2CM5A

Crystal structure of the c2b domain of rabphilin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
144
Chain Sequence
MALYEEEIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C2A-C2B Linker Defines the High Affinity Ca2+ Binding Mode of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords RABPHILIN-3A
total genus 38
structure length 144
sequence length 154
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2cm5A00
2JQZA 1UOWA 1K5WA 1DJWA 5T8IA 1TJMA 2CHDA 4FHKA 2CM5A 4WWNA 3TWYA 4BFRA 3OHMB 5EDSA 1E90A 2WXIA 4G11A 4IQHA 1DJIA 2CJTA 2WXLA 3OAWA 3QARA 3QK0A 2X38A 4L2YA 3CSFA 2CHXA 4FULA 4MJJA 3HN8A 3R7RA 1DJGA 1RH8A 3PYCA 4DNLA 4PS8A 3DBSA 3ML9A 2K8MA 5H4ZA 3QAQA 1WFMA 2NCEA 3L08A 3ENEA 4JPSA 4NPJA 3ZW3A 2LHAA 4ICXA 3PREA 2YOAA 3TJPA 3NSJA 2BWQA 3N5AA 4WAFA 4BGDA 1QATA 3PRZA 2Q0ZX 3W56A 3L54A 1RSYA 4WWPA 1A25A 2CHWA 2ENJA 3ZVVA 1UGKA 2DMGA 3QJZA 4FLHA 4TS6A 5CCHE 3TL5A 4DK5A 2WXOA 3RPBA 1E7VA 2WXGA 4FADA 2D8KA 4KITB 4F93B 5JHBA 2WXMA 2RD0A 4ANWA 5G2NA 4EZJA 3R7QA 3QR0A 2WXJA 4Y1SA 4WEEA 4Y1TA 3S2AA 4FHJA 3NZUA 4LDCA 2YRBA 1E7UA 2R83A 2ISDA 2FJUB 1HE8A 3FBKA 5KJ7E 3LJ3A 3PS6A 2Y3AA 3F00A 4L23A 4QAMB 3JZYA 4F92B 3KWTA 2QZ5A 1UOVA 2WXFA 1E8YA 4URKA 4F1SA 3IBEA 1WFJA 3DPDA 3ML8A 4FJYA 4F91B 3T8MA 2N1TE 2NQ3A 4A55A 2WXKA 4ANXA 3M7FB 1V27A 2K45A 1DSYA 2Q3XA 2A4ZA 3L9BA 2WXRA 4QJ3B 1E8ZA 2QZQA 2ZKMX 4WWOA 4QJ4B 1CJYA 1RLWA 3P2BA 1E8WA 2EP6A 5H4YA 4FA6A 1BDYA 2WXNA 3HIZA 4AOFA 5CCJA 2WXHA 3PFQA 4OVUA 2A5UA 3L13A 3KWUA 5G55A 3NZSA 2DMHA 4OVVA 4GNKB 4TV3A 1TJXA 4LT7A 3MJWA 4PS7A 3HHMA 4KZ0A 4KZCA 1DQVA 2CJSA 3APFA 1QASA 2UZPA 3B7YA 4PS3A 1DJZA 4ICWA 4TUUA 4ANUA 4LCVA 2CHZA 4NP9A 4XX5A 4QJ5B 2K4AA 3IM1A 1DJYA 4L1BA 1BYNA 1DJXA 1W16A 1GMIA 2FK9A 3F05A 2WXPA 4EZLA 3F01A 2ENQA 4GB9A 3L4CA 2B3RA 2CM6A 2KI6A 2WXQA 3GPEA 4AJWA 3RDJA 4J6IA 1E8XA 3L16A 5JHAA 3CSTA 4L1LA 4FJZA 4ANVA 4NPKA 3SD5A 3ZIMA 3W57A 1YRKA 2NSQA 3L17A 2K3HA 3FDWA 2V4LA 4XZ4A 3F04A 2ENPA 2Z0UA 1BCIA 4HLEA 4NS0A 3QR1A 4IHBA 4HVBA 1DJHA 4XE0A 1W15A 4V11A 3APDA 4EZKA 5CCGE 3APCA
chains in the Genus database with same CATH superfamily
2JQZA 3NAAL 4WWNA 3VGFA 1GOHA 2CLZA 3FU8A 5CHNB 2ZWZA 1JD9A 4N2NA 3RTQB 5A2IH 3TN0C 1C12B 1T7ZA 2VXTH 4Q9BA 4AT6B 3GXDA 3N44F 2QVTA 4PJ6A 3U0WH 1FNGB 2FLMA 3QJRB 3TPKA 4Q74A 5E1IA 1DVFB 1HILB 4XN1A 5EUOF 2BDNL 3O6FD 2HVKA 3ARFD 4JUTA 1XGZA 2G2RB 3RFRA 4G1MA 1Y0LA 4WRLA 1KCUH 4LRIC 5FUZH 3WTYA 5JOPE 3FXIC 1RD6A 5DEJA 3RDTC 1B4RA 4L8CB 2AJYH 1M53A 1DBKL 2J8HA 2FHBA 3K2MC 3UJIL 3GJFK 4ZTEA 4E9WA 3PP3H 4HXAL 2H32B 2RD0A 3RLSA 4WHDA 1SDYA 3K0WA 3PU7A 1QI3A 4BKLA 3PY9A 4LDCA 3U0TA 4LSQH 1U58A 3W2DH 2YXMA 3A67H 1CGSH 5ANME 1Q1PA 4KY1H 4FAAB 1U8JA 3KYMA 3GPSA 3KE0A 2WB7A 4EF3A 5C86A 1YYLH 4NBYB 4LSRH 5A2LH 4GRMB 5C0RL 3OZ9L 1QWUA 4ZQKB 4WU5B 1S9VA 3HMWH 1B6DA 1X6NA 3BP4B 1IO4C 1RSFA 1NANI 3T3PF 3SE4A 4JPIB 2VMFA 3HRZC 1AQHA 3SQBA 2WXNA 3D0VB 2B5IC 1DVTA 1QKZL 5GISH 3ARVA 4CC1A 1FH5L 3REWA 1T80A 2IEPA 4ZUSA 2Z31C 4OJEH 1JGUH 2YS4A 4Y4KB 1JK8B 1S7TB 2WJ7A 4NHCH 4I0KA 2DLHA 3UCRA 1E6JL 1S7QA 5DZAA 4ATWA 1S46A 4RQQA 5DMYA 4HIEB 2GTQA 1CXEA 2RCSH 1BOGB 5CBEB 3FONB 2XV2A 3KXFB 1AE6L 2F74B 1RURL 3V6OC 2BSCA 5F2FA 3T4AC 5DJYA 1QW9A 3DJZA 3OJVC 3V4UL 2VSKB 2XYBA 1T66C 4XB7A 4UZUA 5D4QA 3VRIB 1AGFB 4HIIA 3V5KB 1J1PH 1M1XB 4X0KA 4MCYB 4QRPD 5DYOA 2J25A 1T3FA 5ACZB 5HI4C 1YEGH 4TUOB 2HJFA 4FMFA 5CZVL 5C07E 1ZHNA 4M3KB 4MAYD 1OTSC 1GW6A 1DUZA 1DUYA 5HYSA 1X5FA 5IESH 2BSEA 3N1GC 4OGXH 1OCWH 2WZ6A 1XF1A 1RZQA 4U1HB 3VI4E 1A7OL 4JR9H 2ICEC 4RBPK 3EOAB 5EN3A 5IHZA 4NUQA 2DEXX 4WFGE 1KBVA 5FAAA 4JQXC 2YAQA 3FYEB 3KPQA 2R2CA 1FG9C 4I13B 2FZ3A 4LPWA 3DX8B 3QG6A 3AXLA 4HG4K 4X42A 3MVSA 2ZAIA 4MYPA 5IVNA 4WTZG 2BWQA 4UTAL 3NIFB 4MX7A 1F02I 1SBSH 3TCXA 2NNAB 5T33H 5I17A 4YSRA 3L7FA 3QDGD 3RWJB 2OMVA 1EAPA 4MCZA 4F7PB 5ESVB 5L2KE 3PG2A 2A4EA 2JXMA 4KWUA 1A4KA 4R4FL 4ANWA 5J13C 2XQ0A 3L4TA 4EZJA 4M1GH 2YFNA 5LNEA 3UTZB 1MI5D 4Q8BA 4H20H 4LHUB 5EA0H 5DHEA 2X4RB 1XEUA 2C4FU 3ARUA 4AEEA 3KDPB 2RBLA 2AQ3A 2IO5A 1NIFA 4XO4A 5FOBB 4X98A 1QLFB 3EZ8A 3UGXA 4AEIL 5K9OB 5I19L 5I26A 4FDWA 1IL1B 1JRHI 1NMCC 2OX5B 1L6PA 1MNUL 3M7FB 3KMDA 4YJZL 2NUTB 5CJOH 5B38B 5IQMA 2XCMC 1PYWB 2ENSA 4OZFH 4Y9EA 3B9DA 3WKYA 1T03L 4N0UA 1E0OB 4OGYL 5FF6A 1CGXA 4NQDE 5J1AB 3KPPB 4FFZL 3QPQD 2F53B 3CFJA 4K9EC 4PJ5E 1KIQA 2DLFL 4B5ZA 3KLHD 2ZP0T 5LAXB 2MNUA 3D08A 4OIFA 1IGYB 4N0CC 4OQ1A 3X3GH 4JDVA 5D7JA 4P2QB 4UIMB 2JKJA 1A5FL 4XOEA 3CK0L 1UWEL 5DHMC 1T1XA 5IEHA 1JV2A 3A6BL 4I0PD 4EKJA 1KN4H 2VN7A 4F1ZA 5F0PB 4XCYA 3MA7B 2JKWA 3F01A 4JO5A 5C70A 4JG1H 2Y0SA 4YO0A 2AEPH 2DQGH 5IK3B 3T77A 4E0RB 4G72B 3DSFH 4LHUD 2NY4B 3Q2WA 4HJJL 1MWAB 5B7MA 5I76A 3CDGA 1VADB 2V4LA 3D07A 5E51A 2NDFA 3LRHA 4MXQC 3CLWA 4GRLB 2ZUQC 1DQJB 2Q76B 1B0RA 1BLNA 1ZLSH 3CFBB 1YYMH 3K2UH 3UTTD 4IKIA 4D0BA 2WTRB 4G6ML 2FJGB 1DJIA 1WHPA 2W8CA 2Y9RT 3O4LE 2O5ZL 4NM8L 1W6WA 4K3JL 2W91A 4XHQA 4GG6A 4U1JB 2G9KA 5D7HA 4JHVA 1O5PA 5DDHB 4M5ZL 1Q1JL 3TJPA 1BOYA 3WNOA 1GSMA 1F00I 4QNPF 4RGMB 2Z91A 1I1AB 5HHQB 1RP8A 3HLAB 4FQCL 4BXSV 4ZYKA 