5DHVB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 25
structure length 110
sequence length 110
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvB00
1NBYA 5FGRA 2IBZX 3P9LA 2XKSA 2X89A 3ARFA 4N0FA 1XCTA 4K9EC 3VXSB 1FQ9C 3HAEA 3KYNB 4R90L 5EU6A 5GS0D 4L9LC 1HHGA 4MJ5B 2AJ3B 3TBTB 1FRGH 5GS0L 3HPLB 3EOAA 5CZXD 5IB4B 4FG6C 4HX1B 2ZCHH 1KCVL 2FJGB 1TIUA 1RQ5A 4ENED 4GS7C 3FZUD 3RVXC 2JJSC 4PBVC 1FORL 4PYGA 1JPFB 3QDGD 4U4BA 3UX9B 4OCSL 4OZGB 1LDPH 2YD4A 5TPWL 2YSSA 1HZHH 1X6NA 4P57B 3M1BB 3RDTB 2HN7B 5BVPL 2GTWA 1HXYB 4Q9RH 4P23A 4I18B 1SBSL 1GZPB 4MDIA 3OPZH 4CN6A 3QULA 3U7YH 5SWZE 2EC8A 4TTDC 3DSFL 2XZAL 3WIIL 2LE9A 3OGCB 1R0AL 1KTLB 3CU1A 3ZDYE 4QOKA 1S9WB 2AJUL 1N5AB 2VH5H 2XWJB 4LLVA 4POZC 5GGSA 1S7VB 4TUOB 4MJ2A 3H3KA 5GRUL 3JBG7 3FO1B 4UBDC 1F4WH 2VDMH 3PWJB 4WW2A 3A6OA 2JK5A 2N56A 4GW1A 3X3GH 1M71B 4WTZG 5TDOA 5DURB 2EE2A 3BGAA 4B0MM 3U83A 3SY0A 1KXTB 2LU3A 3MLRL 1HK6A 1YMHB 4PJ7B 1R5VA 3WE6B 2YK1L 1MJUH 1K85A 3L1OL 4JFXA 5A16B 3EO1B 3BFOA 4KTEL 3V4UH 5FM5O 4KGJA 5BV7H 2EXWC 1TQCB 3L3IA 3Q2CA 3IDNB 5LXGH 3MA9L 5CJXA 3O2DA 4HS8L 2X4NB 5IB3B 3DROB 3QCUH 3RU8H 1I8LC 2O5XH 1URLA 1HWGB 1CFVL 5CP7A 4XWGH 1FJ1B 4JG1L 1NGZB 3UP1A 3CSBA 5IMLA 2NW2A 4I3RL 1JV5B 3CFDA 5HHPB 2UY7A 4HEME 3TJHC 1UKTA 2ORBH 3KXFA 1MJ7L 1FVCA 2PTTA 4HC1L 4PY7B 2XG5A 2EEBA 4NRXA 4X6CA 1AO7D 4U1KB 4Z5RA 1MHHA 3NIDF 4JPKH 4NQED 1JYVA 3DUUB 2KDGA 5CEZH 3UYOD 5C7XH 3VXSD 4MA1B 4LPCA 1BZ9A 3CCHB 1GVIA 2L7UA 5D2LB 4ZYKB 3QFJD 5FM4A 1LO3L 4OI9A 4JLRA 4M7LT 4JO4L 2ADJA 4XVSH 3RVVD 1NGPH 3HG1A 3EJYD 1J7VR 2PW1B 3Q3GB 4Z95H 4JRWA 3MRIA 5ESAB 4DZ8A 3B6SA 3V6OC 1OAUH 5KW9L 4K8RH 1JNNL 4Y16A 3K4AA 5DVLA 4IBLT 1AIFA 2JJTA 3GRWA 4NFCA 4QHNA 4N0CC 5ADOL 1FVDA 1AQKH 5E6ID 2XOTA 1MRFL 3MCKB 1DANU 2D7TL 4GBXA 1E4XI 1IGYA 1UCBH 4L1DA 4FA8A 2PW2B 3W5NA 1Q72L 4WU5B 5ESVA 5CP3A 5ALBH 1KCSL 2X4OB 1QTYT 3TWCH 4WHTB 5BV7C 5IHZB 2VERN 1QVOA 2NQCA 5KANI 1MFEL 4GRWF 5CD5D 4LLMA 4WEMB 2VAAA 1G7PA 1T1ZA 3V6BR 3O4LD 1X3DA 2QQNH 3HFML 5BXFB 2GSIB 4M1GH 4U6VL 5CIPB 3LQZA 2IQAB 5B3JF 1MVUA 4P2OA 1YA5A 4AM0B 3C60A 3VXRB 3B2VL 4LSDA 4K7FA 2XNAA 2XRAL 1KEGL 2XKUA 5EBGA 4UAOB 5I8CA 1N6QH 5CUSL 5D6CB 5IVZA 3V95A 5DJ8B 5J13B 2SEBA 4F9LA 2BSED 3OJDA 5JOFA 2LQRA 3QRGL 1P4IH 3KXFE 1P7HL 4KJPC 1MRDL 5JZ7D 1HHIA 3I6LD 3F7VA 5IJKA 1OD7A 3MLSH 3BP5B 2HT2C 4HUUA 1JNJA 3QH3B 4IHOA 1RFDH 5C0DA 2ATKA 3TLRA 4L8DB 4K8RC 1ZMYA 4WU7A 4X5WA 2EDJA 1KULA 3HG1E 1NSNL 3D87B 4EI6B 5DTFB 3NCEB 3KPSB 1E6OH 4OFIA 5J3HD 3VXMD 2EDYA 4HIIB 2X70B 3MV7A 4PRBB 3GFUA 1RULL 3PWNB 3LDBC 1TQBB 5EZOL 1FFNB 1INEH 4OSUL 4WJ5B 1OTSC 1T0MA 1KG0A 5IT2L 4PJBA 1A7BA 2WSKA 4OUUB 4U7KA 3ZL4L 1WAAA 4QT5B 4HKJB 5D2NB 3IJSA 4LDEB 2H2PD 1L0XA 4D0DB 2HFTA 3FOMA 3WXWH 3VD3A 5IVNA 5JDSB 4Y8AA 5EU5B 5J06A 5FAAA 1ZANL 3GNMH 2BSRB 5C0BB 5D7JC 4PJGB 5IVXB 2HTKD 2NNAB 1CN4A 2R0ZH 2R15A 2WUBH 4G3YH 5H35B 3C2AH 2UZXB 1ACYH 1CFBA 2XWTA 1V05A 3FFCA 3IF1A 2Z92A 1A1OB 4R4ND 5TH2B 1Q9OB 3QFDA 4RDQF 2WIIB 2KUTA 3GSVB 2YWYA 1DL7L 5IOPA 3NIDE 5KZCD 2NY2B 4P3DA 5C86A 1BFTA 3FB6B 5ABDE 4JFHD 2EC9T 2A9MH 2OJEA 3QUZC 3VXOB 4FQXB 5D7SH 2E5EA 5TQ2H 4PJGF 4W6YB 5IVXF 5F1IA 2CH8A 1B4RA 3ARBA 3MV8B 3GEWB 3LQAL 4DN4L 5EA0L 4PRIB 4U1MB 4A6YB 5C1MB 2NXYC 2R1YA 2DM4A 4GAYA 3ZKQD 1LE9A 1E4XL 2CR3A 5D7LA 3LN9A 1I7ZA 4KH2A 5HY9B 5JXEC 3WJLA 3FO0H 2DJSA 3ORJA 3WS3A 4GG6B 4OZFA 4YPGB 1VSCA 5CWSA 1OGAA 1BQUA 2Y4SA 4XCEA 1ORQA 5GRVL 1NKRA 4M93B 2PYED 4YE4L 4V1DE 4YK4C 3ME0A 5A3ID 3E2HB 5KJRH 2L0DA 1KLGA 1R3KB 1U3HA 3TO4C 4E5XB 5EOTB 1XR9B 3Q5OA 1K8IB 4ORZC 1LGVA 3WIHL 4P48A 4KPHL 2CJUL 4GRWE 4EN3B 3O0RL 2C4FU 1F4XH 2XG4A 1CIDA 4Y1AB 2BNUA 1RUAH 2W0LA 5IW3A 1CIUA 3IFPB 4XNYL 4TVPD 2R4SH 1OPGL 3VWKD 5E08H 1BQHA 2R1WB 3LEYL 4IRJC 1K6QL 2Q7YA 2WM0A 3IB4A 4TVPL 5B3JE 1YMMD 3OX8A 1NGWA 4MSWB 1A7NH 3V0WL 1VFBB 5I18L 2FD6H 1M4KA 3N85L 3DXAA 4G8GB 2WBJA 4RX4A 1A1NA 1SEQL 3FQNB 3OXRB 4JFOA 1UWEL 1KENL 3QHZH 3OB0K 3FFCE 3HLAB 4I0PC 2AXGA 2EYRB 2NYYD 5D1XB 1YN7A 2GUOB 1TZIA 1FBIH 3QEHA 2C1PA 3SOBL 5E9DE 1TVBB 3D5OF 2LVEA 4UU9B 3TNNB 1OWWA 5DJAA 1NFDB 1JE6A 2OTUB 2LAGB 2XN9A 4LSUL 3H3BC 3U0WH 2DQHH 5EFIA 1YPZB 3JUZA 4X0KB 3VXUB 4BQCA 3ZKSD 1EH9A 5HPMB 1KC5L 4WW1A 2PCPA 3MLZL 4KVNH 1MLCB 2DQGH 2VSDA 5IFHL 5J6GB 5GIRB 1DBJL 5H94B 4HHAB 2EDRA 4ZFGL 2BRRL 3VGAB 3PF2A 2F58H 7FABL 4NQDB 1NCWL 2Z31D 4Y89A 4P5TA 4Y2DD 5F9AC 2R2HB 3GIVA 1HYRC 2R0WL 5J8OA 4Q9BA 3IRZA 1BBDH 2YBRB 3BN9D 4FQXD 3D85D 1TENA 1OGAE 2C3VB 5GRJH 1ZT1A 1FGNL 1FLRL 3U7AA 1EJOH 1CBVH 4TUJB 4UDTA 3CH1B 3TIDA 1SEBA 4APQA 5L7XH 3D69B 3MUJA 4CDGC 2B1HH 1GIGH 4M6NH 3QSKB 1NGYA 4I2XA 5FV1L 3GSXB 5B4MC 2R56L 2X4TB 2ZUQC 4XZUB 4MAUH 2NTSP 2A73A 2GEEA 4JREC 2IADA 1BOGA 2X1QA 4M6OL 3SDDC 2OL3A 1H8OA 4QTIL 4NNPH 4JO2L 4ZSOB 4HD9A 4UDUB 1P84J 3R8QA 3TVMD 3QI9B 2FATH 5A2LH 5DEGA 4WV1A 4PUBH 3L3KA 1KTDA 5TF1L 5MHSE 3BZFA 3ZT7A 2HTLD 3F7YB 1YQVL 2X4QB 4M6ML 2VDOH 1UXSA 3BESR 4WUUA 2HT4C 5DRWB 1E28B 1F8TH 2BX5A 4QRUB 1F42A 2VXQL 2FNBA 1VACB 4Y1AD 5HDBF 2YPKB 3FB5B 4KHTH 3T4AB 1JF1B 1KCUH 