5DHVB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
total genus 25
structure length 110
sequence length 110
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvB00
4OCWL 4JGJA 2Y5TA 5HD8D 1EEZA 1JIBA 5H35B 1IQDA 4MJIE 2VLRE 5DJYA 5F7DA 3KNBA 5K9JH 5GRWA 3GSRB 4NO2A 3B9AA 4G8GD 4YBLC 3T2OA 1N4XH 1RIUH 2FYYA 3PGDA 4KQ4H 3QCUH 3JWDH 5D5ME 3WO4B 3UEZA 3WJLC 5D4QA 3MNVB 4HGKC 4RX4A 3EOBA 3QEQB 4ODWA 4XNYL 4RGNE 2ADGA 4GAJH 5BMFH 4YIQB 3TNMA 5HHME 1I1AB 2R0KL 3ARGC 3MFFA 1TTUA 4DGVH 4G6AC 1XR8A 4YWGH 3IJHB 1CBVH 4TUOA 1XIWD 2E7MA 2DLIA 5DDHA 3TNNA 2OK0H 1BFOB 2Q6WA 3HZMB 5EU6B 5C2BL 3K4DA 4JFYA 3IS0X 1P7KB 3ARXA 1RUKH 1SEBA 5IBUG 1FAIL 2AJYL 1TVBB 4Y8AA 2C3HA 2ZSVB 2CXGA 4PJCE 1ZWIB 2WINA 4BELD 2IAND 3MBXL 3VFUB 5FYKE 2NY6D 2E7HA 3VXUA 4YXKH 1DBJH 2IFGA 3PQYB 5ESAB 4PLKC 3F7PC 1N4XL 3CC5B 3GSUB 3RVVD 1OW0A 3WS6C 3EFDH 3MRRB 1AHWA 1E4WL 4WUUA 1MFEH 2P48B 3GRWL 3MLWH 1FZOA 4W70A 4JRYB 1ZAGA 3O2WH 1NANH 5IBTL 3MA9L 4PLJC 2P43B 3O9WA 5JO5B 4IJ3B 4WEBH 3VFMB 3QAZB 4HFWA 4XVTL 3QXTA 1VFAB 4Z0BL 2PUQT 4DCQB 4LRIA 3IJHA 4KQ3H 3DXAB 4PGDB 4UIKL 3DLQR 2HFFB 3NVQA 4POZD 3DYMA 3QJFB 3C09C 2B0SH 4M43L 1BF8A 4UV4H 2YPLD 1GIGH 4NM4L 3UAJD 1XGUA 3OR6B 4ZYKA 2K7QA 4WTZG 1EFXD 5F7YC 3WUWA 5AUMB 3L3HB 4MXVF 5C71A 3QDAA 1HKLL 2EDDA 1TETL 4LLWA 4QTIL 4M4RA 2J6EA 4MQXC 3GMNB 4LHJB 3GSUA 1WCBB 1A9EB 2APXA 3WEXB 5JQ6H 5EC2A 1II4E 2ZUVA 2ZUYA 2EYTB 3PWJA 4NPYB 3CFBA 1U58A 3D85D 1HQRA 1B0RB 5E7FA 1KB5H 3CVHA 4ELMB 4XWGH 2YPLE 1ZLVH 5I1IL 2YC1B 3QT2A 4L4JA 5F8RC 4XMKL 1A1OA 4BSWB 5CZVL 4FFYL 5BRZB 2R69H 1P5UA 3WNPA 1GZPA 3L5WB 4WUKH 5IV2B 2ZZUT 2AJSL 4GS7C 1K4CB 4FQHA 2DF3A 4HC1H 3WN5B 2DKMA 2BVOB 2DQIL 3CLFL 1I1AA 1X9QA 4IOFD 1T5WB 2CMRL 3NFPB 3GMQA 4BH7B 3U1SL 5DHYA 1A7RH 3QIWB 4OBRA 3RTQB 3LEYH 4LHUD 4P2YA 4GG6A 1CFQA 2FL5B 5FXCH 3KPSA 3RP1A 5C0EA 3ARFA 4L3AA 2OM5A 2V9TA 3CXDL 4MD5B 3SE4A 2IBBA 3LKNA 4UTAL 3SE4C 2J5LC 1YECL 2OXGA 3MSPA 3TIDA 2VL5A 4M1GH 5FHBH 1DFBH 1G7IB 3GMPA 5DZOA 3ZTJH 4JM2C 3WXWH 1BVLB 4EI5C 3HTLX 1CIDA 1SJHB 3RIFK 1PG7W 3PWUB 3BKYH 1FFPA 3JUZA 3ORJA 4H8WC 5C0BD 1S7XA 3WFZA 3GSQA 3K46A 1ES0A 1I85A 3G08A 5A43C 2D03H 3MRJA 1FO0A 1EAPA 1JTOA 1NFIA 2YD3A 3MRGB 2EECA 1J87A 5B4MD 3VA6A 1GGBH 1RZKC 4ZAKB 1G6RA 3U48A 1X3DA 1GGYA 1IGYA 5IOPB 3FT4A 4B53A 3FOMB 5FV2A 3IS1X 1FFOA 2FO4A 5IROA 7FABL 2Q86A 4WUKL 3KXFA 5F1SA 2Y72A 5FKPA 1F90H 2E8YA 4NRXB 4UQ3B 4RRPA 1DQDL 5BS0D 1JFQH 3DIFA 4Z7VB 1QQDA 1JZ8A 5CSZB 1WSST 2X4QA 1JHKH 4X98A 2UVEA 2D7OA 5ETUA 5I15H 3VXRA 3ULUF 3MLYH 2W9DL 3MTRA 5HDBE 3SHSA 2WUCL 2QQLH 1RIHH 4JPVH 3MUGA 4J12A 1F45A 5L2KE 1R3LA 1MHEA 1SYSB 3G9VA 2NY6B 5HHOA 1VFUA 5GGTH 5I8KH 2H41A 4Y4HD 5IW6B 3K1DA 4UU9A 1ULVA 2X41A 3QQ9D 4Y1AA 4R97C 4GRWF 5ISZE 2C1OB 3ZT5A 4NJAL 3BT2L 