2CM5A

Crystal structure of the c2b domain of rabphilin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
144
Chain Sequence
MALYEEEIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords RABPHILIN-3A
publication title The C2A-C2B Linker Defines the High Affinity Ca2+ Binding Mode of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 38
structure length 144
sequence length 154
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2cm5A00
4QAMB 1GMIA 2BWQA 2K3HA 2ISDA 4FULA 4BGDA 4F93B 1YRKA 1DSYA 3TJPA 1TJMA 3TWYA 1E8XA 3F00A 4LDCA 3APFA 4TUUA 2CHXA 2K4AA 2WXJA 3L4CA 4ICWA 4L1BA 4PS3A 2LHAA 1DJYA 3CSTA 4PS8A 2CHZA 3NZSA 3F01A 4KITB 2CJTA 3APDA 4TV3A 4HVBA 2CJSA 1UOWA 3L16A 3W57A 3ML9A 2NCEA 2V4LA 1HE8A 4AJWA 3N5AA 1E8YA 5G55A 4URKA 3NZUA 3PRZA 2DMHA 2YOAA 2ENQA 3SD5A 2A4ZA 3QR0A 4NP9A 4DK5A 4FA6A 2WXRA 4OVUA 3NSJA 5H4YA 4L2YA 2NQ3A 1A25A 2Z0UA 1DJIA 2WXNA 4FHJA 4HLEA 2WXGA 2WXMA 4XX5A 3GPEA 4ANWA 1QASA 1BYNA 4WWPA 2WXLA 3TL5A 2D8KA 2ENPA 2ENJA 4XE0A 2YRBA 4KZCA 3KWTA 3L17A 4LCVA 3F05A 3PREA 2FJUB 3IBEA 3PS6A 1CJYA 3RPBA 1K5WA 1UOVA 3CSFA 2X38A 1RH8A 4V11A 3JZYA 2CHDA 4FADA 5CCHE 4L23A 4AOFA 1BCIA 2WXPA 5G2NA 3L13A 3QJZA 2Q3XA 3R7RA 3QAQA 2DMGA 3F04A 2QZ5A 3QARA 5EDSA 3FDWA 1TJXA 4J6IA 3QK0A 1E7UA 4NPKA 4EZKA 1E7VA 3T8MA 1UGKA 4FJZA 4ANVA 1DJWA 4ANXA 2K8MA 4GNKB 2FK9A 4A55A 3ML8A 5CCJA 4FHKA 2K45A 4Y1SA 4F1SA 4TS6A 4WWNA 1RSYA 2WXHA 2WXFA 4NPJA 5JHAA 2Y3AA 4EZLA 2WXKA 2CM5A 4WAFA 3OAWA 2EP6A 1WFMA 3FBKA 3PFQA 1E8WA 4NS0A 4OVVA 3PYCA 4QJ5B 3ZVVA 2B3RA 4MJJA 1DJHA 3HHMA 4KZ0A 3KWUA 2WXIA 3W56A 4Y1TA 2CHWA 3L54A 5KJ7E 4QJ3B 5JHBA 3R7QA 4L1LA 2A5UA 2WXOA 2NSQA 4EZJA 3ENEA 1BDYA 3HIZA 3M7FB 4GB9A 2UZPA 1W15A 1DJXA 3IM1A 4IQHA 1DJGA 1E90A 1QATA 2CM6A 2ZKMX 3MJWA 4WWOA 2WXQA 5H4ZA 2KI6A 4PS7A 4LT7A 4XZ4A 3ZW3A 4F91B 4ICXA 2R83A 3LJ3A 3L9BA 1WFJA 3RDJA 2N1TE 5T8IA 4IHBA 3B7YA 4G11A 4JPSA 1DQVA 2RD0A 3OHMB 1W16A 3ZIMA 4FLHA 4ANUA 4BFRA 3QR1A 3S2AA 3P2BA 3APCA 4FJYA 4QJ4B 4WEEA 4F92B 1E8ZA 3DBSA 3DPDA 3L08A 3HN8A 1DJZA 4DNLA 5CCGE 2JQZA 2QZQA 1RLWA 1V27A 2Q0ZX
chains in the Genus database with same CATH superfamily
3TN0D 2V5YA 3VNZA 1HXMB 2X4TA 3D06A 3KR3L 3M46A 4H2AA 3R0NA 3TWYA 1ZLSL 3B8YA 1T7VA 3TBTB 3MMEA 4Q4EA 5IREA 4PQXA 4PJBA 1I8KA 2AK1L 1TEYA 2WC7A 4FFYH 2V37A 4KQ4L 3ELQA 5A3IC 4NZRL 4HWZB 2AKRB 4XI5D 1HAWA 1E9OB 1PEWA 1XMEB 3H6AA 3IDGA 4AQAA 2GI0A 4E5XA 5DK3A 3FHQA 5B3JE 3CN0A 4MDRA 5BQDA 3LKQB 5AAWA 4NZFA 2BOLA 4FNLH 1ZPLA 3N0AA 1HFUA 4PJCB 3S5LA 4L2YA 1MFBL 2AXHA 4N1EA 3JWNH 5DUPL 5JLZB 1LO3H 3PU7A 5TK2A 2A83B 2Y7OA 1FPTH 2OXHB 5FDYA 1VENA 3AVEA 4POYA 3KGSA 2XXCB 5CCKL 4HUUA 1D9KA 1XL6A 3FT3B 1M53A 4IKKA 5C6PB 3DK2A 5F8QC 1BQKA 4N0CD 3VDBA 4QT5A 3LNEA 4OH2A 1C16A 5IMLB 4Q14A 4X7SH 2FR4A 2JLLA 3UTQB 4TUJB 1D5MB 1VPOL 3WY1A 5FPIA 3H7LA 4MNHB 1K8IB 3DRTB 4LIQL 1T1YA 5GRJH 1OY3B 1DJWA 2FNWA 1FVDB 4LVOB 1CGXA 4UILH 3KPMB 1KDJA 5F9AC 4RMWA 4N8VA 2VABA 3NN8B 1BHGA 5EN2A 5B1AB 4JLRA 1AHMA 2DD8H 5MEOB 1WITA 4Y2OA 3T77B 5JDSA 5I8CA 4D0DB 4FFWD 2F5AH 3CXHJ 3O3AA 3BKJL 4YHLL 2BH0A 3QJXA 3ARFC 4GQZA 4XXWA 5E6ID 4PJ8D 3B9KB 3OSKA 5SX4H 3SPVA 3MGTA 2D7TL 3IJYB 3NSCA 4G9FD 4HGKC 4AZ8A 1ZJBA 1RURL 2JIXB 1HXMA 2AJZB 3SGEH 1T03H 5ESAB 4KTGA 3MBXH 4RX4D 3TBTA 2YZ1A 4PY8I 1HYRC 2VW7A 1K6QL 2PWGA 1I8AA 3DUUB 4LSVL 5DSCB 5TQ0H 2Z91A 4K3EL 1F00I 4HWZA 1IKOP 4NN6C 2AKRA 2DYPD 3TF4A 3QDGA 1M3IA 2B0SL 2NNCA 3GDCA 4ZUTB 2ZNWA 3QI9D 4Q6IB 5E8OB 4AM0B 1OAYH 1IGYB 3KLSA 1WAAA 2EO9A 3LKQA 3IB4A 5T3XH 5JIDA 1G7QB 5TPWL 3KYNB 4PI0A 1W72H 4X6EB 2X10A 3H9SA 3WDIA 5I1CL 4BZYA 1KLUB 1AQHA 2EZ0C 3NIDF 1M42A 2ARWA 5EMYA 3VD7A 2ZOWA 4QGYA 4MASA 5FHAL 2OXHA 3NA4A 2IGFH 1KUMA 3SJVA 1BZOA 4MHHI 4DT2A 1CL7I 3QDMD 4AVIA 4JDTH 3L6FA 4NI3A 3BZEB 4L48A 3LTVA 4ODTL 4ONHB 5BRZA 1JWSA 1PYWB 4KRPD 3SGKC 4KROD 2Z8SA 3SODB 3ZQXA 4RDQF 1R6VA 1HI6A 4NBYB 5CP7B 3QEQD 4TUJA 3ZO0A 4PB0H 4NNPL 5HI3D 1TTCA 2E6QA 4H20L 3U0WL 4MNHA 3SDAC 3DRTA 3WFEH 5JZ7C 2ZCLH 4F7MB 5I6LA 4RDBA 1E6JL 1MFAH 1FVDA 4HHGA 5FFOA 3QZMA 1UM5L 4ZTEA 3P02A 4Y2DC 2DJSA 2R4SH 4OGXL 3T77A 2B8OT 2EDOA 4D0DA 3ARDD 3D87B 4Y4HD 3TN0C 3F05A 3UGXA 1Y07A 5AOMA 3RLSA 1LL1A 1NDMB 2JB6B 3NPSC 3BH8A 1EJOH 1MAJA 1OXYA 2F8OA 3IJYA 1DO6A 1YHPA 4JQIA 1PX4A 3KPOA 5J8OA 1OB1A 3QH3B 2G30A 4F8LA 1JPGA 1ETZB 3QJZA 1J9TA 1LO5B 1SMOA 5D4IA 1DVFA 4M61A 3IXTB 4XI5C 1NCAH 4OD3H 3ARYA 2WINB 4DP8X 1JGEA 5LAXA 4Y1SA 4GMTL 3CUPB 2KPWA 3RX9A 4HMEA 1N7MH 5I0VA 1CDCA 3DSFL 3P0YL 1J5OH 1A5FH 5EOQH 2AAVA 4AM0A 3E6HB 4WGVB 1BLIA 3N91A 2BS9A 2DI8A 2WZ6A 1G7QA 3KYNA 4PJEE 4Y4KC 5F1NB 4K2UH 2GYSA 4HIQA 1QBLH 3GI9L 4N0CC 3UC0L 4GRLA 2W0FB 3OJMB 2FYYB 4LHUG 3DTDA 2WYIA 3DX8A 2O30A 4LASL 1UWYA 1JI1A 5HYJE 1TTAA 2F9BT 4UM8B 4ZUUB 1YUKB 3MRCB 2G5BA 4AC4A 2WJ7A 3HG3A 3T0ED 4NKQB 3TO4A 1U3JA 4NIKB 3MFFB 3N1GC 2CNZA 4U4IA 3S3SA 1YEJH 1YVLA 4X6CA 3CN3A 2QGCA 4TL5A 5CINH 4FFWC 1PZCA 2J6EL 4ACPA 3TVMA 2E56A 1UZ6F 5EULV 3CFKB 1U93B 1PZ2A 1MH5A 3FTVA 1ZIAA 5E6IC 3QUXB 1AKPA 4PJ8C 3JWOH 5F9WC 4UAOC 3APFA 4TUUA 3T3MF 4J3OD 2DL2A 3JTTB 5HHME 2DIEA 2DLFL 1KPUB 5IM7B 