4PJGE 5IVXE 3S34H 1KF9B 1CLYL 4AJ0A 1C5BL 3VG9C 1C5DB 2F74B 1V3JA 4LCCB 4LSVH 3KPQB 3L7EA 5F88B 1SY6A 4E41B 4W4OA 3MXWL 1ZT7B 3CFCL 4ZQKA 2FB4H 5FO7B 3QDJE 1L4IA 1HEZB 1S7TB 3KLAB 3DUHA 4CW1B 4CVZA 4KKBC 1EV2E 2YPLB 1W0VB 2W38A 5IF0A 5T3XE 3DX8B 4PJEB 1EX0A 3MV9A 3T8XA 5EO0A 4KKAD 1P2CB 4LPWA 1BVLA 3MOBL 5E2TL 4XHJC 1KT2A 1FZKA 2VZOA 4X9FA 1SHMA 2O5XL 4MNGE 4E0RB 4X99B 3ISWA 1UGNA 3RL1B 1KFAL 1OTUD 1BREA 1VDGA 1SJHB 3IDXL 2EO9A 2EDEA 2ZJSH 4KI5C 5FGBA 4XBEL 4M8QB 1N2RB 1A4KB 1G6RA 1D5ZB 4WI6A 1MH5A 4TULL 1R3JA 3H6JA 1DQJA 4PGBB 3TH4T 5JXAH 4XNQA 1G0DA 2VABA 5DYOB 1WITA 4M1DL 1JF5A 4HPOL 2XFXA 5C9JA 4YGVB 1AD0B 4E42A 4LHUB 1YYMH 3EDFA 3H7BA 4NQSA 5GRWA 1F3RB 3MODL 3BZ4A 3HMWH 4JY6A 4Y5VB 3OKKB 4C4KT 2Y7QB 3P11H 4L29A 4Z95L 5AD0A 2W9LA 3MFFB 32C2B 5F21B 3PIQB 2E7LC 1PQZB 4YHMH 3K8KA 2OSLB 4NUGH 5AWNH 3FOLA 2E27L 5E5MB 3EOBA 3QJHA 5DO2C 3VU2A 1NBZA 4NKIH 4WUUE 2FZ3B 1EK3A 5HGAB 5D4QA 1Q9WB 3LSOB 3Q6GL 3LN5A 3M45A 2YD6A 3QI9D 5F7WC 4PJ8D 4LOUC 1P4BH 4RWHA 5T33L 3IDGB 1QA9B 2V7NA 5DRZA 2R1XB 2CUMA 3MQIA 4KQ4H 2DLEA 4AZ8A 4QHKJ 1JGEB 4X4ZA 4RDQG 2P24B 3HS0B 1SM3H 3O3AA 2MQ0A 3QIUB 3OQ3B 5T3ZD 4K2UL 2DLFH 4YQXH 4Z7VF 1I8IB 1AHWA 2A0LD 5T3ZL 2ZUTA 3WFHA 3WJJC 3MV9E 3VE0B 2XWBB 4AMKH 1IGJA 3S35X 1A7RH 4R7NA 1TJHL 4JG0L 5AUMB 4GMSL 5BS0D 3IU3B 4JFFA 1DEEB 4JFDB 2OTPA 4ODHL 4HS6A 2BJML 5L8LB 1IAKA 3BP6B 1IC4H 2ZOKA 2BSTB 3ZHDA 1H15B 3ARDB 1EAPB 5BO1H 1I1YA 2YPLD 4LMQE 4F7TA 2VYRE 3DGCR 35C8L 4IMLA 3T1FA 2ADIA 3DHMA 1FNLA 1NCTA 5DJ6B 1SVCP 1JNHB 4CJ1A 4FXGA 4GW5A 1PG7L 1F4AA 5E56A 2IH3A 1XFPA 3MV11 3ESUF 1IBGL 4DJMA 1NC2B 2EEDA 2YD2A 1L9NA 1RZGB 4PGDB 3QWOB 3X17A 3QUXA 4OCRH 4PLJC 5HDBE 5L6YH 1HIMH 3KPRE 3G6AA 1JF6A 5HYSB 4N5UA 1ACZA 3TH2T 5E8OA 4LHUD 2F53A 3AM8A 3RWCB 1QFWH 3U4EB 1I1AA 4HH8A 3GMNB 1UM5L 1XGYL 2XQBL 3K2UL 4H26B 4Z8FL 5C2UB 1C12B 3PDGA 3G9AB 3MOAL 3RWHA 3TIEA 3BVNB 5AG8A 4MJ6A 2X1WL 4YR6B 2NX5A 3FO2A 2YZ1A 1S7RB 3REVB 4Z7VA 3CDYA 4Q6IB 1U8JA 1WSST 3TA3A 1Y0LB 4HQQL 1X5JA 4WI7A 3PWUB 5I1CL 4NOFA 4JY4B 3B9AA 3DV6A 5DJYA 1XF4A 4ELKA 4UB0H 2NLJB 5HI4C 5SWQA 3BZEA 1UZ6F 3O6KL 2WLZA 5C0CE 4RGNC 3QWRD 4XMKH 5GISL 3SCMC 5DLMH 3RX8A 5DJ0B 5IHUH 1UM6L 4X4MA 4UIMB 3TT1H 5K9OB 3MJ7A 3TNMB 3PV6B 1PZ5A 4HUVA 5CEXA 3RI5K 5GS1C 1CK0H 1DE4A 3QG6A 2DQDL 4H8WL 5ANMA 2Y06L 4M3KB 5F7UA 1IZKA 4B7LA 4TOYL 3NCJH 1XGQB 2W9EH 3KJ6L 5LGJB 4O4YH 3QQ9C 4M48H 4G8FB 3OKYA 4YHZL 3MRNA 1PZUB 1A5FH 4ZXBC 1QFOA 3LKQB 4KK5C 4LRNL 3LEXB 5IROC 5HHVL 1W0WB 3CX2A 2VISB 1EBAA 5CD3B 2DD8H 3VCLA 3TBVB 2JJUA 3MLTB 3SGJC 3WXVL 3ARDD 4NNXB 3W81A 3E1F1 1EEQA 4NFBA 4DZBB 2RR3A 3WD5H 4WFGD 4UV4L 2NY0B 3FAWA 3B3IB 4DGVH 4JRXD 1A6ZB 4V2CB 3O45A 5IBLD 5E7BA 1IT9H 1D5BB 4GSDH 1ED3B 2UWEB 3P4MA 4LKXB 4YBQD 4G6KL 1U8MA 1UCTA 1YN6B 5EIIA 2FR4B 3HMXL 3WFBL 1NC2D 3ZT5A 3EAKA 4K94L 1EUUA 4J3VA 1FZJB 2W0KA 1VGKB 3ZO0A 4X7EC 3OKEA 5ID1A 4PJAF 4Z7VE 2AW2A 3MRFB 4NBXB 2HVKB 2ADFH 5L2JA 3BWAA 5IIEA 1IKFH 3AREB 1OY3B 3WKMH 1EMTH 5GGRA 3WNMA 5C0AA 3UJJL 4Q97A 3ULUF 4WWID 3D25B 1Z5LA 1TFHA 1ZXQA 2DL9A 3F12A 1ZVYA 3BQUC 1JGDA 4OLZH 2IPKB 2R2EA 1P9MA 4YXLH 1NCNA 1Q1JH 2YKLH 4QRPD 3KS0J 3O3BB 3WUWA 1X5IA 4HGWB 1G7HB 3VFTB 3I2CL 3WYRA 4H0HB 4YC2B 5A2JH 2ADGB 3KYAA 4LSQH 4X8XA 4JFPA 4S1DD 5A2IH 3TT3H 4PBWD 5C0EA 1X5YA 2DMCA 5D70H 5L88H 3VDAA 4NM4L 1T7VA 5CJOH 4QRRB 3ZDXF 2FIKB 1MCCA 4RA3A 3GB7A 4RGMB 2AP2A 4JFDE 1WCBA 1BHGA 2VZSA 4JY5L 2DIAA 2DQGL 5BMFL 5JR1H 2AJYL 3RZCA 3W0WB 1NBVL 1LO5A 5FUCC 1LO0L 1GCFA 5JHLH 2F5AH 2AJSH 2B20A 3MGTB 4WI4A 4NKDB 4L8CB 4U1LB 3AGVA 3ILPB 5A43C 1MJJA 4GRLD 3SKUD 3I6KB 2VNCA 3FHQA 1QZ1A 1X5LA 4RBPK 3WFDH 3BD5A 3GBNH 5GSRB 2H32B 4WY7H 3MJ9A 2H2SD 2H3NA 12E8L 3RP1A 3OAUL 3RGVA 3AMLA 2UYLA 1KJ2A 2VQ1B 4QYOB 1NCBH 3RDTC 3O6LH 3F62A 4I18C 4PJAA 5CJBA 4OTXH 1CDYA 4XTRD 3MO1B 2Q8AL 5DHXB 5JIPA 4ONGL 4GAGL 2JCCB 5DI8A 4KRPB 2OQJB 4Q0XL 1G9EA 1RU9H 3OJ2C 4X8JA 1EAJA 1QRNB 2FSEB 4P2RA 3V6FB 1UZ6E 2ZG1A 3RIAF 4MVBD 1A3LH 1GZQA 1KOAA 4ZG1A 2F8OA 4LHUG 2WUCL 1BBJA 2X41A 4JQIL 2RHEA 1J11A 1LNUB 5I17B 43CAB 2R8SL 3VGBA 4R4FH 1EEYB 1KPVB 1MLBA 2GT9B 1HOCB 1CG9B 2VDLL 3RPIB 1CFQA 2VKWA 3OXSB 1PG7X 3T1WA 2AABH 2CKBB 4C56B 4Z77B 2X05A 2P7TB 3STZA 4WUKH 4KK6C 3RIAK 2PXYA 4NP4L 2CDGB 2NMSA 2JE8A 3ARED 4J1UB 5J1AA 5JZ7C 1T5WA 1VGEL 3ARZA 5FDWB 1TJIH 3GHBH 1DP0A 1TQCC 1I9JH 1NBYB 1X5KA 2V2WA 3KVQA 3P9LB 5IEHA 2APXA 3ARFB 3EFDH 3QCTH 3MZGB 4N0FB 3SO3C 5LWYH 2Q20A 4NC0B 4ONFH 4ZD3L 5EU6B 1QFWI 1HHGB 1J12A 1BLNA 1G1CA 3VG0L 3E6FB 5ICXA 3EOAB 5C71A 1IC1A 1Z3GH 4NGHL 5C0FA 3VGHA 3DIFA 3MROB 2Y5TB 5FYKE 3ARGA 1INQA 3H42H 4MA1C 1FGVH 4MXWH 4NCDA 2AQ3A 4XP5H 1MPAH 1U41A 3H0TB 1JIBA 5FUZL 3BE1H 4ZOEA 2A77H 5D1ZB 1FPTH 1X6LA 4PJAE 3LS4L 3HE7B 4MDIB 4G8EA 1CDGA 3QULB 2QV2A 2V5MA 4L3CB 5D72H 5FKAA 1I1RA 3VFUA 4Q9CA 5FHAL 1VKXA 4JO1L 2ITDB 2BDNL 5TFSH 4QOKB 1N7MH 1YY9C 3GJFA 1P84K 1LE5A 1EO5A 4X6EA 4LLVB 4Y4FC 5GGSB 1TNNA 3QEQD 1V7MH 2N4IA 4IOFD 4LVNB 4YHML 2V2TB 1FNEA 1U3JA 5D7IF 1FZOA 1N3NB 3F7RA 4KJQD 3U48A 5I30H 4GW1B 3P2TA 1HHJB 4C57C 5SWZD 1XGPA 