1OF2A 2DMGA 1OAZL 3QJZA 5ANHA 2VLKD 5EEWA 5CU5A 5HP5A 3RZCC 5KYYA 2A83B 1XB6A 1CXFA 2EYRA 2IJ0C 4L1DA 3ZYOA 4PGEA 3IDJA 4Y4FA 4GRLA 3PGDB 4OU3A 1E5UI 1NBVH 3VDAA 3E8UH 3IU3A 5M7QA 4TSAL 4GBXD 4BK5C 3QE5A 2PW2A 2WGXA 1JPFA 5IWLC 2DQEH 4ZJ9A 4XOCA 3LVEA 1BJMA 3QJSB 2I27N 4YO0B 2YWZA 4R4BB 1Q0XL 4U3CA 2RQEA 4ACTA 1JV5A 3N9GH 5DMIH 4YPJA 4PLKD 3RA7L 1V27A 3Q6GH 1I7ZB 4PJEB 4K07A 4DPAX 1Y07A 4RGOL 1LO5B 4QOKA 4OCYL 2VDLH 3E1F1 1KGWA 1KIRA 5SWZD 3S98A 4WSGA 3GS4A 3LXUX 1SJXA 3DI3B 1RUAH 1J10A 4WTQA 3DV4B 1KXVA 1I1RA 2VDNL 1ORSB 4Y19D 5FO8A 1HX0A 3MJWA 3DX3A 5EEVA 3QIBB 4F2MB 3QB7C 2DWXA 3EBAA 4G80B 4OCSL 5DEGA 1R3JA 5CSGA 1CYWA 3UO1L 1MW3A 1T5WB 3O6MH 2YD5A 4L3CB 1MCCA 2H9GB 4P3DA 1MCSA 4P9MH 1DL7H 5E5RB 1B0GA 1OSYA 4JM2A 3GPEA 2XICA 1E4XL 2GBUA 4MMZB 4LHJB 2C1OA 5DUBA 1MCOH 1KJ2H 3QIBA 4F2MA 2QR0A 1P7KB 4AIZA 4L9LA 3VW3L 4PJBF 5T3ZL 1E9QA 3UTPE 1IBGH 3MRQB 3CX5J 3JWNC 4ES8A 3U4EB 3GSVA 4ZUTA 3H3BC 4UM9A 1PZUB 3PDDA 5IM7B 4MXWL 5DVMA 2A6DA 2JJUA 2YPLD 2NNAA 1L0YA 5DD1H 1A14H 1XFPA 1IEAB 2WXLA 3EYSH 3O3UN 4J3OC 5E6UB 3C5ZC 2CUIA 5G5DB 4YHZH 4HPYL 3RE0A 4JG1L 1YEKL 2XJLA 2DQJH 3C09B 1DVSA 5ITFA 2NY2B 4LL4A 1S9KC 3T3MF 4G8IB 4D0CB 2NY6C 2A6IB 3KPSA 4KROB 2BVPA 5CGYC 4LOFA 2F58H 3ZYIA 4OGAC 4JPIA 4A2MA 2IQAB 2K1MA 2K78A 4HF5L 5BQDA 1A7QL 1MCPH 4KJQD 1PG7L 4XCEB 2Y22A 4GAJH 3MU3A 4H8HA 4PWHA 5F88A 3GMLB 4L4VE 4PGBA 4XX1G 3MCYA 4XPAL 4F93B 4AQAB 1N2RB 1AS8A 3FUJA 4ATTA 4BZ2A 3BEWB 3CFDB 1LE5A 2R23B 5JQ6L 3DBXA 4A38A 1O75A 5HXMA 5J06A 4MD0A 3QEUB 1J87A 3LZRA 1HI6B 1PD0A 1NGWA 2WK2A 3FBKA 3LB6C 5C0IB 2JTYA 1BZ8A 4DN4H 4IU2A 3K0YA 3U79A 1G7MA 4HGMA 3ARXA 4JFVA 2NY0D 1RJLB 4QF1A 3GXFA 5ETUB 4CU6A 1DFBH 4NDMA 2APFA 4JHAH 5B1BB 2FUQA 1N6VA 3FO2A 4RFEB 5D6DC 1S5HA 2ADIA 4CW1B 4LLVA 2ZWYA 3O8XA 3D3VA 1BIIB 1CFQA 4NXSA 4Z23A 3V9EA 2YPLE 1MFNA 3DARA 3BVUA 1AZRA 3ZL4H 4NM4H 3QA3A 3QIUD 2CGZA 2UZXA 4A6YL 1U8NA 4ZW6A 4I5BB 3GB7A 2AP2A 3JWNH 1UUSA 3KVQA 1QQDA 1QEWB 3QUZD 5I1CH 2VCOA 5BCAA 3FFCE 3OKLB 4FYQA 1GPOL 2ZCHL 3AAZB 4KZCA 1BLIA 4RMUA 3HZKB 3ULUF 1QASA 5KS9A 4I48B 5AWNH 4YGVB 1TJHH 2XI9A 3O11A 3VDCA 1WAAA 4G83A 4DVRL 3UYRL 3GRWL 5HHPA 3P2TA 3VQMA 3F05A 1QSEB 3I6SA 1FE8L 2FEJA 3C5SB 3K6FA 4AW7A 1CC3A 2LLNA 2UUDK 4HKZA 2R0KH 2QKSA 2FO4A 1LEIB 1GYAA 4JRXE 2FRGP 5IW6B 4Z0XB 3DMMC 3ILQC 2QQNL 3G6JF 3HE7D 2VISB 3Q13A 1RXLA 3FF7A 1E28A 5IHHA 3VFRB 3SDCC 2VDRL 1Y6MR 4KQ3L 5KVEE 1RUPL 4AIXA 1PW3A 1QFPA 4AEHL 2MPAL 2BHUA 1EEYB 1K4DB 5CSZA 3W11C 1L4IA 1RZJH 1UXWB 2QHRH 1YDPB 4IRSD 4JFHD 4P5KA 2HT4C 4XXCC 4PV8B 2Y07H 1HQRB 4I3RH 3AREC 3MLSH 1SF5A 4XOAA 3PP4L 2K8QA 5ESQB 3IJEB 2ITEA 1IFHH 3CSFA 2R69L 4YOKA 1FORH 5AW6B 3MLUL 3QZOA 2HAZA 4FTVE 2Y6SC 1HILA 1ADQH 4OZGE 4PW4A 2BSSA 4BGLA 4WHYG 3NJNA 5F6HJ 1Z7JA 3NFNA 1EO8L 5FUOH 1XAKA 1YEWA 5FOBA 3WI9A 4E36A 1HH6A 5KVDL 4WO4A 2HMIC 3O2WH 4GUPB 3MV7E 5FOJA 5HHOA 3L3JA 3X1EA 4QTHB 2MRYA 4PLJC 1AMYA 3CFQA 3HBGA 2XG4B 4B9IA 4AGNA 1A3LL 3EDFA 4KGLA 1Q38A 4FI8A 4BHUA 3TO2A 2ADGA 2B0SH 2LTQB 3OQ3B 1UXSA 2DM7A 2F5BH 1MZYA 3DMMB 1BX2A 5D96B 4A7UA 5IEHB 1NGQH 3CU1A 4K5PA 4V2CB 4JDZB 1HL5A 5EO0B 2EH7L 4MCNA 4AK2A 1MFVA 2I25N 3TIEA 5I0VA 4NKQB 5L2KA 2QSQA 4LLYB 1XSJA 4MLIA 4QRQA 5IEKB 2FQEA 1KCRL 1MHCB 3V2AR 2WKOA 4Z7VF 2TSAA 4QY8B 4ILDA 2B1AH 4P23B 3GZKA 1MCHA 4G9DB 4XNXL 3ZZSA 3UABA 4XOBA 3SYOA 4DTGL 2BNRE 3L3HB 1G7QB 4WJG3 3HI5L 2BSBA 3ZHLA 1OOWA 3US1A 3UOAB 2QVMA 2VJ0A 3BWUF 4IIQA 2Q8BH 4WFHD 5HYQA 2JKNA 1G4MA 3MXWL 2HT3D 2J4WL 3MRMA 5IBLD 4OFQA 3F64A 1KLFA 1NANH 1AS6A 1EH9A 2VNCA 2PXYA 2DTSA 3CXHK 3KEDA 3ZT6A 1BZQK 1JGDA 4J28A 4LCVA 5DMKB 5FLVA 2BHYA 4ZMOA 3OTTA 5DRNB 4JDTH 2A74C 2HCZX 3EUDA 1Q9KA 1FNFA 2QV4A 4HBCL 4HMCA 2ZXCA 4L4TA 5ABAA 3KJ6L 3BISA 4LNVA 4XWGL 3IMBA 1KGCE 3RFZB 1NBZB 5D8JH 5KAQG 1VGKB 5F1IA 1HNFA 1W8OA 3H42L 2O93L 3EJRA 3RY4A 3TO4A 3KAAA 4M00A 2MCAA 4QUOA 4F7CB 1OAJA 4Y5VC 1EEUA 2W59A 2ENPA 3T6XA 5C0EB 4NWTL 1AXTL 1J1OH 1QABA 3BPLB 3K8KA 1HHJB 2BMKA 4X5WB 5JLZA 3GLZA 1LO3H 3KL0A 5DRWA 3MLYH 4X99B 5TFSL 5HHME 1K5WA 3LVTA 5D7IA 5DJ0A 1FYTB 3EGSB 4JQVA 1TMCB 2EVHA 3WHE1 2WY3B 4JREC 4GS7C 1ILUA 3PPSA 3LH8A 5DWUL 1PF3A 5H8DA 2W60A 1LO5A 4XPGL 2BOBB 3WENA 4ZW8A 3H7BA 1PG7H 4HALA 3ZUCA 2ZXEB 1AXIB 4QHUA 4GQRA 1SDDB 1I75A 4Q56A 1TVHA 1FZJB 3PWVB 4WW2F 4BSWB 4LEXH 4JRXB 3WS3A 2ZXQA 5HJ3A 1NCWL 3N04A 4WFFD 3TL5A 4AGLA 4OZHE 1PPIA 7CGTA 3HAEB 1ACXA 4GP5B 4PEEA 4RMWA 4PVBA 1V7MH 1IKNC 4XGZA 2JJSA 2XQYA 3RY5A 3C2AH 4A2LA 3B4NA 3MODL 4MA8L 4IMKC 3VXTA 2F6AA 2VE6B 3PWNA 4W4OC 3VFSB 3QJTB 5K59F 3RY6C 3TYGL 4UQ3A 1AOZA 2OMWB 2VO8A 1EO8H 5E1AB 5F9JA 4AYFA 2GEQA 1OE2A 4RRPM 2O61A 3CX2A 3D85D 4NT6B 3HR5A 4X9GA 4PVMA 3CZLA 1FNGA 4JM0A 3ZKNC 1E8WA 1K3ZA 2Z7WA 1NGZB 1SFDA 1V3JA 2P42B 5AOKA 3Q5OA 1MIMH 1ILSA 5SWQA 4QRAA 5I1KL 5KW9H 2F54D 2PO6B 3GSNH 4KTDH 5E1QA 3ZDYF 4NKOA 3GO1L 2R4RL 5DVKA 5BVPL 4FXKB 1M7DA 3V6BR 1SEBA 1SOSA 2QFPA 3GMQA 3ILEA 3RURA 3VVWA 1VZIA 1IM3D 2YUWA 4HCRH 4GRMA 5CXPA 1DVZA 3WE6A 4DH2A 2NLJA 1TO5A 5FYKU 5GGQH 2YN3A 1A7BA 3X1FA 4Z8FL 1D9KD 3HC2A 3ARGB 3HC0A 1KDJA 1B4JL 4DKDC 1SN2A 4O2EA 3UMNA 4DP6X 1U8QA 