 3MCYA 3PGDA 2XZQH 1C5DA 1EAJA 1JWSB 1B4LA 4H13C 1DDTA 3KYNB 1WK0A 5C92A 3BKCL 1NCBL 2JK5A 3LCYA 5HXMA 2WCGA 2J20A 4APXA 1DVYA 3MV7D 5E03A 5D4IA 1J1PH 1DLHA 3QDMA 3SPIA 1TTAA 3O9WD 1HDMB 4R3SB 1K6QL 4WFGE 5BJTB 1CLYH 3LMJH 1BAFL 3K8MA 4LQ1A 1SYSA 2XG4A 4MNHA 4P3DB 5CINH 4U0RB 4IRZA 1GGBH 5CS7A 2QT6A 2VLJE 3B2VH 2ZP8A 3NPZB 3F7VA 1JG9A 2BSDA 4G7VL 4L29B 5DZLA 4YAQA 4U3SB 3RNQA 3KPSD 4LLUA 5BZWB 4JJOA 5AAMA 3DX0A 5GS0C 4N25A 5LG6A 2XKNB 4JPWL 4X7FC 1NFDF 5L4JA 2X12A 3WMSA 2HG5A 5JIIA 3FU7B 4PMFA 1LNUB 4OF3A 4TSCH 3DX8A 3NRPA 5HHXL 4OZGE 3STLB 4CADA 4E41A 4JFUA 4ZDHB 1ORQA 4N0YL 4BK5C 4DO4A 4QF1B 3QK0A 4JRXE 3A6BL 3OX8A 1ONQB 2BNQD 3VW3H 2XICA 4L3FA 3FO0H 1QHQA 3LV3A 4DKTA 4ZTOL 1UZ8A 4EBQH 1I9EA 4U6VL 5B39B 5KYYB 1BZOA 3FKUS 1E8ZA 2CRYA 4HGWA 1UUSA 2X4RB 2X6BA 5JW4N 1IAMA 5J1AA 4BBWA 4PLNC 5FO8B 4PCSA 4KJWC 4HIPA 1YC7A 4A2LA 5KYWA 3OKEB 1SM3L 1LD9B 1NCCL 5EUOF 2H2PD 5C2BH 1IQWH 3QXTA 3O45A 3Q7JA 4KTGA 3E8UL 5CCJA 2CQVA 3PP4H 1P53A 1WFOA 4QHPA 1QWHA 1F97A 2RMNA 3FO9B 3QJRB 4HFWA 1WDAA 2YC1A 4BKLB 1KB9J 1BXXA 3S4SA 3BAXA 2QZ5A 2VM3A 5E56A 5KSBB 1KELL 4QT5A 3EHBB 4GSUA 2HJFB 1U8LB 2BP0A 4FP8L 3A47A 1OTTD 2IQAA 1MJUH 5HPMA 4XCYA 2GSIA 4LRNH 5E1QA 2V2XA 2PW2A 5CJXC 4ZSOB 2ZX7A 3W11D 3WTXA 4WFGD 1WBZB 5G5DB 3RHWF 5KS9B 3IFNH 4AYEC 1Z5YD 4TQIA 2OTWA 3BHBA 3S34H 4PGEB 1HX0A 2WKLA 2K4WA 1F3DJ 2VLJD 4NN7C 4JPQA 4DUXA 3SQOL 1OP4A 2X6AA 4IGBB 4A2GA 4F2FA 3BAYA 1BZDA 4YXHH 5EORL 2EIKB 1A7NH 3QA3A 3VFUA 4QHLB 32C2B 3LPWA 1WAAA 1BFVH 4K3JL 4OIBA 2AJUL 1CG9B 2F53E 1EV2E 1MELA 3N0PB 1CZ8H 2LLGA 2D3LA 1CLZH 1PPIA 5AOIA 1FIGH 3BZ4B 1QNZH 4OAWB 1U8JB 2Y6SD 2YD7A 3CFJB 4OCYL 5KSUB 4HIJB 1QSFE 3KMDA 4X5WA 4LVOB 1GGCH 4JRXD 3RGHA 1RPKA 4KGLA 5C0AA 1JV2A 4PJBB 4ZAKD 5F7LB 1FZKB 4CMHC 2FGZA 4HEPG 4H8PA 3WD5H 5E2UH 3ZKND 3QBTB 4HWEH 1NMAL 4MQSB 4PVLA 4PJXF 3KW7A 2XWDA 2YBRB 4HCRA 4EDWL 2R0ZL 5ADOH 2BSSB 4PGBA 2AVFA 3H54A 1HFUA 1C16B 2ZXAA 2IOMA 3VD4A 2JKIS 4LPXA 4S11A 5AKRA 5IB2B 4NKDB 5HDRA 5INCB 2A0LC 3DVGB 2H2PC 1GS8A 2EEDA 3CK0H 4JS7A 4I7ZC 1EA9C 2A77H 1Y07A 1OEZW 3B2MA 5JIPA 1BMWA 3CDZA 4MA8H 5DLML 4ZMAT 3L1EA 1T1ZA 5AB2A 5DD0L 1TG8A 3C5SB 5DEZA 2DH2A 2UX6A 4IEFB 5E6ZA 3TF4A 5I15H 5AVSB 1A9EB 3FONB 3QUKA 3RPBA 2R1XA 2RTTA 5I17B 1A8ZA 3L45A 4GQQA 5D9SA 1FPTL 4F3FB 3H2QA 4KXDA 1U92A 4I89A 3Q01A 1HHGB 2XVKA 2XX1A 4ISVB 3CZNA 5AWNH 4IHBA 3U25A 3RU8H 2CO7A 3H7LA 1A1OB 1EHKB 1E3FA 4YDLB 1BQLL 1J86A 1DQJA 1G6RB 2QKIC 3ZDXE 3FCUB 3KYMB 1EANA 1RSFA 2GJPA 4LDEB 3W11C 1VGKB 3EGXB 4ICWA 3W0WB 4WENB 3ZHFA 1EFQA 2LR4A 4TSAL 3SY6A 3EGDB 5FYKE 4O2FA 4FG4A 3SE4C 1AP2A 3OAYK 1QPKA 1ZK9A 3LEYL 3BP4B 4F9LC 1YJDC 4NS0A 3CZKA 1ZT7B 5FCSH 2HT3C 4OCMC 1QUPA 3VFNA 1AG6A 2P8MB 2UZXB 5C07E 1HJCA 2VXUH 4JPSA 2XQYA 3L2NA 3WNPA 4G5ZL 5CEYA 2F53D 4IDJH 3VX1A 3F58L 4MJ6A 4UF7C 4PIBA 2VRKA 1Q1PA 1L7IL 3CXHJ 2Z31B 5I71B 2HX7A 3MRRA 2IANE 3DURA 1QSFD 4PB9L 4PG2A 3IAPA 1B3JA 2PXYA 4Z0XB 4XNUH 3NZHH 1FLTX 5E1HB 3EDFA 1FNFA 1E4XL 1C5DB 3C6SB 4WW2C 2EYTA 4HMDA 5DHDA 2Y6SC 4CW1B 5JDSA 3S96A 2VN3A 2JCCA 2HRPL 4Y0GA 3L4VA 3GXNA 4QGYA 3KXFE 1TZIA 3FDWA 1UB6A 3V0WL 1IGFH 2J2ZA 2W07B 4XNMA 4APXB 1AQHA 5ERWA 2PF6A 4PLJD 2AVGA 3QDMB 3IFLL 3VUAA 5C97A 3QNZA 5KJRL 3M46A 5JR1H 4AE1A 2BX5A 3QYMA 2F8OA 2AV1B 2NY2C 3HC3H 2J56A 2ZG2A 2XWBA 3C6LD 3HKZA 4JM2A 4X6BB 5F7BA 1FNLA 2XG4B 4MNHB 3D2UD 2GC7C 5F7FA 2Z7UA 5F1NA 3QQ4A 4O02A 5FGBA 5F88A 4EDXB 2BIHA 2C7FA 3F7VB 3Q1SL 1OPGH 1MRFL 3AU0A 4YAQB 1HQRB 2D4FA 4LLUB 3ZYOA 3BE1L 1WT5C 4K94L 1SF3A 2IQ9L 2HMID 5HGGS 1F86A 1MUJB 2BW4A 3WNKA 5I18H 1CFNA 3CZLA 1FO0A 2HG5B 5F96L 1A9BB 4PJDE 3DX8B 1C08B 2Z0BA 5TH2A 1G7PB 1KBKA 1E4WL 5E8OB 2OTPA 4CADB 1A4JA 4E41B 1ORQB 1Y0LA 4F57L 5I8OL 3ESVF 3OHXA 3PRZA 3TA3C 3N44B 1UASA 1ZS2A 2BMKB 4OSUH 4KKRA 1YYMH 2XQYK 5DHVA 2QADD 1U2CA 1OAKL 3RVWC 2NY5H 4HGWB 4Y1AE 3WKML 4P5SA 5J1AB 3LN4A 1OVZA 3O3EB 2NY3B 1YEIL 5DC0A 5JIMA 3MUUA 2RIKA 4QCIB 3ZR5A 5C3LD 3NCBB 5FYKD 2VDRH 3GTTA 3O6LL 4IQHA 2I69A 4KROC 2VC2H 4G83A 3ASOB 3CZJA 3VFTA 2BJMH 4QXTA 1EEYB 3PDOA 3X11B 1NIDA 1FVDA 5C07D 1RUQH 3UYRL 4TQEL 1H9VA 3N85H 4O00A 4HFWB 1KJ3H 4KTYA 2VQUA 3BAEL 5GRVL 5C0BA 2PPFA 3PFUA 3REWA 4FNPA 3IJSA 3GT6A 3CZGA 1AQKL 4N2OA 3N42B 2YRPA 4DGWC 4YSPA 3OLIA 2HPTA 2IAND 2R23A 2J43A 2LU7A 3BUDA 3BKYH 3RTQD 5BS0A 1U95A 2GTWB 2VL5B 2K6ZA 3FU9A 1RULL 2WBXA 3TESA 1K5WA 1J0JA 4JFSA 5HPMB 4XCYB 1YNKH 1QI4A 2PYEE 2H32B 3KXFD 5IQOA 1IX2A 4KXZH 4OU3A 4PJEE 2V2XB 2PW2B 