5DHVB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 25
structure length 110
sequence length 110
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvB00
2PNDA 3QCVL 1P7QD 3EW3B 4XX1G 3O3DB 5IESH 1F5WA 1A7RL 4RZCB 4XWGL 5F1IA 3BZ4B 3CC5A 4ONGH 1CK0H 5EBWA 3FQXA 1IC7L 1B88A 5AAMA 2AABH 1AR2A 3RL1A 2YK1L 1I9JH 5I66A 4QYOB 1GOFA 4YHYB 3VW3L 1H8OA 3B8YA 4PRAB 3FFCB 4G7YL 2W0FB 3FRUB 3QUYA 4JM4H 3VXRD 1IGTB 5H2BA 1XGPB 3MOBH 3FHAA 3BESR 2C4FT 1VFOA 2DICA 5DQJA 1AHWC 1S7XA 3VWJD 4V1DB 4YHKL 4NP4L 1RZKC 2P8PA 2F53E 4MD4B 4CKVX 5D6DA 2EKJA 1ZTXH 4X6CE 1AC6A 3PL6B 4HH8A 4KMQA 4UOW0 1C16A 1GGBH 2J8HA 1ZKAA 3BP6B 3BPLC 3DVGB 5FYKL 4AEHH 1OGAD 3PWUA 4PJ8B 3RVVC 4Z18A 1SEBB 4OFDA 5C0NC 4X4XB 5E2TL 1PKQB 4H88H 5JOPD 1ACYL 2E8ZA 4OZGF 4ELMB 3QFDA 4PUBH 4Y16A 1CU4L 1H8NA 5T3XH 2VZSA 5I17B 4HIXH 5IB2A 1KEGL 5KN5A 1N3NB 2APFA 5BO1L 3CFBB 3GHBH 3KXFD 4PB9H 3FT3A 3BP5B 3BEVA 5HHPB 5EBMA 4GRMA 3TO2B 3PP4L 4QNPF 4R2GD 5C0CE 5D72H 5DZLA 1FE8L 4U1IA 3RVUD 4W6YB 2NY6D 4U1MB 5I8EA 2CIKB 4XVJL 5C0BA 3RUGA 3C5ZD 3AVEA 4YDVA 1CLOH 4BSJA 3VXTA 3P4OB 2FBOJ 3C60B 5KW9H 4LL9A 2XWBA 9CGTA 4PGCB 2BCKA 3KAAA 4XZUB 1KACB 3QCVH 4WRLA 4IIQB 3TT1H 1K9TA 3SDDD 5GGSB 4P5TB 1A7RH 5HHOE 2JB6A 1F6LL 2C1PA 5F8RC 2DWDA 4UNVA 3PWVB 3O2DA 1NGYA 4OZFA 3H8NA 1IC7H 3DJ9A 5F6IB 3LQAC 4ZAKD 3PUCA 1MF2L 4IRSC 2GITB 5C0FA 1JWSA 4PJEE 3RJQB 4PGEB 3SGDI 1RFDL 3L9RA 3QNYA 4GMSL 3MLPA 4D94A 4YEEA 2HAZA 3OKNB 4ZYKB 3S5LG 3U79A 4UDUB 1FNEA 4XXCA 3BMWA 4L5FL 2OMNA 3SJVE 3STBA 5I16B 1BQSA 1QBLH 4PJHB 1YUHA 4Z7NF 1B90A 2NXYB 1WUNT 1VESA 4KUCF 3JWOL 1BZ7B 2XQYK 5FYKH 5CP7A 5INCB 4XVTL 1OQXA 3MBXL 5BRZD 2EICA 5E2TH 3I6KA 1LO5B 1G9NC 3PP3K 4NO0B 1NFDA 3HR5B 2HT3C 2DQUH 1U3HA 1R3LB 4XAWL 5J9PA 4M00A 5HHME 1QO3A 3DYMA 4WO4C 43CAB 3TO4B 5GRJL 3QA3A 4QHMB 2B0SL 4QRTB 2YUXA 1QFOA 4NFCA 5KZCB 4GKZA 3PXHA 4XBEH 5TGBA 4X7EC 4NNYA 2EZ0D 3PHSA 4Q7DA 4P3CH 3KJ6L 4YO0B 4M8VA 2R4RH 3SDAD 3MYZA 4JKKA 1WCBA 3O6FD 1ZHLA 3VFTB 1OOAA 1Z2KA 5B21A 4NKIL 1L4IA 2EIDA 1PYWB 4KY1L 4TVPE 5C09D 2EYTB 3QEUA 1KCSL 1W2KT 5DS8A 3WKNA 3MZTA 4OFYA 2DBLH 5DQDL 1DLHB 5GS0D 1B9ZA 5B39G 5DZNA 4N8VA 4NRYB 4MXVE 4F33B 3ULUL 3CDYA 1P84J 3IRZA 4NPYA 1MF2H 1YEGL 3RZCC 3HR6A 3UO1H 3MCLL 5J1TC 1BD2E 1JZ2A 4U6VL 5IVXB 4XNZB 5GGVY 3K8KA 1RFDH 3U0WL 1ZGLP 4GMSH 5IGXL 4Z95L 2ITDA 4PJ9A 2AXFA 3I75A 3FAXA 1PKOA 2PO6C 4YXHL 4DVBA 5EB9A 2P7TB 3IKCA 4L5FH 4HUVB 4ZPTB 2FO4B 4LF3B 4URTB 3VG9B 2QQNH 1QQDB 1LDPL 3VXUB 1OAKH 1BM3L 5KVDL 3RTQA 4JRXE 1DUZA 2A83A 2XZQL 4EVNA 4M4PA 1UWEL 3AU1A 3MRCA 3WL9B 4WHTB 1S7SA 3CNKA 1NUDA 2QQKL 1A2YB 1PY9A 4RFNC 1A3QA 1D7FA 5D7SL 3MJ8B 4D9RD 3D3VE 1RZ8A 1CD1A 4NC1C 1R0AL 4LARL 2NY1B 4XAWH 1AY1L 3D87B 3SQOL 5IR1B 4QOKE 3RVVD 5C0RL 1K8IB 1GJIA 1JNLL 5C0ND 1I8KA 5GRJH 2EEAA 3FN0H 3SDXE 2EH7L 2EDDA 4IOIB 3SBWC 2GAZB 1OL0A 3VU2A 5HVWA 5FOJA 2VKXA 3KJ6H 4JZOA 3UTPE 4OZGA 4Z7WF 2CUHA 3SPVB 3UTTD 3GI9L 1A6TB 1VPOL 1SVCP 4EN3B 1VACB 1NCBL 1Q9KA 5I1IL 4NKIH 3K2MC 4OQ1A 4BFGA 1QFUH 1CVSC 2NR6C 4YC2B 1FNLA 3ZYJA 2P47B 1YNTB 4LEOA 1UCBL 1YYMH 3U7WH 4OCXH 4Y1AA 2WINB 5DQDH 2G60L 4GO6B 4RWHA 5F96L 5FUOH 4OQTA 2NX5A 3E3QC 3RGVB 3ULUH 4L8DB 3HNVL 3LEVL 1YEGH 3FB8A 1T21A 3MCLH 3LN4A 4U6VH 1NC4A 3QDJA 3HC4H 3VFOA 4M9PA 1IEHA 3U0WH 4YXKL 3NOIA 4Z95H 3BDXA 3WFHA 4WDIB 1UG9A 3PDGA 3EO9H 4MAYB 2BMKA 4YXHH 1CLZH 3ARGA 4X6FA 4IRSD 2J5LC 4TNWK 3HZYB 1CLCA 2OXHA 5I74B 1F4WL 3IDJB 1TTGA 4AENB 4HUKB 4CDGC 2VOTA 1T7XA 1P7QA 2BFVH 2BVYA 1NCNA 3MJ7B 1R3KA 2NXZC 1BM3H 5E9DE 1V05A 1J05A 2XZQH 3G6AB 5F7UA 2EIZB 1UWEH 4PP2A 3GKZA 3OX8A 1FP5A 4HIEB 4E41D 1FHGA 5HPOA 4P3DA 5ANME 4XP5L 1LEIA 2GSIA 5D7SH 1UEMA 1T04B 4UNTA 3QFJD 1R0AH 2GHWB 4LARH 1AY1H 3PXJA 2X4PA 4RMVA 4X5XB 2C3VB 2V17H 3RJDA 1JNLH 4ETQB 1A6PA 4XBGA 3MV7B 3SKOB 3VWJA 1UZ6E 4JFDD 4KZDH 4S1SL 3SO3C 2HT3D 4ZUWB 4G9FA 3WNMA 2CK0L 3GI9H 1D6VL 1VPOH 5IVZB 3H9HA 4YDJB 4WO4D 5DJ6A 1OGAA 3P73A 4YFEA 1NCBH 1VADA 3WXWL 1XGQA 4U7MA 3KYOA 5D9SB 3SEPA 4CVXA 4PJIB 3VI3E 2IQAB 3L5HA 4MX7A 1YMHB 2XWTB 4GBXC 4OB5L 1N2RA 4R4FL 4DFHA 1UCBH 3VFRB 2VDPL 1JI2A 4GW5A 2J6EL 2G60H 3HPLA 4XPFH 4YAQA 1H5BB 5DJ2A 4MJIA 3BHBB 3NCJL 3C09B 1REIA 4XMPH 3LEVH 4NQVB 4MQXC 1F00I 3MUGA 2JF1A 1F58L 4NNXA 1GZPB 5A2KH 5IEHB 1I1AB 3RVTC 1NC2B 1IGCL 5HYSB 5GRUL 4K7FA 4ZSOE 2Q3ZA 35C8L 1XR8A 2OTWB 3AMLA 4P5MA 3G5XA 3RZCD 1S9XB 4L8CA 1F4WH 1TMCB 3IU3A 5DRNB 2FHCA 4I4WB 3MRKB 3T2NH 1ZHNB 3BPOB 1HINL 3WN5C 2ICES 3KPRD 2PO6D 3GMRB 2FIRT 1A7NL 5MEPA 4Y5YC 3AAZA 3GB7B 3LY6A 5J13C 3CGTA 5EPMB 1FPTH 3DARA 4WWKD 5I18L 2P1YA 4XP5H 3MLXL 3NIFE 2IMMA 4UOW1 2CDFA 4PJ5B 1JF6A 1YY8B 1T4KB 3U9UA 3GIVB 1MCRA 4OZFG 3HAEA 5GGVH 2VH5L 3EDEA 4BK5A 4ZTPL 1WWBX 1ZANL 2V6HA 4E42B 4S1SH 2YPLA 4YHNA 1J88A 3VDBA 2CK0H 1KLFA 2W9DH 1D6VH 1RUML 3DVNA 5JOFB 1QR1A 1ETZA 1QRND 3WXWH 2DLFL 1U95A 3GMPA 3F65A 5BRZA 1P7KA 1Q72L 1T1ZA 2PTUA 1NBQA 3MRBA 5GRVL 3PQYD 1B0GA 4J23A 4R4FH 1LHZA 3VFUA 1U8KB 1DQLL 2VDPH 2JLLA 3VXOB 2C26A 2J6EH 1T83A 4G42A 4G6JL 2NY3B 3QNZB 2XWJB 1DR9A 4W68A 4QHUB 3MRMA 2LVEA 3NCJH 3KPSD 