2VUOA 3B9EA 3FT3B 3TGXA 5EOCH 3SY0B 4N8PA 2J6EL 2CLZB 1P4LA 2F5BH 3ULSB 3ZDXE 4UIKL 2AJZB 4L4VA 4YHLL 4OF7A 3BRFA 3CFKA 4KVCH 4GXUN 4HK3N 3V5HB 1KB5L 4LCWD 2QQKL 5F7YC 3CZJA 2H41A 3EYOB 4UAOC 4Q9QH 1CF8L 1AC6A 3AXLA 5A40E 4TPRL 5J13C 4HIEB 3KLHC 5DD1H 2APTA 2DJUA 2NW2B 2AEPH 3CFDB 1WC7B 1P1ZA 4H1LB 1FVCB 2PTTB 4LEXH 3QXTA 3RJDA 4WNQB 3SE3A 4X6CB 3C5ZB 2APBA 3MRQB 3RWJA 1MHHB 5T3XH 1X7QA 2W0PA 1ZLSL 1U93A 1QPXA 1L6ZA 2X89D 3W0WE 4M61A 1WBYB 5I1JH 1X5FA 5EU6D 1T2QH 1E4WH 4XCNA 1N5YH 5TE4L 1DVFB 4IRSA 3DOSA 4MQ7A 2R9HC 4YDLB 4J3WA 3MYZA 2XZQL 3OB0H 3D9AL 4H20H 4A6YH 3MGOA 1BQLL 1JPSL 1J86A 4K3EL 3T0VA 1CLZL 5IESH 4LF3B 3MRIB 3DNKA 3H9YA 5LBSH 2GK0A 1F4YH 1TCMA 2FL5A 4WEBL 3EYQC 2I9TB 4TSBH 5D7IA 5DRXA 2UZYB 1AIFB 4QHNB 4RMQA 1FVDB 5HHQA 3GMOA 5EU4B 4LARL 5DZLA 3S97C 4P23D 4O5LH 4MB4A 4LPVA 3ZLQC 1IGYB 2I5YL 5D2NC 2FWOA 4LLQA 2YPVL 3GBMH 3DVNA 4OD1L 1NANH 3WNKA 3QNYA 4QOKD 2KPNA 4PG2C 3T2PA 4KK9C 5J9PB 2DQUH 4LGSB 3CFBB 1DQDL 1V5JA 4U1NB 3MR9A 4L4VE 4BJLA 4EXPX 1HH9A 1C08B 2X4RB 3LS5H 2PF6A 4U1JA 2VLJA 2RBLA 1HNGA 3GBLA 3V79C 3LQZB 3OAZK 1MVUB 4JM2A 5D9SA 3BIKA 5F89B 2V7HA 3S3SA 2IJ0C 3TJEH 5IM7A 4YHPB 5IVZB 2NY2C 4XX1E 1NGXB 4M5YH 2FEDC 4D2NA 4O2CA 4DOHB 3LB6C 4LLWB 3PHSA 4FFVC 5JOFB 4HIJA 2DQFA 3U0TA 4Y5XA 4CADA 1JHLH 4XPTL 1L6XA 2XTLA 4YHKH 3ULVH 4KDTC 3F7VB 5CBAA 2FYYB 3QHTC 4JM4H 1Y18A 2Z93B 4LASL 4MD0A 3BXNA 1K5NB 2HFFB 4PB0L 3O3EA 3O2DL 4BKLA 1K8DA 5K9QG 3E3QE 3FCTA 5GHWH 2DQJH 3P0YH 2FO4A 4F7PA 5F3HA 3T0EB 4PFEA 3L9RA 2AERT 4RMUA 2ICEA 1CICC 1NLDL 4OGZA 3KXFD 5F6HJ 3IFNL 3V9FA 2V2XA 5DQ9B 1K3IA 4Y4KA 2MPAL 5BZWB 1P7KB 1LEKA 4BFIA 2DKSA 3GI9L 4M93C 1AR2A 3MV7B 5D7IE 2IFFH 1MCRA 5C8JA 4H0IA 4OZIA 4FMFA 2ZCKH 3NH7L 4X7SL 1T6WA 3E2HC 4PRHA 5GJTH 2YUVA 2CK0L 1RZFH 3CU7A 3GKWH 1KG0B 4LBEA 1QLRA 2FHFA 4PJBB 3NZ8A 3HG1D 4H25B 1JZ8A 4FQIH 4EN3C 1M05A 1J5OH 3QR2A 3W9EA 3BKJL 4H88L 1E27A 2ARJQ 3FOMB 2DTSA 3BYTA 3C6LA 4Y16D 4F37F 4WENB 1JHKL 4MHHI 4O2FA 3IKCB 3QQNA 2YD5A 5KVGH 4ZO8A 3GRWL 4QTHA 2GK2A 2NY7L 4R0LB 2A38A 4C4KO 4U1IB 4GBXD 1JI1A 1RIVL 3RVUC 1AH1A 3IAPA 2EYSB 3G08A 3QFDB 3PQYA 2ZUSA 5D1XC 4XP6L 3ULVC 4PRAB 43C9B 4P2QE 5EUOA 4G5ZH 4PLOB 1MCWW 4K3HA 1BX2A 4P3DB 4YEFA 3ARVA 3ETBF 4F37K 2HWZL 1DBBH 3IDMB 3BT2H 4NJAH 5HGHA 1IEBB 4XPAL 5TQ0L 4PJ9A 4P2OD 5F1IB 3ARBB 3C60D 3L7FA 4ZFZB 4CBPA 5B8CA 1B6UA 1TETH 3REWB 1U95A 4N68A 4NPYA 2C7UB 4NZUH 2R1YB 5GGTH 1MRCH 4LKCA 3VGAC 2G60H 4GAYB 4JN2A 1LE9B 4HZLB 5D7LB 1X5ZA 1RJZB 2CUIA 4GAJH 2E8YA 3WS3B 3RVWC 4OFVA 1S78D 4RFOL 3N50A 5CWSB 4XRCA 4HWEH 4HK0A 1ORQB 4MXQC 4KMQA 1P69B 3VXQA 4QLRA 2VLKA 5EU7E 5ADPL 2VZ1A 1LEGB 4ALAL 1JZ5A 1IEAA 3RNKA 4QHMA 4LAQH 1NC4A 1GH7A 1KEML 4I9WE 4M00A 1ULVA 1IJ9A 4XC3H 4D0BA 2BK8A 4RIRA 2Q76B 3SBWA 3QPQD 4HULB 4JO3H 5E8EB 4PGEA 4XH2A 1MIMH 1UQSA 2BNUB 1T89C 4LCIL 1XAUA 4WTWA 2NY6B 2HKFL 3CJJA 4Y4HC 4NDMB 3MV7D 4XXCC 2AXHA 2ATPB 1ZVHA 4URTB 4XPHL 1NGWB 4KKLD 2F54E 3FONA 3GSNH 3SDXB 2IAMA 5C6WH 1GPOL 3DXAB 4MLSA 2IANE 4F58L 2Q86B 2AQ1A 1B88A 2E3VA 2I60H 5A2KH 4BH8A 3SDAA 4LFHD 5IK3A 1DLHB 3KPLA 1S9YB 1MSPA 4YFEA 1TZIB 4N0UA 1DSFL 4LCCC 1I7RB 3LKOA 3QBTB 1OAKH 2B7DT 5DUPH 2HJLB 3B8SA 1FNGA 2XN9B 1IAIM 5E99L 4UMGA 1C7TA 5J11B 3HZYB 1GL4B 3FFCD 4WW1B 2PCPB 5I8OH 2BHZA 2QSVA 2J88L 1N8ZA 1S9XA 1H3GA 5DD0L 4DOHE 4QXWA 3JV5A 3HI1A 4JDZB 2VUYA 4PD4K 4R2GB 3CLFL 4FQQB 4P5TB 5DQDH 3SKOA 1RZ7H 3IDJB 4PJHB 5C08B 4LVOC 1N64L 5CKGA 4KHXL 3ZYJA 5E2UL 4HT1H 4I3SL 5F1KC 1ZT1B 3GMMA 4M5ZL 3VXNB 3MREB 2B1AH 4UDTB 4Y88A 1SEBB 3T0EE 2JB5L 3D39A 1PG7W 3N9GH 1WWCA 4DUVA 1F90H 3FTGB 4NO2A 3GMRA 4M43L 4I2XB 1QBLH 2LVCA 4N1HB 5D7LD 3SGDI 1RIUH 4DGYL 1FDLH 2A73B 4NZTL 1OLZA 4H1LG 4O58L 1OGAD 4Y5VC 2OL3B 2H6PA 1XF3A 3DX6A 1GAFL 4HF5H 5I76B 3JWOH 3UTTA 1P7QD 4JRYA 4ZAKA 1FE8L 1I3GH 5DEGB 2X1XR 1LK2A 3MLXH 1CDBA 3BZFB 5IW6B 4N9GA 5TE7H 1U3HD 4Z76B 3IJHA 3KPMA 4O51B 1FFRA 1VEMA 5FOJA 4NWTH 5DT1H 4EOWH 3GM8A 3V0VA 2C5DC 1AKJB 4FQPA 4XPBH 3HI5L 1F6AA 4AT6B 5HYIA 4GJTB 4N0UE 4PJIF 4FZ8L 5MENE 5CJQL 1RIHH 5MHSD 3WS6A 2VZ3A 3L7EB 3TFKC 3LPFA 4LMQI 4UOW1 1PEZA 3BAEH 4OLYL 4ZQKB 1D6EB 2WBJD 4RX4D 3L5WB 4YHNB 2P5EA 4FNLH 5HHOB 2VXUL 3QIUC 1A9BA 2Y6SC 1CXIA 4R3SA 3HUJF 2P46B 2AK1H 3JVGC 3CFIC 1FIGH 2D7QA 4ZUVB 1BVLB 3I84A 1KT2B 1NBQA 4GKZB 1UM4L 3AC0A 3VD9A 1AY1H 1WK0A 5IGXL 3QJFA 3U30B 3QDJD 2NR6C 3QUYA 4L8BA 4ZS6D 5CFHA 1NCCH 4ZUSB 5JNYA 4LQFH 2ED9A 1CVSC 1I3RA 3MYJA 4G42B 1DQJB 4KRNA 4MS8C 3D39E 2VABB 1RI8A 5JPMA 4UT7H 2R29L 3F7QA 4R2GD 3TN0C 3U36A 4U6YB 4KZDL 3EKCA 3JTSB 3O11A 1OP9A 3JWOC 3KYMA 4E42B 3RUGA 4P5TD 3H7BB 3H9SE 1DCLA 4OCYL 4QF1A 3FO9A 1DN2A 2DQIH 1CGTA 3NA4A 3BZ4B 3FN0H 1G9MH 5FYKH 4M7LL 2V9QA 2ICWA 1OWRM 4LRIC 3QDMA 5BVJA 1XCQA 4L29B 3UTTE 4H5SA 4APQD 1N0XL 5KN5A 1G0XA 4PRPA 3QXDB 4ELMB 1MHPL 3SGKA 4X9BA 1OT2A 3TH3T 4BQBA 1N26A 3FOLB 3TYGH 3T65A 4PJIA 3QJHB 3E8UL 2LFGA 1ZT4A 1U8OB 4D8PB 3B9DA 3MRDA 2ILLA 2L4OA 3HI6H 1ADQA 1OAXL 2OL3L 2OMNA 3LN5B 1MFDH 2VR5A 3PXHA 4BK4A 5JLZA 1F58H 4QCIB 1QLFA 3HUJA 3MLVH 4Q6IC 2IH1B 3IFLH 5DRZB 