2CM5A

Crystal structure of the c2b domain of rabphilin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
144
Chain Sequence
MALYEEEIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C2A-C2B Linker Defines the High Affinity Ca2+ Binding Mode of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords RABPHILIN-3A
total genus 38
structure length 144
sequence length 154
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2cm5A00
4QAMB 4F91B 5KJ7E 4WAFA 2R83A 4FULA 5G2NA 4ANUA 3NZSA 2WXHA 4L2YA 3TWYA 3NSJA 4PS7A 2NSQA 4J6IA 2CJTA 2WXRA 4NS0A 2ENJA 2NQ3A 1E8ZA 4KZCA 2BWQA 2K4AA 1UOVA 2V4LA 4PS3A 1DJGA 1DJWA 4PS8A 2QZQA 3F01A 3JZYA 2FK9A 5CCHE 2CHDA 3HIZA 1E90A 5H4YA 1BCIA 3F05A 3N5AA 4XX5A 2K3HA 1DQVA 2WXGA 4ANXA 1DJYA 1DJHA 3HN8A 3KWUA 1W15A 4JPSA 3QR1A 2CHWA 1UOWA 2Y3AA 4ICXA 3QARA 4A55A 3KWTA 4F92B 1V27A 3OAWA 3FBKA 3QAQA 4KZ0A 4ANVA 4FLHA 2YOAA 3M7FB 4HVBA 2A5UA 3LJ3A 3IM1A 3R7QA 5JHBA 1E8YA 3IBEA 4AJWA 1QATA 4BGDA 3L17A 3PRZA 1TJXA 1E7UA 3NZUA 4FJYA 4OVVA 2D8KA 4FA6A 3PYCA 4IHBA 2WXQA 4EZKA 2JQZA 3PS6A 3QR0A 2CHXA 4NPJA 4QJ3B 4Y1SA 3MJWA 5EDSA 2WXKA 3OHMB 3T8MA 3CSTA 4QJ4B 5CCGE 2WXJA 4ICWA 2LHAA 4LDCA 1DJZA 4Y1TA 2WXIA 3QK0A 1WFMA 4ANWA 3ENEA 4TUUA 2CM6A 2CM5A 4LCVA 4OVUA 1DJIA 4L1LA 3PREA 4QJ5B 3TL5A 4HLEA 4GB9A 3L13A 4V11A 4XE0A 3W57A 2QZ5A 3F00A 2KI6A 3HHMA 3L9BA 4L1BA 3RPBA 1E8WA 2ISDA 3W56A 4BFRA 3GPEA 4NP9A 1RH8A 2K8MA 4WEEA 4WWOA 2RD0A 3APCA 2ZKMX 1RSYA 1CJYA 2DMGA 4DK5A 4F1SA 1TJMA 3FDWA 4XZ4A 1A25A 3SD5A 3L16A 1W16A 4L23A 3B7YA 4TS6A 4TV3A 5CCJA 5JHAA 5H4ZA 1GMIA 1E7VA 3CSFA 2Z0UA 4EZJA 2A4ZA 3APFA 1UGKA 2B3RA 4FHKA 3S2AA 2UZPA 3ML9A 3DBSA 2WXOA 3PFQA 2N1TE 1E8XA 3ZW3A 4KITB 1BYNA 1DJXA 2ENPA 4EZLA 4DNLA 4FADA 3DPDA 2Q3XA 4IQHA 2X38A 2FJUB 3APDA 4WWNA 3RDJA 1K5WA 3L08A 1DSYA 4LT7A 4NPKA 3R7RA 3ZVVA 1RLWA 2NCEA 4URKA 4FJZA 4MJJA 1WFJA 1YRKA 3TJPA 2YRBA 4AOFA 2DMHA 3ZIMA 4GNKB 2WXPA 1HE8A 2CHZA 2K45A 2CJSA 2Q0ZX 3QJZA 1BDYA 2EP6A 3L4CA 2WXFA 3ML8A 4WWPA 1QASA 4G11A 4FHJA 5G55A 3L54A 2ENQA 3P2BA 3F04A 5T8IA 2WXMA 2WXLA 2WXNA 4F93B
chains in the Genus database with same CATH superfamily
3ZGIA 2E3VA 2EC9T 3ZTNL 4WKZB 2IOOA 3D1MC 1G7PA 5D5MB 4LLVB 4XMUA 3QJFB 5I6NA 1M53A 1M05B 1UHVA 12E8H 3NSXA 9CGTA 3HG0A 4WLCA 3X3FH 1RU9L 4JRWA 5K9OB 2VAJA 3CFDB 3SDXB 3PGCA 3F05A 4YSAA 1EZUA 5DC9B 4IGBB 4NZUL 5AW8B 3V8CA 4OTXL 3B3BA 4UUJA 5L88L 4UT6A 1PEWA 1A7RH 4HIXH 4PGDA 4JHUA 3II3A 1TNNA 1VFMA 4O2CB 3IAQA 5SV3A 3ZRSA 1N6QH 3R0MA 3KHQA 5F44A 2A4CA 2R29A 1R34A 3S3BB 1J5OH 4LF3B 4OCXH 2ZKYA 4Z7IA 5I6KA 4OZFH 1M3JA 4AM0A 4LLWB 2B15A 9PCYA 4LSSL 3QQ4B 2V7HA 5IGXH 4NPJA 4OD2B 5A3ID 4Y4HD 3KPNA 3OHMB 1E30A 2K3TA 5FKPB 1NCBH 2PPEA 2KUTA 1KB3A 4DW2L 4X8XA 4F57L 4X9GA 4KV5F 5DURD 4M6MH 5AB1A 1LEKA 3MV9A 4JVPA 4PCSA 1KMGA 1O6SA 1RJYA 2KI6A 1ZJBA 3ZRCC 2EYSA 2XQ0A 4JQIH 2YD6A 3RJOA 2DQJL 4KPHH 1UUNA 3ETTA 2NNXA 5E6YA 3RNQA 4JZJB 5F3BA 2EE0A 1ZMYA 5IBLD 5IMMA 3K6IA 1G9EA 4FQXC 2KLTA 1I4FB 2AS5M 3V0JA 1GMIA 2ATPA 3V4PB 4JM2C 3OB0H 4P23D 2VSDA 3BZEB 2E6QA 1PZDA 3MUY1 2N1TE 1EMTL 1PVHA 4ZAKA 1ZT7B 1M2VA 3K2KA 3P0VL 3IXTA 3QORC 5DTFB 2GKIA 4IS6B 3T2NH 3FULA 2IG2L 3GSUB 2W5PA 3FQWA 5FHBH 5D7LA 3S3JA 3TBWA 4C47A 4MQXD 5JDJA 1E9PA 2VL4A 3QXDA 1A3RH 2AJSL 4Y1AE 3B9EA 2F61A 3NSCA 1IRAY 1NLBL 4AYFA 4FQLL 4V2BA 4NN7C 2HJFB 2XQBH 3B43A 4WW2A 5F0LB 2PN5A 1GS7A 4QRUA 4MSWB 4PJ9A 2LTQB 4QO1B 5KYWA 2X3BA 4QHLB 1SHMA 2QPEB 2OMNA 4CGUB 2EH7L 2IBBA 4ZDHB 3DTDA 2EXTA 3DK0A 4YHNB 2FSEB 3ZTNH 1JZ7A 3RPKA 1MFDH 2QMKA 2APTA 4YH6A 4EN3D 3FU9A 1YJDC 2WTOA 3MVSA 3CNKA 1XXFC 4UB0H 1ZLVH 1A4KB 3MRPA 5IVXE 1OP5K 1U93B 2DH2A 3U0WH 4KKZA 1IE5A 1KY6A 4JPSA 3DSNB 3QR1A 2Y3AA 1D7FA 5KSBF 1RL1A 5A1AA 4OCYH 5KVFL 2GK0A 2A74C 3BGMB 3TYGL 5GS3A 1UWXK 1LWJA 5ID1B 4ENZA 4M61B 1HHIB 3ZZSA 1UVQA 3OXSA 2YUZA 4X8JB 5BXFA 4JBSA 1GZQB 2C3XA 1BOGB 5B38A 4ZS7L 4X6CE 5FOJA 3HLKA 5MERA 2GJZA 5I1KH 3WSQL 1N64L 3BPLB 1LNUA 2ICES 2BFGA 1I53A 4HBQA 4NOBA 1M6UA 5IB4B 4R26L 2VQ1A 1MQKL 4WSKA 5AB2A 2ZPKH 3WEXA 2CO7A 3TFBA 3BLPX 5G5DB 4IKLA 1L0YA 2N1KA 3C75A 2HT2C 2IDFA 3X11A 2P43B 1ZA3A 4WTXA 2F6AA 4J8RB 3F85A 5E2WH 4WI0A 1K2DB 3LIUA 1KOAA 5CMAB 1G0XA 4HGMA 4MAZA 2FO4B 1QYGL 2MCAA 2NY0B 3I84A 3T8XB 1E4WH 1NL0H 1J1XL 5JOFA 3OLGA 3STLB 2E46A 4B53A 3OR6A 3RWFB 4F37K 1CF1A 2CU9A 5IROD 1A6VL 4G6FD 5TPWL 4BA8A 2VXSL 3GK8L 4ZMLA 1V7NH 1JS4A 2K8QA 2KMWA 2NMSA 3V4VL 3RVVD 5EN3A 4M7LL 4QOKB 5DURB 4HMEA 3G6JF 1EMTH 3VFGH 1HZHL 2FH8A 1ZOXA 3LB6C 3KYAA 4P5SA 4JE4B 3RTLA 3BT2H 4L2LA 5AL8A 2X05A 4M03A 4E41E 2CDFA 2GEEA 3D85A 1B3JA 3N0PB 4N2OA 3EGXA 2D2OA 4EBQL 1KELH 3WE6A 1X7SA 1A9BB 4UMSA 3RVTC 2VDMH 2QLVB 2VDRL 4D8PA 3Q9QA 1CLCA 5J3HC 3WE6B 3BXNA 5CN3A 4DUXA 1O7DE 4CADA 2PR4H 5KJ7E 3WXVL 3TV8A 5C7XH 1FO0H 5E9NA 3RFZA 1AQKH 3EOTL 4JY6A 4DQOH 2IANE 3TV3L 2WWKO 1AHKA 1JZDC 5JHDB 1SXSA 3Q9PA 1NTDA 3BDXA 3QIUC 5DMGC 1P4IH 4HKBB 1KB9K 4FCHA 5E5LA 2VNCA 4NUQA 3BHBA 5KS9A 4ISVB 1DJYA 3S8FB 4KX8A 2EUXA 4LHUD 4G6ML 4LVHC 3RDTB 3C09B 3VB8A 5TFSL 5IQ9B 3QC5X 1OPGL 4IEFB 1G43A 3UTSD 4Y5VA 3HBGA 3QPQC 1HEJC 4MHHG 3DJZA 1UB6B 