3VWJB 3BKCH 4N8CL 2F8XC 1IKFL 4U6XB 3Q0HA 3BPNB 4Q7DA 4OD2A 3MV8E 3JWNC 3P73B 1XGYL 2DI8A 4MAYA 2XPGB 4RMTA 2ITDB 1BFOA 5TE6L 2ICES 1B4RA 1B4JH 1KC5L 4NOBA 3QDGA 1U8KB 4YHPA 4OF8A 1SY6L 5MEPA 3C2AL 2A6DB 2DTMH 2W65B 3D3VB 4PJBE 5KVMC 2H2PD 2ESVD 3QUYA 2DMKA 4M7LT 1PAMA 1E4WH 3SPVA 2CDFB 5GIRB 4S1DC 1RK1A 3QXDA 4QGTA 2KBGA 2FB4L 1IFHH 3RY5A 3QPQD 4WWKA 4AT6A 4OGAC 1IGTB 2PYED 3DI2B 1CIUA 3QDMD 4HWBA 1NCDH 1I9JH 3QDJA 4EXPX 3DMMD 2D2OA 1LO5B 3MV9E 5T1MB 3WHXB 5EBLA 2P5EB 4NN6C 4M6OH 3FRUB 3FO9A 4RMSA 4FTVA 3MO1B 5D7JA 5ILTL 2VZ1A 3P0GB 4PD4K 1S7RA 3K8LA 5T5NG 4G8FB 4NO5B 4PJFF 4GBXC 5KANG 5BO1L 4R7NB 1EGJL 2EYRB 1S9VB 4M1CC 1FP5A 1S7TA 5HVWA 4QOKE 1KV3A 1XF1A 3K8MA 4XH2A 2W0PA 3VXSD 4GAJL 4OCSH 4Y16C 3QDGB 4Y5XB 1REIA 4XPFL 5TF1L 2F53B 3I6KA 3DUSA 3L3IB 2BSRB 2FHCA 4X6FA 1DDHB 2VH5H 3OX8B 3ULVL 1RIUL 4L3ED 1M6OB 3ARYA 4WW1A 2P5WD 3KVQA 5FCUH 1G7IA 1WBXA 2A6JA 2BSED 4JG1L 4X80L 4BSJA 3QDGE 5KSAC 4PJIB 4LLWB 4EJ1C 3JVGC 4K7PX 4ODVH 2PXYD 3BPCB 5INCA 4KMLB 3U36B 3GSQB 4BK5A 4Y19A 2NX5E 1CLOH 1TPXC 4EDXA 3MRLA 5F1OB 3TH2T 1OGAB 3HZVA 1QO3A 1WZ1L 4EIGB 5FF6B 4QOKA 3ARDA 3GSNB 3SY0B 1FSKB 2YPKA 5ACMA 3VG9C 4XI5C 1FGNH 4L4VD 1J10A 4MJ2A 1MFBL 1WFUA 3V4UH 3QIWD 5D9SA 3RTQD 3T2PA 4FXLA 1K4CA 1M7IA 4M61B 1H3WM 1KJMB 4P4RA 3ZE0F 3LPGA 3OMZA 4K23L 3CDGB 4LIQH 4LOUD 4X9HA 4Y5XA 3EDFA 2XNAA 4NNYA 1I8MA 1MHCB 4LAJH 1TCMA 1DQDH 4JZNA 2LAGB 3DSFL 1JUFB 1XH3A 1D9KB 1YN7B 3PGFL 4KK5C 4ZUVA 3T09A 2ITDA 5IQ9A 1NDMA 3FFDB 4TSBH 4AEEA 3H8NA 5EIVA 1HYSD 3W9EA 3EZ8A 3ARVA 1S78D 3OKEA 4MB3A 5K9QI 4C54A 2G5BB 5IM7B 5F89B 5ENWA 4P3CL 1IGIL 2P24B 3ECBB 3O4OB 4I3SL 1OD7A 3OHXA 2VDKH 4L4TD 1N8ZA 5TE4L 4P9MH 1YEKH 3MXWL 1U8OB 4AT6B 2BVUA 1PEWA 1SJHA 3ZTNL 3BGFB 1G7MB 4OLWH 2ED8A 3BKJL 3C60A 4LBEA 1OTSC 4O51A 1NFDE 3MXVH 5D9SB 1KJ2H 2WWMD 2F9BT 3V5KB 1NAMB 3C5JB 3QEQA 5I0DA 1JYWA 1F5WA 5FHAH 3P11H 2LABA 2PW2A 1EUUA 1C12A 3PWPA 4NKMB 4Y2DC 4PGEB 4Y88A 2PR4H 1BZ7A 4XAWH 3MV8D 1R24B 3KPPB 3RDTB 4HIHA 2E9WA 5HGAB 5I1DA 4W4OC 1D5MB 2C26A 3VFTB 1ZVHA 4HWNA 4P23D 4U49A 4YXHL 4LRIC 3V6FA 4QHKI 2CLRB 2D31A 1KELL 2F58H 3EO9L 1NCTA 3I02B 1QHPA 3U30C 4FMFA 4K94L 5DMGD 2OTPA 4S1RL 1A1NB 4H1LG 4OZGE 1DBKL 2QADD 4H88L 2YHGA 1TZIA 2EICA 1ADQL 3RIAF 2FNBA 4XX1G 2HT2D 2GJJA 5LGHL 3NCMA 4OD1L 2CPCA 2X9XA 4Q6IB 4NFDA 1GOHA 1N5YL 4GMSL 5AD0A 5HYJD 1OF2A 2EH7L 1LO4H 5I0ZA 1QBBA 1J11A 1AC0A 2DI7A 3DVNA 5ACLA 4MSWB 1DDHA 4MA7H 3ZO0A 3FCTA 3DX7B 3UYOD 5DJXB 1T0NB 4I3RH 1YEHH 5ID1B 3C08L 1MI5A 3EJYC 4FQXB 5ID0B 1P9MC 1JHTA 4KRPC 1KACB 1Z9LA 4KV5E 4LRNL 3PGFH 3PL6A 4ZNEA 1IGFL 4XXCA 1UM4L 3WS3B 4OGAD 3BDYL 4W81A 5A2FA 4YE4L 2W9EL 3OZ9H 1UWGH 4F8QA 4RA3A 2VKWA 2PXYC 3SBWC 1UM6L 2DKUA 3D69A 3WNKA 1YJDH 1PFCA 3MCLL 4JFFE 5KZCB 4B41A 2VAAB 