5DHVB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 25
structure length 110
sequence length 110
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvB00
4RNRA 1A14H 1IEBB 4KY1L 5HHPA 2IAND 4JKLA 4Z7VF 3BZDA 5GJTH 5DD5H 1A1MB 4L8DA 3SJVD 2FNBA 4U6YB 2BNQA 5I1EH 1BWMA 1JHTB 2BC4B 4GMSH 4ZYKA 3SDDA 3MLRL 4LSVH 2H32A 4D3CH 3LSOA 4BKLB 1DQJB 1EDQA 4GW4B 3SKJH 4XPFH 1CXHA 5D6DC 4PJXF 1NFDE 2IAMC 1QUNA 5IM7B 2P8LA 1GGBL 4QHMB 3EO1A 1YJDC 5E2WH 3FO9B 2NX5D 1M1SA 1HKLL 1UKSA 1A9BB 3VW3H 2WZPD 3TBYB 4F7CB 1AC0A 5EB9A 1O0VA 1B0WA 3G5VB 1G6VK 4LQFH 5JW4M 4LRIC 3QG7L 5FYLD 4G8EA 4OZ4B 1A7QH 1GGIL 4XC1L 4DEPB 3WN5B 2O26U 2D31A 2VIRA 3MNWA 4U49A 1MCNA 1N2RA 3U4BL 2XRAH 4NUGH 3WFCH 2X9YA 5AEAA 1FE8H 4QRUB 5D2LB 3CH8A 3WIFA 3U6RB 3V6OA 3CSPA 2CLZB 3KAAA 3V8CA 4OLVH 3Q6FB 1VACB 2YN3A 3BPCA 1A21A 1HQRB 2OXGA 3QP3A 3PWVB 3TCLB 1LWRA 2VLJD 1TJHH 4ODSH 3HRPA 4EIGB 5E94A 4Y16C 3GBNH 3QEUB 1DVFC 4NRXA 3S9DB 2E6JA 3ILPA 4WW1B 3LQMA 1U3HB 3L95A 1IT9H 3HPLA 3PWLB 1N0XH 2F53D 5DJAA 4DKDC 1SQ2N 1JF1B 3DX9A 1MQ8A 2IBBA 1CT8A 2LVEA 8FABA 3QJHB 2J8UB 1I1RA 1NEZB 1GJIA 1CL7I 4JPWL 4MNGB 4GKZB 4PG9A 4R7DA 4DGVL 1K8IB 2VDQL 2HAZA 1A6TB 3IJYB 5F93C 1IGFL 1ZVSB 1UZ8A 1IAOA 1OAKH 1T0MB 1EBPA 5C0IA 4ODUB 1J8HB 4LAQL 2X1PA 1XIWC 4KFZC 2MCPL 1JYVA 1MWAA 4JREB 4HJ0D 1R3LA 2UWEA 2P47B 3BAEH 4FTVE 1W0VA 4OLWL 3O6KH 3QJFB 2J12B 5L9DL 2X9WA 3OB0K 3EGSA 2VXUH 4EN3D 4JFZL 4GAGL 4N0FB 4OD3H 4LSDA 4HS8H 1YEJH 4JHWL 5BMFH 3SY0A 5M95B 4NT6A 5I15H 1YYLH 2DB8A 1CFTA 1T66D 3ARGC 2YPLE 3U1SH 4Z7NE 4G8GA 2I07B 5T1DL 3WIHH 1LO5B 5KTEL 3LKNB 1X5FA 5GS0H 5INDB 2EYSB 5EO9A 3WEXB 1ZHBB 1YN6B 1AGFB 2BSTB 4TUKH 1IGYB 1KN4H 4XTRD 3RTQB 1MH5A 5F1NB 1A6WL 1YN7B 4PLNC 4Y5YB 4FQHA 4P2YA 1DBAH 5DJ8B 4EOWL 3VXPB 4O51A 4XNQA 3KNBB 5B8CB 4XPHH 1CE6A 3ZDZE 4HJGB 4GOSA 3QIUB 4NQVB 3VFSA 1WTGT 4MB4A 2BY1A 5GJSL 3EYSL 1FGVL 3MLYL 3VXTB 4OGYH 5HDQL 3GHBL 4H25B 3S4SA 2YK1H 5L2KE 4IMLA 4G43A 1C5CL 1BJ1H 1HHGA 4LFHD 1D5BB 4PRPB 1I7TB 4HWNA 1CDIA 4QOKA 4KZEL 3SO5A 3GIVB 5E99H 3UTPE 3C2SA 3ZKXB 1BOGA 4TQEH 4N5ED 2AV7A 3O6FA 3PWPB 4Y1AD 3BOVA 5GGQH 1J86A 3Q3GB 4LVHB 5BRZE 1P7HL 3M1BA 1WBXB 2Z93B 3LQAL 3QG6B 4F37F 1T7WA 3DXAE 4X9BA 3TBVA 5SWSD 3O3DB 1IGCL 4NRYB 5D96B 1A1NA 4WWKC 4MA1B 1FORL 3RKDD 5CJOH 1RAMA 2A6JA 2VXVH 5FDYA 5FHBL 3PHSA 4KK6D 4G8FB 3VXME 3AREA 4H0GA 3TPKA 4CGTA 5FXCH 3UMTA 5KVDH 4OQTL 1E4XI 1CL7L 4P2QD 5BO1H 1GH7A 2YRPA 4UDUA 1ZSDB 5EO0B 2XA8H 2D7MA 4M61A 1G9NL 4E41A 1MFBH 2E3VA 2FX7L 4Z7VA 4GJTB 4Y5VA 2MKLC 4X6FA 1GRWA 3LS4H 2BOCB 4MD0A 1LVEA 2IH1B 3H9HB 3NZ8B 3KPMB 4HUXA 3RWIA 3VFOB 5E08H 3RDTB 2A6KB 1FHGA 3CGTA 3JV4B 2P46B 2CRYA 2WM0A 5CJBA 3SQOH 1DR9A 2OR9H 3V5HB 3ZDYF 4P4RB 3N0PB 1CGVA 1P4IH 5CD5D 4NFDA 1S9YB 1FL5B 2K7PA 3EDKA 4ENED 3ZL4H 1CQKA 3P11L 4N0YL 3IAGC 3V52L 3UTOA 4QNPF 2BRQA 2Q6WA 1EHAA 1BZ7B 1JMZA 5MP6H 4UBDC 4HGKC 4LRNH 2JK5B 5E9DD 1LP9B 5FM8A 2B1HL 3QUXA 2XXCB 3FZUD 4F7TB 2BC4A 4WHYH 4ERSL 3STLA 5GRUH 2LFGA 2GJ6A 1M6OA 1P5UA 2P7TA 1AGCB 1DQJA 3EOBA 4GW4A 4BUHA 2D2OA 4MAYB 5DYOB 4UT6L 1FAIH 3W11D 2JELH 3PDDA 1A5FH 1H8SA 5DFTA 5J9PB 5HVGB 3RIAF 2X9XA 3DVGB 2HKHH 4KRLB 3TBYA 3QCVL 1U8LA 1F4WL 1FV1B 3BN9D 4YHOL 5DFVD 4AMKH 3TBWB 1NFDF 2RGSA 1T22A 3M45A 3KPPB 3MODL 4EDXB 2H1PH 2VWEC 3L3DB 3CDYA 4Q6IB 1MFAH 3GSRA 5JIKA 2ZJSL 1T1XB 1G9ML 1ZLUK 2Q7NA 2QJDA 4W68A 1EJOL 1T6VN 3E6HA 4DKEL 1FJ1B 1EEYA 2EKSA 3VCLA 2VLKB 4G6FD 4IHOB 4X4ME 1VACA 5F8RC 1PG7X 3QEGH 1S9WB 3SGDH 1KEML 2CKBL 3PWVA 4M6OL 2VMFA 4M5ZL 5T5FL 1SVZA 2JCCA 5JHLL 4KRMB 3HC4H 4JFQB 1VGEL 4P3DA 5HJ3B 4HUWB 4N8CH 3CMGA 4QXGH 4NIKB 1H9VA 3M17B 5DUBA 1BQUA 2EH8L 3BISA 1OPGH 1WAAE 4JPVH 4NN6C 2O61A 1P1ZA 2VABA 3SE9L 5A1AA 3N85L 1X5YA 2IPTH 1JNHB 1A7PH 5IB4B 1NGQH 2VQTA 4MCYB 4OGAC 4K8RD 3MACH 1YMMD 3PWJB 4GKZA 1NC2A 5CSBA 4IMKC 3RA7L 1S7SA 2NNAB 2C1OB 3SQBA 2BMKB 5GHWL 1H5BC 1E4XL 5DS8A 3O41A 3HE7D 4OM0L 4K3DL 4I48B 1T0MA 4KTYA 3IDNB 3G6JB 3WSQH 1JFQH 4NKMA 1N6QL 4QTHA 2RFXA 3MLUH 3GMLB 1A3LL 2VDKL 3LD8C 5E00B 1EUUA 1DQDH 3VXQB 3EHBD 1L0YA 5C0AB 2G5BA 2ADIB 3QJFA 4Y4KC 3MMEB 2DJ4A 5A2IH 4UDTA 1KTRL 2F5BH 3GJFB 4HLJA 5DDHA 4HWBL 5LWYL 4MNQA 3UPCA 1RZJH 3MRLB 3AMLA 2J88L 1IEHA 2V5RA 2H8PA 3RHWK 1Z5LB 2PTTB 3QFDB 4UT7L 2ZP0T 2FSEB 4ZTOL 5T3XL 3ARUA 4I1NB 5FK9A 5IR1B 4NZDA 5AWNH 4GRLC 3I75B 1J11A 1WITA 4LGPB 1ZWIA 3HZKA 4QRPE 2E6PA 1FZMB 1NQBA 3EYFB 4QXWA 5DI8A 1ZHBA 3FO0L 2E9WA 3U7YL 4PJ8D 2NR6D 3OSKA 1IM9D 2OK0L 1CK0L 1FVCA 1ZA3B 2ARJQ 2VC2H 4K23L 4R3SB 3FQTA 1J5OH 1JWMA 5IW1B 1Q0YH 1YN7A 3FCTB 2ZUQC 5GRZA 4L8BA 1U8NB 4PRDB 2D7TL 2NLJB 1NDGB 1SJHB 3QWOB 2C1PA 4H88L 1L4IA 2HH0H 4I3SL 5FYJD 4XNZC 4YDVB 3W9DB 4QTIH 1K2DB 5ENWB 1UH4A 2PXYC 5HGAB 2QADB 4OF6A 1X4XA 3JVGC 1LO3L 3HZYB 3O8XD 1FL3A 3FONA 2NY4C 3VXTA 2B0SL 5FGCB 3TBSB 3F7PC 4Z8FH 4HIIB 4HIHA 4NGHL 3VFPB 5I8OH 2V5MA 5EBLA 2X6MA 4FTVD 4R97B 5T1KD 5DTFA 1CU4L 4WFED 4HW6A 1RUAH 2FL5B 3EYUH 3GSXA 4KU1A 5EZJB 4NZJA 1I3VA 3CLFL 4MMXC 3L3IA 4O02H 5FV1L 1M7DB 4NWTH 1YY8B 4LDOB 4NKOB 3SKMB 3RZCD 1S3KH 4TSCL 3V6BR 5F6IC 2YPLD 