5DHVB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 25
structure length 110
sequence length 110
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvB00
1GJIA 1SVZA 1T5XA 5IP4A 3QH3B 5IJVA 2DQUH 2B4CC 4O51B 4Y8DC 5GRXG 4AM0A 3RDTA 1J11A 3TZVA 1JTTA 2KH2B 3SBWA 4EN3D 3V5HA 2IGFL 4UOW0 1XR8B 2CIKA 3L5WB 1RULH 4HK3J 3GM8A 3I85A 4G6KL 4QTHA 2YPKB 2BY2A 4H5SA 5HSFA 3I6GA 3O4OB 2D3VA 4NM4H 2VR5A 4C54A 3B9DA 1L7IL 3BQUC 5GGRY 4HUVB 1T80A 1CDGA 4JO4H 3V0WH 3CH1B 1CICA 4OD1L 4D0BA 3RPIA 3DO7B 1Q0XL 3C8KA 3QEQD 4LP5A 2BP3A 4W68A 4RBPH 4BK5A 8FABB 4X7SH 3CMGA 5SX4I 3ARFB 4XPAH 3T8XB 4DKFL 3LQZA 1QNZL 4KROC 2FEDD 3TT3H 1J1XH 2FJHB 4P2RB 5T3ZH 2GUOB 3VXRD 1DLHA 2FHCA 4WUUB 2V2TB 4MCZB 2VRAA 4JRXD 1BQHG 3PABA 4LVEA 3B8SA 4QXUH 5D70L 1W0VA 1DQLH 4CN6A 1QA9B 2FJFB 4WFHE 4D9QE 4QCIB 3V6FA 1KLGB 5TE7H 2ZG1A 1OGAB 4Q74A 3MLTA 4G3YL 1CIUA 4M7KH 4GW5A 5I1AB 3MFGB 2WNGA 5FOJA 3NACH 4HIHB 1OB1B 5GRVK 3MV11 1H3UA 5DJCA 4D94A 1IMHC 4ZOEA 4NKDB 4DVRL 5FDWB 4IBLT 3VXTA 4R6UA 3WS3A 4NKIL 4F7EB 1A21A 1IC5H 2EKSA 3BX7C 3VFUA 5CCKL 2IFFH 4R7DA 3SPVB 1EPFA 5HI4C 3TV3H 4KMTL 4OJFL 3MPCA 1YUHA 4YLQT 3S88H 4HFWA 3V9FA 4WTZG 3Q0HA 2F54E 1HSAA 1NBQA 3RI5F 5C0FB 5IGXL 1LEKB 3MV8B 2J88H 4HT1L 1IM3A 3S36H 2ZUQC 1MCJA 1ZVSB 1DCLA 1MNUH 5CEYB 4WI4A 4H1LH 1GOFA 4NQEB 2AKRA 4NFBA 3O2WH 4FZ8H 4NM8H 5IBLD 2Q20A 5I16A 4OZGE 4PUBH 1MCQA 2YUZA 1LO4H 2OTWB 3DURA 4QRPD 3H3PH 1AHWA 1H8OA 2YEZB 3KPRB 3O2DL 1TZGH 3B9KB 1T21A 3Q48A 5HHMB 1KXQE 4NGHH 3I6LD 1IAOA 3DVFA 3QUXB 4OCWL 4U0RC 2M1KA 3H9SA 2XQBL 4GAJL 4JFZH 3L6FA 3HNVL 3KYNB 3MBEC 2VZTA 4LLQB 4U05A 1EBPA 3OAYK 1MFEL 2A83B 1ZHLB 4LSTH 3KXFA 1X44A 3EOTH 1OF2B 3SDXF 3B2UC 4ZSOE 1HOCA 4NO3B 3OGOE 1QLRB 1J0KA 3VXOA 3X12A 2C3HA 4DKAA 2YA0A 3IGAB 3KPPA 1CFVL 4AQOA 4ODWA 3PWVA 4H1LB 5DJ2B 2X4TB 4NOFA 3H9HB 1SJXA 3FB7B 5SV4A 1BIIA 4P5MB 2Q8BH 4HBCL 2YRZA 4MA8L 2HT3D 3RIAK 1NUNB 3FKUS 5TDNA 4YXKH 4IIQB 3RVUC 1FVEA 4OLWH 3DROB 5KSBA 2FJGA 1IC1A 1OAYL 2BSTA 2NX5B 3M17B 3VDAA 4PJAB 2XWJA 2R2EB 4LVNC 1GGYA 3GHBL 3TO2B 5DHVH 4ISVA 1OQXA 1KCVH 4OLVL 3LEXA 2L7UA 4GO6B 3VA2C 5B39G 2NY2D 1O7SA 2EECA 1JGUH 1G9MC 4QRPB 4L3CB 2HFGL 5ITBL 4BM7A 4QOKB 4U6YB 2Z4QB 1OAZH 2DQFA 1EZVX 4CVUA 2P5EE 1UM4H 1UM5L 3KNBA 1EXUB 1HEZA 4LK4A 3CPLA 3IKCA 3GKWL 4C55A 4WDIA 1Y0LA 3UTQA 4YDIH 2K9UA 3JWOH 4YGVA 4IHOA 3AS2A 4EJ1C 1WZLA 3TYGH 1ZGLM 3QCVH 3O4LB 4J3SA 1ZLUK 4KUCF 3WFHB 3ZYOA 2HN7A 4RIRA 1T0NB 3K8LA 4LSDA 4E5XA 5E8OB 5F93C 3L9RB 1DVFD 4LASL 3ALWA 3G6AA 5DHVB 3W0WA 1E27A 4OFYD 1K6QL 4KJPD 4HIXL 4F7TB 5E99H 2E7BA 4OFVA 1BHGA 1FQ9C 4BFBD 3O3UN 1Z5LA 4GQPH 2A6JA 3NIDE 3TO4B 1FCGA 4GAGH 3WIFA 1B2WL 1CD1B 3VFRA 3V4UH 1ZLSH 4LSSL 1Q9OB 5HGAA 3FHAA 1BGXH 4L4VA 1P5VA 4XP6L 3UBXA 3RX5A 2D4FA 4JLRB 3VWJD 4HKZB 5CBEB 1YNLL 2I9LA 5IVXA 1F4XL 2AK1H 3EYOA 4Z7UE 2XA8H 3D39B 4R9HA 3GMOA 2P1YA 4JKWA 1EBAA 5GZND 5JPNB 5F89A 2R0WL 3DYOA 4PLKD 1T5XB 1FZOA 2NY7H 5IJVB 1A6UH 3FN3A 3VG0L 4AM0B 3RDTB 2HT4C 3TZVB 2F5AL 3V5HB 4K94C 5J6GA 2CIKB 3L5XL 5CUSH 1SY6A 2YXMA 3JUZA 4KDTC 1KJ3L 4QTHB 3VGDA 4X7EC 2ATKA 1BQUA 2ADFH 3DXAE 2V2XA 3I6GB 5DMYA 1VCAA 4PJ8A 5ANME 1L7TH 3KVQA 3BRGC 3K2UH 3LB6C 3P4LA 4F15C 1CICB 1P6FA 4D0BB 4XAWL 3RPIB 4NSKA 3C8KB 1ZHKA 1PD6A 3DJ9A 3MLVH 3LQZB 4M43H 5FYKH 1TJIH 3OKMA 3VGHA 4YHLL 2FX8H 1DLHB 4JFDE 3RY5A 1VSCA 3KS0H 3PABB 1C08A 2VSCA 1JHLH 1W0VB 3BISA 5TGBA 1N0XL 4J4PA 1SM3H 2VJXA 3S36X 1ZLUH 1VPOH 4G6JL 5CJXC 5KS9B 5D71L 3RAJL 3MLSH 3TCXA 3MLTB 3BH9B 4H8WL 4GW5B 3AS3A 3C6LC 5K9QI 1FZMA 4NO0A 3VD9A 1H3XA 1QSEA 4EQ2A 3D25A 1EX0A 5ISZE 2OJEA 4JFED 5DJCB 5TE4H 3MYJA 5JR1L 4EDXA 3AXLA 3VXTB 3WS3B 2EKSB 3VFUB 4ZFGH 1H3PL 3LS4H 4R26L 4R7DB 1QSZA 3PNWA 2BVYA 1YUHB 1G0YR 3NMEA 4HFWB 2I26N 3BT2H 2J8HA 4K2UH 5T5NG 4JRYA 4M9PA 1HSAB 3MLRL 4K8RH 2ITDA 3LRSA 4XVTH 3WFCH 1IM3B 3BZEA 2RHEA 4YDKH 2CXGA 1D9KD 2AKRB 5SWZA 2Z31A 5EUKA 3CFBA 4OUOA 4Y4KD 2HKFH 2J4WH 3W9EA 5I16B 4NQSA 1DEEA 3CVIL 4FXKA 3DURB 1OY3B 2R15A 2QQNH 2V17H 4KRPC 5FUOL 4KRLB 1AHWB 3IAPA 1S7XA 4FQXA 4NQCE 5DVMA 2O93L 4PJDE 4OV5B 4HCRL 4JG1H 3TPKA 1OL0A 3UCRA 4EUPH 3UO1L 5HYIA 3LS5H 1T21B 4PJ5A 3RY6A 1IAOB 5J06A 3H9SB 1X4YA 4WEBH 3SDAD 3L6FB 3UTPE 4U2ZA 5CZXD 5I74B 3O8XC 4HIEA 3DIFA 3NTCH 2WSKA 4JAMA 1Q38A 2C3WA 3KXFB 1VGKA 1M6OA 3VA6A 1HQRA 1M1SA 1FHGA 1WCBA 3ILQD 4YHKL 3VMOA 5GS0D 1HOCB 4R2GD 4XMKH 5B21A 3EJZD 1DBMH 3X12B 1B3JA 4PFEA 2BC4A 1U8PA 4IRJA 4QTIL 4ODWB 3PWVB 5KZCD 4UT9L 3KGRA 2NQCA 2BY1A 2VDLH 1BIIB 1TETL 4G6AD 1V7NL 4NQDA 3P9LA 5TDNB 4KKNA 4Y2OA 2C4XA 4JO2L 3VFOA 1OAKH 5D1ZC 1A0QL 5KSBB 1AE6H 2FJGB 5DO2C 2ADGA 1EEQA 2BSTB 2EDEA 4MCYA 1YPZE 2XWJB 1QFOA 3ECBA 5DJXB 4ISVB 3CLEL 1MAML 2PO6D 3V4VH 1MREH 2WWMD 3HA0A 3LEXB 2HLFC 4Y7MA 1OLZA 2AGJL 2XZCH 4ZUSA 1HINH 4A6YA 1MPAH 1B88A 3MGTA 4G9DA 4KKCD 1I7ZA 3TEUA 2NYYD 5KVGH 3KNBB 1HEZB 1H3GA 3CPLB 3IKCB 4CGTA 2IBZY 4WDIB 3MRRA 1Y0LB 3UTQB 1LK3L 1X3DA 3GSQA 1PDKA 4LPXA 3EJYC 1RUMH 4YGVB 4IHOB 4ODVH 3GO1H 1U8OB 1RUPL 5H8DA 3OXSA 2HN7B 1T66D 4RIRB 3SE9H 3L3DA 3L5JA 3E2HC 2QL1A 5GRUH 3LDBB 1A7PH 