1U92B 4X7DC 4E41B 1I7RA 2A7BA 3ZTNH 2GK2A 5BVJB 2CKBH 2N56A 5DMJB 2BNUB 3UP6A 3Q2NA 1ED3B 4A2HA 2K6ZA 2CGYA 3QUKB 1FO0H 1QLFB 1M7DB 1OQXA 2FLBT 1WGOA 3FU0A 3TO2A 1CICA 3FTGB 4M1DL 3R1GL 1N59B 1TTBA 2Y6TE 3S5LG 1QSFA 3ZDXE 4I3GA 1TEGA 2HVJB 3CUPA 4QKTA 1MIEL 5E9DE 3ZY7A 4CJ1A 4NQEA 3AGWA 3TT3L 2EQDA 5GRXG 1G6RB 3JV6B 1S78D 1UXSA 1T66C 4URTB 3D0VA 1LVEA 3RQ3A 2DICA 3MRIB 3RGVB 3NTCL 3V5DA 1OM9A 2YD3A 4CVZB 3PL6D 4O5LH 4C4KO 4ZRGA 1XBRA 4Z7WF 1OEZW 3PGCA 2W0FA 5CILL 4NGHH 2V7HB 3CHPA 2Q10A 3D25A 4HQQL 4K7FB 3JV4B 2C9AA 5HI3C 3RZCB 2K45A 4A2LA 2ZXCA 1DFBH 4YHMH 2VDLH 2H26B 4N8VG 3MRHB 5D1QA 1PG7H 1WH0A 2A2QT 1FN4B 9PCYA 4QRTB 4ZFOL 5J1AA 1ZLWK 3ARDC 1YQVH 3JVGA 4Y4HC 4AM0Q 3EYSL 2WKGA 4S10A 5D1XB 5HDBE 4HJ0D 2I24N 4PJCE 5IWLA 1N12A 4GRWB 4EZJA 4RRPG 5JHLL 4NCC1 1J9CT 1B0WA 4WW1B 4BUQA 5GISL 2UV3A 2R69A 2YMTA 3KCWA 4WCYL 5GZND 3HG0A 1NCBH 1B4JL 3GSUB 1KPUA 5EOCL 1U92A 3SZ6A 3MCKB 1MHHB 5DR5H 1SXBA 4TQHA 3JBG7 3VRJB 5BVJA 3NK4A 4M8VA 3X11B 1NA8A 1BOYA 2D3JA 4NO2A 3EJSA 2XRAH 3LZFH 5B39G 3KEDA 3TGXA 3SKOA 3SQBA 1BAWA 1QLFA 4IBLT 3B9EA 1R24B 4FG0A 2V2WA 3SDYH 1RJZA 3DWTA 4ELMA 1DUYB 1LO0L 3QUHA 3UEQA 6PCYA 4ZTOL 1IQDA 4FN0A 3TIEB 1RU9L 1ERNA 3FQYA 1A9VA 4BHUA 2DQMA 4FI6A 2VN4A 2YD4A 3KPPA 3TBWA 2R0WH 2ZX6A 4Q9RL 4HZAA 5GS2H 1K2DB 1G6RA 2YSSA 3I9PA 3JV6A 4M62L 4L8DA 5E99L 1IBBA 1MRDL 2FECI 2LU5A 4WY7H 4NO3A 4Y9EA 4JN1H 2UXGA 2IEPA 4UNIA 4WK2B 3CMGA 3SD5A 2IDTA 4Y16B 5IB4B 4XPFH 2WN2A 4E9TA 1NANI 2V7HA 4QLWA 2X4RB 5L0QC 1Q0XL 4IJ3B 5ELIA 3I2CL 1P6WA 3JV4A 1IKNA 4XPGH 4XRCB 4YBLC 5LB1A 4X7EC 4J3BA 5FOJA 2CDEB 2E7CA 4EEEA 1E9PB 1HL8A 1A9BB 1YEFL 3RUGA 1Z0NA 3MRHA 1KCUH 5K69A 4KAQL 5F7WC 3SDXB 2CCVA 1NUNB 2DQDL 1ONQB 4EQ3A 2ICEA 1FN4A 2AGJL 4YNYA 2R8SL 4J3OC 2CDFA 3AG3B 1F4WH 1RZ8B 4PG9B 2EUZA 1NGWA 5GZOD 1LLAA 4BH8B 2OZ4H 4O58H 4PJIF 3GNMH 1TIUA 5JHDA 1A1NB 3T04D 4KNSA 2GK0A 5CP3A 4JK0D 1R75A 1NUFA 3SE3A 3ISYA 4KKNA 4WTWA 3RX7A 2Z7YA 4MDJB 3I75A 3VRJA 5HGBA 3GK8L 5D4JA 3OLEA 3UTZA 1FJ1B 4J8RB 2GUOB 4DPAX 1OCWL 4DWHA 3FZUD 4ABQA 3MUGB 1CLYL 3GKWH 4JS7A 1YNKH 4L9LC 4DN3L 1R24A 1S78C 3TH2T 3VU2A 2QTEA 3EJQA 4F57L 3ASOB 1C5BH 4NSKB 5HYJD 4KVCL 2AXJA 3QXTA 1TXKA 43C9A 3IM1A 2NUPB 3TV8A 2IC2A 3FS9A 1Y1DA 4JJ5B 1X6LA 4LT7A 2MOGA 1AACA 1QHOA 1LO4H 3QQXA 4NJ9H 2B16A 2WBJA 4NN5B 4YQXH 2X2YA 1EAPB 1KDIA 5LQBH 1IC7H 1RCYA 5EWIL 4X5XB 4RAVB 5IB4A 5ISZA 2BFVH 1DBBH 2VQ1A 4B6ZA 2FBOJ 3PG2A 4ZMAT 2PF6A 2BHYA 4PS8A 2F54B 3C5SB 3QUYD 1SLWA 1LK3H 4FULA 4XRCA 1PLGH 5HHMD 2IOMA 3QUGA 3QIWB 3UBXA 4AJ0A 4HFUH 2AW2A 1WVZA 1WS8A 1JDDA 3UGEA 3TONA 4HJ0C 1UKQA 5DHYB 3UO8B 3NZSA 3WIFA 4ALAC 2PCPB 3CMOL 5GZNC 2YD9A 2Z8VC 1A3RL 1RZ8A 4PG9A 1AO7E 2V4LA 5E7FA 4C47A 4IMKA 3FCTB 2DH2A 4JB9H 4BH8A 2DIBA 4JRXB 4PRAA 4X80L 2CIKB 2FBJL 1S3KH 1HINL 2APBA 3CIQA 3MACL 5DFVC 5H4YA 3KJ6H 3KLDA 4XBGB 4U3CA 3EOBB 2DZEA 4PGCA 4ZMTA 1OHQA 4OZGA 1TQBB 3FQ2A 3NZ8B 1MF2H 4OY9A 1UFUA 5A43C 1EZSA 3CVHB 3Q48A 1FJ1A 2Q76B 3O4LB 3VI3F 2P28B 4FQXA 1XFPA 3HS0A 2I27N 4PAZA 3MUGA 1E4WH 2B4CC 4FFYL 4RAUB 5D7SH 1QEXA 3DYMA 3VA2C 4DKFH 1JI2A 4AGOA 1FCCA 1OKEA 4Z0XB 5IJVA 2ESVB 5AOJA 2B59B 3CXDH 5ESVB 3WIHH 5BUGA 1DQDH 1UGKA 2OMTA 4YXLH 4BUHA 4JDVB 2YBRB 5F0JB 2VAAA 2X2IA 4YHYC 1EEUA 4FNLL 1XR9B 3T2OA 3DLQR 5DZVA 2Q7YA 3QULA 4LLQA 1WZLA 2LGNA 1UD3A 1G94A 4ONGH 1O6SB 3PP3H 1LO3L 3V0FA 4E41E 3BKYH 2FO1A 1FPTL 1KC5H 5TDPB 1ZV5A 3TEUA 2ZOKA 4RAVA 5CSZB 4FL4B 4LEOB 4N2GA 5EOTB 5TE7H 3EUDA 5C3IA 2WSDA 5A2KH 1I75A 3QXWA 2DWEA 4XHJC 3C5SA 4H5SB 5C70A 2RBLA 4X7SL 2VDQB 2FBRA 2W91A 2JMRA 3D1MC 5GZOC 5CD5D 3R4DA 5ENWB 4BKTC 5DHYA 1Z9OA 1TQWA 3R8QA 4PTTB 4F20A 5L4MA 2ATPB 1OZUA 2Y9RT 4FS0A 1XGPB 3MUJA 5GRJL 5SWSD 4A37A 1QZNA 4UILL 1F42A 4OLYH 4F9PC 2ZTBA 3FCTA 5HDOA 4N85A 5FF6B 2Y2TA 2DD8L 2FSDA 3VJ6A 3QORB 1KXTB 4OLWH 2VN3A 4OLVH 2F5AL 4JY4B 4Z9KB 5FFLA 1WSST 3H6JA 3A5VA 2YFNA 3FZUC 2ZSVA 2VSCA 3NZ8A 4GEIA 1EVTC 3PWVB 4YDJB 1E3ZA 6FABH 2L3BA 4MMZB 3DJTA 5EDXA 1T03L 2EDEA 3MBXL 4OQTH 5F3BA 2VB5A 1HCYA 3QEHB 2CJSA 3B9KD 3KVPA 4RAUA 4JPVH 5TQ0L 2JIXD 5D5MB 1UD2A 3CX2A 3PRZA 4H8UA 4HJGB 4UYQA 5HHQB 4Z0XA 4HJ1A 1YG9A 2ESVA 2HFEB 1HIMH 1UA6L 3NIGE 5D1XE 1CDGA 1HNYA 2PLTA 4GRWE 1OAYL 4JDVA 5C0CA 1SY6H 1MN4A 5T3XL 5CEZE 1XR9A 1W72L 1P69B 3F7RA 1B0GB 1KN2H 4JGMA 4EVNA 1E65A 3AGVA 2CBQA 2RJMA 4TUOA 1S7UB 2VH5H 3H3BC 1J0HA 3QUYC 3BHBA 1PCXA 1XH1A 1IV8A 2IGFL 1PGRB 5CSZA 2NNRA 3VFSA 5KBNC 4LEOA 1K5WA 3O41A 2WLJA 4CSTA 5AW8B 4JDTL 1Y0LB 2YJQA 5DS1A 1Q90A 4H5SA 3RTQA 3RIAK 2F1AA 5FWRA 2B20A 3CH8A 4PB0L 5DU7A 3IJHB 4UCFA 2K8MA 3ZUCA 3WFEL 1MFCH 1KENH 4XPBH 2G3ZA 4IK6A 3H9ZA 1KB9K 2X1QA 2ZCLL 3D3VA 4U2ZA 4AG4H 5BO0D 2CO7B 1MFAL 1RIHH 4BH7A 3GTNA 5AVQB 2BX5A 2OMWB 4G70B 2NY6B 2GIYA 2WNKA 1G5AA 1TVBB 4J27A 1OT1A 4P23D 1E5AA 5D6DC 5FF6A 2R4SL 5K59F 1U8CB 5HGDB 4OVVA 4BE6A 4MJJA 3W56A 4JY4A 2WKOA 3LRKA 2IANE 3IGUA 4YSAA 3VRIB 4NCDA 4ODUB 4TLUA 1EJOL 4KZEH 3L9EA 3WY4A 4LKCB 3TXAA 4NZTH 5JQIB 2Y7MA 1NDTA 1L7IH 1KJVB 2VMJA 4J4PD 4NN7B 2IWGA 1JFHA 2Y5TB 1PCSA 2M26A 1MCNA 1T83A 3DV6A 1NCAL 3B2DC 4OD3L 3QG6B 3F7QA 5BXFA 4ZNEA 3QEHA 1U8NB 