5E24E 5TDOB 2ITDB 4P2CG 3DX6B 2VAAB 5D2NC 3HMWH 4Y4HB 4XBPB 1ADQA 4MWFA 1DQLL 3ZE1E 3VXUB 3W9EA 3I9GL 3O9WC 3GJFH 3LEXB 4XPBL 4IRJC 1NLDH 4KDTA 1NMAH 3HG1B 5HYJA 3BEVB 4FQQB 1LO2H 1JNNL 4Z5RB 1OCWH 4ODWA 3TNMB 2YA2A 3KYOA 3HPJB 1HINL 3HZVA 2UY7A 4LLYA 3X13A 5AD0B 4Q97A 5JW3L 1CGSL 1AGBA 3G08B 4Z18A 3RVVD 3W2DH 5IJKC 2HMIC 3CFEA 3DARA 3SDXB 2R0WL 4YGAB 3FAXA 1VFMA 1X5XA 3QUMB 4FQXC 5D7SH 4N0CC 5LGJB 5JPNA 5IJVB 3VXOB 4DGYH 3MRDA 4BSJA 1QSEE 3NA9H 4HIJB 5FYKH 5H94B 4LSQH 1JPTL 2B4CL 3THML 2VLLB 1C7SA 3TA3D 1V3MA 1WIUA 1RSFA 2XTJB 2EIDA 3JV4A 4K7PX 3RHWF 5CEZL 4IRSA 3D39B 4KI1A 4G7VH 2W0FB 3CXHJ 1NBQA 1F02I 3UTPD 3AY4A 4L3CA 1TJGH 3L1OL 3LN5A 3WIIL 1A9EA 3SKOA 4DKFH 3QIWD 1MAMH 2W91A 4F7PB 4XMKL 2Z31D 5ID0B 1TTUA 1S5IL 1JRHH 2GITA 3GI8L 4ZQKB 1JWUA 1QZ1A 5CFHA 3ULUL 1HYSD 4BQ6A 1U95B 1MWAL 4G3YL 4Y19E 4YDJB 3PDGA 5E2TH 2IALB 3QRGL 1HSBB 5I8KL 3DXAD 2AV1B 2JK5A 2AEIT 5ITFB 4EZMA 2CDFB 5CKGA 3QIBD 1OP5H 4AENB 1JMXA 5TQ0L 3MGAA 1CWVA 5DJYB 2R56H 4RZCB 1ZLWH 1QKZL 3ZKMD 5DEZA 3VWJB 5HHQB 3OG6B 5EOTB 1DDHB 1E4JA 4Q0XL 4EXPX 3T2QA 3D3VD 1DLFL 5C9JB 3BSZL 4ELMB 4I0PC 3DVGA 4LVNC 2IGFL 3TV3L 4LVEA 3F5WA 5EIVA 2HFFB 4ETYA 1QO3B 5IFJA 4HJJL 3NFPB 4MS8C 4X83A 4AH2B 1D9KA 3ROOA 1EMTL 4XXCA 4LCCB 2W65A 5D1ZD 1MCOL 2ATPB 1MY7A 3HUJB 3I50L 1S9XB 3PABA 5E56A 5IT2L 5ESQB 4Z7UB 3ZKND 4H5SB 4WU7A 3IB4A 5I1CL 5GS1B 1FJ1A 4S1QL 3QUMH 3MRMB 5IQ7L 1CGTA 2JTDA 5DD1H 2VLKA 1JPGB 3HE6B 4NM8H 3BXNB 3P73A 2VE6A 4FQLH 1J0ZA 3NCMA 3WUZA 3MGOA 3VH8G 2MPAH 5E2VH 2YUXA 3H9SB 2YSSB 2A77H 3Q48A 1BZQK 3P4OA 3VD5A 3BD5A 4LHJB 2BJML 3M17A 4TRPL 5D70L 2ADJB 3OAUL 5TF1H 1A14L 1ZA6A 1IE5A 4CVUA 3SE8L 1U8IB 3GB7B 3O8XA 4MJ2A 3DOSA 4M93B 1AD9B 3MV8B 1KELH 5TDPB 2CMRL 2XFXA 4JJ5B 4XCFH 4XPFL 1Z3GH 1HQ4B 4JKKA 2LVCA 4N8VB 5DD6B 1CDGA 4D0CB 2EC8A 1WAAF 4RQQB 1GXEA 3DUHA 4P2RB 5LGHH 1W72A 1FNSL 3MREB 1BD2B 4NN5B 1XCQB 3X3GL 1OAXL 5D72H 2FJFA 3RVUC 2P5EB 4LLMA 5SWQB 4JFDE 5ILTH 1QA9A 3RJDA 1A1OB 3ULVE 1NDMB 3GJFA 1RHFA 3NOIA 2JB5H 2R29H 4HZLB 4LP4A 4KJWC 4LVOB 3EO9H 2BSED 3RGHA 4F58H 3BRGC 4JN2A 4CN4A 3WD5H 3RI5K 1Z5LA 3KPQA 2OTWB 1IAKB 4JG1L 3QUYA 3M07A 4I4WA 2WUBH 1A4KA 5I19H 5F96L 2DKUA 3R0MA 2N7BA 3P0YL 5ALCH 4NKIL 1FZMA 2NXZB 3T2OA 2X1OA 3CVHB 3LVEA 5KVGL 4K3JH 4ZFGH 4J4PD 5KJRL 2NY6D 5TPWH 5ADOL 1KV3A 3NMEA 4G6AD 1TFHA 1D5IL 3QWOA 1N0XL 4P5TC 2RCSH 4LKCB 2J7LA 3D2UA 2CRIA 4BH7A 1K2DA 5L2KA 2YPVH 3MRPB 3T3PF 3VD3A 4GAYA 2ZUSA 1JGLH 3FFCB 2Y4SA 3B9KB 5BVJB 1L0XA 2NY7H 2R2BA 3HZMA 1I8KB 1U9KA 4PJEE 2DD8H 3D0VA 4J3VA 2KKQA 3FQUA 3B2VL 2YRLA 3NGBB 5DVMA 3CH1B 1JCKA 5CBAA 5BRZA 1XZ0B 3IFPB 4K7PY 1GPOL 3O4LE 4PG2A 3VRIB 1M7DA 1OW0C 4HKZB 1V3LA 2NXYD 3GDBA 3MRQB 5DEFA 3VXNB 2AVGA 1MIMH 1I7RB 1BVZA 1T1WA 1U2CA 3OKOA 4YPGB 1OP3H 3P0VH 1HHIA 3B5TA 3VGAB 5I76A 3DYOA 4W4OA 2RAMA 2BZDA 4HV8B 4M1DH 2F54E 4QRPD 2VO5A 3VXMA 3VXUA 1ZEAL 1BF8A 3WCYA 2PKDA 3U30B 3C6SA 5ID1A 3V4VL 5D6CA 3DRTB 3JZ7A 1RZGB 4XVTL 2WIIA 4MAUH 5I16B 1RIUL 4YLQT 4PV9B 3T04D 2FGWH 4LCIH 2C4XA 4OQ1A 3BIAX 3HPJA 4RMTA 3QDJD 1LEKA 3V8OA 5IG7A 4DFIA 3TVMB 2Y07L 5IEHA 4JN1L 4LCWE 4KI5E 3ZE1F 5J12B 1UJ3A 1BOYA 2FBOJ 2UZXB 1NC4D 5D7JC 4ZNEA 3OKKA 4W6WB 4DUWA 3QCTH 3CVHH 4XCNB 1DQML 3REVB 5IJVA 5LQBH 7FABL 3RY6A 1S7TB 5HHME 3BT2H 4OGYL 3WNMA 4GLRH 3SGKA 4F3FA 2P8PA 5A16B 3R8QA 3SOBL 5KS9B 5EFIA 2R0LH 1CGWA 5LKNA 2FWOA 1HN1A 5AAWA 4Y4FC 1OARH 1XGTB 4AZ8A 3GSQB 4NQCB 1MHPL 5DO2D 5CAYB 5HSFA 4M1GL 1I3GH 1N8ZA 5EUOB 3WFBL 5JIIA 3GK8H 2QKIB 3HAEG 4NPYB 2OSLB 4Y0GA 5DQDL 3FT2B 2CK0L 5SX4I 3MRJB 1H15B 2ZSVA 4H0IA 3BKCL 4V1DB 5TH2B 1T83C 4X0KB 2QQKL 2AV1A 5J13B 4R4FH 5M94B 2BNRA 1NLBH 1OAQH 2AEPL 1F4XH 4HIXL 3UCRA 4TVPH 5F7KC 2VQUA 4IRZH 3FRUA 3EZ8A 3N1FC 1MCKA 4P99A 3UTSB 4D9LH 5GZOD 4YIQA 3VDCA 1B0RB 3VWJA 5HHQA 1DDHA 3DVIA 3CDGA 2FJGB 3HI5H 4GO6B 1Y6KR 2O5XL 3FN0H 3I02B 1OP9A 3VG9C 3PE9A 4QRTB 1ZLSL 3M8OH 1IAIH 4JFYA 5C9JA 1H3XA 4Q7DA 4ELMA 2V5YA 2B7DT 4DN3L 4FXLA 5DGQA 3DV4A 3IDIB 2LAAA 1UWGH 5BO1L 5AZEL 1BVKA 3CJJA 1CICD 2H3NA 2XN9E 1QSED 3O3AB 5DQ9A 3FQXA 3MRIB 5KAQG 3OX8B 5CBEA 3QQ9C 1VFBA 4Z6AT 3Q6GL 3KJ6H 1QLFA 1T03L 4W6XB 2XG4A 4XCEA 2Z8WC 5EORH 2JJUA 3DX7A 4KK5D 2XV6B 5D71H 4PRAB 3ZYOA 1BEYL 2VXQH 3MRMA 5HHVH 3BMVA 1DQTA 4NQDB 2DM7A 3QEQA 3RWGB 5J6HA 2I5YL 5FB8B 4FFWC 4WUUA 1VEPA 2NY5H 4PB0H 3T77B 5GZND 4X6EA 4EJ1C 1JJUA 3IETA 1MHHB 5J3HD 4FQPA 5BVPL 4OV6F 4Y19D 1RZ7H 2OJZH 2XZQH 4K3HA 4PFEA 2OMBA 4NQEA 4YWGH 3HC3H 5HY9A 1FVDA 4PJ9D 4QHKJ 4ZO6A 4Q9QL 3HFML 2SEBB 4LU5H 1EJ6A 1I8MB 2Q1EA 1CFSB 4P46C 2V2XA 4P4KD 4JJ5A 1X5ZA 1G7LA 1P6FA 4WNQB 2EH7H 1P84J 3B3IB 2HP4A 4D0CA 1IC7H 3DNKA 4RFOL 5F71A 3SJVB 1ADQL 5DA0B 1AH1A 4U6TA 3FTGB 4HF5L 1YNTA 4HKBB 4TTGA 3QXTA 3TO4C 5SWQA 1JF6A 3S35H 5IKCB 5HYSA 1L7IH 3BE1H 4NP4L 2NQCA 4EVNB 3FHQA 4MD4A 4EIZC 1N3NB 2NX5B 4L8SB 1BVLB 2IG2L 3K1DA 3ZE0E 3ESUF 5GGTH 4K94H 4KWUA 1I9RL 3NIDE 4OCXH 1FDLL 3HNVL 1IKFL 4HUUA 3X11B 1OLLA 4WUKH 3TH2T 3QDHA 4CADB 2RR3A 5CUSH 3ULVF 2EXYC 2YD2A 5HI5D 5DMGC 1EIBA 3PP4L 1PKQE 3CVHA 4E42B 2QHLA 1CG9B 3GMRA 5KOVC 