1BG1A 1OGAB 4I2XE 1I9JL 2J44A 4P59H 4YHLH 2CJ3A 3WIHH 3D0LB 2VITA 3L9YA 4NFDA 5CIPB 2KUTA 3HUJA 4K3GA 1JI2A 2GIMA 4P4KA 3IJYB 2B3RA 2OTWB 1VADB 5FKAA 1T5WB 1FORH 4S2SA 2VDQB 2XRAH 4MCMA 2XQBH 2EABA 1MH5B 5D6DA 2HXAA 1ZTXH 4QR7A 1AE6H 2FATL 3ZMNA 2YQ3A 4NZTL 4KNQA 2FECI 3K4DA 4RMQA 3GUTA 1NTDA 3EJQA 2AQ1A 4JDVA 3TH2T 1MLCB 5I16B 5JIQA 1GIGH 4R4FH 2ADGB 1ZAGA 5HGDB 2BP8B 3TXAA 5KTEH 4FQIH 4Y19A 1DBAL 1G6RL 4X5WB 2FX7L 1D5XA 2ZYSA 3SYAA 2DIJA 2CPCA 2CBQA 2CBPA 3IXAA 2WUBL 3GSRA 4Y1AD 2DM4A 4DP5X 1NUGA 4B7LA 4G8IB 5F9WC 1B2WH 1TQCC 3FHAA 2CM6A 4NYLB 3B5HA 3P30H 2CD0A 1GR7A 4TNFA 1N5YH 4HUXA 1IBGH 1JK9B 4F8TA 2EUXA 1DQKA 4DERA 2O5XH 3QXDA 3PABA 1CGSH 3GI8H 3TYGL 1O5PA 1WEJH 2VQTA 2Q9OA 5JTWA 3FFOA 2ED7A 3NT0A 3LHAA 1P5VA 4PY7A 2ZSVB 3BUTA 3QORC 2WXPA 4M1DH 3CSYB 5TE6H 4MS6A 3QUKB 3T1WA 3DROA 1WFIA 2R1XB 4KVNH 3K8LA 4BJLA 3I02A 3FNKA 5JW4Q 5D9SB 3QIWD 2PYED 3V79C 1U92B 3D4CA 1NCNA 5IB4B 4BD4A 1HIML 4MAYA 5D1ZC 4DKFH 1KWGA 3O3BB 4HJEA 5DJ6B 4EF3A 4P2OB 2I24N 1E0OB 2VZ3A 3BPOB 4AGQA 1EAOA 3U9PL 2ESVB 4EN3B 3LQZA 4UOW1 2XA3A 3DXAA 2OMUB 4MTMA 1SMAA 4GRLD 1DQJB 1H3GA 2OCFD 4J7RA 1JGDB 5D2LF 4P3CL 3P0VL 4O2FB 2JTDA 4XXDA 1KULA 2EXYD 1JXDA 3PIQA 1AP2B 2XWEA 3MACH 5E70A 4BZ1H 2G0KA 1OIOA 2UUDK 4ELDA 3WUWG 5F0PB 4GO9A 4KO5A 1AANA 3KPOA 4WSJA 2GPZA 2KBGA 4X4MA 2D7TL 3MZGB 3KVDD 4OW6A 4WO4A 1PFCA 3OKLA 5ADPH 3GXMA 2QSCL 4XBMA 3QRLA 1X7QA 4IW4C 1JMZA 4NP4L 4GRMA 3NJFA 3VE0A 5I6MA 1NM4A 5CR8A 1RY7B 3TJEH 1YNTB 2EH7L 4M6OH 2AEOA 5I6NA 3SKJH 3W1ZA 2Y5TA 1XQ4A 4H1LA 5B1AB 4A38A 1E5ZA 1VCAA 2E7DA 2KZBA 5GJTL 3S96B 1G1CA 5KVMC 4PV9A 5F9OH 1UB6B 3TASA 2WKGA 3ZKSD 1ML0A 2Q86B 3SIKA 1N6QH 4DP8X 2DMHA 3QNZB 4DN3H 1DO5A 5DK3A 5B8CA 3GPEA 4JM2B 3UTZB 3L8QA 3MUGA 4JHZA 2XWBB 4YL4A 5IQ7H 1P4LA 5F1NB 1H5BA 3QQ4B 1PS3A 2W9DH 1AD0B 1X4ZA 5DRXB 5AW8B 4FFWC 1ZV9A 5DMGD 2HKAA 4UZUA 1JYVA 1A3RH 4ZNEE 3QHFL 2FBJH 4DK6A 1FN4A 4TNGA 4Y4KD 2DD8L 1T04A 4OKDA 4J8QA 3ZE1F 2XWRA 3R4RA 4PJIA 1WITA 3EYSH 4X6DF 1BD2B 3KVPA 5B3SB 1FO0B 5EU7E 5DSCA 3VGFA 2DTML 2JKRM 1NCHA 2JKXA 4U1HA 4ZFFB 4D0DA 5C8JA 4HIQA 1JGVL 3RZWA 1A4JB 4MA7H 4ONFL 3S88H 1Y0LB 2WLIA 3AWFA 3OHXB 4NC2B 1N5AB 3RFZA 2VO8A 1BHGA 2VSCA 4R6UA 4OI8A 3B2UD 3GFUA 3M17A 4MSWA 1MCPL 2O72A 5DHVB 5IQNA 1S7SB 3QXAB 4ENED 2F1BA 3NGBB 1A1MB 2D9QB 2AQTA 4X99B 5I6PA 5TDOA 2YWYA 4QO1A 1CDUA 1KPUB 4GI6A 1FZOB 2J57A 1EHAA 1TPXC 1BLNB 4TOYL 3RIFF 4JO1L 4JKWA 4NRXA 3LJ3A 1F4YH 1E5CA 5AVVB 2G75A 5CFAA 1ZV5A 3FCTB 3VFTB 3QJFB 2XJKA 3WSQH 4A37A 1FLRL 3HMXL 3NH7H 1GZHA 1FVDB 4W9JC 3CVHB 3ARWA 3G6JF 1W0VA 7TAAA 4G6JH 3UABA 5C0BB 3U30C 4BCYA 1MIML 2FT7A 2XOTA 3IJEA 3IJSB 4LSUH 3RWHB 2HKFH 2WP3T 2XFXB 1BOGB 3NPSC 2D73A 3ARBB 2HTLD 5FHBH 1V8HA 3NIFF 2CK0L 4HS8L 1OQOA 1I3VA 4W9EC 1UT2A 4HCRL 2NXYB 1MRDH 4GXVH 4BWTA 3MLZL 1LDSA 2IBGA 4YZFE 1KB5A 1G84A 2PO6A 4RRPM 3WO4C 1RCYA 4Z7AA 4RGOH 4QJ5B 4ZW8A 4LZKA 7PCYA 3L48A 2XI9A 3MRDB 4BUGA 5IQMA 3ZTNH 2OJEB 4S2SB 1C8QA 1SN0A 4JQIL 4EIUA 3L16A 2PCPB 2ZXEB 3P2TA 4HJSA 1IC0A 3HEIB 4GSQA 1G9NC 1XF1A 3FTXA 1FHNA 2WV3A 4ODHL 3RLSA 4M3KB 3CXFA 4JG1L 4GW5A 3UACA 1KJ2A 4KQ4L 2B14A 3MNVB 4XX1G 1S7UB 2W9LA 3GUTB 4G3YH 4NXKA 3IFOA 3WHE1 4X8XA 2HVBA 2ICEA 4JQVA 3WFHA 3K5SA 2E7CA 5A6LA 5IV2B 3NOIA 3HMWL 4WHDA 1MHCA 1W0YT 1D5XB 4PEEA 1YUHB 4WNQA 3RVVC 1MI5A 2B15A 1P6FA 3L4TA 5IHLB 3BPLB 2XHNA 4UDTA 5EZOH 4LSSL 4Q2ZB 4XO9A 4FFYH 3HFFA 5C0CE 3FYEB 2W0KA 1K2DB 1PIFA 4G42B 4I48A 3WY4A 4AKPA 1QTSA 4ENEC 3IGAA 3QG7H 4ODWA 5E9AA 4FTDA 1N59A 1OP5H 4HUUA 2LU4A 3EFOA 1FCCA 1XO8A 3QXDB 4LCVA 3WAJA 5AZ2L 1V27A 3MRNA 2WQ8A 1SGKA 1Q94A 3LYRA 1KYOJ 3SJVA 5GGVH 3CFMA 2DV6A 3CZUB 4KK8C 3V6ZA 4FMVA 1EVUA 4PY7B 3VXNA 1E9OA 5ETUB 1BF5A 3CN0A 2BFVL 4YHML 5FWQA 3WFDL 4KRLB 2P44B 2PKDA 5AW3B 3WY2A 1GVIA 3N43B 3KCWA 1SZNA 3BZFB 1BF2A 1VB9A 2A4ZA 2EE0A 2CO4A 2X3AA 2PCXA 4ZODA 4MAYB 5I8KH 4PH8A 1CE6A 5CBAB 3PHQA 1KGUA 1QFWI 2WMPA 1TSRA 1UH4A 4LPUA 1VENA 1N3NA 4N8PA 4L3CB 1CF8H 4L8BB 3O8XD 5D1QB 2LLLA 3UZEC 4PW4A 4M9PA 5I2IA 1UFUA 3MJ8B 3RWCA 2EEXA 3QULB 2YZ1A 1C5BL 1ZE3H 5DVOA 3PIQB 3VI4F 5L6YL 2I60H 3C60C 1FO0L 2BVYA 3T2NH 1N2RB 2XLLA 1YEJH 3QCUH 2PTTA 4UT7H 5HHME 1JZIA 2VDKH 3MGOA 4M61B 1D5BB 3NIGB 3UP1A 1S7WA 3OKLB 1DJIA 5KVEE 1ZXQA 4GRMB 4N9OB 1NMCB 2ORBH 3MRMB 1XGUA 4PJHA 4A2MA 2NY7H 3GYRA 4WGKA 4H1LB 2WBJA 1UTDA 1OWRM 1P7QA 4BSJA 3UAFA 1DL7L 2R29A 1H3PH 1LP9B 1NGZB 1AD9B 4HFUL 5C0CD 1GY2A 4PJ8A 1CDJA 4XMLL 5EG6C 5D4QA 2APVA 1INQB 3CVHL 