2B0SH 2B5IB 4P3WA 1QO3A 2Y5TA 3UTQA 3SDCD 3CZJA 3CK0H 4KK9D 4OV5B 1A0QL 4NZFA 1XEUA 3CSYB 7FABL 2XWTB 3ZDXE 4N2FA 2E27H 2AAAA 3WNPA 4ZMXA 1R3JA 1QSFD 2XICA 4LDOB 2P8MB 3REVA 5ALCL 5DSCA 1CVRA 4HCRA 3V0VA 4RDBA 1CLYH 4ZUVB 4TSCL 1PKQB 1MFBH 4UM9A 1EFXD 1HQRA 3UEQA 2WWNA 3NSFA 3CX5J 2NZ1A 1GGIH 3BEWA 1KYUA 4DTGH 4NRXA 2VISB 3GINA 1SGKA 4ZW6A 1IGYB 1EXUB 2K9FB 2YXMA 2H4EA 3V95A 1ZV9A 4E41D 2X3CA 1GCYA 1UZ8B 1XAKA 3FAXA 1IC4L 4IRZL 2WBJD 4XAKD 1T5XA 5E08H 5IKCB 1Z3GL 5LG6A 3JWDH 4LPUA 2OSWA 3VSUA 4NJ9L 4XMXA 1MWOA 3S2AA 1J8HB 1BPVA 3SPHA 4WO0A 1UD6A 5DMJB 5HI5C 4DPBX 2XTJE 3L3HB 3C60A 4TVPL 2RQ8A 4AGPA 4Y2OA 4OLVH 5IHUH 4KZDH 1W72H 2X7LA 3U36A 5I66A 1SY6A 4AEHL 4GI9A 3RVUD 5FF6B 5ILTH 4S0SD 3WUZA 1GZQA 3UZVA 5F1NA 5IBTH 2W9LA 3MUJA 4I0KA 4GYBA 4M3KB 1ID5I 4X9BA 4DKEH 5B38B 4JFZL 1GZHC 3RVXD 1RIHL 2C8NA 2V5YA 5DFVC 3VGGA 2AI0L 4LCYA 3ZSTA 1X5JA 1REIA 1JPTH 3BESR 3MNVB 1QPXA 5L6YL 1JNHA 1AZBA 4AL8C 4FI6A 4N8CL 3CFTA 4Y19D 4AMXA 5I30L 5IHUL 1XH1A 5HGGS 5AOIA 4NQDD 4Z7WA 3BKCL 3AMLA 2CO3A 2G60H 5B8CA 3A6OA 5D7JB 2YEQA 5AWNH 3KLHD 5KAQF 4KJWC 5I1HH 2ID5A 3RJDA 4HC1L 3EHBD 3OG4B 5DJYA 1P5VA 4WWKD 4OCRH 1EDHA 4XCFH 3FU5A 2ZCKL 5IEHA 1S7QA 4F7TB 1DSWA 4UB0L 2PWHA 3S2CA 2BHUA 5B3JE 3ALXA 3ZJAA 3FTZA 2W91A 3GSWB 1FGVH 1QHPA 4TQEH 1S7QB 2H2PD 2OBGA 1MFAH 4GO6B 4Q8BA 1CU4L 5DUBA 5BZXA 3VFSA 4HS3B 2LU4A 6FABH 2ZSVA 2B5IC 4LLWA 3M88A 4FG6C 2VLKE 1MIEH 1OK8A 4S1QH 5T1MB 5GS0D 5EEZA 2PPFA 5F6IC 4MCMA 3NZUA 4DGYL 3SE8L 4YWGH 1OAUH 1IAOB 2G5RA 2EDFA 4I18A 1CS6A 1UENA 3DI2B 2H3KA 3BWAB 3MV9B 1NL0L 1ILUA 2FLBT 4F15C 3SN6N 5DEFA 1VESA 5T33L 3QEUA 3ENEA 2XZQL 3M17A 3MLXL 3QDJE 2JJTA 3RZCC 5DJ6B 1HH9A 3LQZB 2V8MA 2J72A 4Y2DC 3G5ZA 5AVSB 4Y16B 3KL0A 3EOBA 3VRJA 2UX6A 2XWBA 4IGBD 4ZX3A 3O6FC 4U6XA 3GHBH 4FD0A 5IT2H 1U8CB 1NKRA 1I4FA 2HFGL 4WV1A 3ZE2B 1PPIA 4PFEA 1RZGA 43CAB 3HG2A 4L9LC 1E27A 3RNQB 3SE4C 2YBGA 3VO0A 5CGBA 1DO5A 1UM4H 3MUGB 3W0WB 4M93B 3UACA 3HRPA 4KZEH 5I82A 3MRJA 1V7MH 5L8JB 1QHQA 3HG1B 2ADGB 2PCPA 3OKEA 2DQUL 1RHHA 4Z3EA 3VE0B 3D39D 1FZJA 1G7HA 4KAQH 3G04A 4EZLA 1VFAB 3RHWK 2VZUA 4P46D 3ZDYB 1CN4A 2H0EA 1J8SA 1E67A 1F58H 2ZT9C 4NPKA 2VLJA 1RLBA 5CIPH 3U83A 1IT9L 4JKPL 2JCCA 4WFGD 5GS0H 1T5KA 3K4DA 4XNDA 3BSZA 4H26B 3MLUH 5D70H 3SYCA 4DP8X 1A7OH 1T7WA 3GDCA 3L7EA 4H20H 5EULV 3CGTA 1EX0A 1YY8A 1CFQB 2P9RA 1W8NA 3M8OL 5EU5A 4JDEB 3MRGA 5AZ2H 3HHSA 3AQXA 3FU8A 4XB3A 3MA7A 4ODBD 1XH3A 2DLGA 2PP9A 1NBZA 1JMXA 1KEGH 2YHGA 4KUCD 1ET7A 4QCIB 2VLKD 1TUPA 3GRBA 4Q74A 3UGXA 5FOBB 1KCKA 2O6CA 3QNYB 5DQDH 3BEVB 3ULVL 3GBEA 5E51A 3L3GB 3QUXD 2Z8RA 4LPYA 4X9HA 4K5NA 1YEDA 5CN2A 1LQBC 3LDBB 3MTXA 1DE4A 4YXLH 2F74B 2XN1A 3Q2CA 4XX5A 5D7IB 5LNEA 3UTTE 4HSAC 4FA7B 5BV7L 1A6TA 3LN9A 4WKZA 1E6JH 1FWXA 4B9IA 4XAWL 3KGUA 3O8XA 4U49A 4YUEH 4B9KC 2I85A 2XG5A 4TTDC 5I1EH 4N1CA 2QLYA 4QHNA 4WHTA 4WJKB 1KCWA 4U1NA 2IVFC 2YXFA 3DURB 2DLHA 3APMA 4K7PY 4LLDB 5F8QC 5L4JA 4C83A 3MRHA 5LBSL 2HG5A 1UD5A 2JB6B 2ZWNA 1T03H 3KPTA 2NX5A 3TU6A 3CVCA 2L4OA 4Y1TA 2KZWA 5JHMA 4FTVE 4P4RB 1DQMH 1XH0A 4ANWA 3LRSB 4AQEA 2F0CA 2NX5B 2NY4B 4JCLA 1M1XB 2OW7A 1QR1A 1IL1B 3RI5K 1NEZB 1ONQA 1JV5A 2M26A 4MA8L 2FNWA 5HYQA 4M6NL 4JMXA 4LARL 5HHOB 2ESVA 3CHOA 3H2QA 5K59F 2XFGB 2BNUB 1R6VA 1JL8A 2ITDA 2X44D 2A9AA 5D72H 2QSQA 3LH2L 3EH2A 4U1GC 2G3ZA 2ESVB 3FW6A 3U30B 5BW7C 1JUFA 2G4EA 4JHAL 1VCAA 1KLFA 3O45B 1JCKA 1PQZA 1JZ3A 3K0WA 4OV5A 5F21B 1MW1A 3KXFD 3UADA 2B39A 2X4NB 3K91A 3BUYB 2BOBB 2CDFB 1G6RL 2ZCHL 4ZTPH 5B1AB 2GC4C 1J48A 1U8KA 3T04D 4N2CA 3V5DA 1MHCB 3DOHA 4L8SA 5DO8A 3U25A 5DJDB 4DW2H 4ZBJA 1KCRH 3K5SA 4RA3A 4NX0A 1I1CA 3QHFH 4WNQB 1GZHA 2VDLB 4KKRA 1MREL 2ADFL 2GSIB 3BDBA 5JHDE 1SVCP 5D1QD 4GUQA 2IAMC 2LOEA 2P8LB 1BG9A 1QD0A 4ALAC 4YDIH 4JG0H 3ECBA 5EO1B 3IS1X 3VFMB 3VXMA 2ZP9A 5I6XB 1BVNP 4MA3A 2A9NH 3JV5A 1QUPA 3CVHL 4ODWB 3GSOB 5DJ2B 2LQRA 5E1HB 5GGRB 1QLFA 2ATKA 5E6IB 4HALA 3T08A 4GAFB 4NHCL 2VN6A 1P1VA 2VDQB 2X1QA 3V6ZB 5HY9A 2ICWJ 5A2BA 2GBVA 1SBSL 3WY3A 5AG8A 3OJDA 3OHXC 1KB9J 3V4UL 2X6UA 4U0RC 1MCOL 3MRCB 4APQD 1HSBA 4I2XB 1B9ZA 1WBYB 3LQAL 1RUAH 3QISA 5E6IC 1ZWIB 3L3DA 3T1FB 5J7CC 1EFXA 4ODVL 1XGUB 4JRXD 4LDEB 2ZWKA 4X5WA 2D0GA 3MODH 3CWGA 4FG6D 4TSAH 1UOWA 1MVFA 3QJVB 4YFDB 2GT9A 2GTZB 3K4AA 1HWHB 3MX0B 4PJFF 4ZD3L 3TNNA 2NY2B 2YA1A 3EBGA 4PW3A 5F1KC 1P9MA 4AYEC 4HGWA 2WLZA 5GS2H 1J9TA 3IJYA 2QPSA 1RIUL 1XTLA 3QUZC 2CBOA 4J3BA 3W9DA 1U2HA 4QI3A 5J89A 4K3GA 1A5FH 1N5YL 2QFPA 2F68X 3K1DA 1T21A 1IFHL 3I85A 3RGVB 3SY0A 1KPVB 4Y7OC 1CPUA 3UERA 4KOCA 2DEWX 3BQUD 1CL7I 1U3ZA 4BFIA 2R69L 2WTPA 5ADOH 1HC1A 1ZCRA 2YEVB 4PJBF 1PIGA 1ZANL 5EOCH 3NIDB 3PXHA 2AQPA 1LLAA 1DO6A 4PYGA 1PZ5B 1JNJA 1U8NA 2GJ6D 4FQ1H 2GTQA 4KH9A 5DS1A 1KC5H 1BAWA 5EC1B 3KPSD 1A1OB 1RK1A 1PZ2A 5DVOA 1PG7L 2EDWA 3VD3A 1MIMH 4CN1A 5I17B 5D1ZA 3GKWL 2FSEA 1D6EA 3L4YA 1ZT7A 3TPUB 3BVVA 3AQDA 1TQCC 2J43A 4I48B 1FH5H 3MRRA 1PY0A 5IB5A 3PG2A 4HC1H 4HA1A 1A0QH 3EDFA 2W07B 3T2OA 1A6ZA 4NO0A 2Z8SA 2XN9E 3CCHB 4K2UL 1K5NA 1PLGL 4X9FA 4NN6B 4PIBA 2ZG3A 2QV4A 3RP1A 3IPEA 2B9AA 1L9QA 2AEPH 2OZNA 2VMDA 4I9WE 3HUJB 4Y4FD 2EKSA 