1N7MH 1BQHG 3LMJH 4U2ZA 4ZAKA 5FKPB 1HH9B 1N6UA 1YECH 4TN9A 1NGPH 2X4PA 3D0LB 1HNFA 1JWSA 1HWHB 4EUPA 3MBEC 1BBJB 4G6KH 4G80B 4NFBA 4O2EB 3U7WL 2VLJB 3AS1A 4JQIH 4FP8L 3BKJH 3D85D 4PJXB 5ISZB 5LCVL 1GOGA 3SDAA 1MI5E 4P48A 3HB3D 4TUOA 1JI2A 2VZVA 5TF0A 1EXUA 3FT3A 2ID5A 4HK0B 4OLZH 1LK3L 4LK4A 3I6LD 3MUY1 4KVCL 3TBTB 5LJYH 2ICEA 1URLA 2F53B 3IU3B 5EBWB 4HFUL 5C6TH 3U0PA 2A73A 3G6AA 4CMHC 1FNEB 3G9AB 5E6IC 2I9TB 4KK8C 1KXVC 4JFDD 4G6MH 2W59A 4KMQA 5HPOA 3QR2A 1NAMB 3QZWA 3H9YA 3ULVD 3IFPA 2UZYB 3GBMH 1MRFH 1KENH 4KH2A 3K8MA 1Z9SA 4XI5D 1PKOA 3KPRE 1SBBA 3IRPX 5KAQF 5FM5M 4UILL 4OZHE 4YAQB 1MQKL 3GMQB 4PJEF 1JRHI 1F3JA 1NCNA 5C08A 3F7YA 1H3UA 5HI4C 3MLTB 5KANI 4J6RL 4HGWB 1B4RA 4KGLA 4XCYA 4O58H 4PGCB 3T0XA 4DN4H 5DR5H 2APVA 4YXKH 3X12A 4OIIH 4C4KO 2AJXH 3TF7C 4C54A 3WLWC 3D69A 3NZHH 3LKRA 2YD8A 1TLKA 1MFDH 4WTWA 1Q0YL 2AJZB 5FYLH 1E4KC 2HT2C 5T1LD 4B7IA 2IADB 2XQBH 1EAPB 3O4OC 3TVMA 2HJFB 1VFAA 4WRLA 1ETZA 4FQJL 1IGIH 3MRHB 4HX1B 2MKWA 3ZLQC 1DBBH 1G0YR 1MCQA 2DQIH 4R4ND 1Y6NR 4F7MA 4O5LL 1KIRB 3BPOC 4XPTH 1S5HB 1ACYH 1AI1H 4RA0C 4OGZA 1X5LA 4KI5F 5HHXH 2LU7A 4MQXD 1KPRA 2AAVA 4Z8FL 3DMMA 4R26H 3TZVC 4YXLH 5I73B 2OMNA 4OLEA 3CU7A 3O4LD 3QYCA 1QR4A 4MMZC 1SJVA 2UZIH 1C16A 1G7HB 3WUWA 2KQMA 2K9UA 3ARBA 1RJYA 5DF0A 3T65B 1KJ2A 3UAJD 3HC0B 5I66A 1UA6L 2WBJD 3LS5H 1W72L 3MRJA 2DQFB 1H15A 4G42B 3G04A 4PLOB 3LRGA 2YC1A 2F54D 2GAZA 4XP4H 5H8DA 1U8HB 2DS4A 2EDTA 4ODHL 3U4EA 1R5WA 1DBJH 4R96B 1I9IL 1KB9K 2DQJL 3SBWC 2CRZA 4HG4J 3KVQA 3UYRH 1MCHA 5KW9H 1BMGA 1WEJH 1KT2B 2IQAA 4BK4A 4JQVC 4RBPH 1NLDL 1MRDL 4ZXBD 1JE6A 2O5YL 4Y1AB 4F15C 1FC2D 1MJ8H 3QDME 3ZDXE 3W81A 4TUJA 5JA8B 2OZ4H 2BSSA 4OTXH 4DZBB 3LKSA 4IEFB 4LCWD 4KI5D 1JGUH 1C1EL 3W2DL 1EEQA 3U36B 3L5WA 3B83A 5SWSB 1BGXL 2J4WH 3B9AA 1OB1A 4Z0BH 1O5DT 4X7SH 3JWDH 4L29A 4CVXB 3O3AA 5HHMD 1TVBB 1HDMB 2P1YA 4R8WL 3H0TB 1K6QH 3LB6C 4R0LB 4P2QB 5DMIH 9CGTA 1WWBX 4JR9L 4XZUA 4APQD 1TETH 4PRAA 2FJHB 4Z76A 3BFOA 5FUZL 4N0RA 1J0KA 1ONQB 3V9FA 3RWGA 2DIJA 4WV1A 4K3EL 4NO2A 2BNUA 3MV01 4QHLB 3OZ9L 4GW5B 4NYLB 2QQLH 1IGMH 4UQ2B 3O2VH 4QLRA 4KKBD 3VE0B 3LKPB 1KTLA 2MOVA 5DD0H 4UT9L 5F7DA 3DBXA 5DRZB 3V6OC 1WWCA 2W9DH 3BN3B 4WTXA 4G7YL 3IDGB 4HBQA 5JHDE 5JOEA 3I2CL 4DVRH 4X4YA 4M9PA 5DMKA 1EBAA 1U8OB 1CXLA 1OAUH 1RU9H 3QWRD 1KUMA 5TGBB 1PBYA 4YHNA 2OTUB 4RMVA 3VWKD 4GAJH 3CXDL 5J1TC 3CZFB 5E9DB 1CD8A 3N1QC 1NANI 4QT5A 3FO1B 4HKBA 3HRZA 2XN9D 3DECA 3K8LA 3LH2L 2VWEE 2ARJB 2YN5A 1M7IA 1WBYB 2WWMC 5HHOE 5HI3C 5C09E 1T7VA 4EVNA 3V79C 3HA0A 4BSVB 3VFVB 4L8SA 5HPMB 2DQTL 5EO1B 4YEFA 3BH9B 1MY5A 3IDYB 4M7JL 4BH8A 4K71B 1NCBH 5DQJA 1TPXB 1GGCL 2X05A 1JHLL 1X5AA 4OD1H 5ICZA 4JLRB 2VAJA 5CMAA 1MFEH 3RGVD 4NM8L 3N06B 3QUZA 3O3BB 4WWID 5C0DB 3T8XB 2Q8AL 3C60D 1NBYB 2F58L 1KXQE 5GRJL 1UYWH 3CK0L 2NZ9D 5F8QC 1I1CA 2ERJB 4Z9KB 3ZE0F 1MCBA 3ARFB 4LSPH 4G6FB 3NIDF 4B0MM 1AXTL 4MJ5A 3OF6D 3D0LA 5EG6C 4OFYD 1KBGL 2BERA 4BSWA 1BBJA 1R3JA 3JV6A 1CXIA 5CD3B 2IAMD 3ECBA 5BS0A 4KJPD 1FG9C 5ISZA 1P9MC 1BIIA 1IQDB 4CVWA 3C8KA 5E8DL 3U46A 3QFJE 4XMPL 1IBGL 3E8UH 1Z3GL 1QHOA 1VB9A 5B39A 2R9HD 4Y5XA 3IU3A 1IM3B 1UVQA 1RZIB 5DHYA 1LNUA 5LAXB 2YBRB 5LGHL 4CDGC 4XBEL 4OZFG 4GLRI 1YMMB 1NFDB 5DK2A 2ADFL 1NAMA 4X5XA 1MCDA 1BX2B 5CJXC 4X4XA 3HE7B 2ESVE 4HH9B 3WHE1 5D1QA 4EI5C 3TIEB 1D5MA 1AXIB 4H8WL 4YAQA 2VDOL 5EA0L 1S7VB 4MA7H 4FZEL 4WJ5B 4ZXBA 3D25B 3BGFC 3OB0H 3OKNA 5KN5A 32C2A 3P9LB 3F7VB 3MFFA 5BOPA 1ES0B 5IW6A 1YUHB 2EDNA 2NY3D 3KYAA 2YXMA 4OZHF 2V5TA 1FC1A 4EI6B 3O6FC 1V5JA 5GIRB 4P23D 4RAVB 3VG0H 3B4NA 4ONHA 5CLWA 3KYKH 1MCEA 1A3QA 3MZTA 4O9HL 3O6LL 4XWGH 1IAII 1NUDA 1MI5D 1V7MH 1JPFB 3CCHB 4PJ8B 3RPIA 1IM9B 5HDBF 1RULH 2V2TB 5GGUB 4JY6B 4RFNB 4C57C 3N9GH 5CINL 3DTXB 1R3HA 1JGLL 1KIRA 1XIWD 4MD5A 3GM0A 2MHAB 3P4NB 3U4AA 4NNXA 5C0GB 5K93A 1CDBA 1WFNA 2Q76B 3AREC 5F7EH 4MXWL 4YR6B 1J0HA 3MRBA 5CGYD 5CWSA 4JZNB 4QHKI 1FRGL 1MCWW 4N90E 1P4LA 3S96A 1HYRC 3SGJC 4YXHH 1CN4A 3BZFB 1IAIM 1C08B 4N1CA 3SE4C 3VFMA 3AXLB 1YY9C 4FTVB 5T1KB 5D2NE 3WFDH 4K8RH 1MRCL 3GKWH 5F97E 1F11A 1OAZH 4JM2C 4GKNA 4NNYA 3KGRA 5DJ2A 3RZCB 3BDYL 3AS3A 5E95B 4KTEH 5CZVL 1HNGA 3IVKA 4M6MH 5JUEH 1DL7H 5J89A 2VRAA 3WJLA 1FFPB 2P45B 3VXRE 1A6PA 2DI7A 4PJBE 3QH3B 2B39A 1XGUA 2JIXD 5D1XA 1WZLA 3PV7A 1A6AA 1WV7T 1I9EA 1IL1B 1YEFH 1S7QB 1JN6B 1J1PH 2BSRA 2Q7YA 3QCTL 2OL3A 3CVHL 4L9DA 5F3HB 5E5MB 2P24A 4J3WA 3ZDXF 4ELKA 5TE4L 5ECJE 2E9BA 2W0LA 1IQWH 4YQXH 5JXAL 1PG7H 5D9SA 2YR3A 3H0TA 1T2JA 4CUCA 4HIEB 3WNPA 1BHGA 3UC0H 4PTUB 5IHUL 5F7WC 1IARB 2R0LL 3KDMB 5ERWB 2DJUA 4LARH 3VA2C 1F90H 2HTLD 2X1WL 5T3ZE 1WIOA 4L4VB 4QYOA 5GS0C 1G7JB 4J2XA 4DEPC 4BFIB 5C2BH 3WN5C 5JR1H 1FNGB 3LKPA 5FYJH 4UV4L 3T09A 5D6DA 3T4AA 4LPCA 2CUHA 4N9GB 2Q3AA 3BP4A 4E5XA 5A40E 1TJIH 3BW9A 5BZWA 4O2FB 3CFDA 4MCZB 3ZYJA 1GAFH 4MA8H 3ROLA 4EBQH 3FOLB 5HGBA 2JLLA 3E3QC 3QIWB 1YNKH 2CH8A 3IDMB 1K4DB 2Z31B 3GSVA 4MVBC 3ARWA 4YHZL 1JI1A 1I3RA 1NCDL 3MNZA 4XCCL 5B21A 3QDMD 3AU1A 4JPKL 4TVPL 4LRIA 1A7NH 2C3XA 4Z78B 1MCIA 2YWYA 4TULL 1OGAD 3DXAB 1AXSA 