4FLRA 4ZPVB 2PNDA 2X70A 5I1IL 2H3KA 4A2DA 2LVCA 4GG8B 1Y18B 2F58L 3LKQA 3UBXI 2ZICA 3DURA 4HIQA 1BQUA 1FFPA 2GBTA 3N40F 3UJTL 3S88L 2ODIA 1KCLA 3RJQB 1N10A 4WY7L 4AE0A 4BK8A 5IVZA 3ZSTA 4XCFH 2KQMA 3BAKA 3N41B 2EXSA 3EO0B 1RFDL 2NNCA 5GHWH 4ZG1A 1R24A 2JF1A 4P0DA 4UQBA 3KPLB 1ZWIA 4LOUD 5C0DA 3UIZA 3UC2A 5KSAB 1WJ3A 3H56A 4S11A 5I16A 4BQBA 3VACA 3S3JA 1NCAL 2EDDA 2I7OA 1Z5YD 2MCPL 2IPKA 1TQCB 3L2NA 4NJ9L 5BOPA 5BQ7B 1CT8A 1IM9A 1AGEA 3QVAA 3MV8D 2WVVA 4EQ2A 3M46A 3MLRL 4BJLA 2AANA 2WLLA 3T4AB 4Z0XA 4NZTH 4XN8A 3BH9B 5DS1A 3HE7A 2PTTA 4YXHH 1ZS8A 1UA6L 3BKYL 3GUTA 1QSEA 4KKLC 2FNBA 4M4PA 1UKQA 2OR9H 3WUZA 3VXOA 3LHPL 4JFDE 3MLVL 5JZ7D 1F2QA 3Q06A 1MCWW 3EYSL 4KC3B 2ALWA 4MJHA 2J43A 1SMOA 1NJ9B 2P24B 3BUYB 3V4PB 2G3NA 1JGLL 3U25A 1KTKE 4NLAA 1NM4A 5F9AC 4QDGA 5GGVH 4YHKH 5E2VL 1BXUA 1LD9A 3GJEB 2FX7H 2F0CA 4N22A 4HWEH 1CI5A 4IM8A 1YA5A 3KL5A 3S37L 2G4EA 4R5XA 2ZWLT 4DESA 1ZIAA 5A6MA 3OB0K 4GH7B 4FEIA 2XQYG 4LCWB 3DK2A 5F96L 4TUKH 2D7PA 4FI6A 2P8MA 1QWHA 2WBJD 2WM0A 4HZLA 4WK4B 4XODA 3E6HB 4ZNEE 4A6YA 3IJYA 4HJGB 5FPIA 1RZJL 5MP6H 3TEWA 4LKCB 4XVTL 2QELA 5DJ8A 3MXVL 5D6CA 4WHTB 3MKGA 4NIYE 5BO0D 1OB1A 4CMMA 1BYNA 1XL4A 2WLHA 3FO0L 3OWRA 2E7CA 5HDQH 3DJ9A 1N18A 4U1LB 2FATH 2VLLA 1WBXA 3ZKMC 2EDRA 3T3PB 3NVQA 2X53A 1Q9KB 1V55B 3TBCA 4APQA 1UTDA 1HIMH 5E4AA 2X2UA 4JPWL 3FQ2A 3L16A 3HKZA 4XP9L 5EU3A 2WPGA 2BP0A 3N1QC 1G7PB 5INDA 5I82A 1Z2KA 4HZAA 2XKSA 5DMGD 4NAJA 1TPXB 4JQXA 5T1KB 1INEH 2DH2A 1TLMA 3US9A 4UTBH 1NFDB 3MBEC 4C47A 3FTZA 4FNPA 1H19A 4XHJC 3L4ZA 5IHWA 1KTDB 2COVD 4NPYB 4GP4B 1DJWA 2ZCLH 2WP3O 1HSBA 3TWYA 3FBQA 3NGBB 3WBDA 3BGMA 4N3TA 1E90A 1DANT 3WFEL 5EC2A 4LP8A 3F7LA 1P4BL 1CCZA 1L7TL 1YNTF 4NAMA 3FB8B 4DETA 1FE8H 1FH5H 2WBXA 4CDHA 1NM9A 3DX0A 3QUMB 4PJEF 4B3EA 5DRWB 1SPDA 4HQQH 2IXQB 2GY7B 4O02L 1A3ZA 2AAAA 5EIIA 2OZ4H 1KFAL 4F5CE 2EIDA 3FOLB 5K39A 3ZXAC 3MJ6A 1GRWA 1HZHL 2G75B 4LZKA 1TZIB 4PPTA 2DQFB 3D39B 4YZFE 3MLSL 2ISDA 3UEZA 4KI1A 4PLOB 1FYTD 2HFFA 3K4ZA 1JZFA 3OAZK 1F0LA 3OF6D 4H8WH 1YN6A 2BCKB 4HK3J 4B7LA 2NY1B 3MYJB 1DDHA 5B3SB 1CXLA 2DLGA 1Q9OB 3EOTL 4D9RD 2CZNA 1UC6A 2F53E 4XP5H 4NUGH 1QHPA 2CR0A 3BSZL 1RK0A 1SVZA 1CGVA 2IDTA 5FYJL 2W92A 4UYPA 3RUGF 4TNWK 4U3XA 4B9CA 2VRKA 1E9PA 2C9SA 4G5ZL 3BQUA 3WNIA 2H5UA 5IVXA 1S7SA 1ZTXE 5I15L 3ATBA 3CFCH 2NXYD 4OLWH 4E9RA 3KYNA 3S4SG 3BGMB 4YNYA 2CLZB 2V0AA 4R7NA 5J56B 4X80H 3LIUA 4XN9A 4OD1H 1OTSD 3DIDA 2ZYSA 4P57B 4PS3A 4TUUA 2XNAA 2XWBA 5AALA 1MPAH 5EU6B 4H26A 1JE6A 4J3TA 1L9TA 1R3HB 3IU3B 1EHKB 3AGVA 4K55A 1F42A 3IB4A 1YYCA 4AVHA 5LWYH 1YNLL 3LKSB 4FQHA 5JQIB 4LRIA 1KCRH 1FLRH 5TD4A 1RZ8B 4G71B 1LK2A 1CXHA 1CICD 2P5PA 4OCRH 4BFBD 4N26A 4AC2A 4H2AA 4KBPA 1YUHB 1AP2B 4ERSH 3VWJD 3E38A 1A1NA 3UX9B 2VL4A 1RFDH 5DWPA 1KELH 4KK6C 3VTAA 3HNTL 2DWTA 1F6AA 1A8ZA 1MWOA 3RTLA 3S97C 2XXFA 3QULB 5C0BB 3HLKA 5I19H 1BFTA 3ZE1F 4X4ME 3B7UX 3ESUF 3IDXL 4OKVB 4PY8I 5LCVA 1U8PB 2CHXA 4PS8A 4UV7L 2WSKA 1IM3A 3DXAD 4PREA 4Q2ZB 5BRQA 3EH3B 2X4OA 3VXUA 3D2UB 4HDIA 4R0LA 2LTQC 1QX1A 2N01B 3SDAD 3X1GA 3BPNC 5MEOB 3ZMNA 3THMH 3MCG1 3FT1A 1A1MB 1TF4A 5HGHB 2LLGA 3OZLA 4QCIB 1UH4A 5ID0B 4S0SD 4IU2B 1EMTH 3ZKMD 4S0HA 5D7KD 5MEQA 2Z35B 2D03L 1GVIA 4URTB 4WW1B 4EDXA 4APXB 1BD2E 1IGMH 3QUZB 1VZGA 4FCHA 4QXTA 3TZVA 1ITCA 3I6GA 5LNDA 3ARZA 1CICB 5GZND 3FTYA 1A6PA 3A67L 5AB9A 1T2JA 5DFAA 3T0EC 4AV4A 1UB5A 5JPNC 3ARTA 3WXVL 3U36A 4U1GC 1WAEA 2FX7L 3DOIA 4HETA 4IRSC 3VFPA 2WKOF 4Z7VA 5DTFA 1RVFL 3KLSA 3RKDC 2VITB 5FGCB 3V9FA 1PKQA 1BEYL 2NCMA 3UO8B 1DBAL 3NIDB 3CFEB 1RLWA 4ZW5A 3WUWA 1QO3B 5B7FA 2RAMA 4DKFH 4V1DE 2ICWJ 2XTLA 3R19A 5D9SA 4C4UA 1ZHLB 3ZTCC 4I5BA 2IAMB 1QLRB 5KSAA 1XCTA 2EXYC 4ODUB 1DN0A 1P7BA 4FHBD 3NZHH 5HD8C 2YD7A 4EE2A 3DX1A 4ZOCA 1M57B 3HHMA 3TO4C 4NRYB 2I07B 2Q7AA 2C1OB 5DUBB 3D3VB 3CCHA 3IYLW 5DSCA 5GIRB 5SWSD 4L1BA 2Y23A 3N0PB 1DBBH 1NSNL 3O45A 2AJUL 2WTOA 4M48H 5I1EH 4OZHF 4RA3A 1T21A 1NC2B 2AQSA 4ZO8A 2WIMA 5A3IC 2FVNA 5TQ2L 1H8NA 3LZFH 2A73B 4HWZB 2X6VA 2OFQA 1N6QL 2VERA 1BBDH 4OF7A 1T1WB 2IALA 4H5SB 3SD5A 1KB5B 3NTCH 3TPUA 1WA2X 4Y2DB 5EO9A 2AI0L 1ND0A 4WJ5B 5I66B 4K5LA 4LVNC 3FZUC 5ADPH 3QUXD 3GHBH 5EFIB 4PRHB 3Q43A 3GQFA 3OHXB 5IB3B 4UQ2A 2X89D 1NGPL 2J88L 3NAAH 2R1XA 4ZUUA 2FJFB 3A23A 1X7QB 3EJPA 4MNQB 3L4YA 1BVKA 3RA7H 3G6JB 1KTLB 3FTWA 1EHAA 3MOQA 1I1FA 4OFIA 3SOBH 1SXNA 1E9OA 3QWOA 3WFDH 4PJAB 2FWSA 4ZAKB 1U33A 2UY7B 3R1GH 1HEZA 3TEYA 3WFZA 4F7TA 4MBOA 4MJ2A 4HKXB 1T0MA 3MUHL 2PPFA 3SE3A 3U7WH 4I18B 4OF3A 4TLSA 2VDOH 5FYJU 1O5DT 1UGKA 2TRHA 5GRZA 4TVSa 4MQ7B 5T1KD 3L1OH 1VIWA 2E4TA 2MKLC 5EN2B 2BP0B 1FZMA 3RX7A 4KZEL 1EPFA 5MENA 3ULUL 4PGEB 4DFHA 4AQOA 3CXFA 5MP6L 3BUIA 1KGCD 5CP7B 2VLLB 3WN5B 4AGPA 2NR6D 4G42A 4G42B 3NIGF 4ZYKB 3CN4A 1IBDA 3BVWA 3BSZH 1KENH 4S2SB 4JMNA 3IMVA 1PBYA 2F18A 4M8VA 1KJ3L 3X13B 1S8DB 4P4KC 4Z7QB 3KVPA 1MEXH 3DSNB 1NOAA 2MCPH 3GWJA 4ZAKA 1EJ8A 3ZDXE 1EMTL 3TBTA 1CBVH 1SYVB 2NXZC 4YFDB 3LD8C 3HUJE 1EA9C 5ICYB 1LO2H 3DOHA 1SMAA 4I8DA 4J3OH 3P4MA 1S7XA 4HT1L 2P49B 4DJMA 1A14L 1X4YA 1ZV9A 2X4SA 1I1YA 1BLNB 4FKKA 4KTEL 3I3BA 5EV7A 3F7VB 2EADA 1AO7B 