2CM5A

Crystal structure of the c2b domain of rabphilin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
144
Chain Sequence
b'MALYEEEIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RABPHILIN-3A
molecule tags Protein transport
source organism Rattus norvegicus
publication title The C2A-C2B Linker Defines the High Affinity Ca2+ Binding Mode of Rabphilin-3A.
pubmed doi rcsb
total genus 38
structure length 144
sequence length 154
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2cm5A00
1BDYA 3W57A 2Y3AA 5CCJA 1DSYA 4PS3A 2LHAA 1QASA 4LDCA 4WEEA 2WXNA 4J6IA 4URKA 2DMGA 3KWTA 3QAQA 2DMHA 5T8IA 4ANVA 1E8XA 3QARA 1W15A 2EP6A 2D8KA 4L2YA 1TJXA 4A55A 2Q3XA 3APCA 4F92B 2UZPA 1E7UA 2CM6A 3CSFA 3CSTA 4MJJA 4TUUA 3N5AA 4F1SA 4TS6A 4OVVA 4QAMB 1E90A 3PS6A 4NPJA 1K5WA 4WWPA 3ZIMA 2B3RA 1QATA 2WXHA 3M7FB 2WXQA 3F04A 4L1LA 4LCVA 2JQZA 5CCHE 3R7RA 4Y1TA 1UGKA 2YOAA 4AOFA 3APDA 2CHDA 1DJWA 2K3HA 1UOWA 2BWQA 4F93B 1TJMA 3L08A 2X38A 4FA6A 2ENQA 3QJZA 1GMIA 1HE8A 2CJTA 3P2BA 4L1BA 5G55A 4IHBA 1RLWA 3OAWA 3TWYA 4QJ5B 1DJGA 2R83A 3NZSA 4QJ4B 4FJYA 4KZ0A 4FULA 2QZ5A 3QR1A 1E8WA 2WXKA 1UOVA 4FJZA 1DJZA 3L4CA 3NSJA 4TV3A 4F91B 4GB9A 5JHAA 5H4YA 1WFMA 3ZW3A 5KJ7E 2FJUB 3PYCA 4JPSA 2CJSA 5H4ZA 1E8ZA 2CHWA 2K8MA 3ZVVA 4OVUA 3TL5A 1YRKA 3HN8A 3L54A 4AJWA 3SD5A 2Q0ZX 3QK0A 1BCIA 2WXGA 3ML9A 3PREA 4Y1SA 4WWNA 4XX5A 4XZ4A 4WAFA 1A25A 3L13A 1WFJA 3KWUA 2NCEA 3APFA 4EZJA 4GNKB 2WXIA 2V4LA 4QJ3B 3RDJA 1DQVA 3TJPA 2WXFA 4IQHA 1DJHA 5EDSA 4FHJA 2ENPA 2CM5A 3B7YA 4ICWA 3IBEA 4KZCA 2ISDA 4BGDA 3F01A 3HIZA 4ANUA 3L16A 1DJXA 4BFRA 4EZKA 2ENJA 1V27A 2K45A 2ZKMX 3F00A 3JZYA 2WXJA 4FLHA 1DJIA 2CHXA 5CCGE 3HHMA 3RPBA 4FHKA 4KITB 3W56A 2NSQA 1E8YA 3NZUA 2YRBA 4ANXA 2Z0UA 2WXOA 4ICXA 1RH8A 3FDWA 1BYNA 5JHBA 3MJWA 3PRZA 4HLEA 4EZLA 3QR0A 4DK5A 2CHZA 3PFQA 3L9BA 2A5UA 2A4ZA 3OHMB 4ANWA 2NQ3A 3ML8A 2QZQA 2N1TE 1RSYA 3LJ3A 4L23A 3S2AA 3GPEA 3IM1A 1CJYA 2WXRA 4HVBA 1E7VA 2RD0A 3R7QA 3FBKA 3ENEA 4FADA 4NP9A 4V11A 2FK9A 2WXMA 1DJYA 3L17A 3DBSA 4XE0A 4LT7A 3T8MA 2WXPA 2KI6A 1W16A 2WXLA 3DPDA 3F05A 4NS0A 4PS7A 2K4AA 4DNLA 5G2NA 4G11A 4PS8A 4WWOA 4NPKA
chains in the Genus database with same CATH superfamily
3U7WH 3W38A 1CFVL 2DQIL 4GOSA 4FNSA 4P4KB 4ZNCD 2OA9A 2ED9A 3O3DA 5C2BH 4Z8FH 5SWSA 1KOAA 2R29L 4B0MM 4HKZB 3KBFA 1ACXA 3UTZB 4OM0H 1TQUA 4I18B 1WAAF 4GIPD 3VXOB 4ZPVB 3T1WA 4L4VA 3F7QA 4UB0L 4YHIB 1ASPA 2QKIA 3EJUA 4CL7A 4P5MA 3HPLA 4OVVA 4HD9A 2MCAA 1GTNA 2ADJA 1DSFH 2F1BA 4GW4A 3SDYH 1A4CA 1SVBA 5SV4A 1DVQA 3KPOA 5DJXA 4X7FC 1E65A 2XXMB 4XVJH 1EJ8A 2VOTA 4OF3A 5L6YL 1NCAH 1VDGA 2EYSB 5E99H 3ECBA 1S3KH 3GSVB 5EMYA 3EH4B 4MDRA 3A3YB 3X13A 1LM8V 1FFTB 2HZHA 4UT6L 3OMZA 2E8YA 3VSUA 4KTEL 4AUJA 4X6DB 1SNRA 2N1KA 5GGUB 4F8TA 1U42A 1M1SA 3GSUA 3SGDI 3BHBB 1S7WA 2WUBH 4NQSB 3FSZA 4HS6A 5J9PB 5KYUB 4HAKA 3OJ2C 2R0ZH 3PREA 3RNQB 4QNPF 2HX8A 4L0ZA 1KTBA 1P7QA 3VFNB 1IQDA 4MZ3A 1U6AL 1DJHA 4FNLL 4MYPA 4MB4A 2EDKA 3D39B 5AFAA 4NRZB 4ZD3L 4DFHA 4KZDH 3L5XH 1IFHH 4OD1H 3GMNB 3D4YA 4M9OA 4QRPA 3FFCE 4BZ1A 1XSOA 5TFSL 2EUWA 2PMZA 3GI9L 3HVNA 4QOKD 3MRKA 3GSNL 1BYPA 5JO5A 1JGIA 1GIGL 4WHYG 2NDFA 5F9DC 5I9QB 3SODB 1BOGB 2NSQA 5I30L 3BCDA 3HE6C 1CLZH 4P2RB 5JLZA 4NQXB 4W81A 2G3ZA 5B8CA 2EICA 2A83A 4KRPB 3UBHA 4G8AC 5LNDA 1SZNA 3AM8C 4ZUSA 4B96A 4POZC 5D1QD 1TQVA 1YMMD 1XH3B 4CVXA 4OKVA 4BRJA 4ERSL 3NCWA 4ZFZA 3HZVA 2UY6A 3LHPL 3FQNA 4I8DA 1AO7A 1CDGA 5HDLA 1L7TL 1JK8B 5F96L 5GGTA 3FRPA 5I76B 1BEXA 3RJOA 1MW1A 4PV9A 3SOBL 4FQQA 4FQXD 4XNXL 1BM3L 1IGCL 3FUJA 3EH3B 2HVJA 4GBXC 4NENA 1OGPA 1GHFH 3D39D 5GS2D 1P9MC 5CIPH 2DYPB 4OGZA 4Z3EA 1RURH 5IW6B 2RB8A 4QOKB 3NJVA 3X17A 4F15C 3BFOA 5F7YC 3L2MA 4FERA 5TF1L 1YEDA 4Z7QE 1E4HA 2H8PA 3IU3A 4L48A 3P73A 3ZKQD 2F54D 2VABA 1OOAA 1H19A 2G2RB 1YMME 5E95B 3ZMRA 1RU9H 5B7MA 4ZPTB 3ROOA 1TTAA 4XXCA 5DU7A 1E2VA 2BNRA 4QXVA 4MQTB 4J27A 1NGYA 3C5SA 4RETB 3EDFA 1W0WB 5JQIB 3FMGH 1UB5A 1SHWA 4LEBA 3BSZA 4MMXB 1UACL 1CI3M 3IFLL 1NBVL 3C5ZC 2Z93A 3JWOC 2P24A 5ADOH 4PB9L 4FG0A 4H26B 1TO4A 4DAGH 5L2JA 4JFTA 4JBSA 4FDWA 4FQXB 5HD8D 4PUBL 4X4XB 5C0BA 1L9SA 3VU1A 3UJTL 1IC1A 3KYNB 1G0YR 5E56A 1ADQH 4J3OF 2B59A 3S3CB 2YRLA 3HB3D 1T1ZB 2PR4H 4BCXA 1S46A 3UACA 4PJIA 1JVOA 1TO5A 1T7VA 1NPNA 2ZAIA 4AJWA 1PLBA 1P4BL 2WWMC 1NOAA 3ILPA 3VXPB 4K2UH 1JGUH 2Z1PA 5IB2B 4U6YA 4G7VL 3RDJA 4QKTA 2X0UA 3TF4A 2Y2YA 4HKBB 4IQHA 1FZKA 3UROR 4JZJA 3P4OB 3IGUA 4EUPB 4GUPB 5EOQH 1QRKA 3IDIB 3WUWA 1BOYA 2F1AA 1N0LB 3UZEC 4A04A 2J8UE 1ZTXL 2ZUUA 4AZUA 4UUJB 1R5VB 3TV8A 3V0DA 3GNMH 1P7KB 3SDAD 2IV9A 4CW1A 2ZOLA 4CBZA 5EULV 4IBLT 1LO3H 3T6XA 2EABA 4TQIA 2GIYA 2TAAA 5IB2A 2G75A 3O4OB 1IC7L 3T4AA 1PVHA 4ZMTA 1BVZA 4WWKA 2D03H 4PJXE 5FA4B 5I1CL 4NKIL 4S0TD 2KKQA 1B4LA 3WHXB 5JIDA 2WO4A 1IC7H 1G6VK 2W65A 2VZTA 2WXMA 2ZJSH 3N50A 2ZNWA 1BWWA 4XE0A 5KANI 3L5JA 1I7ZB 4FLSA 4Z7OE 2HT4C 3KPSB 5T1DH 2R2BB 2WLIA 4QTIL 2AZUA 1FVCB 2XTSA 3QEHB 4O2CA 3FN9A 1UXLA 4A2HA 3CUPA 1JZ4A 5HGDB 5E6IA 3EHBC 1MRDL 4I1RA 2LHAA 5DVNA 3CFTA 4G7QB 2B1AH 2E6PA 3M46A 1DDHA 4DGIH 4NZTH 4QRQB 3V5DA 2F58H 3EIFA 2HWZL 5AD0B 4FL4B 