1IAIL 1U3HC 4ZDHA 3QIBB 4NQSB 1WK0A 4TOYL 1HXYA 3QAZB 2QR0B 2XACC 4U3HA 1U93B 4GRWE 4WI6A 5K33A 5MENA 2ARJA 4QY8A 4LMQI 2WLYA 1WBYA 3D3VB 3O2DA 3VFVA 1EGJA 3GI9L 1YQVH 3IDXH 4Y16A 3W39B 1N64H 1FBIL 2PYFA 3L6FB 1DVFA 4MDJB 5BQ7B 2DQGH 4KKAC 1KCRL 5TE7H 4E0RB 4JREC 5D1ZB 3AC0A 1ZLUH 2RB8A 1NBZA 3S34H 1KN2L 2AJYL 1RFDL 5GGRB 5DWUL 4CRPA 2FEDD 2AXFB 4UAOC 3UDWC 3CSGA 3HNTH 3VXSA 4ODBD 3CX5K 2BK8A 4LPXA 1T5WB 1MI5A 4JZJB 3MRKA 3ARFA 1TVDA 5E7BA 5BZDB 1RUML 5D93C 4G9DA 2DTSA 2Q8BH 5JHDD 4PYGA 1MVUB 5E8OB 5JORB 1B0GA 5J8OA 1ZOXA 4LLVB 2BDNL 2ITCA 3AM8C 1S7WA 1XIWA 2APXA 3KJ4B 4N0UE 4YDLB 4JDVB 3QBTB 4XNXL 4KQ3H 5IBTH 1KJ2L 5CEXA 4YX2H 3CPLB 4J8RA 1NCAL 4JRYA 2H6PA 5GGSA 4XVSH 4DTGL 3EUUA 1UB5A 4BZ2H 2NY1D 4NO5A 3RTQC 2EECA 2OP4L 4F57H 5ESAB 4R2GD 1PY4A 1IM3A 3NCJH 3CMOL 4OV5A 5HXMA 3KPRA 1AFVL 3Q5TA 4KKCC 5IB3B 2YBRA 3IXTA 4JFXA 3ARGA 1EFXD 4IOIB 35C8H 2FR4A 4WI9A 3CSYB 4KQ4H 3QIUC 2XKSA 3BP7A 5HHOD 5C09D 4PRHA 4KJYB 1L7IL 4HS3B 3BE1L 5ACZB 4GQPH 2EIZA 4GQ9L 3TESA 1CFQA 4IDJL 4DVBA 5D8JL 2Z91B 3T0BA 4DAGH 1M05A 4S0TD 5KSVB 3F6LA 4WO4D 2DRUA 2HWZL 5ANME 3C2AL 4CJ1A 4GH7B 1RQ5A 4PGDA 5C0CE 5EZLB 4XNUL 5D7LD 2X1XR 3EOTL 3EZJB 5KSUB 2R1XA 1OQOA 4PREA 1IC5L 2OJEB 1FYTD 3F7VA 2HRPL 4WUKL 3U7AA 3EYOB 1ES0A 1FFOA 3EAKA 3GZKA 4PJ7B 3EBAA 3P77B 3ZKXC 4L3EE 4NC1C 2P43B 1TXKA 1SYVB 1X3DA 2UV3A 4K07A 4YGVB 3BP6A 1YECL 4U1GB 3JWOL 4OGAD 3U83A 4ZSOE 4BUGA 3O6MH 5HYQB 3HI1A 4GMTH 4G6KL 4YUEH 3QFJD 1XF5B 4PJDB 1X44A 4K7PH 1PEZA 1IEAB 5D96C 1UQSA 2PR4H 1K8DA 4KTDL 3VA6A 2NY6B 3WKNA 3RX8A 1KLUA 1MCPL 5JXEA 4MA1C 4LKXB 1QBAA 2MHAA 5C6TL 3UTTE 3LQZB 1L7TL 1RZ8B 4Y4KD 2G2RA 1AD0B 5GGVY 4P5KB 4PUBL 1S7XA 2WW8A 1ACZA 5FDWB 1XFPA 5I6XB 3PG2A 4M3KB 2AEWA 4RIRA 2BVOB 2ESVD 4XXDB 3LPWA 43CAA 2W1NA 4J12A 1KSRA 3EOAA 3MUGA 4WWKA 1WBZA 2ZPKL 5CHNA 1J8KA 2ICWA 4G8IA 3DURA 3K2UL 12E8H 1I7UA 4HQQH 4PJFE 3RDTC 4I2XB 1IC4H 5SWZE 3TYGH 4Y8AA 3RWFA 3O81A 2NXYB 5I8EA 5L88H 1E4WL 1J1XH 4YXKL 4D94A 1MHEA 2QSVA 5KVFH 1DE4A 2AJXL 1JZ3A 1NGZB 2MQ3A 4F2MB 2WAHA 5I2IB 1U91B 2C7UB 5B4MC 4YDKH 1KEGL 4J7RA 4LLQB 4PS4H 4GXUN 2BXZA 2MQCA 4QRPB 1J10A 5IVXA 2PYEA 2PXYD 3ARYA 3VRJB 4ORZC 2AERT 3EFFB 4WHTA 1KPVA 3RNKB 2FD6H 2NY4D 1T04A 1PEWA 1CVSC 3GRWA 4TYUA 4MAYC 1YYML 4TPRH 3QDJB 1LDSA 2VSDA 4BA8A 3GO1H 1D5XA 5B38G 4PJBF 2C5DC 4YO0A 2E7BA 1NC4B 4MJIA 4F8TA 3WE6A 2IWGA 1MCLA 1G6RA 2X4SA 4N90D 4U1IA 5ERWA 4HDIA 4JFFE 1XH3A 4K7FA 2QQNH 4D8PA 2GSIB 2FATL 5FUOH 4L4VA 3KPSA 3TT1L 3SO3B 4DGIL 3GIZH 5IFAH 3FB7A 4HUNB 2QBWA 1ZAGA 3HNSL 3NCFB 4Q6IC 2R39A 5D7IF 5FM5O 1C5BH 5A2KH 4L4TA 1OWRM 1OSZB 3V0WH 2MNUA 5BV7L 2DQDH 4UB0L 3KPNB 5J56B 1KLGB 1NAML 3O11B 1MNUL 2WBKA 3RP1A 1BFOB 5F88B 5AG8A 5HGHA 1FNLA 3IDMA 3ARRA 1YEGH 4LHUA 4OD2A 1P2CA 2N56A 5MEPB 3VH8B 1UC6A 4NCC1 4U1MA 5K9QG 4OSUH 15C8H 4KKLD 1SY6H 4FG6C 2EYRB 1MJ8L 4IS6A 4Z78A 1MF2L 3VXRD 4WHDA 1AQKL 3MJ8A 3QI9D 3T08A 1SJEA 2KH2B 5I1LB 1E27B 1MJUL 3LIZL 4D9RE 2P8MA 4KRPD 2HFGL 3DUUB 2FHCA 3GSOB 4QRRA 1T1YB 3G6DL 5IQ9A 4BELD 4OB5L 4DFHA 5DK3A 4D0BA 2QR0A 1AGEA 1VPOH 2VQ1A 2P5WD 3VD4A 3PWNB 1XF2A 4LASL 2F15A 5IUSA 5J1SC 2H2PC 3HR6A 3STZB 4PV8B 3BO8B 1Q9OA 4HWEH 1UM4L 2QHRH 4XPAH 2AK4B 5ITBH 2MMXA 1QLEL 1QSEB 4GRWF 2ORBH 4YHML 3I6GB 2PCPA 3RUGB 4OZGB 4ODTH 2GSGA 5GGRA 43C9B 1MLCB 4YC2B 5IFHH 2YUVA 1XGYL 2GIYA 1H8OA 1TCRB 4IMKA 1BAFH 1UXWA 1RZKH 3MRFB 2VJXA 4JZJA 3UJIL 4WU5A 5CLTA 5IMKA 1H5BA 2YOCA 1QNZL 2CUMA 3UJTL 3DWTA 4HC1H 1A64A 3QUYC 1DFBH 1YPZA 3U9PH 4B41A 3HLAA 3QEHA 3MOAH 2AJVL 3T2PA 1Z9MA 3DO3A 5IBLC 4Y19B 4JO1H 1P7QB 1CI5A 4GG6E 4X6CB 3QXWA 4L5FL 1TVHB 2B1AH 4NWUH 4QO1A 5EDXA 3VFWB 1MUJA 1W0WB 2Y06L 5FCUL 5KZCD 1VEMA 5I1GH 1EHLL 1EUTA 1E28B 1RK1A 4P4KB 4GRLA 3NBNA 1JTOA 4UUJA 2MTPA 2QADC 5FO7A 3RAJL 3DV6B 2NY2B 4PRNB 3RNQB 4G9FA 4W70A 1C12A 1FN4A 1NL0H 2BP3A 3RL1A 3MA9H 4AT6A 1GSMA 3JTTA 4XNMB 3MLXH 4I0CC 2A2QT 1CLOH 1XF3A 4U7SA 4R97C 1QRNB 3LKQA 2OL3L 1ED3A 3MOQA 4NQUA 1JF5A 3QXDB 3RVXC 4CJ0A 2AXGB 4AEIH 1ODAA 3ARDD 1PLGL 2FB4L 1A6VL 1DLHA 3DGCR 1OTUC 2FX8H 1JNLH 4IM8A 2OI9B 4PBWD 1RVFH 3G5ZB 5JMRA 1JGVL 2H26B 1IKNC 4NC0B 4Y4HC 3CUPB 5HYQA 2EO1A 3UBXA 1PFCA 4R9HA 2DIAA 5IHZA 3MLSL 2HT4C 3JV5A 4Y2DD 3BZEB 5DRXB 4GBXA 1OGTB 5CJQH 1I7ZA 5JW5B 3T0AA 3MXVL 1GIGH 2YEZB 3FFDB 4NRZB 3MV7A 5E8EB 2E7MA 2VDLH 5C0EA 4U0RB 1AP2A 3TWCH 2YA1A 4LKXA 4L4JA 3P3YA 5EU7E 5IV2A 3RVUD 2CJUL 3D85B 2FIKB 5C1MB 4YHIA 2XG5A 4AIZA 5EZOH 1H0DB 3EDEA 5D2NA 3W5MA 5F70A 5E4EC 1JHKH 2ZKHL 4ZUTA 2GT9B 1KCUH 3O9WA 3WS3B 4LCUB 3VMPA 3C5JB 4IRJA 4KAQL 4UTBL 3MLZH 2HT3C 2GJJA 4RAUA 4OLYH 2XT1B 1JL8A 4X6BB 4JFDB 3TPUB 3LHPH 2G5RA 1I1AA 3IU4L 3NH7H 3V0AC 5C0CD 5BJTB 1MFNA 4M6NL 1WWAX 5FKAB 5IJKA 3BKYL 2R2HA 1AQDA 1K5NA 2K1MA 4PJCE 3DUSB 3MCLL 3O2DL 1N5YH 1BBDH 1HIMH 4FQXA 1A4JA 4I77H 3DGGB 4L3ED 5AUMA 5H37G 5IOPA 3HAEB 3MA7B 1F4YH 1EGJL 4P2OD 5I0ZA 3T1WA 5TE6H 1R5VB 1CZ8L 1AO7E 4PJFF 4YFLF 1N5AB 3C6LD 5K9OA 5D7IA 2HJKA 1LK2B 1KXTB 2ZG3A 3MLVL 2VISB 2EDEA 1JZ5A 5KSAD 4PJHE 4ZFOB 3W0WE 1MPAL 3MNVA 3T3ME 1OAYH 3N9GL 5T1LB 2B2XL 