3AFLA 3QDJD 2EIEA 1L6XA 2CG9X 3N6YA 1F8TH 4DO5A 3UZQA 4FTDA 4XMKL 5CFAA 4HC1L 1DE4B 4ZO6A 1QUNB 4JFFB 1D5ZA 1U8IB 2V5YA 4QY8A 4ZT1A 3MTXA 4OLVH 4CVZA 1DJYA 5C0EA 1UFGA 4ZS6C 1G9MC 1BA9A 2KZKA 2UX7A 3MOAH 3IF1B 5I23A 2JKSA 4BYHA 2FQDA 5KBMA 3SQRA 4DOHB 3DNKA 3LZLA 5DD0L 2IQ9H 3QIWD 4DN3H 5EU4A 3VX1A 1R3KB 1U4FA 3NRPA 2A1WH 3BDYL 3U2JA 4ETQB 1PIGA 4HUKB 2WLYA 3KGRA 4RAVB 3IDJB 1NBYA 1A9BA 1KIPA 2V5MA 1E27A 4UMSA 1AHKA 2E56A 2DEWX 4ZSOB 5I6OA 2VDNH 1URZA 4OKDA 3FU3A 1UUNA 2G60H 2NTFB 3SDXE 5DK2A 2H6UA 4AQ8C 1UOWA 4P49A 1F97A 1D7FA 4WO4B 1TU2A 5CIPB 1A6WL 4J1UB 2H8PB 2PF6A 2XETA 2YKKA 5BRPA 3QHTC 1A7PL 3QZPA 3OKDA 2RHEA 1IGJA 2WNKA 2BRRL 4FZEH 4U2YA 5DR5L 4IRZH 3EFFA 3LKRA 3ULAB 3BKML 3DIVA 3GGWB 3QORD 1QUPA 2M8XA 3NJMA 5FHBL 1NWPA 2P7TB 3FRPG 1JPTL 4G6FB 5KSAD 4JZNA 1H15A 4Y8AA 1GZHA 4UUJB 2HB0A 1S9WA 2NDGA 3VFNB 4PJIB 1IJ9A 2UYLA 2FT7A 5MERB 3S8FB 2HJLA 1FBIL 5TDNA 1XF5B 3V95A 5ADOL 1YCSA 4GW1B 5EEUA 4L29A 1CICA 4GY4A 3O8XD 2IFFL 3BHBB 1HN1A 1A6AA 3UAFA 4N3UA 4AGOA 3KG5A 4PB0L 4APXA 2D3NA 3ARBB 2FSEA 1JHLH 1IBHA 1JRHH 2VXQH 2YSTA 4JFEE 4KJPC 4BFIB 5KJ7E 4HPYH 3HNSL 1KYOJ 4L9DA 4ZPVA 1TPXC 2MEJB 1KGJA 2BIMA 3L9EA 4GT0A 5IJVB 1NEZG 2BINA 1EDYA 1RZPA 2G30A 2BNQA 4DP2X 4G70B 3DX7A 3EYFA 4K9EL 3SQOL 5CD3B 5SX5H 4A55A 4LIQH 1FVEA 5CJOL 2XNAB 2XWBB 3GMQB 3P54A 4K7PL 5TF0A 4B9JA 5FYKH 4XNDA 5IHZB 4MD4A 4I3RL 2NW2B 3TT1H 4X4KA 2OZNA 3WIHH 2M2DA 4MAUH 5JPMC 5G4MA 1K8DA 5HYSB 1C1EL 3CTTA 2X6BA 2YGPA 3GT6A 1MI5B 1TU2B 5CIPA 3VD4A 4DF9A 3N2JA 4FQ2L 4XVJL 4FLOA 1K8IA 1LO4H 3LS5L 1ZA3A 5F3BB 1H6TA 5AAPA 2JCWA 3GEWB 1OAKH 4OD2B 1N68A 3BUDA 4ZSOA 3HE6A 2XXCB 3D4GA 3FN3A 3KNBA 2YAEA 5FUOL 5GZOA 3JWOL 2R59A 4XC1L 1OO2A 1E2WA 3K72B 3MRGB 3BDBA 3TTYA 4IRJC 4L8SA 4RMSA 3QG7H 1K72A 5DUML 5FA4A 4F5CA 3NN8B 3GMMB 4ZFQA 3MO1B 1NCIA 1UB6A 2DQCH 2ZJSL 3HS0B 3AT0A 5DGQA 3GHBL 5DF0A 4KOBA 5BO1L 5BZWB 2V33A 1HU8A 3HRZB 5FC9A 4UT9A 4Q0XL 4KO7A 5C0CB 1Z0MA 2Y2YA 2X3CA 4M1CC 3UEQA 1Z66A 1FWXA 1EO5A 4WKZA 2NZ1A 4GUOA 5HHNA 5AWNL 2DJ4A 1KCVH 2OR8A 3F6LA 4E9SA 2HRLA 3G5XB 2PMZA 4LFHG 1NLDL 4I18A 1ZLVK 3WXVH 4P2OC 2FLBT 1HOCB 1UD2A 3B2DC 3NZ8B 1MCKA 1A4JB 4A2HA 2R0KL 1N4XL 3D25B 5HVFB 2XZCL 1HL8A 3D4CA 4RFOL 4HLZG 1F56A 3QWOB 4NBZB 5JUEL 5EFIA 1RVFH 5HJDA 2YEQA 5JXAH 5DD3H 4HUWA 5C7XH 4X7FC 1FG2B 4NKIL 1OAZH 4X5LA 4W81A 1H3TA 5BNXD 2ZT9C 5E1AA 4WWKB 2XJKA 4HWZA 1FF5A 1KPUB 2WNXA 2YOCA 5I0DA 1GTNA 2WCSA 2CRZA 3HG3A 3NCYP 3BAXA 5CP7A 2R1WA 3A6CH 4M6ML 3ZO9A 4NCC2 3VD7A 5JHDA 5I66A 3A24A 3GM0A 4YBHA 5FUZL 5BMFH 1VEPA 4OIIL 3LRGA 1XMWA 2D7TH 2ZZUT 4YK4C 1J5OL 1T04B 2GJRA 4N2FA 1AZZC 5IMOA 4TRPH 2XFXA 2VN6A 4HOMA 1INDH 3QXDB 3LRSA 4URKA 3W0WE 3ECUA 3GMPA 3ULUC 2BHFA 3THML 3QDJA 2Y7NA 1YMMB 1AZCA 3QNFA 4KAQL 1HHIA 2C7UA 3KGSA 4K3GA 3W2DL 2HG5B 4LGSB 1OZTG 3FCTB 3UAAA 2XBZA 3G6AA 5EUOE 2B4CC 2DI9A 4J3XA 3ZR6A 3FCSB 5ADPL 1UKSA 1NFIA 4QHKJ 2ETWA 4OCMC 5B21A 4Z7OB 5J89A 3QDMD 2EE3A 3C75A 1GTFA 3CMOH 1MHHB 3V0FA 1AHWB 1Z6JT 2QTEA 3OL2A 3KW8A 4WVRA 3B9KA 4X4XB 1UG9A 3V4PA 1UXSB 2W9DH 1DVXA 3VSQA 3ZE2E 2C3HA 3IDGA 1CIUA 4NSKB 3WG7B 3DVGA 3SBRA 4KK6D 4JG0L 1UM6H 2AJVL 1F4XH 4AM0A 2J1ZA 2BVQB 2ESVA 3FT0A 1RZJC 4HP5A 3OPZL 3Q6FA 4NPKA 5DI8B 4AEHH 3MJ8B 2AQRA 2DYPA 5B3JF 2IV8A 3LNIA 3TCLB 4NHUA 2KBGA 4IRJB 2FYYA 4LCCB 4W9JC 2BNQD 3WL9B 3PWUB 4NWUL 2RFXA 2VABB 4TLTA 3IDNB 4UUJA 5AVVB 1NINA 2XPYA 1RMFL 3OLGA 4F2EA 3D34A 1MLCA 2R69A 3BQUD 1IE4A 4Z7VE 4YIQB 1MFMA 3BAIA 3OAWA 4KMLB 1TQSA 3OMAB 3R7RA 1XGRB 1MI5A 1EVUA 4KPHL 4XX1E 2DJSA 1TYRA 3CSYB 5B1JC 3U6RB 4KI5E 1KENL 3CN1A 4J3OF 1HINH 1KXQA 4M48L 4PV9A 4CBPA 3GSNL 5JDJA 2A2QT 4H88L 1A6TB 3KPRD 4OJYA 2OYPA 4EI5B 1SF3A 3MBWA 3W38A 3BPOC 4NNXA 3RDTA 1OGAE 2FJGA 3NJIA 3CXDH 2JIXB 2BW5A 1KJVB 1E28B 2BW4A 1S9VB 4YVUA 1CLCA 1EGJA 2WTPA 2FD6H 1D3CA 4JKNA 2DYSB 4RVBA 4CJ1A 2W9LA 2V3EA 3MFGB 2ZOLB 1FC2D 2NX5E 3IGAA 3V52H 4KV5E 4Y5XB 5B1AB 1OWRM 4P4KA 1A4AA 1LNUB 4YMPA 1O9VA 3QS3A 1NOLA 2BNRD 2ITCB 4PMEA 5DVPA 4PBDA 1IFGA 4FFYL 4N85A 5F1SA 5TDNB 3IWVA 3VDBA 4BZ2L 5DT1L 3DROB 4QXWA 3WNKA 2EEAA 4X8JB 4RFNC 5FCUL 5D2NB 4GG6B 5IVXB 4YDKH 5IMMA 5KG9A 1BMWA 1PFOA 1WS7A 2MNWA 3C09C 4FXGB 1A3RL 5IV2B 1EHLL 2ARJQ 1NAML 4R7NB 4JM4L 5SWZA 1H9VA 1AGDA 3VXMA 1NAMA 4R5TA 3CH1B 3SE6A 2C8NA 4NZJA 4Y2DC 3S36L 3SBWC 2OL3H 1B3JA 4JKPL 1FO0H 2BDNH 1N7MH 2QFRA 3EUUA 1TJHL 2O72A 2Q3ZA 5AAWC 1YZZA 1J8KA 1RPKA 3LIZH 1P5UC 2O5YH 4BA8A 4JO2L 5C2BH 2XVLA 4GW5B 4Z7NB 1GCFA 2MQ0A 4UV4L 2WXPA 4HW6A 4L3AA 4PWIA 4PCKA 5ISZE 1HXMB 1YJDL 1NMAL 3FC8A 4JZJA 4LPUA 4J3SA 2E9IA 1LEGA 4KRPB 3O9WB 3U4BL 3DDGA 1C5DA 1A0QL 2ADJB 2NY2C 2J4WH 4E9XA 1RUPH 5B8CB 2X05A 5CD5D 4HEME 3DOSB 5C0GB 4XP1H 1TYEB 4YSEA 2IAMC 3MJGX 3V0WH 3LNDA 5C07B 1LTXA 1IM9D 2VLRE 2XIIA 3N1PC 3TC9A 4OJAA 4BFRA 2Z8VC 4HJJH 3BVTA 4PP2A 4HS6B 1BFVL 2NY2D 4XWGH 2O5NA 3GXMA 5CILL 1BWWA 4FZ8L 4HBQA 1OHQA 2YGNA 1LEKA 1SVBA 2B14A 3EDKA 3OPZH 4DSYA 4WUUA 3U4EA 3GS7A 2GSIA 4JMXA 4DN3L 1G0YR 1RJZA 2F15A 2FWOA 2JIXD 3MC0A 3T0EB 1RUQH 1A2YB 1F58H 4S1RL 4YH6A 4Y88A 4JHBA 3HA0A 3ZTJH 2ADJA 4DK5A 1GYVA 4MNGB 3FO2B 3M1BA 4F20A 1KB5A 