2LAAA 5DEGA 3SDXE 5IHLB 1KXQE 2K0RA 3GI8H 3C6SB 5D5MA 4HJGA 2I7SA 2OMUA 1N7ML 1T20B 3SGDI 3PABB 1A65A 1R3KB 4PY7B 1A5FL 1V27A 5EOQL 5T5FH 1J5OL 2DV6A 2YPKB 3GSNA 3S37X 1JZ3A 3POHA 1DSYA 1AGDB 5SX5K 4K2UL 5L8JB 5DEFA 4OGQC 2IXQB 5GJSH 1QBLL 1UKSA 1QQDB 1AO7D 4F2MA 3QQDB 5I0YA 1JYWA 5CD5C 1AYRA 5HGAB 3RGBA 1E2VA 2C9SA 1Y0LA 1JVKA 3NJJA 1PDKB 4LVNB 3CZFA 2NYYD 5DQDH 2A6KA 2FQEA 3WJJA 4TUKH 1XTMA 3DVNB 4P2QA 1YEJL 5JPMB 4PJAB 2Y22A 2A4CA 4YPGB 5EEUA 4Q56A 5CINL 1R3LB 2FVNA 1GHFH 3KGRA 3ZN6A 4X0NA 2Q7NA 4QO1B 3S4SB 1ZE3H 4JUTA 1PY4A 3JWOL 2CWRA 5HGDA 4HK0B 2B14A 2BMKB 1BLNB 3WUWA 3HBQA 4FXKB 2X9WA 1HK6A 5J11B 4KK9C 4AVHA 1JSYA 1SJMA 4QCIA 5IY5B 3QUXD 3ZTNL 4UB0H 2CKBL 5EDSA 3E80A 3K46A 4I1NB 3B9DA 3O81A 3QK0A 4M5TA 2F54E 1CFTA 1BECA 1KJVA 5IMMB 3BP6A 1JUFB 3RX8A 4ABWA 2X70A 4ODHH 3D34A 2EDBA 4MA8H 1FO0L 2E8YA 1CDYA 1GY2A 4PD4J 4XGZB 3V7AG 4MA1B 4DEPC 3BXNB 4OLXH 1YN6B 3C6SA 4PJFF 4RWYH 3LRLA 3FQUA 4LSRH 2CDGA 1F3RB 1NFKA 2F7OA 3BGFB 3E8VA 3SDDC 4ADJA 4GSQA 4JRXE 3SYAA 4UTAH 4Q6IC 4G82A 1VKXB 4KQ3H 1JRHH 1E40A 1ZCRA 3F83A 2ITCB 1X6NA 4PN6A 1MAMH 3B8SA 4QF1A 5J6SA 1AGDA 2R1YB 3LQAC 3RDTA 2VMDA 2IXQA 2J21A 4O5LL 2F68X 3Q1SH 4HOMA 2A38A 1QQDA 1QATA 3O6MH 3OPZH 1D7FA 5D2LA 4NO0B 3RB5A 2DF3A 4NGHL 2GTQA 5DTFB 5FKPA 3HI1A 1GC1H 2TAAA 1FZMA 1W2KT 2BM3A 2N1TE 3O4LE 5MP6H 3RGVD 5CBEB 3L3DA 2MTPA 3NGBC 3B7YA 3P73B 3QIUB 4M5YH 4E9SA 2LAGB 1PDKA 1W8NA 3VQ1C 4ONFH 2R59A 1DFBL 3UZVA 4YHML 2VDLL 4K71B 3ZHFA 1IGMH 3P2BA 3VWJB 2X4SB 1PG7L 3PY9A 3DVNA 3L08A 4P23C 4GW4B 3DDFA 1JIBA 5F7NC 1SJVA 4PJAA 5LBVA 3RZCD 2UY7A 2JK5B 1JDAA 1YQVL 2QQLH 2FJFB 2HJLB 3PV6B 1TSHA 3O3UN 3S36H 1TTRA 3MROB 4QO1A 1WHPA 3NEEA 3ULVE 3W39B 1I85C 3MUY1 4KC3B 1MHCB 1N3NB 3VFRB 3NZHH 3K6NA 4J4PC 4JFOB 1NCBL 3OWRA 2HKHH 1MKFA 2EVJA 5D1XD 1F4HA 5DR5L 1S7RA 3O4OB 3NEXA 4HEPG 1XIWA 4N2EA 1A4CA 1J1OH 5IMMA 2VC2H 2XRAL 2XX1A 3LZFL 3DYPA 3ZT5A 3RWJB 1JZHA 1XSKA 3FAWA 4M7ZB 3N9GH 2J1WA 4N0YH 1UZ8B 1ND0B 5F7DA 3DECA 4JRYE 2E7LC 3SDYL 3NAAH 1MCWW 2L7JA 4NC1C 3H0TB 3VCLB 3KWTA 4P4RB 2P8PA 3TV3H 1U3HD 4PJGA 3CC5B 1VRSA 1Q1JH 3B7SA 1UXWB 4KK6D 2R0WL 4BZ2A 5I24A 4J39A 5FKAA 3GEWB 1RL1A 1ACYH 1JG9A 2LFEA 4JANA 1OK0A 4GI6A 3ZT6A 2YD2A 4RWHA 1NCTA 4WY7L 5EIIG 2VDPB 4D7PA 2R1YA 4JN1L 1J0YA 4Q58C 1Z66A 4NB7A 5F88A 3VGHA 4BFFA 1NAMA 2NYYC 4XPFL 4OSUH 1FL3B 3VG9B 5TD4A 2CQVA 3NVQA 4TQEH 5DTFA 1YAZA 2EINB 2GT9B 4IJTA 5FECB 4FMFA 2VN5A 4OF7A 4XPGL 3TURA 3QIUA 3QCTH 2IAND 3V0VA 4EI5A 5E23A 1O7DE 3X1GA 4Y16D 3WELA 4YS4A 3VWJA 4N5UA 2X4SA 1KCUL 3VXNB 1NOAA 3TCTA 4R4BB 2KMWA 2JK5A 1JS4A 4Y0GA 1YMHB 1F4WL 2FJFA 1IAKA 2HJLA 2BK8A 5J0BA 2OZ4L 4O58L 3QUXC 2WWKT 1NOLA 3GNML 4FTVB 4WDIB 5EU4A 5L7XH 4GW5B 1MHCA 1AGEA 5EC2A 4XCYA 4EIUA 2J8UF 5I1IH 1QLRB 4OW6A 5F6IB 3ATEA 5F7YC 4IHBA 1KIRB 1DQVA 2DEXX 3INUH 4I77H 4ZODA 1NKGA 5JXEA 3GLAA 5F89A 1HYSD 1MOEA 4IBTA 5AQ0A 4DH2A 3B2MA 4ZK8A 3HN8A 3DO3A 4WEMB 1BG9A 1CXFA 1U91A 2H47C 4Y1AB 5D2NE 5D7KE 4AIEA 4C55A 4FE9A 3CFEA 3GKWL 2W65B 3UYPA 1YNKL 3B7UX 4P2AA 1ND0A 1E8XA 1R33A 4JFDE 1O9WA 2CHXA 3H0TA 1ET8A 3K72B 1M71A 4RVBA 1C5BL 5B7EA 1U8OA 3CC5A 1OGSA 3CU7A 2UYLB 1I8IA 1ESOA 2WO2B 5AD0A 2P43B 5GSRA 5C9JB 4H4NA 1ZGLA 3QSKB 1MWAA 2YOAA 2JTDA 1LO4L 2DIJA 4NJ9L 3RGVC 1OOWA 2F53B 4HUCA 1XGYH 1S7SB 5LQBL 2HJFB 1IC7L 4WKXA 2OA9A 5LDUA 4PTUB 5MERA 2VERN 4JFEB 2H0FA 1FL3A 2BFVL 1XZ0B 1DBBL 1BYNA 3OHXC 1A0QH 1N0XH 1M2OA 4RSVA 3V95A 3AT8A 2D9CA 1LK3L 4FMKA 3RZCC 3BKMH 1PLGL 4HF5H 4M7LH 5E1QA 1TZHB 3HPLB 3AREA 3MX0B 4HFUL 4JQVA 4XN2A 3VI4A 5JOFB 4RA0C 1ZIBA 3R06A 1MY5A 4HJJH 4MRBA 2F54D 4R4BA 4AOFA 4HG4K 2ZCZA 1DQTA 4UV4H 3DXAD 4U1MA 3QIWD 3WUWG 4JPQA 5FYJE 4JB9L 3HEIB 4KUZH 4LNRA 5D1XC 3C60D 2WANA 5ECGA 1VDGA 2YO3A 3BQVA 5KJ4A 2BPBA 4FTVA 4WDIA 2YA0A 1S3KL 5TK4A 1I1AC 1N68A 2RTTA 1KIUA 5CSBA 3KJ6L 1HHHA 2HLAB 3EO1A 4F3FA 2EYTB 1QOKA 5KBLA 1RSYA 4JRXD 2RHEA 5ALBH 3VXMA 1MF2L 2QSTA 3BN9D 1UH2A 4YSEA 2X42A 4L8SA 5KSAD 2NRDA 5IW6B 4R90H 1MLBA 4U1SA 1JGVH 1U3HC 5C2UB 3ZMEA 1XAKA 4Z23A 2X4UB 1E4WL 1IC5H 3DHJA 1E67A 3T2QA 1ET5A 4XWGH 1GS7A 5D7SL 1Q94A 4PS4H 4PJAE 4DKFL 5DD1H 1KIQB 1BBDH 1QFWI 3GJEA 1UCBH 3QRBA 3O4LD 4X4KA 2R9HD 1J10A 4NZ8A 1ZHLB 3BIAX 3CXDL 3WIHL 4WGKA 1DQDL 1DFXA 2UYLA 4YXLL 2ADJA 3EGDB 5DI8A 3VDCA 2DBLH 2XYBA 3U7YH 5C9JA 2UX7A 3BO8A 2WMPB 1W0YT 3X3FH 1F3JA 4NKMB 2FJHB 2OMNA 3MYJB 4QI3A 1OANA 4ONGL 5AKTA 5AVXB 2H3NA 1WHOA 3BKYL 5CBAA 1KC5L 1DYZA 3ETBJ 4JFEA 4KVPA 4D0CB 1QSVA 1TLMA 3LZRA 4Y16C 4F7KA 5TE7L 3ULVD 5AAPA 3TCLB 1QBBA 4KFMA 3IMUA 4KKQA 4X5QA 2WUBH 1LK2B 2APXA 1A7RH 4M6MH 1TZHA 3ZU8A 4M4RA 1JMXA 2MQ3A 5ERWB 1BXUA 3TZVA 3BWAB 3V10A 4R7NB 3W37A 3MGOB 2DMHA 3D39E 4IK7A 4O2EB 1KY6A 2X28A 2XFXB 3L2MA 4OLYL 1IGFH 1HOCB 2PO6C 1NKRA 3VH8B 2IALB 4K55A 4JRYD 4U7KA 1VCBC 1PSKH 3D85B 4I3SH 4OLWL 1WBXA 2UWEA 4OLVL 4WV1B 2AAAA 4JREB 1JVOA 1MG3C 2HLAA 4M3KB 4YSSA 1UD8A 4XNQA 2CA4A 3NCXA 2EYTA 1YA5A 2KYIA 2FJUB 3QORD 3BKCH 3MV9B 4MBOA 2HUEA 2AXFB 5IW6A 6FABL 4GPVA 3X14A 1ZPUA 1UEMA 2GI7A 4JQIH 2ZX9A 2CHDA 3GXNA 5I1AA 4OQTL 1ZHKA 4CL7A 3VFPA 2X4UA 1DQQA 3L13A 4G6MH 2AV7B 1TFHA 