4LPTA 4ISVA 5BCAA 4WUUD 4O2EA 3TO2A 5GGQH 1F02I 3O3AB 3DMMB 3PGDA 3T0XA 3QXAB 4ZUTB 1S3KH 1WTGT 1AHWB 4K71B 1MFBL 3ZHKA 4BSJA 2BC4A 1IGJB 5DHYB 4N1CA 5IVOA 3T0BA 4R7NB 5KSAA 3MLUH 1BWWA 1KACB 2VO5A 3QUKA 2AI0H 3CXDL 4JFFB 2OX5A 1J1OH 2VQUA 3SDCB 1P6AB 3U2SA 1QP1A 2ZKHL 1WICA 1LEIB 1SY6L 3W9DA 3O8XA 4HS6B 2EZ0C 2CDFA 1IAKB 4OQTA 2X7LB 1J8HE 1IM3A 1GGIH 2CLVA 6CGTA 3STLA 1I1YB 4YBHA 4F7TB 5ISZE 1A1MB 3MV9D 1YNTB 1H8NA 1G9MC 1NPUA 3T1FB 2ADIB 2J8UF 1IGTA 3A6CH 2WAHA 4K07A 4LLDB 4Z78A 5FKPB 1QRKA 3KAAA 4KKCC 4NO3B 4UT9H 2AJVH 1I7TA 1FC1A 2IH3B 1QNZH 1OP5H 3H9ZA 5KG9A 3HNTH 1G6RL 4LCUA 3OGOE 1G7LB 1AXSA 5DD6A 3RPKA 4PJDF 2QSCH 1MI5E 1R24B 1YY8B 4PRPE 4OGAC 2NY0C 3UTQA 3G6AB 5CINL 1X5AA 5ERWA 3TPUA 1MWAA 4IDLA 4PJIE 2RCSH 1B0GB 2F53B 3BH9B 5IEKA 1FNSH 2O26U 2F8XC 3N0PB 1MAML 4PR5B 3GKWL 4GLRH 4OGXL 1Z9LA 3IFOA 2E8ZA 1A14H 1ZHNA 3MRMA 4X7CC 8CGTA 4EIZC 4G6AD 4OGYL 5F9WB 3TIEB 1LO2H 1EO8H 4MJ6B 5GXBB 2NX5B 2FJFA 25C8H 2HA1A 4JJ5B 4KROB 5C6TH 2BVOA 2XZCH 3QXVA 3K1KC 2X2YA 2E9JA 5KVFH 4XVTH 1FO0B 5K59F 1XF4B 1HHHA 2DTML 3UPRB 3BKMH 5E4EC 4ESKA 5SWQB 3BZEB 1W72A 4P99A 4OCWH 4LSPL 4NRZB 3KR3H 2A6KB 2CK2A 4FTVA 5HJ3B 1I7UA 2VLRA 4P5KA 1SYSA 3LMJH 1FZMA 2O5ZH 5I1EH 4FQLL 3MJ7B 1VERA 2ICCA 4WHYG 4OD2A 4LLUB 4M03A 3C87A 1PZ5B 2J8UA 3DJ9A 5CEXB 1DE4B 4HCRA 2VDRH 3O6FA 4OAWB 5L8JB 5ANMB 1NUFA 2GQHA 4Z7QF 4D9QD 1KLUB 5L9DL 1HILA 4FRWA 5HDLA 1JFQH 4IRZL 1A6AA 4EDWL 2CKBH 1HINL 3B5TA 4KUZH 1GOHA 4GQ9H 1PYWB 2Q6WB 1V7NL 2KKQA 4MLIA 3BPNB 4MWFA 4JFFD 1PKQB 4Q6YA 2V17L 1J0ZA 2YR3A 3OHXA 3BRGC 1ZS8B 1ZA3A 5BJTA 4KRLB 2Z9TA 4WVRA 4YDKH 4AEHH 3PHQB 4X4XA 2ENYA 3C5JB 4XBPA 3CVIH 1P6FA 1JRHH 2NTFA 5JW4M 4Y19A 5EN2A 2HLAA 1RJYB 3FRUA 3O45B 1GHFH 3PL6A 5DWUH 3IDIA 1MCPL 3K4DA 1FH5H 1ZV5A 3P4MB 4XNZB 5ALCH 4JPIA 1U8MB 4KRPC 4NN7B 5EIIB 3T2NL 3D2UA 2C3XA 3NFPA 3L3GB 3CXHJ 4CNIA 3QUXD 3ZKMD 3OKEB 5ID1B 3DRQB 3RNQA 3RA7L 5GJSL 4F9PA 3FB7B 1CTOA 3BYYA 4M1CC 4P4KB 1RV6X 2F53D 2HFGL 3UJTL 5IIEB 2ITCA 4WI2A 4KMTL 2MTPA 4X9IA 5EPMA 3ZYOA 1Y6MR 4J4PC 1I1AD 4UINL 5JO5A 1Z0MA 2EYTA 4HLZG 3WLWD 3I6GA 3OR7A 3UTPE 4FTVE 4G6MH 4TN9A 3RVTC 4Z0XB 1JGDB 4TSAH 3FQRA 2R2EB 2NX5D 4ZPVB 3U6RA 3WFCL 3GHEL 4GMTH 4KROD 4HWBH 3TA3D 1SVZA 1IGFH 3U9PH 2J8UE 5T5FH 5LJYH 5C0EB 1S7WB 1EZVY 4X83A 5HVHB 1NAMA 4OLXL 3ARFC 3GSQB 3GB7B 3X11B 4X5XB 1WCBB 4JQXA 1XIWC 4W81A 4MJIA 4XAWL 4XNUH 3BI9X 3MACL 4PJDE 5DMKA 3UZEA 2M2DA 5H2BB 2PNDA 4K3DH 1RSFA 2FHBA 1WT5A 3ARXA 1J0YA 3EYUH 2HRPH 5DR5H 4C83B 1MY5A 3QO1B 4XP9H 3SJVE 4H1LH 2H3NB 4I48A 1MVFA 4R8WH 5T1KB 3RTQA 4PY8I 3R8BB 1JK8A 1OTTD 1KJ2B 1PJ9A 5C07A 5E8DH 1CS6A 2FBJH 4KWUA 2E7CA 5D1ZC 3HNSH 4JHAH 3HE7C 2OR9L 4NCC1 3WIFA 3DX9A 5F7DB 2ZPKL 5C3LD 1O7SA 4CAGA 3DGGA 3JWDH 1HQRA 1VFOA 3IETA 4X8JB 2FLBT 2VTFA 1INDH 5BRZA 5K59E 1CLOL 2FRGP 5CILH 4RRPA 1YYLL 1J1PH 1KJ3L 1L9MA 5FYJE 1E6JL 4XCYA 2A6DA 3TBYA 3CZFA 3P9MA 2JJVA 3K1DA 4LVNC 4HS3A 1BBJB 5FHBH 2Q8BL 1KIRA 3G6JB 1EA9C 1ZLWK 4PRDA 1EHLL 3LRHA 2BOCB 4JQVC 4OLEA 4YDIH 5DT1L 4U1HA 4X6FA 4M7JL 1ZLVK 4Z7QE 5HYJB 2C3WA 3GDBA 3NAAH 1EEZA 3PDDA 3HC4L 1ETZA 1PX3A 1B4JH 2LTQB 3S36L 4HBCH 1BF2A 5FFLA 2I27N 2Y36L 5KS9B 5J1AB 1UENA 5JA8B 3D3VE 4NYLB 1OCWH 2DL2A 2F15A 4QRSB 5C0AD 1H3XA 1XEDA 3CAFA 3WO4B 4U05A 2QHLA 2APWA 1NMBH 4PB9L 4TQEH 1OW0C 4MJIE 5ICXB 1N4XH 2PO6C 5FA4A 5KTEH 5L8KB 4GLRI 5DHVA 2EH7L 1NLBL 1XF2A 5DD5H 4NM8H 5C0FB 3JTTB 5D8JL 2GSGA 3C5ZC 4I0CC 1DDHB 1QLEH 1A6TA 4KK8D 2BZDA 1PEWA 4DVBB 4JKPH 1QKZH 3ARGB 4B41A 1OSPH 3QUML 1PKQE 2OYPA 3IAQA 3RZCD 3JWDC 5ITBH 4R26L 5DJ2B 3DX7B 5ICZA 1DVFC 5C07E 3IDYB 4YDLC 5I0ZA 5MP6H 4G8EB 2FECI 1J0HA 5D1QC 2BVEA 5FKAB 3VFUB 3FFDA 4ZTOL 5E8NA 3DO7A 2Q87A 4FFWD 4FQCL 5BRZE 1LD9B 1T66D 1REIA 3GJFB 4DAGL 3MJ9L 4M4PA 4PJFF 5DS8A 3RGVD 3Q48A 3BHBA 4DQOL 3EZ8A 2DOCA 1UJ3A 1KJ2L 1S8DA 4I77H 2YC1A 4ZUWA 4PJCB 4GXUM 1AGBB 1FNEB 2QADB 4HJJL 2A1WL 4Z18A 3U7WH 2IMMA 3PDOA 1FZOB 3LPWA 4UTAL 2MCPL 3PJSA 1T0NA 1XGPB 4Y0GA 3LRSB 1OHQA 2OR8A 2VXVL 4ODXA 4ZTPH 1KN2L 3NCBB 4P2RD 2W9DL 4GG8A 3X13A 1P4LB 3ULUD 5DEFA 1QUNA 4TSCL 2FX7H 2DIBA 2H26A 3ULUL 1DQQA 5F72S 4PP2B 1C16A 4GOSA 4R4BB 3G9VA 1N59A 1FV1B 4QHLA 1MCWM 3CFKB 2HT3C 4RFNB 2JIXB 3X3FL 2FO1A 1JRHI 3D48R 4G8IA 1ERNA 1M1SA 1OAZH 1YEEL 3LH2L 4PJXF 5JPNB 1Q9KA 5EC1B 4S1SH 5AYUL 2JJSA 3GI8L 3AXLB 1UACH 4W4NA 2ZOLB 5DJZB 5FGCE 2OK0H 1BGXH 4U6TA 4GKSA 5DQJA 2VDNH 2ICWJ 4MDJA 2F19L 3JV6B 2PXYD 1V3LA 1EGJA 4NFDA 1MUJB 3TCLB 5B21A 4L3EA 3VFNB 3GJFK 1X7QB 1U93B 5FO8A 1HDMA 5F7LB 3QEUA 4XCNB 3T0EC 4Z7UB 4IRSB 1Q0YL 1F3DJ 3ARSA 3I02A 1S5IL 2BP3A 1FVEA 4JFEE 2FGWH 3AMKA 3MGOB 4S1QL 1UB6A 5LGHH 3QNZA 1CFNB 4JFQA 2IC2A 3ZE1F 3ZKNC 3VFGH 1EIBA 1VESA 5C0GA 3ARGD 3P4NA 1FL5A 1TCRA 4XWOD 2XV6B 4N8VB 4X80L 1AGFA 3WSQH 4OT1H 2VLLA 3ALXA 4XI5D 3L5XL 3C5SA 5CZVH 3KS0H 2BNRA 5HHQB 3GMOB 1DZBA 2B4CL 2ZUWA 5AZ2L 1CVRA 4HIXH 3GO1L 1T1WA 1AJ7H 1MNUL 1FN4A 3Q6FA 3S88L 2K7QA 3HB3D 4ZS7H 3DVNB 1TZGL 4O9HH 4JB9L 3WO3B 2CIIB 5JMRA 3QNYB 1GGUA 3MRKA 5KVDH 4OI7A 1DUYA 4ZFOA 1B0RA 3DPBA 5LQBH 3EDKA 1I8LA 4PJXA 