1S9XA 4P2OC 3F7RA 3QQDA 5FM8A 5ALCL 5DHYA 5F1IA 3H9HA 3RZCC 1JVKA 2FT8A 4NO5B 3MRKB 1KACB 2XVLA 3OHXC 4LOFA 3QQ4A 5F7EL 2J8UF 2XTJB 3B7SA 4QY8A 5DD0L 2I60L 4PREA 3VI4B 3K72B 4JRXB 2Q10A 4YXKL 1AD0B 5BZXA 4P06A 5EZLA 2JB5L 5JUEH 2FR4A 3GSVA 4R7DB 3UEQA 5KBLA 2B3RA 3EBIA 3GHEL 5B39G 2ZCHH 1BEYL 3FONA 4G59C 4Y89A 2Q8BH 3ATBA 3HE7D 1QYGL 5FXCH 1LWRA 3UP6A 1J5OL 4KX9A 2HXAA 2J43A 5CJBA 1K8DB 1P84J 1CD1B 2B8OT 2XPYA 3MZGB 4PJEE 3TM6A 4ONFH 1AXTL 1UKSA 4OJEH 1T1WB 5L2KB 2Y5QA 5EHFA 1UD5A 1OQXA 1QBMH 2WNKA 4PWHA 1G6RB 1VGEL 1MWAL 4EMZA 4NUGH 4F27A 3ZXAC 3V4VA 5HI4D 3WNLA 2KLTA 1KTLB 5A6LA 1RU9L 3CCHB 4UAOC 2OQJB 3CFUA 3DO4A 3V0GA 2IH8A 1JXGA 3CN3A 3H2QA 4E0RA 1S7XA 1MAML 1NFAA 3LKOB 3Q1SH 3PWVA 4PTUA 2IDCA 5ANME 3V6FA 5FB8B 5GS0L 1PZBA 1HKLL 2VXQH 3U0PB 3EYUH 5GXBB 3SPVA 1PGRB 4KRLB 3T08A 4NBZB 2EIEA 2L3BA 1TU2A 4ATWA 1ODUA 1Q94A 2NR6D 1PKOA 4YHPA 3UTSE 1CXLA 4NUMA 3MXVH 5E8OB 1U8OB 4PJ9D 3RUGF 3KMDA 3FS9A 3WSQL 3RYMA 4LARH 4M29A 3GKWH 1AKJA 3U1PA 4E42A 2ICWI 2DIJA 3PJSA 3IBOA 2XUWA 1MH5B 3BZEB 2YMOA 1PPIA 3QHFL 5IMOA 3N6YA 1I3VA 5I1JL 4PD4K 3L7EB 2OYKA 1OE1A 3ZMNA 1KTJA 3IWVA 1IV8A 2AANA 1QI3A 2BNUA 2I5YL 3OJVC 4N87A 2OULB 3QPXL 2I07A 4HBCL 1FNLA 1MY5A 2V9TA 3WY4A 4OZIE 4PH8A 4DGIL 5E8OA 4OGAD 3B5GA 3GI9H 4PJAA 1HCFX 4XMVA 2Y3AA 3PDOA 3MRDA 1AFVL 3IJHA 4S0SD 1M05A 3PAZA 3VFWB 3HZYA 2A77H 2VISB 5FECA 3O3BA 4O9HL 4NQCE 4FQ1H 4PJ9B 4MJ5A 4Y9EA 3MV7D 1J9RA 4XI5D 3AG3B 2JI1A 2J44A 1J10A 3TV3L 3SDAB 4ZNEE 2IH3A 4Y9BA 3MUHL 3LPFA 3N3EA 1QQDB 4JG1H 4JRYB 3VTAA 4QKXB 4ZFOL 2XV6B 3NSXA 1C5DB 2A74B 3CH8A 4JPWH 3RDTD 1ASQA 3KBHE 4CN1A 3MFGB 3Q1EA 4HF5L 5A40E 3T8VA 2HFEB 2QMJA 2N7BA 3UO8B 3OSVA 3TN0B 1UB6A 5IIEA 4Y16D 4A6YB 3L4XA 2JELH 1YEEL 4C83B 3K3QA 3T5WA 3KJ6H 4AYDC 1H3XA 1PZCA 1KTDA 5KJ7E 5KSBE 4P2QE 1AZVA 4N2BA 3KLHD 2VAAA 2VLJE 1MDTA 3T3PB 4OIIL 3Q2VA 3ARFD 2VDMB 3RUGB 3TWCH 1J8RA 3L13A 4XRCB 3I6GA 4R3SB 1VJSA 5GS0C 1K3IA 5KYNA 4J28A 3ZHLA 5C0IA 2AEWA 2YO3A 4B9GA 4JHWL 1LE5B 1S9XB 4XPAL 3AQDA 4JDZB 4EPSA 4AQAB 4J6RL 1ADQL 1UXSB 3TIDB 1U9KA 4OZIF 4LU5L 3UCRA 3WL9A 2DKMA 3O11B 4EXPX 3FAXA 1JPSH 1G7HB 1MFBH 3SB3A 2VC2B 4ONHA 4WW2B 4XCYA 2E46A 1FNSL 2HG0A 4I48A 5FYJU 2A38A 4M02A 43C9A 2DD8H 3ALPA 4HC1A 4X5LA 1YHPA 1ZCRA 2DLFH 1CE6A 3NZHH 3QQXA 5I18H 5K33A 2UZXA 1CCZA 4YC2B 3LS4L 1N4XH 2YKKA 3VB8A 2NUPA 5IMMA 1GOFA 5IMLB 1VADB 2CQVA 2HTKD 5HDBF 4YHIA 4R9HA 4Y8DC 3MBXL 3AC0A 5I1IH 3AUVA 1MIEL 3U79A 3HMXH 3KYAA 4Z7NE 2DL2A 1BGXH 4NO0A 2ZG2A 2IEPA 3A67H 1C08B 4XCYB 3UO1H 1DP0A 1T2JA 1LNUA 3FCSA 3PJNA 5I0ZA 5ALBH 6FABL 3RNKA 4D7BA 2F7RA 3OAUH 3CDYA 2G3NA 3Q13A 4O51A 1WWCA 5BRPA 2IXQB 2HT4D 1SEQH 3WDJA 2BOCB 1E8XA 1FNHA 3FQXA 1XGYH 1ZIAA 2MCPL 5JW4N 1OW0A 1T0PB 1V7NH 5EU6A 4M62H 3VD3A 2NZ1A 2CM6A 4RNRB 2OR7A 3UEZA 1OP3K 2GHZA 4PJ5E 3AWFA 3PS6A 4ZTOL 5GZNC 3LB6D 2OZ4L 3NCYS 3SJVA 4JQIL 4LIQE 1QATA 1HILA 2IJ0C 3RZCD 4H13C 3ESVF 5CF3A 1FCGA 1XGUA 1G9NL 4MNQE 3ZTEA 5C0ND 1EXGA 3EFOA 1Q8MA 3ECVA 4HXBH 4ZJ9A 5I6KA 4PJ8C 4HX1A 1B0GA 3UDWA 1MN4A 2H47C 3QEUA 2VLRA 3PWNB 3K46A 2YK1H 3KPLA 3SQRA 3D05A 4IHBA 1UZ6E 4YDLB 5HI5D 3BVVA 3JWNG 3MACL 3AAZB 2BSCA 3PAYA 3LNHA 4EN3C 4U1MB 1UM5L 3LTVA 3KYKH 4TMPA 4TUKH 1IB5A 1CC3A 1KTLA 2GEEA 3VFUA 4E41B 1R3JA 1JP5A 1XF4B 3B2UD 3V4PH 1T0MA 2WWKT 4YNYA 4PJDB 1JFQL 4JCLA 5DRWA 2J88L 4XX1E 2WWKO 3RWGA 4BJLA 2OMXA 1Q72H 3CV5A 3FQYA 1EXUB 2DQCL 5H8DA 5FGSA 1GY1A 1GS8A 4N2LA 2WXIA 3BH9B 3WFBL 1ILUA 1KLGA 1KF9B 3QFDA 4RMRA 4XAKD 5GRVL 1SXBA 1PG7X 1NA8A 3L7FA 2CBOA 5HDBB 4KTEH 5BVPL 4AT6A 1T6VN 3GSOB 4NIKB 5G5DA 5E7BA 2AHIA 2OXGA 3ZE2F 3QQ3B 3BVXA 1R3LA 3V0VB 5B4MC 1F4AA 2HKAA 2AABL 2ZUXA 1JNNL 2DWXA 3ZHFA 4EI6A 1UA6L 4CNIB 1E3FA 3P77A 4GRWH 4X5XB 5FUOH 5HY9B 5CLWA 1I9EA 4PJXF 4KO5A 3SDYL 3H0TB 3OMIB 4PWEA 5A3IC 4J8QA 4HS8L 1F1AA 1VGKB 1H0DB 4E41D 1PF3A 3QCTH 3HBQA 4YGAB 1ORSB 2D9CA 2EDMA 4PRHD 5BVJA 1U8MA 1UJ3C 5BUGA 1X9LA 1DVFC 2MHAB 1A3RL 5IHLB 2Q6WA 3ESUF 5D1ZI 1KIUA 4NS0A 4K7FA 2F53A 1I8UA 2MWCA 2K4AA 1FORL 1JPEA 3BH4A 1EO5A 2WMPA 4UBDD 5SWSE 3BUDA 3DVGB 1KJ3L 3MLXH 4UOQA 3ARFA 3GJEA 4DGYL 4PJDE 3O8XA 1F5WA 4X4XA 5C0BB 1OPGL 2PP7A 5AAMA 1MFCH 3KLAA 1LMIA 4L8CB 1BMWA 3QORB 1QRND 5E8NB 1BQHA 2ZONA 2CDEA 1NH6A 4M93B 1IQWL 5DUBB 2DLHA 5D7IE 4M8QA 2JKTM 4JM2C 2BHYA 2ZCKL 3VG0H 4ODVL 3TO4C 4A37A 4OFDA 3WKYA 4W9LC 3PGDA 4FLRA 1CFQB 1JFQH 3KPQB 3VDCA 2BVOB 1I8MA 1AFVH 2EXSA 4F93B 3V6OE 1CICB 1OM9A 5EBLA 4DK3A 1U3HD 1NDGB 2VN5A 4DZBA 4PRIB 1CDBA 2UZIH 4HXBL 5DEFB 4LVEA 2V5MA 1P5VA 1UEMA 2CLVA 1ZVSB 1YQ2A 2QQNL 3DMMC 4L3AA 1F2QA 4Y0GA 3QH3B 2ZUSA 1WDAA 5HP5A 4LF3B 2YAEA 1EJFA 3FO0L 1IBGH 1RKRA 5C08A 5H4ZA 4S1DD 1VEPA 3FTGB 3MU3A 1Y18A 5AW8B 1BYOA 1CICA 4IBQA 3QORD 3IJYB 5EBLB 5H37A 4Z0XA 4PJAE 4EE2A 3M07A 2GSGA 2LVCA 3EJJX 1LK2A 4KUZL 4R5TA 3OG4B 1LQBC 1R4XA 1NLBL 1JPGB 5IHUL 3ARBA 4PR5B 4CVXB 1G84A 4IMKA 4WW2A 1RZ7L 3VXRB 3BVTA 3NJMA 4XP4L 3C6LB 3ZR6A 3V2AR 4HT1H 3QIUC 2J1XA 4DCQB 1GC1H 4ZNEA 3P3SA 3CFCL 3U2JA 3WUWG 3FF8A 4ZFGL 2C8NA 3F85A 5ALBL 1WBYB 2H32H 4AYFA 4N9OB 4EZLA 4JCMA 1HT6A 5TF0A 3BIKA 5E5MB 1PD6A 3TBSB 1HL5A 1ZAGA 2JMRA 1G9EA 2WQWA 