3MZTA 4XP4L 5I16B 2CUIA 3TC9A 2AABH 3JTSA 4AKPA 3MNVA 5ISZE 1QNZH 1Z66A 2YSSA 4JDVB 4PYHA 3C60C 1FAIH 4X6FB 1D5IH 2WNGA 1XHHA 4MRCA 4PLNC 1AR1C 4MQTB 4X0KB 3QJRB 3F04A 3LH8A 1X5AA 1XCXA 2AQQA 2ZKHL 1IE4A 3HS0B 4OM0L 4UT7L 5D6CA 4K2UH 1X5ZA 1DVTA 2MPAL 2CO2A 1FFQA 1MHHB 1UACH 2BSRA 1HCZA 2YZ1A 3FTUA 4MNHB 3UG5A 2IIJA 1KT2B 5C09B 3F6JA 1J05A 4CC4C 3C6LD 2WCPA 4CRPA 4JFDB 3U6RA 5LJYH 5B8CB 5T3XD 4XODA 4MXQC 3SD2A 3SE6A 1PG7W 4QRBA 3BPNB 4R90H 2IALB 5ENWA 2XWDA 2FBRA 3EYFB 1MREH 2AEQH 2KS0A 2Y5EA 3B5HA 3BP4A 3Q2WA 5HHOE 4CU8A 4Y5YA 4CVWA 3TCXA 1JIBA 4FTVB 4R4BB 4K3DH 3CU7A 3KVQA 1QRND 1DVUA 5ICUA 2AKRA 5CLXA 2I9TA 2ZXDA 1S3KH 3K3QA 1SLVA 3HRZC 3VWKA 2MIZA 4G8GE 3MLZL 3QQ9C 2KL6A 2BHZA 1NGYB 3T0WA 4LIQH 4MAYB 1N5AA 4KXDA 1PY9A 2RALA 3HE7B 5B1JA 3FF8A 3MNMA 4GKSA 2CJ3A 3ESVF 5JUEL 3VFVB 3KR3H 5KYUB 3VQ1C 3JVGC 1X9RA 4N2IA 4Y4HA 5B22A 2FYYB 3GXFA 3NFPB 4IMLA 3D4YA 2EH8L 4PVLA 3MLUL 3S48A 2ZUSA 1A7NH 5HJ3B 2PKDA 3X1GA 5CSGA 1ML0A 2W0FA 1BEXA 3LEYH 4V1DE 4ZS6C 1F97A 3IWVA 1G9NC 3ZDZB 5J4MA 1R24B 4PG9A 4ZD3H 2F5AH 4GW5A 3G5WA 2GSGB 3ILQD 3OBAA 5I74C 5EIQA 5DHVA 4U6HA 5HY9B 5I1IL 5KSAA 3BAEL 1G4MA 1CBVH 4WSJA 1A21A 3STZB 4I5BA 3EJQA 2DQDH 1W16A 4WI3A 1GIGL 5KOVC 5EBLB 4ERSL 3ARSA 1KGUA 3LNEA 3MV7D 4WJ5B 1N59A 4O2CA 4L8CA 2WB7A 2OQJB 3L2MA 3GJFK 5EOQH 4EVNA 2WGNB 4OFDA 1S6NA 4LSRL 1MI5B 1N0XH 3C8KB 1XAUA 4PP2B 4UDTA 2VXTH 5L0QB 1J5OL 1TSRA 3TEUA 5AW4B 1AGFB 1UH4A 4G7VL 3L08A 1UZ8A 1ES0A 1T80A 2VDNL 1RVFL 5DWUL 5FA4A 2CWRA 3O8XD 1DVSA 5PAZA 3VXRD 4JRYA 1K85A 3UTPE 1QFUL 1YPZA 1CGSH 5KBLA 1GJUA 5AKSA 2PTTB 1HHHA 4GG6A 4GINA 4QUOA 5EA0H 4N2AA 3WEBA 4FL4B 3QIWB 1OARH 1BBDH 1IVLA 1YJDL 3PL6B 4FNLH 4N0FA 3MZGB 4LSQL 3AWFA 4O4YH 4I4WB 1FJ1B 2BHFA 3FRUB 2K9UA 4X5WB 2G5UA 3HR6A 3O41B 1X5MA 5IB3A 2L7EA 1WS7A 5I0ZA 1TSHA 3ATEA 4U2YA 5E8PA 4XCCH 5EO9B 4LDLB 2PABA 5IHZA 4MMZB 3U30C 4G9DB 5L6YH 1E5BA 4YE4L 4PJ7A 3TJHD 4LKCB 3N40F 1CGTA 1WHPA 5LB1A 3TH3T 3IMSA 1TT6A 1MVYA 4FP8H 4X7SH 3EBAA 4G8IB 5DD5H 4U1SB 4PM1A 4OLWH 5A2CA 1BQHG 2XFXB 3AXLA 3EYVA 3KPRD 1WISA 3NPSB 3L1FA 2VDOL 4BCZA 4K9EH 1OVZA 5HXMA 2GB2A 3PGDB 3MCLH 4RQQA 4HUNB 3GS7A 43C9B 1GHFL 3WHXA 5B3JF 1J7VR 3WNMA 5EEVA 5EBGA 2VO5A 2Y07H 2CH8A 1EO5A 2AK1L 3RHWF 4XWOC 3D0VB 1FYTD 3MO1B 5DR5H 4LSUH 2I24N 4QJ5B 3PREA 1ZSHA 1I8IB 1I8UA 5DRWB 4KRPB 5C0DA 4BZ2A 4HGKC 1QNIA 3L9BA 2BY0A 1JRHH 4XNYH 3FO2B 4NDMA 2JCCE 4DSYA 5C09D 4JFYA 1RH8A 1P6FA 4WEEA 1AD9B 2P5PA 1CG9B 4EAEA 5C07B 1OW0A 2PUQT 1E0OB 3U4BL 4DZ8A 4W81A 1L7TL 1M7DB 3VD2A 2WN3A 5GRUL 2Y22A 4F8TA 3HFMH 4EPSA 5JUEH 4P2AA 3GXPA 1AKJA 1T0PB 1SDDB 4GFTB 4MZRA 2W1NA 3VMPA 2W8CA 2VZOA 4G43B 4AJYV 5EOCJ 3DVGB 3RWCB 3TJHC 1IM9B 1OWRM 4JN1L 3US1A 1V3LA 2WYHA 3OZLA 5GSVB 4MCNA 3HAEG 3QRGL 4XBEL 3WCYA 1KB5A 1P53A 1UUSA 2ICWI 3RX7A 4MCZB 4RRPG 5JW3H 1NCUA 1KJ2B 4GG8A 5GJSL 3FCGA 3V0AC 2A4EA 3QO1B 3D25A 3E0GA 3ZIYA 5MENE 3I75B 1GC1C 1HAWA 1NMBL 4R2GD 3TPKA 3F58H 4XP5H 1TZAA 3N3EA 4CN4A 1E4XI 4K3EL 4M8UA 2ZG2A 32C2A 5I1HL 4H2AA 1WYJA 4ZFFB 2BS9A 2WXLA 1PS3A 1X4ZA 3DWTA 3BD4A 3SDXA 4HKXB 3GSUA 1RD6A 4N0YL 4J27A 3DETC 5DK2A 1ZSDB 3EH3B 2FL5A 1MCIA 2HN7B 4YK4C 2D3VA 1H8SA 3EGDB 3WYRA 3AVEA 1T1ZB 1INEH 1I1AA 5E00B 3RVWD 5LHDA 2FJSA 3GJFA 2HMID 4L9LB 5IR1A 3SDDB 3UO1H 3O6KH 1KLGA 3DRTB 4M48H 5FA3A 2COQA 2JH2A 3IGLA 1L5GA 1IAMA 2FBOJ 4GW1A 2X0UA 4QO1A 2LABA 3TT1L 5KYWB 4ZSOB 1NBZB 4KI5C 1C12B 5JIHA 4ZT1A 1XCTB 4L05A 4AUJA 1TZHB 5DMKB 2WSKA 4EDWL 2P5ED 2UY6A 4AMKH 1DVQA 5DQJA 4AKQA 3A6CH 3RZCB 1KNOB 3HMXA 1LEIA 3H1ZA 1NCCL 2MNWA 4JFTA 2BW4A 3LXBA 4CMHC 4B7IA 5TK4A 1H6TA 3C9NA 2EVIA 1QSEA 2A73A 1NWPA 1IGML 3BZ4A 3MUZ1 3BRGC 3U0WL 4OGXH 1HZKA 1JHLL 1BEYH 2XWCA 4OJEH 2BIHA 2EE2A 5E8EA 1BGXL 1YQ2A 4EIUA 1LO4L 3TL5A 3EYSH 4KI5D 5KBNC 1D5ZB 2K78A 5G4NA 4WY7H 2WW8A 4L1SA 4U1KA 2X28A 1DFBH 1MW2A 4AQAA 1HQ4B 4JREB 3MJ7A 3LCYA 4E42A 5DJZA 1OALA 2DY2A 5DZJA 1WLHA 2YD0A 4HWBL 1KGCD 2XA3A 4LNRB 3B37A 4HWEL 4KV5E 4AYGA 3QORA 1BF5A 1P5UC 4NAJA 4MVBC 5HVWA 1VRSA 5CILH 2XETA 1ZTXH 3Q8CA 4UT9L 5LWYH 5GHWH 2G60L 1MJUH 3P9WB 2P44B 3U2IA 4X4MA 3H8NA 4ZTOH 3UPCA 3F64A 3D9AH 1ADQH 1A6AA 3C60D 2BSDA 3DPDA 2YRLA 3EJZD 4KRLB 3RU8L 4LCCB 4LLUA 3DYMA 1INQB 1FVCA 1LO2H 2OZ4L 5GGTH 3VX1A 5IQ7L 2EZ0D 5TTRA 3VDBA 1IKOP 3AREC 3DURA 4OF6A 1OSZB 1IM3D 2C1PA 1BLIA 1Q0XH 3VXQA 3GXTA 1GGBH 5AQ0A 1FGNH 1JV2A 1L7TH 2NUPB 5CJBA 1CURA 2GUOB 4ABQA 2QKIA 3RWDB 1DZBA 3DXAA 3TTSA 1XF4A 1NLDH 3UBXI 2RA1A 2W88A 2YMTA 2HFGH 3WY2A 2GJPA 3UPRA 4PY8I 1NCIA 1PLBA 2LAGB 4H88H 5EU7C 4NRXB 1AP2B 4X4ME 4OB5L 2VMCA 5K1JA 5F7HA 3HS8A 5CD3B 2ZD0A 3MYJB 2AV7A 5FFLA 4P2YA 1NC4B 4FNTA 2DJ4A 2ITDB 3FT2B 4G6AD 2OMYB 1E3FA 4PJDA 1EA9C 4WU7A 1F2QA 1RY7B 3KJ4B 1SBSH 2Z35A 1CICA 3IETB 3KWWA 4G3YH 4KTDH 3FN0H 4IHOA 4KI5E 4F92B 3QPXH 5KBDA 3FTVA 4DP6X 4PJCB 1UJ3C 3W82A 1N0LB 3DIDA 2WSDA 3QPQD 3FFOA 1Z9NA 4YPGB 1P4LB 1TQVA 3QFJA 3SE9H 3BGFB 3ZDWA 2HJLB 1U42A 5AVQB 3K2IA 5C0BB 1N0LA 3BPNC 4PTTB 3QR0A 2BDNH 4XH2B 5TK2A 5HDBF 5EDSA 2YPKB 4LFHD 2XWXA 3L9EA 5C1MB 1HI6A 1NOLA 3DVNA 3MRLA 4TMPA 5D7SL 4AV0A 5DZLA 1W0WA 1E5CA 1CZ8L 1GOGA 1VCBC 