3QAQA 2QZ5A 1MW0A 3AT0A 1XL4A 1MFUA 3G5ZB 4CC0A 4JPVL 4K4KA 4IKLA 1KIQA 3MLZH 2NNAB 4KZDH 1HIML 1Q1PA 5F97E 1SYSB 5L2KB 4Y5XB 4JNXA 4MMXB 1SY6L 2XV6B 4HZLB 3KBHE 3FPXA 1NBQA 1TVHA 4P2CG 4K3DH 1KN2L 2H1XA 4ZMNA 1YDPB 4AC2A 2VH5L 1DVUA 3D6GA 4YPJA 3P40A 4A38A 4D0CA 3F7LA 5GGRB 4UOQA 5DYFA 2MCG1 4JFFA 1WUNT 4K0OA 3T3PF 2WSKA 3VFNB 2DM4A 4G6KH 1F2QA 1BBJB 3QUZA 3QIWC 3MRRA 1MDTA 5ERWA 3LVEA 3C60C 3DMMB 2XPGA 1ZLEA 5DMKB 5I76A 4YSRA 3FBQA 3TASA 2YXVA 1MFCL 4OF0A 1KENL 4XPBL 3MGOA 4HU2A 4AG4L 5KVDE 4E68A 1AGBB 4J3OF 1XGRA 4O2EA 1RIHL 4QRAA 5D7KD 2IH8A 2XFXA 1OF0A 4K8RD 1HILB 3VH8A 1QVOB 5DK0B 2AK4E 2NDFA 4JFDD 2YGNA 4HW6A 5KSAC 1G7PB 5DRZB 1XGQB 2X9ZA 4W9FC 5CJOH 3ZMNA 4ABVA 1BWWA 3FH5A 4KK8D 2NNFA 5HHVH 2MRYA 3KL0A 5I6PA 1FWXA 2LVEA 4MWFB 1IEBB 1FYHB 1UWXK 2NY6D 1X5YA 3QDAA 4KZEL 3MUUA 2G60H 4AT6A 1EDQA 4NZTL 1VEMA 1L7IL 2E76C 3APDA 4QRSA 2YLKA 3FT2B 4BSVB 4AEHH 1KLFB 4FOMA 5HDRA 1F8TH 2R9HC 3ZPDA 4U1NB 1PKQB 4NP9A 2CXGA 4KFZC 5E2WH 3MI6A 3G5ZA 4NQQA 2B5IB 1XF2A 3GI8L 2CSPA 1EZVX 1SM3H 3LPPA 4UNTA 5EO0B 4EDXB 3UBFA 2EE6A 3E1ZA 2O1AA 5I8EA 5L4IA 5L2KA 3B5GA 5T5FL 1V54B 4EKXA 3QXAB 3S3JA 2X6CA 1MFMA 1IB5A 4K9EC 2RALA 3HE6A 1CFMA 1FBIH 4A2MA 4HZLA 3WTVA 4EN3C 3ULVC 3GZKA 3C8DA 3HS9A 1T80A 5HYEA 1AXSA 1YY9C 5GJSL 2HFFA 1XCWA 3WL9B 1GGBH 3DVIA 2ED8A 4E9XA 5FYJD 3AXLB 2BERA 1RY7B 2LT9A 3KLQA 2Y72A 2V5RA 5A1AA 4Y9FA 3VXPB 2RH0A 3LAFA 3O6FB 4Y1AE 3VFNA 3WS3A 1N8ZA 4BD4A 2XN2A 4FJZA 3O3EB 1J0IA 1TG8A 5L6YH 5C0BA 1JV2A 2Y23A 5DQDL 5EU7E 4TUKL 5DMKA 1QHPA 2GAZB 4H8HA 4IRSA 5FM5M 3V55A 1U33A 2O5NA 1KJ2A 4NNYB 3HBPA 1GHFL 4B41A 1R19A 2VR3A 1SRDA 1T5WA 1PVHA 1S8DA 3MRPB 1F4AA 5B39B 1HILA 4Q8BA 3EDJA 2X6MA 5DK0A 2D3VA 4X4MA 1KCVH 2A9DA 2F53E 4HIJB 1G7PA 4NQCB 1IX2A 1VERA 3UTSB 3WGVB 2BRQA 1D7BA 4TOYH 4ZMXA 5I1DB 4MWFA 4QGTA 4C57C 3WNPA 3D4CA 5T1LB 2B77A 3HR6A 3D50A 5DRNA 4PYGA 4UB0L 4L4TD 1WICA 4UIMB 3U30B 4WWKB 3GIVB 1NLDH 2VKWA 4MMZC 5KOVC 2VDKB 3PWNB 3FT2A 4ODHL 4BSVA 1CMOA 2VTFA 1X7SA 4MA8L 4V1DA 1HQRB 4M1CD 3ETSA 3D05A 2HT4D 3FUNA 4L8BA 4U1NA 2XG4B 1PLBA 3DROB 2X4QB 2CO6B 2GKIA 5AW5B 2Y06H 4HC1A 4OLXL 4RWYL 1QI4A 4AYFA 3IGKA 5I19H 4LSRL 1JCKA 2X87A 3H7BB 1VADA 1YEHH 2JVUA 3H4HA 4FQIH 2OSWA 3CK0H 4UTAL 3B2XA 3LXUX 2PXYA 4KQ3L 4ZAKB 1JRHL 3VXRB 1G6RH 5EU6B 5IJKC 1MAML 3S3CB 2LHAA 1F6LL 1QRNA 1A4JA 4F1ZA 5J7CC 3Q1SL 5CN2A 3WL9A 3D39D 3O6ML 3W57A 3OPZL 1UADC 4PJ7B 4AJWA 5HPOA 2YBGA 3BP5B 4TNWF 1GC1L 5MP6L 3VXPA 5FFGA 4LLVB 4D9RE 5I9QC 4M5YL 4UQIM 1FA4A 2DTSA 3V5HB 1E3XA 3O3EA 1U8MB 4ONFL 4L0YA 5KVGE 5D2NC 1IGML 2ZNXA 4NO0D 2G5UA 3DX7A 3LXBA 3P11H 4K8RC 3N41F 3TA3A 4AQ1A 3QDJB 4QKXB 2BSTA 2GAZA 2QQLL 5DURB 1Z9LA 1LWJA 1ZTXH 1JTPA 4NNYA 3U79A 2RGSA 2ZOUA 4KK8C 3S36L 4P2YA 4N2FA 1QSZA 2NY6C 4PMEA 4QHNB 3CCHB 3S36X 3SHSA 2WOYA 2EIMB 4B60A 3NZHL 1NEUA 4HIJA 5D6CB 3VFWB 1SEBA 5CEZH 3UTSA 4H0HB 1ZTMA 2HKHL 4HD5A 4XC3H 5CP3H 2BXYA 2ZOOA 2WNGA 2YS4A 3ML8A 4CVWA 5K5YA 4DGVH 3OG6B 3BRGC 1J1OL 5I23A 3PV7A 4NN7C 4F1SA 3ASNB 3GIVA 2VC2L 1IZKA 4D9LH 3CX5K 3AM8A 1WTGT 1HQRA 1MJ8L 3N9GL 3RY5A 3KW8A 4JHUA 4N0YL 3V4VB 1XSOA 2A9AA 3NAAL 5CJ8A 2UZXA 3LHAA 3TV3L 1K3IA 2Y2WA 4YK4C 3F64A 4YWGH 3DX4A 3ZKMC 4M93B 1Q1JL 3VWKB 3CDZA 2FIKA 3GSOA 2QR0A 1IM3B 2BSDA 2X2HA 2I85A 1CGSH 4ZAKA 1ACYL 5IW1B 4MA7H 3VXRA 4P5TC 1THAA 2C1OB 4GFXA 3IU4H 1OP3K 3AC0A 3U0PB 4IOFD 5CEXB 4ENED 1KFGA 3EBAA 3LS4H 3QQ4B 5DF0A 3MV9E 3QRGH 4OSUL 2J6WA 2DLIA 2RD0A 4TQEL 3X2QB 2CALA 4KO6A 1ZVYA 2AK4D 4IRZA 2P47B 1II4E 1G7JB 1BXVA 4LLVA 4NZDA 4CA4A 2H1PH 4P3DB 3IF1A 3QCTL 4LVNC 2UY6A 1M9WA 3FSZA 3VM5A 1UA7A 1HQ4B 4JKKA 3L1OH 1PL3A 3LEVH 2JELH 1S6NA 1VIWA 1ZWIB 4X6FA 4L29A 5F96H 4CW1B 3PIQB 2V5TA 1WTLA 2EYRB 1DQJA 1MCIA 4MB1A 4XB7A 5I73B 4PW4A 5FA3B 4NO5A 5EPMA 3GINA 4DVBB 1NEZB 5B7FA 1WT5A 4BFKA 4I9WE 5CKAA 5IFAH 4G42A 4MCZA 3FUIA 3GTVA 4JFXB 5L7XL 5F6HI 1UURA 3EJUA 5CIPB 3ECWA 3NZUA 5D6CA 3L95B 2VLLB 5I1IL 4DK5A 3LD8C 5J11C 3IAGC 3QXDA 4FHBD 4U7SA 4PRHA 3INUL 4I77L 2HT4C 4IGBA 3SGJA 5HPMB 4M7LT 4DGIH 4PIRF 2X6VA 1RZJC 4D3CH 3DHPA 5GXBB 3HZKA 1S7VB 4G9DB 4A2FA 4B9FA 3U6RB 1NFIB 3B43A 2WAHA 2VDMH 4KXDA 3ZR5A 1EXUB 2WAQA 3IN0A 4MA1C 4YSCA 2ICWA 1BMZA 2FWSA 2XVGA 2CCLA 2YOCA 3DX1A 3JZYA 5CXPA 1TENA 1JNJA 1MI5B 3EYVB 4Y1AD 4G8EB 1ZS8B 3QIBB 5F0PB 1ZDQA 3BGFC 4A7TA 1XMWA 4J1UB 4OF8A 2Z92A 1TCRB 2TRYA 1OAJA 5C07B 5IW1A 5AW6B 3AXIA 3T8MA 2WUCH 5HDBF 3P30H 4PJCF 2C1OA 1HZKA 3KYMA 1XEUA 1I3GH 1XGYL 2WB1A 5CEXA 3QW9A 1N70A 2VSKB 5IMOA 3QQ4A 5HYSB 4CBZA 1BQHB 1NBVH 1CFNA 4JCMA 1OCCB 4CADB 4ZS7H 2WXFA 2DWDB 3NMEA 1OLZA 2YEVB 3W9DA 1WPCA 1A0QL 1N0XL 3JQOB 1G7JA 1TQVA 5EOCJ 2F53D 4HULB 2KZWA 3BKML 4M7LL 4HF5L 5IG7B 1PKQE 4YGVB 4K71C 4F7CB 2H6OA 2HVKB 3CC1A 2YLHA 3BISA 3FUDA 1AC0A 3N43F 3CH1B 2MFNA 5GGUA 5GGSY 4DP6X 4G1EA 3RNQB 4HJJL 1KWGA 1ZWIA 2GIMA 4UV4L 2EYRA 2VLJA 3WKQA 2IQ9H 5FA3A 5A2IH 3CDGB 1NEZA 4KUZL 4CDHA 1KGXA 3KWVA 1HCZA 3CFMA 1OSPH 2D9QB 1E4HA 3ZKSD 3P54A 1DVQA 3WO4B 1JCVA 3FO9B 1BWMA 3RWDA 1L9PA 3WJMB 1A1OA 2J72A 1KTBA 5ALBL 2F8XC 5DZLA 4PJ9D 1HEJC 4FNTA 1S46A 3G6JE 4PJHE 3M8OH 4R90L 5ACZB 2ZP9A 3CVHH 