3ARBB 1MSPA 4MAUH 2NR6D 3BIKA 4FMFA 3P0VL 4HUXA 3GBLA 3C5JA 3P77A 3W9DB 5A2FA 4XBPA 2ZP0T 3WIHL 3MRQA 3V4PH 1FYTD 3SDAA 3SDCC 1RZGB 4WU7A 1IGCH 2V2WA 3VFGL 1F90H 5GRUH 1T1XB 35C8H 5TE6H 2OI9B 4HUUB 4LSPL 5C09A 3V6OA 3ZKSD 5IKCB 4XH2B 3IFOA 4OZHF 4GT7A 5DSCB 3TYFB 3CZFA 1MFBL 3SOBH 1H0DB 2D31B 5IB1B 2UWEF 4LOUC 1I9RL 2Z93B 4M3KB 1HINH 4MB5A 4MYWB 5CJOL 4M8QB 4TNWF 1HN1A 2QR0B 3HC0A 4L3CA 2F8XC 5BVJA 3OJDB 4MA3A 3WSQH 2ICWJ 5IHZB 5I18H 3MLXH 4PJBB 1T89C 2Y25A 1R5WA 2NXZD 2BNUB 1E4JA 3IAGC 1X5JA 1OAUL 5CGTA 5GSRA 4N8VG 2R1YB 3VI4E 1OQOA 3FB6B 3QHFH 4OLZL 4P4KA 2YUZA 4ZTPH 1S7VA 4JGMA 3VXNB 5FOBB 3W82A 3T0EC 5ITFB 2X70B 2C5DC 2RJMA 4U05A 1ES0B 3C6LB 3CIQA 1C1EH 3B2UC 3JWNC 5EU4B 1DBAH 4PPTA 4FRWA 4N1HB 3EYQC 1RUMH 5DJXB 3NCYP 4ZXBB 1EDQA 1XF4A 2DLFH 1WBXA 2VZTA 1Q72H 3DX7A 4FQHA 3W0WD 2DI7A 3S88L 4PRPE 2V2TB 2Y6SC 3WE6B 1T6VN 1MHEB 4JKPL 4EZMA 4O58L 1DQLH 3HZKA 1GGCL 4NKOA 1B0RA 3IFNL 4G6JH 2IFFL 3CXHK 2GJ6B 5IBLC 1IGML 2Y4SA 4KRPC 2CKBA 1G7JA 2V2XB 1EFXA 4RWYL 4I9WD 3P0VH 5HHNB 4GBXD 2VITA 1NUNB 1HOCA 1P4BL 3K2UH 5L8KB 3KHOA 4PRDB 5LKNA 5F9WC 4NWUL 1DUYA 4Z7QF 1SJVA 2V5YA 2NXYC 4GRWE 3VFGH 1T5WB 4NJ9L 1DDHA 4KJWD 4Y4HB 4G8IB 5EO0B 1AGBB 1QSZA 1V8HA 1RK1A 4F7MB 4LSPH 4DZ8A 4MQXD 1G7LA 1M05A 3S36L 2AKRB 2B2XL 5HVFB 3RVTD 4W81A 3MLZL 2FWOA 1D5MA 3BPCA 3QIBC 2YEZB 4WI5A 1XF2A 3FT4A 4HUNB 2B4CL 4LCUA 3OR6A 3CX2A 4MD5B 2K7QA 4Y19B 4M7LT 1A1NB 1A6ZB 1U8QB 2QSQA 4GKSA 1XAUA 1U8MA 2VLKB 4FHBD 3V7AG 4JO4L 4DEPC 5EUKA 4MWFB 4R96B 2YBRB 2DWEA 1KGCE 2W91A 3SKNB 3BDYH 2ZSWB 3S96A 3JWDL 4YDLC 1OAUH 1Q9LB 4GRLB 3R4DA 1G7IB 3S3JA 2ATPA 3O41B 3RWHB 1MHPL 3U83A 4JKWA 5E8PB 2Z31C 4UB0L 1UXSA 5E8DL 5HGHB 3P9MB 1XGUB 4L9LC 3RWCB 1KELL 1WBYA 2R23B 3G6JB 4I0PB 3F58H 4EQ3A 2VDLL 3O4LD 1FFPB 2BRRL 3FN3A 3BW9B 4IBLT 1CGUA 1NAMA 1VDGA 3DVFA 5K9QI 4KC3B 4RAVA 5LGJB 5FIEA 4D3CL 4JKPH 3VDAA 4QHNA 5CINL 4WW2B 5GSVA 4O58H 3S37X 2UZXB 1TPXC 1GGCH 1V3KA 4PRHA 1EAPA 2IFFH 2IGFH 1IGMH 1MI5A 5M94B 3QQ3A 2NNAB 2PCPB 3MA7B 4BJLA 4HULB 4L8SC 2R56H 4MNHA 5F1OB 2IJ0C 3CCHA 4X6EB 3NZHL 3OBAA 1P4BH 5ICXB 2VDML 4Q0XL 5MI0B 1T20A 5SWSB 1SYSB 5MEOA 4KPHH 2ITCB 4IDJL 3V5KB 4NJ9H 1IM3B 3HPJB 2OL3A 3S34H 15C8L 2OSLB 4G8GA 5DJ8B 3V6ZB 3ZDZF 5EBGA 1J87A 4PLKC 2VWEC 1I3GH 4G80B 4V1DD 4AL8L 4H20L 4L4VD 3MLZH 3SDCD 1QVOB 2P8MB 1KTLA 4XPGL 5DHYB 4ZDHB 2B4CH 4B50A 4JFFD 2L0DA 5D5MB 1U8NB 5JIPA 4RAUB 4TNVK 4ZODA 1FSKB 1IBGL 4NCC2 4WFGD 4LOUD 5GJTL 4ORGA 4OZHA 1Q8MA 5DMIH 2GK0B 2Q87A 2X4QA 4W4OC 2W38A 1YC8A 1X44A 1JI1A 3CVHL 4EN3C 4JCLA 2Y7QB 1MH5A 4R26H 1MEXH 5D2LE 2X42A 4M3JA 4TQEL 1MHPH 4ZPVB 2CSPA 5C3LD 1W0VA 2VYRE 1JPFB 4UB0H 3NCYS 1FDLL 1HK6A 5D1XB 2YPKB 1KELH 2EKSB 3BH9A 2LVCA 4Q9RL 3S35X 4QRSA 2BRRH 4DCQA 2C3HA 4M5YH 4HMCA 1KPUA 4ZOCA 2NW3A 5ISZD 5EZJA 4ZUSA 3DRTB 4WWKA 3D85A 3T0ED 4KXZI 4D3CH 2JE8A 3B2UD 5CINH 5I1DB 2AK4E 1N0XL 3EYQD 3V5HA 3D39B 4LU5L 3F7YA 4YPGA 1AGDA 1JBJA 1I9IL 3V7AE 1MREL 5DMYA 3MV9B 1UYWL 4MAYC 5C70A 3ARFA 1P7HL 1BMGA 4Y1AE 5FB8A 2Y6SD 1WICA 2CO7B 3WMSA 3QULA 1YQVH 4Q0XH 1NEZA 5ABDE 5IBLD 4KAQL 4HSQA 2ED9A 3HAEG 4MDJA 4KRPD 2AJVL 4OLVH 4IDJH 4N1EA 3ELAT 3RWGA 1QRNA 1F6AB 3HUJA 4E0RA 3EO0B 5IJVA 4FFZL 1TVBA 5T1KB 1JNJA 1RZIB 3SBWA 4EI5A 5HYIA 4AL8H 3PQYA 4B41A 4L8BA 4BUHA 5T3XD 4MZ2A 2NXYD 3E6HB 1E28B 1ZLUK 5DMKA 3Q0HA 4O5LH 4HBCL 2EE3A 5CJBA 1U8PA 2MOVA 1UKQA 3HG1D 1IBGH 4XXDA 4AEIL 4A2MA 2R1WB 3PABB 3QIBD 1LWRA 5GJTH 5TF0A 2X4RA 1FYTA 5JW4Q 1Y0LB 2NTFB 3ARQA 4IRJC 1LE9A 2A6JB 3SE9H 1T3FB 5IHUL 2KZWA 3L7FB 1CXKA 3H9SB 4BH8B 5CEXA 4TQEH 3VXRE 3O6ML 3WNKA 4R3SA 1JTPA 1FDLH 1I85A 5B4MC 1FVDA 3UZQA 4XCNB 4R0LC 3QDHA 5DTFA 3OAYK 1MRDL 3GGWB 3D9AL 3BWAA 2Z8WC 2Z31D 3MYJB 3ULVL 1OGAE 1OAXH 3BXNA 1CE1L 2VLLB 5L2JB 4ZNEE 5C0AD 5EIQA 3OKEB 1FFRA 3HRZA 1NBYB 3KG5A 4LU5H 5JOPE 3U4EB 1MREH 4XMLH 3HN3A 3PGFL 4PRNA 4PJAA 1E27B 1EXUB 3T65A 4KWUA 1QSED 2ARWA 1PBYA 4AYFA 4MJIE 2PYED 1Q1JL 3KXFE 4N8CL 5GGTA 1Q9WA 1HWHB 4KAQH 5FYKD 1HHIB 1XF5B 1OPGL 3LOWA 4FFZH 2YS4A 2L7UA 4JJ5B 5E2JA 1U93B 5DRZB 2RAMA 3WFEH 3FQWA 5E5UB 3QG6A 3VXUD 2I24N 5INDB 5HYJA 4NUJA 2ADGA 3DHJA 1YN6B 1SY6L 2XQYG 5J11B 1OLZA 3CVHB 5GHWL 4E5XA 5E2WL 5CEZH 3GSVB 1FO0A 1W0WB 4PJHF 3QG7L 1NJ9A 4PD4J 4BQBA 4PLKD 1H8SA 3DROB 4G8FA 4HBCH 4GBXA 4J12A 4QHLB 3MOAL 4AEIH 4UTBH 5DJCB 3RY6C 1KNOA 1NGWB 5KSUB 5EU3B 3T8XA 1YECL 3UAJC 5D7LB 3MRRA 4HKZB 5ITBL 5FGBA 1CFNA 1RIUL 2C3XA 5IB3A 5IHUH 3NCCB 5M7QA 2ZUXA 3EFFA 3KPTA 3H7BA 2Q6WB 2ZUYA 4NQXA 3NZ8A 2YA2A 3CFDB 4RX4A 1DL7H 2WZPD 3GRWA 4U1NA 2BVEA 4PV8A 5DJYA 3TBSA 4OGAC 1JF1A 4EN3D 5I75C 1J0JA 1FG9C 1BHGA 4WW1A 4IHOB 1BVKA 2KH2B 4RQQA 1MRDH 2FEEL 2X4NB 3QEQB 4OZIE 3IJYA 4ETYA 3EBAA 3O2WH 1FZJA 1RJCA 3LV3A 3WUWA 3V9FA 4K9EC 1FGNL 1KCKA 2ATKA 2GUOA 4HUWB 4H26A 1S7QB 4NQCB 1D5ZA 5BRZE 4B0MM 2VL4A 4YHLL 3FB7B 4FQ2H 1JPSL 5IW1B 3JV6A 1EEYB 4W6WB 1QBAA 4YBQC 1OP3K 2OI9C 4R4NC 4EUPA 3C08L 3IJSB 3VRLE 5TE7L 1RJZB 2WW8A 5GXBB 1KPRB 4GAGH 3RNQA 1Q1JH 1K8DB 2PW1A 4N8CH 2JIXB 4LKCA 4KI5F 4H1LH 3D2UA 4LVOB 3HI5L 4MAYD 5EUOE 4ZO6A 2P24A 