4GT7A 1LP9E 5FYLH 3FB5A 3LKSA 4OV5A 3MROA 4NWUL 1LO5A 3OHXB 2R4RH 2EDJA 1KB9J 1JWSA 1DQTA 4U6HA 4NO0D 4NQVA 3GSOA 2CUMA 1HOCA 3WIHL 1AGCA 1I8KB 4KK9D 3B6SA 1WQVT 3K7UA 2HAZA 5LGHH 1TZHA 3MQIA 3EFFA 4ODHH 2AK1L 2RR3A 5HHXL 5C0CD 4TULH 3GSWB 1DEDA 4N8VB 4FQQB 1S9KC 3GM8A 3PQYE 3HCVA 4JY4B 3ILPA 1OAQH 1U95A 5FCUL 5JW4N 2DIAA 3O8XC 4Z18A 3D3VE 1A6AA 4WY7L 5D1QB 4NRZA 2HJFB 4JFED 4RWYH 1NC4B 3MV7E 1EHLL 3QEQD 5EBWA 4YHNB 3OKLA 4MHHG 1H9VA 2Y1VA 3ABZA 1PY4A 4AL8L 1U3HC 4FXGA 3TPUB 1YPZB 1FYTE 4EDXB 5B3JE 2X4TB 3WLBB 4P5TB 1MCKA 3T4YA 1ZGLB 2BNQB 4PJHE 2P5EE 2FIKB 4RAUA 2MHAA 3CUPB 4XPTL 2J4WL 2DS4A 2R1YA 3O9WD 3S3JA 4JZJB 4EQ3A 4PTTB 2VQ1B 3LN4A 1I7TB 2JB5L 3ZMRA 3HPLB 3PNWB 3MR9A 2AERT 5L2KB 4ZFZB 3WBDA 3BO8A 4NKIL 4C55A 2IMMA 5GZOD 4HJJH 5MEQB 4X0KB 3SKMB 3NA4A 3TO4B 3HCVB 4JY4A 1O0VA 2XWBA 3VXRE 4YPGA 4Y0GA 4Y4KC 2DN7A 4AYFA 2OQJB 1S7TB 4G3YH 4XPGH 4WO4B 3OAUL 4B7IA 1Y6NR 5T33L 1R5VA 2YPLA 4GKSB 4KHTL 4LEOA 4N5ED 5C6WH 3GB7A 1BHGA 3MLVH 1BQHG 5JW3L 2V5SA 3VD3A 4F33B 2UWEE 4LHUG 4FQXA 1BQHA 1CWVA 3D9AL 4AG4H 3AM8C 1ZK9A 3MFFB 4GW1A 3MV8B 3T0VA 5KVGL 5E9DB 2IALA 2NY3B 1H3UA 4E0RB 2HFTA 4FFYH 5D7KE 1BF2A 3UZVB 3SDCB 3T3MF 1AE6L 4IOIA 3P0YH 1XCQB 5F9DC 1JI1A 3DPBA 4W6WB 1RUML 2VDPH 1IGML 1UCBH 1HHKA 2DQGH 4PGBB 4FQHB 4Q9QL 2YMXH 3V5KA 2WBJC 1XGPA 3MACH 4RWHA 3IAQA 3QPXL 4Z95H 3SY0A 4HFWB 4OUUB 1U8KA 4DW2L 1S8DA 4JFYB 1LDPH 4OCRL 4Y5YA 4M6MH 2ZCLL 4TQEH 5D8JL 4UNTA 1ZLWH 3MLXL 4CNIB 4D9LH 3G6AA 4XGZA 3VWJD 4MAYB 2B7DT 3T8XB 2R0WL 5LXGH 1WTGT 1GIGL 3DV4B 2VDML 1GOFA 2B2XH 5FCSH 4M02A 1U8IA 1JBJA 5E99H 2LU3A 4KUCD 1DBAH 4L4VE 4CMMB 1QD0A 2VUYA 2JTDA 4JM2D 3WFHA 3MNZA 1FIGL 1VCAA 5IF0A 4ACPA 4NT6A 1WIOA 1T04B 1NEZB 4XC3H 3O6FD 3SDAD 1GGUA 4R2GD 4LPXA 2B8OT 4L29A 3FOLA 3GRWH 4MCYA 5I74C 3FO2B 3GSVB 4F9LA 1MFCL 2EC8A 3RY6C 5IVXA 1C5DA 3HNSL 5AZEL 1DBJL 2X4NB 3QXAB 4LEXH 1ITBB 1JPGB 4GBXD 4LCWE 4MJ4A 5BJTB 4CJ0A 2BDNH 4JPWH 4MSWA 1E28B 1T80A 3CK0H 3CK0L 3ECBA 2W0FA 3ESUF 1EGJA 2HA1A 1CR9L 4LMQE 5T3XH 3AY4A 4N0YL 2CKBA 1JV5B 3G04B 3K2MC 2OMNA 3RGHA 1TNNA 3CXDH 2PKDA 3U46B 1VESA 2UVFA 4ZOAA 1UZ6F 3OJMB 3RWDA 1V7NH 3CX5J 4LP5A 5DHXB 3QI9B 4JJ5A 2YD8A 4JVUA 3RX8A 4JDTL 3RGVA 4MAUL 5AZ2H 5HPMA 3SJVA 2XQBH 5CD3B 3U0WH 1B0RA 1GAFH 2EZ0D 2WIIA 2XQYG 4N90D 2B1AH 3QG6A 2AK4D 1T1WA 5DS8A 1DSFH 5DK0B 4ODUB 2QQKH 4OFYD 5FDWA 1YEFL 3MJ7B 2R1YB 4Q9RL 3ARQA 1KPRB 1TQBC 4JKPH 1M71B 3I9GH 3RAJL 1Q9OB 4JFDA 2BNRA 1DANT 2XA3A 2BSSB 5HYSG 3SN6N 1UG9A 3GSNA 3FQTA 4MB4A 3R0MA 4XCYA 4O58L 2CKBL 4L8BA 3SO3C 4M7JL 4F3FB 3L6FB 4LK4A 1XT5A 1KIRB 4Z9KB 1JUFA 1FYHB 4PJFB 3QHZH 3QIBD 2MKWA 4HHAA 3JWOC 1G9NH 2V5MA 2MNUA 2NXZB 3U4BL 3GSRA 4QTIH 1NGWB 1INDH 5D72H 4WI3A 2X7LA 4HMDA 3MODH 4XPHL 2B4CC 2Y36H 1NCCH 4HW6A 3X11A 