1JGVL 1S7VA 1TQUA 2C7UB 2J3SA 2J8HA 3L1EA 2I5YH 3MUHL 4UDUA 5DDHB 1MCKA 1IC5L 1M1SA 4XWGL 3ULSB 4AENB 1EXUA 4PS4L 5DD1L 5KZCB 1BBDL 4HJTA 5E8NB 4NYLB 5DRXB 1UCBL 1WCBA 4KDWA 4N2HA 3ZHNA 1MI5A 4D9RD 1MJ7H 4JDZA 4N5EC 3V0IA 2JB5H 4ENEC 4ETQB 1AY1H 2DBLL 2H3XC 3V6FB 3U7YL 1YNTF 5C07A 4U1IA 1J86A 4JHZA 3X3FL 3FB8B 2P3YA 3GXIA 4NQCE 3L9RB 4YE0A 4DETA 1B90A 3MO1B 3GMNB 2QPFA 5M7QA 5HYSA 2R29A 1B2YA 4R5TA 3H1ZA 4PP2A 3CDFA 4CADA 2YRBA 1GTNA 5TDOB 1AHKA 1EO5A 1GL4B 3TNMA 4UQ2A 2WUBL 4M6ML 1E9QB 1A7RL 5IG7A 1P2CB 2ENYA 2UXFA 2HVKA 2ZYHA 5D55A 5D96C 1AD0B 1ORSA 3CH1A 3OMZA 2E9JA 2BOBB 3KLLA 3PWPE 3FT4B 1QWHA 2LLGA 5AKRA 4KTEH 2V6HA 2R51A 1E5YA 5DJ0B 1NIEA 1GGYA 1IZJA 3VXRE 1IGFL 1B4LA 3BAEH 5EU6E 4PRBB 5DJ2B 2YR3A 3ZTJH 4L8CB 4FFZA 1PSKL 4I3SL 4D0BB 1OGAB 4Q6YA 1UTDA 4H26B 3F7PC 2RACA 5LVEA 4PJ7E 4R96A 4BQ9A 3CLWA 3WJMA 4Y5YB 2FGWH 3VE0A 3BKCL 1HEHC 1RJLA 4DIXA 2BIIA 3MOBH 2X3BA 5CGMA 3HLAA 3MBWB 3O6LH 4JQIL 2PTTB 3GHBH 1FNEB 3WE1A 3FU8A 4G6ML 1K9TA 1A66A 5IFJB 4HXAH 3MV9D 4AENA 2BXZA 2R2HB 5EU7C 5C86A 4LAQH 3ISRA 3QDJE 4FFVD 4NYLA 5DRXA 3MLZL 1NJ9B 4KZDL 1XV8A 3KXFB 3CG8A 1G7HB 4XMKH 2KLRA 2WBXA 4M1GH 3N50A 3EH2A 2L7EA 4OFYA 3S35H 3T8XB 1MVFA 1WLHA 4BK8A 4NFDA 3MRJA 1IVLA 1YLBB 1NKOA 4LHUD 1G1YA 3FB8A 3GSNH 4K3DL 4NKDB 1OIOA 4X4XB 4NRYB 4BGLA 3L9RA 3MO1A 4HIHB 4X8GA 3OVUB 4K7PX 5KYWA 3OKNA 4HS6B 2AANA 4UZSA 1AGCA 3STZB 1FZJB 4I9WD 3SY0B 1I3VA 2MQGA 2XQYK 2Y3NA 4GQ9H 2IDSA 1LEGB 3S96B 5AOLA 4KITB 3MRFA 3VSVA 2A6IB 4G6KL 2PPEA 3OGCA 4B95C 3FSWA 3SBWC 2AJUH 1HSAB 43CAA 1P2CA 5GS1B 1S7XA 4AV5A 1AD0A 2FSEB 1G5GA 2XYCA 3IPBA 4MB5A 4ODVH 3H3PH 1EPFA 2WXGA 2DKMA 2WXMA 4UI2A 1LGVA 3LPFA 4QRPA 3DMMD 4XVUC 4DAGH 5DJ2A 3WOVA 1DN2A 1H6TA 1SHMA 1C7TA 2X3CA 4PJ9C 4WHCA 2D3LA 5C0AB 1QI3A 1OGAA 1WD8A 5CJOL 3PREA 2IQAB 1FG2A 1I9IH 3PFUA 2EDYA 3NG5A 3HJEA 4JZJA 4WEBL 5HHVL 2DYRB 1CZ8H 2YQBA 5HTSA 5IHHA 5A40E 3WY2A 2WTPA 3VGDA 1UWFA 2G60L 2BP8B 2EABA 5GS0D 6PAZA 2NTSP 3CHRA 4NM4H 2DIAA 4AEHL 2PTTA 4WF7A 2ZXQA 3VD4A 3FTWA 1F8TL 2QADD 1BVKA 3BESR 4MGXA 5DHDA 3FB5A 3LNHA 4PJDA 5HVHC 5KTEH 2CUAA 4OUOA 2BCMA 5E2WL 4FI8A 2R2HA 2WTRB 4EIBA 1QLEB 1U8KB 1SM3L 2YRPA 4YHOH 4BWUA 4BXVA 4WI8A 1SHWA 3UJJH 3W5MA 3KXFA 5DWUH 1G7HA 1YJDH 3EF7A 1RIUH 3F65A 1KOAA 1E42A 1IEAB 5MENB 1A2YA 3FSAA 1NGYA 2C5DC 2P44B 3K6OA 5DLLA 1FBIL 5PAZA 5T1KA 5E94B 1HHGB 1RZGA 1EUTA 4JQXC 5HVGB 3C2SA 2L7UA 4X4XA 4NRYA 4YSPA 5JHBA 3BVXA 4KY2A 4X9GA 1N6VA 4YHIB 7TAAA 1GGBL 3DPBB 3OJDA 3T6WA 2NY0B 3STZA 1A6UH 4JX0A 3MNZB 1DJXA 4ZMQA 1CGYA 1JV5B 3S34H 5AVYB 4XZUA 4NIYE 1LEGA 5KBKA 1BVLB 2A6IA 1WFJA 5L6YL 1H19A 2A6DA 5LUMA 1RK0A 4A7VA 4E9QA 4LL1A 5GS1A 4Q9QH 1MI5E 4GSDH 1AGFB 3K71A 3O6FD 1NAKH 1PX3A 2FRGP 4DJMA 5DS8A 1DR9A 3VNYA 3CFDB 3DO7B 5E2JA 1PX8A 5C07E 4N2NA 3NIGF 3BFOA 3CZNA 4YFDB 4HAGA 5DS2A 4GRWF 1KCVL 2YN5A 4WV1C 4FA8A 4KMQA 3T4YA 4L0PB 2HJKB 4TOYL 2LV4A 1C9SA 2DQ6A 1KTKE 3DX3A 3UP1A 1TKWA 2O5ZH 3EGSA 2OMXB 5IKCB 3SQOH 1L3NA 1Z7JA 4HKBB 4FFVC 1XGZA 4NQCD 4D9QE 1NLDL 2A4ZA 2IOOA 4FNSA 3TNNB 5EIIB 2BNQA 1RZKC 2XWTB 4G8IB 1RERA 2PP9A 1C5DB 5T1LD 4X5LA 3HC4H 2Y06L 2OMVB 3IN2A 1VGKA 5LN4A 1U8KA 4WWKD 3FQ1A 1CYGA 5I19L 3TBCA 2TSAA 1YEHL 4FQIL 1MCPH 1N0LB 3CK0L 2BP0B 3GMMB 4UV7H 4BZ2H 4OLEA 3HI5H 4LP8A 3NFNB 4FDWA 1G6RL 1NBZA 2R2BB 5E94A 1HHGA 3H9HA 2F74B 2R23B 1ET7A 4RMUA 5IB5B 3ULUE 1CB4A 3PWPD 3NIDB 4PYHA 1P7HL 4JFYB 1QUPA 4EUPG 4YXKH 4X7TB 2FTAA 1NAMH 5EU6D 3B5HA 1JV5A 4I85A 2AJ3B 4O9HH 5FK9B 3M1OA 2QTVA 5KG9B 3HN3A 4PLNC 2BVEA 1X9LA 3F7VB 5EZPA 3BPLB 2FO4A 5GRVK 5I8OH 4APXB 1FHGA 3P11L 3QJFB 4MCMA 4CU6A 2B1HH 3WNNA 2L7QA 1PEZA 1AGFA 1M7IA 2OTUB 5ADPH 2D31A 5KN5A 4HWNA 4GKNB 4I88A 4MDIB 1ZTXL 1NCHA 3CFDA 4DPRA 1LEKA 5A2JH 1NCJA 3P9MB 4KXCA 3U48A 3QHZH 5TGBA 4G43A 4XO3A 4HOZA 1WBZB 2DQFA 3FYIB 1PJWA 5GS0C 1FNGB 3QDJD 3VFUB 4PW9A 1MEXH 2QPEB 5DURD 4OFVA 5CEZL 4XC3L 1BD2B 2EACA 4OZFG 2QADC 4TVUA 2HAZA 4GAGH 5IBUB 5E5MB 1AZNA 1UQSB 3QFDA 4DGVL 4HKBA 1IBGH 3ECUA 5DVOA 4D9LL 2PPFA 1W6LA 1IL1B 1D9KC 3TNNA 4KRLB 1QWUA 2OL3B 4PVBA 3J27A 4MD4A 4NUJB 1GZHA 2AABH 2NUTA 5ESQB 1C5DA 5K9KB 3SE8H 1M4KA 1M2VA 1DE4A 3SCMA 2PCFB 2BWQA 3L3JA 1NWPA 2AQSA 7PAZA 5IV2B 2PNDA 4YWGL 2QELA 4DZBA 1I1YB 3AWFA 4Q97A 4Z7VE 2DRUA 4F37K 3T1FB 1AP2A 2BP0A 2W0PA 3GMMA 2XCMC 5KVDH 4FYQA 1I3RB 4KDTC 1CGSL 3NFNA 3RVVD 1CD1B 4MA7L 3BZ4B 2F74A 2R23A 4MJ4A 4XN4A 4AEEA 3EDKA 5C0JA 3VWKD 4P57B 1RUQH 4JFYA 2JJTA 3TIDB 3AJ7A 1ZLVK 2P5EA 3TS8A 2IPUG 4X98B 3DUSB 3QRGL 4J2QA 1BZ9B 2PYFB 3C8KA 1EHLH 2H1PL 4R2GC 5AVUB 5GIRB 4AXWA 5BNXD 2NY7H 4PREA 1X3DA 1KBWA 4R3SB 5IK3B 3TYFA 3C5ZA 3L1OL 3MOAH 3QJFA 3LEVL 2JELL 2UXVA 5IEHB 2JNZA 3GM8A 5F96L 4G5ZH 4MDIA 1JOIA 2F8IA 2XXMB 1NMBH 3ARBD 4L23A 3N1FC 5IFAL 4LLWB 3OLGA 4JRWA 3F04A 4WUUA 2NR6D 2XV0A 2V9RA 1CXKA 1SN5A 2H32B 4PGJA 2Z1KA 1L9OA 4PU2A 3ZDZB 5CMAB 1BD2A 2C3GA 3LHPH 3NJIA 4FCHA 3AB0C 4Y7OC 1G7LB 1UQSA 3WN6A 4DGIL 4RAHA 4D3CL 3STLA 4X6BB 1XCTA 2WCPA 4WWKC 1J88A 2BY0A 1A6ZA 1RAMA 3D7PA 4XP6H 1OF2A 4NUJA 2VDML 4PV1C 4RMSA 4WI5A 5ESQA 2XOTA 2ZZUT 4WO4B 5K9KA 2H9GA 1N5YH 3KJ4B 3RB7A 1LO2H 3A0OA 