5MEND 2VAAA 5E7BA 4JREB 3X12B 4LRIA 3E2HB 5CAYB 3O3DA 2D4DA 3B5HA 4JY6B 1Q94B 5C09E 4JZJC 3V6OE 4ONFH 4RZCA 2VZOA 2DS4A 4LIQE 3BAEL 4FTVB 3JUYA 1AD0B 2QL1A 3QG7H 4X5WB 4LCWD 2RFXB 4F7EB 4QYOA 4P3WA 3MOAH 4D0BB 4PRAA 3NPSB 2W0FA 4JANB 2XN9B 4U6YB 3FRUA 1A7OL 3WNLA 2XA8L 1C12B 1IGTA 1OAZL 3ARRA 1XGPA 4X4MA 5EU6B 3OKKB 1MCQA 2WUBL 3CH1B 2CRMA 5IQ9B 4OF6A 1KTDA 3DUUA 3ISWA 4V1DA 5DJAB 3MACL 1PSKH 4LK4A 4NO3B 3TESA 2OMBA 1CE6B 2LU4A 4MD4A 4Q9CA 2X05A 4KQ3H 3PL6A 4IRJD 3O45A 2GY7B 3BP6A 3DVGA 4PJ8A 3ZDYF 3ULUD 4DUXA 4K71C 2R1XB 5I1KL 1SEBA 5E1AB 4F15B 4X4XA 1PKQA 1UH2A 3BKYL 4MDIB 3LSOA 3B3IB 4ELMA 5B4MD 1YEDB 4OTXH 5I17A 2J8UB 3TBYB 1P53A 4H1LB 3EHBC 1N3NA 4YHLH 4I3GA 2PW2B 3CFBA 1T03L 4D9RE 4IS6B 5EZOL 6FABL 3BP5A 5J12B 5HHPA 2DQGL 3CUPA 4G5ZH 3C08H 3HI6L 3TO2A 5KBNC 5TE7H 5E6IC 4OBRA 5D1QC 5IFHL 1AXSB 4U1MA 2B20A 2CIKA 3C87A 1JWUB 5EULV 3HI5H 5B3JF 3F6LA 2NY5H 4F57L 5EA0H 3VRIA 1C5DB 3T2QA 3ZTNH 3UTTE 4GXVL 1V5JA 4PGCA 4CDHA 2QJDA 4MNGE 2ZOKA 4XZUA 1OP9A 2FL5B 2VQUA 5GGRA 5C92A 1WIPA 4IIQA 2ZKHH 3HHRB 4XP9L 4Y5VC 3BIBX 3T1WA 4P5TA 4UUJB 1FLTX 3PWVA 4WI4A 4HGMA 2AGJH 4LGRB 1QHPA 3ARUA 3BAEH 5LVEA 2PXYC 1JGUL 1YY9C 3DECA 5DVOA 1E6OL 2GITA 4MMZC 1N5AA 1UEYA 3BDBA 1FBIL 4PGEA 1KXVC 4P23B 2QTEA 2DYPD 3B9KC 4PJ5D 5FM5M 1A7OH 3DSFH 2XA8H 3UJTL 3ILQC 3S3SA 3OKNA 2HLAB 2K9UA 1G7PB 1E4XH 1F4XL 4HCRH 1N4XL 3U9PH 1NCDH 5I16A 1F2QA 2VMFA 4PJHA 1KT2B 2O5XL 1NEZG 5C0CB 3UAJD 5I9QB 5EC2B 2ZPKH 4ISVB 5AG8A 2EDOA 1BZ7A 4I5BB 5INCA 3HCVB 3QPXH 4M1GL 5LBSL 4CU8A 5JPMB 2W60B 1BIIB 3U0PB 2GTZB 1A7QL 3TGXA 1EPFA 1LO5A 4OGAD 3HR5A 1DQML 4E41E 1R3LA 3V0VB 4PIRF 4PJIF 43CAA 5C71A 1T03H 3TO4A 5EZOH 1J18A 4L3ED 4QHMA 3TNNA 3L3JB 2FECL 1BJ8A 3QFJE 2DQGH 1N59B 3CMGA 3T0DA 3HI6H 1JYWA 2ZUQB 5BVPL 2Z35B 4PJEB 5DURB 1CFQB 4YO0A 2APXA 5IFHH 2NY0B 1H3PL 1IAMA 2JTDA 1QPXA 2I9LB 3VFTA 3P4NB 2VAJA 4YBQD 1OSPL 5H37H 4JFDE 4R4ND 3MJ9L 1PYWA 4TUJB 1JRHL 3DIFB 4XPTH 3TT3L 3ZSTA 2EYTA 5KVGH 5AWNL 3BE1L 1MPAL 4XMKL 4LMQE 5T5NF 1FSKC 4P99A 5TQ0L 2YWZA 5DFVC 5KANI 1JE6A 1DLHA 1KXQE 3K8MA 4U1HB 2DQTL 1FZOB 5FKAB 4QXUL 2EDXA 4NRYA 1UGNA 1JGUH 2MTPA 7FABL 4PJCB 1E6OH 4ESKA 5IQ7H 4KK5C 3C6SA 3PWPB 2C3WA 4NWTL 5CWSB 1IGJA 2MCPH 5IVXA 5TQ2L 2Z92B 2FATL 3UJTH 4AM0B 4YFLI 3C8DA 5AD0A 5JDSB 1O7VA 2HVJB 5HHMB 2P7TA 4HG4K 4HK3N 1F4XH 4HUVA 4ZPTA 1UM5L 2FO4A 4LF3A 5GRVK 3SHSA 4DVRH 5I71B 4DN4L 1MJ7L 4LAQL 1QQDA 3VXUA 4LGSB 4Z7VF 3SE4C 1E4KC 1NCWH 3WD5L 3X11A 2YA0A 1LO4H 2ICWB 4M1GH 3WL9A 4CMMB 4WHTA 5ESQB 4JKMA 3IXTB 3UC0L 1A2YA 3KPRE 4JEGB 1A7QH 1BVLB 3QBTB 3MJ8A 2C1OB 5ERWB 5K93A 4KJYA 5L0QB 5IR1A 3R1GH 4F37K 1F4HA 1YQ2A 1K8IA 4XB8A 1GXEA 4BA8A 3LB6C 3ECBB 4IOIA 4IDLA 2GAZA 3C2SA 3ARYA 1TNMA 4PG9B 1H3PH 5JXEC 3SPVA 3EHBD 1A6TA 4EN3A 1CLYH 2G5BB 1HCFX 1WIUA 1KIRB 1LD9A 3G08B 4NC1E 3H9YA 2GT9B 3MJ9H 1TTUA 1JRHH 5J6HB 1S78C 4HIJB 4X4YB 1MPAH 1JPST 1QP1A 4XMKH 5D1QD 3OHXB 1YNTA 1QRNE 3HUJE 3BSZH 1GGYA 5TQ0H 3HI1B 4HS3B 2DRUA 2R69H 2WINA 3HMXL 1DN0B 4JRXB 1PW3A 3N0PB 4QXUH 3PQYE 4QCIB 2NMSA 4X7DC 2Q86B 3RGVA 4L8DA 4CVUA 2PN5A 3GJEB 3IYLW 7FABH 3WUWG 2XPGB 4NWTH 3KHQA 4NSKB 5I8KL 4DOHE 2X4OB 5HGAB 5IVOA 3D3VB 4Y0GA 4OF5A 3CMOH 4WDIA 1JMZA 4JHZA 4MAYA 2PXYD 4YNYA 4BFBD 1JHTB 1YY9D 4QOKB 5C7XH 2ENYA 4EUPG 5IJKA 2X89A 3DGCR 3DTXA 3HZYA 1FYTE 4U2YA 1UM5H 3SDXB 3IDJA 2VC2L 1BBDL 4Z6AT 4BZYA 1UJ3B 4X98B 4DN4H 3B9KD 1MJ7H 4NO2A 4OGXL 1I3RB 3MJ7A 3IF1B 3QHTC 3ILQD 3WD5H 3G6AA 2XZCH 2EIZA 4GKOA 5D70L 5IMMB 4U6HB 4QXTB 4HIEA 5CJ5A 4LCWA 4RDQG 1HI6B 3LDBC 2PYFB 3IDMA 4ZS7L 4ZOEA 1L7TL 1I1YB 2FH6A 4TTDC 1TCRB 4WI2A 5HDBF 2GW5A 2O5ZH 4U1KB 1UZ8B 5I1CH 1GH7A 4X5XA 2C3VA 4ETQA 4N0CC 5SWZD 4PTTB 2HH0H 5F7MC 1FLRL 3MV7A 3SE3C 3SKOA 1OCWL 4EQ2A 4OZ4B 1ZT4B 2IPTH 4UT9L 3ZKQD 3FO2B 3LIZL 1JGDB 1AFVL 4P9HL 3OZ9L 4PJAE 1FCCA 5IVZA 4YDJA 4KKBC 1BFSA 2VB5A 5J11C 2VN4A 5D9SA 4XNQB 4PJIA 4Q6IC 1FORL 2IQAA 2CRZA 1YMHA 3L3IB 2XWTA 4I8DA 3S98A 1EA9C 3WUZA 3W11C 1A21A 3VFRA 1SHMA 3W0WE 3P4LA 1CF8L 3UX9B 5D1ZC 2BXZA 1TJGH 3GMLB 4KJQC 4C56B 1X4YA 4NQVA 3K0WA 2J88H 4X9GA 5I8KH 2WBWB 5ANMB 1NCCL 5DFVD 1FFOB 3WFZA 1GZPA 3UDWA 5IEHA 1I1AA 5LG1A 4DGVL 5CUSL 1D5IL 2V5RA 4I9WE 3PNWB 5GZOC 5JW3L 1T2QL 5ENWB 1TXKA 5F7FA 4MNQB 4KK5D 3ZTJH 3I6GB 3L3DB 1KPVB 1BBDH 4PV9B 5DRNA 4LSSL 3BRDA 2ICWI 4OGXH 3MRKA 1ZHNA 4GKNB 1JZ5A 1AXTH 2NY4B 4HC1L 4LSVH 3SKJH 3RIAF 8CGTA 2P45B 3OJ2C 3GMRA 1G9EA 5I73B 3FMGL 5EDXA 2VXSL 5D70H 4NIKB 3GB7A 5IMOB 2I9TB 3OAUL 3Q6GL 3TZVB 2ZCLL 2H3NB 4DKDC 3BN3B 3G6JF 5HGDB 2F5BL 1BLNA 4J7RA 3QNXB 4GQPH 4PJ5A 1YY8A 5HY9B 1T4KA 5JO5A 1J0KA 5E2VH 1L0QA 2E6QA 1CXFA 4RA0C 1A1MB 1YEEL 5A40E 3C5SB 2HVKA 1FLRH 2AXHA 4G6ML 1NMBL 4JJHA 4WW2F 1GGTA 4E42A 4OKDA 4JREC 4LDLB 3IVKB 1AFVH 3SCMB 4P9HH 3ZKXB 2EDEA 4F37F 4FQXB 4CGTA 3LB6D 3HE7C 4RMRA 4MA8L 1FORH 4NHUB 4RMSA 4Z78B 2OTPA 4X99B 2K1MA 5F1KC 5JXED 1U8KA 3VXOA 4RFOL 1HSBB 1P84K 4C83B 2NZIA 3QNZA 5H35B 1NLDL 4U7SA 2XWJA 4PB0L 2X5PA 4QHUA 2VLJD 4XPHL 2ESVD 5DC4B 1S8DA 4M6ML 1S78D 4B7IA 4UBDC 4M6OL 1OAYH 1PAMA 5C1MB 3ROLB 