3KPSD 5T1DH 3W0WB 1CGVA 2W91A 3G6AB 3D3VA 1JF6A 1E27B 1HHJA 3BE1H 1G7PA 1NMBL 2ZUWA 3RA7L 4OLEA 1ACYH 5A16A 3T3PE 4OF0A 3BZDA 4N8VA 1Z5LB 2A6JB 5ESQA 1EA9C 2LAGB 4JHWH 3WIFB 2HRLA 3VFRB 5LG1A 1D5MA 2WINA 1EVUA 1SY6H 4H1LG 3KLHC 1QFWM 5HGAB 3TJHD 1OP9A 4PRHE 4UV4L 1MFAH 4X7TB 4XNMA 4L4VB 5C0AA 3UBXB 1I9RL 1I1AA 5GGVL 1UEMA 4ZNCD 1CF8H 1PLGL 4GG6E 3UJJH 2I9LB 5IVXB 2XA3A 3HHRB 4KGLA 2XV6B 4NP4L 3EYOB 3GMOB 4TUKL 4TYUA 3TIEA 1OTUD 2DWDA 2HT2D 1IKNC 3GBNL 1NLBH 4JM2C 5TDPA 1KJMB 1YY9C 2APTA 3GRWH 3DO3A 5F89B 5F6IB 1CD9B 5EU5A 3RI5K 1FZOB 2DKUA 4KK6D 2I9TA 1DVFC 3VFTA 1BOYA 4YZFF 2YD7A 2AXGA 3OAUH 5IMOA 4PJHF 1JYXA 1P6AB 1TZIA 3SJVD 2ATKB 5SX5K 4LCWA 3T0DA 1QR1A 2V2XB 1SJEA 4PS4H 1FFOA 4PJ8B 2RAMA 5B3JE 4JQIL 5E24E 2PW2B 3RJDA 5SWZD 1T2QL 1KB9J 1IGMH 4YHYC 2HFEA 2JIXA 4NSKB 1ZHKB 5E2WL 5D2LA 2X42A 4RSVA 1OM3L 3VWJC 3QISA 1BWMA 2H2PD 3RNKA 4YBLC 2FNBA 4OZFH 2RCSL 3OKMB 3MV7A 2BSRA 1ZA3A 4MXQC 1F97A 3UTSE 4MNQD 1IKFL 2VE6A 2ILLA 1C08B 2ZPKL 3TA3D 5GZNC 5TGBB 4B5EA 3QRGH 1JNHA 2VDOH 3HC3L 1MI5D 5FUZH 3LZFL 1RZGA 5F6HJ 2UWEA 3VDCA 4P2CG 2BNQD 1FZMB 4HXAL 4NO0B 1QSEB 1A9EA 15C8H 3QIWA 5F7WC 2OJEB 3AROA 5D7SL 3MYJB 4EDXB 3AXLB 3HUJF 1U92A 2CKBH 1ADQL 4KHXL 3WFDH 4XP5L 3PNWB 1P4IL 3O45A 3O6FA 4RGOH 1OTTC 4JRYB 4UV7L 4HF5H 3MA9H 3FQNA 4UMGA 2ITDB 1MWAH 3ET9F 3LRSB 1QHPA 4IDLA 2EO1A 3BZEB 1MELA 5I71B 3S35H 5HGHA 5J1AA 4ERSH 1KEGH 5SWZB 2ICES 2Z31B 2K3TA 3CFBB 5EUKB 3E1F1 3C5SA 4GKSA 4PRDA 3W9EB 4NQSB 1DEEB 4FXKB 4YDLB 4UTBH 5DD1L 4JG0H 1JN6A 4U1MA 4FQXB 1S7XB 1P1ZA 3K1KC 4NJ9L 3T0EE 2LU4A 5HVHB 4JDZA 4PJ5B 4K9EC 2JB5L 4XHJD 1N0LA 2E7HA 2NXZD 3V0VA 4AEEA 1R24A 2RJMA 1FRGL 4HIEB 3DIFB 3VDBA 3FQXA 4JAMB 3RY4A 3LQAH 1MJUL 1D5BB 1VGKB 1M6OB 4IEFB 4A6YH 1HQRB 2OL3A 4BSVA 5TE6H 5C6PB 3QDGA 4WWKA 4XC1L 5EIQA 1EO7A 2BC4B 3BXNA 1L0XA 4HUKB 1U8PB 4IRJB 2BXYA 4OV6F 3SKOA 5MEOA 4X4MA 2Q3ZA 3P11L 5D72L 2H6PA 2BOCA 4NQDB 2VQ1A 3P9LB 5E2TH 4L4TE 4ZOCA 1D9KC 3L7FA 1U8HA 3HE7C 4HEME 3VFOB 3ULVE 4Y4KC 5FYLE 4HQQL 1CL7L 2ADGB 3GSRA 4HKBA 5D7JD 4H0GA 4MCYB 4WGVB 2HTLC 4UTAH 5IHZA 1T83C 3ECBB 4NQUA 3NCCB 2GJ6E 4P2OC 3AY4C 1JWSA 2MPAL 4KXZH 4L5FL 4QRRE 4HSQA 4GKZA 2BXZA 4N5ED 4ZUSB 3QCUH 3MGTB 3JBG7 4G9DB 3SDAC 3D2UA 2VDPL 2VLJA 4F9PC 3GK8L 2VUYA 1NC4D 2C1PA 3HI5H 2X1QA 2O5XL 4NN6B 3WL9A 1FO0A 1KIRA 4FA8A 1XH3A 3M8OL 5GS2H 1B4JH 1JHTA 1NBVL 3MBXH 2VN4A 3EJZC 4ZFFA 1PG7W 2ZSVA 3MRRB 3ARGD 3WLWC 4IRZL 3GSQB 2CH8A 3M07A 1IVLA 2RIKA 4CU6A 5EDXA 3OXSB 4XX1G 2JJTC 4XNXH 4AEHH 5HYJD 5C0IA 3L3DB 4G6AC 2QSCH 4EQ3A 3QI9A 3HZKA 4TVPD 3FTGA 2GSIA 3D3VB 3LY6A 2XTJD 1U95A 1HHJB 2AJYH 4Y4FA 5F1OB 1A3RH 1AY1L 4OGYH 1I3GH 1F4HA 2LE9A 5A16B 4M4RA 3WN5C 2W92A 4N8VB 2JIXD 1DQDL 1OTSC 2ZCHL 3WO4C 5ESQB 4YNYB 1CWVA 1F8TL 1D5MB 2WINB 4JO3L 1QSVA 3BESR 5BZDA 1S9WA 5IBTL 4KI5C 5C07A 4ZNEE 3HI6L 5J1SC 1B0GA 3IDXL 4M48H 1RUQL 1C1EH 5IFJA 4RFOH 4U1GC 4HPYL 2EDBA 4I77L 4PB9H 5LXGL 3D6GA 5GGTH 1A5FH 3TIEB 4ELME 2DWDB 4M1CD 4PJ9C 5EU7C 1YEGH 5TDPB 3EYSH 4Y89A 3PQYA 1T66C 3ZT6A 5EU5B 3ETBF 4XWGL 4W4OA 3ARGB 3BAEH 1A7OH 4WWID 4WENB 3VFTB 1J8KA 1XMWA 2AXGB 5GGRA 3IJSA 5IMOB 5KTEH 2H1PH 5IJKC 3MRIA 3WHE1 1BWWA 3FO1A 5DQ9A 1TZIB 4HWBA 3PUCA 3H42L 5LAXA 4LCWB 1QR1B 1SJEB 1FFOB 3C5ZC 2CLVA 2ZUVA 3CVHL 1K3IA 5EIVA 4Y1AE 3IKKA 2DI8A 4U4BA 2A9ML 2YN3A 4CBPA 4C58B 4MA1B 1J0ZA 2JIXB 3LIZL 4P57A 4P99A 1WZMA 4YHPA 4M5YH 2APXA 4G8FA 5GZOC 3RNKB 2YSSA 5IB5A 4RDQF 2H3NA 4O5LL 1F45A 5D1QD 5C08E 2JELH 3FQTA 3MV7B 2BSRB 3P0VL 1FL3A 1ZA3B 2HT2C 1KB9K 4RISL 5GHWH 5MERA 1YYML 2VE6B 4LCIH 3SGKC 1QEWA 3QXVA 5GRWA 1JNHB 1EFXD 3IS0X 5C0RH 2QHRL 1V3KA 3BPOC 4O58H 4YJZL 1RZGB 2UWEB 1CDHA 4QHNA 2VISA 2EDJA 4D8PA 2DLTA 1CL7I 3UBXG 4WWKD 4FQCL 4KRMB 3QIWB 1OHQA 5A43C 3S9DB 4HULB 4YX2L 1U92B 1UJTA 5ITFA 2R1WA 2VL5A 1KTRL 3GB7B 3IDJA 3FZUD 1I75A 3ARBA 4H88H 4HJJH 2DMKA 4Y16C 4I1NB 3RIFF 5I1JL 3MX0A 3ULUH 3KJ4B 3O45B 3FFDA 1G6RH 1YEHH 4GXUM 3EHBC 4HMCA 2FBJL 3RWGA 3FQNB 4RMSA 3WJJA 1B4RA 4PJHA 5IVOA 4KTEH 4MA7L 4M7LL 5HGHB 1EJOH 4O9HL 2A38A 5IUSA 5J1AB 4EBQL 4O4YL 3C5SB 4GKSB 3T2NL 4XCFH 1V7ML 4NWTL 2VLLA 2MHAA 1JN6B 4U1MB 1P1ZB 2R69H 5MEPA 2Y06L 1T7XA 3BRFA 5F7FA 5I1KL 1U2HA 4JDZB 4L8BA 5EOCL 4GMSH 1XIWD 3QQ3A 3TWCH 1GVIA 3V0VB 3RZCC 1PW3A 2ORBH 5FM8A 1FC2D 3KR3H 4XVUD 3FQXB 3GSUA 3VFSA 4M8VA 1UH4A 4OGXL 5I75B 1ZKAA 3OJVC 3C60A 5EO0A 2EIDA 2OL3B 4BSVB 4P59H 5HD8D 4G8EA 1SHMA 4WIQA 1A3QA 5FUCE 1PY9A 4PJ7A 1RZJH 3LH2H 3QDGB 4WWKB 2RBLA 2QLVB 2V7NA 4FS0A 5DT1H 3SKOB 5MEOB 1U3JA 5MHSE 5I8CA 3DX8A 1MY7A 3GGWB 3TN0A 2H6PB 5DK2B 4E41E 5EC1A 2BOCB 3MLYL 4R97C 4JQVC 2VQ1B 1FNGA 3BVNA 2W9DL 3HUJA 4G7YH 3UJTH 5C3LD 3L7FB 1U8HB 3H7BA 4XPGH 5DF0A 2WV3A 5HHXL 3T4AA 4ZG1A 5EG6C 1KPRA 1QTYT 4LU5L 2XRAH 3RUGF 3MROA 4PYGA 3GSRB 4HKBB 4POZD 5IHZB 3SQBA 1AFVH 4LMQI 3PL6D 4MJIE 4ZPVA 4S1DD 5LCVH 1JWSB 1QVOA 2ESVA 1FORH 4CKVX 1JMXA 4XCNA 1OWWA 1ZV5A 2DMCA 5IESL 1OW0C 4JFFA 2N56A 4Y4HC 2W0PA 1U36A 1LEIA 2GI7A 4XHJC 4ONFL 4DK6A 3NIFF 3D2UB 3DVNA 1WBXA 1WBZA 2VLJB 5DDHA 4AEFA 1CGSL 3QUYD 4HFUL 2C1PB 3WL9B 