5IV2A 1XTLA 3MV8A 3BZDA 3QPXH 5E1HB 3SO3B 4G7SB 1H6UA 1I1YA 1O0VA 1NMAL 3R8BB 2W60B 2P5WA 1MRCH 5C0AE 3HMWH 1I3RA 1OL0A 3V7AE 2VISA 5IF0A 2WUCL 4G6AD 3P30L 3AXHA 4X0KB 5EV7A 5ITFB 5C09A 3ULVF 1FFPB 4Z3HA 1EFXB 1I3GL 4QHMB 4HUVB 3QIBD 4ZMVA 1W6WA 2P48B 3ZSTA 4Z7WB 4HV8B 5CR1A 1NBVL 3V6OE 4EJ1C 4P2RB 4X98A 3DUSA 1LMKA 4WEEA 4ZS7L 2EIZA 2XN9E 1EJ8A 5GIRA 2WD0A 2XT1B 2WVVA 4HKZA 4KI5E 1A4BA 2VLKA 3O6KH 2K4AA 2OQJB 4UQ9A 3FF8A 4ICWA 3RWCA 1K72A 4HHAA 4KH9A 3P3UA 1NFAA 4U1KB 5KVFH 4ZFOA 4M03A 1XF4A 1AHWB 2HT3D 3VUAA 4D9QD 1KXHA 4B9PA 5JIMA 2NY3C 4YVUA 4DFIA 2Q86B 2IQ9L 5MENE 5PCYA 2MKLC 4RFNB 5E51A 4KY1H 4U1LB 5D93C 4ZS6D 3WE6B 1OSPL 1UD6A 1IJ9A 1P0SE 2W59A 2CUMA 4PMFA 4NERA 2KDGA 5K9QG 2H32A 4OCNC 4W70A 1GSKA 1QSEE 2H3KA 1G1OA 4X6DB 3BUBA 4XH2B 2GJZB 1IGTB 3BQUD 2VJXA 2UVFA 2FUTA 3M8OL 4ZSOA 2XTLA 3V2AR 4G7YH 3CVHL 1T89A 3O8XB 3VTAA 3EYOB 1OCOB 2I5YL 3C5XA 1BVOA 3BSZA 1IO4C 4WJ5A 3WEOA 1KYFA 1CDIA 3H54A 5B1KA 2JF1A 3RVVC 3TO4C 5KVGH 4NHUB 2MHAB 2AMGA 4HUXB 1MJ7L 4Z7UE 3MV7B 2DH3A 4LLUA 5BRPA 2JB5L 5D7LB 3VWKC 1E7VA 1SQMA 4G6FB 4JGJA 1F4YH 1AY1L 3T0WA 2GJRA 4OKDA 1BOGB 5F1IA 3TVMC 3A24A 4L37B 2W94A 2LU7A 1FFPA 4E42B 5GHWH 1YEKH 2NW2B 3GGWA 4QHMA 3I9GH 3TEXA 5FO8B 4Z7WA 1F13A 3NFSH 4M02A 3HB3B 2CLZB 3S3BB 4Y2NA 3SY6A 1TSRA 2F5BH 2XTJC 3PUUA 1A8JH 3WTSA 4GXFA 3EW3B 4OV5B 2PTVA 3LH8A 2EADA 3W9EB 3HVDA 1DVSA 1S7TA 4AMKH 4B50A 4HWBA 1M05B 2DLGA 2FHFA 3FU7A 4AL8C 3VD3A 3T9WA 2G4GA 5LCVH 3ARBC 1LWHA 4LHQB 4B7LA 4PS7A 4Z77A 3OQRA 2WZAA 1AHWA 4KTEL 3IGFA 3NCWA 4Q2ZB 1VSCA 2ARJA 5A16B 3BAEL 5C92A 2APTA 4PJIB 5INDA 4ZFGH 2J55A 2B15A 1XXDC 3L3GA 3L4ZA 3P1VA 3QR1A 3WE6A 4A66A 3NIDE 1JDCA 5I16A 4ZQKA 5IFHH 5FB8B 1J8KA 1LD9A 2Y4SA 1EZLA 1Z1WA 3QJRB 2FGWL 4D8PB 2PTUA 4JVWA 4YLBA 1ZT4B 1GY1A 3NCCB 3TC9A 3QZWG 2YSTA 3U46A 5I15H 3PQYA 4F37F 3MOBL 5K39B 2V9QA 3O6LL 4LPUA 3GHBL 3O8XA 4RQQB 4H0LC 3EYOA 1A7PH 1QWNA 1UH4A 4PJ5B 2GTWB 5HXMA 4HXAL 1MNNA 4N22A 3ABZA 1JF1B 4LAQL 1NH6A 5F7UA 2EDTA 1AMXA 5H37A 2IDCA 2MHAA 4MX7A 5D1QC 4HUXA 4X83A 3MV7A 4XMKL 4M1GL 3QIBC 1RZIA 3VTMA 3H3KA 3S35L 3JVGC 3EJJX 4QOKB 4BEIA 3UBHA 4FP8H 2QQQA 2LTQB 3GSNL 1FL5A 2FJSA 4J8QA 4BINA 4E42A 4C54A 2NW2A 4H8WH 4HJIA 5KYNA 4H1LA 5DFWH 2BS8A 2DBJA 2PW2B 1P5UB 3LQMA 4N20A 4RGMC 4YDZA 4OZ4A 2YEZB 1EVUA 2OJEA 5C0GB 3M6DA 4GQ9L 4DP4X 4OV5A 1BSIA 2C4FU 1YMMA 1J0JA 2HT3C 4E9LA 1I7TB 2X4OA 2AJUL 5T33H 1J11A 1JPTH 1S7QA 3WBDA 2BY3A 4HLZH 4LSPH 1FZOB 2P1YA 5EBGA 3LXCA 3X1EA 3FTYA 3GSXB 5JXAH 3P2DA 3VXUA 4ODVL 3H3PL 4F24A 3AG4B 4NT6B 4BK4A 4RFEB 4ZZKA 4FFTA 1WV7T 4IHOA 4ENZA 4DAGL 5A16A 3UTTA 3BQUC 1MUJA 4GKSB 1HNGA 3BZ5A 1I9IL 1CZ8L 4GKLA 4D8PA 2E27H 5C0AD 1ZT4A 4G7RB 5B4MD 3VI3B 4NM4L 5F2FA 1DJSA 1QPPA 3ZYJA 1OK8A 3B56A 4GP4B 1SLXA 5KTEL 5LN8A 2ERJC 1JF1A 2Y1ZA 1D5IH 3BT0A 3LKPB 5I0WA 4YHOL 4HC1H 3N1MC 2PW1A 3UJJL 2XN9D 2ARJQ 1H15A 1UZ6E 5DWUL 3RY4A 4CN6A 2O6FA 1YJDL 1RIUL 4N2CA 4KI5D 3BEVB 1BX2A 3DX2A 5LGHH 3VQMA 4QOKA 3FSVA 4TQPA 4FQCH 2VR4A 3ZDZE 5BOJA 2EJ1A 4WI3A 5JPNA 3QQ9D 1GJUA 3GLZA 3MC0A 1XWVA 5MEND 1A6UL 4YE4H 1CG9B 3CZLA 3BCDA 3S34L 2YEZA 1LXMA 2EKSA 4NUGH 4A7GF 3SE3C 1QACA 5E8EB 3L4YA 5DD3H 3TWCH 3WGUB 3SDCD 4FQPA 2P9RA 1K5NB 1MCOH 2ICCA 3Q6GH 4KO9A 3Q2WA 5DMGC 1QSED 3M1BB 3E2HB 3GMQB 4TVPH 2WV3A 3FH7A 2XIBA 3K6IA 3LX9A 4H25B 4GSDL 4WLCA 5JW5B 4Q9QL 5C0ND 1NAKL 4ANWA 3GSXA 2CBOA 2IVFC 1KTLA 1HCFX 4NT6A 3ILPB 3KHQA 4KZCA 1CI3M 2MH4A 4HOWA 1N2RB 4NWUH 5C0FB 3Q05A 4XN5A 3L4WA 4WSGA 3GBLA 4GKSA 1S9WA 3O3BA 1D5ZA 2AXWA 4P2RE 1F2XK 3W0WA 4J3TA 2O5ZL 4Y5YC 1IJNA 3EG9A 4OIFA 3SQOL 3GXFA 3LVTA 1R34A 5C0CD 4JKMA 1P7KA 5EUKA 3VI3A 4AH2A 4Z76A 1TZIB 2JKIS 3B3BA 3MJ8B 4UIKH 2Z4QB 4HIEB 1UWGH 3HC4L 4KDVA 4NQSB 2HLEB 2I32A 2EIEA 3LKPA 4H8PA 1X5MA 4MQTB 2WXKA 4YDLB 2A3TA 4MCYA 4EN2A 1MCPL 3JZ7A 4MNQB 5C2BH 4I13B 5TQ2H 2HPTA 5DHVB 5GSVB 2ZT9C 4UV7L 1RQ5A 3D0LB 4WFGE 3VD5A 3HI5L 4BZ2L 1JZ6A 1H6EA 5AL0A 4YBQD 1W72A 4JM4H 2R2EB 2GW5A 3M7FB 5L9DH 3BRFA 4HDIB 4X6DE 1A22B 2P8MA 3OX8B 4YXKL 1NAML 4B9ZA 4O9HL 4R97B 2WSPA 4G8FA 4IRZH 2Q6WB 1K5NA 2NPLX 4MQXD 4AQ8A 4FLHA 4A2EA 2FEEL 4L3EB 4F92B 3M1BA 2GHZA 5I8OL 2B1HL 1HHJB 3CZUB 3K91A 2KDYA 5ADPL 3A23A 5D7LE 1MVUB 1QR1A 1YUHB 2PETA 2ED6A 5H2BA 2EIJB 4LPCA 2QSVA 3DDGA 1UASA 1UKTA 5FUCC 3ILPA 3REWB 4DP2X 3QHZL 5J6GA 3HG1D 4C4BA 5C0FA 4L9DA 4AKOA 1Z3GH 5B4MC 1MEXL 3MTRA 4WO0A 2Q2LA 3PWUA 5JUEH 1QR4A 1P5VA 4MJ5B 3RIFF 2OCFD 3I02B 1XHHA 4GAGL 4P5MA 5HHNB 3HRZB 5E70A 3GXMA 4LKXA 3V6OC 3WNLA 1IBGL 4YLCA 5DA0B 4HMCA 4FEIA 3WTTA 1KTJA 5C8JA 1AI1H 1TZIA 5IBTH 3MJ8A 2AABL 3QP3A 2JXMA 2Z4QA 2Y69B 3B2VH 3OTTA 4HIEA 4KI5C 4XCNB 5DFTA 3SE8L 2EDKA 4X5WA 1UM4H 1ITBB 1T3FB 3TTSA 5E4EB 4LDLB 1E2WA 1TOXA 1F90H 5DJ6B 1IAIH 4XP1H 3MNVB 3D4YA 5LGKA 2XKUA 1CT8B 3GSQB 3H56A 1SBSH 5KVDL 4PJIE 5E1AA 3QQ9C 5D1ZB 1GZQB 3C09B 1OE2A 2JJVA 4F15B 4I2XE 4DO5A 4APQA 3OKOB 1DP0A 2XWZA 4WK0B 4XAWH 4NWTH 2H2PD 1OHZA 1RUQL 2MQ0A 4FG2A 4FQHB 4HDIA 3SDCC 3TLRA 2VXQA 3OMNB 4A55A 1D5RA 5FGBC 5A7EA 5BJTB 1R0AH 1CN4A 1KB3A 4K5PA 4P3WA 2FH6A 4Y4FB 1X7TA 4QRBA 4DP5X 3QWRA 3C6LD 4FQQA 4IEFA 1EHLL 1WZAA 3GMRB 