3W9DA 3H9ZA 4XCCL 4NN7B 1TENA 5CUSH 1RZGA 1D5IH 5D5MF 1C5CH 1T1XA 5JW3H 3ARTA 1DQQB 3QT2A 3GIZL 2M26A 1GSMA 3DX8A 5F7EL 5JHDD 3BPNB 5IKCA 3IT8D 2GCYB 4HKBB 5DSCA 4X4ME 3TYFA 1VGEL 5H94A 1OWRM 2NYYC 1H0DA 5IB1A 4HC1H 2FECI 4V1DE 4M8QA 2DKMA 1MFDL 2SEBB 2VXSH 4JVWA 2QR0A 4L4VE 3LCYA 5IBUB 3Q6GH 2ZCLH 1S9KC 5IHZA 1JUFB 1VSCA 2RCSL 2F5BH 2H2SC 4PJBA 4JFFE 3CXDL 4LQ1A 2BNUA 4Z76B 1JRHI 2UUDH 1CTOA 5JQ6H 1ERNA 2R1YA 1GGIH 4ELME 3FB6A 4WFGE 4LHUB 4G6MH 3VXNA 5FOBA 4NQDB 1ZWIB 4TTDD 5ITFA 4MA1B 2X70A 3NCFB 5C0IA 4RIRB 3C6LA 1CL7L 1JJUA 5EU4A 2XTJC 3RL1B 12E8L 1BOGB 3NCMA 3SKUD 3WO4B 4TTGA 5DJXA 2DQEH 3RGHA 2E7MA 4N0CD 4ZXBA 4YLQT 5DVLA 4JZNB 4NQSB 2VZ3A 4OCYL 4MA8H 3S37H 3VXMD 1YNKL 2BVOB 2V2TA 5H2BB 1JPGB 4ZOAA 3WE6A 1MHEA 4BELD 3DUHA 3IDYB 3CFJB 2NY2B 4XC3H 3QI9C 5ISZE 5DD3H 4KKBD 1NLDH 5DQJB 1S7XB 4K7PL 3T0EE 2V2XA 4P46B 2P5ED 3VWKB 1INQB 1BAFL 4LCCB 3QUML 4M7JL 1X3DA 4M6OH 5HHNA 3W11D 1BF2A 1C16B 4TVSa 4XNMB 2E27L 1DBBL 2VABB 4PRDA 3ARVA 1U8JB 1QFWH 2F15A 4LHJB 1H15B 4HIIB 4Y4HA 1GGUA 4G8IA 4KJQD 5EO0A 1AGBA 5F7EH 3GIZH 3SY0B 4F7MA 2DQFB 2E7LA 1TJIH 5IB2B 2AKRA 1UH3A 3QDGB 5GZOD 2YEZA 4Z7UF 4MD5A 4Y19A 2X2YA 1MFDH 1A1NA 1AGEB 1T7YA 1A6ZA 1A9BB 1U8QA 5T3XE 2I07B 5LWYL 2NY5C 1WTLA 1I1CA 2VLKA 4D9LH 1KTKE 1YEFH 2RCSH 2VDRL 4MWFA 4R96A 2YBRA 3QCTH 3QH3B 3CXDH 5K59E 1CD9B 4PRPB 4YDVB 3SKNA 2ZSWA 5IFAL 4GRLA 2XWBB 3HG1E 4POYA 4HD9A 1FYHB 1G7IA 3OKMB 1FIEA 3O41A 4FG6C 1WGOA 5E8PA 2Z8SA 5HGHA 3P9MA 1XGUA 3B9KA 2CK2A 3RWCA 2R23A 4I0PA 1U3ZA 4X6DE 3VCLB 1CL7H 4BH7B 5A43C 12E8H 1FFPA 5T3ZH 3BW9A 3GM0A 1AI1L 3ZE2E 4GRWB 5CEZD 4ODSL 5D93B 3PF2A 3L9RB 1SM3H 5LGJA 4AIXA 3DI3B 3R06B 1YNKH 3WIHA 4WW2A 1TIUA 2WNGA 4YHPB 5C9JB 2NY7L 3QIWC 2HRLA 4QHKJ 3HE7D 4DKAA 1UJTA 3MRHB 2NNAA 5C0AE 5SWZA 2PCPA 1BAFH 3MA7A 3QUMH 3GI8H 1LP9F 2ILLA 4QWWC 4X6EA 5KJRL 2CQVA 3TH2T 1L9NA 5ICXA 2E27H 1DBBH 2WV3A 3I9GL 5SWSA 1QSEE 1SYSA 4ZD3L 2ITCA 1MRCL 1CFTB 1PGRB 3V5KA 2YD7A 1IM3A 3HNTH 2PYEE 3HPJA 4APQB 1G84A 2OSLA 5DJ8A 3O6LL 3V6ZA 5FDWB 1Z6JT 3DMMB 3X13B 4G80A 5FYKE 5JUEH 1QBBA 4BUGA 3V0AC 4QXWA 3RDTB 1A4JB 5DWUL 1QVOA 2P8MA 5DHYA 4LVHC 3KPLB 4ZDHA 3HC3L 2QQLH 1IKFH 4HFUH 1H3VA 3VXUE 1U8NA 4RAUA 5LWYH 2VDQL 2O61B 3I3DA 1NAKH 4BQCA 1Z3GL 2R29L 3EIFA 2VDRH 2DLIA 3AREC 2NYYD 2DI9A 3JBG7 1P6FA 2GK0A 2VWEE 3P11L 5IFAH 5CP3H 2Y7QA 3VGAB 5IP4A 3JTTB 4X8XA 1DVFB 5E8OB 3RX5A 4M43L 1HSAB 2LU7A 5GRXG 4ZPVA 2WUCL 4DTGL 2H2SD 5JA8B 3KJ4C 1JPFA 5D1XA 3OXSB 2A38A 2V9RA 2YPKA 5T5NG 3BOVA 1MJJB 3RKDC 2EKSA 5JW5B 4NPYB 3EJYC 4Y2DB 3UYRL 4UT7H 2DKUA 1AI1H 2XXCB 1XF1A 4ZFFB 1NBVH 4DW2H 1M71B 5DMJB 4HLZH 1UCTA 3QUMB 4N8PA 1ZMYA 4JO1H 4ODUB 4XVSL 1OW0C 3E1F1 3TNMB 5ADOL 3D69B 1E4KA 5I1DA 2XTJD 5ETUB 1JYNA 4M93B 3D39A 4XHQA 4CW1B 5BXFB 4LVNB 4HEPG 5I6XC 2VISB 1ITCA 3MV9A 3B9AA 4X0KA 5CLWA 4LSTH 2IAND 3RFZC 3AY4A 4KDTC 1ZT1B 4KVNH 4ENEC 3QAZB 1WZ1H 4K7PX 3QI9D 3L5IA 3I9GH 4PG2C 3MLYH 4ZD3H 3MLRL 4KGJA 4P2RD 4UV7H 4JDTL 3EKCA 4GJTB 3EO0A 1JGLL 1IAIL 1RZIA 3O6LH 5D2LB 1NFKA 2QLVB 4NZTH 5EH1A 3EAKA 4HDIA 1B4JL 2P5WB 3B9EA 1HHHB 5MENE 1ZS8A 5DWUH 4D9QE 5LGHL 3HC3H 4OF0A 3E6HA 1E28A 1AGFB 4YFLF 4OLEA 4PP1C 3ULVF 2VDQH 2MMXA 1Z3GH 1YNLL 2R29H 3CX5J 2R1WA 1DBKL 3PABA 4R90H 5K9QG 4DGIH 3C8KA 4LCWE 3V6FB 1H3GA 5C6PB 1UM4L 2AK4B 1Y0LA 3O9WC 2NTFA 2B5IB 1F3RB 3W39B 1ORSB 2A6JA 3LEYL 1T3FA 1TETH 3MLVL 3L7FA 4BH8A 2PF6A 3J8F7 4TUKH 5BV7L 2WUCH 4DTGH 2BOCB 1CFSB 5FUCC 5HVHC 2Q8AL 1IM9D 4XCNA 3CJJA 1RK0B 3UYRH 3GGWA 1PQZB 2DQJH 1DEDA 4XB7A 4FG6D 5AZEL 4NZUH 4RMTA 3OGCA 1W72L 3MYJA 2FIKB 4XVSH 3UZVB 4QTIH 3ULUE 2VLLA 5L2JA 4X6FB 4R97B 1A6AB 3OKEA 4DKFL 4MS8C 1NBYA 5GGUB 3TCLB 2VRAA 4XCFL 1E27A 4A6YB 3T2PA 4AT6B 2BRQA 3PWPD 5IB5A 3MQIA 2AEWA 1KLUB 5IIEB 2BC4B 1CXIA 4X6CF 1IVLA 3QIWD 5JOEA 1WT5A 2ZNXA 3LZFH 2LE9A 1KB9K 5A1AA 1HHIA 2YKLL 4JDTH 1OP5H 1QYGL 1DANT 1LEIB 1MJ8L 4LIQL 1JGLH 4HKJB 4JJ5A 3VXSD 1IAIH 1U93A 5DRZA 4QWWD 3VXRB 4S1QL 1B4JH 1V3JA 1V3MA 4KUZH 4NN6B 2YD2A 1CDUA 5INDA 5LGHH 1YN6A 4KZEL 1G9MH 3CVHA 3AXLB 3RIFF 3GSVA 3W9EB 4GAJL 2P5EA 3W2DL 1W0WA 3DROA 3OGOE 1CL7I 1DBJH 3A0OA 4QHLA 3TIEB 5DJCA 2EE9A 1DBKH 1OGAB 3GBNH 3GK8L 1NGWA 5DEFB 5KSUA 5EU3A 2HP4A 2XNAB 3SCMC 2APBA 1INEL 5D7LA 1IQDB 3O0RL 4HKZA 3S97C 2EC9T 3LKNB 1P4IL 3LEYH 2HRPL 1HHJB 3RWFA 3MLVH 1Y18B 3AUVA 4PJ5E 5BV7H 4JFQB 5CZXC 3AM8A 3GHEH 2Q6WA 3ARED 3CFDA 4P4RB 4G6KL 4J1UB 1ZVSB 3L3KA 4WFFD 3KXFB 4YBLB 2Q8AH 2D0GA 3WIIL 1SEQH 5F9OL 3TBTB 4WVRA 4IHOA 3THML 5DD1L 5F97E 2X4NA 3QEQA 4KH2A 4R2GB 1BQHB 5AZEH 1KJVB 3MUZ1 1TVHB 4PJEF 1I7RA 5BJTB 2NY6B 1CT8B 4PREB 1XEDA 1JZ4A 3C5ZB 3RKDD 1S7QA 4NQCA 4TYUA 1U6AL 3EJYD 4DKFH 3P4MB 2WLZA 4LRNL 5F7YC 4BSVB 2CR3A 3FB7A 4L8CB 5IW1A 1HYSC 1EEYA 3RQ3A 2FR4B 5CZVH 3SDDB 2DJSA 3MPCA 1RJZA 3IS1X 5DK2B 2BXYA 2VXTH 1K8DA 3MV8B 4L3EE 2JIXA 4ZAKB 4DZBB 4FQQA 2YC1B 4MCZB 3MLUH 1Q9OB 4Y89A 1QNZL 4F3FB 2YKLH 1QYGH 1MJ8H 1UA6H 4KK9C 4ENED 1HCVA 2VLRB 4X9IA 3X12A 4S1QH 2FX9L 3RL2B 4JY6A 2QKIB 1KJ2L 1Q94A 4KZEH 2X4SA 1UB5B 4BK4A 4GAJH 4FTVA 5F21B 3W2DH 1AD0A 4X5WA 