3UO8B 3GO1H 3QJQB 2ILLA 4G6KH 4JMXA 4XR8C 4B9FA 2ZYIA 2WWOA 3V55A 4AYGA 3FSZA 1BQHB 3HB3B 2L7UA 1O7DC 1I3RA 1P4LB 1H5BB 1IGJA 5DXWA 3HBGA 1THCA 4AYBA 1AS6A 4XE5B 4MB1A 2JVUA 2OCJA 1FN4B 3GSUA 2J88H 1S7RA 3OR6A 4EI6B 2NY1D 2E76C 3KDMA 1H3XA 1ET5A 1G9HA 5LB1A 1AKJA 3GIZH 2FAUA 4IIZA 2WYZA 5DSCB 4YHNA 3LN9A 2VCOA 5C0RH 5CCKL 3Q8CA 2E56A 4KOBA 4D0DB 1SLWA 4N9GA 4GUQA 1UD6A 4LE8A 4U1LA 3DV6B 3CFKA 4AENA 2HVJA 3RFZB 5ESQA 1IAOA 4YQXH 4MSWB 2GYSA 5AAPA 3I9GH 2WUCH 4XVTH 2QLVB 5BV7C 1HT6A 4QO1B 2A1WL 5DUMH 2FGWH 5H4YA 4IOSA 4K8RL 2Y07H 2E74C 3VTTA 2N59A 1KCRH 2A5UA 8CGTA 2BIIA 4LU5L 1ZDQA 4NRXB 5KVGL 4TQ8A 5DA0B 1M9SA 1QFWM 5BUGA 2YQBA 3MKKA 1RZIB 4B97A 4G80A 4ODVH 2P5WE 3K6FA 3FUIA 1Q9KB 3QQXA 5HHMD 4ENZA 4N0FA 4LEXL 1W0VB 3PJLA 1R0AH 1QMUA 2G5UA 25C8L 2F68X 5MI0B 5FM5M 1CD0A 1DVFD 3KWWA 3QUGA 3VWKA 3NQIA 1XF2A 2DBLL 1DP0A 3QO1B 3UTTA 5LNGA 1MCNA 4I0KA 4UB0L 3FUDA 5HI5C 4D9RE 4RMSA 3WS3B 4UNVA 3NSXA 3CGTA 4Y2DB 5HI4D 3TN0B 2ZOLA 3VGGA 1QFPA 2LT9A 1KB5B 1WBYB 2ATPA 1FVCA 3P4OB 2C9SA 4XP1L 1XWVA 1U8PA 3AB0C 2EO9A 2OP4L 2G30A 1T1XA 4XP5H 4ODBD 4I18A 2JB5H 3C5JB 4JJ5A 5C0AE 3FQ4A 4H8UA 2R8SL 5GPRA 4RIRA 2WQVA 5ID1B 4PJ7E 1A3LL 4BEIA 2YXVA 2E4FA 3AT9A 4TVPH 3T3ME 1TEFA 4Z9KB 4BSVA 1AO7A 1ID5I 2H3KA 1DEEA 1SJHB 1UACL 2NYYD 1A14L 1M05B 1R33A 4DHLA 2AJYH 5SX5H 2E47A 3ZTJH 1DZBA 1LXMA 1T2QH 3QI9B 3IJ8A 1JHTA 3PLYA 1T0OA 1HXMA 4N8CH 3KM2A 4KUZH 3EDJA 4PRPA 5EU4A 3WFHB 2GAZA 1XAKA 1MHCB 2R2CA 4WNQB 1QTYT 3MLRL 5HHNA 4A7UA 1AR1B 5B3NA 4UDTB 5TGBA 1O9WA 2ZICA 2OMWA 3FRUA 1MZZA 2J3SA 4DVRH 1HNYA 4A6YA 4ZTPL 3GMNA 3T6VA 1DVSA 4HK0A 5CILH 4NSKB 4D94A 4FHKA 3BSZA 1HESA 3ZHLA 4ODWB 4FQXB 4WW1A 2WLJA 3KGUA 3H56A 4HUMB 3GC3A 2YKKA 1OP3K 4HIIA 2P5WD 3EFOB 1XR8A 2QV2A 5D7LA 3VXUA 3CFUA 4ZT1A 2Q10A 4WKZA 2G4GA 3RURA 1RHFA 4F7PB 3FB5A 4UAHA 2K78A 3LDBB 4F37K 3V6ZB 1MREL 3LZQA 3DNKA 3QFJA 4JE4B 1MCKA 1G5AA 1E9OB 3N40P 1GAFH 2FT8A 1DVFC 5IEKA 4D9RD 3A22A 2HB0A 2P8PA 2QELA 3ARDD 1JNJA 1EO8H 4P23A 3IKCA 4XMKL 5JLZA 2UY6A 3BP7A 3D52A 3RQ3A 3ETSA 4YIQA 1FFPB 3ISYA 2AABL 1KN2H 1AR2A 5INDB 3RTLA 2QVFB 1QYGL 4U3CA 3PHQB 1PD1A 3EF4A 4FULA 4LHUA 4KZDH 3F7QA 4MJIA 4QHNB 1KENH 3IN0A 4YUEL 4W68A 2VRQA 1EEZB 3E6FA 4XPBH 5C0AD 1JAEA 3GXUB 5AB0A 5L4IA 3SSGA 4OT1L 4X83A 5IW1A 1BZ7A 5JOFA 2JCCE 3BKJH 2G3ZA 4AUJA 3V5KA 2JB6A 1FSKC 1F18A 2AQNA 2WLNA 5E4EB 3X3GL 3X12A 1QSVA 1XB8A 2NT0A 2WXRA 3CMOL 3FYIB 3PFQA 4B27A 5DUBB 5C3IA 2R4SL 2XWZA 2BHYA 2PTTB 1T7YA 1QATA 1GYWA 4HPYH 1RJLA 4JO2H 2J6EL 1BVKA 5D5MA 3WFEH 2NYYC 4ODSL 1R3HA 3GEFA 4KVCH 4Q0XH 2V0AA 2ZOWA 2R59A 3WCYA 4U1MA 2WP3O 4HZ1A 5FPIA 4HZLA 3L08A 3P3UA 4R26H 4OB5L 1BPLB 3T0VA 1DBKL 2VN7A 4EN2A 2DQMA 1XCWA 5F9DC 1PNDA 3UBXB 5EOCL 2GQHA 3MRHA 2W81C 3DSNA 3G6DL 4HW6A 1CVRA 4RVBA 3ZR6A 1I7RA 5E8PA 4A2FA 3W9EB 3CNKA 1UOLA 3V8CA 4K2UH 1AGFA 4N8VB 1WZAA 1I3RB 2YGNA 1IGJB 4WJKB 1EGJA 4B9PA 4ALAL 3FB8B 2VAAA 3IDJA 1D5IH 4WKXA 5I0YA 1P1VA 1MEXH 3FMGH 5E5UB 5HJGA 1S7RB 3DJSA 1AZZC 4YNYA 4ETQB 3CUPA 3HS0B 3FU5A 1VERA 3VD1A 4H0GA 2F8XC 1AXSB 1ZTMA 1PJ9A 1T1WB 1F58H 1Z9NA 3KYOA 5D2NA 4HPOL 1PG7W 3QIBB 5EU5A 2F5AH 3L3DB 5D70L 4M43H 1GYCA 1UZ6E 3IGFA 4YC2B 3W2DH 4TUUA 3ARDC 5JO5B 5CCHE 2AJVL 2IEPA 1IM3A 5SWZE 1MVUA 1WBXA 4DT2A 3IFPA 4NJ9L 2EO1A 2PXYD 5BS0E 4L5FH 4MCZA 4XNXL 5IFHH 1UGKA 3GI9H 2D3VA 2PCYA 1NCJA 3O2VH 4DEUA 3GZQA 3MOBH 1N8ZA 3DBSA 2YJQA 3PQYE 5GS1A 1HSAA 3KJ4B 2Y3AA 3SQBA 3HG1A 3BIAX 5E0QA 3E0GA 1A22B 3ILQD 4P2CG 1M7DA 2HT4D 4P5TC 3T6WA 3TM6A 5I5RA 4P9HC 5DFTA 3HUJE 3QCTH 4GW4A 1JXGA 1UKTA 1X6LA 3U7YH 4A1RA 5ICYB 2NNXA 4IK6A 3ZIYA 2BNUA 3KWWB 2PETA 5CXPA 4PWGA 4WW2F 1HOCB 4BH7A 1XF2B 3T0EA 4PN6A 2VRAA 3OLGA 3UTTB 1RVFL 2G2PA 5CP3A 5FO9B 4IIQA 4I9XA 4JB9L 3RJOA 1U3HB 3RVTD 1MNUL 2NQ3A 1B88A 2ZOLB 4KJYB 3WJLC 5T3XE 2WXOA 3BVDB 1S7XB 3LNGA 3M86A 3B56A 1KIQB 3PAUA 1EIBA 4Y19E 5D7HA 1CLOL 4KK9D 1T7WA 4AGPA 4I18B 4JJ5B 1CL7I 3LHPH 2YN5A 5SX4I 2ZZUT 3RUGE 4Z7QB 1VLXA 3QHZL 2D7NA 5E94A 2ZX5A 5GRJH 1LQSR 3EKCA 3FH7A 4XPHL 3S36L 1AO7B 4BSVB 5IJKC 1K8IA 3KBHE 3U36B 1FL6A 1H19A 5KVFL 4RWHA 1G9MH 4DOHE 3VFMB 1UFGA 4BQ6A 4XPTH 3A24A 2BP5M 3B3IA 1BOYA 3VFSB 2A7BA 3O2DH 3WE1A 1NIBA 3SHSA 1IEHA 4PRPB 5JXED 1CQYA 4WWKA 3V4VH 4MA3A 2HN7B 5GHWL 1OL0A 5HHNB 3Q48A 5ELIA 1G7JA 1O5DT 2YUZA 2UXGA 5SWZD 1S78C 1HVXA 1FHGA 3OD3A 4YSUA 5BS0D 1JV5A 1VFAB 4UNTA 4F8QA 3LD8C 4A6YB 5JW4R 4X9GA 5E4IA 3PWLA 4YWGL 4PSPA 4HK0B 5I5IA 1EHLL 3SYPA 5JQ6L 3OAUH 3QEQE 4KQ0A 