5SX5H 4FQ2L 3TGXA 35C8H 1F4WH 3IKCA 5DEFB 5F7MC 2OP4L 2GTZA 1AO7E 2H2SC 3KPLB 1MLCB 2W9EH 3OZ9L 2IBZY 1A6ZB 2A73A 2F8VA 4QXTA 1T0PB 2BC4B 3MOQA 3W0WB 2A0LC 5C0RH 1MHHB 1Q94B 1ZGLM 4M7ZB 3QQ3A 3J7HA 1D5XB 5CEZH 5JIPA 3OKDA 3VD4A 2FGZA 2FEDD 1JWUA 4HK3N 4M6NH 1F4XL 2B5IC 3BZDA 2P4AB 3LRGA 1TZGL 1H3VA 4XHJD 3SGEH 1K9TA 2DICA 3ZYOA 1FZMB 1IGJA 5TFSL 3F12A 5JHLL 4OD1H 3LS4H 4P46B 4XTRC 3OKOB 2V6HA 3VI4F 1KIPA 1WC7B 4G43B 1R3LB 5T1LA 4ZUTA 2BX5A 1QKZL 3D1MC 5B8CB 1PQZB 1P4IL 1WFTA 4MXWH 5HGDA 2PYEB 5C9KA 5MEOA 5ANMA 5FOBA 1RZ8A 5DUBB 5JLZA 1WGOA 5MEPB 5JA8B 3JV4B 2OJEA 5BS0B 2YD4A 1U95B 3I3EA 1ZLUH 4L8SB 3PGDB 1FH5H 1LE9A 1I3GH 4QXTB 2W60B 3ARPA 1A8JH 5DD1H 3SO5A 2O5YL 2GSGB 2YOCA 3TN0C 2ZUQB 4PJDB 5KSAB 3IDXL 4Q6IA 1L4IA 3P9LB 1C5DB 3MLUL 5HTSA 4LMQI 3DRQA 1H0DA 2CK0H 3FOMA 3BH9A 5T1DH 3IF1B 4QF1A 1ZTXH 4JN1H 4ZG1A 3H9SB 2HRLA 1KPRA 1FSKC 3WUZA 5KSBB 2MSPA 3DX9B 3LAFA 4R96A 1MVFA 5F6IC 3U9UB 4UOJA 5D1XB 4LKCA 43CAA 3PHOB 2GAZB 2UZIL 2A2QT 4Y4HA 1QUNA 4YBQC 1S9VA 3E2HC 3VXRB 3QI9A 1BM3H 2D4DA 3TBVA 1KEGH 3VJ6B 4ZO8A 2VZSA 2F74B 4NN5C 1OGTA 2KQNA 5HPMB 4JFPA 4PJEF 1MHPH 1IEBA 3HAEG 5FK9A 4DK3A 2N1KA 2VSDA 1DQJA 1CGVA 4F7CB 4HKXA 4R2GB 1KT2A 3EDKA 5JUEL 2CRMA 1VADB 1HXMA 3WLWD 2R4RL 4ZD3L 3WSQH 2X4TA 5LJYH 2A9NL 1WJ3A 2FSEB 2ESVA 3QUYD 5C6TH 3NABH 4QHNA 1HSAA 4UUJA 3E6FB 2CR6A 1WBZB 3RWIB 4Y16D 4HUXA 3WKML 2GITA 3LKRA 4K55A 1F3DH 3RWEA 3GSVA 1MJUL 4WHTA 5GSRB 2P44B 3GGWA 4P23B 4Z0BH 3T1FA 3TO4A 1MCSA 4I13B 4Y2DA 3U9UA 3VGDA 4MS8D 1IC4L 5CJOH 4M8QA 1YEGH 4JDVB 2A83B 1N64H 1QLRB 3IRPX 4GKOA 5FO7A 4FTVD 5TDNA 3VD9A 4N0UE 4WU7A 4KTDL 5TGBB 5T5NF 1F00I 4ZS6C 1U3HD 2YUWA 2VR5A 5LCVL 2IH1B 5IW1A 1YMMB 1OGAD 1CDCA 3CMOH 3EJJX 3R06A 2BP3A 5GSVB 1FL6B 2Y06H 2Z8SA 4AENB 3CCHB 4DUXA 3SBWA 5B21A 1IAOB 4PJ5E 3CXHK 3KPMA 3V0VA 1A7QL 1OAUL 5D1QD 3V7MA 4XT1C 2HVKB 3HI5L 5DD6B 4E41A 4MNQD 2Z8VC 3BQUC 1F42A 4IEFB 4OZHA 3MNZB 1TJGL 4OI7A 3MJ8B 2YN3A 1KELH 3EO9H 3PHSA 4X6BA 2AJ3A 1I3RB 3ZYZA 3WNOA 2NY1C 4X6DA 5TF1H 5JTWA 1K4DA 2ENYA 4YFEA 5A16B 1HEZB 3HR5A 5E03A 2FLRT 2JJTC 1FJ1B 2NY4D 3V5DB 1U8MA 2J6EL 2ICEB 1MJ7L 2NY3C 1C08B 2G9HA 5EOCJ 1X5XA 4KGLA 1Z9OA 3C8KA 1EO5A 2FEDC 32C2B 1I1FB 4CVZA 4O5LL 4EI6B 5IVXB 4XNUH 4BFGA 4M9PA 5FYLE 1Z9SA 1YMMA 1EEUA 3H2WA 2EDKA 1KFAL 4NGHH 4RMVA 4K3EH 5C0BA 3DARA 4CVUA 1K85A 4EN3B 1I9JL 3G9AB 4JDZB 1NLDH 1P4BL 2MFNA 4ELKB 3CFCL 2VLME 3VRLE 1OW0C 1U3YA 3KWWB 4L9LA 1JN6B 5SWQA 2VN4A 4DN3L 1IFHL 4TSCL 4WHCA 1A6WH 3JTSA 1YEJH 1FNSL 1NCAH 1NGZA 3MRPA 5J8OA 2VN7A 2V9QA 1VFMA 2BFVH 1IM3A 5CHNA 3I02A 2R23A 4NJ9L 2NR6C 1W72L 4M61A 4P4RB 4RMUA 2DLFL 5EBMA 3NA9H 4M48H 1MCJA 3G6DL 5TDPB 2CKBB 3G04A 4YX2L 5IB3B 4JB9H 2JELL 3RL1B 3P3YA 3WL9A 4CKVX 2AJXH 5C09B 1E28A 2MCPL 4NQDD 2K1MA 4G5ZL 