5C0NC 2LR4A 2Q6WA 4PJ5E 1HSBB 4ZD3H 2VXVH 4BV1A 3SE6A 2NY7L 1CE6A 1USZA 4L3EA 3VSUA 1MJUH 3MOAL 1MDAA 1TPXC 2CLRA 1BQUA 4LBAA 4PG2A 2EDHA 1NEPA 4J3XA 4AUUA 1JMZA 4G5ZL 4F8QA 1LE5A 1ADWA 1NMBL 4XXDB 1ZHBB 3LEXA 3TH3T 2AJYH 2OI9B 1YY8A 1R4XA 5HI5D 1CU4H 1P1VA 3SBQA 2NX5B 4Y19B 3LRGA 4U1JA 5FS5A 1ILUA 4JZOA 4MSWB 1SDDA 5EBLB 1U95B 4MJ5A 1WD9A 3LHPL 4OUUA 2VUOA 3FUKA 3EGXB 5CGYD 1PMYA 4BJLA 4OF6A 3S2AA 3O2WH 1ORQA 1USQA 3HNTH 1SJEB 4CC4C 2OR8A 1L6XA 3QQNA 2WQXA 4XP6L 2CIIB 4U0RC 2FWLB 2CR6A 2VDOB 2OR9H 1FSKB 2VL5A 1N5YL 2PP8A 1B6DA 3Q8FA 4POUB 4PJFB 4YBQC 4AIZB 4W9JC 1J8HB 2I9LA 4AKQA 1LO2L 3IDNB 3JWNG 2V2XB 3QPXL 4LVHB 4U3SB 4W9DC 3OBAA 3QJHB 3MNVA 1A6WH 4MTMA 1MRCL 3LKRA 4PLKD 5B1JC 4WO4D 4WHTB 3ROOB 4JCLA 3S98A 3HMWL 5D1ZA 4KO7A 2C3WA 3WDHA 3IWVA 4BK5C 1PFCA 3OKOA 1ZEAH 2X6BA 5AENA 3JV0A 3I50H 1FYTB 4MVBD 5FM5O 3ILQD 4MQXC 3U7WH 3LY6A 3IFPA 1A64A 2R29H 4WNQA 1NSNH 4MD5B 1K4DA 3T0BA 1EFXD 4W9ZA 3GS7A 4F80A 1TEFA 3IBEA 1IKFH 3O6KL 4HUWA 1H5BB 4P2RD 4ZXBA 1PZ3A 1SXSA 2CO3A 3ZGIA 3OG4B 2X1PA 1T83C 1KG0A 4DKTA 5KVFL 3VXOB 1DQLH 4QMEA 1MCEA 3Q8EA 1I8LA 1G1CA 3EXLA 5B7MA 2EUVA 4FKEA 4R0LA 3KLAA 4XXDA 2CUIA 4KY1L 3DIDA 4Y19A 4N8CH 1T5XA 3TBYB 4MSWA 1X9QA 2WN3A 1MCJA 3VFOB 3ARFB 4HISA 4N0FB 3ULUH 1E4XH 4WFGD 3EGXA 1XDTT 1MVYA 3B2UC 1WZMA 4P9MH 3X13B 8FABA 2RAMA 2VW6A 5E9NA 3ZRCC 4ZX3A 4G7YL 3D18B 4P46D 3ROLA 3TTYA 1IBYA 1SXCA 1KCRH 2CIIA 4WFFE 4DSYA 1JNNH 1BZEA 4K94H 3II3A 2WYHA 4LOEA 1WAEA 3N40F 5T1MB 4PJFA 5KVGL 4AIZA 1J8HA 4NN6B 4HBCH 2V2XA 3EO0A 3RWEA 5I0DA 3ESVF 2H2PC 4MLSA 1A3LH 4FLOA 1F4YL 4NC0B 1WZKA 1AOZA 3ZE2E 2GBUA 3RBSA 1GYVA 1GYCA 3BUYA 2X9YA 3L48A 3L5XH 4IIQA 3VXSE 3BP4B 3WEXB 4UTBA 3C6LC 1YEKL 2LE9A 5GHWL 2O93L 2CR0A 5D7LD 1MPAH 5MEQB 2MNUA 3I9GL 4G6FD 3RHWK 2A4EA 4N90E 4DOHB 2YD6A 5DXWA 3NFSL 3ABMB 3GJFB 3PYCA 4JFHE 4HETA 1OSZA 2HRHA 3MGAA 1PIGA 2BNRB 2EXYD 4MD5A 2F5BL 2XWBB 4I9XA 1M57B 5AOKA 1QW9A 2FWOB 2GUYA 2ZX5A 5HJGA 4PS3A 4AMKL 2CGRH 2ZP0T 2AITA 5FV2A 5C7ZA 1PZBA 5F71A 2IAAC 4WJG3 3IRPX 5DC2A 3HB3D 5LCVL 1BGXH 4OJCA 3Q7JA 1JWUA 2EE9A 1AH1A 5G55A 5AFAA 5HI5C 2V33A 4KKBD 3SDAB 4MNQE 5I5JA 3OR6B 2PR9A 1DLHB 2OZ4A 5EF1A 3MJ7B 5KOMC 1U8HB 4Y2DB 1ZT1B 3SKNB 4ZFGL 1JPFA 1DJIA 2WXNA 5CGYC 1YYLH 2HKFH 1IIKA 5IJDC 4TULH 3SPGA 5IFHL 3VFOA 5IQNA 3QNZB 4LBEA 3ARFA 3NPSB 5MHSE 4XMPH 2OTWA 4MD0B 3Q2VA 3X13A 5I15L 1MFDH 3L5WA 1U8PA 1ZHNB 5DQ9B 35C8H 4Z0BH 3WNKA 3LZNA 1A7PL 2DQCH 3U9WA 5GPRA 2HG5A 2YAQA 4KX9A 3QT2A 4PLKC 3LS5H 1HKFA 25C8H 4K5NA 2YUZA 1XT5A 2KZ1B 4ISVA 5T1MA 5DC9B 4XNDA 5DO2D 3EYFB 1IILE 5JIHA 2C3VA 1SXNA 1SXZA 2OJZH 5DJ8B 1IE4A 4PJ5D 3MRBB 3NP4A 3FU3A 3VFVA 3ILQC 3ECBB 5EZLB 4H40A 4JN2B 4YDNA 4KXZH 5DZNA 4W9HC 5E08H 2B39A 2CM5A 4FP8L 4TVSa 1TO4A 4Y4KB 4YDVA 3QVAA 2QGBA 3CXFA 3WEXA 1UACH 3QA3B 4H8WL 4HJEA 4R7DB 5MEQA 2DAVA 5CAYB 3ZXAC 2X0WA 4A6YA 2ODHA 3NCEB 2BNRA 5JOPE 4A1RA 2BOCB 5AZEH 3P9LB 4QHKJ 4U2YA 3G6JF 2VIRB 4HFWB 4PJHF 4QHPA 1G9MC 2A73A 2PP7A 1KELH 1TCMA 3DI3B 2AEOA 4FQ1H 2AVGA 2OBGA 3FRPG 4G8AC 5T33L 2OW6A 2EECA 1JPTL 3LSOA 2WZPD 5D7JD 2N0MA 3JWDC 4LSPL 3FJTA 5BV7C 1HWGB 1UD5A 5JXAL 4PSPA 1CD8A 2QLYA 4FNQA 5AWNH 4JO3H 2DKUA 4I8DA 1DLHA 4B97A 3C9NA 4PRDB 3DPDA 4JKLA 4KI1A 1U8HA 1OCRB 1EAQA 4QDGA 4PJ8B 1HL5A 4WWID 1ZT1A 4ELDA 1UUSA 1RLWA 5F9WB 4MQ7A 4UAOB 3L54A 1S2EA 2KLSA 5GGSA 4XPAH 3T6XA 3TN0A 5JNYB 2J8UA 2X40A 2WLZA 3T0DA 4P46C 4A04A 3QR2A 1HJBC 2E27L 4MD0A 3U2SA 5CU9A 2F15A 4CVXB 3IE9A 4LSUH 4O02B 5DQ9A 4AYGA 5ALCH 2DYPB 4H2CA 4MZIA 4YHPA 3DOHA 2WNWA 3AAZB 3TJHC 4F5CE 3BAKA 1UWEH 4EUPB 1U30A 3QR0A 3SZKC 3L2NA 1D5IL 2J7LA 4EI5C 2M83A 4HC1L 2VRKA 3EYFA 1QLEH 4GOSA 5J3HD 2IADA 4W4OA 2HTKD 5DJ8A 2NSXA 3V5KB 5IB1A 2M8XA 3L81A 5LGHL 3L17A 1KPVA 2EXYC 2NX5E 4I48B 2GJPA 1GXEA 3QC6X 3QWOB 4FQCL 2EDNA 1OP9A 1NGZB 4KKPA 4UZGA 1OGTB 4CMMB 1Q9WA 1DQMH 4TTDD 3PXHA 4YE4L 3HB3C 5F21B 4OZIB 1L5GB 4NUGL 4QYAA 5DD3L 4H0GA 4TSBH 3M86A 4ZTPH 1Z9SB 3P9LA 4NPKA 3TWCL 2VIRA 4ODXA 5JXEC 1MCOL 3Q6GL 4KKBC 4ELKB 3FCGA 4W1TA 5ICUA 4PJFE 4TVPL 3RRQA 4OZFB 2WVUA 3CZGA 4TS6A 3S7GA 4HD9A 5DC0A 1BPLB 2NW3A 3F84A 1G7MB 1Z9NA 1QAWA 1DEEA 4WFFD 2JKWA 3FOLB 2VN7A 4IBYA 4NWUL 5E6IA 4BDVB 4PJ8A 2DQHH 3WJLA 3WXWH 3QWQB 1A4KA 2VSMB 4G9FA 4Y5VA 1FYTE 3NOIA 3E6FA 2F1EA 4RX4A 1QPKA 5B1BB 4PR5B 1CC3A 1GIGH 4CVXA 3FT9A 1HWWA 3VXSD 1QUNB 5DO2C 4OQTA 3GTTA 4PRIB 2DYPA 3D08A 4N90D 4UIKL 3ATDA 1UWGL 3QI9A 4NDMB 4JFHD 1IAOA 5E6ZA 3RBGA 3RJOA 1RLBA 4NUPA 3NRPA 1JHTB 2GIXA 4LLYA 4YC2C 3BD4A 4JFFD 2PKDA 4ECNA 3HAEB 5C2BL 4UZUA 5TQ2L 3V5KA 2XZCH 2VMEA 1KGCD 3FN9A 2XJLA 3NDZE 4JM4L 4ZOAA 4I48A 3VM7A 3QDMA 5HVFB 5L9DL 3QWOA 2VUYA 3IBOA 3L7EA 4MNQD 3GIZH 3L16A 3VSQA 2J71A 2JSFA 3O11B 1P5UC 2R1XA 3R18A 3BT2H 2D4FA 1X5IA 3QEQA 5D7JC 5L0QB 3T3PB 2C8NA 3P4OB 4P5SA 1VHPA 4ZPTB 4IRZL 3AZUA 1MCWM 1NCCH 4YBLB 3IMBA 3OD3A 4GSXA 3VXTB 3MVSA 3G5VB 1I1FA 3QRLA 4OD1H 5DC4B 3BOVA 3VAEA 1QEWB 5MHSD 3RVTD 1SOKA 5HY9B 1H0DA 1XSJA 3QZBA 4MNGB 4XB8A 4XWOC 3D30A 4O4YH 2V8MA 4DGUA 3ARDA 5KYYB 4Y4HA 2Z8RA 4ESKA 2X1OA 4LSTH 1JGLH 3FOLA 3T65B 3BAXA 1KT2B 3PGDB 1ES0A 4HJUA 4ODSH 3NQKA 