1FAIL 4JKMA 3PQYD 4M9OA 2J8UB 5DFVD 3EYVA 3KLLA 1AHKA 3DXAE 3KYKH 2QHRH 1XR8B 2RQEA 1MAML 5D7LB 5C09A 3P4NA 5GGSA 3UX9B 5E0FA 4P4KD 2VR5A 4DTGL 3ILQC 1H9DA 1TDQA 1ZHKB 2HT4C 2ITFA 3QJTB 4N2CA 5C7ZA 1NCWL 4EO5A 1RHHA 3FSVA 3QFJB 2WO4A 4PRHA 4BK4A 4J28A 3BX7C 5IEKB 2QVTA 3B43A 2OSLA 4OTXH 3IKCB 4X4ME 3X2QB 3ZO9A 2Z35B 3GXFA 3C8DA 3CN1A 5I6KA 3BP7B 4X7TA 2W9EH 4EQ3A 3O6FC 1IGCH 1RZKH 5T3XD 2VDLB 5I0DA 2FX8H 1KBGL 1TO5A 3BUBA 3QWRA 2IMMA 4YX2L 5JHLH 5L7XL 1I8MA 4Y4HB 4Y19D 3PPEA 2VXQL 4ZS6C 2FTAA 3HZMA 3P77B 2HFFB 1AIFA 1EZSA 4A7GF 2ZOOA 2BXZA 2UXFA 2WKOF 1BZ7B 3CHXA 5JOFB 1JF1A 4KK9C 2Q3ZA 1HH9B 5FFOA 1CVSC 1GYUA 3HG2A 3NESA 3NFSH 4Q56A 4UIMA 5FA4A 1JNHA 3W3BA 2ZCHL 3V7AG 3OF6A 2A9AA 3UROR 1OOAA 3D9AL 1JZJA 1UM4L 1GGIH 4TUJA 3N2JA 3HFML 1RJLB 5D5MB 2A9MH 4N1CA 3OZLA 4AUUA 1LEIB 4PLKC 3H7BA 1R3HB 4I4WA 4YDJA 1R17A 5LO7A 4X2UA 4QUOA 4ONGH 4U1MB 3GTVA 1HU8A 3CVDA 5C0EB 4UQ2A 4EEEA 5K9OB 1TJGH 1EXUA 4PJIE 4MJJA 4JE0A 5CZKA 5GZNC 4IBYA 2X0WA 1ULVA 2L8AA 5E24E 1I7RB 2IGFL 5E8PB 3WTSA 2GBUA 3QEQD 1OAUH 3Q5YA 4LQFH 2VH5H 3MA7A 3N04A 4U6YB 4HIXH 1R3IH 2EIZA 5HBBA 1NSNH 3TVMA 1NBQA 2UYLA 1U4EA 3K1KC 5ECJE 3S5LA 3UJJL 3DXAD 2NW3A 5A2FA 4ZUSB 1Q0XH 2FWUA 3T3PF 2VAAB 3IDJB 2OI9B 4KAQH 3UG5A 4UT9A 3UZQA 1KNOA 2HX9A 1N4XH 2X05A 5F8RC 2AJSH 4YDIL 3NFNB 4L1SA 4N4YB 3WNNA 5D2NB 4JDTL 5LQBH 3LRKA 1MCWM 3ZW3A 1Y6NR 3A4FA 2XETA 4YDMA 4NC1E 4XNQA 3MXVL 3W9DB 3RIAK 4WO4D 4EZMA 4OY9A 4ES8A 1ZHBA 1IM3B 1MVUB 1BZ8A 3IFPB 5L8JB 4MCZB 4CVXB 4G8GA 3MYJA 1JSYA 3IETA 3SDDA 3OG4B 5SWQB 4G6MH 1XGZA 4NKIH 3UCRA 3ZE2B 3R19A 5FYJU 3QNYB 2XUWA 3R06A 2IALB 3G9VA 3SQBB 2CJTA 3HG1B 4HEPA 3RWEA 1NLBH 1AQMA 2DIEA 4FJZA 4J3OD 2WNKA 4UAOB 3KWUA 5F3BA 3BVWA 1JNNH 3O3AB 4GW4B 1ADWA 4O58L 1DUZA 1MDTA 2DYSB 3JTBA 4PJDF 4BFBD 3T0EB 1I82A 3GBML 3A6CL 1GXEA 3K2UH 3QUYA 4RNRB 4U6TA 4YFDB 3VTMA 2GI0A 1AZBA 4GAJH 4AVKA 1A9VA 3CQPA 5AAWA 3G9AB 5CMAA 3R7RA 1JWMB 1BBJA 2NXZD 2XCMC 4LARH 4WEUD 5TD4A 1CFSA 3SKOA 1YN7B 2F1EA 3UXFA 1E42A 2VLLA 4ZOCA 5DC2A 3LKPB 1JZ2A 2X4TB 3KVQA 3D7PA 3MXWH 3AG3B 2FEEL 4YDKH 1IBZA 1IC1A 4AQ1A 1FZJB 1MI5E 1O9VA 2QQNL 2VXTL 4IYKA 4HKXA 4YBLC 1OTUC 1X5JA 1TTUA 3QQ3B 4RMWA 2QHLA 2Z9TA 3V4LA 4HIEB 3NACL 1FL6B 4N8UA 4UOJA 4LAQH 4TPRL 5C6TL 1G43A 5C0DA 4UIKH 1I8KA 1YY9C 5IMOB 2XXMB 2AEQH 3AADB 5AKVA 3U4BH 1LO3L 3B3IB 2EINB 3GMOA 1WISA 3ULVE 4OZFB 5C0JB 2J73A 4UV7L 3C08H 2AQ2A 4XN2A 2EDYA 4TUOB 3SJVE 4BXVA 3KPPB 4WEMB 5AVYB 4PJEF 3CQQA 3TBCA 3MA9L 4HUVA 5E99L 4M48L 3QG6B 4OFYA 1TLMA 1JV5B 1FIEA 1PMYA 5ABZA 5IWLC 4JFZH 1IUZA 4KRMB 4UOQA 5T3ZE 4L8SB 4UBDD 3IDXH 4QY8A 1WE5A 4WCYL 4OI7A 4RFNB 1K3ZA 1NAKH 2RD0A 3KBPA 2PO6D 3LSOA 2W5PA 1JYNA 4FAAB 2IAMD 2FZ3A 4KI5E 3K6SA 4ANVA 2DY2A 2X38A 3KR3L 5GJSL 4YE4H 1L0QA 2ZKHL 2D03H 2HJLB 3LH2H 5C09B 3P4NB 5GGSB 5MP6L 3US0A 1WZLA 4NNXA 2X3CA 4JZJA 3ZTEA 4N2DA 4KGJA 1N0LB 2Y72A 3MODL 2JNZA 1J8KA 2PPAA 4NBYB 4PRHB 4DKEH 4RGNB 4FF9A 2VABA 4PJGF 5L4MA 2C1OB 2BSTB 2FJHA 5F7WC 2X70A 4PJAA 5LBGA 5JUEH 1W72B 2QPEB 1WA2X 5HDWA 4LDOB 1GSKA 4RDQF 5LBSH 3TEUA 5EBMA 1WF5A 2A6KB 5AUMA 3QUZA 4FFZA 3SDAC 4F15B 1EGJL 2BZCA 4MJ5A 2Y24A 4HOZA 4PJHE 3I3BA 3OKYA 3PNWA 1IFRA 3HZMB 5DI8A 5K1NA 1MI5D 5DO2D 1OTSD 3BYTA 3VD0A 1CDHA 2HFGH 3RDTA 2BIQA 4AYID 3WFBL 1A7PL 1QACA 3BIKB 2R0WH 3P73A 1URZA 3WI9A 5I0WA 2FO4B 4BZ2L 2B9AA 4Q8BA 2RAMA 1HEZA 1W16A 3EO1A 3NG5A 4UIMB 5FA4B 1ZGLM 2A9CA 3UJTL 1CDYA 1GYVA 1A6TB 4FXGC 2KMWA 1DBMH 3F2LA 3E2HB 4HBCL 2YKLL 1KYUA 4JHWH 2HJKB 4TUJB 5EO1B 1XIWC 1TZ8A 2WGNB 3C6EA 2PWEA 3ULVD 3ESNA 3S37H 3QWOA 4YDJB 2BIMA 2ARJA 2GHWB 3K6NA 4PJ5B 4Y5XC 4P46A 4LVNB 3SJVD 1IBHA 2ADJB 3ZL2A 2FQDA 5FYKH 2TSBA 2BLFA 1S46A 2ITEA 3QCVH 4UQ2B 5KN5A 4N86A 2BSRA 1IGIH 1NCIA 1A64A 4NC1C 7FABL 4S1DD 1U8MA 2WXNA 3WLWC 1ID2A 5DLLA 4HXBL 5H2BB 3SKMA 4QTIL 5GRUH 4MLSA 4PS3A 3MJ9L 5T3ZD 5IJBC 5T1KB 3DSFH 1IKNC 3ROOA 3EJZC 4E9WA 3MA7B 2CPUA 3T4YA 3GSVA 1N18A 1WA1X 2EIZB 5ENWA 2VQ1B 4UV4H 3ENEA 3L3OA 4KI5D 3TVMB 3ZBMA 1T3FB 1WICA 2WXLA 1S9YA 2EIBA 4AGMA 4Z8FL 3QWNA 4TN9A 2IAMC 1NFAA 5FLVA 1X5AA 2EYSB 2Z4QA 1KNOB 1RZFL 3OGCA 2NDFA 2AS5M 3MJWA 1HEJC 2XV0A 4JQXC 1NFDA 1NGQH 4Y4FB 3APCA 3BMWA 2GY7B 1GGYA 5JHMA 1TTGA 3H8NA 1IL1A 1DJSA 4DEWA 3PGCA 2J4WL 4Z3IA 4AVHA 3DVFA 4ECNA 2WZ0A 4HD5A 1QW8A 3HPLA 4K7PX 1J5IA 4M6NL 1ZHBB 1UJTA 3GHEL 1F00I 3P4MB 5I1CL 4OCWH 5D72H 3KPNA 1FGVL 3PWJB 3QJHB 3JTSA 3RRQA 2WBJD 2ZXQA 1QZNA 3OLEA 2NTFA 4MVBC 4KJQD 1P7QD 4PM1A 3D50A 1K85A 