5GGRA 5FECB 5IOPA 3HLKA 4I5BA 1RPKA 4ZFFB 5EV7A 3ARYA 3VG9C 1HZLA 1WYJA 1A3LL 5LCVA 3WLWD 3Q8CA 1OGAD 4IK7A 2EXTA 4PJCB 4LSSH 2AEPH 1SY6H 4NQDE 2VQTA 1KENL 4O02B 3CXDH 1IEHA 2D3VA 5BMFH 2QVMA 4AMKL 3M17A 1R24A 1MJUH 4N2HA 3RY5A 1N0LA 3GMMA 4UQIM 1QKZL 3IJ7A 1CB4A 3KS0H 3VXRD 2OS7A 3B2VL 3LN5B 4MGXA 4QRRB 3PF2A 2KDYA 3OR7A 2H26A 2VITB 3IDIA 3WUWB 2W9EH 4IRJA 3VXQA 2GY5A 2NY3B 5AOMA 1DBKL 3QS2A 4MWFA 3T0WA 4AC2A 4BM7A 1N18A 1AY1L 5DJXB 2QPUA 2KC0A 4LPWA 1GKOA 4XT1C 1ZY9A 5B8CB 3R18A 4NOBA 1NICA 1Q1JL 2ITCB 3DJZA 1QR4A 1J9TA 3QQNA 1E5ZA 3KJ6L 4U0QB 2F7PA 1QEWA 2Y9RT 1B0IA 4TLKA 1XL4A 1YUHA 3CC1A 3DYPA 4W6WB 5DFWH 5E1AA 2C1PA 5F6IC 3BAIA 4PS4L 1KN4H 1TZIB 4E2OA 4YNYB 4WFFD 4QCIB 4QJ5B 1I1FA 3SZKC 2HFGL 3P9LB 1NGZB 4CMMB 4V33A 3UYOD 4MBRA 2JE8A 4X6EA 2MHAA 2X05A 4XN1A 3A4AA 3AXLB 3LH2L 3L9YA 1NCWL 4OLUH 1BFOA 4RMVA 1JZ5A 2J1WA 3L54A 4HZ1A 4TSBH 1LYQA 4LSRL 4MDJB 2P5WD 3SE4A 4LNVA 2VXSL 1PNDA 5C3LD 1PYWA 3HB3C 3WTWA 2AQTA 2IPTL 4U1HB 5B1AB 2MH4A 5F88A 1XV8A 1X5XA 4S1QL 4ETQA 2YJQA 3K72A 4G6KH 3A22A 5A2AA 4N0UB 3BKJL 2PCPA 3KPRD 3GHBL 2EDBA 5AVRB 2DIEA 3GUTA 1BMZA 3P30L 4JY6B 1A14H 3FONB 1KMGA 4LLQB 1OM3L 2X9YA 5J7CC 3FN3A 1GW6A 3OKLA 4YHOH 4GG6E 2WAQA 3LSOB 1V7MH 1GVIA 3QNXA 2P52A 5IT2L 4G3YH 2QLYA 3H4HA 3FQNB 1XTLA 4DIXA 1QR1A 1IC4L 5C70A 5B4MD 1GRWA 3QEHA 2VIRB 4HFUL 4JM2D 3M8OL 4YHOL 5CZKA 3PWPE 3QWRA 4EKJA 4IBWA 2YEQA 1IGJA 1GYVA 3ZK0A 1A4KA 4DVRH 5I1JH 1UD4A 2ZSWA 2DTML 4K3DH 2BZDA 4EIZC 3WSQH 6TAAA 4FXLA 3DX7B 4Q6IC 4B95C 3QYCA 4ABWA 2P5WB 1MCHA 3W5NA 4AZ8B 5GZOD 2YMXH 2HG5A 4A2GA 1CU4H 2H0FA 3LSOA 4G11A 3OPZL 4MZ2A 4RRPM 5AYUH 5AW9B 1SLWA 4OY9A 3K71B 1LK2B 4LSRH 4PS3A 4WNQB 2CGYA 3FO2A 4GQPH 5E6SB 3IFLH 4M1GH 4ODBD 2OMTB 2E4FA 4NM8L 4P23D 1B3JA 1MW2A 3LH2H 3KLSA 4BQ6A 4EN3D 5BJTA 3ULUH 4HWBL 5E1GA 4NQVA 3RIKA 1IM9D 1QSFB 4WO4B 3D39A 4KJPD 1MW3A 5DJYA 4GS7B 2G9KA 1E50A 2C9RA 2GK0B 4N0YH 5C0EB 2ICES 3CVIH 5EORH 3AY2A 4FG6C 4G8IB 1H6TA 4IOFD 2DM4A 1SDDA 4XI5C 1LE9B 2OX5A 3RWHA 3MROB 4P99A 4LCIL 3BP7A 4W9KC 3B9KC 4D0DA 1IO4C 3EAKA 3DTDA 4NP4L 2BNRE 4FMFA 2XIDA 4U1KB 4JUTA 1A02N 3U9PH 3M1BA 4GQQA 4EQ2A 3ARGC 2XA8L 3KXFB 1ED3B 1DJGA 3W37A 1QHOA 3QFJE 1I9RL 4AIZB 2QZ5A 3GBMH 4AY0A 2WIIA 2X2UA 4HPOH 3VQMA 3CSGA 3GF8A 5DVOA 3UAAA 1N5YH 4HG4J 1JNHB 3HS0A 4I0PB 3T2LA 1VKXB 3CXHK 3FU3A 3U6XA 3OD3A 5E2UL 4HWEH 4DVRL 4ZW3A 1IKFH 1KPUA 2DQFA 2VW6A 1OP5K 4MQ7A 4FNPA 1IC4H 2DL9A 3OG6B 1EHKB 2GFBA 1M56B 1WGVA 3QDGA 4LCYB 2W59A 2XJKA 3K4DA 3H3BC 3G5YA 5HI4C 3R4RA 3HRZA 4L5FH 1UFGA 4WFHD 1FZMA 2CHXA 2I9LA 3GHBH 1ECYA 1H5BB 1T3FB 1Y0LA 4PG2A 1DN0A 2APWA 4D7PA 5HBBA 1ZK5A 1NC2A 5SWZE 4UQCA 4CDGC 3EOTH 5AVWB 1XSKA 4TF4A 2CR3A 4DVBB 3OR6A 5C9JA 1JZDC 3KDPB 2IOOA 4CADA 2D03L 3QULA 3MLTA 4PFEA 4I0PD 3P0YL 4UQ3B 3HVDA 3F6IA 2PCYA 4R0LB 5E5LA 2BINA 5ABDE 1NFDF 5I1CH 5KSVB 1RP8A 4RA0C 3T8XA 2ZOKB 5KJRL 5IHUH 3MNDA 4IBZA 2VJ8A 1T3FA 4LLYA 4QRQA 2JLLA 3V5DB 3Q05A 4NWUH 2FE0A 4EI0A 1QW8A 4K71B 5C71A 4U7MA 5BXFB 1EBPA 2D4DA 3RPIB 4PS4H 2KUTA 3A4EA 5CCJA 1ZTXH 2G60H 2IDFA 2I85A 3A6OA 4NO3B 4OCNC 2ITDB 1XF2A 3BT2L 1IBGL 3GMRB 1YJDH 2P80A 4B7LA 1PD1A 2DQGH 1USZA 5JHDE 1KC5L 4QYOA 4JZNA 4L8SA 4P4RA 3O6FD 2CKBH 4F9PA 2X0VA 5T5FA 2AXFA 4UQEA 3VE0B 3M86A 1T6BX 5H94B 3ARXA 4FF9A 4JFZL 5IMMB 1NUGA 3GMLB 5C08B 1FSKB 1CK0H 1R5WB 3F12A 3ZYJA 2UZYB 3ABGA 5IB3A 2ZOLB 1U0QA 1WBXA 3O2VH 2X9ZA 1KV7A 3RIAK 3NN8B 1ZVNA 2VLME 1HE8A 5HYJD 1VFUA 5KUMA 2Y5TA 3RX9A 4TNEA 5GGUA 3U6RA 1WTGT 1UWGL 1QFOA 1RSFA 2GUYA 3MRBA 4MNGE 1ACYL 2NQDA 3EYQD 3P9MA 3MOQA 3NJHA 2VC2L 4OLZL 3BUQA 4XP5H 4CVZB 5K9JH 4G8FA 4PBWD 1TZHB 3BWAB 4JPVL 1O9WA 4HIIB 5HHMD 3CNKA 2AI0H 4FI8A 1D6VL 4OGQC 1MI5A 3NFPA 5TF1H 2ADFL 1SOXA 4XB8A 5C08D 4ZFGH 5ADPL 4ANUA 3Q01A 4Z0BH 3IE4A 3P4NB 2ZZUT 3E3QE 3H9HB 3N0AA 4N86A 1QLRB 3MBEA 3MGOB 1GS6X 3RWJB 1MHPH 1BZOA 1U8KA 3K7UA 2WYHA 5F8RC 2TSBA 4GQZA 1BFTA 2E76C 2B2XL 1I75A 5GJSL 5D7HA 5CIPB 1URLA 4B53A 1GPOH 1G7LA 4LAQL 1DCEA 2BIOA 2ENSA 25C8H 3HG1A 4POYA 3JT2A 1ONQB 1U92B 5HHME 1VFBB 3MA9L 3O81A 4XH2B 3QRGL 2F5BL 3PU7A 2C26A 3CQPA 4ELME 3L17A 3IXTA 4G70B 5J13B 4GP5B 1DYZA 4IRSA 5BZWA 5HHOE 5HVHC 4JL1A 1JJUA 4P48A 3T04D 2G2PA 3TONA 1P7HL 5I30H 2OXHB 4YOKA 5HI5C 2OLDA 5JZ7C 1Z3RA 4HWZB 5ICXA 2YD6A 5DVKA 1GGCH 3P0GB 1MW0A 1OF2A 4JFQA 5DEFA 1T7ZA 4EI5D 4AT6B 1JG9A 5CILH 4FAAB 5T8IA 2H2PC 3QARA 3GSQA 3HE7B 5SWQA 4TQHA 1KT2B 5JIKA 4O2FB 3ZU8A 2O5ZH 1HINH 4XGZB 3NABH 5DJ8A 2VRQA 5DHVB 1QSEB 2EJ1A 5TJWK 3ULUF 1UB6B 3HG4A 3ELAT 4NQCA 3BQUC 3IN2A 4HGWB 3WNIA 4FXGC 3IGKA 3LCYA 3MA9H 4MB5A 1PMYA 2HPOA 2VDKH 3TO4D 3DUUA 1RUKL 3HOGA 1UWXH 4Y4FA 1WO2A 4OV5B 3VWKB 2OMNA 2FLRT 5I1GH 4OCXL 5TDNA 1S3KL 5LBSA 2EO7A 5I5RA 1G0DA 3I75B 5C0CA 3T2QA 1AZNA 1NBZB 1G9MC 3CDGB 1BIHA 5CP3H 3AS1A 1KPUB 2DQFB 5D5MF 5E2WL 3KG5A 3KS0J 4GBXB 4EF3A 1S9VB 4OLEA 3D4GA 5A3ID 1AE6L 4JREC 3TEXA 1IAKA 4YSAA 4UB0H 2XWTA 3VXUB 4U3CA 3G6JB 5D1ZB 2CK0L 1GYWA 1R3HA 3ARDB 3QGVA 3OKDB 4N2DA 2ENYA 4PJAB 5EZIH 3LZQA 5HJ3B 3EJZD 1G7PA 3DSNB 1UA6H 2ARJA 1XGZA 1ZT4A 3D4ZA 1GY2A 1JXJA 1NCUA 1TETH 1DJXA 1CFVH 2NY0C 5D2LF 1KCVL 3CMOL 