1FO0B 3OF6D 3CMOH 2X05A 3RGHA 3AU1A 3RBSA 1KIRB 4PJCE 1XH3B 2ARWA 1JHTB 4BUGA 2L4OA 4ZFFB 4MB4A 1I7RA 2ZSVB 1PSKH 1U6AL 12E8L 3INUH 1YJDL 1JNJA 1RJYA 5DK3A 3OSKA 1IT9H 3FT2A 2UVEA 4RZCB 5C0IB 1KGCE 4TUOA 1JPTL 4TNWF 1FNFA 3QI9B 4FQ2H 5HVWA 3HZKB 4P2QE 3FTGB 2GSIB 4NPYA 4YAQA 4GRWH 5L2KD 1UWXH 5JPMA 4XPFL 1U95B 4G5ZH 4Y4FB 3FB8A 5LBSH 4Q97A 1PX4A 2A9NL 1P2CA 5D7JC 3Q1SL 2Q8AH 2JCCE 3A6BL 1U93A 4KY1L 5LGHL 4S2SA 5EPMA 5GSRA 3ZKMC 1MCOL 2X4NA 4HWBH 5BZDB 3PL6B 1S9WB 4IMLA 3IB4A 4M4PA 5C07B 2RQ8A 2G2RA 5F21B 5IQ7H 2L7JA 5IFJB 4TUJA 5DUBA 4WO4A 3MJ7A 3S98A 4X0KA 1EV2E 2NY0D 4Y5XC 3V7MA 1AJ7L 5EA0L 3MLZL 4FQLH 3W39A 3MV9A 2AEQH 3QUYB 3HN3A 2NXYB 4RFNB 1L9MA 3NPSC 1A22B 2QKIA 2G60H 3VI4E 5T3ZD 5IMLA 1CU4H 3PQYB 2DQDL 3CX5J 4Z7VF 4TSCH 2HVJA 4RGMC 2OK0H 1CXLA 4LSQH 3QDME 4U1KA 4XXCC 1EJ6A 5GGRB 3IJSB 4TULH 1F3JA 3MRIB 1FH5H 4PGBA 2W65A 2F54A 5D6DA 3FO1B 4WW2F 2DD8H 5DD0H 4HS3A 2ADJA 4FNLH 5DQ9B 3RJQB 5C2BL 2ICCA 5TPWL 5DUML 5LAXB 3K74B 2E9WA 4F3FA 3X3GL 3WKNA 4CMHB 1HKLL 3CFCH 2CLVB 3LKSA 5E0QA 3VXMD 1J8HA 4OIIH 4LQFH 1TITA 1A4JA 5BV7C 5JIIA 4P57B 2AERT 4OZGA 2F58L 2NMSA 4YHPB 4G8FB 2FB4H 3O41A 2W9EL 1IAIM 5I18H 2YSSB 3D1MC 3VGFA 3ZE1E 2YK1H 3VFWA 3FQTB 3VFGH 3VXSE 2EXYC 4DTGL 4LSVL 4L9DA 5BOPA 5MERB 5E1AA 4YWGL 1QEWB 1IRAY 1BX2A 1RUKH 1G0DA 4N8VG 3OL2A 3ZT7A 2J2ZA 4LARH 2B7DT 1X5KA 4P4KC 4LHUA 4K3DH 1FPTH 4FTVE 4QHNB 2VISB 4I3RL 3QO0B 4ZSOA 4D8PB 4YC2B 5KVFL 4ALAL 1GIGL 2YWYA 3MRCA 5D8JH 3WHXA 1MCLA 1QBAA 5ITFB 2R1WB 5GS0L 1OP5H 3IDJB 3QEHA 1X5IA 3ARBB 1V3LA 3U4BL 4J7RA 4KKBC 3FFDB 3PHQA 5CJOH 3D69A 4XMLH 1AXIB 1T0PB 1HQ4A 5IB4A 3FAXA 3RWGB 2Q86A 5C7XH 4PRIE 2D2OA 1FAIH 3ZDXE 3MXVH 5I76A 4M3JA 4PJHB 4Z77A 4GG6F 4LLWA 4XTRC 1MLBA 2NY1B 4Q6IA 3ZE2F 1A7RL 4PGDA 1A1OA 2VLLB 3N06B 4JFFD 1OAUH 2MHAB 2HJKA 1A6PA 4KH2A 5MEPB 5DHYA 2I5YL 5ECJE 2P5EA 3FCTA 4L8BB 2P8LB 1O0VA 4X80H 2NZ9C 3QQ3B 1NC2A 4UDUA 4HC1L 5E9DE 1RZIA 3JTSB 5BRZE 4JPVH 4CJ0A 3GSUB 1P7HL 3TESA 1Y18A 3VFSB 5TF1H 2N7BA 4JR9L 43CAA 2GTZA 3C60B 5EO0B 4X7FC 4UIKH 4I8DA 2WUCH 4G8EB 4MMXC 4PJ7B 1OAQH 4HUNB 4HGKC 4G8IA 2X10A 4LIQL 3LAFA 1FNSH 4OF7A 4P5TA 4EVNA 3WXWL 2DTMH 1AGBA 5I8CB 3DX8B 1NMAL 4P4RA 5ACZA 3MRMA 4NNPH 3TN0B 5EC1B 4LPYA 2ZJSL 1FNGB 3BVNB 3HUJB 3DRQA 4JREC 4R4BA 3H7BB 4OLZL 1KPRB 4QRQA 2E6QA 5FIEA 1TQBC 1Q9WA 4KV5E 3MROB 1EHLH 4Y19D 1C5CL 3NIGE 3LSOA 3QAZC 3OKKA 3RGVD 4AMKL 5DRWA 4XNUH 3CFJA 5F97E 4M6ML 3VRIA 2ESVB 3RU8L 3AMKA 5TQ0H 3E3QC 1HNGA 4JHBA 4WO4D 3EIFA 4JFFB 3N50A 1LEIB 4WI7A 4Z7UA 2E27H 3P9WB 3DVNB 3LKOA 2YKLL 1WBXB 1WBZB 5LWYL 4UILH 5DDHB 3FL7A 5MI0B 1A6AA 4N8CL 1KXVC 2F19L 1H8NA 1XCTA 4UBDC 2V5MA 3SDCD 2BNRA 5HD8C 4LCCC 2KPNA 5EOTA 3LEVL 1I7RB 1KCUH 4JY4A 1VKXA 3OR7A 2CO6B 1RJYB 3L1OL 4XCCL 5DSCA 3SGDH 5CJQL 1QRNA 4PB0H 3FT2B 5F7DA 5E08L 2X6MA 4TUOB 4LVHC 1TTGA 3I9GH 4NPYB 1X4ZA 4YAQB 3DXAA 3ZMRA 5LJYH 1WIOA 5JPMB 3KJ6H 5ANMA 1J8HD 1P2CB 3NCJH 3C09C 3U36B 2AJSH 3GNML 1FV1A 4JKKA 5GJTL 1U93B 3MOAH 3VCLA 1ZGLA 2X89D 4S2SB 2HH0L 4ZXBD 1W8NA 4FQIL 1WSST 4KVNH 4J3UA 1I9JL 5EPMB 5GSRB 1IGFL 2X4NB 5B8CA 1EH9A 4HDIA 3K1DA 1CVSC 2ENYA 1HIML 2G2RB 5C1MB 1GZQB 4JFDA 5HY9A 5SWQA 4TUJB 5DUBB 3PXJA 4WO4B 4EI6A 1YC8A 3MJ7B 3D0LA 1CGWA 2DQJH 4X0KB 1KCSH 3K3QA 3QEUB 5ALBL 3LEYL 3W39B 1CYGA 3OKEA 3MV9B 2D7OA 2H2SD 3IU4L 1CDUA 1QG3A 5CBAA 2VXVL 2QKIB 4R3SA 3RIFK 4KTDH 3TBWA 3STZA 3EYUL 3D85A 2HVJB 4Z7NE 3MODH 1NGXA 4U1KB 4X83A 1YMME 1F6AA 3WIHA 1KB5A 1F3JB 1MFDL 2H8PA 5JXED 2DQCH 2W65B 2F54B 2EIBA 1BOGA 1MFBH 4HS3B 2ADJB 1PVHA 2APWA 1FZJA 4H0HB 4OLUL 4PBVC 3CX5K 1RD6A 2F53D 4Z9KB 4NIKB 4F3FB 3LKSB 4UIMA 1HYSD 1J8HB 3IFLL 4UAOC 4X5WA 1UJ3A 3ELAT 4WFEE 4AJ0A 1A4JB 5HYQA 5HI5D 3GZKA 3R0NA 2IPTH 4OZGB 2YA1A 1T03L 4M7JH 3O41B 3O3BA 4PRPA 4K7FA 3K80A 1PKOA 4YBQD 3VFWB 1CBVL 1M05A 3PP3K 4P46D 4XPHL 2XICA 2HTKD 3K7UA 1JGDA 1FJ1A 1OARL 1WC7A 3CD4A 5E1AB 1ZEAH 5L9DH 1BX2B 5DC0A 1U9KA 4I2XE 4R4ND 3WSQL 4LHUB 3QG6A 2IG2L 3QUZA 2BNUA 4JDVA 1YYLL 1CLZL 4ELKA 4X6FA 1LDPH 4I0PC 4ZSOB 3MRCB 4PTUA 5KJRH 2YBRA 4M6OH 4U6VL 4MQXD 1P4LA 3TC9A 5KW9L 2X70A 3QEHB 3U0WL 2C3XA 4Q0XH 4U1LA 3B9KC 1T89A 3QG7H 1RHHB 3ZE0F 3PHQB 2VMFA 4NUJA 3D69B 4NRXA 4MS8D 1YQVH 1HQ4B 2VDMH 4NZUL 4C83A 4NHCL 5IB4B 1FGVH 1KUMA 1ZANH 2Q86B 4G9FA 3SCMC 3F6IA 5I76B 1YPZA 2GK2A 4IDJL 4Z77B 4LLWB 4MDIA 4WW2A 3S34L 1DP0A 3VRLF 1SQ2N 5CKGA 4ZUTA 1EAJA 4WUUE 2GFBA 1G9EA 3MREA 5JW5A 4DN4H 1MLBB 5JDJA 4Q6IB 4YHMH 4PGDB 4JM4L 1Y6KR 1LHZA 1A1OB 5GGVY 3MRNA 2HFFA 2HJKB 2CLZA 4QRTA 2BVQB 5F9WB 1EMTH 1UACL 3HB3C 5DHYB 3HZVA 5CS7A 4UNTA 2P5EB 1NKRA 3FCTB 4IIQC 4KJWD 2FL5B 1NC2B 1J1PH 1RZIB 4TNWK 4Y2DD 4YE4L 1Y18B 2J5LC 1RIVH 43CAB 2ITCA 2VH5H 4S1SH 1LWRA 5F9JA 4Y5YA 1IILE 2VXUL 4HX1A 4XGZB 3WDIA 3VJ6A 3MV8E 4H20L 4GKNA 4G8IB 4TNVF 4ODUA 3TLRA 1U0QA 3K46A 2QADC 4Q7DA 3FRUA 4P5TB 3PWLA 4EVNB 1GXEA 3JWDL 1AGBB 1FFNA 3ESUF 4P4RB 1AGDA 5ACZB 3MRMB 2W59A 1IQWH 4OLXH 3FB6A 4TVPL 2WBJA 5LQBH 3DRQB 4K71C 4OUUA 4POUB 5EUOE 4OCYH 2CGRL 2MQ0A 1LK2A 3V4PL 2D9QB 5I9QB 4QRQB 4XNQA 1NSNH 5C71A 1Q9WB 