2FWSA 1VHPA 4PRIA 1EGJA 1BXAA 4JDZA 4PP1C 3WNLA 2N56A 4F37F 15C8L 5G4OA 3W81A 2Z65C 1P5UB 1GS6X 4X6DA 3ZMEA 4UINL 1AMYA 2XRAH 5ISZA 4NLHA 3VW3H 3I50H 2IWEA 3U7WH 1FC2D 1G1CA 2X6BA 4MJID 1G84A 5F7KC 1D7BA 1NAKH 2HT3C 5GZOC 2R9HD 4KVCL 3FOMB 3O9WB 3FJTA 2CK2A 3MJ9H 4NKOB 1JVOA 4RAUA 5I15L 3GIVA 4PJCF 3NG5A 5L2KA 1RZ8B 4AYFB 2FR4B 3B6SB 5E7BA 1KENH 3BIBX 4XHJC 4G7QB 5I26A 1J1PL 4ELMA 1N59B 3V79C 4X99B 2ZX7A 5HHVL 5GRVL 4MNQA 4BUGA 1WTGT 4OD1L 3ERXA 5BV7H 2DAVA 2NNAA 3LKSA 5I71B 4WKXA 4N2DA 1M2VB 3RFZC 4KVCH 4ZMTA 5AW6B 4MJ5A 1CXIA 5I1KL 5JXEC 3SPVA 3EO1B 3AQYA 4XTRD 2ZSWB 1XR9A 4AMWA 4OGYH 5GS1C 5CM1A 1UXWB 4A6YB 3IMTA 1U8HB 4LCWD 1T3FA 3GBNL 1YMHA 1NC4D 3B1UA 3T6WA 4HEMA 1A14H 2B8OT 3TYGH 3L6FA 4QIRA 1VIWA 2GW5A 1F90H 1S7XA 1ND0A 4OAWA 3QUZB 2CJTA 3MMEB 2J56A 4AQAB 2HLAA 4E42B 4IJTA 4MWFA 4Y5VC 5LGJA 3RZCA 3D2TA 4HISA 2ZE0A 1P4BL 2FAUA 1JAEA 4UILL 3ALPA 3M07A 3RGVC 4Z78A 4P46C 5C86A 5KYXA 4WZ9A 1MAJA 1X5HA 1NOAA 1N4XL 3HN8A 3WEAA 1G0DA 1HVXA 1AQDA 3K8MA 4JN2A 2DH3A 2VABA 2ZAHA 4WTQA 1MFVA 1THCA 4XP4H 1F00I 4YEFA 5A2IH 2XYBA 3P1VA 4NQDA 4P4KC 3V4LA 4BD4A 4NIKB 1TCRA 1G4RA 2UWEB 3AY4C 4DCQB 1RUML 5ENWB 5IFJA 3UBXA 1HK6A 4DFIA 3EJYC 3P9LB 1I8KA 1KEMH 2VKXA 2YN5A 3C5JA 1PG7X 2FX7H 3IDYC 1A3RL 2AJSH 4YX2L 2WAHA 3BKML 3NQKA 4Y1AB 1JERA 1PX8A 1KPUB 4QTIH 5EZJB 3SBWA 1R3IL 1JZ8A 5C0CB 2CO6A 3OGCA 3WN5B 3MBXH 4MS6A 4W9EC 3P30H 5DHMC 3ROOA 2EUZA 1OE3A 1MHEB 2B4CH 3NFSH 4OLVL 2DQCH 4YSCA 2BMKB 4JE0A 3BAYA 1ZGLB 3QH3A 3OKDA 1YN6B 2LE9A 1RUKH 2V3EA 1M05A 3S3CB 3BUIA 5F88A 5EU6D 5DYFA 4YR6B 4ELMF 4L23A 3T0AA 4L9DA 5ECGA 1FZKA 1Q1PA 2N3JA 4XVJH 4IIZA 1J1OL 3F7VB 2PXYA 4FFZA 3WS6A 1JZGA 2F53A 4KRPD 3GTVA 2VN3A 2X0VA 3EO9H 5AOZA 4R96A 4LCYB 4XPGH 2WC7A 2HVKB 4ZSOE 2ORBH 2E75C 5I9QB 3FT0A 5EOTA 3MLSL 1M7UA 4WW2F 3DV6A 4XPFH 3NESA 2HT3D 4A2MA 5KTEH 2C1OB 3QJFA 1U8OA 2P5EA 1FVEA 5DJ0A 4XCFL 4XVJL 1SHSA 1J8HD 2CCVA 3QQNA 4KUCF 5FUZH 5CJ5A 1MF2H 4BA0A 2NYZA 2X09A 3FQ4A 5DJXA 1MRCH 3IXAB 3AC0A 3U6XA 2WPGA 1KDIA 2H47C 3WEMA 4CNIA 2C3VA 4G71B 2WANA 4L3EB 1H6FA 4AE0A 1U6AH 5JIPA 1MFAL 4YE0A 4PJ8D 3MJ9A 4Z7NB 2F53E 4LARH 4DETA 3GS4A 2R4RL 4BXSV 1K8IB 5SV4A 2VLKB 5FV1L 2PETA 1HZLA 3FFCB 5C6TH 2Z8WC 1ESOA 3ZTJH 5I1JL 1JHTB 4JFEA 1OQOA 4FQXB 1QO3B 1PZSA 2Y5TB 3UTQB 1DQQA 2ZX9A 2AJUH 3MUUA 3QIBB 3QR2A 3TO4D 3M1BB 3ZE0E 2ATAA 4AZ8A 1AGDB 4UTAL 4OZIE 4UQ2B 1G87A 4AGQA 1YHPA 4HJEA 5HHQA 5EORL 4KMTH 1QBLH 2DLTA 3BHBB 1I9IH 4XI5C 3VXNA 4HKJA 1TZOA 3SQOL 1LVEA 2QHLA 3Q3GB 1WICA 2WHVA 3UZEC 1LQSR 4F57H 1UM5H 5GGSY 1X5LA 4QHUA 3D69B 1FAIL 1YZZA 1U8MB 1RPUA 5HHPB 4K15A 5BOPA 1T2XA 5TJWK 2X1OA 1QUNB 2ZOTA 3C2AL 1T7XA 2NLJB 4YBQD 4EBQH 5DJCA 4IU3B 3SYAA 3W0WD 2WLHA 3VXTA 4OF3A 1GHFH 2OCCB 3RDTA 4JHWL 3WXVH 4MFHA 3IGUA 1K4DB 4MA1C 3MV8A 2NY3D 2JK5A 3G08B 4FXLA 4QCIA 4MAUH 1A25A 1I3GH 1U8IA 1QKZL 3VD0A 3PV6A 2R0WL 4JS7A 4QXTB 3S37L 1AIFA 4FQIL 1IL1A 3LZFH 5L2JB 1OGTB 5DHEA 1ONQB 3CIQA 1MRFH 5BJTB 2A6KA 3BUPA 5SWZD 1NCWL 1EVUA 1Z3RA 3EHBC 4S1RH 2PTTA 3M1CA 4NQQA 4A63A 4GG6B 3IDYB 1CXKA 4JY5L 2CLZB 1XCQB 6CGTA 2R7EB 2UYLB 3GSNA 3S36X 4H1LB 4WWNA 2YGNA 4Z8FH 4HSCX 3MGTB 3STLA 2HVJA 4AYBA 3IDIA 4DZBB 1R5IA 4Z7VF 4R2GB 4QHLA 4LSUL 1BQ5A 2J5LB 5JXEA 4XX1G 4UOJA 2RR3A 3IF1B 2VL5A 1GOHA 1BFTA 1FO0A 3DXAB 4N2GA 4PGCA 1IBHA 1DBKH 1HHJA 1S5IH 3IKCB 3CFKB 4GRMA 3PWVA 2XPYA 3O0RH 3U4EA 3VX0A 3QFJD 3V2AR 3O6FB 1OWWA 3MRPB 4F91B 4NWTL 3NIFE 3LNFA 2PWFA 4Q6IB 1EK3A 1R3KB 3ZQXA 1KXVC 4QHMB 4IIQB 4W9FC 8FABA 2W59A 4KQ4L 4DGWC 4OCYL 4YDJA 4NQDB 2HKHL 1MFCL 4BFOA 1IGIH 3DBXB 3BAJA 1F3DJ 2FB4H 3TNMA 2O5ZH 4ERSH 3IMBA 3H7BB 5ABDE 1SDAB 1GGCH 2O4EA 3LQAC 1KEML 3DECA 3PDGA 2JIXB 1WFIA 3GWJA 4FYTA 5F97E 4C56E 4GSRA 4WGVB 3VMOA 4Y4KA 4ZW5A 1BJ1J 1W2KT 1JI2A 1AC6A 1FV1B 5IMKA 4IU2A 2D7QA 4XCYB 5IJKC 4KZ0A 1YNTB 2DWSA 4RGNE 1E43A 4PJFB 3QRFM 3NPSC 5I71C 3VWKD 1XF3A 3VFVA 3PDOA 1AIZA 4JZOB 1NBVL 5EPMB 2EC8A 3TBTA 5DD1L 2FD6H 3D4CA 1T22A 4LVEA 2ZSVB 4QRQB 2PWGA 3VXOB 3IPBA 2ZWLT 1AGEA 3UYPB 4WF7A 3L3JB 4N0UE 2FO1A 3NAAH 1WBXB 3PIQB 4MS8C 5HDLA 3MRDB 2KPWA 3KZ8A 1UJ3A 1V05A 5HPMB 4FXTA 4GMSL 4H0GA 4GB9A 4N5ED 4X8CA 5LXGH 1WFTA 2YKKA 4F8LA 4H8VA 3QDJD 4M7ZC 2BVQA 1CTOA 2XWJA 3DO3A 1QFOA 3S35H 2JSFA 4JFDA 5EIVA 2ZPKL 3PWUB 2XQBL 1JPGA 1PF3A 4YZWA 1NCDH 2J4WH 3QIBD 3OR7A 2XWJB 3EW3B 5E6ID 3PP3K 1U92B 4L4VD 5ALBL 3GIVB 1U8CA 3ZYIA 3QWRA 5FECA 3DXAE 2X4RB 1JF1A 2ADIA 1O5DT 1BMWA 1QSFB 3D07A 5EWIH 3II2A 3VA6A 3C5XA 4DWHA 3BKYL 3D09A 3RVVC 4AYMC 1GYCA 3T65A 4M56A 3GPSA 4HFWA 4R5XA 4XTRC 5FYJD 1FL3B 2CRYA 5LN4A 4MAYD 5SWSA 3MRJB 5JXAH 1CK0H 3CUPB 5IFAH 1DDHA 1IAOA 2VLLB 4JY5H 2AXGA 2IF7A 2J2ZA 3FUHA 2DMKA 2Z31B 2K7QA 5IVXA 5I5RA 3N42F 2YUXA 3G9AB 1BYPA 3SCMB 4CVXA 5LBSH 4FNPA 3UTSA 2VDLH 2VMEA 4NXSA 1WV7T 5HGHB 3L4CA 1NGWB 3TM6A 2A74B 1IIKA 3H0TA 5E8DH 4GAYB 3GD1C 5I1EL 5IMOB 5A16A 1PLGH 3OG6B 1XSJA 1UWEL 2GY5A 3JVGA 3GSXB 4QKXB 3K2UH 4J6IA 4WCYH 5SWSE 3JQOB 5AW2B 4B95C 3HRZB 1P7KB 2ED9A 2BX5A 2VLRD 5LGHH 3ARBB 3L9RB 2P7TB 3B9KD 4RSVA 4XZUB 2X4SA 3G5XA 4NM8L 3VGDA 4U1IB 1SXNA 2PPCA 4WIQA 4I7ZC 3HBQA 5HYJE 4DP7X 