3VWJC 3GHEL 3G9VA 2DJSA 2BRRH 3SE3C 2V2WB 4QCIB 2ZOLB 4U1NA 5F7EL 2OQJB 4LNVA 5T3XE 2IBGA 3WL9B 3B9EA 3ZHLA 3ZTNH 2F74A 5EC1B 4CNIB 5EN2B 4HBCH 3PQYA 2EXWC 5EUKA 5EOCH 4LCCC 1ZS8B 3IFLL 4FXKA 2FH6A 2DMKA 3VFTB 4PLJC 4PJEB 4LNRA 5FOBB 1I1FB 5ESVA 4U6XA 1OHQA 2OR7A 3GFUA 5GS1C 5SWZD 3O4LB 1L0QA 4YHKH 1TITA 4I0PA 2HVJB 2BVYA 3HE6C 1TZGH 3I6KA 3SKNB 3ZSTA 4G6JH 1CLZL 2PO6D 4M7LT 5EWIH 3RZWA 5CKAA 3VH8A 2WBJB 3MRNA 3IFOA 4L9LA 1ZT7B 3O0RH 3HI6H 2EYRA 4XP5L 3X3FL 2F54B 5JDJA 1JPSH 1QEWB 5I1JH 2HLFC 1U42A 5EU4A 3ULVH 2E7CA 3VRLE 3V2AR 2ICES 2BNQE 2DLHA 3B6SB 3EYVB 4YE4H 3DUUA 1KTDA 3EJYD 4NM4L 3BEWB 3QHTC 2OXHA 4M93C 1HSAA 1YEFL 3HAEH 3PV6B 1J1PL 5JNYA 5DSCA 4XC3H 1CXKA 3P30L 3FT4B 1VADB 2M2DA 5IMLA 2XPGB 3BP5A 4QF1B 1T1ZB 3BO8A 4JANB 1QBLL 4WW2B 4JFFD 4NN5C 2CXKA 4KHXH 2AK4A 3NTCH 4S1DD 3BGMA 4UIKL 1IMHC 3NACL 5HHMB 1QFUL 4NNPL 1F90L 5C07A 1SYSB 1UXSB 2NW3A 2G9HB 5FM4A 4NJAL 1QSFE 3GSWB 3U79A 2E7HA 1HEZB 3BHBB 5KG9B 1OSPL 3PIQA 3IJHB 4PGZA 5EU3A 4APQB 2WV3A 2A9NH 3V6OE 3ILQD 1B2WL 1JUFB 4JAMB 3V6FB 3A67H 1JK8A 4TNWK 4ONFL 2A6DB 3UO1L 1E6OL 2VDRH 2A9ML 1RJLA 2N7AA 4CVZA 3F58H 3TN0D 4XVJH 4RGMB 4NJ9H 1Q1JL 3KXFA 2NXZC 3KPOB 3H7BB 5E5UB 3OHXB 1P7QA 5CZXD 5EBMB 1BQHB 3LDBB 3MRGB 2VDNL 3QXAB 2HRLA 4FQ1L 4X6CA 5JZ7C 2F5AL 3S36L 3FQNA 3WJJA 4S2SA 1RUQL 1T5XB 1UKQA 2DN7A 1JGEB 3IJSB 1UCBH 2ED9A 5CEZE 4MX7B 2OCFD 2K3TA 2X4NA 1OT1A 5AYQA 4K9EH 1D6EB 1VFUA 2DBLL 3VWKB 5C8JB 1WC7A 1NGYB 4U6VL 4KXZI 4GG6F 2CDEB 2R23A 3PHQB 3VGHA 4NZRL 3BUTA 3B9KC 2I60H 2X09A 4P3CH 3OJVC 3ULUE 3VGEA 1XGQB 1EPFA 5EC2B 1FFNA 1I1YA 4L3EA 1TCMA 2O5ZL 4KZDH 2XN9B 4M3JA 3BZ4B 4S1RL 1S9VB 1YEIH 4GKSB 1JVKA 3BWAA 2C4FT 3NGBC 1TQBB 4JY4A 5SV4A 1FVEB 4P5TA 3E6FB 4J3UA 2WUCL 3GRWL 4JEGB 2X70B 4R90L 3S34L 2XWJB 1OY3B 4JFEA 1C5DB 4LPYA 3V5KB 5K9JH 1R3IH 3L9RA 2NTFA 1T0NA 3JTSB 4ZS7H 4Z77A 2KPNA 4G8GE 1A7OH 1G6RL 3C08H 3RGVB 3RX7A 4HUVA 3U2SA 5DJ6A 1KB5A 3VGAC 5DJCB 4XH2A 1CFNB 5BXFA 3C60B 3G5XB 3R1GL 3UTTA 2Q86A 3BZEA 3U30C 2APTA 3CFIC 3FFDA 1SM3H 4FFVC 3INUL 2X4UB 1QQDB 1OW0A 4LCYA 3TO4D 5D7KD 4N68A 2IAMB 2FIKA 3TVMC 4M62L 1NCWH 5J12C 5DHVA 2XZCH 1ND0B 35C8L 1KULA 3F12B 2W60A 3UBXI 1I4FB 1FH5L 4YH6A 4LSTH 3ARQA 3I3DA 1FGNH 4OAWA 2V17H 1FQ9C 3L3GB 2NY5C 5T33H 3T0ED 1FNAA 1ZKAA 5C0BB 4OZIB 3MRCA 3MYJA 3TT3H 1FO0B 1IRAY 1P7KB 4FQ2L 3SGEH 4U1KA 4CMMB 1EHXA 1JGDB 2DLFL 5MERB 2R1YB 3WFHA 2X41A 5IVOA 3ARVA 1N4XL 1Q38A 5JO5B 5EOQH 3CFCL 4RMQA 5D7JA 4LHQB 3MA7A 1F42A 1JYWA 3OAZK 2AEQH 2BHUA 5DJZB 2X89A 3EFDH 3MBED 4FMKA 4XP9H 4DUVA 2PW2B 2DYPD 4MNHA 3MCKA 4I5BA 4U1SB 3GUTB 3EO0B 1N5AA 1A7RH 4XP6H 3DO7B 1PKQB 5FECB 2Y6SC 4PJCF 1G84A 1RURL 3HS0A 2ADGA 2NY3B 3KYNA 2VISA 1HZHH 4Y4FA 3WFEL 4H26B 4QHNB 4P23B 4PJ5A 3LKOB 3R0NA 5FHAH 5L7XL 4LSUL 5C0FA 1AKJA 4ZTPH 3MR9B 2CDGA 4PP1D 2V2WA 4QCIA 2AXJA 1ORSA 4I3RL 3OPZL 4K94C 4R4BB 4IOFC 4PJHF 1T83A 4MDIA 2DDQH 3OBAA 4Z7VE 1SVCP 5CSZA 4WTZG 3T3MF 4ZUSB 4OGXL 1CFBA 2BVEA 4PRIE 1ZS8A 4TTDD 2R0KH 3VFTA 1LO4H 3BH8B 5HI4D 4UU9B 1I1FA 4CW1B 3OXSB 4P59L 1YJDH 3L5IA 4WVRA 1SBSL 3HR5B 1IC4L 1PYWA 1RHHB 3TYGL 3WLWD 1BFSA 2AXHA 2Q87A 4YNYB 1FAKT 3DROB 4OZHB 5A3ID 1N59B 2HJLA 1H3PH 1I8IB 4F7EB 5FFLA 3SDCD 2DQUL 2VSCA 5ADPH 2ILLA 2ZWLT 1WCBB 3B2UC 2HT2D 2Z8RA 4GAFB 4HPOH 1AO7D 1FO0H 3LEYL 5GRWA 4HUKB 4DW2H 3ULSA 4P57B 3GSNA 4PJAF 2CLRA 2OBGA 1R5IA 1FG2B 5H2BA 2XXMB 1F3RB 2H41A 3S88H 2GJ6E 2I9LA 3W0WD 4ALAL 3PGCA 4PBXA 3RPKA 4PY7B 5TQ2L 2GTWA 4YDIH 1AC6A 2FX9H 1F3DH 5H35A 1FPTL 2R15A 4OCYL 5ALBL 2XYCA 2AI0L 1OM3L 3TZVD 3VRLF 3WO3B 2JIXB 4X99B 3QPXL 5T3XD 3QQ4A 4QRQB 3QQ3A 5CIPA 1KJ3L 3ES6A 1LD9B 4M5YH 4U3CA 4WEBL 1X7QA 2XOTA 1CQYA 3S4SG 1UXSA 3QNZB 4GW1B 4POUB 5FUOL 3LV3B 1F58H 1IGTB 1NCCL 4HXAH 4C56A 1UM6L 4JVUA 4B53A 4YHPB 4P46A 4L8SC 5J57B 1IFHH 1U8PA 4ZMAT 1KJMA 4NFCA 5LXGL 1A3RL 1QYGH 4XB8A 1PSKH 1AGDB 4U6HA 1JUFA 1AE6L 1F3DJ 2C3VB 3E3QE 3P4MB 1CFVH 2BFVL 5GSVB 4ONGH 1J7VR 2FEEI 5F9JA 4Z7QE 3QUZC 2VXTH 2JCCE 5F1IB 5CEYA 4ZFZA 1DBMH 8CGTA 2D0FA 4V2BA 3G5YA 3L3OB 4KPHL 3EJZD 3IKCA 4M48L 2BNQD 1Y18A 1CBVH 1YEKL 2CGRH 3SDDD 3RWCB 3L5HA 4NKQB 4MXQD 3CFJA 4O4YL 3BQUA 3QDGA 5L6YH 3L7FB 4AL8H 3GMPB 3AAZA 1HE7A 2JJVA 3TFKD 3CD4A 2VDPH 3LB6D 2HVKB 3QA3A 1OGAB 5I18H 1YNLH 1RK0A 2D03L 1KYOK 1ZGLB 2WMPA 2V9TA 1FZJB 1S8DA 5IEKB 4OZFB 5FAAA 2R4RH 2GEEA 5C0JA 1UH2A 2XTLA 3RWJA 4NO3B 4A6YA 1DSFH 3MO1B 4HWZB 4MNQE 4MA3B 1J05A 5T3ZL 3PL6B 4ODTL 4OBSA 3ULUF 1A2YB 1MREL 2P49B 4NSKB 4PTTB 1R0AH 1YEEH 3QULB 5DJDA 2NW2A 4F8QA 4HJ0C 1A6UL 5J0BA 1P4BH 4OFPA 1OF2A 1EEZA 1GZPB 6FABH 2XWBB 5E6IA 1RIVH 3MQIA 3GSUA 2R1WA 5I17A 2H9GB 5IP4A 3RVWD 2PUQT 5F7YC 5HDOA 4FFZH 1HHJA 2A83B 4R7NB 3L3JA 4RGOL 2RJMA 3DX8A 4JO1L 4DCQB 2FZ3A 5JHDB 2X7LA 3HCVB 4LOUC 1DZBA 4L8CB 5CEZD 1PJ9A 3MV9A 1YEHH 3V7AE 2WWMD 5C0RL 1RJZB 2BY0A 5GISH 3BPLB 5I1GL 3T4YB 4JKMA 3F12A 4HT1H 1O7SA 1RV6X 5IROC 4OM1L 2LAGB 2NY1B 4XTRC 4N8PA 3J7HA 1BQLL 2M8XA 5CP7B 2VH5H 4R2GB 2GHWB 3ULUD 5C86A 2H2SD 5I1DB 1CE1H 5K9KB 1EFXB 3P9MA 5C0BA 3MA9L 3V0VA 3WKML 1JIBA 1FP5A 1MFCL 2YD5A 