1GGCH 2A77L 3B8YA 3GM0A 4JFQB 3LSOB 3OKKB 4X5LA 1NGWA 1U8QA 5DRWB 3CFEB 3VXRE 3W2DH 3CFJB 3VRIB 3WIIL 4MAYA 5E95B 3ZTJH 4JRXE 3DTXA 4GG6A 4LMQE 5DMIL 1HE7A 1X6NA 1E4KA 4JDTL 4Z7UB 3O6ML 3LKOB 3LMJH 2R4RL 3FFCD 3MCG1 1A6AB 1QSFD 1OT1A 3QO1A 1I1YA 1XCTB 2YD3A 4NC1E 3TO4C 4MB5A 5J3HD 5CMAA 2BNRB 4MJ4A 3OAZK 1F5WA 5BO1H 4NBYB 3STLA 2BRRL 1QLEL 4JY4B 1VKXB 3OR7B 5DZLA 2W60A 1A6VL 5FK9A 3THMH 5DSCB 5GS1A 1QRNB 2R56H 3C08L 5F7DB 3JWOC 1QZ1A 2ZCLL 2NX5E 1N4XL 4OT1L 3BKMH 4PJAE 4QXWA 3QCTH 2OJZL 1JGVH 2X1XR 1J5OH 3MNWA 4MB3A 5ANMB 3ZYIA 3BRDA 3OXRA 3VGGA 3BDBA 5T33H 1FV1B 3RGVC 5EO1A 5F7EL 2X9XA 4PRAA 3Q5TA 3VCLB 1ZGLB 1KB5H 3PWJA 4QRPE 1GSMA 1L6ZA 3AGVA 4R90H 5IROC 4QOKE 2DOCA 3EO1A 1INDH 3SBWC 3TZVC 4EDWH 3AAZA 4HDIB 1H5BC 3I6LE 2MQ3A 2BDNL 3I50H 3RUGB 1M71A 3SDDA 4JFDB 5E8NA 2DQTH 1J10A 5I1LA 3DUHA 5HY9B 4K94H 1TJGL 5SWQB 4EI6B 3GDBA 3D0LB 2DTSA 5IB1A 3RL1A 3SDCC 5C70A 1D6VL 2XG5A 3OKEB 3NABL 1V5JA 5I8KH 3EKCA 3HPLA 3IJHA 4R3SB 3DSFL 3TBWB 1YNKH 4LSRL 4KQ3H 5E8PA 5GRJH 3STZB 4QO1A 3C6SA 3D85B 1NCAL 2FATL 3NH7L 4XNZC 3W5NA 2DJSA 5FAAA 5IEHA 1NGXB 1JFQL 2P49B 1W0YT 1F6AB 2FD6L 1KB5B 1XF2A 3B9VA 2H8PB 3QHFH 3GSVA 2Y72A 3MTRA 1BOGB 1AKJA 1P9MA 1F2XK 1WZ1L 1FZJB 1BD2D 4G9FD 1JBJA 1L4IA 5T1LD 3DBXA 4K23L 2RR3A 1FIGH 4UQ2A 1R3LA 4UIMB 2X7LB 4X5WB 1UJ3B 3T3ME 2CPCA 5HHOA 2FR4A 5HYQB 2XY2A 1CLYL 5CP3A 1UCBH 3CIQA 1XF3B 1I8LA 5D1XD 4YXLH 1CGYA 2Y5TA 3CDGA 3GSNA 3L3OA 4TRPH 3O3BB 4PRPB 2CO7B 4JO1L 4K7FB 4DGYL 2FO1A 4PP1D 3T0EA 5GQBA 1XEDA 4U2YA 3DX7A 1M05B 1S9YA 3O2VH 5IW3A 3ZKXC 4QXGH 1EDQA 1RZKL 4ZAKC 1JGDB 1FJ1B 3D9AH 3DVIA 1RVFL 1R0AL 4GXVL 4OQ1A 4YHOH 3QG6B 1FO0L 3FONA 3QXWA 1A3LL 3QUZB 2DIAA 2BNUB 4JDVB 4MZ3A 4ELKB 4X6FB 2EDRA 1P4BH 4NOBA 2Y36L 4I5BA 4PTUB 1X9QA 4K7PL 5JXEC 4PGEA 2YUVA 2YBRB 4KPHL 4WFGD 1P4LB 2X70B 4RAUA 4XBEH 2R23A 4KHTL 3ARDD 2D03L 4U1LB 2AJXH 3AREC 4Z7VB 4NUJB 4L4TA 4NRXB 3MGAA 2WBJD 5JO5A 1CTNA 2ED7A 5K33A 4G9FB 4WHTA 1YPZB 3UPRA 2YPVH 5DWUH 4K8RC 4WW2B 4MDIB 4P9MH 2GJ6A 3T0AA 2IBZX 2ERJB 2V5SA 2ZCKH 4ZUTB 4CDGC 2GFBB 4QRRA 3MREB 5JW5B 5H35A 4P46C 3BIBX 5JOEA 3GEWB 2GT9A 3VI4F 5KSAD 2HFFB 3BWUC 4G6FD 5IIEA 2NY3B 2CLZB 1V3MA 2BVOA 5KS9E 4QRTB 2Z92A 1QFUH 3HZVB 5ICYA 4LFHD 3QWQB 2DWEB 3VWKD 3ZKQD 1YECH 2R29L 4HS8H 1BFSA 1MCBA 4F37F 4ENED 1CLCA 1IEBA 2VO5A 2ITCB 4UINH 3PV6A 3O0RL 2X4UA 3DHJA 5F9JB 1DJSA 3BO8A 4HX1B 5CLWA 3VJ6B 5CZVL 2CRYA 5MP6L 1S3KH 4GKNB 1TIUA 2NPLX 2CJUL 4RGND 5GS3A 2W1NA 5GS2D 1QBBA 3FRUB 3PWLB 3BN9D 1FFNB 3PGDA 4LHUG 2ZUXA 1AGDB 4OGAC 3MRFB 5F9AC 2VIRA 4UT7H 3FB6B 3C2AL 2WBJB 3MLWL 2BHUA 4OUUB 4LSPH 5DJYA 4AEIH 2XXMB 1LK2B 1JGEB 1X5ZA 4PGJA 4PIRF 2B8OT 5DI8A 1A14L 4XNQB 4N1EA 4LVOB 3WO3B 4Z7QE 1DR9A 3GKZA 3HNTL 1NGWB 1U8QB 5BMFL 4ZNEA 4MAYB 4WVRA 3DTXB 3LDBC 4GG6B 4YH6A 3NA4A 3V52H 4ETQA 4G6FB 2AK4D 1YEDA 3DGGA 2QHLA 3VH8A 4ELMA 2DQGH 5K9JH 2HWZH 1ND0A 1VADB 1D7FA 3DECA 3BHBA 3QO1B 4LBEB 1I1YB 3LOWA 3UPAA 4JFEE 4P9HH 1IGIL 5CMAB 5SX4H 4BA8A 5F96L 3STLB 1ZS8A 2YD6A 3P3YA 4NO2A 1JRHL 1R3IH 4O00A 4HHAA 2ZKHH 2W60B 3T08A 4R8WH 5FK9B 4YUEL 2CK0H 6FABL 3MGOB 5GS1B 3QSKB 3V6ZA 1CQYA 4HW6A 4QGYA 5JIHA 2VDRL 2VKXA 3WXVL 5E4EB 1A9BA 3MNWB 3MRJB 4GQ9L 5I1CL 3OXRB 1JNNL 4Y1AA 3OKLA 1C5BH 5EO1B 4XC3L 2AJVL 4PRAB 4TTGA 3PWJB 2VABA 3RVVC 3N0PB 2R9HD 5FV1L 3AAZB 4FQJH 5C08A 3BYYA 1AO7A 2FX9H 1GC1L 4AL8L 1M71B 3SDDB 3U7YH 4AG4L 4FRWA 5E8NB 5CILH 5I1LB 1G84A 2XZQH 4KZDL 5DK0A 3REWA 3BFOA 3QHZH 5IB1B 3WDHA 3RL1B 4PJ8C 1BJMA 4LPWA 5F88A 5CP3H 4DVBA 3HPLB 3IJHB 3G5VA 4OCSH 3BEVA 4DKEL 1F6LL 5ENWB 5E8PB 1GGTA 1N64H 3C6SB 5ESVB 4DUWA 4QEGA 5F7HA 1IM9D 1DBJL 5IEHB 1OSPH 3E8UL 4S11A 1VEMA 4KV5F 1XF2B 3X13A 3ZL4L 4P3CH 1YEEL 3NFPA 2ED8A 5B4MD 1AKJB 3CLFL 3SY0A 4P3WA 5GGUA 5A40E 3EDKA 2NY5H 3UROR 4J4PC 5T1KA 2IANA 5F7NC 3LV3A 4Z5RA 3DBXB 2NR6D 4GBXD 3ORJA 4UQ2B 1R3LB 3GJEA 1S7TB 1AQKH 5HHOB 5E2UH 2FR4B 5FYJD 3GJFH 5IVXE 3OPZL 5LGKA 5AEAA 2Y5TB 3CDGB 5IWLA 1HXYA 1RMFH 3GSNB 3L3OB 5B22A 3UPCA 2K7PA 3ULVH 3H9ZA 5FYLH 3T0EB 3ZTJG 3DX7B 1S9YB 1SYSA 3PE9A 2ID5A 3TGXA 5E5RB 3NFNA 1I9IH 2DLEA 3UC0L 1WFUA 4M1DL 4HV8A 3MOBH 4HK3N 5ADOL 4K3EH 2Y07H 2R0LH 4TNVK 1QHOA 7FABH 4NN5B 5DXWA 4LIQE 3FONB 4U3XA 4HJ0D 3QFJD 1AR1D 2IQ9H 1QO3A 4LEXL 3KPSE 2UZIL 4I5BB 2APFA 1N5AA 5C0DA 4OCXL 1IEAA 4GRLA 4X7DC 2IGFH 4FQXC 2UY7A 2ZOLA 1JYWA 1K9TA 4RAUB 2R23B 1VENA 3EDFA 4G6KH 4E41A 2ZP0T 4L4TB 4LHJB 5JO5B 4HGWA 1KIUA 1JP5A 3CDCA 1KELL 3FOMA 3F12A 4WHTB 1L7IH 4APQC 3UPRB 3W11D 4OD1H 1TVHA 3QCVL 2GJ6B 2W0LA 1Q0XH 3GMPA 4MJIA 1UVQA 3T2PA 5I1DB 1HCVA 4JPIA 2V6HA 5HDOA 2B5IC 4GSDL 4QRRB 1PY4A 3WNOA 4DKFH 2ATPA 5H35B 5JIPA 1QNZH 4IRJC 4XVJH 5HDQL 5ID0A 1JRHI 2CKNA 5C09D 2HG5A 2GT9B 5IIEB 2BVOB 3H3BC 2WLYA 2Z92B 3WNPA 5ICYB 3HR5A 5D70H 3ARRA 1J1OL 5E2VL 4WTWA 4F57L 4N90D 4PJCA 4MXVE 3LHPL 4X6CE 4PJBE 5DJ6A 4FQ1L 4PG9A 4XAKD 4G3YH 4N0FA 2OBGA 1KLUA 5HGDA 1RZ7L 1IEBB 1KJVA 4WI5A 4LLAA 1ZHBA 3PV6B 3HZMA 2X4UB 1U3HD 4JRYE 4X6BA 4DVRH 3BO8B 3LQAC 4MAUL 4NKIH 5CCKH 4L4JA 4OFIA 4KMTH 4OJFH 3TBTA 4BFGA 4NBXB 4Z0BL 2KKQA 