4OCXL 3ZUNC 3PFUA 4JFHD 4CDGC 2XWTA 3DX7B 4NN7B 4OSUL 4HUKB 2QQLL 4BFKA 5KYYB 1TQSA 3NP4A 3V4PH 3KS0H 4UZGA 2E7LA 1EDYA 3QXUA 4JGUA 3L17A 4R7NB 2UY7B 1MWAH 1R47A 1FNHA 1HEHC 5KVFE 3ZL4H 5DUPH 1NUNB 4UTCA 4KVPA 5FF6A 4QJ3B 5KSBE 1OTSC 2AV1B 3EZ8A 3WLBA 5EUOF 2BVUA 3IE9A 5HYIA 3QULA 3D85D 1E2VA 4JFXA 1JV2B 4BH7A 3DA0A 4W9DC 4GP5B 3ARGD 2AEOA 4HLEA 3T3PE 3CC1A 3KM2A 5DLMH 5DU7A 3TIEB 3X14B 4MJ6A 4AVKA 2JF1A 4EOWL 5KN5B 1JNHB 4BZ2L 4Z7NE 3VTAA 1G7LB 4OUUA 4GSQA 2K8MA 3RWIB 1U95A 3ZN6A 2IH9A 2R39A 4X4YA 1MLBA 5TQ2L 5CU5A 2GI7A 4MD4B 5GHWL 3EUDA 2ZONA 4NNPL 4G8EA 4AV4A 2OMUA 4DO5A 1GTFA 2BSSA 4L3CA 1QX1A 4JFQB 2BHYA 2DBLL 4D9QD 5BV7C 5A2AA 5KVMC 3R1GL 5SWZA 3MRKA 1IV8A 3ATAA 4B9CA 4PJ5E 4JKNA 1DJXA 3B3IA 1X5KA 2DWEA 2ZKWA 4PV8B 5HDQH 2VXQH 5L7XL 4DEWA 4AYDC 5HVHB 3CH8A 3PU7A 3QHTC 1SEQH 2VDPL 4N90E 4GUCA 2VN7A 5HHOA 5IG7A 2C9RA 3D39B 1J0JA 5C0IA 3BUYA 5KS9E 2P5WE 4QXGH 1AH1A 4JPQA 3UAEA 3QSKB 4F33A 5DFVD 2WTRA 3INUL 2G5BB 2HFEA 2NYKA 5C0DB 1NCAH 4KKBD 1NPJA 4DZBA 2P5EB 1L0QA 1CDGA 1WVZA 1AZNA 3CFEB 2WJ5A 3VFPA 1NFIA 3T0EB 1BX2A 3PL6C 1QFWI 5L7XH 2DQIL 5HGDA 1JHTA 4Q9CA 4K8RD 3L4WA 4MA3B 1S9KC 1KCVL 3NSJA 5JYMA 5I0VA 4XXWA 1QOKA 4NQCB 4F8PA 4PRPE 5F7EL 1C8QA 2D03H 3FQTB 3ZLQC 5AB9A 3KGRA 1BZEA 1DQKA 3WFDH 4BZ1H 3SDDD 4UM8A 1PZAA 3HFML 5FYKD 5LNGA 3U79A 2EDQA 3T0VA 2F1AA 3T0XA 2XN9B 5C0BE 3IJEA 1A9BA 1VENA 4NJAH 2EDLA 1SJVA 1QFWH 2JQMA 2F19H 2VXVH 3P4NA 5EO0A 4YQXH 1E50A 3ZO9A 1QBAA 1T04B 2G3XA 3BZ4B 3GC3A 4JJHA 1Y6NR 4FFYL 2Q2LA 1QZNA 4U3XA 2J71A 4NNYB 3VRLF 5EUOA 1SY6L 1YMMD 2DPKA 3L4ZA 2NW2A 5FGCE 4PJXF 5HHMD 3W37A 2EYTA 1E4KC 4AV5A 1T03L 1JGEA 4WUUB 3QHFL 3F2LA 3VFRB 2NY6D 2W07A 1G9NL 5DFTA 1H3WM 4JUSA 4JRFA 4JB9L 4QHKJ 2XTLA 4N0YH 3GI9L 4PJEE 4J1UA 4AQ8A 4ZMNA 4MKMA 1MXDA 5MERB 4N90D 2FJHB 2WMPB 2R2BA 4X7DC 3IS0X 5EZLA 1NPNA 2ZUXA 3BSGA 3D30A 4BDVB 1N6UA 1CF8H 4G72B 4DKFL 4S2SB 1L3NA 5DUPL 4KHXH 5EF1A 4ODUA 1I1AD 5EFIA 2YFNA 3APFA 3B2VL 3O2VL 1SXZA 4OGZA 4H8PA 2NR6D 2HLFC 3CFBA 4NRYA 3GXMA 5E2TL 4M6OL 5EF0A 3FQUB 1T20A 1RZIA 5FM5O 4L3AA 2OYKA 3W5MA 3SGJC 5CEYB 1R5WA 3UX9B 2AQ3A 3GB7A 4APXB 2EIDA 3P4MA 4H13C 2X4TB 3S5LB 1G7JA 5FKAB 3WKNA 3FCBA 4EN2A 1K3IA 4S0TD 4HJGA 1S78D 4PJ9B 3RVUC 5CF3A 1ZJAA 1N5YH 2NXZD 2NY3C 4NZRL 4Z0BL 1ZDSA 3FCSA 4PR5B 4BK5A 1U4FA 3NCWA 5ID1A 5IB2B 1YYMH 1AXTL 2IJ0C 1Z9SB 3KPRB 4XBEH 4ZO9A 3D39E 1JPSH 3OXRA 5ESAB 3TYFA 3T0DA 2FLRT 4L1TA 2GEQA 2ZUUA 2G4GA 4ODXA 3D05A 2OX5A 3FQWB 2OR9L 1YCSA 2VDRH 1ROWA 2BOLA 2JKIS 1CGWA 2WKLA 1BW8A 4N20A 4WK2B 4WWKB 2OTPA 4LP4A 4MNHA 1TCRB 4NO0B 2UY7A 3ZL4L 5I76A 4D3CH 4JRYE 3SE3C 5IUSA 1DBBL 2P80A 2XQYA 1JGVH 3APNA 3ZDYF 2Y7LA 5B4MD 3ULUC 3RL2A 3KWTA 5DEFB 4I77H 3BVXA 1A47A 1A7QH 2OI9B 4HVBA 3ZT5A 3OKMB 2EEXA 3ECVA 2IADB 1SM3L 2J1XA 5EU7E 3RG1C 3ZSSA 3IDXL 1AGCB 2BWIA 2CIIB 1YC7A 3PP4H 4R97C 5CGYC 4YUEL 5LAPA 3RILA 3VG0L 2H41A 2BINA 3QJHA 1FE8H 1MWAB 2E56A 1KT2A 3TT3L 2F1BA 5JIDA 3CX2A 5D7KE 1JZ2A 3AITA 3FQRA 5C2BL 1FUNA 3WMSA 3MCYA 3LRLA 5D4HA 2N59A 2XZCH 1ZHNA 4YBQC 2QPDB 4ONGH 1AR1D 3CFDA 5K9JL 1GYWA 4PMFA 2YS4A 1JUFB 1N70A 4JEGB 4N1EA 3ZTEA 1T1YB 3RPBA 4LFHG 1CFTB 4O4YL 2ISDA 4LNVA 3RIFK 1I8MB 1THAA 3ZKMC 3B9KC 3DX2A 1P5VB 2HX8A 4JHAH 5F89B 3GI9H 1LJMA 4XVOA 2DQUH 3FDWA 3GMQA 3WIIH 1P84K 2F54E 1XIWA 3T0ED 2R2EB 4ZNEA 3TBWB 4YE4H 4GXFA 1HDMB 1QFUH 1WIPA 2CDEB 2Z35B 3BP6B 4Z7VE 4UUJB 3KCWA 3C12A 4NQCE 4YJZL 5BUAA 2XQYG 1EFXB 4HW6A 4Z7NF 4W9ZA 1BZ9B 3GBML 1CDCA 3QEQB 3NJLA 1E9OA 2LU7A 4J8QA 1NKGA 1M56B 5JQHC 1KIQB 3FOLA 4WUKL 3SOBL 1EXUA 5LDSA 4TQHA 4E0RB 3DRQB 4XN4A 2NTFB 3VFOA 4NQEB 1U2YA 4PG9B 4PJGF 5F9AC 3MYZA 5SX5H 1OT1A 2V2XB 5B3NA 3MOAL 1OD7A 5E8PB 4YLBA 5I73C 1JPEA 4K23H 4P57B 1DEEB 4NPYB 3K81A 4D9LH 4LEBA 5BOJA 2UV3A 2KT6A 5ETUB 1S7RA 3ULUH 1NICA 4XNMA 4G6JL 1INDL 2JJTC 5I1JH 3ARRA 2A9BA 2GJRA 2E4FA 3VJ6B 2VIRB 3L81A 4JQVA 4Z7OF 3NZSA 1RPKA 1QEXA 3NCJL 4NWUH 4U6YB 4XNXH 3U7AA 2HTLC 2DQIH 3VG9C 3KNBB 1OAQH 3BH9B 1J5CA 1IQWL 4POZC 2FECI 5JDSB 5A7BA 4KZCA 2WMPA 4LCUB 1CYGA 4U6YA 1SBBA 2VM3A 1CE6B 4AT6B 1XF4B 1IGCH 4JHZA 2WNWA 2ZXWB 1TNMA 1W15A 3B34A 4Q4EA 5IHBA 4TUKH 2XTJB 4B6ZA 3BI9X 2EYTB 2ZX6A 3O11A 5B7EA 3UIYA 3ZYOA 2H45A 3FO0H 3RJQB 1F5WA 5L9DL 2ICWB 3BSZL 2WOBA 2FJFA 4EZMA 4LLUB 5ADOL 1Z9LA 1MFEH 4R7VA 5KSVA 5CLTA 4A2DA 5L8LB 3L2LA 5D2NA 1PCSA 2CKBB 1OP5H 4D8OA 4KROD 3H2WA 3QI9C 2W9EH 3VRIA 2IOMA 5F7MC 1FFRA 1ZK9A 3CXDL 2W94A 1I1YA 5FB8A 3HNVH 2R29L 4M62H 4GSDL 3LKQB 4YC2C 4IBVA 4TVUA 1LXMA 2UZIL 4S1SL 5JO5B 2ARJB 3O6FA 1FYHB 2BVTA 3WHE1 2FQFA 3HR5A 3P02A 4ZUSB 3ET9F 4HETA 4P2QD 4FXKB 3ZDXF 4ACPA 5I1AA 3SBQA 1TJIH 3CSYA 4JO2L 2QBWA 5DT1H 1G7QB 4Y9GA 5BVJA 3HR5B 1P7QA 4ZUSA 1VAHA 1FVCB 2JB5H 4P07A 2NY6B 3HJ0A 5AVWB 3ZXAC 3F58L 1O6VA 3PJSB 5MI0C 1OM3H 2IEPA 5IT2L 1OSYA 4J3UA 3V4UH 5D93B 3PFQA 4P4RA 4FTVA 4MB1A 1W72L 5JHLA 1JBJA 1GGUA 3QVAA 4IBQA 5F6HJ 4K5OA 3SGJA 4K7FA 3V0HA 3ARPA 1GY1A 1Y18B 3HE7C 4OKVB 2AITA 4MAYC 4RAVB 2YO3A 3H4FA 3RTQD 5C0JA 2ZYHA 1U2CA 3EJTA 4XC3L 4ZYKA 1SEBA 3UFIA 1HEZB 1T4KB 2H1PL 2DQFA 5G5DA 4D2NA 3EDKA 3KLLA 1OOWA 1U8LA 5GISH 4GW1B 2KQMA 