1HQRB 4OZIB 3RWEB 4YHNB 2RFXA 4FXGB 5BV7B 1OSZB 2V7HB 4F7EA 5F6HJ 4KHXL 1O5DT 4WI8A 4D0BA 3K1DA 3RAJH 3LQAL 3D1MC 3GK8H 4JANA 2XN9A 4U6YA 3KLDA 1C12A 4OD3L 1INEH 4NC2B 2DQDL 4PJBE 3OKKA 2AXJA 2CLZB 3CH1A 4PP1D 3EDJA 1P4IH 2QQQA 5IQ9A 1B0GB 5HVGB 4JGJA 2N1KA 5DJAA 1W72B 3A6CL 4NO3A 1R5VB 1KENL 4G6KH 3ARZA 1CE6A 1DBML 5C2UB 2YZ1A 5I30L 3O9WD 2HFGL 3PWLB 3WIIH 5F9OH 2QHRL 3BIKB 3QO0A 4Y4KC 5DD1H 4JO3L 2DMBA 3K74B 2R1XA 5E1AA 2CIIA 5EUOB 1GAFH 3VWKC 2DLEA 1NSNL 4XBPB 3U82B 4MDIA 5BMFL 3SDAB 2IBZX 3K4DA 3B3IA 4NKMB 3O6FB 1YEDA 2AS5M 4LLDB 3CSBA 2J8UA 4UIKH 1U6AH 3TBYA 4LRNH 4H1LA 1G6RL 4H25B 3V52H 2PW2A 2XA3A 4ZFGL 4IS6A 5DF0A 3IAQA 4C56D 5IK3B 2P46B 4JFHD 1TQCB 5E03A 3HZVB 3TPKA 4BZ1H 4MS8D 1AXSA 3MRPB 3FOLA 2MQ0A 3ZYZA 3CFIC 1JWUA 1SY6A 5HI3C 5T1DL 1C5DA 4MNQD 3BO8B 2UZYB 1HKLL 2FL5A 3HKFA 5LCVL 5DJDB 2BDNH 2FX9H 1X4ZA 4JPKL 4KMLB 3MRGB 4LLWB 2X9XA 2F74B 3TFKC 4FQ1L 2CXKA 2CLRA 1S7VB 1JFQH 3OKYA 4DQOL 5DRWA 3SDXF 1MCNA 2VSDA 3H6JA 3OQ3B 2RR3A 5ACMA 2H32H 4RISL 4P23A 3LQAH 4JFPB 5ADPL 4FQCL 4UU9B 1OVZA 2MKLC 1AHWB 3DV4B 4JHWL 1F2XK 4OD3H 4WJ5B 2DQDH 2HLAA 3BGMB 1G7PA 1HWGB 2W59A 4NKOB 3LKQB 3BPLB 3WS6C 5CIPH 1KT2A 1KENH 4I2XB 1DBMH 5C0CA 3O8XC 3SCMD 5EC2A 3RVXC 5I30H 2HFGH 2DB8A 4ISVA 3ROOB 1MQ8A 2X10A 1NCAL 5SX5K 4I5BA 2IALB 2VITB 4L1HA 3MODL 1IKNC 4LCIL 1P2CB 5JPMA 5CZXD 1NSNH 1BIIA 1T7ZA 4WV1C 3EYSL 3UTTB 3BRGC 1TZHB 4MNGB 5T1MB 1DZBA 3PDOB 3MBEC 3V0VA 1IAII 4PJ7B 4JB9H 2EEBA 1G7LB 3RP1A 5CJXA 3L3JA 1N59A 3R0NA 2OZ4L 1KTRL 3DO3A 1CDCA 5HHQB 3BEWB 5E24E 1U8IB 2Z35A 4PJEA 1J0IA 3GSRB 1CFQA 4I3SL 4XRCB 5SWZE 1KJ2B 1N64L 2I9LA 1A7BA 4PRID 1OTSC 3HFMH 1HYSD 3TWCH 1U8MB 3P4NA 4RMUA 5JW4N 3KYMB 2YA1A 3MRDB 4TUJA 3DIFA 3N06B 3V2AR 4OAWB 4OD1H 3T09A 3DUSB 4P2OC 2CO6B 5DUBB 3MGAA 4IRSB 4M6NH 1CDIA 1X5KA 4PD4K 4EXPX 3V8OA 4JPIB 3N9GL 3I2CL 4U1HA 1FZOA 1IC5L 4IOSD 1RY7B 3VD5A 4DQOH 4KK9D 1RSFA 4PJCA 5LXGL 1JV5B 1UZ6F 1WBYB 4OI9A 2HG5B 3PWPA 5CWSA 3UMTA 4YUEL 1OY3B 4ONHB 5CIPB 1WITA 4RISH 5ADPH 2OTUB 5E5MB 4HFWB 4FQCH 2Z92A 3QXWA 4AM0A 4JHWH 1KBGL 4E41B 3U46B 3NGBC 5JDSA 3AFLA 2HVJA 5F1NB 3VI3F 1I4FB 3HRPA 5GSVB 3QFJB 4NQDD 5DD6B 1EVUA 2F8OA 1ND0B 4D8PB 4WU5B 3C9NB 4QY8B 3RX7A 1JZ8A 1HQ4B 1U2CA 1G6RB 1NCAH 5F7HA 3K46A 4LVNC 2ICWA 5JXAL 4JFDB 3MODH 5ESQA 4UZGA 4W4NA 3WFBL 3IXTA 3FN9A 5J4MA 1VGKB 4QRQB 2AJUL 1T20B 1BVLA 1KCUH 2BSTB 4WO4B 4OF3A 5DEZA 2C1OA 3UPAA 5ERWA 1WQVT 1BZQK 4Y4KD 4K55A 2EDQA 3BIAX 1AE6L 3VWKD 3WDIA 4G7VL 4M03A 2X1XR 3ECBA 2RIKA 1TNNA 3NFPB 3D39E 1DTUA 2OZ4H 1PEWA 3AREA 3G5YB 4K94L 5I2IB 2A74B 2DQIL 2IAMB 2PR4L 5GISH 4I3SH 4PG9A 4HEME 4XP6L 4U0RC 3UP1A 5DJ0B 1KIRA 4AK1A 4EBQL 1VCAA 3G08A 1PG7W 5T5FL 5HHXH 2GT9A 3OWEA 3CZJA 4YDIL 5J6HA 4HIJA 1CZ8L 5T33L 1NANH 5K9OB 1ADQL 4MJ6B 4X4YA 3NMEA 1BGXL 3OHXA 4LDOB 3HI1A 5D6CB 4HS3A 1RJLB 4PJGB 3QDGD 4J3TA 5AUMB 1DN0A 3RZCB 5HI3D 3N9GH 2EDKA 1IC5H 4CADB 4QCIA 2Q86A 4OT1L 3LH2L 3PDDA 2XPGA 4S1RL 3BH9B 5CGYD 2X4OA 3KPRB 4KROC 2PO6B 4YUEH 3BVNB 4Z77B 4O2EB 1QRKA 5HGAA 3WYRA 2ESVE 2AV7B 4F7CA 1S7UB 3TFKD 1MVFA 2YPVH 4LLMB 5I1HL 5EZJB 1KBGH 1MCSA 3VE0B 1DEEB 1JHTA 1EO5A 4QOKA 1RVFL 1B0WA 1FZMB 4CVZB 5I1GL 1T7VA 2DJ4A 4KDTA 3SDXA 3TVMC 2WIIB 1AD9B 1UWXH 3EOYG 1UJ3A 1AGDB 4X98A 2YN5A 1I3RA 2VN7A 3IF1A 5FGCE 5JHDE 2ARJQ 4R97C 1NKRA 4RFNB 3UBXB 5JR1H 1WLHA 2XRAL 5IMMA 4U6HA 4QXTA 5JXAH 4MMXC 5EU7C 3QULB 4PS4L 1HI6A 4Y4FC 2WANA 5EZIL 2PYFA 2EDJA 4OCWL 1MNUL 4UINL 4I0CC 3O8XD 1I1YA 4JRYD 1QRNB 3RVXD 1TCRA 4JFED 4N9GB 1OTUC 3ES6B 1UZ8A 4U1KA 4CVWA 2OYPA 1IJ9A 2BK8A 1AE6H 1A6UH 1F3JB 1DQDH 4WENB 4K8RL 4PTTA 1J8KA 4K94H 4OZ4A 2YUWA 2DQIH 2H9GB 2H45A 3MBED 3FO2A 2PR4H 1UM6H 2EE2A 4KKCC 1JGDA 4AG4L 2E6JA 3VDCA 4XP6H 3KPSB 4E9LA 1F13A 3O3AB 1K6QH 4QRPD 3LN5B 1FGVL 4EBQH 5T5FH 4XNQA 4FZ8L 4DAGL 1GVIA 3GEWB 4YDIH 2X4RB 4RFEB 5T33H 3UYPA 3L3IA 5IEKB 1ADQH 3H3PL 3T3ME 1X9QA 3S9DB 4XAKD 5DD0L 1OTSD 3VI4F 1FL3B 3O6KL 4KJPC 1X5LA 1M7XA 3KWWB 3VXME 1U91B 3QDMB 4X7TB 1HKFA 2MNUA 1UACH 5E94B 3LH2H 3GMLA 5DA4A 4C56A 5CILL 2X44D 4CN4A 4S1RH 2A6IB 4P2OD 5ANMA 1FFOA 2P5EE 4KI1A 3EDKA 2J5LB 1JVKA 3R0MA 4U31A 4H1LG 2CXGA 4O2FB 3PNWA 5T3ZD 4HWNA 5ENWA 1KIPB 1RVFH 1CDYA 4ZUUB 2ADFL 4MNQA 2MSPA 3A6BL 3I6GA 3L3DA 3ZDZE 1KPVA 3M8OL 5JHLL 4PV9A 5IMKB 3BD3A 2GTWB 2AJ3B 4O9HL 4HPYL 5E5RB 4U1SB 4GKNA 3BJLA 3T65B 5FM8A 2XRAH 5CCKL 5IMOA 5F3BB 4PS4H 3TZVA 5F7DB 2H3NA 1T0MB 2KQNA 3QJHB 5TF1L 5EZIH 5HGDA 3HS0B 4OCWH 1Y6KR 4UINH 3QNXA 1GRWA 1ROWA 2ERJC 5HY9A 4G6FD 4TSAL 4OGYL 3GSWB 2F19H 4NCC1 1MCOH 4MB4A 4OCMC 1G9MC 3RWJB 4YIQB 3W0WB 5HYFA 1J1PH 3SO3B 4NQCE 4PJFE 4LCYB 3C5SA 3UTSD 4K8RH 5IESL 1L9MA 1CK0L 1HDMB 4AG4H 2P44B 3IVKA 3SCMA 3HMXA 1AO7D 3F7VB 4JKLA 2XTLA 4MZ3A 5CEYB 3F5WB 4HMDA 4PJDB 1I9JL 4FQXA 5EIVA 1FGVH 4DAGH 4PY7B 3D0LB 1EO7A 4NHUA 5K9JH 3U36B 3QXAB 5GJSH 4Z78A 43C9B 4Z0BH 1CXHA 1ZSDB 2P5WD 4OM1L 4X99A 5CEZE 4R4BB 1MRFH 1RIVL 4J3SA 4M48H 5DD0H 1CG9B 3MOBL 4WHYG 1HSBA 2Q3AA 3O2DL 4C83A 2G5RA 5H35A 3O6KH 5IWLC 4FXKB 4LHQB 4JM2C 1L7IH 2FB4L 4JQVC 2C4FU 4OCLC 5C0DB 3H42L 