2DI9A 4BXSV 4MMXA 3EOBA 3QPXH 1JI1A 4HIHA 1OTSC 5DO2C 4PJ8D 3R06B 5EUOA 3A0OA 4IBZA 2EDEA 3RWEB 3FFCE 1P5UA 1RI8A 2CGRH 2MOQA 1WCBA 3IDYC 3ARGA 3GLDA 3TT3L 2P80D 3QXUA 2AF2A 2D0FA 1DUZB 3HJ0A 5EO9A 1HWHB 2OK0L 3V0VA 2IH3A 2OBGA 3QUYB 2NCEA 1KCBA 4MCNA 4RFEB 5EIIG 3FH8A 3U1SH 1OHZA 4ZUVA 1AKJD 3ILEA 4I0PB 3F7KA 2B77A 1CT8A 1DQLL 1CFSB 2GUOA 2XIBA 5E1IA 2H6UA 1CBVH 1T83A 4GXUN 2CO6A 3WENA 1CICD 4OCRH 4MMZA 5IW3A 3PHAA 4JGMA 4LLVA 5IROA 1ORSA 1CGXA 1J9CT 2CJSA 4WTQA 5T1JA 3D33A 2AK4E 4I3SL 4H8QA 3GHBL 3IDNB 2EKSA 1NCAH 1B4RA 4EOWH 2F54A 5K9QI 4MAUH 5TDPB 1W72L 1TVHA 4C83A 1H3UA 3E8UH 1LK3H 2YHGA 2XTJB 4YHPA 4GW1A 4IMKA 3IU4L 2NLJB 3L5WB 2KPNA 3VXUE 3WUWA 4E0RA 3EJYC 2W1NA 1OM3H 2DEXX 4YZFF 2YD8A 1KIRB 1JPFB 3RVUC 4OLXL 3VWKD 4BFEA 1F4AA 2R56L 5FLUA 1KTLA 4GKNB 4K9EC 5LXVA 1HWWA 2APWA 5CJOH 5I1JL 4GEIA 1E90A 1HINL 2V3EA 3ELQA 4G8FB 5IR1B 1NGWB 1SY6H 4PJXA 5HYQA 5EHFA 4I13B 1I7TB 2ZWNA 1R5IA 5FOJA 1J8HB 1SQ2N 1N6VA 3U2SA 5C70A 1ETA1 1F8TL 1BYNA 3LSOB 5ANMA 1KTJA 5DHEA 3QH3A 1X5ZA 2FZ3B 3FFCD 3K6SB 2WNWA 3ZOAA 5L2JA 4LSVH 5E6RB 1I1AB 5IKCA 4MJIE 4AW7A 1M1XB 4NCC2 4HJIA 1OGTB 4O51B 3EH3B 2JH2A 5JNYB 4JZJB 2ODIA 3AZUA 3TEYA 1ZJBA 2AW2A 2CZNA 4L18A 3ZMEA 3MRGB 3F01A 3FN3A 2R9HD 2AJUH 2FJHB 3QEGH 5DQJB 2R1YA 4HWBA 4FNTA 1YPZB 2NY4C 2QFRA 1J9TA 3LIZH 1IFGA 5FAAA 2XZQL 4JY5H 3OJDA 5AYQA 5MEPB 1SJXA 3VWJB 1CFVH 1BQKA 4TVUA 4AX3A 3RNKB 1OCZB 1VACB 4TL4A 1TEGA 2VL4A 3MLVH 4MJ5B 3VFVA 3PNWB 1XTMA 4P8QA 5DI8B 1J1PL 3GRWL 3NJJA 3EYQD 4QXWA 1MHHA 2WJ7A 3BDYH 1N26A 1Z9LA 1CLYL 2G0LA 3LMJL 3F04A 3EBAA 1S9WA 1CICC 2AK4D 3F84A 2GJ6A 5IJCC 3U6RB 4FGMA 1GGBL 1CD8A 3EO1B 3B2VL 4XT1C 2GJZB 1XGTA 2LU5A 1BVNP 1F41A 1TTRA 4CGUB 2VW6A 1P7KA 5F7UA 3QWOB 2DZEA 4QTHB 1W15A 2X9WA 3VXUD 3C5ZA 3L54A 4TSCL 4L9LC 3I6KA 1OF2B 1J9SA 3D51A 1WTGT 5KN5B 4PP1C 1BM3L 3FO2A 4JPKH 2RFXB 4UM9D 4Z7NE 3TBYA 3FO0L 3FU6A 1E4KA 1JNLL 2B4CC 4HJ0C 4WI9A 4P23D 2RALA 4TSBH 3SKMB 4EBQL 4MQXD 2BCKA 4H8HA 4OD1H 1ADQA 4WV1C 2GTZB 3O3UN 4PRDB 4U1GC 1U3YA 2C3XA 3BLPX 4RX4A 3TA4D 4X5RA 2TRYA 1Q0EA 4JFVA 3SPJA 1ZD6A 3I3DA 5ID0A 2OTUB 5EC1B 5ENWB 2C4XA 3L3OB 5T1LA 3L5IA 1F6LL 4LHUD 1KB9K 5SV3A 4MJID 1D5MA 1IQWL 4ZMZA 3PV7A 5DZOA 1A6PA 5DVMA 1QEWA 1JGEA 2GC4C 1S9YB 3MRPB 4NHUA 3PP4L 4U7SA 3IS0X 1FJ1A 4E42A 2VWEE 4HCIA 2Z4QB 4P9MH 4GKOA 2GI7A 2XN0A 3HG1E 3SZKC 5EEVA 3H9SA 4KKBD 4G5ZH 2XG5B 1J0ZA 1UC6A 4UTBA 3F58H 4CU6A 2DWEB 1IL1B 2O5NA 3OJVC 4QRSB 1GW0A 5H8DA 3DOHA 5CP7A 2P1YA 2H9GA 5J5EA 2R9HC 2WZPA 2IH9A 5BRZA 2ZCLH 4MDIB 3G04B 3RWFA 1EJ8A 3KPNB 3TNMA 4IKJA 4DEPC 1NCGA 3WTUA 4B3EA 1OK8A 3F6LA 2NTFB 2OMXB 2ZX6A 3Q44A 4NZUH 2WWMD 3KH4A 3QPQC 4QAMB 4ZOAA 1KCWA 2OAAA 5GGUB 4MMXB 1R3LB 3IFNL 1UOVA 3DX4A 4FG6D 2OKMA 4FQLH 3S34L 3B9KB 4S1QH 1NWPA 3P11H 1P5UB 5DRNA 1WCBB 2XYBA 3TCLB 4YXHL 4RGMC 1A7NL 3AFLA 1TU2B 1IFHH 4U7MA 3Q2CA 4XCFH 5EO9B 4GAGL 1LE9A 2VC2B 3TL5A 5G4NA 2CLRB 4DUVA 1M7IA 4K94H 2IH3B 4YHKH 1CLZL 4OQTH 3ZN6A 2IQ9H 3Q43A 3PPSA 1FIGL 1QNZL 4L0PB 2ZQKA 2VZUA 4JPIA 3K7UA 4RQQA 5DD6A 3HE7B 2IOIA 1YYLL 3MVSA 5IEHB 1Z9MA 2J5WA 2Y1VA 4Q58C 1SF5A 4IRJA 5GGRB 3FSOA 4ES9A 4KWUA 3AREA 1JXKA 5HGHB 2A74B 3N6YA 5E2UL 4HWEL 5JPNB 2DIAA 1I8AA 4MMZB 4NFBA 1XH3B 4CDGC 1K9TA 3X1GA 4LLVB 1ORSB 5ADOL 1QWUA 4LOVA 3WKPA 1YEIH 2H5UA 5TFSL 4HS6A 4CL7A 4Z5RA 4YVUA 3O6LH 2EKSB 3ISRA 3OBAA 4FFVD 4W9FC 1TVHB 1P69B 1NOAA 3EO9L 5EU3A 2FYYA 3CK0L 2A77L 3HG1D 4GW1B 3TJHD 2X1OA 4MA8L 2YAHA 3DBXB 2FIRT 1U8QA 3MRBB 1AQKH 4C4KT 3WUWB 1RXLA 3HG0A 4KKBC 4WU5B 3TCTA 3GM0A 5AW0B 2P24B 2PLTA 1QSEE 1S7QA 2BOCB 4N1HB 5D1XA 5EIVA 1C7SA 2NDGA 1FFQA 1T4KA 5AWNL 4YHIA 3L4WA 3VXOB 2QQKL 5HGBA 1MCCA 4YE0A 5HYQB 4LNRB 3GHPA 4PJ7F 3OR7A 1R5IB 4KXCA 1A7OH 1I9JH 3U2SB 2FLBT 2WANA 1DJYA 5AKSA 3ZT5A 3NTCL 5I75C 3QH3B 1T66D 3AQXA 3Q3GA 2BWQA 2VMJA 3R1GL 1BIIB 3LZPA 1HHKA 1ZLSH 2LTQB 2OR7A 3M1CA 1MWAH 3BOVA 4DGYL 1F0LA 2YGQA 2VXUL 4HKJA 4FTVE 2NY6D 2FATH 3EZJB 4IDJL 1O6SB 2GABA 3MLUH 5BO1H 3ZDZE 5KUKA 4GLRI 4N6QA 1E50A 4PWHA 4YLBA 2AXHA 1H3TA 3HN5A 2WHVA 1DO6A 2C4FU 4XNUL 3NZHL 3H9HA 3BDBA 5CGBA 1CGUA 5CLWA 3PUCA 4N2HA 5E6SB 1GGUA 2ATKA 1DBAH 4Z7OF 3GJFA 2BHUA 5IGXH 2JTYA 3FFDA 1CN4A 2FCBA 1KJVB 4WWKD 5B1JA 5A16B 1IGFL 1U2YA 2V5TA 1ASPA 1MHHB 2HCZX 5GRYA 3QQ9D 1P2CB 5GS3A 2V7HA 5JR1L 3DC0A 5FOBA 2F19H 3HC3L 3BPNB 4WEEA 5D2LA 4Z77A 4JFYA 5LGKA 1MQ8A 3L3HB 4Z3FA 2BY3A 2A2QT 4U0RC 3T8XA 3FCSA 4CSPA 3A6OA 2O6FA 1X3DA 2DWXA 4HP5A 3EH5B 4K3HA 1OPGL 4MD5B 