4Y5XC 4H5SA 4FQQA 4HV8A 1KCVL 5CGMA 2HMIC 4WWID 1D5ZA 3EJZD 3LEVL 5JIIA 3T1FB 1K2DB 2YKLH 2CJUH 5DO2C 4PJXE 1NUNB 1YYLH 3U7AA 3KJ6H 4Z76A 2DQJL 1NAMH 5ALBL 5A1AA 4WU5B 2QQNH 2OR7A 3VXMA 3WS6A 5GGTL 2QKIB 3G6JE 3QUMH 4WU7B 4KZDL 5D1QA 5JOFB 1GGCH 1FGNL 3ARED 2H6PA 1NFKA 1FZKA 4QT5A 1MI5B 4PS4L 4OV6F 2OTWB 5A2KH 4D9RD 3HC0B 1ZOXA 2X40A 5I18L 4LLUB 3BPLB 3SCMC 4J4PD 1R0AH 4OLXL 4JAMA 3S36L 1CLOL 4UT6L 3O6ML 3QEGH 2KZ1B 3FQRA 4CMMA 4N9GB 1LO2H 3B83A 3W2DH 4OSUH 2BRQA 2Z92B 5IK3B 1IGCL 2OL3H 4X9BA 4P2OD 5T5FL 1XIWA 3QNZA 4UT7H 2I9LA 3OX8A 5D2LE 4NQVB 3QDHA 3GMMA 4BSVA 3LMJL 5ERWA 2EXWD 2DL9A 1FL5A 1FVDA 1XCTB 4R96B 3D69B 2X89A 3F5WB 4RAVB 5CBEA 4NHUA 4FFWC 3U0WL 3DRTB 3GSWA 2DQDH 4U1NA 4C56D 5IMMB 2VLMD 2NTSP 3PL6B 3BZFA 4ODBD 4RBPH 3DROA 1QA9A 3GBLA 3BE1L 4ESKA 2FX9L 5DJ0A 3QAZC 4X5XA 3RUGF 3UDWA 4P46C 4IRJC 2VB5A 3U9PL 4JRXB 5TPWH 2MQ0A 3RNQA 4D0DA 1F3DJ 1DVFC 5HVFB 2Z91B 5DA0B 4KKBC 5IT2H 4OV5B 2ORBH 2VLKE 4YH6A 4CMHB 3MRLB 5JHDE 3WIIH 4KZEL 2WUBH 5D2LA 4HULB 4LSSH 3SKJH 2ZNXA 2HTLC 1UFUA 3VD5A 4R8WL 3C6SA 4OF5A 3RHWF 1BVKA 4X5LA 3MV9A 1HXYA 1I3VA 3O3AA 5CWSA 4MNQE 4OT1H 1A7RL 2XXMB 5T1LB 1PSKH 3QUYB 2FRGP 4X5WB 3BEVB 43C9B 4NSKB 1DN0B 3S35L 2VXVL 3ARZA 3CFEB 4QHKJ 5DT1H 2XFXB 5FA4B 3GGWB 4P23A 2COQA 1JF5A 1ZLVK 2YXMA 3QHTC 3DURB 4B50A 4EUPG 4JANA 5SWZE 3VGFA 3D18A 1RZJC 4LLMB 5FYJD 2XKUA 3NCEB 4N1CA 1PX3A 5K9KA 2QSCL 1MEXL 1ORQB 1BLNB 2GCYB 5DHVB 5D2NB 2NQCA 1CLYL 1JGEB 3V95A 4FQXD 1I1RA 4KUZH 5TF0A 2WSKA 3NZHH 1QBML 5E95B 3LS5H 4P2RA 1VDGA 4JO1L 4R4BB 2VDRL 4PBXA 3BKMH 2GW5A 4OFPA 5J6GB 4C59B 5IIEA 4FZ8H 4CRPA 5HSFA 3LEXB 3F7VA 3ULSB 1NCBH 5ESQA 4U1GB 2UZYB 4DW2H 5DQDL 1PZ5A 3OKKB 1ZHKA 5D7LA 5IB3A 3CPLB 2E7LA 1T21A 1PG7X 3M8OL 3HI6H 2GUOB 4DAGH 2D7NA 2FDBP 1RJYB 3ZHKA 4W68A 2VDPL 4P2QA 3SGJC 1B9ZA 1AGDB 3OJ2C 1QTYT 1KIPB 1NPUA 1WC7A 4XVSL 1CK0H 2BY3A 2KL6A 2BOBA 3RI5F 3K4ZA 1NMBH 5J6HA 4LVOC 4U0RB 1MCPH 4MX7A 2BY2A 1NDGA 4QRUA 5L2KD 4YHLL 1BX2B 1ED3A 3CNKA 3FT3A 3WN5C 1YQ2A 1X7QB 5HGBA 2JIXB 1T7XA 3BWAA 4P4KD 1AO7B 4JO2L 5SV3A 4XC1H 2C4FT 1KTRL 5J12C 3NIDE 4R4ND 2HG5B 4ETQB 2R0ZH 4HKJB 1CVRA 1GC1C 1HQ4A 4HC1A 3KPNA 4NZRL 4XPGL 3RX7A 1NBYB 5DLMH 3VWKA 3TT1L 3T77B 1S3KH 5E8NB 1JTTA 2D4FA 3IDIB 1U8OA 3ET9F 3REWB 2IBZX 1ODAA 5C0CE 1N6QH 1CDHA 2YD1A 3RWIA 4WI6A 5DD3L 1P1ZB 3P4LA 4N1EA 4IOFC 1KN4H 4P2OC 4JY5L 4NC1E 5D7LE 3AM8A 2XTJB 1FL5B 4OZHB 5F9WB 3NFSH 3KXFD 1OWRM 1MRDL 2AK4E 5T3ZL 4HK0A 2VZOA 1J0YA 4YHZL 3OG4B 3MGAA 3GI9H 1V7ML 1KSRA 1HHGA 5L88L 1PLGH 2RQ8A 1IAOA 3C5ZD 4YDJB 4QRPA 4D2NA 4LDOB 2D9CA 4XI5D 5JDSB 3FT3B 1R6VA 2WK2A 3VH8A 3O8XA 3KPRD 3PV6A 2PTVA 3HUJF 1WBXB 3WDJA 2RFXB 2D0HA 1U8HA 3CSYB 5GGUA 5IROC 3CGTA 5K9KB 5FEBA 3T3PF 3BOVA 5BV7L 1P2CB 3DVGB 2I24N 5J9PB 5L7XL 