3EO9L 3FU7A 4A2GA 5JHLL 3HPLA 1BBJB 2X1OA 5D2NE 4PRDA 1R46A 3BPOB 5EBWB 3NZUA 2K6ZA 3MUZ1 3JVFC 2HFTA 5DK0A 4P3DB 1OGAB 2AFNA 1II4E 4MD0B 2HVJA 5I0XA 4BEIA 4TULH 3O9WC 3L6FB 3LRMA 4QYAA 1F6FB 1BF8A 2PWGA 5I17B 4X7SL 4AENB 1QG3A 1BYPA 5IFJA 4OCWL 4PJCB 5DFWH 4UTBL 2WAQA 3EYUL 2P8PA 1MHPL 5D2LE 3L9BA 3QXAB 3AXLB 4LLUA 2R2HB 4YSTA 4GP8B 3TJEL 2FEEI 4NZTL 4R9HA 4RNRA 3G5XA 2NXYB 4OJCA 1RURH 1B88A 1U4EA 3J2PA 2UXTA 1N59B 4J3UA 4HZLB 2MQCA 3MNVB 1EV2E 4U3SA 4NPYA 2DMHA 2RR3A 4HUXA 4U6XA 2AEIT 2WD0A 2X6UA 2AXGA 4PAZA 5C97A 3BUYA 5D7JC 3PUUA 4MB1A 3RWDB 3APFA 5KN5B 1CR9H 4R4BA 1FGVH 1SZNA 2I5YH 4PG2C 3S2CA 4PJ8B 2VDQL 3QXAA 5FKPB 3C5XA 5HI3D 5F6IB 4MXQD 3F7PC 2MJWA 1EXUB 5FHAH 3TNMB 5KAQF 4N28A 5I0YA 5IB2B 3FN0L 3P4OB 2OK0H 3EBHA 1BQLL 1L7IH 2GFBB 4YHML 2CUMA 3ARDC 1DDTA 2BZ7A 4M6AA 3G6JE 1E8XA 1A3RH 1YMHB 3GRGA 5D7SL 1QLEL 1VJSA 4H1LH 5F96H 3RWHB 1Z5LA 3VGEA 2V9RA 1GCYA 2WUBH 1WT5A 1Y6NR 4GJTB 5C0ND 3LEXA 1MQKL 1KCBA 5EBWA 4NN7B 4PTUB 5LBSL 3BWUC 1RAMA 3G9AB 3JV6B 3GSQB 3BOVA 4TVPD 4HU8A 1ACCA 4AYGA 1BW8A 1MCDA 2YD4A 3Q8CA 5A2AA 2BIPA 5EDSA 1XGRA 4DK6A 2ED9A 1IT9H 4NGHH 1ZK9A 3FTUA 5JR1H 1N70A 1W0WB 3INOA 3KGUA 5F70A 4QRTB 2GJ6E 4F8LA 3HR6A 1G7JB 1IFRA 1T0OA 2VLKE 2YRZA 1PLCA 5I74B 3LSOB 2PTVA 3BRGC 1RZIB 3N5AA 2WNWA 1H5BC 5KBNC 3H53A 4H8PA 2NX5D 3G5WA 3T4YA 1BX2B 1TMQA 1X4XA 1A25A 3X11B 5E6RB 3UIYA 3VWKA 1VADA 1OGTB 5I76B 1JAEA 4U1SB 2NUPB 5D2LB 1PTZA 1FHGA 5GRVL 3ATAA 2DI7A 4QNPE 3A3YB 3ZKXB 2I9LB 2FJUB 5C2UB 1HKLH 3PS6A 3UERA 4ZS7H 2FO4B 3MLWH 3NIDE 3NSXA 1MZZA 3WLWC 2A77H 1WS8A 4OGYH 1FZOB 4AK1A 4OI9A 4OZIA 2CBTA 3FL7A 5G4OA 1KDIA 1Q9LB 3H7LA 1IU1A 5IROC 3MRIA 4YDVA 2ZUQB 1E4KC 1DANU 4POYA 4FP8L 3MLTA 2H47C 2QZQA 4AMKH 4LVOC 5GZOC 5C3IA 1LWRA 1M6OB 3CXHJ 4QWWD 3OXSB 2OZ4A 1UASA 3ALPA 5F1NB 3IGLA 3W9DB 3DWTA 3NEEA 4RDBA 3KWUA 2FGZA 2I85A 3BAYA 1RK0B 3CHQA 1P69B 3ZGHA 2YA1A 5EU5B 3LTVA 4HV8A 1AR1C 3NH7H 2GI0A 5IQ9B 1L9QA 2Y1AA 4N0YH 3AS2A 3VE0A 1MRDL 4ETQA 5D2NA 5TE4H 2I32A 4LLVB 4BM7A 4ELME 4XMXA 1DO5A 4PJ5D 3D50A 1GW0A 3MNZB 2DQ6A 1SBSL 4Y9BA 4NKMA 2P8LB 1MCOL 5DJ6A 4NO0D 2KDYA 3BYTA 5BXFB 1G1OA 2OM5A 3H9SB 4YHLH 3MN8A 1J5IA 4YK4B 3V0VA 1WBYA 5DD5L 4G6MH 4JY4B 1P7QA 1E2VA 2HN7B 2K3HA 1WZ1H 5HPMB 4FNUA 3VQ1C 4KX9A 3C60B 1PLAA 4R7DA 2CUHA 4Z3FA 3DO3A 4L9LC 3GBML 4OD1L 5EOCH 1SHMA 3SO3C 4Y2LA 1L9SA 1GZPB 1U8CA 1JHKL 2IBBA 2ZUVA 1IZJA 4E9YA 2XKUA 1CD9B 2X4SB 2JIXA 2XC8A 3OAUH 4IK7A 3RUGE 1E3ZA 1RL1A 3P77B 1TVHB 1KV3A 3HZVA 1WG3A 3S96A 1TKWB 2R4SH 1JPSL 1Q8MA 2QLYA 3O8XB 2W9DL 3ABLB 1A4CA 1F58L 1QLEH 1O9ZA 4OLZL 2IV9A 4WTWA 4HUNB 2ZTBA 3TBWB 3ULUE 4TSAH 2PPDA 1W72A 3BH8A 4H25B 1FYTA 2ITDA 5DLMH 4K71B 1E4JA 5DQDL 3BKCH 5J12C 3VGDA 1F13A 3IDIA 2WNGA 3BUPA 1ZOXA 3I6LD 3VI4B 4KUZL 3DHMA 3V5KA 4AKOA 2BZDA 4G7YL 3QJHB 2EDOA 3II1A 1LE5B 3HFFA 5LB1A 1PEZA 1TG8A 5E95B 4XGZB 2G4GA 3HUJB 3FB6A 4RGOH 4X7SH 2X1QA 4M6OL 1E4KA 1OGAA 3NGBC 2H9GA 2J8OA 1IX2A 4JRXA 2QZ5A 3P2DA 4NRXA 1IGFH 2WVTA 3B2VL 4F7PA 5C08A 2D9CA 1I3VA 1EANA 3FU7B 2WLZA 4TUJA 2DIJA 3HJ0A 4BWUA 2VAAB 4JVUA 2ZOTA 2EDEA 5KSAC 2G5RA 1ASQA 2BOBA 3D12B 3O3DB 2X4UA 3ZDZF 1NDGA 1TT6A 4HK0A 3ZZQA 2LT9A 1E40A 4KXDA 3ZQ9A 4Z5RB 2X3BA 1QSVA 3IE4A 3D0VA 2FJFA 5CCJA 4LE8A 4UQ9A 1T1ZB 3PWPD 4W9LC 1NFIB 5HGDB 2HT2D 5FUCE 3WJJA 4TOYL 1MI5E 1J7VR 4TV3A 5BUAA 4AIZB 4LT7A 3UTSA 5D70L 4NJAL 4YSUA 4YE4H 5I5IA 1P7QD 3NOIA 4TUJB 1HCVA 4BH7B 1QVOB 1RJCA 3EYQD 1WEJH 4HFWA 2YGQA 2FSEB 4QRRE 2YMOA 1B4TA 4OF5A 3NJJA 2X89A 3MROB 2OXGB 2HT4D 4Y1AB 3U2IA 2ZYHA 3S3DB 2E0PA 4YXKH 1BJ1H 4WGKA 3K4DA 4CC4A 5FO9B 2A3TA 1WLHA 2JFCA 3JYBA 4GIOA 4YSCA 3CVHB 4HC1A 2VJXA 4YEFA 3HNVL 1KN2L 2BVYA 4EI6B 3FTGB 4BH8A 1E4WL 1BXAA 4LSSL 3II2A 1J9CT 2VDPB 2VC2B 4CC0A 4JL1A 4L3EA 3MRKA 3A4AA 4PG9A 2EC8A 3H42H 1E43A 1AKPA 3N9GL 5HI5D 2AXFA 1JGIA 2KLTA 3LIZL 4MDIA 2F7OA 1T5KA 4ZMYA 3QO1A 3TURA 1SJMA 5K5YA 4PB9L 4O9HH 3V5DA 1UM5L 1ZS2A 2ICEA 4XAWL 1JXGA 5SX4I 1O7VA 2H0FA 1XF3B 4ZUWA 3LMJL 3K81A 1NCDH 1JPFB 2GTWB 3AQXA 1BF5A 1LYQA 4XNUH 3OMZA 1K5NA 3MRPB 3SDDC 5K9KB 4KKCC 4Y4FD 1YMME 4ZAKD 5I1JH 3TZVB 2X2IA 3CDGB 2I9LA 1NGQL 4S0TD 3OKKA 5DHYB 1QKZH 3AM8C 2EDNA 4M62H 2ZXBA 1PZSA 2Y5TB 1KIUA 4JHWL 3SPJA 1U8IA 3IGAB 5T1JA 3CQPA 3WO4C 1KEGH 2Y3AA 5E4OA 1HYRC 2Z91B 4IS6B 4XO3A 2MTAA 2X0VA 3X11A 4YBQD 1W72H 2ADFH 3LS4H 2CKBA 2UVEA 1TVBA 2BY2A 2WINA 3PGCA 1H8LA 5I28A 4B9PA 3FRUA 2D03H 5E8DH 1JG9A 2EKSB 4PV1C 1VAHA 4LLWB 2MPAH 1W8EA 2QGCA 3RAJL 2V2XB 4G1MB 1U93B 4JPKH 2Q86B 3O2DA 5A6LA 2XT1B 3BD3A 5DC0A 2DB8A 1P4UA 5I1LB 4KKBD 2Q76A 1FYTE 1XQ4A 4ZBJA 4KXAA 2V5RA 4B3VA 2IADA 4N2BA 2V5SA 3EHBD 2GJZB 1R5WA 5FDWB 4WWKD 4JFFE 5CSZB 1DQML 3T0DA 2OMWA 1CDUA 1PZDA 1YEEL 3V0JA 4KK8C 5KVFE 2FAUA 4FG2A 5I5JA 2XWJB 4Z7NE 4E42A 3RWGA 1OSPL 5J13B 3PCYA 2FR4B 3PV7A 4R90L 5IVXF 4DKFL 4OCNC 1UOKA 4IDJH 2DPKA 4FG0A 4UU9A 3AMKA 2CJUH 1UD4A 1QRNE 4OZHA 1YC8A 1CWVA 1XF2A 4PWEA 4KFZC 4F8OA 2G2NA 3MGAA 4ZRGA 1IAOA 5HYEA 1TNNA 4P57A 3S35H 2WO2B 3R4DA 3T5WA 4S10A 1GGYA 1Z9MA 1MFEL 2J7LA 2IPUK 2J1KA 3D4YA 4XCYB 1SDDA 2Y7OA 1D6VL 4UOQA 3CH8A 3T4YB 2R7EA 4XZUB 3EJZD 2VC2H 