4IDJH 4N90D 4BQ8A 3VMPA 1HH9B 4BUGA 4AIZA 2NY4B 2IG2H 4R0LC 2P5WA 1JTOA 4U1JB 3MCLH 3QIWB 3WDJA 4WHYH 4JM2B 5D9SB 5JUEH 3MLYH 2V7HB 4XNXH 5IM7B 2OP4H 5D7KE 1L7IL 2Z4QA 1DQMH 2P45B 2W65A 2FECL 2PYFB 2PKDA 2CMRH 3R4DA 4L4VD 3U0TB 4NHCL 4OIIL 5JHDA 3THMH 3WFEH 3AS2A 1Y18B 5E2VH 1IGIL 3ARBC 4L3EE 4QRQA 3NBNA 2GYSA 4MD0B 5FCSH 1OQXA 3GSUA 3V5DA 3O3EB 4G9FB 3VWJD 1NKOA 5DUML 3PGFH 3FCTB 4J3SA 4HWUA 2EECA 1QBBA 2QKIA 2R69H 4JPWL 4LVHC 1NGQL 1BMGA 4LCYB 3EBAA 3DVIA 1F6FB 2KZ1B 5HBBA 4MCYA 4PJFE 5I1AB 4PGCA 4CN1A 1U8PB 3WN5B 1ZA6B 2V2XB 4Y5YC 3A6BH 1RJLB 2NW3A 1KJMB 4BFIB 1LEKB 3MXVH 4XPFL 5GGVL 5AAMA 5BZDB 3LN4A 5IB5B 4OD3L 3DARA 3P0GB 3BEWA 5C8JB 2GJZB 4UNTA 4OZIB 1T1YA 3R0MA 1JWSB 4HIHA 4PRHB 3DUSA 4IRSD 2BNRE 2FX8L 3MRRA 1CT8A 2XTJB 3NVQA 4LBEB 1QLRB 2EDNA 5HHME 3AUVA 3FT4B 3M8OL 1M05B 1SBBA 3W9EB 2NY6C 4YHOL 3VGFA 1E27B 3ZTNL 1RZIA 1HKFA 5CBEB 4OF0A 1LO4H 5T1MA 5JA9A 3AU1A 1U2CA 3CK0L 4HJGA 1EBPA 1JTTA 5EUKA 5HD8C 4HLZH 4BZ2L 2IPTH 1B2WH 1YEGH 5CGMA 1NFIB 4XMPL 1UEMA 2RJMA 2Z35A 4C59B 1JGLL 3R1GL 1AE6H 4EBQH 1GGCH 3SE8H 2BFVL 4F80A 3L3HA 2D3VA 3PWPA 3X14A 3PQYB 4XHQA 4NQUA 2BNQA 4HJ0C 1WQVT 3VRJA 3OKOA 2IQ9H 2R4RL 5EUOB 1QFHA 4LSRL 4WCYH 3V7AE 2V5SA 4KAQL 2V6HA 5IW1B 2EC9U 4LHJB 1NMCB 4U3XA 2NY4D 4HWBL 5JHDE 4OLWL 2VLJD 5J11C 1JUFA 2UY6A 3DYMA 2NPLX 4JM2D 1X4XA 5DJXA 1T4KA 4IS6B 1IKNC 4OFKA 4NPYB 4M7ZB 3ZE1E 1S7SA 1R3HA 2QEJA 3V6OE 3WHE0 3BUYA 1IGCH 1U91B 2ESVB 4F8QA 4CGTA 3NZHH 3U46A 1CDCA 4DVRH 4FABH 3AFLA 2DQTL 1SMOA 1MY7A 1RVFL 4HK0B 1U3ZA 1IQWH 1FL3B 3VXQB 3AS1A 4UV7H 1YEKL 3EYUL 3RNKB 4BQ6A 2X09A 1NC4B 3NA9L 5J7CC 5GS2H 4N9OB 1RUPH 4GT7A 3CFEA 3CC5B 4D0BB 5AYQA 5D7JA 3H2WA 3RHWF 4ODUA 2LABA 1KBGL 5J89A 1WEJH 4F15C 4Y4KD 1QG3A 2D03H 5F6IC 3MV01 4NN5B 5DK3A 3D0LA 4OFPA 2DN7A 5BW7C 1JWMA 1E4KC 4YUEL 3CXHK 4PG9A 2OCFD 4PRHD 2IAMB 4LIQH 3KDMA 4I9WD 3V0AC 3DURA 4XPGL 4YBLB 5CEZE 3P30L 4WFED 2WINA 1CWVA 4ZO7A 4MQTB 3VXPB 3PWPE 4BH8B 3QUZA 2JELL 3BW9A 2GY7B 2MSPA 4F33B 3C6LD 1IEHA 1CR9H 4DTGH 2KBGA 2AEWA 4DW2L 3SO5A 3UZQA 4XVUC 1YEHL 1BD2E 1DEDA 2GFBA 5HYQB 5CMAB 5B3NA 2NY5H 4XP1H 5HDQL 5ESQA 5JXEA 2CKNA 3CDGA 1MEXL 4U0QB 2BERA 4I3GA 1N8ZB 3T0DA 3BD3A 1Q94A 5EU3B 1ZSDA 3HE6C 3CUPA 3D18B 3HI1B 1NL0H 5DDHA 4NQCB 4AL8H 1H3UA 1TZHA 5INDA 1MCOL 5E2WH 3SKOB 5KOVC 3U30C 1OL0A 3DBXB 5DUBB 3TO4A 3A67L 3RQ3A 3V7AG 2OZ4H 4KQ3L 4PJ9D 4D94A 3G6DL 3GMMB 3P0VH 3DRTA 4YO0B 1OF2A 3G5ZA 4JKWA 1M7DA 2F9BT 1CFTA 3GMRB 4UTBL 4JCLA 2HFEA 3QCVH 2VXTH 4IRJA 2R2BA 1RURL 2KL6A 3QWRA 1PLGL 5I15H 3BRDA 1A0QL 1IGML 1U3YA 5JW3L 3LKPA 5AZEH 2OS7A 4XCCL 1QBML 1XF3B 3TEUA 5JQ6L 1F3JA 2VLKD 4O00A 3RWDB 4I0PA 1FAIH 1JP5A 1LK2B 4JN1L 5ENWA 1FYTE 1NC4D 2IGFH 5C0RH 4RAUA 4P3CH 1YUHA 1QSEA 3J7HA 4LSTH 1D5XA 2YMXL 4GKOA 1XH3B 3GMPA 1MF2L 1DN0B 4P9HH 4FS0A 4MNQB 4M62H 4TUKH 4EJ1C 1B90A 3CLEL 1F6AB 3T08A 2NY5C 5IQ7L 5D5MA 4GXVL 2O5YH 5FYJH 5CSGA 5BOZG 4EI5B 4N8VG 2IAMD 3BJLA 3H3PL 4MMXC 1UZ8B 3UAJD 4BELD 2VN4A 1RHHB 4FQ2H 5CJ8A 3QP3A 5BOPA 1MHCB 1BIIA 2ERJB 2P5EB 4OB5L 5B38A 3DMMC 1A9BB 5HHXH 3C6SB 1JPST 3SDAD 4M7KH 4R3SB 5C0IB 5SX4H 4KXZH 1G9NL 4K71C 3ALPA 4Y8DC 4X7TA 3BDYL 3HR5A 2OJZL 4F3FA 3T2QA 5MEND 2UZIH 4OLVL 1FO0H 2D7PA 1CFSB 2EKSA 3OMZA 4OZHB 1D3CA 3U1SL 3V4PH 3SDCC 2CRYA 1YEFL 4S1SL 3BPLB 1GJIA 1J05A 4LSSL 4KI5F 4YXKH 5HSFA 1VPOH 1UXWA 2EXYC 3QUYB 4P5MA 2DQCL 3MUGA 4D9LH 3EYVA 4HZAA 3WNNA 1I9RL 4GFTB 4LU5H 5KVEH 3SDDA 4P2CG 3ZTJG 1Q0XL 4XVJL 2P8MB 3MBEB 5JPMB 1YJDH 5F9JA 4Y2OA 5E94B 3RUGB 4AG4L 1YECH 3KG5A 5DMIH 2H8PA 2P42B 4YHIA 1HKLL 2ICWB 4X7FC 3QDMB 5BVJB 3U4AA 6FABL 4P9HC 1WWAX 4HUXB 3D39D 3L3DA 4XCFH 4JHWH 4PRNA 3RWGA 2NZ9D 4RAVA 3UJIH 1QSEE 5GGUA 4NT6A 2D7MA 2DYPD 2GITA 4OT1L 3T65B 2XXCB 4M9PA 3SQOH 1ZT4B 2VXSH 3N1PC 1JWUA 5D71L 3MRDB 5D96B 5I1IH 1KCRL 3T4YA 4LEOA 4ZNEA 2NY3B 4LHQB 3CVHB 5I2IA 1BJ8A 4J3XA 3UTTD 5F9WC 4JRYD 1BZ7B 4NHUA 5FB8B 4ZAKD 5JLZB 2E7MA 1CU4H 1H5BB 4FZEL 3KYKL 2AEQL 2AV1A 2HJKB 5IV2A 1SJVA 4O2EB 3TO2B 1CL7H 4RQQA 1YEJL 3PGDB 1MREL 2AKRA 4W6WB 3EFFB 2VC2L 3WHXB 2FDBP 1DBMH 4ZPTB 5KSAB 3FQWB 2K9UA 2Z8SA 4NSKB 2MQ3A 2VLMD 2KQMA 3QUKB 4MA7H 4OLUH 3FRPG 2BY3A 1QSFB 5HHNA 1BP3B 1DQML 3O8XB 1C7SA 1YJDC 5TDPA 2P5ED 4X6DF 3UYRH 3RKDD 2GJ6E 2CLVB 1H3TA 4L4TB 5GZOD 4NQCE 2J12B 3L3OB 4WTZA 3QXWA 5EOQH 4TNWK 3IVKA 4OIBA 5J0BA 4QXTB 1IGTB 2BY1A 4OI8A 2I07B 4Z78B 2XA3A 4BSWA 3F58H 5I73B 4I1NB 4QXUL 2AK4A 2HLFC 3HZMB 4RFEA 2E7LA 1D5MA 2R69L 3FN3A 3HA0A 2Q1EA 4KY1L 4UZGA 3IS1X 3QUYD 1KN4L 4MAYD 3K46A 1X4ZA 1CZ8H 1YDPA 3C08H 4RMRA 2PUQT 3VJ6A 4LCUB 4QRTA 2FX9L 4PLKC 4K23H 5C09A 1UWGL 2AJXH 1XR8A 3EZJB 3UTQB 5SWSA 4N5ED 3TPUB 5ERWB 2XYCA 1MWAB 1A6UL 1JNLH 3EGSB 3GGWB 1RHFA 3DECA 1IC5H 5T1DL 3SPVB 4MCZB 1AQDB 1NCDH 4XNZC 3UTSE 4OF3A 1IQDB 1QFWM 3IFOB 4NN7C 1NMAH 4CVXA 1ZHNB 5F71A 3MRMB 3QDMD 3MRJB 1MI5D 1IAIL 4PRPD 2FJFB 2VDQH 3WJJA 5E8PA 5JOPE 2AQ2A 2VL5B 1R5IB 3PP4H 4NJ9L 4P4KC 1VENA 4Q7DA 3MLWH 4U1GB 2IPTL 3QDGB 5L2KA 4HK3J 4KC3B 3OV6A 3X12A 4F57H 2QSQA 4KI5E 1ADQL 3B2UD 1I7UB 2VLRB 2EKJA 4P5KB 5FUOH 3IJYB 