2HMIC 1ZTXL 5CILH 5EWIL 3ROLA 1WAAE 5CJQH 4FTVE 3NA4A 2VZVA 5T1LB 4PYGA 4Q9QH 3MRFB 4H88L 4G9DB 3WUWB 1DQQA 2ATKB 3IRPX 2ADFH 1YEIL 3WN5B 3KPOB 5HBBA 2YD6A 4Y5YB 4RRPA 4O9HH 3RPKA 4OIBA 4HPYH 1AQKH 5J13B 2CLVA 4PB9L 5C07D 1LK3L 4ODWB 4K3DL 2SEBA 4P9ML 3KGRA 1SMOA 4F9LC 5D72L 1EMTH 2H8PB 2PW1B 3TVMD 5TF1H 2BNRD 1JUFA 4FQLH 3O4LB 3AS3A 4ZUVB 1CCZA 1II4E 1U92B 4TSAH 4Z76A 4OGYH 4WCYH 5KSBE 1OP5K 2VDNH 3TT1L 4Y4FD 1L0XA 2J8UE 4LHUA 5D7JC 3TV3H 4NQDA 1ZWIA 2EXWD 1ZVYA 1NCUA 1OTUD 3HA0A 4RIRA 4D0DB 5HHVL 4DJMA 1KG0A 5D7IE 4YJZL 1BOGA 2QSVA 2OXGA 4JZNA 4NQSA 5GS3A 1ZVHA 4KQ4H 4GS7C 3V4VL 2BVOA 4KKCD 1JPGA 5BS0B 4OM1H 4Q58C 5J06A 1RIVH 5HYEA 2BY1A 2JJSC 3CFJA 4L4TD 3O2DH 4Y7MA 1CDJA 1KTDB 4OZFH 3TLRA 4NFBA 3DUUB 5D2LF 1QBLL 1CDHA 2FB4H 3LMJL 4OCSL 4P46A 3VWKA 4F7TB 4LDEB 1A0QL 1INQA 2XTJE 3P0GB 3H42H 4L4VB 4LCCA 3E6FB 3JZ7A 3SDCB 2M8XA 5EWIH 3O45B 2FHFA 4IMKC 3GM8A 3BX7C 4JFFB 2VABA 4XNMA 4ERSL 4KJPD 2D3VA 4HC1A 1U8JA 1FAKT 1H15A 4GLRH 4HIIA 2D2OA 5IFJB 3LSOB 2BP3A 2GYSA 3WFCH 4FQPA 1I7TB 4J2XA 3SY0A 2XT1B 1WV7T 4WEUD 1YEIH 2DQFA 3BQUC 2DQUL 1AQDA 4C57C 4Z7OE 4M1DH 1IAKB 3WJLC 2XYCA 3QDGA 3K81A 3CUPB 1OD9A 1LK3H 4K3DH 4LASL 4XBEL 1RU9L 4P9MH 1AGEA 5TE4L 2DF3A 1A9BA 2I07A 1XGTB 4LPUA 4P3CL 1FRGL 3VG0H 2R4RL 2VXQH 3GSNL 1ZEAL 1RJYB 3QH3A 2D7MA 4PRPA 4U3HA 5IROC 1WWAX 3VRIB 5ISZB 3LRGA 2YRPA 1MCIA 2JJTC 2ZOKB 3OKMA 3T0EB 4PR5B 5GGRB 3BD5A 2DBLL 3KR3L 4XP4H 2B7DT 3U2SB 4HWUA 3T3PE 4Z5RB 3MV8D 1U0QA 4HWBL 1ZGLB 3DWTA 3VCLA 4YDKH 4QKXB 5HHVH 2N7BA 4BH7A 4TRPH 3OR7B 1N5AB 3VFWA 3UO1L 4BFEA 5I1JL 2AK1H 4U1GC 1HXYA 2YUVA 3WS6A 2VLRD 4JY5L 3V4VH 3R06A 4CMHC 4KRPB 2ID5A 2YRLA 4YHPA 5C9JA 2XOTA 3ARDC 1ZV5A 1NQBA 4JRWA 3R8QA 5J89A 3MRHA 4OCSH 3LMJH 2QQNL 1A0QH 1N8ZB 2DMCA 5F9WB 1OAKL 1ACZA 4YHIB 2ICEB 2UYLB 4OUUB 1FZKB 1EVTC 2J2ZA 3OMZA 3RHWK 2FJGA 3P9LB 4PJCE 4ERSH 1HXMB 2GJZB 3PWPE 3S6CA 2HFFB 4N5EC 5CSBA 4JM2D 1CFTA 1K85A 1BQUA 3HG1B 4APQA 2BERA 2HMID 3QIBB 5FDWA 3DMMA 3X13A 3MO1B 1LK2B 4F2MB 1FFQA 1CTNA 1JNHB 1J0YA 2AXGB 3DLQR 3P9WB 3RDTA 1A4JA 4X6DB 3TNNB 3FN0L 3KPLA 4DEPB 4I0KA 4LPCA 4LQFL 2N7AA 4LASH 4OV6F 1OHQA 1RU9H 5TE4H 2XI9A 5EIIB 3T0BA 2O61A 1FRGH 1NGZB 3LKRB 4YDLB 3GSNH 1T80A 1ZEAH 5DO2C 4J6RL 2IAMC 1BZ9B 1T1YB 2RHEA 5DC0A 4ZFZB 1MHCB 1QFUL 2Z31B 3MFFB 3UPRA 3NA9L 5JW4R 3JTTA 4L9LB 5E8OA 1DVFA 3KR3H 1HSAA 1YYML 5C0AB 4LFHD 3U7WL 4OCXL 3DBXB 2ARJB 5JQHC 3OXSA 3U4BH 5FUOL 2ZCKL 2DTMH 2YXFA 4HWBH 1MJJA 1ZLVH 2WQRA 5JW5A 1DE4B 4YGAB 3HZMB 4Y2DA 1QSEB 1S9WB 2WBJC 3C6SB 4ZFFA 1IGJB 3HC4L 1M71A 2UVFA 4WFFE 5D7JD 5I1JH 2PYEB 3L95B 2BVPB 1TPXB 2CMRL 3QUMA 2AEIT 3MSPA 4ODUA 4JY5H 4X7SH 4CN6A 2IH1B 3NCBB 3TNMA 5AD0B 2QEJA 3EO9L 3U30B 3ZE1E 3D69A 1CICC 1CLZL 2MHAB 4LSRL 3L7EB 5ETUA 3ZHDA 4OQTH 3VGEA 4L8SB 4CW1A 5BXFA 1LGVA 2VISA 4HT1L 1Z9LA 5HDLA 4NM8H 4ZUTB 2BFVL 2X40A 3ALWA 3UTSA 2WWKT 3EUUA 1WTGT 1ZT1A 4NGHL 3X11B 1IT9L 2RGSA 2KZ1B 1KIUA 2R0ZL 1FL5B 4NOFA 4AIZB 1ZHBB 5D2LA 4XP1H 5L8JB 3LRSA 3BKJL 3GSNB 1IL1B 4KJYB 3K1KC 2ZNWA 2P5WA 3X3GH 2V17L 3OPZL 1HHHA 1S9YB 3VA2C 5IOPB 2MWCA 2B1AL 3RPIB 1X5FA 3ET9F 2VLMD 3Q1SL 5CP3A 1AGFA 3K4ZA 4LQFH 5C3TA 4KZDL 3FZUC 3VRLF 3BQUD 3PJSA 3TN0C 4JFYB 2OJZL 5E2UH 2BVQB 3PWNA 1OGTB 3VMPA 1B2WL 2ZJSH 4J6RH 1LD9B 3WHE0 4NT6A 3V6FA 1YPZE 4LAJH 2AK4A 3I50H 4C55A 5EUOF 1S7RB 3W39A 1ORSA 3LS4H 3NA9H 1V7NL 1VA9A 3ZTJG 1R6VA 3AMKA 3N85L 3I02B 3MTRA 2BOCA 1CFSA 4M6AA 4XPFL 2ZCKH 3WEXB 4B7LA 1CQKA 5MP6L 1RK0A 4M7KL 5M95B 1RIHH 4XMPL 5SV3A 3JV4B 3PGCB 1PQZA 2AQ3A 3O2VH 5JZ7C 4RGNC 1D9KC 2AP2A 2CMRH 4RRPG 2FIKA 3WBDA 4YNYB 3B5GA 1D3CA 4JQXC 3QPQC 4LSRH 1A6AA 3UJIH 2IC2A 4LEXH 2W0PA 3DTXB 5GGUA 3TCLA 5LGKA 5MENB 4K9EL 4PYHA 5FUCE 4HT1H 2D7QA 5J7CC 5IBUG 4NHCH 1I8MB 4NO2B 2WBKA 3R8BB 4A6YA 4AT6A 3T2NL 3UJJL 1KLUA 3MLWH 5ID1B 5IIEA 4NGHH 3UPCA 2BC4A 1TZGL 1IT9H 3BZFA 5F7WC 2PKDA 3ARDD 5CS7A 1S5HB 4C56E 2CDGB 4LCWB 1FPTL 4JFHE 1J8HD 3QB7C 3IDMB 1FC2D 2R0ZH 4LHUG 4OLYL 4HKJA 1B3JA 3V6BR 3BKJH 2XKUA 3VXRA 4K94C 3RHWF 5GGVL 2OS7A 1KV3A 5F6HI 2VE6B 3OPZH 4MNQE 3TIDB 5D2NB 2B1AH 4N5ED 1KLGB 3L1OL 3Q1SH 2E9BA 3AXLA 1XFPA 4JPWH 1PG7L 1QZ1A 3W9EA 3BUTA 3P3YA 1QLRB 3AB0B 4YR6A 4MSWB 1JGEB 1RD6A 2ENSA 2OJZH 2W9DL 4M61B 3TIEA 5J3HC 4IRJB 4ORZC 1B2WH 4TVPD 5DEFA 4ZNEA 1GCFA 2XNAA 1IQDA 3LKNA 4PGBB 5DMGC 1I8LC 2AEQL 1HHJA 1V7NH 2BNQB 1Y18A 4XCEB 5L6YL 4JFQA 4R0LB 3N85H 5DO2D 3B2VL 1UVQB 2HKFL 1KN4L 4P4RA 2IAMD 4S10A 3M45A 3ALXA 4J1UA 1ZVSA 4CU6A 3P40A 3KXFA 1HYRC 2IBBA 2UV3A 5MP6H 4MAUL 4M7KH 3TBTA 3IU4H 4G6AC 1RHHB 4P2CG 2X1QA 5IHBA 3G9AB 1OTTC 1BQHA 1KJVA 5BJTA 1TVHA 3V4PL 3TA3C 1CT8A 4PREA 4O51B 5FFLA 1F90L 2D0HA 1UENA 1BBJB 3BZDA 3C5ZA 5FO9A 5TE6L 3VFPB 3BKMH 3TYGH 2JK5B 1E4WL 4NZDA 5EOTB 1T1WB 5EU5B 3P4MA 2WBJD 5FM5O 4BSVA 2YSSB 1IGIL 1DSFL 4K9EH 2O26U 2J3SA 1RUPL 3MGOB 3PE9A 4U6XB 3B9DA 1A14H 3SOBL 2FR4A 1UWXK 3SDDA 5A2JH 3UJJH 4OM0H 4NBYB 1UB6B 5DK2A 1CICD 1TZGH 3MV8A 3JVGA 1FCGA 3ZHKA 4IJ3C 3M17B 4ZAKA 4DZBA 3WSQL 2YC1A 4MCZA 4F58H 5D96C 1Q9OA 4F3FA 1BLNB 4OLYH 3AC0A 1ODAA 2DYPB 