4JB9H 1KCVL 4C55A 5HHOB 5C09B 2DQHH 5AG9A 1CD1B 3U0TB 4LBEA 1E4KA 3DIFA 2XIDA 1GOHA 4FZ8L 3VFNB 4I18A 1HK6A 4PPTA 5I73C 1BIHA 4YPJA 1DANT 5E8NB 1LO0H 3UTZB 4ESKA 3OKEA 3FB6A 4WO4B 3O2WH 3HN3A 4FQIH 1F6FB 5DJZA 3DETC 4G8GD 4I9WE 4OZFH 4PJHA 5D7LB 4MXVE 1UACH 4HH8A 4YFEA 4U1SA 3GUTA 1FYTB 1NGXA 2YRZA 5GGVH 4JO3H 3P2TA 4JPIA 5JOFB 3DJ9A 5FA3A 1LEIA 2ATKA 4RAHA 3IS1X 3KR3H 1KIPB 4NN6B 4N5EC 4AG4H 5HYJE 3FN9A 2HYMA 2CR6A 1FNFA 3DYPA 3OKLB 5CJQL 5EIIB 3RVTD 3MJ9H 4ZG1A 5EPMB 1WVZA 2VDLL 5I1HL 2VLME 4ODXA 1AY1L 4LLWB 2FO4A 3TO2A 2VL5A 3ARSA 1T3FB 3E1F1 3QFJB 1ZHKA 1O7VA 4U7KA 2DQCL 5D1XC 4D0DB 5JDSA 3TJEL 1JHKL 2VKXA 2ZUYA 3SBWA 3RKDC 4KMLB 4X9IA 4PJAA 2AS5M 1EO7A 2ZCHL 2L0DA 3WS6A 3MLWH 1ZVYA 1XF4B 4Y4KB 3K7UA 4R0LC 4JG0H 4H20L 2UY6A 3C09C 4PB9H 2W9LA 5T1MA 2J6EA 4I0KA 2ESVB 1KJVA 4ORGB 4LLDB 1SHMA 1A02N 2GFBB 2AJ3B 4OKVB 3EYQC 3O6FD 1Q9WB 1N59A 1I8IA 5DLMH 4IIQB 1R24B 1F4YL 1RZFL 2HG5A 2VXSL 2NTSP 1BFVH 1V7NH 4JM2F 4RWYL 1U92B 2ZUUA 2ZCLH 3GMNA 2GY5A 4B50A 1DN0A 2CUIA 5CD5C 3CC5A 4FNLL 2ZUQB 1HILA 4KJQC 3LRSA 4OUUA 2WINA 3AS2A 1VDGA 2JB6B 4YK4B 6CGTA 3ARED 4MQ7B 4GG8B 4LPVA 4ZS6C 2XZAL 3QHZH 2PXYB 4JO2H 4RDQG 1QSFA 3V7AG 4LLUB 1KB5L 1PW3A 3C5ZA 4GRMB 4QRQA 1G7IB 4LIQL 4RISH 3FZUC 2BY2A 2VNCA 1XEDA 2NY4B 4M8QA 4ZPTB 4QRSA 4POYA 1QG3A 1XGPB 5D5MB 4E41D 3S5LA 3ZTNL 3UPRB 4X6DB 1NGWB 1MOEA 4JKPH 1BJ8A 3QNZA 2ZOKA 4OF0A 4UV7H 4XBGB 1QFHA 3W11C 3ZYZA 3EIFA 5DUPL 1IGTA 4U33A 4KKNA 3FO2A 1NAKH 4YHPA 3WO4C 3BESR 1WFOA 4XAKD 2BOBA 2CIIB 4JM2D 3IDYC 4NHCL 1F6AA 3RX5A 2VLKE 3T2NL 4K71C 5JMOC 4HCRA 4OLUH 5I1AB 3BN9C 1TPXC 5ETUA 4BK5A 3P4MA 2Y5TB 2J8HA 4F37K 1QLRA 2EDRA 3VFRB 4K2UL 1UWEH 3BKMH 5KSBA 4WDIB 4AEHL 3GJEA 2A0LD 4Z95L 5D2LF 1MJ7L 4HPYH 1NFKA 3OGCA 3LN4B 1SEBA 2CQVA 2W9EH 2ERJC 3OAYH 1G7PA 4H1LA 1U8KB 3L3OA 4JFOB 4P5MB 2GJZB 3ARFC 3QUXD 5KVEL 4NN7C 1KPUB 5L2JB 3KLAA 5F9WB 2LE9A 3A6BH 2GJ6D 1A6ZB 4Z7QF 1U58B 2BCKA 1IGJB 2JCCF 4MB5A 4MZ2A 3BVNA 4PR5A 4TSAL 3VXRB 3QI9B 4R6UA 4PJBB 5IK3A 3ZZ1A 2AJSL 2HN7B 3QO0B 2J8OA 4KRPB 5J1AA 3RWHB 2D7QA 3NIGE 3BWUC 1FZJA 1TZHA 3OR7B 2J8UF 4OZFA 4RWHA 5CP3A 1KCSL 5I30L 4K8RC 3FKUS 1G7QA 1RUPH 2F9BT 2P5WB 3NTCL 4UINL 5HGDB 4XAWH 1AR2A 4ZNCD 4HKXA 1UM5H 4HWZA 3SGEI 1YEDA 2AW2A 4WFGE 5DEGA 1FIGL 3PL6A 1KC5H 1P9MA 3MGTB 1S78D 1N26A 2PW1B 1T20A 4NHUB 4YHLH 3WHXA 1T4KA 1EK3A 1BZ9A 4KROD 2XWTB 1U8JA 1NMBL 2A74A 2C4FU 2UYLA 3RJQB 5EZIH 4GXVH 2VDRL 1LEGA 1AHWA 4M7LL 3UJJL 3QNYA 1XR8B 4MZ3A 4HMDA 5ICYB 3GMOB 2M1KA 1BREA 3WXWH 5I8CB 3SCMA 5CJXA 1D5ZA 5FYKE 5FEBA 4EI5A 2GK0B 3STBA 2F19H 1NBVL 3RIAK 1DCLA 2EE3A 3TIDB 2HKFH 4PP2B 1NC2D 1NJ9A 3KYMB 3EKCA 1U8QB 3WXVH 2VLRB 3RU8H 4MJ6A 3PHOB 4PJ8C 2NR6C 5MEQB 2EC9U 4X8JA 3NA4A 4RFNC 5JXEC 4HLZH 1NFIB 3CX5J 4KKAD 2DMBA 4JY5H 1TZIA 5KZCB 3GSNL 3MBXL 4RSVA 2GQHA 4GRWB 4NOBA 4RDQF 4RGNC 4BM7A 4OT1L 3NAAL 1PQZB 5AYUH 4F9LA 4AJ0A 1MEXL 3TC9A 1UGNA 2HLAA 4ETQB 4MNQD 5FA4B 3RIFF 3CLEH 3NFSL 5A2LH 3UTZA 5E2UL 3X17A 3BYYA 1P5VA 1BJ1J 5CILL 3PJSB 1T80A 1DQQB 1QHPA 4OUOA 3QCUL 4LSRH 3JXAA 1HXMB 3VXUE 4KHTH 5DT1L 4X7EC 3K4AA 3KHOA 3KG5A 3ARDB 3F8UB 3RZCC 1Q72H 3SGJA 1Q0XH 5FO9A 1ZT4B 3CFBB 4MXVF 1HHKA 3C5SB 4KKCD 4N0UB 3SE4A 4PRIA 1A8JH 1KIQB 3SDXE 2V7HB 3VFUA 1B4JH 3H42L 4ZNEE 4Y2DB 4FQCL 1MELA 2BVPB 3OV6A 3RY4A 2XZCL 1J1OH 4LF3B 1QBMH 5DJXB 3GM8A 4JM2A 1INEH 1QFOA 2PTVA 1JV5A 3QUKB 1BQSA 5B38B 5IHBA 2EEDA 3ZKQD 2V17L 3RVVC 5FUCE 3KLHD 3IXAB 3TT3L 3CSBA 3UTQB 2FECI 3EW3B 4TNVF 1FLRL 3PDOA 3NCEB 1Y0LA 4Q9RH 3U0WL 1JTPA 3L3HB 4NO0A 3VFNA 1IEBA 2G60H 3OKMB 1UWXK 1A1MA 1XCTB 4X98B 4U6YA 2Z92B 1GC1L 1JHTA 3D18B 1QFWH 1NEUA 4JHAH 4RMWA 4I9WD 1FL6B 4IJ3B 5C0CB 1WUNT 4BKLA 3TYFB 4GRWH 3NN8B 4JRXB 5HHNB 5GSRB 2CLVB 4DQOH 5I1IH 1INDH 2AGJH 1OQXA 5IM7A 5CCKH 1PG7W 4QHMA 3JUZA 1QVOB 2BNRE 3FO9A 3QT2A 4A6YL 3FOMB 4NZUH 3U48A 2R8SL 1RUKH 1K85A 2FLRT 4ODVL 1A9BA 3QIWC 5HYJD 2IQ9H 3MJ6A 3FMGL 2Z31C 2R4SL 2WWKT 4P2OB 4F7CA 1EO5A 1QR1B 4FFYH 4X80H 4BZ1H 1G7MB 3WIHA 3BX7C 3G5VA 2AABH 1XAUA 2VLMD 1TDQA 3CVIL 2MQ0A 4KVNL 4OZ4A 4P49A 4ZSOB 3WN5A 4Q2ZB 3C6LB 3DRQB 4ELME 2VZTA 2FBJH 3NABL 4Y7MA 4ZO7A 1CD0A 3N1MC 4WFFE 1J18A 3QIBC 4QRUA 5D2LA 5KSAB 1ZANH 3U6RA 5IB5B 3QAZC 3OL2A 4X6DA 2CLZA 2X10A 4M43L 3Q6FA 3BMWA 3O3EB 4Z0XB 1HQRA 2PETA 4DZ8B 5KANG 2KZ1B 3JBG7 3RDTD 3TCLA 1QPXA 5IIEB 4IRSD 1G9EA 1CLYH 2Y36L 1LE5B 5E2JA 3X14B 1AR1D 4M7KH 3QEUA 2KBGA 3QEQE 3LEVH 1CF8L 5I1AA 4WW1A 1U3HA 3OR6B 2Y5TA 4WUUE 3PWLA 2E27L 2P4AB 2DI8A 4NKDB 5D1ZC 4CN1A 1JF1A 1SEQH 4Y89A 3JUYA 5EU5B 4YHYB 5KOMC 3QJHA 2J8UA 5HVWA 1NEZA 4PJFB 2E7LC 3VFGH 2BXYA 5ADPL 3IS0X 4MNGA 5DGRA 1EO8H 1K8IA 4NDMB 5SWZB 1A6TA 3MOBL 4QGTA 3IJYA 4NQEE 4JZJC 3UZQA 4XNYL 1ZVSA 4PGBB 4URTB 5DFWH 2PO6B 4ODUA 1J8HA 2EYTB 2B8OT 3FB8B 3SPVB 1S7RB 4JDTL 4LDLB 4YDLC 4KY1H 2VDML 4XP1L 2EDXA 2JJSC 2HA1A 2V9QA 2ZNXA 1Q94B 4LLAA 4EDWL 3MLRH 4N0FA 1RPQA 3UDWA 1CIUA 2WBWB 2P5EE 4P9ML 4M5YL 3A6CL 1D9KD 5JW4N 1GGBH 5C6WH 4PJGB 2I07A 3W5NA 1HKLH 1LO5A 4OCSL 3LKNA 3AM8A 5INDA 1F58L 2YMXL 3TJHD 2EYSA 4KUZL 2PW1A 2FECL 