2XV2A 3Q8AA 4ZSOA 3MBXH 4AM0A 5I1IL 3V5HB 1T83A 3VI4E 2ATAA 3UADA 4P5KB 1HL4A 1JPTL 2P44B 2Y2WA 4LEOB 4BK8A 4Z8FL 1KLUA 1PCSA 2C1OA 5C07A 3FO1B 3LRSB 1W0VB 1BJMA 5C8JA 4WV1A 2Q86B 5I18L 2YRZA 2C9QA 3K71A 5AW4B 2VQUA 3BKYL 4RFNB 2EDXA 5CGMA 3SY6A 4FQXC 1YA5A 5FFGA 3CVHB 4D0CA 2ATKB 4N0RA 2CO2A 3GPEA 2Q8AH 3IF1A 3ROLA 1MNNA 4U1NB 3GWJA 5GS1B 4F33B 5LQBH 4W9ZA 4H2CA 4U6XA 4L4TA 5C09A 5TD4A 2APFA 4G80A 5EF2A 1QVOB 2F53E 2OP4H 3TT1L 4JHWH 4ES8A 4W9IC 1TUPA 4OAWB 3BUYA 3L5WB 4N28A 4I77L 3WLWC 4X6BB 1K4DA 2VUOA 4XN4A 3IGLA 1IAIH 1U3NA 3BDYL 3DIFB 5FKAB 4BH7B 1ZE3H 4XCEB 3SYAA 1BLNB 3EGXB 3GSNB 5FWRA 3GLAA 3BCFA 2DMHA 3MNZA 4K8RH 4FEIA 4WTZA 3MREA 3SDDA 2O6CA 3RDTB 3V8CA 2CNZA 2BNQE 1WPCA 2FHFA 3AG2B 4K7PH 4Y88A 5L4MA 4D94A 3CPLB 4ODUB 2X10A 2QKIC 4UTBA 2P5EB 5CZXD 3EFOB 1A6ZB 2XY2A 2RH0A 2X4TB 4M1CD 4RESB 3G04B 4BFFA 1NEUA 4CNIA 3QWNA 1FUNA 2W0PA 1JF1B 1RUKH 4Q9QL 3SO5A 3QH3A 3T2NL 4PGBB 3MUGA 3ESPA 4OKDA 3KNBA 1S9KC 3MRJB 4LSPL 1BJ8A 3TNNA 4NHCL 4JFDA 4JDEB 4P3WA 5I0WA 2XC8A 4M8RA 1EPFA 4OZGE 5DF0A 2B08A 4GW4B 5I16A 3MLVH 2AEQH 1UD8A 5ECGA 2EZ0C 4AH2A 1HINL 2BXZA 3GS4A 4XMTA 5EIVA 5J4MA 1OHZA 2P5EA 4F91B 1OE2A 2IF7A 3BAEH 2V17H 1G5AA 4X6FA 5D71L 3FK3A 2WBJA 5I8CA 5IFHL 2HMID 2VLRD 4U1GB 2GK2A 5JR1H 3EBGA 4PLKC 3NSFA 4V1DD 4X9IA 3DX8B 3ECUA 1KULA 2X2YA 1QBLL 2A1WH 3VXTB 2FX8H 2PF6A 3QI9B 1BVOA 3NK3A 5C1MB 1AI1H 2PP9A 4DUXA 3QXWA 3TJPA 2FEJA 2H1PL 2E75C 2NQCA 2V3EA 4GAYB 1WHPA 1KBGL 5IJVB 4J4PA 5MEOA 3LZFL 3VRIB 3G08B 3AW5A 2YQ2A 1JWSB 1QSEE 4HC1H 3TOPA 4ZMPA 2X1PA 2BFGA 3IDGA 1JPSL 1MFBL 2WXJA 2CHNA 1LMKA 4FLHA 4ORGB 1JL8A 1MCBA 4AXWB 1RZIB 1X4ZA 4HH8A 3X3GH 1A6WL 4FQPA 3VD0A 1K8IB 2NY4D 2XKUA 4XHJC 3CLEH 4MNHA 5J1SC 3BP5A 2Y06L 1I8IA 2AP2A 3MNMA 3NPZB 4MLIA 2IBBA 4QOKE 1MHPL 1HDMA 3VU2A 1UASA 3F6LA 1P5UC 3TT3H 4ZX5A 5DRNB 3U36A 2NY1D 3MZTA 4H25B 4U3XA 5I0XA 3D1MC 3LNDA 4GW5B 2H26B 2VITA 4FQCL 5IHZB 5TDOB 2AQ3A 1CXHA 1CD0A 1MLCB 4IKKA 4V1DB 1DJYA 1EV2E 4MX7A 1IGFL 2E27L 3ILDA 4EBQL 3FC8A 2HRLA 1K8IA 3BC9A 2VGLM 3JQOB 1QZ1A 3KPMA 4J2QA 4AW7A 4WY7H 4NNPH 3SPVB 3VB9A 2VC2H 2NY2B 2XRAH 3HHSB 3N1PC 1QEWB 1B4TA 1TT6A 1XIWD 4F7PA 1RVFH 4UTBL 5EIIA 1D5IH 2XVBA 4Z3HA 1KIQA 2QBWA 3VI3B 1LEGB 3MLSL 3G5XA 4XBPA 2IOMA 2AQ1A 4ZX6A 2R0KH 2J6EH 2Q3XA 3LXAA 5HYSA 1CI5A 1P2CB 4XE5B 3BX7C 2EE0A 3IT8D 2CGRH 2BK8A 4Z3FA 1J5IA 1G9ML 2DIBA 2DTMH 5SX4I 2BP8B 4E9XA 4RLDA 3VWJD 1RXLA 2X38A 4AGMA 1B90A 3DKHA 5JUEL 2J8OA 2R56L 1HOEA 1B9ZA 3D6GA 3P4NA 1FC2D 1CD9B 2FBJL 1H3GA 4HWNA 1N67A 5C86A 3FQWA 3EDEA 1EEZB 1HNFA 1N6QH 4I3GA 3L2LA 4NQDD 2OMTA 4WI2A 5ACZA 2J5WA 4XODA 1WFJA 4W9CC 5E0FA 2VYRE 4OQ1A 5F1KC 3MLRH 4LIQL 5AVZB 1G4RA 2FEEI 5C6WH 4AL8L 5IVXB 1KIPA 1RERA 5C0EA 2Y25A 4EOWH 4K73A 3SDDD 2QVIA 3BUTA 3QEGH 1QSVA 4XVSL 3RI5K 4GG6A 2IALB 2HT2D 3VWJB 1AIZA 2J1KA 3SYOA 3AFLA 3RVXC 3VUAA 3QNFA 4ICXA 4OT1H 2P48B 4M7KL 2RIKA 5HYFA 4F33A 2Z3FA 5LJYH 4ZAKB 3G5ZB 2R69L 3OZ9L 4N9GA 1ZEAH 4G80B 4M1CC 4MJ6A 2PYED 5M94B 5B1BB 4BUHA 3QJSB 3PGFH 2WZ6A 1ZTXE 5CGYD 1OXYA 1TCMA 1A6TB 5INCB 5BW7C 4N2FA 1A6UL 1PX8A 4FEMA 2CBMA 3VI3F 4HEME 1GYAA 4PCYA 4IM8A 5C0FB 3FOLB 3D52A 3CFEB 3L4ZA 1TMQA 3ZT7A 3ZUNC 5HJBA 5IGXL 4RAHA 3DPDA 1QLFB 1YEGL 1EO8H 2WBJD 5E08L 1PYWB 1ZSHA 3E80A 3QCUL 2IGFL 3C12A 2QPDB 4HUKB 3WL9B 3BOVA 2W9EL 3BP7B 2GT9B 2A9BA 4N68A 4JZJB 1SMOA 1KYAA 3S35H 2GJ6B 5IM7A 4Z3IA 2PWHA 2YAMA 4XN7A 4R8WL 4H88H 4KXCA 3KDMA 5LDUA 4NZFA 1PY9A 4YGVB 4JO4L 5K9QI 2I60H 4KVCH 4PGZA 1J8HD 2V5RA 1MFAH 5CFAA 1DL7H 3QIWA 4M5YH 3IJSA 5HYSG 4NLAA 4HZAA 1N0XL 4R7DA 3GSRB 3MCLH 1MCRA 4PB9H 5T1JA 2FO1A 4FCHA 1A3LH 5G4MA 3AM8A 3BZ5A 1UACH 1TLKA 1UGKA 1XFPA 3D0VB 4NFDA 2L7EA 1I8KA 4OH2A 2B1AL 4UV7H 4YC2C 5EA0H 5EIIG 4AOFA 5LDSA 3L08A 4UQ2B 3CSYA 2CLRA 2YGPA 4Q52A 2C3WA 5AB1A 4HK0A 4O4YL 5EPMB 2XV3A 4G83A 1I1YA 1XCWA 4UV4L 5FYKD 3WJMB 1XCTB 4MMZC 3HPLB 3RG1C 3TBCA 2AJYH 4YBQD 5CINH 2WD0A 2ZF9A 1KGUA 4OFQA 3AT9A 1UM6L 4H1LH 4OB5H 4I1PA 3EDDA 1UH4A 2NNXA 5C09E 5I19H 2IPUG 5J1AB 5DRWB 3AS2A 2B4CL 1QO3A 2WLIB 2XKNB 4N0FB 2MOVA 1QFWM 1RZ7H 3V9CA 3V55A 1MHHB 1OAQL 2PYFA 3DXAA 5EU7C 3BGFC 1BWMA 2YPKA 4OIAA 5CJOL 5EWIL 1L4IA 3IDMA 2FO8A 1X5YA 3C09B 1KBVA 3FCUB 2WOBA 5GGSY 5EPMA 1KZQA 3NA9L 1EAOA 1KXVC 5I6XC 2VN7A 4GEJA 3DX9B 2HYMA 3GINA 3BN9D 3L1OL 3GBDA 3W9DA 1W9XA 1EFXD 2NX5D 5ILTL 1BD2D 4LLDB 1NEZG 2DPKA 4ANXA 4KKCD 1QSFE 2LOEA 1DVSA 3CDFA 5I8KH 5TH2B 5IWLA 4OD3L 5J11B 2OSLA 5IT2H 5EC1A 3RFZC 4KROD 4A2FA 4JFDE 5EFIA 3AQXA 5IEHB 1YEJL 3RWGB 1MH5A 1OK0A 2DIAA 2VDRB 1FJ1B 1NGQH 3P4MB 4RIRB 3ZDXB 5CD5D 4YSQA 4POUB 1CJYA 4ABQA 5F0JB 1AANA 5JIQA 1ZLSL 2NCMA 2RD0A 3B83A 2XTJE 2FNBA 1ZDSA 2K6YA 2P5EE 2Y4SA 3LQZA 4X80H 1A1MB 4R97B 4CMMA 4M7JH 5J6HB 5I8EA 1ADQA 2ZUYA 3KBPA 3B9VA 1AMXA 4YSSA 4HUMB 3UTTB 2Q87A 2WC7A 4Y4HA 2DJ4A 3QXDA 4K9EC 3BRFA 1AGEB 1JFHA 3D0LA 1PFCA 2AMUA 1S4IA 5D7SL 1JBJA 1OPGH 5ETUB 2COVD 2FZ3B 4Y1AA 5FW6A 1BD2B 3NIDB 5I0YA 4LRIC 4B97A 2GSMB 1GZQA 1DZ0A 1WK0A 1QFUL 2IDQA 4WSJA 4KROB 3N06B 2PUQT 4QAMB 4QT5A 3F7PC 1IGIL 1L3WA 3QG7L 1F4XL 2Y7QB 2EH8L 4N0CC 1IAII 5J8OA 2JJSC 3LXBA 1X5FA 1NSNL 1OSEA 