4KUZL 5B39B 3PWJA 4Q6KA 1CCZA 1NFKA 5ACZB 4EI6B 5FHAL 2YWZA 1ZLSL 3IFLL 1IC5L 1RZFL 4F8OA 1EHNA 2JCCB 2VE6B 1L7IH 3CZEA 5HSFA 3SB3A 3EG9B 3UH8A 4D8PB 5AB0A 3HG4A 1G9NH 3R4DA 3TWYA 2M2DA 1X9QA 1YDPB 3ZKNC 1HCVA 2XZAH 3M1BA 5FLVA 1KB5B 1I7ZB 3F5WB 3GZPA 4U1HB 2XN0A 5IUCA 4PS3A 2ZCKH 1J1OH 3QP3A 4JKWA 2E27L 4X7TB 1J0HA 3JZYA 2PO6A 4KDTC 4Y9EA 1RJZB 4Z7WF 4G43A 3AUWB 2F53B 3D4GA 2LFEA 1ZEAL 1HH6B 1VFBA 1ITCA 3BGAA 3MRNB 2FDBP 2FZ3B 3DKHA 1MQ8A 2BIQA 3Q0HA 3D6GA 5FUCE 4MKTA 2R0KH 3FONA 2QGBA 1GC1H 3QO1A 1M71A 4BGDA 3DROA 1T0MA 2C1OA 4FNSA 2FSDA 3JUYA 2QSTA 3C08H 4WU5A 3IJYB 1Q0XL 1KELL 3BFQG 1LEIB 4TL5A 4WFHD 3NP3A 1VGEH 3QZOA 3B9DA 1NAMA 1FPTH 2A6JA 2ZP0T 4XCEA 1SOKA 3EFOB 3VXSD 2V3FA 3ZTJG 1N12A 5HP5A 2NY4C 2XCMC 1HTYA 3HHMA 4E9VA 4ETYA 1KN2L 3OLIA 3P9LA 3Q2LA 4NP9A 1U91A 3PXJA 3WE1A 1IAIL 1V10A 1UCTA 4E2OA 4UOZA 5C97A 3GSXA 1BWMA 3WGVB 1PLAA 2I60L 3MXWH 4YHNA 3UO1L 3BKMH 4GMTL 1LO5A 4PRNB 5T1JA 1CI5A 4JQIA 1E7VA 4MSWA 4AQ8C 1BVZA 2ZCLH 3ROOB 2G2RA 4D9RE 3I9GL 1RZIB 4NKDA 2H7WA 4JPKH 3ETBF 1VFOA 3SPVB 3QDGB 1JFQL 1DUYA 3CVIL 3N43F 5HGHA 1NMAL 4YXHH 1IVTA 2CUHA 3UG4A 1G1KA 1S5HA 3EGSB 1Z9OA 3LSOB 4LASL 5IW6A 2WV3A 3HNTH 5EUKB 3UGEA 1AG0A 4B41A 2C26A 4U1MA 2IXQA 3I02A 4FNLL 1M7IA 2FX9L 3IKKA 5CUSL 3NZHH 4CVZA 4XVUD 2Z4QB 5J06A 1BVOA 4UQ9A 3UYOD 2OXHA 1LWRA 5CLZA 1P4BH 2BSEA 4XC3H 1GJWA 1XGTA 4JM0A 1PQZB 1HE7A 3WKML 3DPBA 4UMGA 1JZEA 1SEQL 3TFKC 2KERA 4JO5A 4G8GA 5T5FA 4XP1H 1YAIA 4A6YH 1I3VA 3EO9L 5IOPB 2YGPA 4EF3A 3T4YA 2EYRA 5IG7B 4ZMPA 5AENA 4PS7A 3U0TB 5IJVA 1R9FA 3CQFA 1WWWX 3NIDF 1RIVH 2HLFD 5JW4M 3MLTB 4ZXBA 3BRDA 4LPWA 3K6FA 2XXFA 5JQIB 5T33H 3DNKA 1J8HA 3WV0A 4IU2B 3E6HA 1NFIB 3GMRA 1YEHL 1TENA 2V8LA 1G7MB 3ZZLA 1HI6B 3BAEH 3VWJD 4PJEA 4JFQA 4KWUA 2YPLB 1UYWL 3N04A 5C7XL 4ANVA 3VRIB 1L9SA 3MBXL 4EI0A 2AXFB 1EAJA 3CFCL 4GSDH 4TVSa 4QRQA 3VXOA 3L5WA 1UZ6F 2MTAA 2OL3L 3AM8A 1HWWA 3DOSB 3NQIA 4GBXB 3JV4B 2ZKXA 1HKLH 4LLYA 4WHYH 2WUCH 1R19A 1WCBA 3BMWA 3IDJA 1DJZA 1NEZA 4UOW1 2Z91B 3WIHL 2AVGA 1XGPA 3TO2A 1WCBB 1Q9OA 3T2QA 2C4FT 3KPRE 4UTBA 1DLFH 4IGBA 1F3RB 4ONOA 1QEWA 1PD1A 1U8JA 1A14L 2UWEF 3KPLB 2RMNA 5JOFB 5DMGD 2FNBA 4KQ3H 4G6JH 3K71B 3DBXA 4KFMA 1IAKA 3RVWC 3WS6C 4C83B 3TBSA 2DEYX 3K7UA 1R24A 1IGFL 3ESOA 3QUGA 5KYNA 5HI3C 1Q9WB 4R4BA 1S9VB 3N40P 2C4XA 4X83A 2XDHA 3GXIA 2VCOA 3IDMA 5F9JA 1NIAA 2G3NA 1E5UI 4Y4HB 1F3DH 2D9CA 4J28A 4PJFA 4AIZA 1KEGL 1XSIA 5IWLA 3S3PA 1W0WB 4AC2A 3QJSB 3NFNA 4QYOA 3TCLB 3P9MB 2WGXA 3WO4B 1Y6KR 3G9VA 4KTDL 2HVBA 1IEBB 3CDZB 4Q9QL 1W0VA 3X13A 4N1HB 4BRJA 5CIPB 2IH1A 3VH8G 2PYEE 2R27A 3D12B 3QNYA 4E0RA 2NY5C 1KTCA 3JWDL 5IJKA 2N0KA 4FQIH 4G7RB 4ZS7H 5JW4N 2ED6A 4NXKA 3PF2A 3OKKB 4NB7A 3T4AC 4JANA 2D03L 2OTUA 3AT9A 4HXBH 2P8MA 1A4AA 1FYTA 1XF5B 2VAAA 3GHEL 3KYKH 2BCKA 4K71B 4P23B 5G2NA 3N06B 4LCWE 2P47B 2O72A 5E2UL 1GR7A 3O4LB 3IU4L 5GGRY 5DCCA 5ITBH 2Y6TE 3FO9A 3O2VH 3MV8B 3SZKC 1HJCA 3TWCH 2CMRL 3Q3GA 2VLJB 3FRPA 4F9PA 2HRPL 2IO5A 3O6FD 3T71A 4AI7A 4HT1L 1CLZL 2YD3A 4XO9A 3VW3L 1CXFA 2OTWA 5HI4D 1SXAA 2WQSA 5J13C 2VLMD 5EZPA 4CA4A 4ONFH 4WI2A 1QTSA 2DDQL 2FLMA 5DJCB 3W2DH 4IU3A 4YGVB 1COBA 1S7TB 1XF2B 4JQXC 4OQTL 4XP1L 4OGQC 4XCNB 2EJ1A 2XA8L 1GGTA 1IC7L 3Q01A 1J8RA 4Z7WE 5E9DE 2Z64C 4R4ND 1LO4H 2OSXA 3K1KC 4N87A 3T3PB 2QR0A 1IGJB 1S7VB 4YL9A 4A39A 3K74B 3SQBB 4UQ3B 3DIVA 3CN1A 1Q8MA 5GGQH 3CZKA 2CBTA 4GQ9L 3KYNA 3SHSA 2Z92B 5ICZA 3PJLA 3OVUB 3KLDA 3GUTB 1WZLA 1YNKL 3DUSB 3O2WL 4G42B 4PVNA 1LNUB 4LOVA 2V9QA 4PLKD 4E9QA 2MHAA 2FWOA 3TGXA 4N2KA 3L4UA 5I1LA 3K6DA 3JWOL 1AQKL 1YO4A 3SGKA 4B60A 4ZMAT 4HUUA 5CBEB 4D7BA 5CEXA 4HFUL 1BBJB 2VR5A 1DBBH 1T7VA 5CHNB 1XEDA 3BWZA 1AC0A 4MTMA 3IGKA 3D2UD 4HMDA 2RFXB 2PYED 4YHOL 2XBZA 1OCWL 1LE5A 5EUKA 1CE1H 4LCWB 2XACC 3A23A 4PJBE 5BO1L 1MFMA 1WZ1H 3H3BC 1TTAA 4KKAC 3WJJC 1BVLB 3A47A 1RKRA 1MWAL 2WBXA 4AIOA 2ILLA 2VSCA 4ABWA 1H9DA 4FADA 3HE6B 4PJGB 5HTSA 4FNQA 5LBVA 4ZOBA 4ZW7A 2YSSB 3GLDA 1MJUL 3NJMA 3U9PL 3HB3B 2IAMB 5CJOL 3QIUB 3BW9B 4PWJA 4MXVE 3RE0A 2BMKA 4AEFA 5K9KB 4LF3A 1R3KA 3MV8E 1K2DA 5FC9A 3PQYA 2WINB 5IBUB 5CXPA 3SDCB 1CL7L 4GXVH 5HVFB 5KG9B 3MRMB 3W0WE 3NJXA 2WVVB 3C09C 3V6OE 1INEL 1J18A 1OQXA 3ES6A 1A3LL 1HEZA 2VDQL 3DMMA 4PJBA 4O2EA 1OAKH 1FBIL 4H0LC 4R7XA 1DVZA 3Q7JA 3MRMA 4U1GB 4WWOA 3U4BH 4Y9CA 4WEUD 3GT6A 4WAFA 3ABGA 2B4CL 3NFSL 2R1YA 5DS8A 3QIBC 3ISWA 4M4PA 5T1DH 5F7NC 2OJZL 3RWGB 4PJ8B 3VXSA 2P8PB 4R90L 5C0EB 3LHAA 3PAYA 3ULUL 5JHDD 4Q0XL 3N1GC 1CL7H 4GXVL 3C2AH 3C6EA 4I1PA 3MCG1 5SX4I 1TYEB 5AVUB 3PWLA 5KVDL 4U1JB 3ZMRA 2DMCA 2VDPH 5K39B 3BZDA 4OZHA 4HJ1A 1LD9A 32C2B 3DJ9A 2JJSA 2NNFA 2ZOWA 3V0IA 3H55A 3I75A 3U1PA 2D8KA 3MRQB 4M1GH 1JVKA 1UFUA 1W8OA 5DR5L 3VD4A 5H37G 4IS6A 5B39G 1F6AB 1J10A 2NY7L 5AOMA 1NJ9A 4C55A 4NI3A 4TM9A 3CXHK 5C2UB 1WP6A 2EXWD 5ID0B 3GLEA 1VPOH 5I1DB 4HJUA 3NZ8A 3LDBC 4M7KL 5HDWA 1YNTF 2F58H 5FCSH 2NZIA 4MGXA 1FF5A 1JI1A 3ARVA 3BPCB 3WIIL 5KS9B 1PFOA 1JF1B 1PL3A 4NHCH 1JD7A 2P4AB 2FX8L 2C9SA 4QXVA 3E8UH 3MRIA 3O0LA 4OZHE 4LPVA 1NIEA 4UM8B 4Y0GA 5EG6C 1KJVB 4AL8H 1WBYA 4Y1AA 2QADB 3MBWA 1IO4C 2H8PB 4OAWB 4UV4H 4X99A 