4PRIE 1QSVA 4K8RC 5JO5B 1EAJA 2A9ML 2VLRA 4Y5XC 1EHLL 3RL2A 1YMMD 3FO9A 4D0CB 3QHFL 2N56A 2QKIA 2V7NB 3L1OH 2HVKB 4M7ZC 2ZOLB 4TUOB 1PG7H 1ZE3C 3NFNB 1UB5A 4UDTB 3QWRD 1DQJB 4GG6E 5BZWB 4HWEH 1AJ7L 1HQRA 1SVZA 3RWEA 4OZIA 4FXGA 1OSZA 2V7HA 4XPBL 1C1EL 1DBAL 3WNOA 2E7HA 1QSFD 2Z4QB 3NIGE 1DFBH 2X6MA 1L6XA 5E8NB 3JV5A 1WFTA 2CLZA 2AEQH 4KRLB 3FZUD 4RBPK 4XT1C 3TN0D 5L6YH 5FGSA 5I75B 1RUQL 3B2VH 1W72A 3DGGB 2HKFH 1KN4H 2HFTA 1R5VA 1EIBA 2YD1A 3QUYC 1S8DB 4L3EB 3PWLA 4NYLB 4Z7WB 2Z8RA 1ED3A 4NQDE 5EOQL 2E6PA 5EUOA 1CGTA 2HT4C 3K2UL 4JDVB 4NKMA 3MNZB 3O6FA 2EYSB 1XIWC 3G6DH 5D6DC 4LLDA 1E4WH 4OIAA 3DX8B 2CKBH 4RAHA 1IGIH 1DSFH 3FQNB 3QDMD 4H25A 4HJGB 3MR9B 2XFXA 1RUPH 1JL8A 4RGND 1D9KD 5H94B 5D4QA 4J3WA 5IK3A 3AS1A 3WCYA 2YD4A 4Y16C 3GDBA 3HZVA 3L3HB 3KLSA 3QPQD 3L3OB 4MJ4A 1ZT7B 5HGBB 3MRPA 4U4BA 2F54D 5L2KD 4NKDB 3GBML 5DQ9B 5D7JA 5HTSA 4XGZB 1BJMA 3BO8A 3BDYL 4JZJB 5FYJU 3G9VA 4WUKH 2A9MH 4O4YH 4WEBL 5DJDA 5F70A 1EHLH 5BZDB 3IFPB 3MRGA 4LLWA 2F74A 4N0UB 3INUL 5CSGA 5CLTA 1HE7A 1AJ7H 3F58L 3QDGE 5C0IB 4XPBH 1MFCL 1IGFL 5F9JB 3U7AA 1G0DA 3E0GA 5ILTH 4JFPA 2VQTA 4UU9A 1AHWA 3DV4A 4WJ5A 3BGMA 4WUUD 3D48R 3LKQA 5J3HD 1RUQH 4JHAL 3HUJF 3WNPA 2IGFL 5D8JH 4I2XA 1RZJL 4K71B 4HUMB 5E6YA 2H41A 1JYVA 3ROOA 5DMGD 2R56L 1NAMH 1K4DB 2IALA 2APVA 2D7OA 4AQOA 5EOQH 4BFIB 4NOBA 1P2CA 4K3JL 3REWB 1U2HA 3CLEL 3CU7A 1JHLL 2WP3T 4NQED 3UTTA 4KPHL 1TZHA 4MNGA 5T1MA 4B53A 3PDOA 3KS0J 2A73B 5EC1B 2FZ3B 4G6AD 3S34L 4PJ7A 3QUZB 1OTTD 5E6IB 1I3GL 2B1HL 4UQ2B 4K23H 5D1QB 2R2BB 5KVFH 4JFEE 5CBEB 3TA3D 5E4IA 3FL7A 1FV1B 4LNRB 3LQZB 5FA3B 3BEWA 3LD8C 5HHQA 1U8IA 3O3BB 5IROA 3GSRA 4XRCA 3QUXB 1KJ2A 5ALBL 5T1LD 2X9YA 1G1YA 3B4NA 4GW1B 1IGYB 2OL3H 1KB5L 1MCCA 3KYMA 5HJ3A 1I3VA 3GBMH 4JVUA 3MRDA 4Y5VB 2UVEA 4OAWA 1UXWB 3WIFB 5DMIL 3DUSA 4QRPE 3FTGB 4JAMB 4WEBH 2PXYB 5DUBA 4R26L 3T4YB 4JQIL 4OFIA 4IRSA 1MEXL 4CJ0A 4JPIA 3INUH 1JGVH 4XAKE 3DX9B 3B9KB 1JV5A 4M1CC 4K8RD 1OARL 5FK9B 2MQCA 2HG5A 5GS2H 4UILL 1MFCH 1IGFH 3VXQB 2FJHB 1WVZA 4ONHA 5CIPA 4AEFA 4PJAF 5IT2H 1NBZB 5C0GB 4M5YL 5K9KA 2OTUA 5E5MA 4HFWA 4EDXB 2X41A 4E41A 3U46A 1J8HA 3LS5H 5F1NA 1I4FA 5DK3A 3QEGL 1FNAA 4NCDA 2WP3O 3QFJA 4JVPA 5DD6A 2EYRB 5T3ZE 4JHAH 5FHBL 1ND0A 4D8PA 4WU5A 3C9NA 4QY8A 1RZJH 3U30C 4NN5C 3CSYB 3MRNB 1HQ4A 5SWZB 1JNNL 5TJWK 1G6RA 3K8LA 1JZ3A 3Q3GB 1E0OB 3MCG1 4XCYB 4JFDA 4K3JH 4QTHB 1YQVL 1VGKA 4QRQA 4ZO8A 3CLEH 1JHLH 2BSTA 4WO4A 5BS0D 4OLVL 4NJAL 3QUYD 4LPWA 3RTQC 3U1SL 1KYOJ 2B1HH 4YQXH 2HT4D 5DI8B 3NFPA 5I2IA 3G5YA 1XIWD 3T0AA 2A74A 1KXTB 2IAMA 1IFHH 3EYVB 2ED7A 3LKOA 3UTSE 2GEEA 2VIRB 5ALBH 4O5LL 2FGWH 2ICCA 5DJ0A 4NNPL 1KB5H 7CGTA 1RUAL 4EJ1C 1VERA 4Z8FL 1NDMB 1UQSB 2BHUA 5K33A 1AO7E 5K9OA 1Y6NR 4Y16D 4MJ6A 2R15A 2G9HB 3BN9C 2G75B 1G7HB 5D6CA 4UAOC 4GUPB 3SE9L 1RJLA 4PJGA 4JQIH 5AUMA 2UWEB 2VDOL 3RZCA 5CMAB 3KLHC 4CADA 2P5WE 5F44A 1BQHG 2GI7A 1LILA 3QP3A 5ICZB 4IMLB 1I1FB 3BI9X 1X5YA 1OARH 4UILH 1JWMB 3KPRA 2PO6A 3BVNA 4Z77A 4O2EA 4PY8I 2AV7A 5C0BD 1S7UA 5C2BL 1JN6B 5EZLB 4LLMA 4I77L 4ELKA 3NCEB 3VE0A 1DEEA 2EDWA 5IHLB 2FRGP 1FZMA 1OAXL 4JY4B 3QEGH 4CVZA 2WIIA 1AD9A 3MROA 2D0FA 5FHBH 1RMFL 3NN8B 2KQMA 4XMLL 5GQBA 1RV6X 1NMCC 4RDQF 4X0KB 1TJHL 1JNNH 4L4JA 3UBXA 3ARGC 1Q0XH 5GGSY 3UROR 3X17A 1ZK9A 4YHZL 2KBGA 4ODVL 1G0YR 1W8NA 1MCEA 1EGJL 3ZE0E 3QRFM 2OZ4A 4LPTA 4KTEL 5C07E 4LPYA 5EO1B 2E3VA 4WY7H 2BHYA 4N68A 5TDNB 5HDQL 1FL6B 4NJAH 4N9GA 3VMNA 1H3WM 3U1SH 3ES6A 5LJYH 2BNRE 1I75A 2OR9L 3VA6A 3GSXA 4TN9A 1INDL 1KB5B 3WFEL 4HDIB 1F3JA 3LVEA 3UTZB 1ZS8B 3LQMA 3TBVB 1EO8H 2COQA 2H9GA 5GGTH 5CEZL 1AGCB 2VLJB 3S36X 2ESVB 2GK2A 3D25B 2GKIA 3KPSA 3O3AA 4QRUA 5D2NC 2FJFA 3TM6A 4BZ2H 1YJDH 3LKPB 4NNPH 3LN5A 3EOBA 1RUAH 4UTBL 2ADJB 4Z8FH 3AB0C 3VWJC 3C8KB 4RFEA 5IEKA 2Y36L 1TFHA 4LGPB 1LDSA 3GMQB 4GMTH 1FL3A 5FGCB 2QHLA 5JHDB 2VDOH 4ELMF 3KWWA 1FO0H 1U91A 3DV6B 3QDMA 4HF5L 4X7TA 1ZA3B 4KDWA 2YXMA 5E94A 1DL7L 4H8WL 5FYLH 1MHHB 4L4TE 1OB1B 3U4AA 4WI3A 3RY4A 1XT5A 1LP9E 2A6IA 1XGYH 1ZLVK 4JQXA 5C2BH 4J3XA 4O2FA 4I77H 3O2WL 5F89B 3OGCB 1KIPA 4WTWA 5IW6B 4JE4B 4M1CD 4ZUUA 5EG6C 1NLBL 4OFYD 3MJGX 2JB5H 4I1NB 5IMKA 2GTWA 2AJ3A 4FQ2L 1AP2B 1RMFH 5SWQB 1X6NA 3KDMB 4U49A 4U1SA 2ZZUT 4I48B 5B38B 1TJHH 3LDBB 1B6DA 4WNQB 3O11B 5IB5B 3GMOB 4HK0B 3CAFA 2I25N 3K80A 3T1FB 4GAGL 1R3JB 2DBJA 4YHZH 5F3BA 4ODVH 5F7DA 1T0MA 3QJHA 1EGJH 4OBSA 3CVIH 1W8OA 3HS0A 4KTEH 5F1SA 2NZ9C 5CD3B 1QHOA 3QSKB 5HDQH 2CRYA 4WGVB 4F80A 2I27N 1AR1C 1A9EB 3GSWA 2OR9H 1XR9B 3VXMB 1INDH 3RWJA 4YIQA 3W0WA 4LCYA 4NUGH 1HIML 5L9DH 2XY1A 1IARB 1KCVL 1ADQA 4ONFL 3X3FH 1HDMA 3RTQD 4Q6IB 2P5EB 3F7VA 5CEYA 5BCAA 3F5WA 4PJDA 4JPVL 1T6WA 1CGXA 3MV8E 1UWGL 4BKLB 1C5BL 4UQ3B 4PY7A 3D0LA 5C8JB 4X4ZA 3T0XA 3U36A 3QXAA 4EOWL 43C9A 2Y36H 4JG1L 5K59F 1ZSDA 4PRBB 4R4BA 5D1ZB 3ARWA 1CG9A 5I0DA 3RWFB 1VENA 4TNVF 1U36A 4HQQH 5IF0A 4FXKA 2VLRE 4HF5H 5BOZG 3K7UA 1PSKL 2D03L 4H8WH 5C0DA 4O2CA 3L3KB 1S5IH 3BN9D 3O3EB 4WI7A 1MWAL 4HX1B 4KQ3L 5FEBA 1X5ZA 4X6DF 3FT2A 2H6PB 4YGVB 3JUZA 1IC4L 1T83C 5T1LA 3KLHD 3ZE2F 1F8TL 