4L3CA 4I0CC 3NFNB 3FCGA 3QNXB 1DJWA 3ZKXB 1OT4A 4OZHB 5JXED 1JDDA 1JNJA 4QXTB 5DRZA 1SYSB 1EEZA 2PO6A 4Y19B 1MXDA 1ET5A 2V8LA 3RFZA 3O2WL 4YBLB 3NH7H 2SEBA 5A2IH 2DEWX 2RMNA 4GSDL 3O3AB 3RWFA 2JLPA 4I3SL 2ZAGA 4YEEA 2VLKE 1N6UA 2JQMA 2CUAA 3F7KA 4NT6A 4APQC 5I8OL 3S8FB 5GGSA 2EC9U 4H5SB 4G9FD 2QQLH 1BXUA 1A25A 3UAFA 1MJUL 1MCEA 4A1RA 1X9QA 4L3EB 3MCYA 3F3HA 5DJZA 4QYOB 3B7YA 1HYSD 3IBEA 2XG5B 3GFUA 5CIPA 4WI6A 5BOJA 2YAFA 8FABB 1A3ZA 1CTOA 1VRSA 5ID0B 1AGDB 1C8QA 1LJMA 2P4AB 3II1A 4JM2B 5DS8B 5FDWB 4FTVE 3VQ2C 1OAYH 3NZUA 4UIMB 1ND0A 1QQDA 4JRYA 1S5HA 2K3TA 3IEAA 3HPJA 4N8PA 4KZDL 4JHZA 1A9BA 4HJGA 5JHBA 5I1LA 3D0VA 2AJXH 2OMZA 1SUHA 1UZ8B 2OMYB 3JV5A 3L9BA 4X5XA 2VDNB 4XMXA 5TQ2H 3BP6A 4Z0XB 4YO0B 4HCFA 1FYTB 1K4CA 1AHWA 2FO4A 2VDQL 5HDQL 1DEEB 3S34L 2X4RB 4GAAA 4XP4H 4UBDC 2K9FB 5IF0B 2PO6C 4L1DA 4AQ8A 4KXBA 3T0EC 1XGPA 1EGJH 3FH7A 5K59E 4LCWB 4IDJH 1E9OB 1XDTT 1O6SA 3MNVA 2AFNA 5AOJA 5DLMH 1A4AA 5CHNA 2BDNL 4ZSOB 2B7DT 1JHKH 3PQYD 2ZXBA 2L8AA 4RA3A 1G4MA 2B16A 4Y2DD 5FKPB 5IBTH 4AGPA 1P1ZA 3V4VH 3VW3H 3QXUA 1SEQL 5A2LH 2GITB 2GY7B 4ZTPH 4U6YB 2QQNH 4HP5A 4C47A 2AF2A 1F4YL 2YUXA 4WGVB 2QPFA 5HVGB 1NUDA 1JGDA 4YSRA 1MWAA 3KH4A 2UZPA 2OI9C 4Z7VB 1W72L 1T1YB 3LRMA 3C8KB 4UANA 4C4BA 3IFOB 3WN5C 3NTCH 4P3CL 4YZWA 3HMXL 2ZCLH 5CZXC 1FYTD 5JHDA 3CSYB 4M7LH 2HUHA 4TXVB 5K1VA 3W9EB 1CE6B 1OAUL 3FQRB 2CKBA 1J1OH 3HC3L 2ZE0A 1OCOB 1M42A 2QV2A 4KNSA 4CU8A 2O6PA 3VG0L 1SVCP 3PWVB 3O2DH 4WFFE 1RIVH 2TSAA 3EJRA 4F8LA 3C8KA 2GJPA 3E8UL 4HJUA 3A24A 4G6AD 4YVUA 5EUOB 5AUMB 2PABA 1DJZA 1MWAB 4N2IA 3OKMA 2NZ9C 5JIMA 4PEEA 5JOEA 2FH6A 4OFIA 4DPRA 2OZNA 1S9WA 4IRJB 3TL5A 3MRCA 2P1YA 1HI6A 2HN7B 4N6RB 4WAFA 4UT9H 4OQTH 3KLQA 1JIBA 5G4OA 5D4IA 1JZEA 4ICWA 5T33L 2V33A 4JHAH 4D9LL 4BGLA 4UM9A 4IU2A 5EU3B 4NFBA 5C7ZA 4Y1AD 5I1KL 1SJHA 4OIIH 3CVBA 1Y1DA 1FFNB 3KNBB 5FA3B 2J5LC 3WIIH 5IJKC 2HSIA 3GPSA 2WCPA 1QTPA 1DJSA 2CSPA 4JRXA 3IMSA 4Z7QF 3MJ7B 1VFBA 3L4VA 3DO3A 3G6JE 4JN2B 1A4KB 3LIZH 2DH3A 3GYRA 3GJFA 1N10A 4DN3L 1T83C 1Z7JA 1FHGA 2ICWB 5JXEA 1ESOA 5HYSB 1AHMA 3O2DL 1U8QA 4L4TE 3C60C 4PJ7A 4JO3H 3GXNA 2A6DB 4P46B 2AK1L 1LDPH 3HZMA 4OI7A 3DIVA 4BA8A 3H42L 1RZKL 3Q6FB 3MO1A 5TE6L 4NQXA 1KXTB 2ZCLL 4D8OA 3TVMB 3GMOA 1U93B 5CEZL 1FZJB 1U95B 1HOCB 2IG2L 5J1TC 4U1IA 5JOFB 4PHXA 1OE3A 4QHKJ 3CQFA 3ULSB 3VJ6A 1BHGA 3ETBJ 1NFDB 3QWOB 3MRLA 3KWXA 2CLZB 4ZTPL 3VFTB 3PAVA 5HXMA 2X7LB 1AQKL 2ERJC 4LEOA 4YDIL 3E6FA 3GT6A 3MACH 3TJHC 5TGBA 1IQDB 1DBJL 3APCA 3VCLB 1E7UA 1GA2A 2ICEB 1W8EA 2WLZA 2PR9A 4MA7H 4P9MH 1A7NL 4TS6A 5HDOA 3SGKA 3V6ZB 2LU4A 2HT3D 2BWDA 5CN3A 4HS6B 5KYUA 3RIFK 4OZHA 1JF6A 1L3NA 1X5AA 4ZMNA 2RTTA 3FJTA 1O5PA 3C2SA 2NY6D 1KBWA 3SBWA 2WIMA 1PDKA 1A3QA 4HIJB 3D34A 4FA6A 3WTSA 4R6UA 4YDVB 4QNPE 3W3BA 4BXVA 3KYOB 5LCVL 2GIXA 2APTA 3VJ6B 4EIBA 3VX0A 2AGJL 2XN0A 3NZSA 4ELMB 2XWBA 1DQJA 5AVSB 1H3UA 5EN2B 4BYHA 3E2HC 4YHKL 1JWMA 3VRIA 5HHMB 2IDTA 5FCUL 2LR4A 3T6WA 2CG9X 4FHBD 4KI5F 2R1YA 4FE9A 3DYMA 2BCKA 4TM9A 5F6HI 1ZA3A 2A6KA 5DK0A 5SX4H 4MJ4A 1KCUL 1UWEL 1AGCA 3MMEA 4AQ8C 3CCHA 3HC2A 2VXQL 2AW2A 5IG7B 2VW4A 3KWWB 2OKMA 3IJEB 2XQBH 1YEHH 4CSPA 1RQ5A 3QHTC 3SJVD 1JMZA 2Y6TE 4BKSC 1V3MA 2O6FA 3NIFE 3F58H 5JPMB 3WIAA 1RIUH 2DRUA 4C57C 5FLUA 4OLZH 4G43B 2X88A 3PWUB 3H7LA 4E9TA 3AU1A 3HHMA 4LPCA 2YZ1A 2GTWB 1O0VA 4WU5A 4KI1A 3APMA 2Z6FA 2DM2A 3EG9A 4XPGH 1ACYH 2R2EA 1QNZL 4WHYH 2D0FA 2XX1A 1EMTL 5KUKA 2BY2A 2BNRB 1V05A 3IWUA 1QD0A 5AEAA 3OKKA 4UQ3A 4UU9B 4NKDA 1W6WA 3RTQA 4AGQA 5HHQB 4RZCA 2PPCA 1WV7T 4M00A 3LEXB 3TBSA 5KVEL 3TFKD 2PCFB 2Q8BL 2W0FB 3DV4B 3JT0A 1TTUA 4JW3A 1E28A 4FLQA 4H8VA 1X7QB 4DKEL 5KBNC 1BZ7B 5J5EA 2IDSA 3EGXA 1H15A 3GSNA 4WKZB 4XBGB 2DLEA 5JIHA 1BXVA 1WFIA 3IPBA 2I9LB 4F8PA 4KVNL 4BHUI 2CCWA 3K0YA 3GGWB 2I7SA 4W1TA 3HRZB 1N12A 2E7HA 3AS0A 3L4YA 4G6FB 4DP1X 1HVXA 1QSED 3Q48A 3WJMA 4UMGA 2HP4A 3VFMA 5HYQA 4L8BB 4WJG3 4L8DB 5ANMA 4YUEH 2YPVH 1PQZA 2XIIA 3DSFH 1NMBH 3FCTB 2H0JA 2F19H 1HSBB 2FEDD 3FNKA 5AVUB 3RVUD 3FT4A 1L9TA 2K7QA 3QEQD 5I73B 2VNCA 4OFYA 3SGJA 1NC4D 4LDLB 3H9SD 4JHBA 2EEDA 2Y5EA 1SHMA 4WUUE 4YH6A 4OCSH 3ALWA 4Z18A 1ZHKB 3MLPA 2BNQA 4XMWA 3QCVL 4Z78A 5HPMB 4JPWL 1KGIA 1DBMH 2MCG1 3QDJA 4X80L 1SDAB 4JM4H 1DQML 4Y16A 3F7YA 3QJHB 1B4JH 1KELH 3UTPE 3SE4C 4E9SA 2PPDA 2OL3B 3K8KA 2UVEA 3Q2NA 4JFWA 2MPAH 3HJ0A 4JKMA 5D7EA 3ISRA 3LKSB 4MX7B 2F8IA 1P4IH 1KIPB 2VWEC 3OGCA 5ESVB 1FL6B 4N0UE 2HN7A 1S2EA 2ZG1A 3KGUA 3L3DB 2D7PA 2DEYX 4G6FD 4QXUL 1BFOB 1W6LA 1NCGA 2GJJA 5FYJH 1T80A 5FEBA 3QEQE 3KZ8A 4Y16B 3CX2A 4N90E 3AXLA 4JPKH 1FO0A 4NO0B 4E5XG 1D9KB 2F0CA 4W9FC 5J6GB 4OKVB 1HJBC 2GBUA 3INUL 4N1CA 4NJ9L 4YR6A 1TQBB 4QRPD 1WLHA 4HUNB 3QPXH 1JF5A 2OL3A 1AG6A 3TZVC 4NNXB 1OEZW 3SKJL 1AACA 1IE4A 1QLRA 3MBEB 4JKKA 3RY6A 3AQYA 5IB3B 5DHEA 4G9FA 4LLVB 2W88A 1JD7A 2XVKA 2V5TA 1QRNB 3RA7L 1HHJB 4GRWE 4N20A 4GSRA 1WAAA 2DLIA 2EH7H 3RGVD 1TYJA 4LO9A 1IGML 4AI7A 1ETB1 4JKNA 2DYRB 4WFGE 2J3SA 4C4KT 2W38A 2GITA 4HUUB 4YHNB 4Z76B 4P57B 5F9OH 1EVTC 1SEBA 1TMCB 4F7TA 4HVBA 4H44C 4KUCD 5FYLL 3U4BH 4NO0D 3CHSA 3DGGB 2IOIA 4QHPA 2O30A 2X70A 5IUSA 1MCWW 4EI6B 