4QY8A 2FH6A 4NN6C 1DQJA 3PGDB 5IGXH 1UEYA 4G8GA 5SWZE 4I0CC 4ZO7A 2EE3A 4ETYA 4UB0L 4HT1H 2VIRB 2JCCA 4LEOA 4Y8AA 5DJYB 4NQVA 5E5UB 5KANG 1IGTA 5DI8B 1DN0A 3OG4B 1H3VA 4TSBL 4L3EA 3S37L 3BOVA 5KSAC 2IAMA 3BZ4A 4MNQE 1BF8A 1RY7B 2KQMA 4Q2ZA 1T5WA 3DOSA 5AD0A 3O2DH 4ETQB 2Q6WA 4LPVA 1MI5E 2H9GA 1YEDB 2NY6B 4OCWH 3DGGB 3WFBL 4I0KA 3VH8B 2XQBH 4GAJH 3QPQC 4K07A 1ND0B 3HNVH 1BJ1J 2NY4D 4MQTB 2XZZA 4RNRB 4YXHL 3BHBB 1MFEH 2ADIA 3MJ8A 3HAEA 4L29A 5KVDL 1PQZA 2E6JA 1S7UA 1CK0L 2AAVA 1ZS8B 1ETZA 1U8JA 4NO2B 3UTTD 2WP3T 2D7PA 4HHAB 4XRCA 3QDMA 3V5DA 3S7GA 1CFVH 1I1AC 3BN9C 3V6ZB 3RX7A 2GJJA 2R8SL 1BZ9A 1D5IL 3RTQA 3FO0L 1T1YA 1WUNT 4HBCH 4MA8H 1VPOL 3ZKND 3G6JF 1A9BB 1JNLL 4CU7A 4HCRA 5CINL 4Y1AB 1OAYH 1RZFL 3OKLB 3O3EA 3W9DA 5FHAL 3IDNB 3GHBH 2LTQB 2VABB 5EU6D 3X3FL 4PJIF 3KHQA 4OLVH 1EIBA 2FIRT 4WI6A 2BVEA 1FVDB 3JWDC 5C08B 4ZQKA 5HVFB 3BDYL 3HE6A 4D9LL 1NANI 1AO7B 3VXSA 2HFGH 5ITBH 4YQXL 2OX5A 2X4OA 3DNKA 5DK0B 3REWB 2CR3A 3BIKA 2ZZUT 1UM5H 2WIMA 5F88B 4RAHA 4ZTOL 1A6WL 2JE8A 1J12A 3SQOL 2KBGA 5F7UA 4DVBB 5CEZL 3Q5OA 5DD3L 3GKWH 3U1SL 2Z35A 4BUHA 3BEVB 1TCRA 3ZSTA 1RUAL 5DGQA 2VC2L 2PYEA 4NYLA 1FLTX 5EU4A 3GI9H 3SDXE 1RPQA 1JCKA 2IPUK 5ILTL 5EUOF 5CGMA 3X14A 3ZYZA 3O11A 2XKSA 3X13B 4M6AA 4LASH 4J8RB 1K6QH 3SY0B 4HIXH 5GGUB 2F5BL 3QUML 5CGYD 5T1KB 2IANB 3UTZA 3BQUA 3LV3B 4Z5RB 4AT6A 3KLAA 3GJEB 3MMEA 4JN1L 5E00A 1B2WH 1TNNA 3QIWC 4LSSH 2ZG3A 1HHGA 1A7NL 4KWUA 1D5XA 1HXYB 4XP6H 5B38A 1SEQL 4ZS6D 3VXNA 5F70A 4F37K 3KJ4C 4ONHA 1YNLH 3O6FC 4FFVD 1SYSB 1F4XH 1G7QA 3NFNB 3TP4A 2PR4L 4HV8B 1BM3L 3LPFA 3DETC 2R0WH 3QIUA 4M61A 5HYJE 1MCPL 1QO3B 4RWYL 1PBYA 5I8OL 4TVPE 3VG0H 1NCCL 1N5AB 3LKNA 3J7HA 2F5AH 3RWCA 1IEAB 4GRLB 2XTJE 4Z7WF 2ZOLB 4J12A 4PJXF 2I25N 2D9CA 3L5XH 1IGCL 1KJ3H 5IVZA 1WIUA 4XP4L 4OF6A 4KK5D 4P5KA 1HSBA 1E6OL 4HGWB 2B1AL 5JW4N 2X09A 4PLOB 1X5HA 3FOMB 25C8L 4F80A 4FG6C 3DSNA 4M93C 3F12B 5SWSA 3ULUC 2I27N 4ODXA 2F74B 1F13A 5I75C 3FB5A 4OBRA 2I60L 1TVHB 3B9AA 4XAWH 3MV7E 3GMPB 4MJIB 1UVQB 5D2NE 4HLZH 1EVTC 2DYPA 2ATPB 3SKJL 5ID0B 5GJSL 3L5HA 4IRSD 4JPWL 2HG5B 4YHLH 3D18A 3WKML 4NZTL 3B4NA 1JJUA 3HR5B 3DMMD 1N0XH 2V2WA 4BZ2L 1WWBX 4PJCB 4G6JH 1CE6B 5DJ6B 1X4XA 1UT9A 3HG1A 4PG9B 4RA3A 5D71H 3RAJH 1GH7A 1N8ZB 1TDQA 1VESA 4N0FB 4H8WH 1KLUB 1A6TA 5HGDB 4B50A 1KJVB 1MVFA 1ZHBB 4BKLA 3HZMB 5JR1H 3MRLA 4X6BB 2ZNXA 4M8QB 1H3PH 1Z9MA 3EO0A 4NQXA 4R26H 1RZKC 3ILPA 5MENA 3TBTB 3VFMA 5L6YL 3WIHL 4X8XA 4PV8A 1RZJC 3MLRH 4QY8B 1DQJB 4YFLI 4G8GB 3WV0A 3P30L 2JCCB 2VAAA 4D9QD 1S9XB 2YR3A 1B6UA 1E6JL 4NQVB 4RMRA 1B0RA 1N7ML 1IGTB 1DN0B 5FM4A 4L3EB 2PF6A 2IAMB 2YPLA 3CVIH 4GW1A 3BZ4B 2EKJA 1MUJA 4G6ML 4JM2F 1U8MA 1Y6MR 5E56A 3JTTA 5FUOH 3T1FA 4YFDB 3QI9C 1RIHL 4Q2ZB 1T5WB 2HJFA 5AD0B 4HCRH 2Q6WB 1AQDA 3UO1H 4LOUD 1KOAA 5L88L 4FFWD 3U79A 5DD5L 5DTFA 2CDGA 5GIRA 5FO8A 5FGRA 3MJ6A 2ADIB 3MJ8B 3HAEB 2YD4A 4L29B 4JQXA 3BJLA 1PQZB 1S7UB 1ZOXA 4YHKH 4X4ME 1ETZB 1U8JB 5CIPA 5C0BD 3IXAA 4MJ6A 4XRCB 4XWOC 3QDMB 2X1WL 1HXMB 3V5DB 4QNPF 5KBNC 4W6XB 4QTIH 3WHE0 2EDKA 4LF3A 1JZ3A 3G9AB 4UT9H 1WTLA 4NKOA 3JV4A 1BZ9B 2X4SA 3EO9L 3RTQB 1T1YB 5DVKA 1TETH 1HILA 1V7NH 3BQUD 2W38A 1NLDL 4HXBL 2DF3A 4JO2H 3SGEI 1A0QH 1X5LA 3O3EB 3W9DB 2VDKL 4KROD 1CN4A 4W4OC 3OWEA 3CLEH 1MAMH 3DWTA 3V6OE 4UDTA 4PPTA 2Y25A 3B2VL 2AGJH 1DLFL 4ZQKB 4BJLA 3HE6B 3VI3F 3VXSB 1F58L 3HRZA 4U49A 3NBNA 2X4OB 4I2XA 5D7IF 3BIKB 2E9JA 2YXFA 3QIBA 4ZYKA 5HTSA 3S35L 1GGUA 2XN9D 4ZFZB 1AC6A 1QKZL 4M5ZL 1PEWA 2Z35B 2RGSA 5AZEL 2PXYD 1BVLB 1LK3H 4RRPA 4QHKI 1TCRB 2XYCA 5HI4D 3QPXL 3DI3B 2PYEB 4NYLB 1IEHA 4U1NA 1RUPH 3MRGA 5C0BB 3Q3GA 1WITA 4KKAC 5EBLA 3WUWB 3X14B 4RX4D 1FL6A 3VH8G 5ICZA 4Q9QL 3N1QC 5CSBA 3DO7A 2D4DA 2RFXA 5CEXA 4JJ5B 5GGQL 1NMBH 3RA7H 3UTZB 3BQUB 1ROWA 3K8MA 1LO3H 4TN9A 4AT6B 2UZYB 3KLAB 1V05A 4WUUA 1WTGT 3MMEB 2V2TA 5E00B 3QXUA 5GISL 1TQCB 4G7VL 2ZUYA 4YC2C 2Z8RA 2AS5M 4ZUVA 2PYFA 1HHGB 4UV4H 4HWZA 1D5XB 3SO3B 5B38B 1ZLWH 1I9RH 5GGVH 1MCSA 1QPPA 3ARBC 4JB9L 3MSPA 1PLGH 3PIQA 4X98A 1H15B 4ONHB 1IZJA 3MBED 4NP4H 1IE5A 4PJIA 1G7QB 4P0DA 4TUKH 5CJXA 3I84A 1HHHA 3WJJC 1MCWW 4RWHA 4F7EA 1X5FA 3GBNH 4V1DD 1KEML 3UYOD 5JXAL 4FMFA 2FECL 3C6LA 5F7MC 4EN3A 5J8OA 4G43A 2AXFA 3MO1A 3QIUB 4M61B 1JZ2A 3QNZA 3OJ2C 1FLRL 4MDJA 3LKNB 4L8DA 5IM7A 3RWCB 1ZVSA 1MLCA 1WAAF 4HUMB 3RVUD 2R2BA 5IMKA 5IVZB 1CD8A 2C7UA 4P5KB 2ZUQB 1GAFL 1HSBB 1KFAL 2XG4A 3QEQA 2N4IA 5EUOA 4KZEL 3CJJA 4JQIH 1L0QA 5SWSB 4OCMC 1D3CA 2O5ZL 1T2QH 4ZTPL 5F72S 4ODXB 5KAQG 4FXGA 2VDNL 4DFIA 1BLNA 3FB5B 5K9QG 3WNKA 3C60C 3QBTB 3HR6A 3MJ9A 4PP2A 5F8QC 3VXRA 5E2WH 4DCQA 2BHZA 1OM3H 4JRXA 3IRZA 3RHWF 3BGFB 2DYPB 4FFVC 5DR5L 2RCSH 2EYTA 4LLYA 3H8NA 5FF6A 5DRXA 1ZHLA 4O2CA 5KANI 3D18B 2AJYL 1SBSL 1IKFH 3TN0C 4N5UA 2ZPKH 2J8UF 5IFAL 2V2WB 1P84J 5L8KB 2DN7A 3BZFA 3HC3H 1W8OA 5IG7A 5KOMC 3LZFH 3HG1B 3U83A 1NCWL 2PNDA 3N85L 1A6TB 2DDQH 1OPGL 4HXAH 2DIJA 2D0GA 4BKLB 1X5XA 1QFWL 5D7SH 3MRLB 3CVHA 2D31B 1CE1L 4YZFE 3UJIL 1Z3GL 3RRQA 1ADQH 3EO0B 4KHXH 4NQXB 3ILPB 4XP5H 5MENB 4PJHE 1P4IH 2R2EA 1UA6L 3H6JA 