3WEXA 3T3PE 3QG7H 3NIGF 1YN6A 1AGFA 4JFFB 4NHUA 2BSTA 3R4DA 2VLKD 5C9KA 1GGIH 3KPLB 4XC1H 5I1KL 1IGYA 3RTQA 1U36A 5F1NA 1A0QL 4Y5YA 4G5ZL 1WQVT 5DJ8A 3U4BH 3VXPA 2YXFA 3KNBA 2V5SA 5B8CA 4POZD 4TSBL 1MHCB 4HJGA 3QIUA 1YMHB 4NQVA 5F6HJ 1VKXB 1I9JL 5CZKA 2ZSWB 1YC8A 3BIKB 2GCYB 1MCWM 2J6EL 3D9AL 4PBVC 4OCRL 5INCB 1LE9B 4H25A 1V05A 3L7EB 4HZAA 4U1GC 3TN0B 1CBVL 1UEYA 3L5XL 3SEPA 3DVNB 4EQ2A 2VLRA 4M1CD 3QHFL 4GBXC 2FIRT 1D5BA 3FFCE 4JZOB 4PRPA 4J4PC 1I7TA 2OS7A 2NY6C 1NFIA 3S8WA 1VENA 3GIVA 4S1SL 4JPWH 2VDQH 4O2CB 4HK3N 1IC1A 1IGFH 3PWPA 3GNMH 2R4RL 1VEOA 4AYFA 3Q3GA 5JLZB 4M00A 1QRKA 1WBXA 5I6XC 2Z93A 3A6OA 3QG6A 4U1JB 2X4OB 2EDOA 3IT8D 2MCPH 3VGDA 4TVPE 5F89B 1KNOB 4XGZB 3O3DA 1CDJA 2NCMA 4OLWH 5CS7A 3MJ7B 3RBGA 3C87A 4S0SD 5DUML 1TMCB 3MXWL 3O45B 4NRYA 5L9DH 5LBSL 3QUYD 1I1AC 5E8PB 5C08E 2UUDK 1PZUB 2V6HA 4JFZH 3R06B 4GAGH 3QQNA 4JO4L 2YKLL 4G8FA 4JHWH 3C9NB 5D4QA 3N1GC 5IBLD 4GSDH 4LEXL 2NXYC 3GGWB 4U1HB 5T1DH 5KTEH 2Z4QB 1ZSDA 5EO0A 5DK0B 5AZ2L 2D0HA 1GHFL 2Y7QB 4HCRL 5FOJA 3OKDB 2BOCA 3D2UD 3K4ZA 2IH1A 1VGKB 3H9HA 5L2KD 3NZ8A 3KPMA 3VFOA 4F33B 3JWNC 2FGZA 5HTSA 3RDTA 1A6WH 2A6KA 1WFUA 2X5PA 4GG6B 4EOWH 3NIFE 1MIEL 4JDZB 3MUJA 2EZ0C 3V5HA 4OKDA 4P4RA 3QUKA 5FF6B 4MQSB 3TO4B 4OCWL 4C58B 3PNWB 1S9YA 4ZUWB 5B38A 1FL5A 3QNXB 2I26N 4LEOB 1ZTXL 4NBYB 3SDXF 2J2ZA 3FRPA 5GJSH 5HYSG 3EYSH 5JTWA 1FGVH 1DEEB 3MLYH 4CN6A 1CCZA 1RZKC 4Q9BA 5BRZD 1QTYT 1BZ7A 3FQWB 5DD3L 5HDQH 3GHBH 5JPMB 5F9OL 3MRRB 1JP5A 4BFEA 1LP9A 3ZYIA 1OTUD 3KPTA 3T0EB 1GCFA 4F7TA 3SO3C 3D18A 5DZNA 1C5CH 3PGFL 1AGCA 4JRXA 4MAYA 5GSRA 4OF7A 5B3JE 4M8VA 3FL7A 4KZEH 4M6AA 2ED8A 5DYOA 3VXMD 3VXUD 1E6JL 5HDLA 5TDNB 1HKFA 5DO2C 2BX5A 5J9PA 1U6AL 4ZD3L 4XX1E 3SKUD 2N1KA 4PGEB 1FZOB 4ZFFB 2XKNB 1ZT1B 1QR1A 3LQAH 2CSPA 4HKJB 1FV1A 2DYPB 4L9LC 4EUPG 1QP1A 3TBWA 1CR9H 3PWUB 3KPPA 4EDXA 1IGCH 3L3DA 4Q6IA 3SDYH 2EKJA 4ZUUB 1T1XA 1FORH 1HI6B 3LZFH 3PXHA 5H37H 4XVUD 2UVEA 5FHBH 5C92A 1C7TA 5GZOC 4CMHB 2HT3D 4IHOA 1M71B 1MCJA 4OQTH 1BM3L 3QRFM 5BOZG 1CL7H 4P0DA 2N4IA 1OWWA 2QLVB 1HOCB 1S9WA 4ELMF 1CD9B 3QZWG 2AKRB 5I74B 3MC0A 1G9NH 2A6IB 1UH3A 2FX7H 3LOWA 4JFQA 4JG0L 5HJ3A 1XR9B 2DTML 4HUWA 2CKBB 4HXBL 4BQ8A 3IGAB 4DK6A 4KMTH 3OR6A 1IZJA 3HUJF 4HK3J 1GZQB 1WZ1H 4WEMB 1MLBB 5GJTL 5DD5L 3EDJA 4Z7UF 5I1EL 3MROB 1JNHA 4GMSL 4Z7WB 5IB4A 4BFGA 2FCBA 1M7XA 4MCYA 4LSVL 4D3CL 3PWJA 4YC2C 1TIUA 4KK5C 3SKJL 1WISA 2NNAA 2C1OA 2BMKA 3P11H 4N0YH 2BNRD 2YWZA 3PP3K 2ZCLL 3V52H 4I48A 5E2WL 1SJXA 4Z7OE 3IDNA 3G6JA 1W0YT 4NUJB 1YQ2A 1OD9A 2EYTA 3SDCB 3GMLA 2CK2A 5DRWB 5GZNC 3VW3L 3VWJD 1R3KB 3TEUA 5C3LD 1X5JA 1ZHNB 5E00A 3O4OB 1J0IA 3VXQA 4JJHA 5C0AA 2B1HH 4LQFL 2ADIA 3MMEA 4ERSH 1A7QL 2LTQC 4PJIB 4JFPB 3QHZL 3WJJC 4HFWB 4WFFD 5I71B 2BVQB 3K74B 4QGYA 3MRLA 4UT6H 2XRAL 3KWWB 4NUGL 3WFCL 1FE8L 3S37X 2PTTA 3QFDA 2FSEA 4QEGA 2I25N 5IR1A 1WGOA 2X4RB 3CDFA 4P4KC 4PLJD 4DOHE 4OLVL 3I75A 4CU8A 3DI3B 5A2JH 3TZVB 1AIFB 2NY2C 4JFHE 3QCVH 2VN7A 3BRDA 1PZ5B 1F4WH 3EYFA 4YHOH 1MCSA 1MAJA 1TJHL 3OJ2C 4ODSL 5ICXB 3QEQD 4QXTB 4AM0B 3MODH 5F7FA 1WLHA 1ZA3A 4R3SA 3WUWG 3GBNL 5DZOA 5EU6B 2ZJSH 4WUUD 5IW1A 3FCTA 1G9MH 4YBLB 4GUPB 5FO8B 1U8NA 4PRDA 2NLJA 1NDGA 1SJHA 2V7NB 4LGRB 1IT9L 1MSPA 2ARWA 4DKEH 3W9DA 4UOW0 4YDVA 3FB5B 1VCAA 1YMHA 5ENWA 1YDPB 5HGAA 2YD9A 4NQED 1KEMH 2CKBH 3HZYA 4M6OH 4XX1G 4M5ZH 1UB6B 5T5FH 3TBSA 1OAKL 1VGEH 5DC9B 5BS0E 4HIIA 5ISZE 3VFPA 3F62A 4UQ3B 2EH8H 2WQ8A 4RNRB 5HHPB 3BAEL 2FL5A 5EZJA 3SE9H 3O6KL 4L8DB 1A22B 3N85H 2BNQB 1GOFA 1A7BA 4ZYKB 3SDDB 1YY8A 2VXUL 2H32B 4NKOA 3VMOA 3LSOB 3SKMA 4KK9D 4OD3L 2FHBA 4HS8L 1YEJL 5DVKA 5BMFL 3RA7H 2X44D 3ZO0A 5GHWH 5I15L 1YYLL 1PD6A 5TDOA 1E4XH 2ITDA 4RX4A 2P8LB 3DX6A 1S7UB 4K3DH 4OM0H 3EO1B 1IKNA 5T5NF 3U1SL 4AEFA 2VAAA 3H2WA 4Y4HA 1N6QH 4XBPA 3WIHL 4U1JA 1A3LH 2E5EA 2X4OA 3VJ6B 1UM5L 2VDKH 5GS0L 3LEXA 5F89A 1KC5L 3MJ7A 4G8EB 3CAFA 3HG1A 3BEVA 4FQQA 4TUKL 1KN4L 4FS0A 4HWBH 4Z5RA 5LWYH 3TNMA 2D31B 3MNWB 5AD0A 1N2RB 1DBAL 2J88H 3G08A 4XPHL 3SDXA 1X6NA 4UT7H 5TJWK 2VITB 5T3XH 1WJ3A 3QUMA 4UNVA 5HVHB 4ZAKD 5LGJA 5HYFA 3BPCB 3WXWL 3ARTA 3VXOA 4HIJA 5H94A 3FO0H 3U7YH 2VLLA 5E94B 2OK0H 2IMNA 3SDAD 1CK0H 2YK1L 2V9RA 4AQOA 2EDKA 4NRXB 4KV5E 4X5WB 1H3VA 3ILPB 3L95B 2D7TH 4H88H 4U3XA 3D39A 3RU8L 5DJAB 2W0FA 3DX9B 4JHZA 4I3SH 1CT8B 8FABB 4S10A 4HUMB 5E99L 4F7PA 5ID0A 4PG9B 4R7DB 4TQEL 1LO3H 4PD4J 4ZQKA 3SGDI 4HGMA 1DEEA 4WCYH 1U95A 5GGQL 3NIFF 1UZ8B 4YDJA 1IAOB 4KGJA 5C0IB 4FXGB 2IALA 1HSBA 1HHHB 5FV2A 4NGHH 4OIAA 4TVPD 5ITFA 2CDFA 3C8DA 4AENA 3WLBB 2VR5A 4DUXA 1MWAB 5IVNA 4LL9A 1CU4H 4UMGA 2H32H 1R3LB 2UWEB 4NCC2 4MQXC 2WLZA 5C08D 5DJYA 4RZCA 3QO1B 1P6AB 5EOTA 1OTSC 3EGSB 5CJOL 2VXVL 5TDNA 3SE3A 2NYYC 3VDAA 5C7XH 1CLCA 4PY8J 3VGFA 4TSCH 1OTTD 3SY0B 4NT6B 5KVDL 3AROA 1FZOA 1CFTB 4YBQD 5L8LB 2W92A 2DLEA 3OAZH 1OT2A 3UZVB 4FFVD 3UAJC 2HFFA 1K9TA 1CIDA 1QO3A 4G8GB 3NFPA 4BQ9A 1DQLH 2EDFA 4K9EC 4AH2A 5B3JF 3I9GH 2XA8L 4XPBH 4LCCA 3TVMD 1MFBL 3CU1A 2ATPA 3HUJA 1S9XA 4XHJC 3NCBB 4M7ZB 5EO9B 5ESQA 3NCCB 4Z7UA 3LS4L 4H5SA 3Q0HA 5GRYA 