1KB9J 4RMQA 3SY0B 4KNQA 5HHVH 3CVIL 3BPOB 1YEIL 5E4IA 4L37B 1FZOA 1HL9A 5ICXB 1URIA 1BDYA 1IM3B 3DOSA 3TIEA 3QO0A 2F8XC 5C0AD 2IMNA 1VGEH 3FUKA 4NM8H 5LGJA 1SMDA 1SF3A 5SX5H 4R8WH 5E23A 5AYTA 1ZOXA 4MA1B 1OSPH 3QFDB 5AYUL 4E9RA 1ITBB 2AJUH 2CWRA 3NBNA 1RMFL 2Z35B 5CBAA 4HEPG 3MLZH 3PQYA 4Y2DA 2IBZY 2OMWA 2P7TA 3IFPB 4Y9FA 3ZE2E 2QTVA 4GKSA 3GRWA 3SO3B 3DPBB 2WXHA 4G7YH 4R90L 4M3KB 1CVSC 1HIML 3LN4A 5IQ9B 3WTUA 5IVXF 2J4WL 4NM4L 4ZUTB 2C9AA 2J6EA 1T4KA 2R4SL 1DVUA 1ROCA 4PW9A 5E2JA 1CXIA 2VLRB 3L5IA 5GS3A 4PR5A 2GEQA 3LS5L 2UV3A 1QHPA 4IGBC 2AK4A 1HHKB 2YBRA 4WKXA 1I1AA 2WIIB 3TXAA 2Y7OA 1CLVA 5FM5M 1SDYA 1RUPH 4I88A 4LL1A 3X1NA 1TDQA 4YVNA 1IGYB 2HWZH 1U2CA 4HIPA 4ZUVA 2FJUB 1A14L 2VABB 4NNYB 4ZS6C 5HVHB 3M1BB 1I1AC 5E70A 1L9QA 5F21B 1EDYA 1G6RL 1X4XA 3HC0A 5IBLD 1DDTA 1DQMH 3QVAA 4JM4L 1OGAE 1FE8H 1MHCB 2BHFA 1J88A 1MCLA 2YEVB 2DQ6A 2QSTA 2WY3B 2KLRA 5EDSA 4Q97A 4NQCD 4WZ9A 4AJYV 1PS3A 4XTRC 5MERA 1YPZF 1CT8A 1LEKB 3DECA 3VGAC 4QRRD 1YNKH 3DVNB 1FZMB 1M53A 2Y36H 1J5DA 4YX2H 3WTVA 4IYKA 4CC1A 2AXHA 1E8YA 1HTYA 1B0RA 2IANE 1CG9B 3BQUB 4MMYB 5TK4A 1OOWA 4F7MB 5M95B 4H20L 4I1NB 5EO0A 1CIUA 4I2XB 2FJGA 5AENA 3FTWA 5INCA 2ZX8A 4FN0A 4M7ZB 5ID1A 4IBUA 4KJYA 2ZWLT 4IHOA 3RVUC 1U8KB 4HCGA 4N2EA 4MS8D 1JZGA 1ITCA 3NZ8B 3W11D 3DX0A 1QFWL 3LEYL 1NAKH 4KKCC 4L4JA 4BUQA 1UWYA 2AVGA 3VNZA 4L2LA 2C7UA 1YYML 1WTLA 3DX2A 4GAFB 4M5ZH 3JWNC 3VFMB 4M5TA 3L45A 1KIUB 4BFJA 1DTUA 5FV2A 3KHOA 4ZS7H 3VFSB 3TFKC 3C9NB 3DDFA 3N44F 5ID0A 1HHHB 2G3XA 2AXGA 2DEXX 3E9TA 3Q2CA 1P4BH 5AZUA 1HEJC 1PCXA 4Y1AE 4LDCA 1RMFH 5A1AA 5E6ID 1NDMA 2HJKA 5CR8A 4K5PA 5ISZB 5C2BL 3MRMA 1AIFA 2NY7H 3OKOA 1E4JA 4XBMA 2Y72A 1RZJL 5AKSA 4K9EL 2CKNA 3IF1B 4IBVA 2APSA 4PMFA 4O2FA 2UX7A 2J21A 4Z7UB 3RWFB 4AUYA 2VAAB 2G75B 1LGVA 4L1LA 1FG2A 4XMUA 4XZUA 3UJJH 5T3XL 2HH0L 4IMLA 2IPUK 3DTXA 4XOBA 1I9JH 3E38A 3BMVA 1SJEA 3MNWA 4IW4C 1U8LA 1A4BA 2KH2B 2Q7YA 3LD8C 3VNYA 3O6ML 4OM1H 5G55A 2QQKL 1WT5A 3HZKB 4MHHI 3EO0A 4LKXA 3FU7A 5DJCB 5HGDA 1MPAL 4P23C 2PYFB 3DXAB 1OQOA 2EO9A 5DS1A 3PHQB 1Z9MA 2Y06H 3DYOA 4AGNA 2CE6A 4KXZH 4YK4C 3QRFM 2OMUA 5EZOL 2CPUA 1F41A 3NIGF 4LLWA 1FGNH 2I25N 3RKPA 2BY0A 1MEXH 3V52H 5GRVK 5BQDA 1DE4A 2PNDA 4PRPA 1OAZL 4BE6A 3P9WB 2YAQA 5KVDL 3WNNA 4MAZA 4BFEA 1T1YA 4F2MA 1BF2A 3LHPH 3S88L 3RILA 1SJMA 3QDHA 3WE6A 1XH1A 3BAWA 1Z9LA 2VDMH 3VXSA 4B9PA 2YD4A 4PJEB 3B9KD 4P5TB 5EOTB 4YFLI 1IGTB 3QZPA 3QIWB 2B4CC 1D5RA 3MGTB 5HGGS 3SDDC 3W0WE 1NJ9A 4J3UA 2Q86A 4WV1B 1GL4B 2N7AA 1HNGA 1OAKL 3TEYA 1GGBH 2I9TB 2FEDC 4RFOH 2CR6A 1RZKH 3PNRB 4JRLA 3BW9A 3OSKA 5EF0A 2R27A 3EFFA 3SKMA 3STLA 3HUJB 2KZKA 3QZBA 2V5SA 3IFNH 3CHPA 4OLVH 3CZLA 4A63A 1IFRA 1NGZA 1EDHA 2ZCKH 3HBPA 3NSDA 4IGBA 3DX6A 3TCLA 2XZCH 4PS7A 2XCMC 5I5IA 3ARRA 1A1NA 1DLFH 4P3DA 1FFOB 3MDJA 3GIZL 4PQXA 4IKJA 4PB0H 4RWHA 4APQA 2DLGA 3P3RA 1JERA 3B7UX 3V6FB 4AIOA 5FB8A 4ZUWB 1MJ7H 3S96A 4C83A 3OLDA 3R0MA 4GI6A 5D93C 1RFDH 3D51A 2NOYA 4NEHB 2P26A 4QRFA 3BESR 1KYOJ 4U6TA 3D9AL 2LQRA 3CFBB 1A4JB 2M83A 2DYSB 3O4LA 5C0GA 3VH8B 5E9DE 4ECNA 4PLJD 3O0RH 3O6KH 4YDKH 1JYNA 2DI7A 3LKNB 4G9FE 5CUSL 4Z3GA 3KYMA 5ICUA 2WTPA 2MPVA 4M8UA 4OZ4B 2ADYA 3Q5OA 4HV8A 3CBRA 4NZ8A 1A3RH 4BHUA 1F4WH 4DK6A 2WLLA 2PXYB 4NO2B 4X98A 1SBSH 2AJVL 1G6RA 4ONGL 1TG8A 4LGRB 3ZE1F 3D2UB 4DKEH 5C0RH 1IMHC 1P5UB 2ZOOA 1SM3H 1J18A 1TNMA 4OCRL 3HC4H 3TCXA 2ODIA 2XPGA 1MAJA 4X6CB 1QA9B 4W9JC 1NL0L 1E8WA 3PDOB 3IKKA 2C4FT 4G8GA 5D1XB 3IS0X 1NFIB 4DKFH 1D6EA 4L05A 3NJFA 1MCCA 3MLUL 3T0EE 4YWGL 3JWNH 3SDCD 5B3JE 4DW2H 3MJ9L 1YY8A 1EEQA 2PW2A 4S11A 4PJEF 3VFNA 2CDFA 4O58L 1UT1A 4NKDB 1OT1A 3V5KA 1I8MB 3N43F 5KW9L 2J7LA 1JPTH 2O5YL 5FM5O 3LZOA 5ESQA 5JMRA 3ABLB 5KBMA 4FQLH 2HJKB 1CGSH 4FXGA 2HVJB 5DMIH 5FWQA 5ISZA 5KTEH 1S5HB 4P3CH 4XCNA 2FL5B 3FUEA 2PXYD 5CSZB 5E7FA 2E9IA 2BIPA 1SOKA 4LXFA 4ZMAT 12E8H 4EDWH 4ZFZB 1WAEA 3II2A 5T5FH 1KIRB 5DD5L 5AG9A 2YD1A 2Z7YA 3KBEA 5L0QB 4Y5XC 4HKJB 3X1FA 1KYDA 4PG9A 5IBTL 2O5XH 2YK1L 4FL4C 3VQLA 3JWDL 4WUKL 1UXWA 3CVHA 1UVQB 4H1LB 3UGEA 4JAMA 4D0CB 4YXHH 3GRGA 3ASWA 4L8CA 4Q0XH 4D8PA 4JRYE 1EAJA 2D7TL 4YSDA 2AQQA 2WN2A 1ZVYA 3KLDA 4L8SB 2N01B 5GZOA 2ZXEB 2NW2A 4Z7OF 2DQDL 3B37A 1AP2A 1BZ9A 2WJ5A 2YEZB 5DQJA 2K1MA 2OJZL 4I4WB 1AQ8A 3L3OB 1TJHL 1ETZA 1AGFA 1W16A 4M8VA 4JM2F 2X3CA 4X7SH 3U0TA 1UXSA 3KWVA 3MXWH 3VTTA 1WICA 1JRHI 2UY7B 2VZ3A 1CYXA 3JTTA 4W4NA 1FDLH 1NGWA 4PWJA 2ARJQ 1EJ6A 4LCWA 3KCPB 1R5IA 5D70H 2XBTA 3MUZ1 4JQVC 1S7UB 3HLAA 3QUZA 4LVNC 5JYMA 1N3NB 4UTAH 4FZEH 3ESOA 4PIRF 3DTXB 3ILPB 4JFHD 3VXSD 1DVTA 2Q7NA 4LVOC 5IB1A 3VWJC 5KSAB 1FG2B 1ZV5A 3CLWA 4N2GA 3QXTA 4OZHE 4Y5VC 4KK5C 1FO0L 1AXSB 3R7RA 3RB5A 2J56A 1F56A 2E7MA 3NQKA 1T1ZA 3BEVB 3QDMA 4JFOB 2P46B 3N43B 4YSTA 3KYNA 2WYIA 3EHBB 2WVVA 4YHZH 1F90H 1IBBA 5H94A 4WEBL 7FABH 5FYKU 2XICA 3NCYP 4PVNA 4QI3A 1FIGH 1ZWIB 3IRZA 1MF2L 5JPMA 1CBVL 1BVLB 4M6NH 2EIJB 5F93C 3DGDA 4PGEB 4WU7B 4GXUM 4L8DA 4OAWA 5ANMB 2DQHH 3FN0L 2AV1B 1NCJA 1ZXQA 4RZKA 1J8HE 1WZLA 3T8XB 3I2CH 4LSTH 1UA3A 2W9DH 1M2OA 3NRQA 3PGCB 5CEXA 3ARBC 3SPCA 2JH2A 3MNVB 5GSRB 1NSNH 1DVXA 5F1NB 5I74C 3AXHA 2QGEA 