2ED7A 3BD5A 3AU1B 5GGRB 2C7UB 5FO9B 1MUJA 3X3GH 4UBDD 1IC5H 4HIEA 3EOTH 1H3TA 2DJ4A 3DX8A 3LKOA 1FAKT 2WV3A 4M93B 2IF7A 5KSVA 4OCMC 3GKWL 3FB6A 2ESVB 4PJDF 4LARL 3D25B 5K93A 2OXHA 3U46A 4PRAB 1A21A 2NY1D 4Y7MA 1Q8MA 5I17A 2VLJE 4ZUSB 1CXLA 3OGOE 3WUWB 1BGXL 1EO7A 5EPMB 3WDIA 3PL6D 4WNQA 3FCTB 3O41A 4PRID 3O6FA 3C2SA 2KPNA 4J6RL 1XR9A 2PW1B 4C4KO 5CEYA 4A6YL 4E9LA 2GT9A 1EHXA 1OTSD 3TIEB 4DFHA 1IAIH 4YHNA 4BZ1L 1MCDA 4OZIE 4Z7QF 2V7NB 3FT2B 4D9QE 5D7SH 5ETUB 2VOTA 3ARGA 5DFVD 3LSOA 4QYOA 4ODUA 3AS0A 2IQ9L 3DGCR 4I18C 4WFED 4HHAB 5DMKA 4MQ7A 4TUKH 1ACYL 4PJAF 1K6QH 3OKNB 3MO1A 3EOAA 3KLHD 4KJYA 4XCYB 4NUJA 4ZFOA 3KR3H 3KPNB 1M05A 3VFWB 3EDJA 4MA7L 5IB1A 3CFKB 1KN2H 3KDMA 3OR7A 1RD6A 4FQLL 3ZE1E 5J0BA 4KVNH 3S37L 3RUGE 5D7LD 4LQFL 2H1PH 2YRLA 3OSKA 4ZO9A 4PRIB 4HF5H 1XF4B 2DM7A 4GMSH 3HMXA 1ZGLA 2DWDA 5C7XH 5F88A 4HWUA 2AEQH 1QSVA 4WGWB 3VWJA 3O4LE 4XHJC 2P46B 2IPUK 3O2VH 3P4OA 5DD5H 3FO0H 5E2JA 3C8KB 4OZFH 1BJ1J 3BMWA 2XY1A 3UJJH 2V17H 4PLOB 1UM5L 5LWYL 1KCKA 2YBRA 3HC4H 4G6AD 1UACH 3O6LL 3OPZL 4IMLA 3IT8D 3RZCB 1K8IB 3TZVA 2NY7H 3CU7A 3KLHC 3GB7B 3M45A 3UTQA 4LVOB 5FF6A 2DQTH 2HFGH 4QRTB 4PJCF 4U3HA 4FMKA 3GIZH 5FGBC 4ONGH 5H94A 5T1KD 1HZHH 2VXTL 2NY6C 4R4BA 1N7MH 1UB5A 3OAYH 4BUHA 1JMZA 4HKBA 3JZ7A 1TCRA 4XTRD 3TV3H 4XMLL 5C0DB 1T83A 2YA1A 4PG2C 4L4TB 4PJ8B 5F1IB 2EEAA 5CEZE 4RZCA 5CFHA 5HYEA 1U8PB 2VSCA 4G8EA 1DUZB 3QG7H 5HHVL 3EYOA 4UMGA 3U79A 4OCWH 1JGUL 2CSPA 5BRZA 4WUUD 3FO1A 3BZEA 3EGSA 4OLWL 3EYVA 1I8IA 3UBXI 5JMOC 2JCCF 4EKXA 3GO1L 3BP4A 5H37G 5JQHC 3NFPA 4N0FB 2FJFA 1VEMA 5DGRA 2Z4QA 2QL1A 3SDAC 5D2NC 3P30H 1LE5B 5CEYB 1CVSC 1IAIM 3L7EB 2FGWH 1OSPH 2EEDA 5I6XB 4PB0H 4LCUB 3ARFB 1DBML 3MLZL 3P9LA 1HKFA 2DM4A 3QNYB 4PJBA 3O0RH 4Z7WE 4MD5A 4LNRB 1OP5K 3MROB 4HIXL 1MFAL 1X6LA 1IC1A 2ID5A 2OZ4A 3IDIA 2H9GA 1OM3H 3OKNA 4XPAH 4PG9B 1PW3A 2Q7YB 1XF5B 5GS1B 3SJVE 4OLYH 4XNZB 3JV6B 2OZ4L 2PETA 5J57B 4N8VG 2I9TB 1GPOH 1P1ZA 2AJ3B 3U7YH 3PP3H 1AP2A 3C5ZB 3X17A 1M6OA 1U2CA 1UH3A 3DOSA 4HH9A 5TJWK 3FN3A 4MJIB 1IZJA 4ZQKB 1A3RH 5D1ZC 3V2AR 2HWZL 1PY9A 3WFEH 1U3HB 3BHBA 4S2SB 1ZA3A 4JHZA 2X2YA 4OD3L 5IEHA 3CX2A 2UV3A 4YC2C 1Q9WB 4ZDHB 1QOKA 5ICXB 4LF3B 4U1LA 1MJ8H 2NY1B 5JIHA 2EXYD 12E8H 5I74B 2ITCB 1DQQB 1NMAL 5GGVH 1OOAA 3F8UB 1T4KB 1YEDA 3NTCL 3OKEB 1S7UA 1IAKA 5EBLB 4G9DA 5JW4R 3OKLB 3IDYB 4IMKC 1OTTD 3T04D 2DYPD 3OF6A 4LCWA 3CFBB 5AD0B 2PTTB 4U1IA 3IF1A 4TUOB 5D1ZD 1FNEB 2OR9L 3GFUA 4K7FA 5M95B 3DX8B 3LKOB 3O6KH 4PJ7E 1AR1D 2HN7B 1XR8B 1X5HA 3HG1D 3SE3C 3C87A 1VEOA 1RURH 2DYPA 5DD6A 3KPOB 1KF9B 2EIZB 4NO0B 2O5ZL 4HQQH 3RBSA 4YC2B 3KPRB 5LAXA 4MVBD 3T4AA 1OB1A 4I8DA 2YD7A 1Q0YH 2EDQA 3MV9D 1T0MA 1MJJA 3BN9D 5C09A 5D7IB 3CH1B 2F54A 3D39A 4HGWA 3ULUC 4PJFA 2NY0C 2EYSA 3GMRA 8FABB 