1Z3GL 4H0IA 1IMHC 4L2LA 5FYJU 3GMLA 5IJBC 1MNUH 4OLUH 4DOHE 2XDHA 4A7UA 5JUEL 1W8EA 3I6GA 3BPCB 4OCSH 4UWQB 4NQTA 4ANXA 1U4FA 2AQ1A 3BI9X 4LLDB 3L3KB 4G72B 3GT6A 1DCEA 2GTZA 4G7QB 5FC9A 1AI1L 5J3HC 5IBTL 4JR9H 2HTKC 1F4XH 2WLIB 4K7PH 3B2VL 1NC4D 4NQVA 4F7EB 1U21A 1H8SA 2CCWA 2NY1C 1UM4L 5JOPD 3KPSB 3OSVA 3OLDA 3UIZA 4WSJA 4DEWA 1CBVH 1E28A 3TZVC 1F90L 2XY2A 3REVB 4ZMWA 1IAIL 4XP1L 3R7QA 3HAEA 1AZBA 5B21A 2GBAA 1SBSL 2QKIA 5H94A 1U4EA 4TTDC 5BZDB 5IQMA 4LEBA 2XJKA 5TJWK 4NJAH 4XAWL 4NWTL 2MIZA 3QYNA 4ZW7A 5I74C 1IC1A 1UJ3B 1SOSA 3SO5A 3T0EA 1R0AL 4GXVH 1JZGA 5ECJE 3SBPA 1WFNA 4FJYA 3RL1B 4N87A 3WG7B 2C1PA 1YECH 4ZD3L 2VXVL 3QO0A 1WIUA 3L3HB 4JRLA 1MJUL 2W9LA 3CSYA 4Y4FD 2OYMA 1PZSA 4N6RA 1C7SA 1MCFA 1HDMB 5IQ9B 5KYYA 2X44D 1UVQB 1CFSB 3IAQA 5TH2B 5L8KB 3T65A 2EE3A 1S5HA 3O45A 3PGDA 3I6LE 4M6OH 2AJYL 4YIQB 3D0AA 3DBXA 4S1RH 1CU4L 1AXTH 2WWKO 3H2QA 5E8DH 2WJ5A 1CFVH 4QRQB 2H32H 2WXRA 1GCFA 2X0VA 1WWAX 4YAQB 4ORZC 3AW5A 1CIUA 4LLDA 4PBWD 3S8WA 3O2WL 4V2BA 3HNTL 2NX5D 2PXYD 1GGCH 1QASA 1ACXA 3KH4A 1EEYA 5D7IE 4NOBA 3CXHK 1EH9A 1DCLA 4LE8A 4F7PB 3ARGD 1QRKA 2OR9L 2WLIA 3U1QA 4L9LA 3FB6B 4YMPA 3BSZH 3QISA 3HNVH 4GH7B 4C58B 4GAJH 3QUZC 1MREH 1KCBA 4OCWH 2APWA 1E4JA 2AJXH 3NIFF 4HGWB 4YDLC 4FLRA 4GXUM 3REVA 6TAAA 3VD0A 5JR1H 3LKOA 3PL6A 1A6WL 4QIRA 5FW7A 2Q3XA 4L3CA 5BRQA 3WNMA 3EJPA 2H0EA 4LPTA 1HH6A 1CD9B 5LG6A 5EZOH 4GLRI 4YSDA 4JAMA 1VEOA 1ZEAL 4PWIA 3I50L 3U7WL 3Q5OA 3DIFB 2QSQA 3F5WB 2R29L 1ANUA 1NSNL 2FZ3A 1B4TA 1OCZB 1S4IA 3P4LA 4ZYKA 4HKXA 1CDBA 1FYTD 2BHZA 3RU8H 1IKFL 2K3TA 4HWBH 3NSDA 3L3HA 1NGQH 4XP9H 4XVOA 1CVSC 2ZG3A 1K4CA 1DQLL 5CLTA 5E03A 3QZWB 5FYLH 2I60H 3CQPA 5GZNA 2OX5B 1Y1UA 1CFSA 4JPWH 4XOEA 4X4YB 1J87A 4Z7VF 3PHQB 5LG1A 3RDJA 3U2IA 4YIQA 1KGYE 3WKPA 4JG5A 2WLHA 2OK0H 1BQRA 3AITA 3IU3B 4RGNB 7PCYA 4N8CL 4QRQA 4IW4C 4HK3J 4QRUB 3ULUL 4OZIE 3I6KB 2P80D 2R1WA 1E4XL 3BGAA 3FTUA 4Q74A 4G1MA 5CD3A 3AWGA 4Q9BA 2Q9OA 5AUMB 2BINA 4P9ML 5CJBA 2BIHA 1UC6A 4ES9A 2BWIA 4OLZH 2ZSWB 5LBSA 4E9WA 1Y6NR 2X53A 3WIIH 1KCRL 2G75B 5BCAA 4F7PA 1JNNL 4K94L 1A7NH 1CGTA 1IARB 3ARSA 3FB6A 5EIVA 2Y7SA 3L3IB 1JGIA 2ROYA 2DKSA 3MLYH 3RI5K 3FC8A 1SGKA 4LRNH 3WHE0 5H37H 4HBCL 3VQ2C 1A3LL 4N26A 5B38G 5ETUB 1KJMB 2R56H 3MNWA 4IRSC 4KTDH 1HZLA 3RILA 3L5XL 4S1QH 2E75C 3I3DA 1J48A 5BQ7B 1MSPA 2GSMB 3HUJF 3HBGA 4I4WA 1MPAL 3GPEA 3QUYB 5KAQG 3DIFA 4HXBH 4H1LH 4QRRB 3UAJD 4U1HA 4Y4FC 5L4FA 4OZGF 4IOIB 4PRIE 2EO7A 5BUAA 1FLTX 2CGRL 4Q89A 3Q6FB 4XBMA 3AACA 1CF8H 4PH8A 1BGXL 5GZOA 4O2CB 2DMGA 2OYLA 4G80B 3MLXH 4WZ9A 5C0DB 1JK9B 4FEMA 2Y25A 1U2YA 5DJAB 2OX5A 4KO5A 1CCZA 3ZYIA 4ZO8A 3NSYA 4F9PA 5A2AA 2A74C 5SWSB 4OTXH 3B1TA 3QUMB 2E4TA 4BSWB 1IBHA 1U8LB 1YYLL 2QHRH 2HKFL 5G5DA 5IQ7H 3SDAD 1D6EB 1A6AB 2PXYC 3IU3A 4WAFA 2DWTA 4PJEA 4TULL 3IVKB 2OPCA 3BLPX 5EZIH 3SE4A 1TTUA 4C83A 4B9KC 3BMVA 1L9NA 1NUGA 15C8H 2R39A 3ARGC 4XMPL 4Y2DD 3EO9H 4UT6A 2FNBA 3ZOAA 3V4PB 1MFDL 2XA3A 3MLTB 35C8L 2ZSWA 3A6CH 5HYJA 3AU1A 2K9UA 2G75A 2CO2A 2DQCL 4IMLA 4BXSV 1ZGLM 2VLRB 2F58H 2VR6A 4HCRA 1FSKC 3LS5L 4KI5F 25C8L 3WV0A 4MNGE 1T6VN 4DTGH 3BVVA 3AT9A 2OJ1A 1KYOJ 1P4IH 4LVHC 4POZC 5A2LH 2OJZL 2YXWA 4LGRB 1TQTA 2G2PA 4N2IA 4QXGH 4GG8B 5ETUA 4KX7A 2QVMA 4UU9A 3FUMA 3QO1B 2XLLA 5HDBB 3V0DA 5E08L 3WFZA 1KZQA 5ICYA 5BQ7A 4RIRA 1UACL 3O3DB 4P4KD 1NM9A 3WHXB 3QUYA 4MBRA 4BELD 3G5YB 1RK7A 4MMYA 3G3LA 3F62A 4X50A 3VGEA 3EOAA 3I6LD 3TP4A 4Y4KD 5HVWA 5AZEL 3GBMH 2IPKB 1IBFA 2D0GA 1KELL 3L8QA 3CPLA 1UCTA 3NCBB 3Q6FA 4FQ1L 4HIIB 4TNVF 4WFHE 1H5BC 3JTSB 3SKMB 3UACA 2VZTA 3N43B 3S5YA 3KPSE 1CFQA 3K6SB 1AAJA 5JO5A 1WEJH 2BRRH 3DX9B 1XH3A 3IK2A 4HALA 5EBWA 4UOZA 1JBJA 5LGJB 3D12B 2XKSA 5AWNL 3IDXL 4JO3L 4LIQE 1SXAA 1EFQA 3DVGB 4MYWB 4XCCH 5E9DA 4Z7UF 2I26N 5D6DA 2K9FB 3PWJB 3ZUNC 2R15A 2VR7A 3HZMA 1YNLH 4Z7NE 3QUMA 4BSWA 4XPAL 3ME0B 1BZ8A 3IVKA 4TM9A 4FXGA 4NAJA 2ZUTA 2YEQA 2EVFA 1ODUA 1WYJA 4YR6A 3SE9H 5I6XC 1F3DH 1FLRH 3A6OA 1UENA 1N10A 4LSUL 1P4BH 4Q7DA 5ALCL 5EORH 4ZO6A 3G6DH 2YARA 1UWEL 3RGHA 3V7MA 3GYRA 1FFOB 4DEPB 1EHNA 4OGYH 2ED7A 4LCCC 1QLEL 3FF7A 1GW0A 2I07B 4DKAA 1KJ3H 4PHXA 1E9OA 4FYRA 3SDDB 4XPTH 2IWFA 5JQ6H 3TX4A 4GG8A 1E8WA 1YNTB 3ALWA 1E30A 1EK3A 1OM3H 2H4EA 3LRMA 4PJCA 1CYWA 3LV3B 3BAIA 1E5UI 4ZUSB 1LMIA 5FO7B 3UAJC 3BMWA 5DD6B 4N3TA 1YN7B 5JLZA 2NSQA 3KPQB 1FIEA 2DTMH 4KGJA 2A83A 1F11B 1V55B 1DQML 2X41A 3BPNC 1T66D 2L8AA 3S3DB 1JXGA 1T7WA 1U8IB 3E0GA 3BSGA 1ZLWH 1FGVH 3BC9A 3FT3A 3IGAB 3F58H 4TSBL 3NGBB 4ZTPL 3BIKB 3N85H 3VX1A 3DK0A 5F9JB 1X9UA 3L9BA 1G4MA 3L4TA 5SWSA 3SKMA 3UABA 5IMLA 4XBPB 1SF5A 4N86A 1YCSA 3EYUH 3CNKA 4P23B 3UTQA 4QXWA 1D5MA 1U3YA 3EH3B 3DX9A 3HKZA 2DQEH 2C9UA 4HK3N 5LGJA 1E5CA 1K8IA 4OIIH 3D2UD 1ZLUH 3IJSB 5I75C 3MQIA 3KPMA 3IS1X 3NN8A 3ZHDA 1WDAA 4HAFA 3KCPB 3PWJA 1SVZA 2DQHL 4OD2B 4P04A 3WXWL 5MEOA 4AGPA 3ME0A 4QTHB 4C56E 1WAPA 3V0GA 2CHZA 3D5OF 3RI5F 4HVBA 3CQFA 1KNOB 1HE8A 3BLKA 3B9KA 1GIGL 1MWOA 2EDQA 2JIXA 3EJTA 2AJZA 3Q13A 4R7LA 5K9QI 5KSUB 1CGUA 1R5IB 1EQWA 1FFNB 4ADIA 5ESAA 1BJMA 1TITA 1WG3A 5C97A 3NSXA 4NPYB 4DHLA 4Z3JA 1HJCA 2HN7B 3DUUA 2H8PB 5DSCA