4L9LB 2YPLD 5B7FA 1D5MA 5I0DA 4GMSH 1YY9C 1J8KA 2XLLA 1UG9A 3LEXA 1GW0A 1XGUB 3W56A 3OHXA 5CO1A 4BQBA 3VXQB 2JVUA 1R34A 1JF1A 3FKUS 5EU3A 4LRNL 1ZHBA 2FSDA 3EHBD 4OI9A 5BZWB 4BBWA 4UM9B 5BQ7B 2Z8VC 1BQLH 2X6CA 5F1NA 4B41A 4ZMWA 3STLB 4NO5A 3IYLW 4DT2A 2NR6C 3HG3A 2X6AA 2WNXA 2CXGA 15C8L 4AEIH 5DRNA 3U36B 2UY6B 2AMGA 2JXMA 3U2SA 5HGAB 3KL3A 1NFKA 1VEMA 2NXZB 2YA1A 1MVUB 4JANA 4JRXE 5FS5A 1V10A 4FTDA 4PY7A 4WNSA 4KTYA 2KHAA 5CJ8A 5I5JA 2VDOL 4CU6A 2A6KB 2FJSA 4ODHL 4XBEL 3RL1A 3TV3H 5JOFA 1PFOA 1T0NA 3SBQA 2H7WA 4IJ3B 4ZO8A 2CNYA 2FLBT 3SQOL 2WLHA 4GP4B 3EJZC 1YNLL 3O6LH 1VPOL 5I6MA 4K15A 4NNXA 5E1AB 5JO5B 4HXAL 4Q9BA 1MJ8L 4AEFA 4OJAA 5C07D 1SN0A 1M7DB 5HTSA 2AKRA 3QNYB 1TTRA 4Z5RB 4E9WA 1ZSDB 4O02H 4JR9H 1XAKA 4HSCX 2BOLA 4TVPE 4U4BA 3TBWA 1H3TA 1MCPL 3X3FH 1BX2B 4HIXL 3QJXA 1GOHA 1FL6A 1DBBH 4HIQA 4IOSD 2EEFA 2VXUH 4M48L 5T1LA 2EDEA 1ZLVH 2PTUA 1IE5A 1BXXA 1PJWA 4EZMA 3BJ91 5TGBB 3VCLA 5FF6A 4MSWA 3ZSSA 1NCHA 2AAVA 1KFGA 3UC2A 2JF1A 1DUYB 1TZOA 2DZEA 3HE7A 1HCVA 3LV3A 4P2OA 2EKSB 4LNRB 4OZIB 5BJTB 3K6DA 1ZT4B 2ZYSA 5EZOH 2DMBA 3GUTB 3T0XA 5CEZE 4DP7X 1NBYB 2H5UA 3HAEH 2K70A 4J3SA 4N0UA 4RCAA 1JZFA 1F6FB 1IBFA 3RJDA 5E8EB 5H4YA 1UM6H 4OB5L 2FUQA 4DF9A 5JXAH 2ATPA 3BIBX 5KOVC 2BFVH 3QORA 4R5XA 5E8NA 3R4DA 5E00A 5L4JA 4Y1AB 5F70A 1A2YB 1CO1A 3IXTB 3DLQR 3ML9A 5F7MC 2BZ7A 3CX5K 5FF6B 2ZKHL 3W2DH 4F15B 1RULL 3CVHL 2FNWA 4X7EC 2YFNA 2EDWA 4XNUH 1MAMH 3Q1SL 5CP3A 1DQTA 4LCUB 1D7DA 1NCOA 3CZGA 2WO3B 5LLIC 1VFAB 3QUZD 3BZ4A 4M6OH 1IAMA 3JZYA 1CLYL 2OCJA 4UOW0 3AMKA 3RWIA 3TESA 2MNWA 2WSKA 3SKNA 3C9NA 1WAAE 5KG9B 1S7TA 2VISA 5F6HJ 4UWQB 3RI5F 3EXJA 1BOGA 4QWWC 3HFMH 2YAHA 2BS8A 2MEJB 4LCUA 2HX9A 1E6OL 1FFRA 2L7UA 2VSMB 3PE9A 2PKDA 3CZEA 4Q74A 4X5PA 1N7MH 4UQBA 3NUKA 4O5LH 1VFMA 2HMIC 3S36H 2LFGA 1JGEA 1WCBA 2N3JA 3U7YH 1I9RH 1I8LA 3ARED 3WKNA 1S8DA 3DRTB 2Y1YA 3HN5A 5KZCD 2FATH 2V7NB 3QZMA 1URZA 2VT0A 1LO5B 3K4AA 3GHEH 3NIFF 4UI2A 1ZK9A 1BQUA 4LT7A 1Y0LB 2RAMA 3WTXA 5E8DL 5AZ2H 1JYWA 1NC2B 3RBSA 3JTTB 3G6DH 5CWSB 3ZO0A 1G94A 3ATDA 3JV4A 2XBDA 1GGIL 4DQOH 3SYPA 1Z2KA 4XP9H 4G7RB 4JRYD 4NZTL 1RHHB 3NJNA 5IWLC 3BXNA 3N42F 3QAQA 1E6JL 2I26N 3OKDA 3QUMA 5DXWA 1TSHA 3G5VA 5F9WC 2AEIT 4TNFA 4K5MA 5C0CE 2LAAA 1TZAA 1DEEA 4NC1E 4EO5A 3CVHH 1Q0YL 5JHDB 5BS0D 5BV7B 2Y7LA 4JG0H 3STBA 2FWOA 3OPZH 2Z8RA 3L8QA 3FB7A 3NGBC 1EAPB 1IEAA 2D3JA 2WUCH 3QI9A 4DN4H 3V10A 4GQ9L 4UT7L 2YKLL 5D7JD 1LO0L 4I9XA 3BE1L 3BXNB 5CU5A 4OFYD 1CTMA 3KPSD 1LQSR 4BKLA 4JO2L 1SGKA 4TOYL 5E24E 5CSZA 2D0GA 5SX5K 2EYRA 5F1SA 4PJIE 3UC0H 3QDJE 3GNML 1P4LB 1QAWA 1R24B 3ZR5A 2Q9OA 2NY1B 4HA1A 4N5ED 4TPRH 3P11H 1LE5A 2ZUQB 1I7RB 4JUSA 4N8CH 3BZDA 4TVUA 5I6NA 5LBGA 3LEVL 1BZ7A 2NY5C 3CH1B 3OR7B 3A21A 4HX1B 1XCXA 1T1XB 1CDCA 5DO8A 2R4SH 2Y0SA 3HMXA 5LGKA 2G0KA 1YAIA 4N22A 4AMWA 5KSVA 3PL6C 3U4AA 1E4WH 2XXFA 4ODXA 5IW3A 1E5YA 2ROXA 1HCYA 1UJ3B 1FNAA 5CXPA 4ELMF 1JGUL 1OY3B 1CDJA 2E6JA 3OHXB 1WFNA 3N41F 4X9BA 2NY4C 5DT1H 1RUML 3K74B 3ARUA 2OPCA 3KL0A 2O1AA 4DGVL 4GEIA 4XZUB 3I6KB 5FUCC 2FQFA 4Y5YB 5L7XH 4ZOAA 1YQVL 2QGBA 1KELL 2F74B 1C1EL 5B3SB 1OARL 3MJWA 5A6MA 5IHHA 2F18A 3ZRCC 3QRLA 4P2OD 3VD5A 4A67A 1L9NA 4GRWB 4UM8B 3CVDA 2X70B 2V6HA 4ZO7A 4L0YA 2BVUA 5DZLA 4FQ2H 5JHLL 1XR9B 2X40A 4L23A 1HSAB 1UWFA 3V4VB 1B2WH 1LILA 1ZV9A 3G5XB 4XBPB 4G9DB 4AEIL 2C4FU 5FYKL 5EA0L 4R4FH 4JFEA 3FT2B 3DUSB 4HMCA 5B22A 3TA4D 1I7ZA 4GMSL 4GAGL 4CSTA 4EUPG 2W91A 1AO7E 1SJHB 4JJ5A 4TUJB 3IMBA 2O5NA 3QEQB 1GMEA 2R59A 5ELIA 4ETQB 2WBXA 3RVXD 4K7PY 1VF5C 1ED3A 4MKTA 3ZGIA 1UATA 1PZ2A 1AKPA 4FNTA 2OJ1A 4YR6B 1KGCE 1ODAA 2WVSA 2LTQC 4KDTA 4HULB 2A9AA 2VERA 5JHLA 3NCCB 5I1AB 4Z7WF 4UMSA 2FVNA 3HCVB 4YSEA 3ZTNL 4M6NL 1KCSH 4NFCA 3GB7A 3SKJH 2AC0A 1PLAA 4XN5A 4AQEB 4H1LG 3VA6A 2DQHL 1WP6A 3FN0H 1L7TH 3LV3B 5IGXH 3MOAL 4WUUB 4XPTL 1I3RB 2Z91B 4N6QA 4RAUA 1KG0A 3MRNB 1TPXB 2JKLA 4NGHH 1P53A 1EZUA 5BVJB 4A7QA 1D9KD 2E4TA 4ZZFA 5IFHH 3WTYA 4M8QB 5CSGA 1WZKA 5F7UA 1T89A 1U93A 2B9AA 3E1ZA 4FP8H 1T5WA 4EI5C 3ZDWA 3L6FB 2BSBA 1CE1L 3M45A 5I8EB 1WD9A 3EFDH 2AJSH 1X6LA 2R7EA 3RHWF 4DFIA 4AKPA 2XN1A 4I9WD 3TU6A 5C7XL 2W1NA 3FHQA 4AYEC 1S7VA 2D73A 4Y4HB 1HKFA 3ZDYF 5LWYH 3RP1A 3RHWK 2DI9A 3B8YA 2NNFA 1X5GA 2FTAA 4BELD 5BO0D 2JXMB 3VWKA 1WF5A 3U2SB 2WP3O 3C5JB 2VIRA 4MMYA 4F7MA 3L3JA 1WBZA 3DHMA 4HKZA 1N59B 4TSCL 4FQHB 2PLTA 1IT9L 2GYSA 2W60B 2VDLB 4J3OH 4YAQB 4DWHA 1HJCA 3FFCB 2F19L 3BW9B 5DC9B 1YDPB 2W92A 1E27A 1GTFA 5IV2B 5IQNA 4G2AA 4YDZA 2EIMB 2Z0UA 4UZSA 9PCYA 2FX7H 4YE0A 2DLTA 2OXHA 4OUUA 1FVDB 1MJJB 2EXWC 4UTAA 4XN8A 4DOHB 5LXGH 1SY6A 4GO9A 4ZBJA 5SWQB 3NQIA 4TQEH 4WUKH 1MCPH 3P54A 3X3FL 2IANA 4KVNH 3IVKB 2EIKB 3CLFL 1AMYA 4CRPA 4DUVA 4ADIA 2PW1B 1K72A 4QHMB 1E7VA 4YGVA 3EF7A 3A0OA 4JFXB 2FK9A 1DQDL 4FYTA 5I1EH 2LVEA 3SBWC 3ZQXA 2Z9TA 4ONOA 1II4E 4L3FA 2WXLA 2ZP9A 5T5FL 2HPTA 5HDWA 1IZJA 1VPOH 4HJIA 1CYGA 2E5EA 3BWUF 3FSOA 3VXUE 2OYLA 4OJFL 3I6LD 3G5YB 3Q6GL 4G43A 4W9HC 3QS3A 2J6EL 2W80C 3MRGA 2VZUA 3BRGC 5DJZB 1MCOL 1Z0NA 3E7JA 3HHRB 3UBXI 4WGWB 5JPMC 3C5SB 4KVPA 4FFYL 1CGSL 4GMTH 1JZIA 3ARSA 4Z7VE 4LVHC 3CGTA 4HLZH 4PSRA 4DW2L 