1RZ7H 4ZI8A 2P1YA 3ARUA 2IH3B 3PL6A 4NGHL 3QWOA 1UZ6E 2H6UA 5HHQB 1ACYH 3MLYH 2G75B 4UNVA 4PGZA 5E5RB 3EF7A 5GJSH 5ITFB 4O2FA 3M7OA 4OT1L 3SKJL 1QABA 1QW8A 3EBHA 1ZANH 2ZSWA 4BBWA 4M6NH 3BEVA 3L1GA 2Q3XA 4QRPA 1YEEH 5ALCH 2NXZB 2YWYA 2Y7QA 3L5JA 4MMZA 4ZTEA 3U0PA 3AMKA 4HEPA 3ZVVA 4G1EB 3FUIA 4PRHD 4K3EH 5IMMB 2F2HA 1CDJA 5AYQA 2FJFB 1CFMA 2DMHA 4N9GB 1JGVL 4G59C 1VDGA 4RMQA 1AKPA 2R1WA 2YXWA 3CZNA 3NCEB 3TWCL 3K80A 4TUJA 1A7OL 4XMTA 3T4AA 1O7VA 3DTXB 2Z7YA 1D9KA 5GGSB 3BPOB 4OJDH 4RH4A 4NBZB 1E28A 2LTQC 2DQTH 1CE6A 2MOVA 4AT6A 3BDYH 1N67A 3IVKB 4BHUA 4ZUTB 2QSCH 3L3OC 5EZOL 1FNSL 5SWQB 4L2YA 1BQLL 1I1AC 2GBUA 2HG5B 4FQCL 3SCMC 4HUVB 3KGSA 2A77L 5KYYA 2HFFB 1H8LA 3VXMD 1S2EA 2Z9TA 2ICWA 4PP1D 5C0GB 1D5IL 4E5XG 1KLUB 4PV9A 5JW4R 1IGFH 1VJSA 5EF3A 3FXIC 2FYYA 3IYLW 2IC2A 2X4OA 2OXGA 3Q48A 4Y16C 4GRMB 1BFSA 4L37A 1H8NA 1A1MB 3WLBB 2F5AL 2XXCB 1FNSH 1NFDF 3PHOA 3JV4A 1D7CA 4FFVC 2DWYA 3IJSB 4IOSA 4ZPTA 4ODHL 4JFFD 4Z3JA 1JXGA 2J55A 2Q7NA 4S1RL 3VI3F 2MOQA 3VA2C 4G1MB 4FP8L 2Y72A 1U95B 3RA7L 5ALBH 3NIFB 1Y0LB 3HVDA 1R0AH 4H20L 1TZIA 1SHWA 3DJSA 3DV4B 1C9SA 2JKSA 3KYMA 3HC0B 4Q7DA 3BP4B 2H3NA 4EIZC 4MXVF 1FG2A 4FG0A 4TXVB 5F7DA 3T2NL 3TH4T 4B9GA 1NGQH 4HHWA 4YSOA 5B1BB 1HT6A 1ZT1A 3CVHB 3IMRA 5JORB 2PPAA 3MJ8B 1LK3H 5I8CA 2R2EA 3FU7A 4F24A 3FT3B 2GPZA 2GJZB 2BNRE 2QQKL 1G6VK 3L16A 5EEUA 1URIA 1R0AL 1NMCB 2AEQL 3B7TA 3QFJB 3GSNH 4WW1B 3C2SA 5C9JA 3D51A 5JHAA 3IJ9A 1UD2A 4OGAD 4OCRL 2VWEC 2Y69B 3P9MA 2JCCF 3NCJH 1OTUD 5FO2A 5MP6H 1ZHBA 4V1DB 1U8PB 1HWGB 2IANA 2NR6C 3GKZA 3ORJA 1TQTA 1GKOA 1AQHA 4PRIE 3QCVH 4X0NA 3TEYA 4OF7A 2ICEA 4OQ1A 4PBWD 3VFTA 2BVQB 1MAMH 5BPPA 4DGIH 4JGNA 1EZVX 2W9DH 3DX8B 3ALWA 3CUPA 4H25B 4ALAH 2DQDL 2WLIA 3WTTA 5KSAB 3IMWA 5IWLC 5FX3A 2BFVH 4PD4J 4PN6A 4N8PA 4HUWB 3NUKA 4U7KA 4GS7C 4O02L 3UMTA 3V0GA 3NIGB 4R0LA 4NP4H 1NGXB 4GQQA 5CZVL 4CVZB 3LRMA 1V7ML 1CQYA 2MEJB 4N2LA 2WQAA 3DHPA 4H40A 2V3DA 3K0YA 4XNUH 5E1AA 2GVYA 3ARGC 2AXGB 4RRPA 3MLPA 5T1MA 4JPWL 1LK2B 3FYEB 1X5IA 4XMLH 5DMKA 2FVNA 4L8SC 1N3NA 2J4WL 1RZ8A 3KPRA 3QS2A 4K7PH 4Z95H 1OE2A 5CP7A 3RGHA 2H0FA 2IDUA 1Q94B 4RMUA 3R06B 3NPZB 3ZX1A 3ARGB 2DLIA 2H26A 3BN9C 4YDJB 3TO4C 3P73B 1T21B 3J2PA 4A2LA 2JELL 2UVFA 4L4TA 3QJUB 2VXQL 3MRFB 2A9DA 3LKSB 2NZ9D 3CE1A 4Z77A 4OZIB 2XWRA 1MVUB 3NEOA 2SEBB 4U7SA 3HC4H 3H54A 3KGTA 5E8OA 4YAQA 2IXQB 1WGOA 2WSPA 3MJWA 1B4JL 5HYSB 3VVWA 2OL3H 1AHWC 3P0VH 3TVMA 4BE5A 4FAAB 2X6MA 4BK5C 1N6QL 4S2SA 2Y1ZA 2V6HA 1EHXA 1IC1A 1NA8A 2YGQA 4TUOA 4WY7L 1CFNB 2Z3FA 4G8GB 2QMJA 1LEGB 3GYRA 3O3EA 3NJHA 4K9EC 5AZEH 5BZWB 5HDQL 1WFUA 1PNDA 4HV8B 4IDLA 4ZFZA 4L8BB 5HI4C 3ZHFA 1CC3A 3MRRB 1P2CB 4JFOB 1L3WA 5E5MB 3G6JE 4MD0A 3X1EA 1PJWA 3PL6D 2APSA 1X9LA 4WO4A 5L4IA 4B9PA 5I0YA 2IPTL 4G8FA 1MCOH 3CBRA 2I9LA 4HHAA 5ILTL 2EINB 2D31B 3SE3A 4MQ7B 4PV9B 5E9DB 2R1XA 2LT9A 3TV3H 4JCWA 1HHJB 2V2WB 3UTZB 3SGDH 5FO7A 3IMVA 4IQHA 5CLYA 3PNWA 5H35A 2AV7B 4HUMB 4I88A 3D2UA 1I8KB 3C5JB 3IRZA 5B1JC 2J25A 3FOMA 4OSUH 3K6NA 4XBMA 4L1DA 3SCMD 3DUUA 1U3HC 5SX4H 5MHSE 2C9PA 4Z3FA 1RPQA 3H9YA 2AK4B 1FIGL 4AXWB 2NPLX 3OSVA 4M8QB 4EJ1C 3L3HA 3EYOA 1RK0B 3MLRL 1KXQE 4NJAL 4GY4A 5EOCL 5DRXB 2LU5A 2R2HA 3E2HC 4MZIA 2VDRB 2BSTB 2QPUA 4TNVK 1PGRB 3N41B 1RJZA 2Q8AH 2OMVB 4NT6A 4KXZI 4H5SB 4FQXD 3F12A 4OGXL 1FIGH 2CG9X 2R2CA 3D3VA 2W81C 4FMKA 2NY0C 3VFWB 3FT9A 1XVSA 1RV6X 3OTTA 3V5KA 1DCLA 1TTBA 4D9LL 1XBRA 1IEHA 4JMNA 4C4UA 3FQXA 3FPYA 1DVFD 3L1EA 2YD9A 4PJCA 2FBJH 2DRUA 3LS5L 4ICXA 4NCC1 3VFWA 3QIBA 1SJMA 3FAWA 4PEEA 3EO0A 1AO7B 4IW4C 3AY4A 1JPFA 1IBFA 5E4IA 4Z23A 3D39A 2Z34A 3PRZA 3AROA 3E38A 4FQ2L 3X11B 1DQLH 3FT2A 5DWPA 1J9SA 2ICEB 3BPLC 4K9JA 4NQCA 3TA3A 3BP7A 1K9TA 1IM9D 1D6VL 5DJXB 1JG9A 2JXMB 3W11D 3I6KB 5I5IA 1XIWD 5H37H 3T0EA 3BXNB 4DOHE 4TYUA 2YD2A 1MLCB 2VE6A 4NN5C 5HHME 3RWFA 3ELAT 3QJXA 4F7MB 5AAMA 2J8HA 4NLAA 1K3ZA 2HKFL 5C0AE 4U05A 3GMOB 4WI5A 4HOMA 1N26A 4RVBA 1W9XA 2VLJE 3DVIA 3KL3A 1WBZB 3CVHH 5AW3B 4NQXA 2NXZC 2WIIB 2A0LC 3CJJA 3WENA 1U30A 3CZSA 1JN6B 2GBTA 4M43H 3SD5A 5FYLD 1C5CH 4CSTA 4AG4H 3B9VA 4AVIA 4DGIL 3QUXA 4RRPM 4GIOA 5F7UA 1ASOA 4UOQA 1NAMH 1LILA 4PWHA 2WIMA 3LN4B 3OWEA 5EIIA 5CU9A 1L0PA 4MA7L 5LG1A 3WXWL 1KIPA 5CJ8A 2Z93B 1DBJL 1PX3A 3PWPB 2EH7H 2AK4E 4PJHB 1EDQA 5IM7B 4D0CA 3ATDA 5C0CD 4HDIA 4ADGA 4JRYB 3QC6X 3RDJA 2NDGA 4PJAF 4Y2NA 5CBAA 3D06A 1KXTB 4LT7A 4LSRH 3P4LA 1F1AA 1MF2L 2GJ6E 1HAUA 5EC2A 1IBDA 1UVQB 3OXSB 4X8JA 3GO1H 3UZEA 4N6QA 3B4NA 4AOFA 5D7KD 3WIHH 4FEIA 2CHZA 4LLDA 4RZKA 5CGTA 1MCHA 4HJ0D 4UIMA 4PG2C 4F7PA 5T1LA 1XH3B 5GS2D 4ATTA 2LAAA 2DWEB 1TPXC 1RZ7L 4WCYL 4S0HA 4KGJA 2DI7A 4CGTA 4JG1L 3ML9A 3T3ME 2WZ5A 3PHSA 5H2BB 5MEPB 2MCG1 4HX1A 1NZRA 1YN7A 3VUAA 4LSQH 2D4FA 2HX7A 3PY9A 3OPZL 2NSQA 3D87B 4P5MB 5I0XA 4U2ZA 2ENJA 1E5ZA 5D71H 5AKVA 2VABB 4FXGC 4N2BA 2FUTA 3ZPDA 1WH0A 2HJFA 3BQUC 4WW2B 1QFWM 4ANXA 3QQ9D 4HF5H 2AABL 1TG8A 4QLWA 4LHQB 3VWJA 4GSXA 3VNZA 1N2RB 2I9LB 4DUVA 2M1KA 3O6LH 3M7FB 2WVUA 2Y3NA 1XDTT 3RBGA 2GY7B 2V2TA 3BAWA 3IAGC 3O9WC 3E9TA 3SDXE 4P04A 3BDYL 1AHMA 2AGJH 2FO8A 4GMSH 5E2TH 3H42H 4FA6A 1ASPA 2YQGA 4MRBA 