3VXME 4UV7H 1WT5A 4BH8A 4ZMAT 1T6VN 1PG7L 2C9AA 3BP7A 2YC1A 4LVNB 3IRPX 1B0RB 2EIEA 5CAYB 2J8OA 2EYRA 3MLXL 4IRSC 5EH1A 1MRFL 2YPLB 4MD5B 4GW1B 5E8DL 1JIBA 1MUJB 5DD1H 3IXTA 1U8MB 3T1FB 3JTTB 4N9OB 5DEZA 2LVEA 3GSNL 2HJFB 4NJ9H 4X4XB 1AQDB 2BSED 5D6CA 1K4CA 2AVGA 2B39A 4A2LA 1LO5A 1KENL 1MCCA 2JB5H 3WUZA 5DTFB 2CDGB 1FRGH 5GIRB 2Y6SC 5FO8B 5E8OA 1OT2A 1MJUH 1HHIA 4KUZL 1BFOA 2HT4D 1GGBL 4KDVA 5CIPB 4CVXA 4K7PY 3IXAB 5E8EA 5BW7C 2R1XA 4PTTA 4XC1H 3WCYA 1XGUA 32C2A 5TFSL 3HUJE 4LF3B 1RURL 4NQCD 2A6IA 3MC0A 2X4SB 3P11H 5D72H 1S7QA 1HILB 3LB6D 4BK4A 3R8QA 3QFDA 4K3JL 3DV6A 4UNUA 5J57B 3NOIA 5EBMA 4FFYL 4HQQH 1CL7H 5DC9B 4HKZA 4C56D 1WIPA 2UYLA 4JFFE 2FECI 4BELD 4XBGA 3ARPA 3IDUA 2MPAH 2DKMA 4L5FH 2Q1EA 4UDTB 1A47A 2EE6A 4GJTB 4HLZG 4LOUC 5FYJL 3RWHA 5DVOA 2YN5A 3HRZB 2VDPH 1MHPL 3GK8H 1IKNA 4I2XB 4L8SC 3VMPA 2O5XH 3QIBB 5FECA 4JM2A 4ZYKB 3C6LD 4KK8D 3SKMA 3M8OH 3PWUA 1NBVH 3P0GB 4I9WD 4IRZH 1DVFA 2E7LA 4OFYA 4U1NB 2KUTA 2DMBA 3MRGB 5KG9A 3Q3GB 3A6CL 5EBLB 3GHEH 1DUYB 4NUGL 1FL6B 3SO5A 1T3FB 3TVMD 3ZO0A 5ICZB 5JTWA 5F1IA 2RFXB 1AY1H 3QULA 3HFML 5CEXB 3HAEG 4LDOB 5E03A 4WUKL 3Q2CA 4CAGA 4F15B 1DQDH 2ZCHH 2DQEL 4GAYA 1KTDA 5J7CC 3VWJA 4KRPD 1F8TH 4C56B 2HVKA 4JO3H 4ZUVB 1WQVT 3G6JB 2PYFB 3LN4A 2OXHA 5IBTH 4HWZB 3HI6H 5GPRA 3MV9E 1QFWI 3IDXH 5KS9A 5I73B 3PIQB 4X98B 1ES0A 1RU9L 1RUQH 4KK9C 3BH9A 5E5MA 5DQJA 2VSDA 3O8XD 4HPYH 1BQLL 4PJIB 4Z95L 1BEYL 1F90L 4I77H 5CKAA 5LXGH 3VFNA 1HHHB 4HMDA 2PXYC 4EOWL 2IQAA 4ZFOA 1H8SA 1NEUA 1OP3H 3C6LB 4EN3B 4G43B 2AXFB 3G08A 5IB2A 3MO1B 5D7IA 4XWGH 2DM2A 3QNZB 4Q6IC 4GLRI 4MDJB 1MOEA 1G1YA 4O02L 3TBYA 4L8DB 2YZ8A 4Y0GA 1IC4L 4PRHD 5IM7B 4GW4A 4V2CB 5IKCA 3NGBB 1MLCB 2GJZA 5F9WC 1J8HE 5IBUB 5B3NA 3MRHA 4MSWA 2R2BB 3RX8A 5D1ZD 5IMKB 2C7UB 4U1HA 1EGJL 3H42H 5D5MF 5DO2D 2F8XC 1O5DT 3QEQB 5EUOB 4FOMA 2EDFA 1KT2A 1DBKL 3CVHH 3ZHKA 4OV5A 2A9MH 5EORH 4FXGB 2HLFD 1BLNB 2P5WD 3LIZH 4PP2B 3VXRB 1JPST 1JZ5A 3N9GL 4DCQB 1J05A 4JRXB 4LCUA 4KRPB 4LP4A 5I1GL 4NZJA 2EYTB 4LLYB 4O5LH 5FF6B 5DRXB 4O2CB 4P5TC 3P0VH 4RISH 2AP2A 2JJSA 1YYMH 1NEZA 4D0CA 4P3DA 5I15L 1LO2L 1M4KA 3BZFB 1S7RA 4JFEA 2QHRH 3EJYD 2B2XL 5IG7B 5I9QC 1G9NL 4NNXA 1XGYL 1T22A 1DQQA 2ZUTA 4OM1L 5ADPL 5B38G 4FQCH 2CDEA 4ZUWA 3CVHB 5I2IA 3VXPA 4YX2H 1P84K 2F53E 1G7MA 3I2CL 2E5EA 2MMXA 5I1JH 1CT8A 1U42A 3CXHJ 3NCEB 2VL4A 4AIZA 5DJXA 3UTSD 1D9KA 2FBJH 4BH8B 2VLKA 5D1ZB 1MRDL 4Y4KA 2MFNA 4PJXB 4N0UA 3KLHD 3BP7B 2IBBA 2YC1B 4FN0A 2WK2A 4MA7H 5DMJB 4M7LH 4O9HH 4EBQH 3AY4A 2OMNA 4LSQL 2EYRB 4WFFD 4O4YH 3T2NH 1AXSA 1V7MH 4HKXA 4NWTH 5CEZE 3IXTB 3SDAA 1NCDL 5FA4A 3CXDL 3HNSL 1VGEL 2Y06H 1WFTA 2XT1B 2YD1A 4I3SL 2LABA 5D6CB 1K4CB 5C92A 5I1KH 5ID1A 4JM2D 1LO5B 5EOCH 1YY9D 1U8OA 4F8TA 1JGLL 1HHIB 2EE2A 1BFOB 4N1CA 4OGXH 3QRFM 2Y5EA 2J8UA 4L9LA 3BSZL 4CVXB 5B8CC 1WF5A 5E8EB 2R1XB 4PTTB 1XGUB 32C2B 4S10A 3HMXA 4XVSL 4KRNA 3GI8L 1UH3A 2A6IB 4DN3L 3EOBA 1S7QB 3MXWL 3MLYH 3EW3B 2W9DH 2WW8A 5F1SA 3QFDB 3DV6B 5E6ID 4X7TA 2J6EL 3FHQA 2PO6A 5EBMB 5HHXH 5JOPE 4LU5H 3OAYH 5BZWA 2R0KL 2NY2B 2UYLB 4Z76A 4XBGB 4HC1A 2C26A 4A2MA 2AI0L 4MXQD 5FYJU 3A67L 4MJ2A 5IESH 1KJMA 3CSPA 3RWHB 5DFVD 3IVKA 4ONFH 1INQA 2BNRE 3DYPA 5INDA 2G75A 1CGSH 4HFUH 3T04D 4B53A 1LE9A 5FECB 4JM2B 2EO9A 3MUJA 3SKMB 1UJ3C 1QRNE 3PWUB 3ULVD 4KDWA 3KPSA 1U6AH 1DDHA 12E8H 1DVFB 1G7HB 1YJDH 4TOYL 2NZIA 1VERA 2BY3A 3UP1A 5IJKA 1NFKA 5KG9B 1OTTD 2PW2A 4JZNA 1JPTH 4U7SA 3C5ZA 4XPFH 5F1IB 3QULB 3RHWK 1GPOL 2A9NH 1IBGL 2XOTA 3Q1SH 2PTUA 4NJAL 1MFCL 2JJWA 3BPNB 3QUZC 3A6BH 3Q6FA 3F5WA 4KY1H 5LGHH 4GAYB 4LLVA 3RUGE 5I6XB 1KTDB 3VWJB 2HVKB 1MCOH 3LN4B 5KN5A 2XNAA 5D7LD 3U0TA 2DQIL 1BVKA 3FFCE 3R1GL 1T89C 1ES0B 3SGKA 1QSFE 5E5MB 3QZWA 5DQJB 5BOZG 3KYKL 4KK8C 4DKDC 3NIFE 4QHUA 3V6BR 1HH9A 3C8HA 1AJ7H 5EA0H 4BFIA 3MLZH 4X6CA 4PJBA 4HIJA 4MNGA 3VFNB 1FZKA 1R5WA 4MQ7A 4D0DA 4ZFOB 2IQAB 3C2SA 4WW2C 4XP1L 2ERJC 3G08B 3RNQA 5IB2B 1VEOA 1PAMA 3KPNA 4JKLA 5D7IB 2RB8A 3SJVA 3TVMC 3TBYB 4GW4B 3OX8A 1EHNA 2NY3C 4MMZC 5IKCB 3R06A 1K4DA 2GJZB 5HHNA 3MRHB 3HE7D 4MSWB 2VLKD 4CU8A 5C2BH 5TPWH 5DUMH 3O6KL 1KN2L 4U1HB 4DQOL 2Q87A 4HGMA 3OKDB 3X3GH 1HKLH 2HTLD 3OKOA 1BMGA 4RRPG 1KT2B 4P2OD 1OGTA 4IMKA 4NO5A 4PRPE 4B7IA 5H37H 5FCUL 2DLFL 4DAGL 2F58H 3M1BA 4Y5YC 4MNQA 1J05B 4LCUB 3DARA 1F4WL 4PD4J 3LD8C 3TA3A 5GSVA 2W9EH 1KCLA 3P73A 4BSJA 5DQDL 2VZSA 1I4FA 1D5BA 1MI5A 1KIPA 4LKXB 4YEEA 4DTGH 4LSVH 1CIDA 3QDJD 4YWGH 3RZCA 4DOHB 3SGJC 1NEZB 2X4QA 2BNQA 5DJ8A 3RVTC 1F3DJ 3RWJA 4D0CB 4PYHA 4OD3L 4P3DB 3UAJC 3WLWD 1S7RB 4JFEB 1Q1JL 2XWTA 4NZRL 1NGZA 3O3AA 1CR9L 4NNXB 1T22B 1DQQB 2CUIA 4I3RH 1HHKB 5KVFH 2WZPD 1GIGH 3K81A 4ALAH 4Z7VE 2B4CL 1PKQA 4MAYC 4PY8J 2CDEB 4ZUWB 5I2IB 3VXPB 1BD2E 1IGYA 4G9FE 5GS0H 3U4AA 1G7MB 3U4BH 1CT8B 1KN4L 4LKCA 4X99B 4ESKA 3IT8D 4ODTL 4PY7A 3KLSA 4JQVA 3SDYL 1TTUA 4R4FL 1AIFA 4AIZB 3HMWL 1D9KB 1OTSD 2VLKB 2EDXA 1F42A 4Y4KB 1T1XA 3JVGC 4N0UB 5I19L 3BN3B 1INEL 2AJUL 1NMCC 4KI5D 2D7QA 5JA8B 3REVA 3CXHK 4JFXA 3QQNA 1C16A 1A7RH 1AXSB 5GS1C 4HKXB 3IAQA 3C5JA 3M45A 1MHEA 1EO8L 