4OGXH 3N41B 2JKTM 5BOZG 2Z7ZA 4NZFA 1ZA3A 2K9FB 1JHLL 4I87A 4CNIA 3BKMH 3JWDL 4DZ8B 1F6FB 2X89A 3ARFB 3ZDYE 4WI0A 2BIOA 2WWNA 2FWOB 4XZUA 2ZSWB 3FF8A 1BAGA 1B6UA 3R4DA 4CVZB 2CO1A 2Y7SA 2DDQL 3TBYB 5D7JA 4FQPA 4EKXA 1YYML 3VSQA 1KPVA 4LLWA 2BCKB 2NY5L 4IRZH 4OBRA 2G5RA 1QASA 2ICCA 4XN1A 4BELD 1N70A 3QWRD 2CUIA 1J1OH 2VDRL 4O2CB 1TZGL 4JREB 5E6IB 1HTYA 5HD8D 1CUOA 2VC2L 1D5MB 1QLFA 3EJTA 2EEAA 3IMUA 2MCPH 2BJML 3MO1A 1JGEB 3FC8A 3NRFA 3P0VH 2AKRA 4G8GE 4NHUB 1XSIA 4XVJH 5HYSG 5CO1A 1RUQL 1X5GA 4FTVD 3VFPA 2JIXA 1QVOA 3N85L 2UZYA 1KJ3L 4NQXA 4V11A 3AS3A 4NOBA 3RTQA 2AXFA 2JSFA 3QT2A 1M57B 5A2KH 5FW7A 2XBDA 1X9RA 4GNKB 3OF6D 4WFFE 4X6DA 3M1BB 3EHBC 1KY7A 2E75C 4X4ZA 4JCWA 3EBHA 3SEPA 4HU8A 3D69A 5DUPL 4WI3A 4ZUTB 1SBSH 4D9LH 2AK1H 5BRZB 1RFDH 3DHUA 3TLRA 4L05A 1L9TA 1YNKL 4XVUD 5I5JA 1RZJC 4MXVE 3HIZA 3JVGC 4WI4A 4F5CA 4X8JA 4Y2LA 3WIHL 3U1QA 1YMHA 4W9IC 5IFAL 1NANH 4GG6F 5D55A 1FNEA 5FGCB 4H2AA 2OYKA 1XH2A 3QC6X 4ZRGA 5DS1A 3CZFA 2F2HA 2ITDA 3AUVA 4KDTC 3R8BB 2XRAL 2E27L 3K6OA 4IGBC 4NT6A 5DRNB 5B7MA 1ZTXL 4LHQB 3QISA 1AE6L 3HNSH 3IGLA 3G6JA 4ORGB 2ADFH 4X0KA 3H0TA 1D6VH 5FUOH 2G60L 1DBJH 3QHFH 1L6XA 2DYPB 4GUPB 5A7BA 4QRQA 4JL1A 4L2LA 3LEVH 1ZEAH 4GRWF 1ECZA 1I8LC 1M7IB 2Z91A 3L3GB 4OD3H 3V6OE 1GIGL 5BCAA 2Y6TE 5KTEL 1HH6B 3HZKA 4LHJB 1F4HA 4J1UB 5CLTA 3ZE0E 1MAJA 4RQQB 3WEOA 2DTMH 5TK4A 3KHOA 1PG7L 2V9TA 4ONFH 4OGZA 3OKOB 1ZCRA 3BAJA 2AJZA 1JGLH 5TDNA 3HI1A 5KANI 4CC4A 4GG8A 1A6ZB 5L88L 1ZVHA 1D7FA 3Q6GH 1E5BA 2VDQH 3GMQB 4NUQA 5FO2A 4JFPB 4F7MA 1B2WL 4Y16A 5FIEA 3FOLA 3PWVA 4HSQA 1JZ3A 1E65A 1NAMA 4W6XB 3BH9A 3P30L 2Q8BH 1N5YL 1FH2A 3PHOA 5HYJB 1IBGL 4G8GD 4YGVB 1OV8A 2O5XL 4OGAC 3SDDD 5HD8C 4GP5B 2EADA 3GI8L 1CTOA 1WEJL 5EU3B 1MFVA 2Z92A 2P3YA 1NQBA 4PYHA 4PRBA 2FYYB 4LEOB 4XHJC 2D3JA 5LDSA 2AZUA 2BHZA 1F90H 3T04D 2V9RA 4WFFD 3BEWA 1U8QB 3GXTA 4WHYG 2DQEH 1FFTB 4PTUA 1I85C 4M1DL 5CGYD 5TE6L 4XBGA 5T5NF 1PZ2A 2GSMB 1WIPA 2V8LA 3D12B 1KYDA 3EGSA 3Q8AA 4HS8H 4KVNL 2D7QA 2DEWX 4MA1B 2DMBA 2JJTA 2AP2A 4HCRH 1S7QB 5D1XB 1IC4L 3UBFA 4C56A 4DKFL 2WIIB 4PJAE 1DQIA 4QMEA 4ZUWA 3QAQA 3RUGF 4HUWA 4D0BA 2VN6A 4JLRA 3IRCA 3OR7B 2V5RA 2AZAA 1URLA 5H4ZA 2VJ0A 2I9LB 1R24B 1TETL 2A6IB 2ADIA 3MLSH 3Q3GB 3CCHA 4ZOBA 3AU1A 3MACL 3S4SG 4AZUA 4NC0B 4NB7A 5DJXB 1HHKB 5I6XB 2P8LA 4IU2B 2Y36L 3OKKA 2VN4A 4APQB 1K8DB 2AQSA 2JJSC 2APBA 2VO5A 3L81A 5ADPL 1JK8B 4IHOB 4ODHH 4JG1H 5FECA 4FRWA 2FX9H 4D8OA 2EIMB 1HWGB 2PP9A 2Z31C 1SXAA 4KQ4H 3TJEL 4F1ZA 5I71C 3MBEB 2NR6A 4M6OL 5HVGB 2AXGA 3GRBA 3SKJL 3H9HB 2YAPA 5DO8A 5I74B 3IK2A 3L1FA 3QDJA 4G1EB 3WIIH 5HP5A 2ATKB 8FABA 1BWMA 2B20A 2I9TA 3FFDB 5F9OL 3DTUB 2EC9T 4FA8A 2XY1A 1IVTA 35C8L 3LXCA 1JPGB 2J1YA 4HCGA 4BINA 4QRTA 1N6QL 3VH8G 5KZCD 3ELAT 5E00A 2V7HB 4DN3L 3F64A 5FF6A 5IQ7L 4Z77B 2X4QB 2YD2A 3VI4A 2VM4A 3FCSB 4UT6L 1IMHC 5IB1A 1ZWIB 5SX5K 2Q0ZX 4K5NA 3DGGA 2C1PB 3LKSB 5DRWA 4A63A 1E5YA 2FNWA 1A3RL 1T7XA 2FBJL 4MXWH 4CKVX 1A4AA 3IVKA 4LEBA 1E27A 3SDCA 2Y7MA 1S7VB 1UXSA 2B9BA 3V0DA 3L17A 4FYSA 1EZVY 2C9AA 1CGYA 3D5OF 1DBBH 4YDVA 5EEWA 3EYSL 4WI0B 1HXYA 1WGOA 3H3PL 3MCG1 3ZSSA 4XZUB 2JI3A 2BFVH 4XX5A 3QUXA 1F56A 2Y7OA 2P43B 4M5SA 4MA7L 4OCSH 3S88L 2EE9A 2B5IB 4NIYE 4LLDA 3Q9PA 1NFDE 5FO7A 3KL3A 5IOKA 3QEUA 4P5KB 3OWRA 1M7UA 3ARXA 1UB5A 4ZW5A 4PU2A 1M2OA 3NRQA 5IVXB 4O02H 3MOQA 4EVNA 2NY3C 1JMXA 2KLSA 1KIPA 3CTTA 3O4LB 4L23A 3QUZD 5JORA 3LKNA 3KZ8A 4V33A 1UD2A 4UZSA 1YEEH 1QLFB 5K1VA 2VUOA 3WN5A 4HUNB 5J06A 3MO1B 3RDTD 2AKRB 4G43A 1IAII 1U33A 3NH7L 3HI5H 1FO0H 2JIXB 2CLZA 4EIBA 1QVOB 4FCAA 2UZYB 4K7FA 5EUOE 3U0PA 4XMUA 1PY4A 1BZQK 2HKFL 3ZE1B 5DVKA 4KITB 1NUNB 3FAXA 4O2EA 4X6DB 5FHBL 5FA3A 2MMXA 1Q9LA 3VM7A 3WG7B 2DQCL 5I26A 4IK7A 5DHVH 4XWGH 3V6OC 3D69B 1MRDL 4YLCA 1GRWA 3GB7A 4GXVL 4IRSB 4ODTL 4C4KO 1S2EA 5I6LA 3VGAB 3I6LE 4P46D 2EXSA 4F2MA 4H44C 4Q89A 3BP6A 4GBXA 1JS4A 4RGOL 4X8JB 3WDHA 4OFDA 5HDLA 1VFBA 5A3ID 1FNEB 3VRLF 1PX3A 4MWFB 3ZSTA 3MC0A 4M00A 1A2YB 3VFGL 1T5XA 2Y69B 3AXHA 3NJXA 3ZTNL 4FQQB 4V1DB 5KG9A 1G7IA 5LG1A 4K71B 4DQOH 1PEWA 3FQRA 4OQ1A 1HNGA 3W38A 2IDQA 4NPJA 1T0MA 4HH9B 3G6JB 4G7RB 5CZVH 1A3QA 4CJ0A 2Z8RA 1E5UI 3H0TB 1G0XA 4LPCA 4R2GD 1AQ8A 2NY0B 5I1LA 1ZMYA 1RQ5A 1GJIA 4OLWH 4J12A 4JANA 4KFZC 5EZIL 2CRIA 2F54E 2Z91B 3NIFB 4G3YL 5JOPE 1I9RL 4DCQA 5J4MA 3HZKB 5CCGE 3HPJA 4LCCA 1BBDH 1DANT 2X0UA 2BY2A 4A55A 1WWCA 3ILPA 5FR3A 3VM5A 2YPVA 5DD3L 5EZOL 4DFIA 2AJZB 1DVUA 4TULH 5TDNB 3V4UH 3HI1B 2G9HA 