3MRFA 1I7RB 4G9DA 4OSUH 2VR5A 1XCQB 4R7DB 3DURA 4OTXL 4PJFB 1NLBH 4P57B 3EYOB 3WN5A 3KPOA 3VFVB 1X5HA 4Y5YA 2ZUSA 2OLDA 4GSDL 2ZG3A 3NH7L 3IDXL 2NX5D 2OQJB 4G5ZL 4ODWA 1LMKA 1Z5LB 4L9DA 5DZOA 1AH1A 3O4OC 1VHPA 2H8PA 1EZVX 1NC4D 3A67L 3QDJD 3QIUC 4RMWA 2ZCHH 4FQQB 3O4LA 1TQBC 4ZUVA 1OAQL 2LTQB 2NY5L 5EA0L 1U92A 3ZTNL 5IVXF 3ARGD 2Z9TA 5E4EC 4C58B 1MCFA 2ZKHL 1FG2B 3UEZA 4KGLA 1HIMH 2YD5A 4OD2B 1KCVH 3EDFA 2AGJL 2X4SB 3HE7B 4D0DA 3M1BB 4LLYA 1YEJL 3KYNB 1BWWA 4KV5F 3QQ4B 5DLML 32C2B 1VB9A 3GZKA 1KF9B 4JPVH 3E8UH 4P4KC 4LVEA 2F58H 1UWGH 2CDEB 1C5BH 3BMVA 3T4AB 3DSFL 1NL0L 4EOWH 4JG1H 5BS0A 3T04D 1ZGLM 3WXVL 2IPKB 4FA8A 1NMAL 4EIZC 1E4XL 5IW3A 4HCRL 1M6OB 4YHOL 1TCMA 3U9PL 3MV01 1FIGL 1U58B 4KUCD 1NCDL 1J0ZA 4F7TA 3MNWB 3LKSB 5FCUH 2D03H 3QUKB 3PHQB 4L4VA 3E6FA 2Y72A 3SDCA 4AQ1B 2ZPKL 1MWAH 1XIWA 2FX8H 5LQBL 4N0FA 1FVCB 4G9FD 3QO0B 3QPXL 4JFFA 1IC4H 1LE5B 2A0LC 2CIIB 5CSZB 5MERB 5AAWA 1F8TH 1HH6B 5KSVB 5KSBB 5IFJA 2D7PA 3Q6FB 2ORBL 1I7TA 2BNQD 4GG8B 4PJXA 5B3NA 1CFBA 2WMPA 1IAKA 2IG2H 1KIQB 4IM8A 1GIGL 4GSDH 1MQKL 3NH7H 3IDXH 4MJID 4NFDA 4BSWB 5D7IB 3QUZC 5FM4A 2BSSB 1T89A 5C0EB 4I2XE 1U8OB 1XGTA 4PGJA 3A67H 2VLME 3FOLB 1RJYA 4UNUA 1NPUA 3ZL4H 4LSDA 1OAQH 2R9HC 5F3HB 5C6TL 1WFNA 2DM4A 3QUXC 4XPTL 1U3YA 5ISZA 5KVGL 1FNHA 2EEDA 1MIEL 3T0EA 3KYAA 1FFNB 4PR5A 1Z9MA 4PTUB 2XTJB 5ESAB 2NZ9D 4PJ7E 1XCTB 3U2SA 5J56B 2CLRB 4Z5RA 1NDGB 4X7FC 1AR1D 3ZYOA 1ZGLA 5DRWB 1QLEL 4XWGH 1YEJH 4LLVB 5IQ7L 3OR7A 5DLMH 2IANB 2MCPL 1LNUB 2CRIA 1GHFL 2YK1H 4CN1A 1VEMA 5ELIA 3VW3H 3QI9B 1NL0H 1MWAB 2OP4L 4G7YH 3EDDA 1MFAL 2JCCE 4P2RB 1M7DB 3ESUF 3WXVH 1NMAH 2KPNA 5DEGB 4YHOH 2ZSVB 3UBXG 4U33A 1FIGH 3B8SA 3MX0A 4DVRL 3DYPA 4GAFB 1N8ZA 4YHKH 4YHIA 2ICEA 2UYLA 4NP4H 1NCWL 4OUUA 1FZKA 1MY5A 5TDPB 1Z9OA 2YPLD 5LQBH 2ZUTA 2YD8A 3GNML 1LO4L 2EECA 3P9LA 5F88B 1HXMA 1I7UB 2GJZA 2HFFA 3FONB 4PGDB 4HH9B 2DTSA 3STZA 4XX1E 3HG1A 1J1XL 4LPVA 2ORBH 4IOFC 1H3XA 1ACYH 2W92A 3QIBA 2EIBA 5KS9E 3M07A 3MO1A 1CU4H 1J8HE 1LK2A 4F2MA 3ULUF 1CIUA 3R1GL 1JNHA 2AXGA 3DX6B 1KEGH 1G1CA 1GIGH 4X6DA 1MQKH 5BO1H 3FQTB 2D7TL 1BFOB 1ZLUH 2H1PL 5EIIA 1I8IB 5GS1B 3IKKA 3PP4H 3QXDB 3TH3T 1NGZA 3LKRA 3QISA 5GZNC 1IM9B 4OFKA 1CLYL 1FE8H 2KDGA 1QD0A 2IADB 2FGZA 2LAGB 3BFOA 1UT9A 2EC8A 5C6TH 1BZ9A 4WTZA 4XVJH 1T1YA 4H0HB 2GFBB 4ZFZA 1MHCA 3KLAB 2Z31A 3JTSA 3MFFA 3H0TB 1PY4A 4KKNA 1MIEH 4L9LA 3BSZL 3QIUD 1FNGB 1TITA 5FDYA 5C0AA 3AGVA 2R69L 1X5GA 2HJFB 2MJWA 3DBXA 2ARJA 4ZFOL 4WFHD 3MXWL 3MV11 1QLEH 1OWWA 1DE4A 1NUFA 4QEGA 3HZMA 4DK6A 1QSEA 3OAYH 1S9WA 2RBLA 3ESVF 1GHFH 2PYEA 3L95A 2BVPA 3QIWB 3CMOL 4YZFE 2OP4H 2WLYA 2IH1A 1MFAH 2MHAA 5C7XL 4NC0B 1RZJC 3L7EA 4L8SA 3VXSB 2ADIB 4P4KD 3EYUL 2J4WL 2V5TA 1VFUA 4ZUTA 2VNCA 4PJGE 4WWKC 3KS0H 1MJUL 2XZCL 4Q74A 5BW7C 3GNMH 1EBAA 4ZO9A 3JWOH 4XVTH 1RPQA 1CIDA 3UTQB 4KK8C 3MBXH 1FL5A 3ARFC 2Z0BA 3QJFB 1J1XH 5E0QA 4AIZA 2AV1B 1ZHBA 2Y5TB 1CGYA 3NABL 1WEJL 1J9CT 4LVHB 3GSNA 1IL1A 3EGSB 2O5ZL 5I1CL 3VMOA 4EI6B 2A0LD 3OXRB 1OT2A 1S9YA 5IOPA 1S7WB 1GC1C 3RPIA 2OK0L 2HH0L 2D7TH 1MUJB 1EFXD 2UZIL 2H1PH 2B0SH 1FJ1B 3AREB 2VXUL 1YMME 2IPTL 4P0DA 2E5EA 1P1ZB 4EI5C 3CH8A 4W4OA 4JFYA 3BWUC 3AROA 2BVQA 3QQ9C 1OGTA 3RWDB 4L3AA 5C08D 3D6GA 4HWBA 3QUZD 1YDPA 1NKOA 3DO7B 3IGAB 3KJ4B 1S7RA 2KUTA 5E6ID 3O81A 3TF7C 4KY1H 1A7PL 1QSFE 4RGMC 1KCSH 1CI5A 3MUY1 5DDHB 3FO0L 3G5ZB 1K4CB 3I02A 4JHBA 3IB4A 2R9HD 2B39A 3MXWH 2AI0L 4FS0A 4U6TA 3WEXA 3QUXD 1TJGL 3CDCA 1HZHL 3ORJA 1PZ5B 4Z0XB 3JV4A 3PGCA 2J88L 1Z9SA 4NRZB 1GZQB 2FEEI 4LNVA 4F7CB 4M7LL 3KPSE 2X4UB 4LLAA 3MRIB 3MLSL 5I6XB 1I85C 4J3VA 5IGXH 2O5YL 2BHZA 5EO9B 2LQRA 4KKLC 1N0LA 5FYJL 5MENA 4PJBF 4LP4A 1FN4B 3EYUH 1JP5A 4AJ0A 3E3QE 1OP3H 2J4WH 3MREA 4WI6A 1I8MA 3GSOA 1WCQA 1G7QB 1AXTL 1MJUH 4LSVL 3NBNA 3SKJL 1T0PB 1LDPH 3OKOB 3QDME 4FXLA 5ID1A 3TC9A 5KVDH 4FP8L 1EV2E 4RGNE 3WFDL 4C59B 1S5HA 2CDGA 2HYMA 1YPZB 1KSRA 5KG9B 4QRRB 3ZDXE 2QQKH 3N1MC 3NABH 3D0VA 2GY5A 1WEJH 5F7LB 2F54E 5L2KE 5E2VL 1DCLA 3PHOB 4PRHD 4J3UA 3V7MA 2VE6A 3TIDA 2XICA 3SQOH 5D2NA 4XVUC 2OK0H 1KLGA 5C0RH 5ACLA 1MI5D 2C4XA 3VFNB 1EBPA 2UZIH 1YJDC 1VKXA 4IOFD 2VXUH 1QLRA 4PLOB 2EH7H 3BH8A 4MSWA 5SX4H 1JYXA 1JGEA 3LAFA 3O9WB 2OBGA 4M61A 4ZFOB 3RWIB 4IRJA 1J11A 2A2QT 1IZKA 4G43B 3BGFC 4UMGA 1FVEB 1VEPA 2VL5B 5I1IH 4PGBA 4QT5B 1V3LA 2N4IA 2HJLB 4G8GD 1A7PH 4EEEA 2BNQA 5HVHB 5GZND 4XCEA 3FO0H 1E4XI 4R0LA 4X7CC 5JIKA 1GOHA 1UVQA 5C9KA 3U48A 4QGTA 2AI0H 3L6FB 3KPQB 5F96H 5F7NC 1HZHH 4ZQKB 4WUUE 1RHHA 5FGBC 4KJWC 5C6WH 4GFTB 1OAYL 3HNVH 1F4YL 3FB5B 1HHGB 4X80L 1T0NB 2DL9A 4M7LH 5GS2D 4PJDE 3JXAA 4GH7B 4NO5B 4O51A 1C5CL 3MLSH 4YXKH 1BBJA 3WLBB 3VFPA 1H3TA 2O5YH 3FQUB 1F02I 3MRJA 4U1JA 2JK5A 2I5YL 2A6KB 4Y2OA 1T1WA 5EOTA 5FYJH 5EU5A 5GPRA 2YSSA 4NQEE 1PJ9A 3N1PC 2CJUL 5I1AB 3MGOA 4W6XB 4U6XA 3IXAB 1AKJB 4JN2B 1UB6A 3EZJB 4FP8H 2LABA 1A64A 2JELL 3M17A 3WFDH 4CNIB 2D9QB 5GRYA 2MFNA 1PFCA 1N6QL 2Q8BL 1X7QB 3D85D 5C86A 1MCWM 4U7KA 2DYPA 3C8HA 1X5AA 1WWCA 5JQ6L 3TPUB 1GGIL 4D0CA 3O3UN 1T66C 4WHCA 2LTQC 2AJZB 4Z7VB 1AC0A 2V7NA 5ALCL