1TJHH 2VRAA 2PXYB 3FQXA 2VO5A 2DBLH 1D6VL 3GJFB 3VFTA 2XKSA 2Z4QB 1ZANH 3B9EA 5CBAB 3AGVA 4TPRL 4KRPB 4L3EB 4RIRB 1TENA 4DZ8A 4YXLL 5J3HC 2DIJA 5IW6A 4U6YB 1HHJA 4XXDA 4AZ8A 3UC0H 5GS0H 3V8CA 1CU4L 2BNRD 4D3CL 5I8CA 3PDGA 2GK2A 4OIIL 1NSNL 4LSTL 4DTGL 4D0BB 3C5JA 5SX5K 1EV2E 1LEKA 3F6IA 4H0IA 1T2QH 2X4RB 1Q38A 4HIJA 2YUVA 1YZZA 5FKAB 1KG0B 1OTUC 3RVTC 3WO3B 5E9DD 3PP4H 5F7LB 3TVMD 1XF5A 1AXSA 1QLEH 5HI4D 3QSKB 4WV1A 4V1DA 2OL3B 1DR9A 4Y5YC 3TNMB 4OZGF 5JDJA 2LV4A 4L4VA 2HT2C 1JZ5A 4OAWA 4BH8A 4HZLA 1FZMA 1KCSH 4NRYB 4Y8DC 1G9MC 4ENEC 1D5BB 3LKQB 4QLRA 4W4OA 3WL9B 1OVZA 3HRPA 3UTTE 4PJAA 3TZVB 5L6YH 3KHOA 3FN0H 5IB4B 5JHDA 1TVHB 4JN2A 1IBGL 2XZQH 5I1KH 3CU1A 3M17A 2AKRA 3VMOA 1YNKH 3Q6GL 2P7TB 3RNKA 3ULVC 1YC7A 1NGQL 4C58B 4LGPB 3UBXB 2LU7A 2BOBB 3MCKB 4R4NC 2WAHA 3RDTD 1P6FA 1BEYL 3B2VL 4RGMB 1HCVA 1I7UB 1U58B 2J7LA 5BZWA 4FABL 5C0AE 3PHQA 3OXRB 4YBLB 1NBYA 2C3VB 2R4SH 1ZEAL 4FG6D 2DWEB 5IQ7H 2AK4B 4HKJA 1RK0B 1AXTH 1KLUB 1PG7L 3O4OC 3B9KA 3GBNL 5KSAA 1BJMA 3TBYA 4U2ZA 4JHWL 5DR5H 5IB2B 1XAUA 4QOKB 3QIUD 1OHQA 1MIEL 5FUCE 1NAKL 5EA0L 4M3KB 4Y4FD 3PWLA 5BJTA 2F53A 3CDCA 3O11A 2NW3B 1UXWB 1WWCA 4ZNEE 4MQ7B 1OB1B 3QH3A 1KJVB 2A6IB 1QBLL 1J12A 1ZE3C 1E6OL 1ZLSH 1I1YA 4JKWA 3M17B 2I60L 4PBVC 4I77L 5DURD 3SDDD 1LE5A 3FQXB 3X3GL 2AJUH 2B1HL 5GS0C 3EUUA 4JFDE 5I8EB 1KNOB 4PJCA 4WV1C 3UTTA 4WTWA 3VFVA 3H7LA 3O8XD 3SDDC 4J8RB 1KBGH 1HXMB 5CZXC 3H7BB 3HZVB 1HYSC 4BFIA 4N5UA 5IIEB 3TA3D 1S9WA 3HC3L 2G5BA 4GH7B 4M5YH 4XX1E 3RPKA 3B9KB 4EXKA 3LIZH 4XZUB 3ROLA 3LB6D 2MJWA 3ZL4L 1U8NA 2Q7YA 1IGYB 5F44A 4LBEB 3VFPB 5JW5B 4MAYC 1SJEA 3NOIA 3BISA 1N6VA 3AROA 5D7JB 3DRTA 2ICWJ 3CFJA 5ACZA 3A6CL 2IANA 4ZODA 5GGRA 2DOCA 5K59F 4U7KA 1T6WA 4FFZL 4UT9H 1E27A 1X5IA 4HH9B 3FMGL 2OSLB 1J5OL 4DKFL 1WFNA 5J1AB 2V2WA 2BMKB 3FFCB 2ADJB 3STLA 5GS1C 3GMOA 1HIML 5ITBL 1X5YA 3V8OA 3DROB 5DJ8B 4G80A 3BRFA 1RZIB 1WEJH 3N06B 4X99B 4J1UB 4N0FA 3ZTJG 1CG9B 3SOBL 1ACZA 5ICZB 5EOCL 2BNQA 4Q6YA 1BQUA 3NFNA 1F4YH 3I75A 2JCCE 3T0DA 4JZOA 3MOBL 4G6FB 4OKVB 1J05A 1NAKH 5LGKA 1BWMA 4P9HC 5IVZA 3IFNL 4GMTH 1V8HA 3CVIH 3GNML 5KSBF 4TNVK 1E4KC 3LV3B 4Y5VB 1A7NL 2WLYA 1QVOB 2R8SH 1NAMA 2FHBA 3X14A 5GHWH 2KKQA 1U8PA 1EDQA 1AD9B 1NCWH 4PUBH 3GK8L 2VDLH 1B6DA 4JANB 4EOWL 4K7FB 5IESH 4Z7UF 4KQ3L 4RGND 4XCEA 3QO1B 4YNYB 3EGSB 2ZCKL 3JWOH 3LH2L 3O3EA 3GEWB 1NJ9A 4PBWD 2CIKB 4KI5F 1NQBA 1YNKL 4K8RH 3QDMB 3BIKA 3HUJE 5IMOA 3NGBB 5SWSE 3OJVC 1KEML 5DQ9A 1NKRA 3EFDL 2DLHA 3C6LB 4NP4H 3VGGA 3RVXD 2W59A 5D7IE 3L1OH 5EOCH 3H6JA 4RX4D 1W0WB 1BIHA 4ELME 3F7YA 1KCSL 5EZOH 5H94B 2O5XH 5ICXA 4F7EA 3QDJB 3VGAC 1H5BA 1P7QA 1F8TL 5ITFB 2AJYH 1E4XI 4ERSL 2CGRH 3BX7C 3RVVC 4KRPD 1FPTL 3QA3B 7CGTA 4YUEH 4A6YB 1GXEA 3AY4C 4Z7VE 3H3PH 1XFPA 2X6MA 3LZFH 4YHOL 