3GS0A 4JRFA 4KAQH 3EYFA 3FTVA 5A6IA 2E7CA 4JAMB 5F72S 4UNUA 3HI1B 2QFRA 1G7MB 5CJQH 2YSSA 2Z7UA 4LEXL 4KMLB 2BJMH 4ZUUB 2FRGP 5JQ6L 2QDWA 4QOKA 1UOWA 3R8QA 1MVFA 2D7NA 1M6OA 2X41A 2B14A 4C4KO 2XZAH 4Z7UA 2VLMD 2YHGA 3EF4A 3EYOA 4FQIL 3GSWB 3TWYA 4P5KA 5DEJA 5ESVA 3VGHA 2QTEA 4FG4A 2GSIB 5FGBC 3Q9QA 5KSBA 1KFAL 4O51B 4XCNB 3ZL1A 3U30C 4JLRB 1E9OA 2MJWA 4M61B 3RTQC 3WFCH 2DF3A 3I02B 5IJKA 4IEFA 3AREC 4ZDHB 3F64A 2XXGA 1LTXA 5EUOA 5AUMA 3UDWC 3UJIL 4JY4A 5LXGL 1FBIH 4XMKL 3CZNA 1UCBL 4MCYB 4X0KA 3CQQA 1OPOA 4J3BA 5F9AC 3LKRA 4I18C 4P8QA 2QHLA 4FGMA 5GGRY 5CR1A 3F7YB 3QJHA 4M1DH 3KLHC 1OAXH 1JCVA 2ARWA 4ODSH 4L4VB 2CIIB 1KYOK 1Q94B 5I0VA 1BIIA 5KEZA 2VR8A 4FHKA 4MZRA 3WKMH 1IILE 3MNZB 4N4YB 3ETBF 3OX8A 4F58L 3D2UA 3MV8B 2Y24A 2QDVA 4G9DA 4X0KB 5FUZH 1VACA 5AZEH 3DIFA 3EO9L 2BM3A 2HA1A 3WXWL 4PRDA 3KYKL 4GG6F 1BZQK 4MNQB 2YA0A 1QRNE 5FCSH 1D9KA 3UYRH 2Y07L 2VDLL 3IPEA 3QHZH 5AZEL 2X0WA 1KTKE 1W8OA 3P9MB 4NAMA 1BQHG 4BSWA 4IBYA 4LGSB 1F4YH 5AAWC 1HYSC 4RBPK 3VDAA 4MAYC 4MXWH 2B0SL 2JCWA 1I4FA 3KH3A 5DWPA 5LGHL 3KW8A 2UYLB 3WS6A 3US9A 2WM0A 1Q90A 2HRHA 3RWCB 2J57A 1QBBA 4FFVC 4HPHA 2BDNH 1G5GA 5IQ7L 5KS9A 1MLBB 2HAZA 1D5MB 1UZGA 2H45A 3VXPA 1C7TA 2B77A 4ZYKA 4XWGL 4YQXL 3T0AA 5LAPA 2WK2A 2J8UA 3K5SA 1OIOA 3DMMA 5DO2C 1HXMB 1OGTB 3T2OA 4JFYB 1X44A 3TASA 5CD3A 2B1OA 4L1HA 3PABB 5CGYC 2E8ZA 4N2NA 2AJZB 4YAQA 1TJXA 2L7JA 2R51A 3LZNA 1Z9PA 4Z76A 4XVUD 1NIEA 3UJIH 3FCTA 5E6IC 4IRZL 1Q0XH 5EZJA 2W8CA 3B34A 4K3EH 3UZVB 3WMPA 3WY1A 1OP9A 1ZLWH 2P9RA 1G7IB 1T4KB 2Y1ZA 3O4LE 2OP4L 2CHDA 2EDLA 5F7KC 3FAWA 5DR5H 3LZLA 3CHQA 4PP2B 5CU9A 5EIIB 1QI4A 2QQKH 4XO8A 1HEZB 1T5WB 2DMKA 4L9DA 3UYPA 1HE7A 5EEUA 2ZG3A 2AJZA 2WJ7A 4TV3A 4WENB 1E2WA 1TENA 1U30A 1ZDQA 4QDGA 1CBJA 5D7JA 5EFIB 3Q8BA 3G6AB 1H3PH 3W1ZA 3LQZB 1ZS2A 1ANUA 3B2XA 2XNAA 5IW6A 2OBGA 4FG2A 5AVQB 1E4XH 4FI7A 2X09A 5E4OA 5KSUA 4P5TD 4AK2A 4CVUA 2ENPA 4H25A 1CGVA 2J71A 4GKSB 3Q6GH 5B7EA 3RVTC 3ZE1B 2BRRL 3Q06A 4M93C 1JTOA 3THML 3IDJA 4JFZH 5IV2A 1W72H 1S78C 4NC0B 4DGVH 3WEOA 2ZXWB 5DVLA 1OCCB 4X6CF 1F00I 1OK8A 2BP5M 3ULAB 5JIPA 3UG3A 5I1EL 1CFTB 1O6TA 3UAJC 3N1GC 3V0VA 3SEPA 5JW3L 3KVQA 4HISA 3PRZA 3LVEA 1YMHB 3UXFA 2F68X 2J72A 1UJTA 4KQ0A 2RFXB 1AP2B 1BZ9B 2JQAA 2YLKA 4AKOA 4OI8A 5K39A 1JVLA 3CHOA 4P2RD 2WBJC 3EGDA 3MJGX 4OGYH 4G42B 3TFBA 4TQEL 1TU2B 2ZX7A 3ARZA 4PG9B 5EC2B 5K69A 4D9RD 4J5VA 1N6VA 1IM9B 1QSFD 4PGJA 2Z31A 4PJFA 4QHNB 5E6UB 3ULVC 3MFFB 5KAQF 4PB0L 4Q7DA 2GUOB 3FQ2A 2G9HA 4EN2A 3OBAA 1JGVL 2D7QA 1FNEA 5MENA 4CGTA 4FYRA 1KCLA 1XCQB 2OX5B 4FQ1L 5ESQB 3D09A 3V9EA 1FH2A 2DAVA 1M7IA 3VFVB 2QVKA 5I6PA 1M1XA 2NTFA 3ECQA 4HSAC 2JK5B 2DYPD 4LFHG 3UTTD 3CSTA 3H85A 1MHEA 5F7BA 4L5FL 4LP5A 5F0LB 4WWPA 3EYOB 2WLJA 4MTMA 3D30A 4HCRH 1JPFA 4M7ZC 2V9UA 5DMGC 3X12A 4BIKA 5EU5A 2YQBA 4FP8L 1AC0A 4HWUA 1ZHKA 1T04A 1AC6A 2VXTH 2NDGA 3G3LA 1YZZA 2K9UA 5ILTH 4RISH 5D7IF 3SJVE 2JB6A 3UTSB 3IE9A 4BWWA 1H6EA 3OMAB 4QGYA 3BD3A 3TTSA 5KVFL 5E2TL 3GKWL 4S2SA 2GTZA 1A6VL 2HCZX 1T0MB 4N2CA 3G9VA 5EWIH 4MQXC 1RCYA 3O2DA 3V0EA 1U4EA 5DJ6A 2WN3A 2L04A 3IK2A 4PJFF 4M4RA 4ZQKB 1ZWIA 5DJ0B 5IZ7A 4NP4H 35C8H 1AS6A 3EYQC 4TULL 4TL4A 1UADC 1BJ1H 1F86A 3CBJB 3I74A 2ITCA 3WENA 3CE1A 4PW3A 4WQOA 5GS0H 1IAOA 2ZOTA 5I17A 1XF2B 3HZYB 5J57B 1R0AL 4NCDA 4LLQA 2EVJA 1UOLA 1ZJAA 2AI0L 4J4PD 2FIKA 1E4KA 1NINA 4JGMA 5CP7A 5IVZA 4G9FB 1YVLA 4LLVA 3OPUA 4NDMA 4Y8AA 5L2KE 2OW7A 3OQ3B 4MCNA 5HHVL 4PJCF 3GO1L 4PCKA 3QA3A 4Z95H 3COOA 1HAUA 4XNAA 5CAYB 1DZBA 2BH0A 1U8NA 2WWNA 3IS1X 1FHNA 4BZ2L 1TSRA 3B4NA 3ZE0F 3BKMH 4JANB 4DSYA 1SHSA 1H8NA 3MRIA 3QUYA 3BDXA 5KVFH 2VDPH 4ZXBA 1AXTH 4X7DC 2DJSA 3Q8EA 1F6AA 4M7JL 3ES6A 4S1SH 5F0MB 4TTDC 5F71A 2ZAHA 3S5ZA 5KAQG 3EYVB 4KK8D 3NFSH 3TNMB 2FIRT 4AYID 3ME0A 4R96B 1AR2A 3KL5A 3WNJA 4F80A 5IB5A 2H6PB 2VDOB 3SE8H 3RGBA 2IAND 1V55B 3VXSB 2X44D 4K3JL 4GW1B 2MTAA 2W81C 2DBLH 2FHBA 5MEOB 1FZOB 1AXIB 3QYMA 5IQMA 4JFUA 5TQ0H 4E0RB 3TYGL 1PAMA 3F8UB 5ES4B 1BPLB 1EFQA 3MA7B 1HL8A 2ESVA 5TDPA 3MV9A 5D7IB 2MQ0A 4F9LA 4M03A 2AAAA 3BT2H 2VDNH 3A6BH 3HW7A 3FQ4A 3ZHKA 3K6SA 3BRDA 1G7IA 2OJEB 3O6FA 3AJ7A 4C54A 1F97A 4C55A 3B56A 3EBHA 3VFRA 1ZHLA 2Z64C 3QG6B 4N0FA 2ZXQA 2OMWB 2P7TB 2JQZA 2R69H 3IFPA 3K5RA 4U1KA 5F7FA 5ACLA 3WV0A 3AAZA 5H35B 2FWSA 4FG6D 3APDA 4B0MB 5B3JF 2ZJSL 3MV9B 5D7IA 2YPLE 4P2RA 3WOVA 1LO0H 5JLZB 4Y2DC 3GC3A 5E4EB 5DZAA 2BERA 4C8XA 1RZQA 1F42A 4E9VA 4JDTH 2LT9A 4L0PB 4EXKA 1ZVSA 1NMCB 3VGBA 4WFED 1ET8A 3RY4A 2O93L 3V4LA 1PEZA 4WO4A 1MI5B 3NFPB 2HFGH 3ZE1E 3FTGA 2YXFA 3BMWA 3D25A 2WOYA 5IW1B 1HNYA 2OTWA 3L4TA 3FRPB 3KEHA 4NOFA 5EOCL 3TO2B 5AOLA 4F1ZA 3OKKB 3H7BA 1KPRB 4GNKB 2LLGA 4U31A 4PN6A 3H9SA 3WIHA 3L2NA 3DC0A 1N2RB 4GSXA 4UM9D 2VWEE 3VFVA 1IJNA 2MSPA 4HHAA 4LDOB 4Q2ZA 3CZUB 1MFAL 2VM4A 3D48R 3ELQA 1JPST 4RMUA 1VHPA 4OSUH 4YFDB 1L6XA 5HDBE 4KITB 1JAEA 3SCMD 1O5DT 4RRPA 3KEDA 4JMNA 2ID5A 2X4QA 1SXSA 2A74C 3TBWB 1B3IA 5DHXB 2FD6H 4TULH 3ASOB 3EJQA 2H2PD 4JN2A 1FWXA 2A5UA 2AITA 4M5SA 4GI9A 5CZVL 4WO0A 2FATL 1XF5B 1GZPA 3VI4F 4IHOB 4HIIA 2MQGA 3N1MC 3NJLA 5DR5L 3MLSH 4EVNB 1MNUL 4AEHL 3REWB 3DVGA