4DQAA 3U4AA 1QI4A 4G2AA 1T0NA 2D7NA 4XO4A 5EZIL 3WTVA 3ABZA 4ZFZB 4FQHB 5C08B 4JCMA 4GQPH 1I8IA 3RY4A 1GOFA 5BOZG 3FONB 3R8QA 3UAJA 4FQHA 4QT5A 5DI8A 2CDGB 3PWNA 5FDYA 5BCAA 1BFOB 3BD5A 2APXA 4P3CL 2BSED 4AM0B 3ZDZF 4O2EB 2DD8H 2MSPA 2CSPA 3U7YH 3PJNA 1M7DA 3IU3B 3WAKA 2Q7YB 1B9KA 1MUJB 2B7DT 1I7RA 1BAGA 3RNKA 3D48R 2ZNWA 4PB9H 4KI5F 1B88A 2Q7YA 3KDMB 2YQ3A 3MAWA 3FBQA 2V2XA 2X9XA 3HE7A 1IAII 5F89A 2Z7ZA 3GSRB 1O7DC 3ILPA 5HYSG 4GKLA 3GSWA 2QTEA 3ARDC 1WD9A 2QDVA 3K2UL 1OTTC 4N8VA 1TQUA 2NX5E 1J0YA 4IOIB 1VADB 3UTTB 1KGIA 4MAUL 1Z9MA 5BRZA 4M7LT 4OJFH 3M45A 4YO0A 3CLWA 4AVJA 1I7UB 5HHNA 2J57A 4R7DA 4DPAX 5IJCC 3DX8A 3Q5TA 3JUZA 1K8DB 5K1VA 2O93L 3BLBA 1CT8A 3KM1A 1WITA 3CMOL 3KXFB 3NDYE 2CO4A 1FRGH 3O0RL 3TJPA 5BS0B 1V5JA 1FDLL 1LO3L 2QHRL 2D3LA 4CKVX 1JZJA 1J05B 2RACA 1ORSB 4M93C 5FYJH 2B59A 1CBVL 1TZHA 5J5EA 1AE6L 1HCFX 3VYOA 2HTKD 5I2IB 3SKUD 3UIZA 3T6QC 3QZWG 3U48A 1OP4A 1XR9B 4FULA 4WEMB 4YHZL 4N0UB 4X5XB 1BAFL 4Z3IA 4ZFOB 1OY3B 2Y2WA 3WDHA 1G7JB 5FKAA 1KLGB 3DRTA 2E0PA 1NUFA 4N26A 1LMKA 3QCUL 2BNRB 5EWIL 1NFDE 4RIRB 1AGFA 3ARBD 1QVOB 1A1OA 1RK1B 2H2SC 2RJMA 4M02A 3ZK0A 3T6ZA 1UKSA 1M1SA 3RUGA 1I9EA 4A2EA 3O3DA 3TZVD 1JPST 3A4FA 2NNRA 1XL4A 1EJ6A 4ZFFA 2PW2B 1BQLH 4BZ1L 3EDEA 1XR8B 3RUGB 2BK8A 1J87A 4POUB 4BK8A 2R4RH 4FLHA 1B90A 1LO0L 1BQKA 3RLSA 3FH5A 4JG1H 3VI3B 1E8YA 4AQ1C 4PGJA 4KGLA 1EGJL 1I31A 1DR9A 1PCXA 4AGLA 4BIKA 4TLKA 5C71A 4LMQE 3P4MB 2F8XC 4FI8A 1GSMA 1WC7B 2IMMA 1M6OB 2KDYA 3CHQA 3LYRA 2QKIC 4L37B 1A1MA 4BSJA 1IGMH 5E70A 3MX0A 2XG4A 1MIML 1U8NB 3C60B 5C0FB 2V9RA 4NNPH 1DVXA 1H8OA 1YECL 2BP0A 4Z76A 3QUXB 4KY2A 4HK3N 4L1BA 2VR4A 3CSBA 5EFIB 1RJLA 3QA3A 2RD0A 1RSFA 1T5XB 2EXYC 3DGCR 3IF1A 3GBLA 5F9DC 4XZ4A 4PD4K 4TOYL 1UD4A 1WE5A 2YC1A 5DHXB 3NN8A 3QJOA 2KDGA 3QE5A 2VZVA 2YMXL 3QUXC 3GGWA 3UEZA 1FL5A 5FA4B 2CZNA 4APXA 4KU1A 4AM0Q 3VYNA 1LYQA 5E23A 4A66A 3WNJA 4YHIB 5D7JC 4A7GA 4KTEL 2DIBA 5J6HA 4KK6D 4MBRA 4NAMA 4DP5X 2ZP8A 4D94A 3SKOA 3MLWL 2VM4A 2X4OB 3G6AA 4YK4B 4A6YL 5HJGA 2XA8H 4MJIA 2ITFA 2OMZB 5C3LD 1NC4A 4NUGL 1JWMB 4MQXC 1S9VA 3BE1L 1EQWA 4HULB 1OT4A 3UAJD 1GH7A 4ZO7A 4PG2A 4Y2LA 4FF9A 4GNKB 3DJTA 4DVRH 3SPCA 4PIRF 1HU8A 1EAOA 1Y7VA 2BM3A 2CA3A 1M1XA 1CTNA 5J1AB 1KIQA 1OL0A 1OF0A 1AGDA 5LCVA 2P26A 1U33A 5JPMC 1SOXA 1DLHA 3VI4F 5I28A 2V5MA 4BQBA 4W1TA 1TFHA 4AY0A 3WTUA 4XPGL 2EZ0C 3OAUH 3S5YA 2EKSB 5I16A 1NDGB 2ODIA 3B8SA 2P8LA 3ZKSD 3X1NA 3R1GH 4LVNC 1NMCC 5HI5D 2D3NA 4BSWB 5GZOA 3WOVA 1G1YA 3DVFA 3VXUB 3FT4B 1FYTB 3NCCB 3HS0A 5D6CB 2BVYA 4NFDA 4Z0XA 4H7VA 3Q13A 2EE6A 1VZIA 1R1CA 4NZJA 3VXTB 1BYOA 4TRPL 3HN3A 3LH9A 5JNYA 4ZZKA 1F6AA 5DVLA 3FTYA 1IFGA 2CUAA 5K9QG 1KSRA 2DWXA 3QG7H 2XX1A 4Q56A 4I77L 1ORQA 2DJSA 5JPNA 1ES0B 5DJZB 3DX4A 3CLFH 1KNOA 5DZ9A 3GZOA 2EDTA 1T89C 2EAEA 4HZLA 3G5YA 4KOBA 4F9LA 2K4WA 3WMQA 3CN0A 4KZEL 4Y8DC 3TIDB 3CSTA 4ORZC 5GGUA 1DVFB 3WSQH 4LRNL 4JRYD 3MNWB 3NYKA 4QLRA 2KPNA 2NY1B 3CU1A 3LIZH 4ZSOA 3UJTL 2BRQA 4P5KB 3WUWA 3SGEI 4P59H 1J0IA 1T5WA 2IDCA 2D7OA 2UZIH 2OFQA 4S1SH 3JWNH 5DYOA 4AYSA 1EO7A 3DHUA 5IHWA 5GIRB 1R5VA 1MCWW 3GBMH 3GUFA 3LKPA 3BH9A 3S96B 5KVGL 1IEAA 3CFIC 1M7IB 4GQ9H 4WFED 1FG9C 2NY3B 1MZYA 2FZ3A 4TUOB 3MA7B 4PY7A 1GPOL 2W0FB 4OZHB 1UGKA 4Z78B 5LQBL 2P24B 1A02N 3BVTA 1Z5LA 2XQYK 3B7SA 1CI3M 1FN4B 1TTGA 3P30L 4R5VA 2X6VA 4TNGA 3O8XB 5JLZB 4RCAA 2K6ZA 2VJ0A 3SOTA 1J5IA 1P7KA 2ZCZA 3CFCH 1QPPA 4OFQA 5HDOA 1K5WA 4UF7C 3HMXH 1B4JH 1M3IA 4PWIA 3VM7A 4F7CA 1DE4B 4YHYC 3AS3A 2H9GA 4QXUH 2R8SH 4BFJA 2ZG1A 1PYWA 2OM5A 3PHAA 2X9WA 1J1XH 5FM5M 1OE1A 4JFED 3UAAA 4YHKH 4ETQA 5FUOH 3PV7A 3CHXA 2WBJB 1T2JA 1WEJL 4V33A 2D7PA 1F4HA 4NFBA 4X7EC 2LV4A 3P3RA 1N3NB 2BP0B 2DDQH 2Y2YA 3W2DL 2HLAB 4J3VA 3DARA 1KN2H 1TDQA 2NYYD 4MMXA 3G5XB 5HGAA 3V55A 1BBJA 4NM8H 2BCMA 1AD9A 3B1TA 3FS9A 1ETZB 5J6GB 2WQWA 4OCWH 2GAZA 1KIRA 1KV3A 4PREA 5IROC 3GFUA 4F1ZA 2PXYC 1EVTC 4JDTL 4NC1C 4BV1A 4Y4FA 2K70A 3PJSA 4FQQB 4NUJA 5TE6L 3DPBB 4NYLA 4AQ1A 1WWAX 2H2PC 3S35L 4DIXA 3GTTA 4Z8FL 1X7QA 1YEEL 3AAZB 3HB3D 4IOFC 4PW4A 1CXEA 1KCUL 5G4MA 1X5GA 3CXDH 2WLLA 4XNQB 4OZGB 2NRDA 4ZTOL 2OX5B 1NKOA 3VXRE 1JGDA 5DHYB 4FN0A 3TP4A 4LLQA 4XBGA 1O6TA 5EBMB 3Q2NA 5CHNA 2BIMA 1BFOA 3VFSB 2ITCB 2I25N 3LEXB 1BHGA 2XFXA 2N4IA 3EYVB 4QY8A 5ICXA 4FA8A 3WFZA 3O9WA 1R4XA 3QCVL 5GRZA 3VGEA 1XGRA 2PXYD 2ZJSL 3SZ6A 1SXCA 2TRHA 4NKOA 4CILA 2VJ8A 3UC0H 2X41A 5JYLA 2J8UA 4JFDD 1FNGB 4ZUWA 1UD8A 3PWJB 3FFDA 2X3AA 2WO4A 2BOCA 2Y5QA 4EQ3A 5LO7A 2WKOF 3TA3B 1MFBL 3FQNB 3KPQB 1EBPA 4X5LA 5DJYB 1E3XA 1F4AA 4M29A 4ADJA 3LS5H 3PDOB 2P49B 4XP9L 4TPRH 5E2VL 5IVXB 1I7RB 3VXRA 2EACA 3QEGL 4G9FE 4BH7B 1ACXA 2H32H 1NIFA 3WNNA 4DVRL 3ZGHA 1KBGH 2X4NA 2DYSB 3NA4A 3THML 4P0DA 4QYAA 3VG0H 3OKMA 3TXAA 1EV2E 2HP4A 4I0PC 7PCYA 4A6YA 1F11B 5HPMA 2FX8H 5J1AA 4NIYE 4HJTA 3CVIH 3AWEA 1YEKL 3FN0L 1BF8A 4FHBD 5T1KB 3GMMA 4Y1AD 5CINH 1U8JB 5ACLA 3HI5L 3UGUA 2E6JA 4UNUA 5CWSB 5T5FH 4AYID 2JKJA 4XRCA 3L3KB 3X3GL 5D5MA 4UOW0 2JQAA 2O5NA 3HZKA 2BSTA 1GVIA 5IMLB 4QXUL 3EH5B 3IRPX 2R8SL 4ZAKC 4EVNB 1Q9OB 5JPMA 4FHJA 3AACA 4G6KH 3LB6D 4F27A 1RZKC 3ECUA 4MLIA 4U1IA<