3BESR 1BHGA 3UTQB 4DZ8A 3K74B 4M61A 4DCQB 4K7PH 1MHHA 3CZFB 3C08H 1FVCA 3HUJF 3QUYD 2VT0A 4WI2A 3TXAA 1PZAA 2DWEB 4D9QE 2OCFD 5MENE 3PAUA 5EBMB 3P9MB 4IIZA 3VXNB 4UQIM 3GGWA 5CZRA 3HG2A 2X1PA 5DZOA 3FUNA 3D2TA 1KPVB 3ZHNA 3LZOA 2H8PA 3RNKB 1XX9C 5IOKA 5IM7A 4Z6AT 3BDXA 1NH6A 3AVEA 1FN4A 4N2IA 1BFOB 1XWVA 5TE7H 3MRDB 4JEGB 4TTGA 3DHPA 1A9BB 3HUJA 4OSUL 3WFDL 4I1NB 5IVOA 4LIQE 4QXUL 4NZFA 1HESA 3B2VH 2B3IA 3DK0A 5BV7B 3D8MA 4UDUA 4Y9CA 3RI5F 2ORBH 3BP6B 2R0ZH 5J6SA 3NQIA 4JG9A 4PQXA 4JM2B 1F11A 4DAGH 2CBOA 2VLRB 3HI5H 2B39A 1MEXL 1VEOA 3K6IA 5GZNC 1X9RA 1A6ZA 3KDMA 1NWOA 5EBMA 1S7UB 2YKLL 2ZCZA 5EDXA 2Q3XA 4WFEE 3LNEA 5AVXB 1AY1L 2X41A 2Q2EB 3PGFL 1G7LA 4ALAL 2QHRL 4RGNE 3ZKQD 5K69A 3O3DA 2R8SH 5DGRA 3QQ9C 3L3OA 4NQEA 4WUUD 4Z7UB 1A6VL 3VFVB 1JV5B 4RX4D 4PHXA 2CBQA 3ZMEA 4LXFA 3NZ8A 4HUVA 2W0KA 3R0MA 5JLZB 3ARWA 5IR1A 1TXKA 1KXTB 3NIFF 3MOAL 1LWHA 5ECJE 5IMKA 3HMXA 3ZLQC 2AEWA 3OG4B 2VDLB 2OP4H 4RRPA 4X83A 4UAOC 2D73A 1JPEA 1LO3L 2XVBA 5F1IB 4DEUA 2Z0BA 4NN5B 1NCHA 2ZUUA 4MCYA 5GS0H 3FFCB 1BFOA 2UY6A 2NSQA 3LD8B 2B15A 2OJEB 1JFQH 5K1JA 3Q8BA 5ILTH 3B37A 4PS4L 5I5MA 4JK0D 1XMEB 2WQUA 1FP5A 1I1CA 3KYOB 4OLVL 5D1QD 4PRHE 2NY6B 5BRZD 4Q97A 5CJQL 2GI7A 2D7NA 3GHEH 3REWB 1RJZB 4EMZA 2P48B 4YN3A 3S8GB 5L6YH 1TTUA 3T2NH 3FT4A 3MR9B 2F7PA 1UURA 3OJDB 2G9HB 1QHQA 3UTSD 4JHUA 4B53A 4ODSH 1LD9B 3GJEA 2YPLB 5JW5A 2K9FB 4C4KO 2YMTA 4IJ3B 2DQCL 3OVUB 4PJCF 1UXWA 3HW7A 4NBXB 3MACH 4G7VL 4W1TA 5HDBE 3SDXA 3K5RA 4KXZH 1V10A 4Z3HA 3SKMB 3I75A 4WWPA 3EGXB 2OYKA 1JNJA 4FLHA 5H94B 3EOYG 3Q44A 2D8KA 4BUQA 2E6JA 2X4PB 2VISA 1M3JA 4ZMAT 1A7PH 1AO7D 1OWWA 2R39A 1TCMA 3GNML 3MGOB 2J6EA 3AY4A 4FN0A 3A4EA 3D5OF 4MKMA 2VR7A 3E3QC 1GC1C 4FTVB 5FKAB 2WIIB 3O6LH 5EO9B 3QH3A 4B6ZA 1CIDA 5B38G 3QEQE 1C16A 2ADFL 2BSTA 3LS4L 5LLIC 4XPBL 4YSSA 3TA3D 3P02A 2KPNA 4HKJA 4DZBB 4ZTPL 1TZHA 2YN5A 4A66A 4GLRH 2IBZY 3SY0B 1MXGA 2GBAA 4L8SC 5JO5B 4L0YA 5CLWA 1WFNA 5AB0A 5JXAL 3M7OA 3RVVC 3GMRA 1NPJA 1QFWM 2VYRE 5ALBL 1RZ7H 1L0XA 1TCRA 1MLBB 4NWTH 4A7TA 2IFFH 4JFQA 1FYHB 1YYML 2VDKL 2Y5EA 3K2UL 4R96A 3SODB 3X2QB 5D7JB 5KSBA 4ETYA 1JJUA 3ZTNL 3SGKC 1Z32X 1RUMH 4U05A 1JZIA 1SEQH 4WUKL 5FB8A 3AJ7A 4KKPA 1R24B 3PXHA 4FL4B 4YIQA 2B4CL 4LDOB 3L48A 1D6EB 2TSBA 4MMZC 5GGSY 2H0JA 1NUNB 2Z92A 1NUFA 2Z9TA 3T1FB 3IGKA 2QLVB 1JPST 1OSPH 4OUUA 3JWOH 5I24A 3IXTA 2CKBH 1V54B 3NFSH 2HLAB 3GSXA 3NA4A 2HP4A 1K4DA 1P7HL 3MRHA 3PNWB 4LU5L 1YECH 1DJXA 2CDGA 1TZHB 1J9TA 4WY7H 4FLSA 3IS0X 3V0IA 5AYUL 1I9IL 3I3EA 3H4HA 1ACZA 3L2LA 4JFUA 1OVZA 3KPOB 1B2WL 4X98B 1A8JH 5CMAB 3VWKB 3RVTC 4GQ9L 2QKIC 3NA9H 1JYXA 1N2RA 1SMDA 4GKZA 3WNMA 3WY1A 1U8OB 4OFYA 4LHUA 4JNXA 3BX7C 4KU1A 2VLKB 3UAEA 2EXYD 4NKDB 4IHBA 4WF7A 4X9FA 5DD6B 1L3NA 1OTTD 1X5HA 1YPZB 3LDBC 5CGTA 5H94A 4H8VA 3QPXL 4PP1D 4PRHD 4M5SA 4I87A 1P53A 5CZXC 5BV7H 4B9YA 5LVEA 3S5LG 3L7FB 1WAPA 5E4EB 5HY9B 3MOBL 2F53A 3CFJB 4WCYL 2G0KA 5FUCC 5K1NA 3BAEH 2ED7A 4NO5B 1G9NL 2HMID 1YSOA 5LBVA 1AO7A 4ZMQA 4TN9A 4AJVA 2EUVA 3UJJH 1EJOL 2Y1VA 1ZMYA 1CFMA 3UYOD 5CBAB 3FUKA 2FECL 1MHEA 4GO8A 4PBWD 4R2GD 3WLWD 2OTWA 3TFKC 1MLCB 4ZS6D 4WAFA 5A2JH 4P4KD 1UACL 4WENB 5E9AA 1KXHA 2ENJA 3QYCA 3WL9A 2VQTA 5EIQA 1F11B 1I9RL 5DA0B 1ZLUH 2DTML 2X6AA 5EU3B 1OP3K 3TWCL 4KITB 4FNRA 3L5IA 4K3JH 1HYSD 1B0IA 3U9UB 1S8DA 1PMYA 4P46C 4PJEE 1USZA 2EVIA 4NUPA 1EEQA 2ZOUA 4WI8A 2ORBL 3O3AA 1GIGL 3BGFC 4J2QA 1F4YH 4MAYC 4RGMC 4RISH 3TGXA 1ZTMA 2C9VA 2J6EL 6PAZA 5AW0B 4KRPC 4IOSA 1DVQA 2MHAB 2HLEB 2W1NA 4GBXA 1HINL 4EIGB 3JWDH 3T9WA 4HZ1A 1PY9A 4Z0BH 4P2QD 3RX8A 5D1ZC 4JANA 4J7RA 5T3ZH 3SO5A 2L8AA 1PZ3A 2EECA 4QT5B 5EHFA 1YNKH 2X5PA 4JKWA 1KF9B 2QVFB 1MW0A 1AS7A 3FHQA 2W65B 5DJ0B 2X4NA 3CZFA 4IBTA 1CG9B 1MFEH 3AQZA 4XMUA 4DCQA 5KZCB 3L5XH 1MPAL 1CD0A 2BMKB 4X5WA 1TO4A 3CMOL 3PF2A 4NZ8A 4JVPA 4G1EA 1NEPA 4DT2A 3WHXB 1N67A 4NNPL 2HA1A 3CVIL 2J1WA 4P3WA 3JWNE 4M6NH 1YNLH 4D9RE 2WVUA 1SQMA 4QRRB 3BW9A 4JM2D 4R8WL 3CPLA 3TZVC 4JY5H 5JOEA 4MJ6A 4PJFA 4O4YH 2GAZA 1FA4A 1AQKL 1Q9OA 1X5GA 5F44A 1R5VA 2RQ8A 4GSRA 2Q1EA 4A7QA 1SEQL 3EJJX 4L1LA 2P5ED 3ZTDC 2VN4A 4ESKA 4BKLB 1R0AL 4Z7WB 2EXWD 1R3JB 2KS0A 1N0LB 1UWEH 2OL3L 3T2NL 4MD5A 5F7MC 1I8IA 1FAIL 2O6EA 4ZPTA 2BNUB 1LP9F 1LP9B 3SGJA 5JOFA 4JFHE 1JNHA 4EN3A 3FQWB 1I3RA 2CK0L 4BA0A 3CH1A 1X5KA 4PJXF 1CF8H 1FUNA 1JN6A 1AHWC 1AJ7H 1G43A 5DYFA 4LLMA 2XN0A 3NA9L 4WLCA 4HK3N 2CNZA 4TL5A 1NTDA 5D7EA 3UG4A 4JRXD 1BG1A 2D3LA 4HH9B 4IOSD 4X7TA 3V6OA 1VFAA 5JPMA 5GGTL 2BNQB 3O6ML 4LPCA 2J8UF 3IMUA 1VRSA 1ZVNA 2CPUA 3GJFA 3KPOA 4XVUD 3AWFA 4LOUC 4MB5A 3WLBB 1A3QA 2APSA 1NKRA 3S2AA 4CSSA 4LBAA 5B39A 1TVDA 2CBMA 5HGBB 2ZOLA 5T3ZE 4GEJA 2Z4QA 5E03A 1F3DH 1CXKA 1JPGB 1GS8A 4YLQT 1UB5B 4M7KH 2DMCA 4PJHB 2GSGA 4CUCA 2HT2C 4ZOBA 1BAWA 1S3KH 1UCTA 3BPCB 3CFCL 3P40A 4JZJB 4KQ3H 2A83A 2EYRB 1H6EA 2XWTA 4ERSL 4P4RA 5HI4D 2DIBA 4Q9CA 2ITFA 4X2UA 3LKOB 4PJDB 3HE6B 4GO9A 2G2RA 2A4ZA 2ZUYA 4O00A 4C83A 4L8DA 43C9B 5HDBF 4QCIA 5I6NA 1WTLA 1U8MA 4F8PA 1S78C 1A1MA 4AOFA 4I1PA 1G6RH 1XCXA 2DICA 2CKNA 3I9GH 3PAZA 4AH2B 4DP4X 2AMGA 1JYWA 4ZPTB 2DQEL 2VXQA 4ZW7A 1FORL 2ROXA 1ZGLP 