1JNNH 5E08L 1FYHB 1MH5B 5GS1A 5B39G 1HINH 1ZLVK 5JW3H 1CGSH 4O51B 4XNQB 1JPGA 3HE6A 3SQOL 3BXNA 2OR9L 1JZ2A 3FHAA 2R0WH 4N9OB 5F6HI 1P4IL 4KI5C 3DMMD 5EBGA 3ZL4L 5BW7C 3H9SA 5EH1A 2YSSA 4KDWA 4WW2C 1JPTH 3IGAA 5MP6L 2ADJA 2B4CH 3ARBD 3THMH 3S4SB 3ET9F 4LRNL 4BJLA 1U8IA 3GB7A 1ORQB 1MLBA 4EXKA 5CEZH 2EDYA 3PGDB 2MWCA 1AD9A 1NUFA 3MV8A 4G43B 4IMLB 5GRUL 5TDPA 4HULB 1HHGB 3IAQA 4A2MA 5FGBC 4QOKB 5MI0C 1HQ4A 3L1OH 2NY0D 3WIIH 4N8VA 5DD6A 1FAIL 1INDL 4XMKH 2IANB 1BOGB 2JELL 1S5IH 5ACMA 1A5FL 3EOYG 3GI8H 2AV7B 4M03A 4RQQA 4ZO9A 3ULUH 3Q1SH 5C71A 4P2RA 3MREA 1BD2A 2HKHL 1XCQA 2NMSA 1MWAH 4G3YH 4PLKD 4RGMC 2P5EA 3M1BB 4CU7A 3MX0A 3QRGH 5I8KH 1IAMA 4D9QE 1H8NA 4AMKL 1A1OA 2AABL 2CPCA 2WSKA 5TQ0H 3TBVB 1NDMA 4PJIA 2H1PL 4HZLA 1MFAL 1Z6JT 4Z7OF 1QKZH 5IMMB 2JJTC 1A1NB 4HS6B 3KWWA 4Q0XH 2A6JB 3WNNA 1DLFH 5MENE 3BQUC 2OTWA 3AREB 3BSZH 1IAKA 5DA4A 2IGFH 3CIQA 3VWKC 3TV3H 3QEGL 1GC1C 4HJJH 4UDUB 1EMTH 4OCLC 4M61B 5IF0B 4E41B 3HC4L 3I50H 1G0DA 4Z7VB 5IT2H 4N8CL 4QXGL 4Y5VB 3CNKA 4X6FB 5FGSA 3CX2A 1OPGL 4MD0B 4JPVL 4HUXB 3RWIB 3B2UD 1PAMA 1TQBC 2EDDA 5I1CH 2D7OA 5DHXB 4S1QH 4LKCA 3MSPA 5IQ7H 5L8KB 4J3TA 2IPTL 3VXSE 1H3WM 1A7PL 1YDPA 1NGQL 3MRPA 1KCLA 3MACL 3WYRA 3E2HB 3FFCA 3B9KA 4HHAB 1UB6A 3RGVC 5BVJA 1W8OA 4MHHG 1I8KA 5F7LB 1INQB 3WSQL 1JFQL 2Q6WB 1GGUA 3C60C 2BJMH 3MLUL 4TRPH 5D70H 1J12A 3OAUH 4JRYE 2NZ9C 2R2EB 1DQDL 3CH1A 3SE8H 1X9QA 1XZ0A 3OGOE 3QUXB 5IGXH 3VRIA 2F5BL 3STLB 4HKZA 1U3ZA 5FYKU 3MRQA 2CMRH 3VXNA 2GJ6B 1M6OB 2P7TB 4UI2A 3EOBB 4LP5A 1RZJL 1YMME 1I7RA 1RMFH 4KJPC 4YPGA 4PRHE 1S7UA 4HV8A 5AAMA 3PUCA 5AWNL 1FNSH 4JFHD 4EN3B 3VJ6A 2R9HC 3X3GH 1OAXH 5E70A 3QB7C 2W07A 4ZPVB 1U8LB 3K0WA 3DRTA 5HDBE 1UZ6E 1RZGA 1EERB 1T22B 5I16A 4PV9A 2VC2L 3QUZD 1J5OL 3GSRB 1EX0A 2DAVA 1D3CA 5IB2B 4I18C 3E6HB 1C8PA 1Q9KB 2HH0L 4HWUA 1EEYB 2VITA 1KOAA 2EKSB 3VCLB 1AJ7H 2AK1H 2FYYB 1BJMA 4JG1H 4QTIL 4XCNA 5F96H 1KYOJ 1L9MA 4KROB 3REVA 4PYHA 3P0YH 4NKIH 5DURD 1S7TA 1JYNA 5KVGH 5BS0D 2JCCB 5ISZD 2VR9A 4P3DB 5A16A 5KJRH 5I8OL 5KS9A 5DUBB 5ADOH 4X5WA 2NY3C 1D5IH 1XGTA 2O61B 3IAPA 1P1ZB 3GSQA 4NQCA 4P23C 1RUAL 3EYUL 1F4AA 2VABB 3BDXA 5EUOA 3DHMA 4O02L 2YUZA 4RGNE 4NWTL 5FYJE 2QKIA 4NPYA 1ZVHA 1NC2B 2OSLA 5SX5K 3FT2A 1S3KL 4QHUB 1S7SB 3GNML 4KV5F 5DS8B 3O41B 1RJCA 4V1DA 5TH2A 4QKXB 4X0KA 5D1QD 4FXGA 3HMWL 4WTZA 1OVZA 4NKMB 1HHHA 4QTHB 2G75B 2RFXB 3L5JA 5JA9A 5LVEA 3WLBA 3B2VH 3WS6C 2O93L 1TNNA 1NMAL 3UTSA 2G5BB 2DM2A 3BI9X 4HMEA 4WFEE 3QO1A 3D6GA 1GPOH 4UDTB 1B0RA 1LO2L 5CGYC 2FJGA 5DDHB 1OCWL 1MCFA 4MNQB 3I02A 4UAOB 1FIEA 4QRTA 3DVFA 4GSDL 2H8PB 5GGTA 3IDIA 5D93B 5FK9B 4QWWD 4LOUD 5D7SL 4Y2OA 1ZEAH 1ZWIB 3HZKB 4DGYL 3MRIA 3OX8A 5IVXE 2PYEE 1RI8A 3V4VH 3NA9L 5FYKL 4LSQL 5DI8B 3OG4B 4X7TB 4XVTH 1RIUH 1FVCB 4CDHA 3FQTB 1JWMB 4L8BB 4NQDA 4DWHA 2Y07H 1WTLA 2C1PB 4JN1H 2KUTA 7CGTA 4G7VL 5FB8A 3MTRA 2P42B 1TJGL 3TM6A 1A47A 4ZOAA 3T77A 4DKFL 1DQMH 1GYAA 1MAML 1P69B 3I3EA 4MJIE 3MYZA 1JRHL 1MHHA 3C5ZC 3ZSSA 1VFOA 7FABH 1FL3B 3GEWB 3FONB 5MEOB 4L4VE 3KPSE 5E2TL 3SOBH 4HIHB 1LDPH 1ORQA 3DETD 4BQCA 1FCGA 5EBLB 1MAKA 2SEBA 4L4TE 3PGDA 4X9FA 5DTFB 1I8MA 1CFSA 1MHPH 4WGVB 3GSXB 4M1GH 2R56L 4WNQA 2APFA 3WFBH 3L3IB 3B3IA 2IANA 2X4QB 2HTLC 5DQDH 1P53A 2CK0H 3SJVA 3FTGA 1KCKA 3BKCH 2QQKH 5IKCA 2VERN 4MWFB 3W9EB 2AEPH 4HIXH 3WMSA 1CR9L 1N3NA 4JGUA 5D1XD 3SDYL 2NX5A 4QRRE 1BVLA 5IMMA 5HYJB 4HS6A 4P9HH 1FNHA 3LZFL 2O5XH 4ODWB 1ZLSH 4LLYB 3KYOB 3X13B 3QUML 3HZVB 1JYXA 3X11A 1AGBB 3D3VE 5DD1L 4DN3H 2X2YA 3OJMB 3CFEB 4CADA 5AZEH 4FQLL 3LAFA 4OF3A 2KL6A 3P4LA 5JPNB 2MPAL 5E2VL 4E42A 1CG9A 2PTUA 5IF0A 3S3JA 2A77L 3MRDB 3TCXA 3EYQD 5FKPA 1HH9A 5GRVL 3Q6GH 4KMTL 1T03H 1ULVA 5TF1L 1WZ1L 4G80A 4O2EA 2VLJA 1BEYH 4IRSB 4PJXA 3PL6C 4CBPA 1T7YA 1KELL 2I5YH 3H7LA 1EFQA 1LGVA 3TP4A 4HK0A 4XCFL 4L3CB 1F8TH 3LN5B 1A9EB 3SKOB 4OIBA 1T2QH 4HHAA 3TBTA 2F53A 1YPZE 4KJQD 5EBWA 2GITB 2QQQA 1JWUB 1INQA 1FNEA 5BVPH 1U2HA 4OFIA 4ZS6D 2I9TA 1AHWC 2FEDC 4HEPG 4D9QD 5D72L 2R0ZH 1PX3A 2R2EA 5ILTL 2XQYG 2A38A 4UIMB 3DSFH 3SCMC 4Q9QH 3HFMH 1FSKC 5ELIA 2OTPA 4F9PC 2MJWA 2JB5L 2R29L 2I27N 5L0QB 3EO9L 4GS7B 4F58L 5MEND 4PY8I 3GMQA 2HFTA 5IBUG 2OZ4A 3WD5L 4RFOH 3BPLC 2ICCA 4ISVB 1ADQH 3MLTA 2Y1VA 3ME0A 4HGWA 4G9FE 4HF5H 2WUBL 5I19L 4EN3A 2NY1C 1I85C 4PGCA 2WP3T 5DVOA 2XQYK 4Y16D 1ROWA 1CVRA 4R2GC 3F5WB 1DVFD 4ZPVA 4RFEB 5IFJB 5ALCL 4NP4H 1D9KB 3ROOB 4K3JL 4GKOA 2W65B 2IFFH 3PABB 5MHSE 4ZFGL 4U31A 3FJTA 4F9LC 3D1MC 2AJZA 2IG2H 5TPWL 5IB2A 2IADA 4WU7B 1EAPA 4PJ7E 2HJFA 4N1HB 1I9RH 3VXSD 1Q9KA 1FDLH 2RCSL 3HNVH 3MRHA 1IKFH 5IROA 2FYYA 3ARFD 4HX1A 4WO4C 3P73B 2YPVL 1UZ6F 2VE6B 1F5WA 1KACB 5SV3A 5F9AC 4LHUG 5SX4H 3MGOB 3PP4H 1S5HA 2NY7L 1NKRA 3P4OB 4JRYD 2CRMA 4PJDE 3S97C 3V5DB 2X1QA 2DD8L 3MV7E 1ZA6B 2Z9TA 2LV4A 3DYMA 3O8XB 3ZTJG 3U7WH 3V4UH 4FP8H 1G7HA 3KPRD 4MJ4A 4JQXA 5LCVH 3T65A 3ARGD 1TENA 3HC0A 3WNKA 2XFXB 1KF9B 4QHUA 2AQ2A 1MIML 1LK3H 4PRHD 4L1DA 4KVCH 2DQFA 5GRXG 4G42A 4AIXA 4ACPA 2EEAA 3P0VL 5E6YA 1H3GA 4HFUH 1U8HA 4M1DL 4R96A 3TH3T 1W72B 2G75A 3LRHA 1XF1A 2FJFB