2FEEL 1UYWH 2C3GA 4FQJL 4YXHH 3O6MH 1P9MC 4OD2B 3P4OA 3WEXB 3FL7A 5FA3A 1G7JA 3ROLA 2F8VA 5TE6H 4J6RL 1BM3L 3BGMA 4OM1L 5HVHC 4G7YL 1XGRA 8FABA 3EHBD 2HMID 1KNOB 4XNMA 1M7IA 3NACH 4PJ5E 4DKEL 5CGYC 5FCUH 5DJCB 3GK8H 2C9AA 4RWYL 4RMWA 2XY2A 3QIBA 3UBXI 3ABZA 1KSRA 3EOTH 3O8XD 1IGCL 5EZIL 1HQ4A 1JGUL 2ZSVA 3C8DA 4OQTL 4YX2L 4DVRL 2JB6B 4MA8H 5IMMA 1QR1A 5I74B 4ODBD 1ZVSA 4FQHB 5DFVD 1OM3L 5C09E 1YNKL 4Q2ZA 1UWXK 3LKRA 3WBDA 1A6WH 2VDPH 1HXMA 2NTFB 3QNXA 2C1OA 5SWSE 4BQ9A 5J1SC 4Y19B 5HPOA 5EN2B 5GS2D 4LNRB 3PL6B 5HI5C 5SX4I 1R6VA 1LK3H 1UG9A 5B39B 1ZOXA 1U58A 4I8DA 4JPIB 4TRPH 4R7DB 5I1KH 4CMMB 3D2UB 5F7EH 1MQ8A 5IWLC 3AROA 4MB5A 3OKDA 1NCUA 3UTOA 4U33A 3RNQB 2EO1A 3SCMA 1AO7B 2XY1A 4KTDL 1G7MB 1EZVX 5I1LA 4NQEB 1BFVH 1T03L 1U8KB 1IC7L 1MWAL 3WNOA 4GRMB 1S7UA 1EHAA 2ITCB 5L2KE 4X7DC 1FFOB 3GJFH 5HGBA 5JO5B 3QFJB 2EYTB 1ZTXL 3UO1L 5GS1A 4DUWA 4X6BB 1BVKA 4JAMA 4F8TA 4X6DE 3B5HA 3MNVB 3NOIA 3QPXH 1OAQL 4NRYB 3U6RB 1MJ8H 1YEIL 2WWMC 3SKMA 4UUJA 2VOTA 4G6FD 1A7PL 1FFPB 2LTQC 4LK4A 5IFJA 1QBAA 3MJ6A 4ZXBA 5JIKA 1MQKH 2Y5EA 1WISA 2QQLL 4XGZB 2H9GA 1AXTL 1AI1H 3GM0A 4RGOH 4KZEL 4F2MA 3MBXH 4HH9B 5GZNC 3WO4C 1W72L 4FTVD 4HUWB 3SGJA 2VLRD 4FP8L 5E6IB 4NZRL 1QYGL 4XB7A 2J7LA 4MD4A 1QSFE 1QSVA 4S0SD 2CLRA 4HKBB 3LIZL 5ETUB 4CU6A 2OI9B 5DMKB 3K8MA 3T3PF 2WBWB 1YNLL 3O6FD 1T22A 2Y07H 4R97B 5EO1B 3K80A 4HCRL 4O02L 3L3JA 2ED7A 2X9WA 3LHPL 4DCQA 3MRPA 3NTCH 4GQPH 3KHOA 4NWUH 3HZVA 1RZJH 3O4LB 5F9OH 3VRIA 4OZGF 4I48B 1JGVL 3D1MC 3EJZC 3RTQB 1X44A 3DVGA 1JK8B 3VFWB 5I19L 4ODSL 3IDYC 2QHRH 4OKDA 5I1GL 1I1CA 4ZFFA 4MX7A 1A3RL 3LEVH 1GOFA 1ITBB 3WIFB 3DX9B 4UQ3A 3GIZL 2ZP0T 5MEOB 3DGGB 5KSBB 1HQRB 3BKYL 3G5YA 4M4RA 4GKNB 3SJVD 1D7FA 4RGNE 5F1NB 4V2BA 4YAQB 3TBYB 3BQUA 4Y19D 3CZFB 1FNAA 3UC0H 1NCAH 3PL6D 4HS3B 4L4JA 2QADC 1P5UA 1T3FB 1MCDA 3O2VH 4K7PL 3D2UD 4FN0A 4XMLH 4U1HB 4ZODA 4B53A 4P59H 2VE6B 4CMHC 1ETZB 4PJ7F 2BVTA 1N6UA 4MQSB 3KYNA 3VXMB 2AJ3A 3TBTA 1NAKL 3ZYIA 2AEIT 3G5XB 4NKMA 3IT8D 3LD8B 5IB4A 4RFNC 1BAFL 4HX1A 3BGFB 2FJGA 1VFUA 1MAKA 2WNGA 5HHXL 1ROWA 5EIVA 2FJHB 5CHNA 1RUKL 2GHWB 4JZJC 2QTEA 1H3PH 1JPFA 4PP1D 1RZJC 2UZIL 4G7VH 4U6XB 3ZTJH 2IBZY 4QGYA 3ZE2F 5EWIH 3EO9L 3D3VD 3M1BA 4I13B 3RDTA 2GSGB 3SE3C 4WFHD 2HN7A 1C5CL 4JKLA 1A6TB 4I18A 5DK0A 4IMKC 1JPTH 1P5VA 3W2DH 3NPZB 1NAML 1DUZA 2A74A 5D2LF 3DETC 1RMFL 4S1RH 3SKNA 2IWGA 4MJID 5HYEA 1KTLA 3RL2A 4P9MH 5ICZB 2V9TA 4PYHA 2NXZD 4HXAL 1CE1L 1N5AA 1XGUB 3O2WH 5ILTH 4RZCA 5I16A 1T20B 4G6JL 3IXTA 1S7VA 2GW5A 5KZCB 3I75A 2DJ4A 1KTRL 5IQ9B 1UA6H 1RUQH 5EBLB 3AVEA 4CN4A 1M71A 1HH6B 2GTZB 4KV5E 1ZEAL 4IJ3C 3GMLB 3RTQD 5DS8B 1L7TH 4J12A 2ZUYA 3KPPA 5C07D 5FK9B 1FLTX 1JPGA 5C0ND 1AFVL 1S8DB 4ZUWB 2EH8H 3RX5A 1YMHA 3WE6A 4J8RB 4XP4H 2DDQL 1I8MA 5DGQA 5BRZD 2RGSA 3QHFL 2BY2A 4NQEE 4FQ1L 1U6AL 3X13B 3VXSE 3INUL 2HRLA 2VIRA 3KPTA 1FJ1A 4D3CL 3PGCA 2DKMA 1C16B 1NGZA 2PYEB 1KELL 2W91A 3CPLA 3VH8A 1DFBH 4OFYA 4DGIH 1N59B 5FUCE 4QHLB 3OJVC 1TJGH 1JV5A 1S5HA 3R06B 4QY8A 3QIWC 3T3PE 2B5IB 4OJFL 5I66A 4GS7B 1IFHH 3MRBA 2PTVA 4JZOB 4LLYA 5CCKL 3CCHA 5D2LA 4GKSB 4WHCA 4ZYKA 1T1XA 4OZGE 3VWKB 1ZHKA 4V1DA 1R3IL 1A6VH 1CXEA 1YMMB 4N8CL 4GW4B 3TBSB 5F97E 2PW1A 5FO8B 1WJ3A 3Q3GA 2R0KL 1DQLL 5IBTL 2J5LB 1DBAL 3OJMB 3QEUB 4OIAA 1X5GA 3EIFA 4OFDA 4JPVL 1C1EL 3I02B 3WLBB 4UILL 2HKHL 4Y4FA 1FVEB 2DAVA 1RUML 2JF1A 3WN5C 3VW3L 2ZCLH 3QNZB 1G84A 4JFQB 3ES6B 3MCKA 3QAZB 1AR1D 4WGVB 3KPOA 2FIRT 4OCXL 5F96H 5GRVK 1AGFB 4WU5A 1UH3A 1HN1A 2VLLB 2Y72A 4U1SA 1DLFL 1SJEA 5K9JL 4FFZL 4RMVA 4RSVA 2XTJC 1CD8A 3NFNB 3O81A 4PJ7E 4OF5A 5EORH 1MCIA 5HVWA 3EJJX 4AENB 5ACZB 5E9DA 3Q6FB 2GSIA 1I4FB 1D5IL 2Z31B 1NEZG 4Y2DB 5EZLB 2CGRL 3MRKB 4WGWB 3QA3A 5DJDB 3VXRA 4OM0H 4AM0A 3ILQD 4ZFOB 1CGXA 4D0CB 3D85B 1F11B 5C2BL 2P44B 3RIFK 2P8LB 5D6CA 15C8L 1MCFA 4AIZB 5DJ8A 2R23B 2JKXA 2P5WB 1OSZB 3AB0B 4U6HB 2DQEH 4XAKD 1I3VA 5B39G 4BZ1H 2H1PL 1ND0A 1I85C 3ZE2E 4YLQT 3LZFH 5I9QC 1J0JA 4KFZC 3GSRB 1HE7A 1H0DB 1OARL 2W65B 4D9RD 5D2LE 4K9EL 1NMCC 3LKNA 3MC0A 4K3JL 4Z0BH 3PHOB 2ZG2A 3TVMB 4DKFL 3MUHL 1P7QA 3PNWA 4L8DA 4DFHA 3S35L 4FG6D 3DO3A 4QRQB 3JXAA 3GSUB 1FSKC 4AYFA 1WZ1H 3KPSA 2FH8A 4M7ZC 5KAQF 3HPJA 3RVXD 2QKIB 4HIIA 4HPYH 4AEFA 4PRBA 3GUTB 3G5VA 3BEVB 2P48B 3AY4C 3TV3L 4GG6F 1I9IL 3OZ9L 4TNVF 1OAYL 4MCYB 4PGCB 2VDKH 3BKCL 4K7PX 1BOYA 5EC2B 5FYLD 1EGJL 5FYLL 3LY6A 1F00I 4L3ED 2C3HA 1ORSB 3IKKA 5IG7A 2PR4H 4HKJA 4TTDD 1QFUH 5LCVL 3RAJL 1IL1A 1L0QA 4HIHB 3Q5YA 4BZYA 4D0DA 5IJVB 3HC3H 3DUSB 4PG2A 5ICYB 3HKFA 5BV7B 5EU5A 1VEOA 4L1HA 2DLTA 2DB8A 2BSRA 5C0BA 4YFLF 2MWCA 4POZD 4PJGA 5IVXA 1ZHBB 2NNAA 2ZSWA 1HI6A 4UBDD 3HZKA 2GJJA 1RZIB 2RAMA 1K3ZA 4NN5C 4TNVK 3JUYA 3CDFA 1MFCL 5JW4R 1A1OA 5BQ7A 4ODVL 5TH2A 3AU1B 3LQMA 1Q9OA 3QDJA 4UT6L 4HJGB 3LKSB 3VXRE 2LU7A 5I8KH 2WIIA 7CGTA 3Q1SL 3GSVA 4FFYL 1BEYL 1A7OH 2BNRD 2EIBA 4YBLC 3FB6A 5LGKA 1HYSC 1AGCB 3L3HB 4MNGA 3RWEB 4YNYA 3S4SA 4KDTA 3ULVF 2FGZA 2EXWD 1FRGL 2BNQB 3OKOB 3EYSH 1PY4A 4PRIA 4A6YA 4ZFOL 2ZCHL 1NFDF 5MERB 3PABA 3ESVF 3RFZC 1G7QB 1YPZF 1KCLA 