2Z8WC 4ZMZA 1L3WA 2J6WA 5LNGA 1W0WA 4OVVA 3UAJC 4OSUH 1DBBL 1YMMD 5JIPA 1S7WA 4PIRF 1SNRA 4LL1A 4ICWA 4N25A 2MFNA 2EIMB 5TE6H 2GSGB 1P6AB 4GXUM 5D7LE 4IS6A 1OAUL 3P4OA 2DIEA 3TJEH 3MDJA 1NJ9A 2OSXA 5E8OA 4XMKH 2X6CA 3IFLH 4OBSA 3F7QA 3T77B 4E0RA 1IEBB 3NCFB 3ARBA 1DBJH 3GJFB 4O58L 1YMHA 3I02A 3EH2A 3MUGA 2PETA 1LK3L 2Z0UA 1E65A 3N85L 5JW4R 2CSPA 4E41E 2AXGB 1CFTB 3DV6A 1VFAB 3NP4A 1ZS8B 4MQXD 4Z3IA 1UEMA 4WUUE 3FQXA 4LVEA 2ATAA 4TMPA 2O5YL 2C9QA 2EQDA 2WLIB 1XB3A 3VFTA 3V0DA 4I0PC 3SKJL 1KY6A 1RZFH 1XEDA 5F1OB 4FJ6A 1VHPA 2WXIA 4IQHA 1JBJA 2W0FB 1DVFD 5GGRA 4RIRB 5DO2C 1NDTA 3O3BA 4JFZL 1P4IL 3D0LB 4X6CE 2VDRH 4BFOA 2K7PA 1P5UA 3C2AL 4PVLA 4OCLC 5F7LB 3OBAA 4HMEA 4MFHA 1SYVA 4JS7A 5EO1B 2FYYB 2DQHL 4LCCA 1YEJL 4MDRA 3MXWH 3PWJB 4RWYL 5ACLA 4GG6F 4JGNA 4PGCA 1ES0A 5A2BA 4LQ1A 1A66A 1IUZA 4W9ZA 5ANMA 1UKTA 4DGVH 1ZTXH 3CE1A 4CU8A 5SX5K 1IL1A 1DZBA 1NMCB 1VGKA 2VWEC 3QUYC 1M7IA 4ONHB 2KL6A 3BZFA 1CDHA 1Z5LB 2V9QA 4J4PC 4QO1A 1EZLA 3QR0A 3U9UA 2AK4D 2WBJB 2E8YA 2DEYX 4WTXA 3B9KB 4X4XA 3OD3A 1EZUA 1NCUA 1QNZL 2OULB 4KY2A 5AOIA 3KYKL 4XCEA 3H9ZA 2WN3A 2GJPA 4F57L 4N2CA 2Y07L 5IW3A 3RWDA 5KN5A 3CFUA 4CKVX 2HUHA 4CRPA 4IKJA 1B2WH 2OMXB 3C8DA 3CN3A 3AS3A 2DM2A 1AHWA 4FQLH 4AL8H 4H13C 1HK6A 1WT5C 4I0CC 1T7VA 2OTPA 2AJZA 2HH0H 1Q0YH 1P84J 4HFUL 5HY9A 4LDLB 5B39G 2H0PA 2VSCA 2UWEA 3RWFA 4UBDD 5JORB 4F9PA 4GS7B 4TULL 4N2AA 1UQSA 3ZK0A 1RZKC 4YDLB 4OIBA 5L2KB 4JKPH 5L7XL 5AQ0A 1MRCL 2GT9A 4PRPA 4R8WH 1D5XA 2I9TB 1U8OA 4GMTH 1DJZA 3HHSB 1HZLA 1QPPA 4TKWA 5I30L 1BAGA 3L6FA 4GQZA 5DMGC 2PKDA 2P28B 2D0HA 3MPCA 2AGJH 2JWYA 4CMHB 3QIUB 2XFXB 4BCYA 4GEIA 2WLJA 4HCRA 1KYAA 3TU6A 2JQMA 5JHAA 3F7YA 2H32A 3FHEA 1SXAA 3L7EB 1LWJA 4K15A 1OP5K 5I18L 5DVNA 4LAQL 2OL3A 3AWGA 2A74B 5H2BA 1ORSA 1SHWA 4H0LC 1U41A 2OTUA 2ZP8A 3QJFA 4LLDA 5DLLA 2DRUA 3FF8A 3V4PH 5KBKA 4DW2L 2XZQL 3BE1H 3GI9L 3GBNL 3OB8A 4N2HA 3SKOB 4AVKA 2NY0B 4KV5F 5I1HL 2OK0L 1NCCL 2NY7L 4ODTH 2BP5M 1OP3H 3AC0A 1L6ZA 4JX0A 4U7KA 3V5HB 5GS0D 5FYLD 2LW3A 3OR7B 4QGYA 3MA9H 4MJJA 3U9PH 3VJ6A 4G1EB 2YXWA 1BGXH 4X5QA 4WI9A 3UROR 4TNWF 4Y7OC 3UAJA 4DPCX 2VLJE 3D9AL 5IB4B 2X4NB 3KPNA 2YOAA 2DQTH 1MCIA 2XQBH 1M7XA 4I4WA 2XQYK 5GXBB 2WOYA 1KB9J 4QLRA 5D7IB 3GSWA 3C60D 5DEFB 3F5WA 4KDTA 3QXVA 1PGRB 3I9AA 5HHVH 2YXVA 1TTCA 2AXJA 1DBML 1F18A 4WEEA 4XPTL 2IGFH 1MG3C 1MXDA 1CLOL 3U2SA 4P5TC 4LKXA 4FA7B 2YA2A 3LJ3A 3CHRA 5JYMA 4FCAA 4FQ1H 1IC4L 3FRPA 3ESMA 1BMZA 1H8OA 3GSNA 4HT1H 3CVCA 2HRPL 5KSUA 2H45A 4P2YA 4N2LA 1UWGL 1TNMA 5MERA 1R3IL 3NDYE 3VE0B 1MJ8L 3PQYD 1E4WH 4LSSH 3FTXA 4OAWA 1H3PL 3ZDZE 1P2CB 1OD7A 4WGWB 1M05A 5C0RH 3MV7D 2EH8L 1JMXA 4JZNB 1MVFA 3MV8A 1SOXA 1A65A 4IBVA 2RGSA 3OGOE 4J3OD 1XGQA 4JM2F 3VFOA 4YHIA 3QFJD 4YAQB 2DQIL 2VR6A 2D31A 3C6SB 4ABUA 3U6RA 1PJ9A 32C2A 4X8JA 4ZMLA 4Z3EA 4GAYB 2C3VA 4PS7A 1F4WH 5FHBH 2UZPA 2P80A 4LBEB 5I5RA 2VDQH 4L05A 5IBUB 5DUMH 4C83B 2GUOB 2FH8A 3S4SA 1RULH 4KJQC 3S5LA 1HI6A 3CFNA 5F21B 4N0FA 3V6FB 3MLRH 1WBZA 5KW9L 4JDEA 1FJ1B 4FFWC 2Q6WA 4KKRA 3ISYA 5GRUH 1FL5B 3DX7B 3EYFB 4AVIA 4AL8L 2C9AA 5F9OH 5EOTA 1A7OH 1XF5A 4JR9L 5F88B 2PABA 1HNYA 1U2HA 2X4PA 4U31A 3V4UH 1NCBL 2IPTH 3VFNA 2VDMH 4WW1A 3AU1A 3QR1A 5EORL 1VFBB 1MRCH 1J0YA 2JELH 3S4SB 2ADYA 1YUKB 3VGGA 4YS4A 4JFDD 3SEPA 4TVPE 4FL4C 1THCA 1B4LA 4G6KH 3U30B 1C5CL 3KHOA 1JVOA 4NNPH 1HNGA 1T1YB 3OKDB 3Q1SL 3CBRA 1JZEA 4Q6KA 3JQOB 3B7SA 5D8JL 4RSYA 5AKSA 4ENED 4ISVB 3PYCA 4QRSB 1ED3B 1N5AB 3PDOB 2MH4A 3LQMA 2A9AA 3OKEA 1HXYB 4ZSOE 2D9QB 4HCRL 2IOIA 2ZG2A 4EI0A 3CVBA 2YSSB 1VCBC 3MV9D 1GSKA 4N68A 4NZRL 1DP0A 4DO6A 4YSQA 1JZ2A 1JRHL 1MIEH 2W38A 1AZBA 2YPVH 3STLB 1I3RB 5ISZD 2G5UA 3CUPA 3GMOA 3MBEB 1ESOA 2AJ3A 4UCFA 5DJDA 3O6KH 4NC1E 4XP5L 1KGUA 4PV8A 2WSDA 2BM3A 3FH5A 4NIKB 1FNLA 2PCYA 3JT2A 5C08E 4ACPA 3N91A 4LASH 4YHPB 4BIKA 1D5BB 4PLNC 3N0AA 2OMYB 5EF0A 3KJ4C 6FABH 3US0A 2P43B 5I15H 2YQBA 3H55A 4ZS7L 1BGXL 5B1JA 3PFUA 2KERA 3MRFA 4NNYA 5GSVA 4MA3B 5EF2A 3RVWD 4MX7B 4QAMB 3BO8B 1KUMA 3DX9B 2Y7QA 1AJ7L 1CGYA 4FQLL 3WJMA 2DL9A 4MQSB 3VRJA 4BQ9A 1WH0A 4FP8H 4ANXA 1NCDL 1V7ML 3KPQB 3O11B 4G6JL 4Y19E 2NYZA 2OJZL 3LHPH 3S3SA 4IBLT 3V7MA 4C56A 3A6BH 1MJJA 1ZGLB 4PJXE 4XPTH 4HHAB 3ZYJA 4W9GC 3QC5X 1QQDB 4M6OH 2BHZA 1UCBH 5DEZA 4Q89A 4OZGF 5C0CA 1HOCA 4NFDA 4JKLA 1FO0B 4OFYD 4X6BA 2XZCH 1V5JA 4N1HB 5J6GA 4DEPB 2K6YA 3AWEA 4Q4IA 4F2ME 4XX5A 1BIIA 1CFQB 1I3UA 3GTVA 3C2SA 1QSEE 1T04A 5IVXE 3RBGA 1BZEA 3B3IA 3KYOA 3FT2A 5KVGH 2IH8A 4AI7A 4JFDA 2J8UE 1G6RA 3GKWH 4RFEA 1OGAD 3FT3B 3I6KB 1UD8A 2X40A 3F7YB 4E9QA 4FG4A 2DQHH 3ROOA 4Q6YA 3OGCB 2UXGA 1ZANH 2FX9H 5IB1A 4UIKH 2X1XR 2H1PH 3VFMA 2QQQA 5FIEA 2APWA 4N2OA 1FNEA 2B20A 1ORQA 3ZHDA 1VGEL 2PWDA 5IG7A 4B27A 3LIZA 3B2MA 4U1KB 3CC5A 3P3SA 3OR6A 1KLGA 4TSCH 4PGDB 3IXAB 1A1OB 3SYQA 5JTWA 3BEVB 2IVFC 3TBVA 5CUSL 5CBAA 3AB0C 2X6MA 4WU5A 4HMDA 1G7HA 3LMJH 2JE8A 2MIZA 1MJJB 2O6PA 4NQDA 4XO9A 4P5MA 4BGDA 1G7LB 1BVKB 4KXCA 1T20A 3ZVVA 1RSYA 1DBMH 4K5MA 2EDXA 4QHNB 2MKWA 5IT2L 5CCHE 5I1JL 4DVBA 4FYTA 4UYQA 4HJUA 4KROC 2JLLA 5C09E 4CVUA 3BSZA 5GS1C 3VXUE 3R7QA 1MNUH 3VFUB 1PIFA 2BS71 3S5YA 