2FBRA 4NHCH 4GG8B 3CBRA 3K4AA 3T4AC 4OLUH 4U1IB 1I31A 4ORZC 3N1QC 4F7MB 1JD7A 1KYOK 4EE2A 3SD2A 1NAMB 1PZ5A 3BH9B 3ECVA 3PHOB 3L5HA 3FAWA 5FV2A 2K6YA 4PJXE 4AM0A 4NENA 4UILH 4ONHA 1SDDB 2NX5E 1KBPA 4H25A 4ZTEA 5T3XH 2Z92B 4PRBB 5LLIC 5ANME 4Q6IB 5GGVL 3SB3A 2WZAA 3GJEA 3MUJA 4LEXH 2AAAA 3L1GA 4BK5A 25C8H 3BEWB 2UUDH 1IAIM 3ARGD 3APFA 1UA3A 2WINB 3GMRB 2VERA 2J55A 4LCUB 3L3JA 4XBGB 5D7IB 1DE4A 1RIVH 3EGSB 2P7TB 4P4RA 4WLCA 3TBVB 1I9IL 3BD4A 3I6LD 1XGRA 4NPKA 4AYFB 4DP4X 4ZS7H 1WZ1H 1OARH 4ZQKB 4MNQA 4P2OC 4ZUWB 2MPAL 2ICWI 4HUWB 4D0BB 1RK0A 4EN3C 2IDUA 4O4YH 1QG3A 1CF8L 2E8ZA 2D7MA 1O7VA 2OP4H 3RY6C 2R2BA 4FD0A 2D0GA 1Q0YH 3CHSA 4UUJB 5JW5A 5I6OA 2DLHA 3CCHB 4WGWB 2I60L 2LQRA 4PJ9D 3POCA 1A3LH 1ITCA 4RZCA 1YEJL 3QCUL 4UT7L 1MW3A 2VDKL 2WLLA 4OUUA 2ZE0A 1KWKA 2GJ6E 2XVLA 3US1A 2D8KA 1XL4A 2F54D 5JOPD 4FLSA 4RAVB 2EVIA 4LO9A 3LS4H 1FE8L 2YK1H 1Q9WA 2ORBL 3HZVA 2XWCA 3BQUB 5CJXA 4TUKL 4WK0B 4LVHB 2OFQA 3QDJB 2HTKC 1QQDA 5FYJE 2Q6WA 2EUWA 1AGBA 5LGJB 3RPKA 1WUNT 4PCKA 3STZB 1DJZA 2R2HA 5EBWA 4XO4A 3UERA 4WHTA 2APFA 1JZ5A 2ENQA 4QRTB 3GO1L 2MRYA 2NZ9C 4QEGA 4JM2C 5FF6B 3WXVL 2RCSH 2WW8A 4FEMA 5AVTB 4AK2A 1DTUA 3MNWA 4K8RD 3PNRB 5ICUA 2NX5D 1YSOA 3U6XS 4Q9RH 3GZKA 2CRMA 3U7WL 3NJMA 1ES0A 3IVKB 2Y22A 1L9SA 2J88L 3OC5A 5E4AA 1ROCA 4CBZA 2F8IA 4K5LA 4H1LH 3MUZ1 4KJPD 5DZVA 5KSAB 4YDVB 3GIZL 1U8NB 2IH8A 4D2NA 2RR3A 1HXYB 3DMMD 2VR8A 2V2TB 3ATDA 3QUXB 3NEOA 2BNQA 1MN4A 2QGCA 3FUMA 4LLDB 3IF1A 3H9SE 3AACA 2PTVA 4J3OH 1EZUA 3QEUB 1SHWA 3I9GL 3EOAB 1Z7JA 2XNAB 3NGBC 1UB5B 1T0NA 2WUCL 4XVTL 4N0UA 1HL4A 3G5ZA 5DUML 2FGWL 2DLEA 1U3NA 3LKNB 1Z9SA 2JMRA 3C9NA 1D6EA 4PGCA 1T20B 4MYPA 3GDCA 2VZSA 1JXFA 3VXSE 4ODVL 3P02A 3E8VA 5DMKA 3N06B 4PJ9C 3RJQB 2GJ6D 4NPYA 1R0AL 4FL4C 1JDCA 4L0YA 4K7FB 4FXKC 1H8OA 5IMMA 4MBOA 3ARBC 4O2EB 2WVVA 2J6EH 5A7EA 5FA3B 2XPGA 4GQZA 2YAOA 1Q9LB 1RJZA 3FBKA 2A73A 2M83A 4RZKA 3MLTA 2NXYC 3V0HA 3EXJA 5FYJD 2ADYA 3O4OC 1P9MC 2QKIA 5MERB 4OB5H 5DFAA 1NKRA 3C5ZD 4F2MB 2A83A 1M3JA 1QR1A 3BP6B 4GBXB 4JFDE 3SE4A 1P6WA 3G6DH 3MR9B 3TFBA 3PWPA 3VFRA 4F9LA 5IM7A 2JB5L 3DI2B 5GIRB 3ECBB 1FYTA 2DQFA 1SVBA 3AAZB 3BWSA 5GS2D 3W82A 2FUQA 5GSRB 4HOXA 1T5XB 3VRIA 2Q7NA 3CWGA 3TEXA 2N0MA 4TVPL 5MENB 1G7IB 3DJ9A 3H3KA 3MCKA 4YPJA 4F33B 3QARA 4RAUA 3F7PC 4K8RC 4YBQC 5T1LD 2BK8A 5FYLE 1PY0A 2AJYL 3PU7A 1HC1A 2ZP0T 1LMKA 1F6AB 4WW2A 5AW4B 3T65A 4XC1H 4W9DC 3FQTB 1L9OA 3LZFH 4KUZL 1KB5H 4BFNA 2P45B 4DCQB 2R2EB 4HPOH 3BW9B 3W56A 1JOIA 4KK5D 4PRNA 4LCCB 2K45A 1CFTA 3DMMC 1U8KA 3H9SD 3N0AA 4KQ3L 43CAA 3D0AA 5K33A 4J3OG 2XIIA 1MLBA 4DVRL 1YMMA 3ATAA 1H3WM 3CAFA 4JFWA 5TE4H 1R5VB 1V05A 4U7KA 1C8PA 2VDOH 4GYBA 5CN1A 4BFFA 3ES6B 1NJ9A 4KMTH 4I1RA 4EUPG 1PZ5B 5DS8A 1SYVB 1BQ5A 5J57B 1WT5A 4XPAL 3TV3L 1HKFA 4PY8I 3VXSD 4Z76B 1KJ2H 2X4UA 3HE6D 1I4FB 2WIMA 4HS3A 4NENB 1QRNA 5CBEB 4HV8A 4PYGA 3MFFA 5HHOE 4H25B 1SXCA 5E8DH 1NBZA 5FDWB 1G7LA 1VCBC 2BVPA 2YSTA 3TA3A 4XOEA 2JE8A 4YMPA 2QVMA 1T2XA 4B60A 1ZT1A 3L6FB 4F1SA 5DC9B 3X1EA 1EO8L 2FO1A 2H6OA 5ANHA 1SBBA 1TXKA 4Q7DA 1V10A 3FOMB 1XGRB 1TITA 4PJ6A 5I30H 1N8OE 4NNYA 4U1JA 5LXGH 4IM8A 2YQ2A 1KN2L 3D3VA 5D1ZI 1H15A 3U0WH 4JFDD 4P57A 3ZUNC 2MTPA 4X4KA 3TU6A 4KZDL 1RK0B 1E7UA 4NAMA 3V4VB 3ULVH 4XPBL 2HLFD 3PWNB 2A4EA 4IRJD 3JWNE 1CLOH 4Y2OA 3ARED 3SO3B 5D1QC 3VXTA 3BKJL 5JW5B 2E6PA 1NC2A 3VVWA 2EE2A 4RZCB 3UTQB 5FYLD 5EH1A 4MCYA 5DEFA 3HBQA 5D2LE 4HPYL 4EIGB 2PUQT 5TF1H 3U46A 4JO2L 12E8L 4ZXBD 3WFEL 5T3ZH 6PCYA 3BUYA 3GSNA 4Q0XL 4MRCA 1NMCC 1VDGA 3UP6A 1Q9WB 3EYUH 3HZVB 3NFPA 3WMPA 1LE5A 3PJSB 5F97E 5CGMA 1JPTH 1NFIA 1ETZB 5E6YA 4GIAA 4R26L 2N7BA 3FW6A 4IOFC 3DETD 4JZNA 1E43A 4RMTA 1LWJA 5C1MB 3ZLQC 2IG2L 5D8JH 2Q6WB 3Q05A 3MV7B 5DJCA 3P3TA 2EDNA 4N26A 3O9WB 1IAKB 4DH2A 1X5KA 2X42A 2DJ4A 1HE8A 2OYPA 5B3JE 3T2LA 4A7GA 1G7QA 4PRAA 2H26B 2WKOA 4RRPG 2OZNA 3ARZA 1W0WA 5HJBA 5F72S 1ZLVH 4K2UL 1FAIH 3H1ZA 3HB3C 3VD5A 4KRPD 4DSYA 2PCFA 4WUKL 3KPSB 2Z93A 43C9A 2NNFA 3VNZA 3WFZA 2HRGA 5HHOD 1DVXA 1D5IL 2BSCA 4MDRA 3FMGL 1ES0B 3HE6C 3VI3B 4OF6A 3DKHA 1MAMH 2HVKA 1XF3A 3LKQB 1PFOA 3WKYA 4ZMYA 4DTGH 3FUNA 5ESAB 1F58L 1NEZA 4ICXA 4XP9H 3CHRA 5BVJB 1BFOB 3C75A 1KT2A 2R29H 2B0SH 2NUTB 4M43L 4NCC1 1XD1A 2BNQB 3W2DL 4LXFA 1NDGB 5E1AA 3V6FA 1CMOA 3IF1B 2BZ7A 2OQJB 3MJ7B 3CBJB 4X6CF 2WXKA 3UEQA 1XF4A 1AAJA 3OVUB 5LN8A 2WC7A 1P4UA 4L5FL 1AGCB 5HY9B 5IFHL 4JRWA 1DVZA 5EIIA 3GI9L 2DLTA 4EZLA 5L7XH 2I7OA 3WEXA 2VXQH 3TPUA 1TTFA 2EUVA 3O2VL 