2Y25A 2P5WD 4EQ3A 1N6VA 1CICA 1JUFB 3CMOH 5HY9A 3TJHD 4K3GA 4LPYA 1RD6A 1J87A 4YPGA 3V4VH 1LDPL 3L5HA 3KPSE 1PSKH 5JOEA 3V52H 1S7SB 2X40A 3EO0A 4NO5B 1HZHL 2HJFA 1MIEH 4Q9RL 1NJ9A 3EYFB 4QHUA 3U46B 3H9HA 3LDBB 3OPZL 3HNVH 3BUTA 1R3KA 3U7YL 4CVUA 5JHDD 5EOTA 4PJ8B 3S37H 1XR9A 1GC1H 1K8IA 2J8OA 3QYCA 3V8CA 1ZGLM 2DBLH 4EUPB 4RISH 2H45A 4EN3A 4AEIH 2VH5L 5D2NE 3IFPA 3MRLB 1OB1B 4ERSH 2R1WA 3CFJA 4PS4H 1O5DT 1F4WL 1GGBH 5DFWH 1VFBA 2VDML 4N0YH 5C0BE 2ZUUA 2CR6A 4N0CD 3X3GL 4ODUB 3P40A 2YOCA 4G8GA 3JV4B 4KJWC 4P46C 5BS0B 4N1EA 3NN8A 1KV3A 3MX0A 3D0LB 3SDYH 1U8IB 1K4DB 1MJUL 2EYRA 5GRXG 5D1XA 3BSZH 1PW3A 2GUOA 3KDMB 3V4UL 2HH0H 5BV7L 3DURB 5C92A 4XBGB 4TVSa 4UU9A 5LXGL 3QDAA 1ODAA 3TNNA 2OTUA 3QCUL 3RU8L 5KVMC 3QUZB 3BW9B 1QR4A 4XWGL 1S7XB 1AC0A 1EVTC 3MV8E 1JYXA 4EI5C 5J6GA 5GIRA 4PRIE 5H94A 4JFZH 1QOKA 1A9EA 2ORBL 4HHAA 5IFAH 1F3DH 4NC2B 3CVHH 4JPKL 4NQDA 2ERJC 5CEZD 2D9CA 1TTUA 3DV4B 5CEZL 5C7XL 3PWPD 3CDGB 2YBRA 4KJPD 4PJEF 4GG6E 4JR9H 4HDIB 2VKXA 4QXGH 3QEGH 1OT1A 1Q94B 3PUCA 2BNQD 5M94B 2C3VA 1GC1C 3I9GH 2CIKB 5DFTA 3NFSH 4XVSL 2HT2D 3CH1A 3VFOB 1CDHA 1CTNA 4MQXC 5GQBA 4YK4B 4Z7WB 2CRZA 1NGPL 4DEPB 1BD2D 5KANG 2BCKA 1CGSH 5JORA 1MFAH 1WZKA 1XF5B 1Q8MA 2QR0B 3QUYC 4K8RD 3U4BH 2YUZA 3SE9H 1OAUL 4K8RL 3KPRA 3NABH 1MHEB 4HXBH 4F7EB 2A83A 4Y1AE 2YZ8A 3MBEC 1W8NA 1M7DB 5I1HH 2R0LH 3NIFE 1T2XA 4LPXA 4UDUA 3FMGH 4Y4HA 1AQKL 2HFEB 2E9WA 4XXCA 5EG6C 4S1RL 2VZUA 3OKMB 1UCBL 4XC1H 3F7YA 1J1XH 4YWGH 3I50H 3LKPB 3O2WL 5DD3H 1OTSD 5ALBL 2W60B 4G8GE 3TWCL 5DRWA 1E28A 5DK2A 3U9UB 2WK2A 4QRUA 5HXMA 3N1FC 1V3MA 2CRMA 1VACA 1KXVC 3C09B 3GZKA 2YPKA 3FB5A 3GMQA 3T4AA 3D0VA 5DMGC 3KGRA 3ULVE 1MCSA 1YUHB 1Z9OA 2QQNL 5C0CA 2XA8H 4M1GL 1C5DA 2F74A 4WWKC 4LCCA 4MZ3A 5D7JD 1RZKH 3CDCA 4E41A 5D96C 5C0JB 1ZT7A 2A9NH 2CDEB 1NFDE 3ET9F 2RIKA 4JE4B 4DN3H 5GGTA 5FO7A 3SEPA 2EIZA 2NY3C 3KLAA 1YPZE 5GRZA 3VXUE 2W0FA 1N6QL 3DLQR 4CW1A 2EDOA 4G80A 4R90H 5D5MB 1W0VA 4WO4C 1ZGLA 5GS0H 1P4IL 1H5BC 2IALB 1KCVH 4NQDE 3MLSL 4X99A 1E0OB 1F13A 2BRQA 3MRHB 3RL1A 4JRXB 3ELAT 3QUZD 1SJHA 2A6IB 1D9KC 1FORH 2LU4A 1UWXH 5J1TC 4M8QA 1N2RA 1RFDL 1A4KA 3FB8B 4F3FB 5KSAC 1D5ZA 4AIOA 4OCSH 4PGBA 3UEZA 5TPWH 3F6IA 1OP3H 2NXYD 4NZDA 2YA1A 5DYOA 4WI3A 5BVPH 4JGUA 4X4YA 1SBSH 1E6OL 4L3AA 4YGVA 3KJ4C 1UB5B 5JXED 3EYVB 3IAGC 5KAQG 3DSFH 3KWWB 5EO9A 2XZAH 3WIIH 4JZNA 1BF8A 2K7PA 3GSNA 1R0AH 4Y5VA 3KYOB 2AJUH 4ZSOE 1INEL 3OKKA 2GCYA 5J56B 5F9JB 5I73C 4I4WB 1PQZA 5GRUH 4Q58C 1UKQA 3TO4D 1LP9B 3MA7B 3RI5F 5E5MA 4QRPB 2VQTA 4YHIB 4BUHA 3WXWL 4MMZC 4NN6B 2P8PA 4LAJH 2FZ3A 1RZKC 3GNML 2P1YA 5T3ZE 3GSOB 1KJVB 2J8HA 1ZK9A 5CEYA 3MLRH 2WUBL 2R0ZL 4RAVB 4G3YL 5FV2A 4IRJD 1CLCA 3C2AL 2YK1H 2GITB 3L1OH 1ACYL 5HGDB 1FYHB 4KTEH 4E41E 3KNBA 5GS0C 4YDJA 5I75B 2R1XA 3T4YB 4LEOB 3MA9H 5CZXC 5I0DA 4HS8H 3DI3B 4LGRB 5MEPB 3QIUA 1T6VN 1LP9F 4ORGB 2B2XH 4B50A 4LP5A 4I0PD 2YPLE 1CFVH 1I8IA 5DC9B 3WL9B 4JG1H 2VSCA 3JVGA 4PJEE 2A9ML 4GRLB 3VE0A 4ENEC 1QSED 3RY4A 3FZUC 2Q3AA 4I3RH 3DI2B 4J23A 2DI9A 4HKZA 5D7SL 5TQ2L 5AUMA 3VFPB 3MRGB 3IU3A 1MJ7H 4HC1H 4ZUUA 4Z7OF 4JFDA 5E1AB 1CD1B 2X4UB 1WWBX 3TF7C 3MMEB 4PIRF 1AGEB 4CU8A 2AKRB 3TBWB 3BP6A 2XZZA 1CDUA 1H15A 4KUCD 1EAPA 3MJ8B 3FO0L 1LO3H 5DXWA 4JO4H 5K33A 5DEZA 1K2DB 1RY7B 3T3MF 3TN0A 1YEDB 4RMSA 1A2YA 5DJ6A 1JNHA 1D6VH 3PE9A 2A6JB 2EDTA 5KW9H 5KJRL 1JNNH 3H8NA 5DVNA 4LRIA 1RZGA 4PGDA 4U3HA 3K74B 5ADOH 9CGTA 2AK4B 3S8WA 4ZDHB 1HCFX 1F4XL 5B4MD 2D7TH 1RUAL 3S5LB 1QFPA 3IXAB 2R4SL 5E08L 3KPNB 1YDPB 1Q72H 2YN3A 2WZPD 3VJ6B 1KCSH 4QRTB 3U4EA 1UT9A 5I74C 3GMNA 5IKCA 1A7NL 3SDDD 5JW4N 2FD6L 4RNRB 1C12A 2PR4L 1MFEH 3MNWA 1GGTA 4YR6A 1S7RA 2MOVA 3QHZL 3PL6C 3HFMH 2UWEF 4Q6IA 4U6VH 3QO0A 2XACC 5HI3D 3B2VH 4JY4A 2HT4D 2WV3A 3T77B 4CVXB 2XRAH 1FBIL 2NLJA 4EUPG 1KEGH 4OV5B 5CUSH 3OG6B 5DJ0A 3U0WL 2DQHL 4EKXA 3QUMA 4UIMA 4NQXB 3QRGH 1ZWIA 5E7FA 4AQOA 3BIBX 4KVNL 1MRDH 3U82B 3N06B 3ZMRA 1PAMA 4L8SB 3NCMA 2UUDK 5FO9A 2F58L 4KKBD 3ZZ1A 1XGQA 3RVVC 3VFVB 3BH8B 3EJYC 2YD7A 4G8FA 2YUWA 4IIQA 3W39A 3ROOA 3TESA 5JOPD 1BBDL 4WFGE 5D93B 1F5WA 4XHJD 3P4OB 3RWFB 5FA3B 3LEXA 4JRXE 5GRJL 3OG4B 5K93A 1W0WA 1NSNH 3ROLB 1EJOL 1CBVL 5CD3A 3BGMB 5L7XL 3MLTA 4KI5D 1XGRB 4HLJA 2B1HL 3QEQB 8FABB 1Z9SA 1GIGL 4M6NL 1JMXA 5E6IC 4NNXA 1M7IB 1K4CA 4XNMB 1A47A 1RULH 2P43B 5EZOH 1U8HA 5SWZB 4MAUL 4OSUH 2OI9C 3QIBB 3B3IA 3ZSSA 2X4PA 1QQDB 1TVHA 3N1MC 4FOMA 3VFSB 5IT2H 1A6ZA 4NNPL 2ZSVB 3ZL4H 5E03A 5CD5C 2FATL 1ED3A 2UWEA 4PUBL 3QZWB 3SE4A 5IMMB 1QR1B 2HVJA 1ZVSB 1YN6A 3L6FA 2FR4A 4OKVA 4AH2B 2VDOL 4LLAA 4HFWA 4IM8A 1HXMB 1ZANH 3QNXB 1MOEA 1KB5B 4NQTA 1JZ2A 1VGKA 1LP9E 5KSVB 2AK4D 1F8TL 4LCWB 3VRLF 1Q9LA 3TM6A 4J3UA 3BJ91 4M9OA 3MRFA 2HVKA 2JCCF 3MRCB 4KHTL 5DO2D 1U58B 5ACMA 1KIQA 1KCUL 3S34L 4Z7OE 4NUJA 4EIGB 4NZJA 4LSVL 5C09D 1DL7H 3M17B 3VDCA 2M8XA 3G04A 3D25A 5SWSD 4KRMB 2FB4L 2IPKA 4LOUD 1XGTA 4JVWA 2EDWA 3O3BA 1XCTB 5IP4A 3HAEB 1G7HA 4U2ZA 1QO3A 2YRZA 5CIPH 3T3ME 3LQAH 4DN4H 5LAXA 5E1HB 5EA0H 3BO8A 1MCJA 4QRRA 1U42A 2FIKA 3SKMB 3VD5A 5JTWA 4WDIA 3WV0A 1E4XH 