4RMVA 1WBXB 2UYLB 5C0AE 3QEGL 5E6ZA 3LX9A 1MJ8H 3G08B 3ZQXA 25C8H 1NC2A 4HPOL 4Z95L 1C5BH 3G5ZA 4PIBA 3BVNA 1J9SA 3RAJH 5IGXL 1ULVA 3VXRD 3D39E 3B6SB 3LKNA 2WO3B 1HZHH 3ZKND 4FXTA 4Q0XH 3GSXB 1H6UA 4LGRB 4E5XA 4GSQA 1CJYA 1KXQE 3QDHA 5H4YA 2V5TA 3WNLA 2ZKXA 2OCCB 1WFOA 2JI1A 5JPNB 1RZGB 3UACA 3GFUA 1OCCB 1RZGA 2COQA 3BC9A 3IJHA 4KPHH 3NTCL 1K4CA 1IGJB 1SJEA 5FK9B 1D9KC 1PX8A 3WTVA 4K2UH 5F7EL 3WJLC 4WI0A 5IJCC 1CN4A 5AD0A 4RFNB 3HB3C 5A3ID 3IDMA 2GK0A 2WO4A 5JW4M 3APNA 3K3QA 4MJ5A 2IANA 2LQRA 4JPKL 2XY1A 3FB5A 3FRPB 1DLHB 3V9CA 1AANA 2K4WA 4U1SA 1I31A 3G7TA 4HJ0D 4L1TA 3D39D 4YC2B 5E8OB 5DURB 1TEYA 2B59B 3PXLA 1EAPB 4PRPE 5DMJB 3TO4D 4JFFA 4KK5D 2KPWA 2I7SA 3OAZH 4CN6A 4KO5A 3VFUA 5KJRL 1DQMH 5EG6C 3BZ4B 1EXHA 1ETZA 1ZVSB 5GGRY 5TF1L 1W8NA 2FNWA 4P3CL 1WUZA 5MEOA 4NQDD 3TH4T 4YHMH 2VSDA 1CLOH 1WSST 3SPCA 4TL4A 4NKOB 1AQ8A 2DWDB 2K3TA 2DWSA 3DECA 2RIKA 3D05A 4JFXB 3VXME 4KFMA 4M43L 3H3PL 3HCVA 1MQKH 1FCCA 1XH3A 4FQQB 1QAWA 4A67A 3VMPA 3FNKA 2XTJB 3QZMA 3R18A 3Q05A 3BQUB 1WO2A 3T0VA 5HDBB 3QA3B 3B2UC 2JB6A 5TDPA 2ZYRA 5TGBA 3ARGC 5K93A 3FT4B 3RNQB 3QCTL 3NIFE 1FFTB 1QYGH 4KRLB 1J8HD 3AZUA 4JE0A 4K3DH 4GXFA 5IHLB 1XGTB 1TFPA 1TIUA 3CG8A 3V8OA 3JYCA 4UOW0 2G3MA 2VLJA 4Y1TA 3MSPA 1RIVH 1DN2A 2QADC 4UQEA 3PDGA 3UADA 5E6ID 1RIHL 3NACH 3RVWC 1FLTX 2X70B 1WRFA 1R17A 2CO1A 2E75C 2YA0A 3G5YA 4FXKC 4ELKA 1PDKB 1KBWA 4ZO7A 4KVPA 2NXZD 4XNZC 1CUOA 3BEWA 2N1TE 3JTTA 2E6PA 3I84A 4PJAA 5FCSH 4E9VA 2CXKA 2H4EA 4LSTH 1CZ8H 5ID1A 5EU6A 4PSRA 2GSIB 1J9RA 1E50A 3SZ6A 1PZ5A 4P9ML 4D7PA 3RVTD 1CL7H 2OMZB 2XX0A 1SJHA 4XMTA 2WANA 3BMVA 1BZOA 4WCYH 1NKOA 2UWEB 3RWFB 5J1SC 1KULA 4UT6H 5JIDA 5HHNB 4GINA 1KJ2A 2AV7B 4FQCH 1C8QA 1J0IA 4YC2C 3H1ZA 4N2DA 3GKWL 2NUTA 5B38A 4ZMNA 3IM1A 2BXYA 2QKIA 1TOXA 3MRQA 4XMLL 1T21B 3QUMH 4PRHA 2BZCA 5E5MB 2WUCL 2ZSWB 4C58B 2WUBL 1DSWA 2C5DC 2EYSA 4FKHA 4PWKA 1RKRA 3UXFA 2H26A 2H26B 5IBTL 1JOIA 5DJDB 4EZLA 3ZIMA 1PLGL 4MJID 1U92B 2FJHB 4J5VA 4NRYA 3NJKA 3CFIC 3INUL 1DQDH 1F3JB 5EU5A 4FX5A 3KLAA 1MFAL 5DHVH 2O30A 8PAZA 3L9YA 3SCMD 4LDEB 4QTIL 3U0PA 1JWSB 1OCRB 1KFGA 4PGCB 4PJ7E 5IB5A 5L88L 4PJHF 1OZUA 4DGWC 1BZ7B 2I07A 3KM1A 2Q7YB 3QR2A 5LJYH 4Z1PA 2XTJD 4U3HA 4UINL 4F15B 4PJ9C 2G5BB 4WFGD 1WC7B 2Z93A 4UTCA 4WWKC 2V2WB 3QAQA 1BFSA 2L7QA 3AROA 4P23A 3FB8A 1QR1B 2GYSA 3CZGA 4P04A 3WJLA 1JGEA 4I0PB 1ZHLA 3HS8A 5IB3A 1XL6A 3UGEA 5C1MB 1YN7B 2A9NL 2VUKA 1LLAA 1NAKL 4ZTOL 4MAYA 4XBGA 1ZT4B 3O81A 2NW3B 2FT6A 3BQUC 5EPMB 1YEHL 4XCCL 4KKQA 1P6WA 5EWIH 5T1KA 5D5MF 3QFJE 2R83A 2WCGA 4MAUL 4XRCB 3IJSA 4XBPB 4CMMB 3TEXA 5HGAB 1E6OL 1T5XB 4GUPA 5HHOB 4L5FL 3ULVL 4YZWA 2KLRA 5DJ2A 3AACA 1FSKB 1MCWM 4LKCA 5TH2A 1P4LA 1KJVA 3IBEA 4B9ZA 4KI5D 3VXMB 4P5RA 4XP6H 5MHSD 1FCGA 1SJEB 1X7SA 3EOBA 1G7JA 2EDBA 4YSAA 1L0PA 1QPXA 3SDDB 1MIEL 2EDJA 2LABA 4BWWA 4NRZB 5ANMB 2C3XA 2YQ3A 1Z3GH 2BSED 5DFVD 4ENZA 1X44A 2C4XA 2NRDA 4J8QA 1RU9H 4JFED 3E6HA 3MX0B 4PJCE 5IJKC 4ODWB 2VQ1A 1BFVH 3RWEA 4BRJA 1HDMA 4FABL 5I6MA 1WVZA 1XSIA 3BVNB 4QTFA 4U49A 2KLSA 5DUPH 3MRIB 3W1ZA 3HZVB 1SY6A 3WS6A 4KI5F 1A64A 2EE9A 1FI8C 4ZZKA 1NBYB 4P2QE 3U1PA 3WKMH 1GZPA 3BZ4A 1ZJBA 4L3ED 3TLRA 2IH1B 4F7EA 2DM4A 1GOGA 4Q58C 5EU4B 2EDFA 1JZ7A 2B59A 3IFNH 2LU5A 3DGGA 1T66D 4I7ZC 4BV1A 3FQNA 3P30L 4OM0L 4P2OA 4Z76A 2NNXA 1RK1B 1SN0A 1QUNA 3FKUS 3KWVA 5LKNA 4B50A 5C0FB 4MAYB 4FE9A 1HEHC 4IMLA 4QR7A 2UZYA 1AD9B 2DJMA 2LVEA 2EIZB 3T4AA 7PCYA 4K9JA 4M6NL 2QMKA 1OCOB 2A9MH 4LSUH 4YAQA 4O02A 1TEFA 5FYKL 3T1FA 1FRGL 4U0RC 4JDVB 1T0NA 2DQDH 3IJHB 4LVOB 4GKSB 2OI9C 5LAXA 1FVDB 2FBRA 5AUMA 5ICYA 1M05B 1PFCA 4L4TD 3QJFB 3LPGA 2E59A 4FQ2H 1X5LA 4XVJH 5I6XC 1JF6A 3WFBH 4TTDD 1TQVA 2NTFA 4Y7MA 3ZJAA 1VENA 1S7VA 4Z9KB 3ZE0E 4MVBD 1MRDH 1CR9L 3S6CA 4BSJA 5I9QB 4CADB 3JWDC 1XIWC 4I2XB 3NACL 3VXTB 2VIRA 3FQTA 4DKTA 2QPUA 5GGSA 2PTUA 1AG0A 2HFFB 4KKLD 4M9OA 4ADGA 2N56A 1E5BA 2Z4QB 3F65A 3FT9A 4AQ1C 1UD3A 3FMGH 3PWLA 3SCMC 5J9PA 3LPOA 2VDPL 3D18B 3D69A 3RUGA 2AEQH 2LLLA 4X6CF 4HJSA 4Y1AA 2X44D 4CSTA 4HUUA 4DGYL 1K3IA 2WB1A 2DTMH 4G3YH 4EUPG 1KB5H 3AUVA 4U6XB 2A6JB 2L3BA 4ZTOH 2OSWA 3HC4L 5AVZB 4D0CA 3HHSA 2ZKMX 2YGOA 1FGNL 3DVIA 1U95A 3QUMA 2E7LA 1QFWI 1BPLB 3MRCA 2X9WA 1UM6L 2AKRB 4WWID 2CUAA 4R26H 5BW7A 5JHDD 4AYFB 4P23D 2XPGA 4V2BA 4LB8A 1GJIA 5I73C 1J1OL 1UT1A 4KZ0A 3ES6A 3R8QA 3MUY1 4XNYL 4EBQH 5FR3A 1DVFC 3NBNA 4UNVA 4DWHA 1AC0A 4NZUH 4BZ1A 3FPXA 5F7UA 4MA3A 4ZFZB 1Z9OA 2HVJB 4OLEA 5EUOA 4L1SA 3UGUA 3NCMA 1SVCP 3HAEA 4ONHA 1G7IB 3QUKB 4P99A 1WWBX 3IFPB 3SJVA 3NCJH 3PABB 3ZY7A 3QWNA 1SFHA 1AGFA 4HIIB 3P0GB 3FDWA 3CAFA 4PLKC 1G5GA 3CVIH 3R06B 4ORGA 2IXQA 3UZEA 5DUPL 1DJHA 2DBJA 3FQ1A 5I6LA 2NNFA 1EXUA 3NK3A 4XC3L 2ZAGA 3VXQA 3H9HA 1WCQA 3KEHA 1DQQB 9CGTA 5CS7A 5H37H 4D94A 4ODUA 1HCFX 4C56D 1CK0L 2IG2L 4PW3A 5I8KL 3QARA 4FFTA 4LAJH 1YNTA 4B5EA 4UAOB 2GVYA 5D71H 4XNAA 4AJ0A 3VTMA 3GIZL 1IIIA 4HS6A 1KV7A 1B2YA 5K1VA 3UTSE 4OZ4B 1E3XA 1K6QH 1QFUL 1ZSDB 1MUJA 5E7FA 1B3IA 1M3IA 4JW3A 5C07A 3MLVH 4JPVH 2A9CA 4HUUB 1DEEA 1PY4A 3ARDB 1CQKA 3L54A 3QQ3A 1HL4A 3AGWA 4JFOB 3T0ED 3W0WB 1GY2A 3WELA 4BFKA 4KQ4H 5DT1H<