1U36A 3RKDD 4QXGH 1RIUH 3FU3A 3MDJA 4KXZI 1IE5A 2OMZA 2XWJA 3DX9B 3NIDB 3CDYA 4JFXA 5C07A 3WE6B 5FFGA 5J13C 4UQCA 1IC7H 3QORA 3V4PA 1KN4L 1MFCH 1XH0A 5J6HA 1L5GB 3C87A 3OKNA 4LMQI 2Q5BA 5J3HD 2BINA 3QCTL 2ZCHH 5MEOB 4GT7A 2XA8H 5MI0C 2WZ6A 1Y6MR 3D9AH 1P4BL 4N0CD 2HT2D 2OMYA 1J5CA 4PGJA 3FT4A 5IHUH 2H3XC 2XPGB 5D1ZA 4ZXBC 4YEEA 4ALAC 1JHKH 4XXCC 2ISDA 2X4SA 1GOHA 2A73B 3MLTB 2ZPKH 1FFRA 1RUMH 4Q14A 5DZJA 4Y2DC 3S3BB 2QKIB 2X89D 1OT4A 3KEDA 3TN0C 4L8CB 1AOZA 3UTSA 4MZ2A 3NIFE 2A83B 1UT1A 4MBRA 4KHXH 4OZIE 3G7TA 2A9NL 2XY2A 5DJAB 3UOAB 1BF8A 1G94A 3GSOA 1XCXA 4NQUA 3VFRB 2EE3A 2W95A 2IPTH 1M42A 2WYTA 1SMDA 4NQEE 3LHPL 3IDMA 1U0QA 4MKTA 3H85A 5D7JD 4YHYB 2VLJB 3ZTCC 2DQFB 2YFNA 1FL3B 3VRIB 1BVLB 3KH3A 3MCKB 1SUHA 1CDCA 3OB8A 3V0GA 3NBNA 4XPFL 1OCWH 1WJ3A 4HBQA 4RAUB 4G71B 1R3KA 4HHWA 1G9ML 1BEYH 1DSFH 2FJFA 3MREA 5J12B 3CFEA 4EXPX 4XPTL 4PJDA 4WW2B 4W4OC 4OZGB 3O2DL 3QI9C 3T65B 4OI9A 4OGQC 4A66A 2BHFA 4JRXB 1G87A 4ELKB 1NOFA 4OM0H 2KDGA 1I1RA 3V4VL 1SLUA 5IFJA 1QWNA 4ZAKB 5JZ7D 7CGTA 1RZ7L 1S5IL 1KJMA 1OP9A 1U8KB 3BZDA 1KGYE 4Y1AA 1LILA 3E80A 4N2AA 4R4ND 4R5VA 1BQUA 4AYDC 4HQQH 1E8WA 1T03H 5IHHA 1YDPA 3UPRA 4R4BB 4Q4IA 3UCQA 2I32A 1ZLDA 5FDYA 3OAUL 5KJ4A 2YLKA 2WQRA 3AMKA 4TLTA 4FQXC 4C56E 5DMIH 1I53A 3NP4A 5DS8B 1U2HA 3BAWA 2KZ1B 2XN9E 1J87A 3FN9A 3HZYB 2GBVA 5E08L 4HS3B 1FNAA 2J25A 1QRNB 2QHRL 3KYKL 1ZV2A 3NAAL 2Y1YA 4HV8B 5KSBF 2OJ1A 3P2BA 4NZ8A 5DQDL 4ABUA 3O81A 4GFTB 4X7SH 1NBZB 3LDBC 3WMQA 4P49A 3ULSB 1AGDB 2BVPB 2YPKA 1VEMA 3LKRB 5IHBA 4BE5A 5JW4M 5EOTB 1QSZA 4F58H 1K72A 2UVEA 4N0CC 4OTXL 3GBMH 2PYEA 4HMCA 5DHYA 1GC1H 3A6CH 4A6YH 4PJEA 3IPFA 3E6HA 4I3RL 1MCQA 4NNYB 3BSZH 5KS9F 4KKCD 1IGCL 4A67A 1RZKL 1VKXA 2VR7A 1UHVA 1MAKA 2BNRA 3IGKA 1H15B 5JHLL 4P57B 2R69A 3MRFA 2KERA 4NQED 2OL3A 5DTFB 1UURA 3N91A 1JRHH 4Y2OB 4FQHB 3HRZB 5AQ0A 4IBVA 5DVNA 3DVNB 4LKXA 4C4BA 1F11A 3WKQA 4W9GC 2QQNH 3L4CA 2QPSA 1TQBB 3NFSL 1U6AH 2YA1A 2FSEA 3HNTL 4DP2X 4Y16D 2F53B 4QRRE 4MCYB 3LS5H 4Y8DC 1GGIL 3NACH 1S8DB 4J3BA 4JO4L 3VI4E 4TPRH 1QSFB 1XZ0A 4Q9QH 4HAKA 2H45A 4PJGA 2CDFA 4PJBF 5I9QB 2F18A 1XSKA 3FQYA 3NFPB 2VDLH 3QEHB 3FUHA 1MY5A 4ONGL 4NUJB 1JFHA 2YMXH 5K93A 4JZNB 4ANXA 1DUYA 2YD0A 1MJ8H 2HPOA 2YA0A 3H4HA 2IC2A 5JHDA 2YFOA 4PS7A 3V0EA 1LEGB 3P0GB 3A67H 3C6LB 1OAUL 4NZDA 2VH5L 3D2UB 2WTRA 4HIXL 2Y2WA 4PRAB 1GPOL 4C56D 5T33H 1R3IL 1W0WB 1UENA 3FQXA 3II1A 1NSNL 2X40A 4HXAH 2XN9D 4L4VA 4JRYA 4H20H 2XWTA 2QDVA 4X5LA 4M7KH 3I6GA 1U93B 1Q0XL 1LGVA 3AXIA 3HW7A 5D96B 5IB3B 2YD6A 4FABH 2ZKHH 1U58A 3ZDZF 4ZFZA 4EIZC 4WI6A 4MD0B 4PBWD 2HVKB 3RX7A 3QFDA 1WC7B 2PWHA 3HS0C 5F1IB 5EEUA 2DPKA 4FDWA 4KDWA 3F7RA 5KBDA 3T77A 1GHFH 2VW7A 3QIBC 1TJIL 2Y23A 5CLZA 4H8WH 1FNGB 3S5YA 1NC4D 1TZHB 1PGRB 3HN8A 4YC2C 2MNJB 2VDMB 3MRKA 4G6FD 3RI5F 4WFHE 4ZX6A 4AE0A 2QADB 5E1AB 4KUCD 1J8RA 4X4XB 3SN6N 1D2PA 3ZDXB 3FT0A 2VW4A 2I07B 4KKCC 3H42H 3NZUA 1EGJH 1YAIA 5EIIB 1R34A 1PEZA 4I88A 3WEXB 4G6ML 4NKIL 4FKEA 4AZ8A 2XBTA 1NGPH 3F5WA 1OAXH 3HBZA 3V52H 5LKNA 4H26A 4E9QA 2XWJB 3KJ4C 5C07B 4F8OA 1NLBL 5HVFB 1EEQA 4QLRA 5DQ9A 4QRRD 3MRLB 2BW5A 5EZLA 5J6HB 4OIFA 3HR6A 2CG9X 1JNNL 2ZAGA 1F2QA 4YDZA 2CO3A 4WRLA 2IANB 3E1F1 1INEL 4HJJH 4P48A 3RTQB 1A4KB 2KLRA 3CD4A 4OZ4B 4NQVA 3SDCD 3HR5A 2VGLM 4GAJL 3B1UA 5C86A 2VXVL 1XBRA 4LHUG 3EJJX 3KXFB 4F9PC 1WFMA 1U3HC 4HAGA 3T5WA 3L2LA 2OR8A 1HS6A 3X13B 1WA0X 1MNNA 3UZEA 4YO0B 3DPBB 2H3NA 4UOW0 4E5XG 5IP4A 4R7NA 3MXWL 1T1YA 3C60A 1SMOA 4X5XA 3GBLA 2GK2A 2L0DA 4G7SB 3NA4A 1KTCA 4A2EA 1LYQA 4JHAL 2HSIA 4AQ8C 2GJJA 2V37A 3ARQA 1CFQA 2WXIA 4M3JA 3ZQWA 4ZNEA 1OE3A 2ERJC 1J05B 2DQJH 1ZA6A 3F85A 4R0LA 5AW1B 4U31A 2FD6H 1IEAA 4MZIA 4JO3H 4IMLA 3SDXE 3ARPA 4FLHA 1W2KT 4HISA 2FJFB 5CP3H 4K3DH 3CFEB 3T0DA 3CX2A 2W92A 3GIVB 2AEQL 1AQDA 4PJDB 3TO2B 3U4BL 3V0JA 1JZFA 3BZEB 1AI1L 2MQGA 2JI2A 3N44F 1BCIA 1CLCA 1ZLUK 3DA0A 3C08L 1S9XA 4WWPA 4OV6F 2ZAHA 1YYCA 4WFHD 3SCMD 1MW2A 5IFJB 4MXVF 1KYAA 1QOKA 2I7SA 4P06A 4QOKA 1COBA 1VESA 2OMTA 2ZKWA 2L3BA 1SN5A 3IWVA 2R4RH 4Y1AB 3ZZLA 6PAZA 4JUTA 4NKMB 1H6UA 3B8SA 2IDSA 1ET7A 4CILA 2KI6A 1QFUH 3MGTA 3IDXL 3QGVA 4PHXA 4CMMB 2CRZA 4YOKA 4M1CD 1SRDA 1NAKL 1HL9A 1K4DA 5PCYA 3O41B 4M5YL 3G08A 4GBXD 2X6MA 4MNQE 5F6IC 1MXDA 3Q6FB 1KIUB 4YE4L 3L13A 3MX0A 4YHOH 2D03L 2LABA 3N42F 4OZFH 3LH2L 2O5ZH 4N6RA 4QRFA 4TTDD 4FA7B 2MCMA 1TZOA 3S3JA 3VFOA 1IKOP 4IBUA 4ADJA 1KV3A 2YPKB 4DKEL 3ZE0F 4URKA 5I28A 3PL6C 5B1CA 1BMGA 2Q2EB 5BMFH 3V9CA