1ONQA 5J3HC 2ZJSL 5IR1A 4ZXBB 3O41A 2E7HA 3W0WA 5L2KD 5IFAL 3LD8C 2YD8A 1T83C 5JXAL 4L8CA 4U1LA 2YSSB 3ILPA 5J57B 1SYVA 4YE4H 3I6KA 2GTWB 4P23B 4MD4B 4NBZB 2BVUA 1EFQA 1DQTA 1YYML 4QXGL 5GSRA 1HHKA 2CLRB 1VADA 2YEZA 2D0HA 3HMWL 2H2PC 3WIHH 4KPHH 2CJUH 3A0OA 2ZG3A 2P4AB 3O0RH 1WWWX 3CNKA 3P11L 3VD7A 2HTKC 3MO1A 4XNYH 2UWEE 1OPGH 1I1FA 3LEYH 1K6QH 3OF6A 4TVPH 4HXBL 4NUGL 4YDVA 5AWNL 1H3WM 3R0NA 3V0WH 5HDOA 1QRNA 4WW2B 5I18H 2JK5B 4NKIL 4R4NC 3N85H 3V6FA 1T0PB 2R39A 3QIBD 5TDOB 4PLJD 3RY6C 5T1LA 4ZFFB 1SEQH 1UWEH 1KENH 3T09A 4UQ3B 1WUNT 4XC1L 3VMOA 5F7MC 1R5VB 1LNUA 5E6YA 1P4BL 2VL4A 5HYSG 4JFXB 3G5YB 4J4PA 5I17A 2CXGA 4HBQA 1EEYA 1KPVA 4DKDC 2GT9A 1CG9A 3SOBH 1EHNA 3LQAC 1DTUA 3RPIA 3L3IB 3MNZA 4KQ4L 1JYWA 1RAMA 1SM3L 4LSUH 5JIIA 5DVMA 2VWEE 3VWJA 3OXSA 4JJHA 2DLFL 4YQXL 2CKBA 2J2ZA 3GSWA 5CP7B 4C56A 2P7TA 4Z77A 1KC5H 3MLZH 4AMKL 4HV8A 4KTYA 1A7RL 1J0KA 5IMLB 3LRGA 5IFHH 5HI4D 1DBJH 4KJYA 3KXFB 5LKNA 4P49A 4ZFGH 2BRRH 4QRRE 4RGND 4NRXB 4OZ4A 5GRYA 3SCMD 1J10A 3B9KA 4Z5RB 7FABH 3VDBA 1NCWH 1XIWA 1IC4L 2R0WH 2VR9A 5H8DA 3E6FA 4NKMB 1R3LA 2X6MA 5BO1L 1BZ9B 5A3IC 1PDKA 4PLNC 4NKOA 4OCMC 1FGNH 1FLRH 4JLRB 2B5IC 2ADJB 5CHNB 3MROA 3HG1B 3QQ9D 5H37G 2Y5TA 4NKQB 1IZJA 3UDWC 1G7IA 2K3TA 4DZ8B 2R56H 1NEUA 3B6SB 4ZXBD 3VWKC 4KK5D 3SN6N 3K0WA 3H0TA 4X6CF 4Y16B 2BVQA 3QEQE 1TQBC 3O9WA 4M6OH 5D1ZA 3VRLE 5DK0B 1A7QH 3HE7A 4JO2H 4QTIH 4OCRL 1OLLA 2JCCE 5CSZA 5L6YL 2A74B 1DUZB 4BA8A 1HIML 2CO7B 4L3CA 2J5LC 3SKNB 4GBXB 5TF1H 1A8JH 2ITDA 1QRNE 1T04A 3RL2B 1QFWL 1YQVH 4M6MH 5ESVB 2NYYC 4W68A 5DF0A 2LV4A 3B83A 4DWHA 4RZCB 5I16B 3IXTB 2VXQH 3I75B 2GAZA 1QVOB 2V2TA 4LLMB 2R2CA 2VAAB 1G7PB 2X42A 1N3NA 3PXJA 1T1ZB 3QAZC 5F7FA 3NCCB 4HWBA 3RZWA 1HHJA 3AS3A 3VGDA 1FIEA 1CLYH 1C5BH 4LCWE 3FT3A 3QT2A 4JQVA 4P2OB 3C60B 3KPPB 3MXWH 4K7FB 1JPGB 2XNAB 3CFCH 2CLZA 4UB0L 1CYGA 3ULSA 4HKXA 2MKLC 5I8CB 2AJZA 4C56E 4P2QA 4XMKL 3S5LG 1W8OA 5DLML 5IHUL 2SEBB 1I8MB 2Z31C 3OJDB 1KUMA 4Y2DC 3TT1L 2Z8VC 3V5HA 1NUGA 1HHIB 3BN9C 3MOBH 1FFQA 1FG2A 4FQXC 5E2TH 5INCA 5FM8A 3SO3B 3EYOA 2B2XL 3BQUD 1CK0L 5EU6E 2VIRB 4YHYB 1OW0A 3PGCB 2OBGA 4HIEA 2PO6A 3CPLB 3VH8B 1KFAH 3IDXH 3NCJL 4HUUB 3EUUA 4DFIA 2W9EL 3AB0C 4O4YL 3DHJA 1T5XA 3OB8A 4XBEH 1WC7A 4M48L 1S5HB 3S37X 4IHOB 4QY8B 4H1LA 5C0DB 1A5FL 2ATKB 4TULH 3WHE1 4WNQA 3C5ZA 4WU7B 3MRQA 4A2LA 2VRAA 4X5WB 1Z2KA 5I66B 3MRBB 4M1DH 4HPOH 2DD8L 4LLYB 1WBYA 3I3DA 1T1XB 5IMOA 2VR4A 1ZHKB 3TVMC 5J4MA 4V1DB 1DVFA 3MODH 3K4ZA 2QLVB 2HTLC 3WD5L 1T0MB 1D6VL 2YA0A 3QB7C 5D1QA 4LF3A 1BFSA 5E95B 4DGVL 4GRWB 2I9TA 4QOKE 3WCYA 1IT9L 3IJSB 4GSDL 2E27H 5HVGB 2EE6A 4Y4FB 5EU4A 3RDTD 2F54A 3Q6GH 2IANA 2VAJA 3KPOB 3UXFA 2ADFL 5T33H 4YIQA 1U8NA 2XWTB 4HWZA 3FFCB 3IF1B 4U1SB 3E0GA 2Z92B 3F6LA 1SJEB 1IKFL 5DRNA 5HVFB 5J9PA 3WKML 4PJBF 1EMTL 4EUPH 1KCKA 4CUCA 4KKAC 3CFBA 2DI7A 1WAAF 2X9XA 4U1NA 5IOPB 1C08A 2X4RA 1JL8A 5E9DB 4K2UH 5ID0A 4OLZL 5T3ZH 4YXLL 1TDQA 2YKLL 1Q1JL 5FOBA 2OJEB 3QA3B 1OTUC 3QZWG 1TJHH 4JG0H 2EDQA 4GMSH 5DURD 5F89A 1OGTA 4LSQL 3V5KA 3TT3L 4YHPA 1VFAA 5D70L 5L88L 4ODHH 1NGXA 2RFXA 2BJMH 4LLWA 1OOAA 5CJOL 4RCAA 4JDVA 2BHYA 4KK6D 1LILA 1X5HA 1I7ZB 1ND0B 4X6CE 5JR1L 2FYYA 35C8H 3AAZA 3PWVA 2Z93A 4OZFB 1K5NA 5JHLL 2HFFA 5EBMA 2F5AL 1OGAB 2AJSL 2V5TA 4KKNA 2W1NA 4XCEB 2WQ8A 1IAMA 3LKNB 1PG7H 3IRPX 3T0EA 1P7QB 2Z91A 4OFYD 3PNWB 3C2SA 2DM3A 3WFDL 3HAEG 3GBNL 1KLGB 3UROR 4WY7L 1IBGH 1U3HB 4HMEA 3U0PA 5DQ9A 3ZSTA 1GRWA 1NDGA 3HPJB 4JEGB 5BZWA 1P7KA 1NCBL 3O6LL 3LCYA 1T7XA 4OTXL 3G5VB 2ID5A 2KQNA 1MFNA 1BQHB 3V6ZA 4V1DD 3QI9C 2IEPA 1EFXA 2Q7YB 1RU9L 4PJ8C 3OX8B 1UM5H 1XGYH 2XQBH 3K2UH 1SMAA 4H25A 5AEAA 4R96A 1KPRA 5I6XB 4Z8FH 2Q7NA 2FLRT 5IG7B 2WBJB 3MOAH 1A1NB 3ECBA 1A3LL 3SGEH 4JFOB 2YXMA 1IL1B 1JZ4A 3LAFA 3UZVB 1YY9D 2AXGB 2A0LC 2X5PA 4HQQH 4JKKA 3STBA 3IKCA 5I1CH 1YN7B 4R4FL 4Y4FD 1AGDA 4PTTA 5MENA 2BMKA 3QEHB 2ZSWB 2C1PB 5J6HA 4R0LA 1HI6B 3O6KH 1S9VA 4U1IA 3HZKB 4S11A 5DJAB 5GISH 1JMZA 3ARYA 5BQ7B 5EFIB 1UM6H 2EYSA 3QDJB 3BD4A 3QDHA 3SDXF 2AABL 4U0RB 4WUKL 4PRAA 43C9A 4BYHA 1EPFA 1TJIL 3GHBL 1I9JL 2DQDH 4H8WH 2Y06H 3OSKA 2J4WH 3EFDL 3QCTL 5E9DD 4TOYH 5LWYL 1NH6A 3IDMA 4ONFL 4MNGB 3KJ6H 4YNYB 3S4SB 2Y9RT 1IEBA 2G2RA 3GIVB 1FAKT 4YHZH 3VXRD 4ZFZA 3T2OA 1NANI 4JGMA 1FP5A 2E9BA 3REWA 4LRNH 3S7GA 1Z3GL 2C7UA 5HHVH 3OTTA 3I85A 3PABB 4YFLI 3VFRA 1EO7A 3S98A 3TIDB 4APQB 3KLHD 4HZLA 2DICA 3WXVH 1CICB 1RJZA 1NGYB 4PY8J 3H42L 4IOIA 1FGVL 2DYPA 5FDYA 4MXWL 4Y5YA 3H9SA 1XT5A 4KMLB 4XP5L 1MPAL 4UV4H 3EO0B 2HJFB 3BE1L 2IADB 1BOGB 3MV7E 2DWDA 2A77L 1FPTL 1NJ9B 4QHUB 1LEGA 4PJHF 4DEPC 3H9HB 5D72L 2P49B 2R9HD 4WV1B 3L3KB 1KTDB 4G6KH 4HMDA 5TFSL 2Q76A 1N7ML 4PJBE 1EJ6A 3HMXH 5DSCA 3WFBH 1BZQK 4K94H 5E8EA 1UXSB 4S2SA 4P0DA 1WAAE 1UVQA 3KPSD 4WUUB 4MJ4A 1DBKH 2EDFA 1V7ML 3EYQD 4NDMA 3CFJB 2ATPA 5F3BA 5I30L 3SDXA 4PPTA 3B5GA 1LVEA 3UJJH 2Q86A 3O3DA 3NN8B 5EOCL 4UNVA 2N7AA 4H8WC 2F5BL 3C09C 1DLHA 1S9YA 4CVZB 1CE6A 4KK9D 1XZ0A 3I2CH 4KVCL 1I7RA 5IF0B 3MV9B 5C0BD 2VMFA 2YRPA 5EO0B 3T8XB 1CXHA 1AXIB 2HJLA 1P53A 2VJXA 3W5MA