3SDAB 1I8KA 5FA4B 5HDLA 2I5YH 4DK3A 4PJ9D 5ID1B 3C8DA 1YEJL 5IHLB 2WUBL 3QDJB 4JANA 3V8OA 5JHLL 1A1NA 4HC1H 3ZKSD 2HMIC 2BVPA 4R2GB 4R7NB 2EE9A 3B5GA 1FBIL 3T0BA 3UZQA 1SEBA 2P7TA 5JQ6L 4JR9H 5KZCB 4XMPL 3SDXA 1WGOA 2J8UB 4L9LB 3TPUA 5C2UB 4LGRB 4P9HC 1IAIL 3SDDC 4LIQH 1UM6L 2BHYA 1QBML 3C5ZD 4IM8A 3WXWH 2X1OA 4YNYA 1T1ZA 1NMAH 1S78D 4WTZA 4ZUUA 3EOBB 5D7JA 5FKAA 2ZJSH 3WJLA 4OZHF 1G1CA 1HH6A 2PO6B 4OLZH 3FN0L 1LDPL 1XR9A 5BZWB 4I18A 5GZOD 2GAZB 3PWPD 1C5CH 4GUPB 5K59F 3VFPA 4Z76B 3UYRL 4AMKH 4OKVA 4HG4J 4D3CL 1S7SA 4M6MH 3RU8H 3ZE2E 1NC4A 3IJYA 1DBAL 5IT2L 1REIA 4X6EA 1AGEA 4U1GB 1OLLA 3IVKB 2V9RA 1P9MC 3K8KA 1INQB 2YKLH 5INDB 2G75B 2GEEA 1RK1B 5MHSD 3ARGA 3QQ9C 4N8CH 1LE9B 3TNNB 4DZ8A 1GGIL 2F19H 4X5XA 4QHMA 5AG8A 3NZ8A 5HYJA 3LEVH 1S9KC 1QACA 3KPSB 4TSAL 5EZOL 1DDHB 1Q72L 1I8LC 1CDYA 4RGNE 4Y16D 2XACC 3L1OH 4XB7A 4XCCH 5CJQH 1FDLL 1U8KA 2VZUA 3T0EC 3EHBD 4MX7A 4JZNB 5E08H 5GRZA 1RFDL 4OIAA 1BJ8A 5E6IC 3CSYA 3C5ZB 1HWHB 5FXCH 1J1PL 5EZLA 2QQLL 5FDYA 3GNMH 5F1NA 4WTXA 3F6LA 5E6YA 1BFVL 3Q6FB 3F5WB 2NY5C 4E0RA 2HH0H 4LLVB 2VLMD 4FQIH 5D2NA 9CGTA 2EH7L 2FX7L 4ZODA 1U8IA 1I9JH 5INCA 1IGFH 4KU1A 2R4SL 3PWPB 5IMMA 1XGTA 5DFVC 5KN5B 4Z7OE 2XNAB 3NCYS 1LE5A 3U0TB 3RVXD 1BVKB 1HIMH 4DWHA 1W72A 1TTFA 2VDQL 1G9ML 4JVPA 2C3VA 3RZCD 3QZWB 4P2QD 4QHUB 1HH9B 4BFIB 3UX9B 1DE4A 5ALBH 3LEYH 5JLZA 3ULVC 4X6CB 4PJBB 4PREA 4HIJB 4MNGB 1FZKB 3IU4H 1R5WB 3F7QA 2Z8VC 4MQ7B 4D0DB 1TMCB 2DM4A 2VXVH 3GB7A 2OYPA 1WEJL 2EXWC 1J88A 3G6DL 3AB0B 3RNQB 3EYUH 3KPNB 4XT1C 1OWRM 3ULSA 3U2SA 1F4YL 3EZ8A 3SJVB 2CRZA 1GZPA 1TPXB 1R6VA 3WYRA 4G80A 3OX8B 5C0EA 1JPFA 1MFDH 3R06B 1K4DB 4J6RL 3WFEL 1YN7A 1P7QA 3QYCA 3GMNB 5HHNB 4S0SD 4CUCA 4OLUH 4ONGL 1JPSL 5HHOE 4HUUA 1XZ0A 2MSPA 4EKXA 2HKHL 3OKOB 4NFDA 1K8IA 2NLJA 1X7QA 3IFLH 1OGTB 4NO5B 1KBGL 3DUSA 4IJ3C 5D1QA 2BFVL 3M1BB 3NAAL 4Y4HD 3AC0A 4MNQB 4PRBA 1T7YA 1T03H 3TA3B 5GSVB 1L6XA 3U9PL 1JMZA 3P73B 4OLYL 1EFXA 5AYUL 3SOBL 3WNNA 1CBVH 1I4FB 1MI5B 1IAII 3G5XA 3SE8L 3GBLA 4XPHH 1KIPB 1OARH 3PJSA 3GSOA 3RP1A 3RZCB 4FQQA 3WBDA 2X4QB 2BNQB 4JY5L 5DJ8B 4X8JA 3RWJB 4IOFC 5SX5H 1LP9F 3WSQH 1P53A 3U82B 5IHUL 2IG2H 4PD4K 1DANU 1F00I 1A1MA 2XWTB 1YYLH 1CLZH 1NGZB 4OF3A 3O3AB 2DRUA 4C4KT 3GGWA 4Q9RL 5HI3C 5L2JA 5DK2A 1TENA 1PKQB 2WM0A 3RQ3A 4U6VH 1IGYB 2Y1VA 5KW9H 3U0WH 2V5TA 1JTOA 2OTPA 1MAJA 4LKCB 3MZGB 4PY7B 3BP4A 2NY6C 3MQIA 4R97B 1N2RA 5EZJA 3QNXA 3ARTA 1AIFB 2EEBA 4NZUH 4NHCH 3NCMA 3MRBA 1UH2A 3T77A 1T1XB 3KWWA 5KSUA 5FYJE 3BKYL 3ZKMD 4IDJH 4U1IB 3S34H 4JHAL 4FTVD 2P47B 3IFNL 5DJAA 3REVB 3V6OA 3ISWA 3QQ4A 4JFXB 4M6NL 3BD5A 1C16B 4JM4H 5JIKA 3C5JB 3VG9B 3VRJA 1XIWA 4KVCL 1MHEB 2B20A 4CVWA 2NXZB 1I8KB 2O26U 1J86A 1AD9A 5EULV 1UACH 4QWWC 5DEFA 3QFJE 2ARJQ 2XXCB 4JANB 1A1NB 2F8VA 4LCCA 4RMWA 4RZCA 3TFKC 1XGRA 2BVPB 4YE4H 5CD3A 2LTQC 1SEBB 2P7TB 3FOLA 3CU7A 3SDXB 3ARSA 4FQPA 1K2DA 2LVCA 1L0YA 3TPUB 2VXUH 2BMKB 2XKNA 4H20H 3IYLW 4FFZL 4CN1A 3L3HB 5C0CD 4NQTA 1NEZG 1CXFA 3W5MA 3JWDH 1T1ZB 4ZUUB 3ZE0E 5D7JB 5FKAB 3WE6A 1FYTD 1G9NC 1UFUA 4GH7B 3PL6A 4TVPH 1HH6B 2CGRH 2UY6A 2H32A 1XR9B 5E9DD 3V4PH 1I7TA 4P23C 4NBZB 3I6KA 5BRZD 2A77H 5CD5C 4I18B 5C9KA 4JFHD 3VRLE 5AWNL 3VFPB 3KYAA 4XI5C 5C09E 5H37G 4JVUA 4OKVB 4ZD3L 1ZSDA 3MJ9L 3WIIH 1S7SB 3QUYA 1NC4B 4OBSA 2EXYD 3IJYB 4XBEL 5JHDD 3U9UA 3OF6A 4X6EB 5DMIH 4PJGF 1AGEB 3D0VA 1U58A 3O6LL 4JDTH 4N90E 1QD0A 3O6MH 4P4KD 4WGWB 1T6WA 4XAKE 1UADC 2R4RH 1KTLB 3H7LA 3NPSB 4RMVA 1FE8L 4DZ8B 3O9WD 4HG4K 4DGIL 5IR1A 4X5XB 4QHMB 5C0NC 3TH2T 1NAMB 1D5ZB 3NZ8B 2VXTL 3TNMA 5HYJB 3G9VA 2BRRH 1QLEH 1KJ2A 4S1RL 2ZNWA 4I13B 5L2KA 5IWLC 4QRUA 1A6VH 2XTJB 4KKBD 1KCRL 3OKYA 1U8KB 3J8F7 1S78C 5D93C 1P7QD 3CK0L 3C08H 4YFLF 4MX7B 1FG2A 2ZCLH 5T3XD 1WWAX 1N4XH 4OT1H 3LKQA 1RAMA 3CSYB 3DX9A 2OJZH 2VR9A 5EZLB 2EZ0C 4U0QB 2UV3A 4GRWE 5BV7B 4XTRD 5F1NB 5F7EH 3WNLA 3EYFA 2C1OA 4E0RB 5EFIA 1AO7E 5D2NB 3QEGL 3MCKA 1U8IB 5FUCC 1FCCA 5INCB 5DGRA 1JF5A 5JUEL 2AJZA 2M2DA 1QYGL 4OZHA 5IMMB 1XGTB 4GRLC 3MACH 4F9LA 1LE5B 1BQSA 2BDNH 5B39B 1A7QH 2D0FA 3T4YA 1LD9A 1W72B 2NZ9D 5E1HB 4NKMA 2C3VB 1MEXL 1TJGH 3QO0A 4KGJA 3S3JA 3LKPA 4QHLA 5L7XL 4D9RD 4Y5VC 5JLZB 1DE4B 1YN6A 1C5DA 1CZ8L 1D6VH 3FJTA 4PREB 3NABH 4OAWA 2A1WL 5K9OA 3DUUA 4NRYB 4I0PA 2FGWL 5BXFA 4LSRH 1VB9A 1NCAH 1URLA 2FATH 3NH7H 1IGJA 3ULSB 3U2SB 3WD5L 4EI5D 1JFQH 2OL3H 5HHVL 3U0PA 1GZPB 3GIZL 2IANE 1KNOA 4G80B 2FD6H 2DICA 1QR4A 5C0EB 1JPFB 1KXTB 3DI2B 4L3AA 5HHQA 1BAFL 1XGPA 1YN7B 1P7QB 3VXMA 4ZOBA 1WZ1H 4OI9A 4HUUB 1XZ0B 4GMTL 1ZK9A 1AR2A 3SCMA 1QQDA 2VERN 2LQRA 2EEDA 4K23H 1K8IB 5EU6E 4FZEL 5CP7A 2NLJB 1X7QB 2K7QA 4EIGB 4U6XA 4XPTL 1IFHL 3DUSB 4HZAA 5DVNA 5D1QB 1CLYH 3RVXC 4N0YL 2V5YA 35C8L 2P8LA 1G0XA 1YDPA 4PRBB 2CMRL 1A4KA 2PCPA 4JO1H 3JTSA 3MCLL 4DGYH 4N0CD 1EFXB 1YMMD 4FMKA 4PR5A 4B7LA 4JFOA 3G5XB 5I1HL 1RZKH 2VLRD 2DBLL 4MLSA 4UBDD 3PJSB 3GSOB 4TPRL 4FQQB 3GMRA 3PGCA 4X8JB 1RVFH 1WWCA 1KC5L 1R0AH 4GXVH 1FO0H 3QB7C 1A1MB 1A3LH 4PJFF 2VZOA 1IC7L 3EOAB 3VW3L 1AI1L 5L2JB 2Y36H 1TJHL 4K7PH 3KS0J 5J9PA 4F58L 3QZWG 4H8WC 4RBPK 1ITCA 4KPHH 1ODAA 4JZJA 2FO4A 4OIBA 4KHTH 2D03H 1MIML 3BP4B 5EZJB 1N2RB 3QNXB 4OTXL 4HWEL 2AQ2A 1MIEL 5KOVC 3IFPA 3MRBB 2VWEE 3T77B 3KWWB 5KSUB 1TQBB 1W2KT 4LGSB 3F62A 3VU2A 5IV2B 5DJAB 3OZ9L 3DRTA 3L3IA 3QQ4B 1N6QL 2IALA 2LV4A 1CLOL 3VRJB 1XIWB 3PGFL 4LCYA 4PLNC 3OV6A 1AD9B 1NCTA 3RTQC 2OQJB 2H32H 3F58L 5DMGC 3NA9L 4GG8A 5DEFB 5DZNA 3EUUA 2F8OA 2GHWB 4UQ3A 1JV5A 1ORSA 3O81A 3VXUA 4LCCB 4KAQL 3ARFD 1XGRB 3OJMB 2R29H 1HDMA 3GSXA 1EUTA 3LKRA 4ZFOL 4KC3B 5CD3B 4HMEA 4BZ1L 3FOLB 2XIDA 4P2RD 5EZIL 5FO9A 4ZOAA 1NDMA 1K2DB 3O0RH 3T09A 1LP9A 2I07A 1UWGL 4G8GE 3SKNA 3FO9A 2XKNB 4OF8A 3U36A 3ZLQC 4LVHB 4C57C 5MP6H 4Q6YA 3S5LA 2CJUH 3SE4A 1OGAD 1YQ2A 4M1GL 4PRNA 1CS6A 4Y19A 4L3EE 3WE6B 5JZ7D 3RGVA 3C2AH 3MLWH 2QBWA 2QSVA 2EC8A 3V95A 2IQ9L 3N1GC 1NAKL 2H32B 3KPQA 1I7TB 1T2XA 1GZQA 4MWFA 3I6KB 1A8JH 1A14H 2VXQL 5CWSA 5IROA 1NGPL 4ORZC 3TCLA 4GXUN 3HNTH 2B0SL 3QEUA 3QNYA 5BMFH 1H5BA 5IW1A 1ZSDB 2GCYB 4OM0L 3MV8D 4KKLD 3U9UB 3W81A 3QWRD 5ESAB 1WBYA 3D0VB 1U58B 2J3SA 1RHFA 3SDCA 5EBGA 4K9EL 1BBDL 4NQED 5KVMC 1IJ9A 1UQSA 2F9BT 1L9NA 4I0PD 5IR1B 5A2LH 1EERB 3ARXA 3EAKA 1IGIH 5KSVA 1TQCC 1U8LA 5DD6A 3TNMB 5F96H 5I1EL 3JZ7A 4X6DF 2FBOJ 3KPRD 1KJ2B 1JRHH 4MHHI 4FP8L 2C4FT 5L2KB 2XQYK 1BF2A 3B9KD 3SO3C 4QRUB 5HHMD 4YUEH 6FABH 3QUXD 5LKNA 3RFZC 5FM5M 3HRPA 5FGCE 1FG2B 4GKOA 3QR2A 2VDRH 1J0YA 3LKQB 2XPGA 3SCMD 3WXVH 3DX9B 2X89A 1GHFL 3IF1A 4ZXBA 1XGQA 2GQHA 4QHKJ 4MQSB 4GQ9H 5I1CH 1FGNL 4UAOB 5IF0A 1JNNH 1PYWA 4XC3H 3ZDYF 2AJVH 1KACB 2JK5B 3EYFB 3QIUC 2C1OB 2LAAA 5EFIB 1Z9LA 3S4SA 5BS0A 3MCKB 4ZO6A 2AJZB 3CGTA 4OZHB 4OGZA 3MLUH 3HB3D 2NY0B 3T1WA 1M7IA 4S1QL 4IOIA 1NFDE 3T4YB 5EBWA 1GC1H 1LD9B 3UDWA 4AL8H 4AG4H 4ZAKA 1N5YL 3PHSA 1I85A 4NKMB 3O9WC 4KZDH 2NX5D 1NUFA 4FQHA 3LKPB 3QUKA 4QHLB 1YN6B 1C5DB 2PYEE 4HAFA 1CQKA 4PJGA 4YHZL 4OAWB 1UWEL 1ZT1B 5C0BE 2GITA 3B6SB 5K9OB 3DUUB 3HZYA 4I0PB 5BXFB 2VYRE 2HYMA 4DKEH 1RHHA 2CSPA 5JXEA 5DLML 1GYAA 3BP6B 1OQOA 3BGFC 1AXTL 1IGJB 2QADD 5F7KC 4QOKD 1DBJH 3WEXA 4NWUL 3U0PB 2F53A 2AW2A 1KNOB 3E8UH 5I0ZA 3AREA 3ZL4H 5HHQB 1XGPB 1YEEH 3MYZA 2P46B 3HMXL 3VXMB 3CLFH 5A3IC 3SCMB 1QQDB 5CJ5A 1E4WL 4B0MM 3O4LD 5CP7B 1ORQA 4LGPB 1C12A 4U6XB 4ZPTA 2BVQA 3K4DA 2P8PA 4J3XA 4P46A 4YK4B 4OZIF 2VN7A 1KCKA 3OPZH 4K7PX 2FL5A 1YDPB 4MVBC 3RKDC 1A4KB 2PCPB 2VB5A 2KDGA 4PR5B 3LQMA 4JFOB 2XN9E 4MNHA 5EWIL 3UC0H 1T7VA 2DBJA 1MJ7L 3TO4D 3KLDA 4M1DH 3VXUD 5E7FA 1YEKL 4EUPA 3GMRB 1YEIL 4XGZA 1FFRA 3PGCB 5ADOH 1XF5A 1UYWL 2J5LB 2FH8A 4EI5C 3QUMA 2P44B 5C0GA 2EDTA 1R3HA 4LEXH 2VAJA 4XH2A 2UZIH 4EIZC 4XNYL 1NANH 5J9PB 4OCXH 5DYOA 3D39D 2QADB 4DGVL 3WS6C 4JZJB 5EN2A 1NFIA 2FO4B 5SWSE 4GRMA 2AEWA 5I30L 4JFQA 1A64A 4K71B 3CFEA 3BKJL 3IFPB 4Z7OF 1KELH 1UC6A 5HYFA 1S5HA 4BSWA 4JQXC 3RDTD 3TZVD 3GI9L 1N6VA 2OI9B 3U7AA 1DL7L 1OD7A 3DRTB 4HKJA 4GSDH 4N0CC 3L3IB 2IALB 3L3GA 5HDQH 1P5UA 4O2EA 4LCYB 3PP4L 3OKNA 3HG1E 5D2LF 4AH2A 1H9VA 4PV9A 1HN1A 4Y2DA 4V1DE 3JUYA 4GG8B 1LVEA 1J1OH 5E2VH 4HJGB 1CICD 4UQ3B 4EEEA 4F57H 1JV5B 1ORSB 3LHPH 1J9CT 3VXUB 1S5IL 2P43B 4FQ1H 4TQEH 3HC4L 3KPLA 3MUGA 1HDMB 3GSXB 4F33A 4U31A 3LKRB 5T1MA 4XP9L 4WV1A 1RZ7H 5MENE 3AM8C 1JHKL 2AABL 5FO9B 1TFHA 5BVJA 1NDMB 4JJHA 1UZ6F 1LP9B 2WBWB 2WMPA 2I07B 2B1HL 5AZ2L 2IMNA 4MAUH 3SKNB 3FO9B 2UWEF 5TQ2L 2OCFD 3ZTNL 1JWUA 4PJFA 3S5LB 1U41A 3ZHLA 4Z0BH 3GBML 3NN8A 4PRNB 3QIBC 1WV7T 4Y19B 4UB0H 1CI5A 1FVCA 3RGVB 5CSZA 3E6HB 2YPLE 3V8CA 4LAQL 3RUGA 3KPQB 5BS0D 4MD4A 4MWFB 5CWSB 4TSBH 4X9GA 2Y7QA 5HPOA 3S37H 3O4OC 3TCLB 3QNYB 5DRZA 1H5BB 1EUUA 1K8DA 5IW1B 4D2NA 3VGAB 3FFCA 4ZAKD 5FYKD 1MQKL 1QSFA 2VXSL 2EDWA 1WBYB 4H5SB 5IB3A 4LRNL 1I7UA 3SDCB 4QLRA 1I9EA 3WFBH 3ARFC 4OSUL 4J23A 4YXHH 1KYOJ 1UQSB 2QQKL 3NZHL 5JW3L 3N1MC 3TIDA 1M7XA 3B5HA 4DUVA 5L0QB 2WBKA 1MHHA 5ALCL 3TT1L 5KVDH 5KSVB 2MKLC 3OB8A 2A6DA 5DD6B 1U8LB 4XNZB 1CK0H 4Z8FH 2A0LC 5BVPL 4LPUA 5TJWK 5GGSA 3LCYA 3LRHA 1E4XL 4V2BA 3GRWA 1FSKB 3BMVA 5HPMA 1UKSA 3JV6A 2VQUA 4X9HA 3AS0A 5C6TL 3ULUF 3ARED 1NGQL 5I73C 2BJML 3H9SD 4JFYA 2R8SH 2X7LA 1JE6A 1OAXL 5KVEL 3B3IA 1D5IH 4WY7L 5JZ7C 3FO0H 2R0ZL 3V6FB 1CXEA 5I17A 2XPGB 5FHBL 1JZ7A 3KXFD 4ZXBB 3IF1B 1XF3A 1XGQB 4K8RD 2OS7A 4OB5L 1JNLH 3K4AA 5CINH 5IF0B 4EN3C 1PYWB 1RZFH 3FAWA 5FHAH 3KYOA 5DUPL 5BS0B 3S4SB 3X3FH 4POYA 2NTFA 5K9KA 2Z91A 4KKLC 2OZ4L 4NT6A 3ES6A 3P9MA 4UOJA 6CGTA 2DQHL 1B6DA 2ICWJ 1M7IB 3NGBC 4U33A 4ZO9A 3BDYH 4IOIB 3ZKXB 1OCWL 4D9LH 5EBWB 3UEZA 2HJLA 4YQXH 4ZAKB 4OZFA 4FQHB 3QUKB 3LPWA 1MRCL 4ZTOH 1A6WH 3SQOH 4PJGB 5CEZH 2FZ3A 1CCZA 5DD3H 2FEDC 2GTWA 2GITB 3L5IA 3U1SH 3HZYB 1OSZA 3QUXC 4Z7VA 1RUAH 3BP5A 2VC2H 1NUDA 5ILTH 1BD2A 4M7LT 3WEXB 3EDDA 2F53B 2E7MA 5EU3A 5T1LA 4OGAD 3GMLA 3AREB 4X6DA 2CKBA 3TJEL 4J3VA 5JW4R 1SVCP 1EEZA 2F5BH 3K0WA 3QUMH 1UGNA 4BQ6A 4C56E 4NC1C 3G6JE 4APQA 1ACZA 5D1XA 1DFBL 1ORQB 1MWAA 1C12B 4JN1H 4ZPTB 1FNHA 3IU3A 3VXOB 2P8PB 4HH9A 3KPPB 4P46B 4CMMA 4FABL 3W0WD 4PJIE 5J11B 1A7NH 2DWEA 4OF5A 1SEQH 4M00A 4AK1A 5L8JB 3OB0K 1HKFA 1FG9C 5A1AA 5CGTA 1WT5C 4MNHB 1FVEB 3ARWA 3SGEH 2VZ3A 2PR4H 5DJZA 4EUPB