3MUGB 2UUDH 3DJ9A 5FKAA 3VA2C 2R23B 4HIJB 1S9XA 3SDAA 4C56B 4GRWE 4HWZA 2BVPA 4AJ0A 1RIVH 3BP4B 1IQWL 3RQ3A 3WDHA 1FYTD 1MCWW 1GRWA 3MGOB 4XWOC 2E6JA 2CDEA 2ZUXA 5EC1B 43CAB 4EN3D 2P45B 1T83C 3DVIA 4JM4H 4M5YL 15C8L 4EBQL 5CEXB 5D6CB 2APWA 2FEEL 3S5LB 5CKAA 1RHHA 2ADFH 2XN9E 4O9HL 1JGEA 2W0LA 2AQ2A 4XNMB 1BQSA 3MUJA 4ELMF 5DC4B 3INUL 2MPAL 3CLEH 2B1HH 1UT9A 4GW5A 4JRYE 4UIMB 4DUWA 3RWFB 1YNTB 2W38A 3I3BA 3V0WH 1SM3L 1XEDA 1QHOA 4ZPTB 5E6ZA 1CICD 4ZS7L 3ZZ1A 4OJFH 4OTXH 4WO4C 4OCXH 3I2CH 3PUCA 5TPWL 1S7XB 4X7DC 5CD3A 4TSAH 4M7KH 4L3EA 1KIQA 2N7AA 5FV1L 2WW8A 2UWEF 3C5SA 4MJ6A 1AIFB 3TESA 1M7IB 3ULUL 4YHYB 5I16B 4LOUC 1VFAA 3GJFK 5EUOA 3RY6A 4CBPA 1NUDA 1U41A 2NY5H 2C7UA 2ZG2A 1GGIH 5D1XD 3U0TB 1AR1C 5EU7E 3TFKD 4YIQA 5I1HL 4NWTL 5E8PB 2AXHA 5FM4A 3TO4C 4YDIL 3BQUD 3FB6B 2KQMA 4J4PC 4GAYA 1H3GA 3D25A 3HS0A 1PZUB 1VGKB 4GG6E 2FH6A 2X09A 3VH8B 5HHOD 1CFVL 3Q1SL 1A3LH 2ZUQC 1A02N 2DD8L 1BWWA 1JHTB 3TA3B 1SEBB 2L7JA 2OBGA 5FDWB 2PW1A 1MWAA 2XZZA 1EERB 4Z7WF 3VFVB 5I8CB 1MIML 1S7SB 5BVPH 4TTDD 4PRAA 5IR1B 3BH9B 4PG2A 3AREB 4WRLA 4HBCH 3MCKA 5E2UH 2HFEB 4FP8H 4R4FL 1D5IL 4RZCB 1FBIH 1F2QA 1G9ML 3KJ6L 2ZOKA 1MCHA 4Z8FH 5L2JA 3BRDA 5KJRL 4XZUA 3ROLB 1YEIL 4UTBH 5C8JA 4HXBL 1LWRA 3KLAA 3PXHA 4GRWB 3UTSB 1OAYL 4CUCA 4FNLL 1YNLH 4FTVE 4NKMA 4PJGE 3CSPA 4KJQC 5CUSL 1IM9A 1U8MB 3MJ9A 5EZJB 4OUUA 4O2CB 3S7GA 3TWCL 5I73B 3W11D 3G6DH 1XGPB 4C83A 4QRRD 4AMKH 2Y5TB 3PDOA 2IAMA 5DZLA 4P2QE 2QR0B 4K3DH 1QA9B 3MJ9L 2BFVL 5EU7C 4HH8A 1ORQA 4RGOH 5E2VL 1ROWA 5EIQA 5FA3B 4NYLA 4GSDH 1H3PL 4JLRA 4MNQB 1NGYB 1UQSA 1IVLA 4QRRA 4HXAL 5IGXL 4YGVA 1NANI 4YK4C 1NC2B 1WZLA 3CFCH 2C3GA 2HJKA 3KXFB 4KJPC 5DMIL 5IF0B 1J05B 4QWWC 3QFDB 4PJGA 1PJ9A 3LRHA 1MQ8A 3QUXC 4H0GA 3RUGB 2NX5A 4KJQD 5L2JB 1X5KA 1ZHKB 1BP3B 2E27H 1VPOH 3ARBD 1HXYB 3MYZA 4RFOL 1RVFH 5GS2D 4XMLH 4PP2B 3L3HA 4X6DF 4EBQH 4NOFA 4Z5RB 4JDVA 4J7RA 3L95A 4CADA 5C0DA 3TVMC 2R56H 4FQJH 5HYFA 1E4XL 1JPFB 3ROOA 3WD5H 2NXYB 2JF1A 4P2QB 2HFGL 4WFHE 3DUSB 3L3IA 1KNOA 1J88A 3VGBA 2OJEB 5BS0A 1A2YA 4DQOL 2RCSL 3M1BB 5IMKB 5HHNB 3VCLA 4KROB 2H32H 4HT1H 5DSCA 1O7VA 5DRNA 4I0PC 5DTFB 3IGAB 1XGQB 3NIFF 3QUZC 2AI0L 3ZE2E 5HHQB 4CN1A 5HHPA 4MA1B 1RPQA 4XP1H 1EEYB 2W1NA 4ZFGL 1RULL 1XGRB 1DL7L 3BUTA 4PJAE 5KSUA 4ONHB 2YK1L 3NN8A 3DGGB 2D7TH 5GGQH 1AKJB 4LCUA 4NQCD 2V5TA 5IOPA 2X44D 1CL7L 2Y4SA 5GRVK 4JFHE 3MLRL 2DDQL 2XA8H 3BVNA 1RI8A 3O2DA 2GUOA 5JXAL 4M9OA 4PJFE 4I9WD 4U7MA 4Q58C 5MEND 3QZWG 2IGFL 3SPVB 1TQBB 1A3LL 2FIRT 4IRSC 1CLZL 4JO3L 5DD0H 4ODTL 3VW3L 3G6JB 4H25A 2EC9U 2XKNA 2H45A 1QRKA 3QH3B 4NQXB 5A3IC 5EN2B 3DTXB 1J1XH 4PJDE 3ARGD 2D0FA 4OZIA 5A40E 1CD8A 3F7RA 2VISB 4S0SD 1KIRA 4EIZC 5ESVA 1EJOH 4R7DB 1RUAH 2R29L 4Y4HC 3BH8B 4PRPA 5KVEL 4JDZA 4M8VA 5EUKB 3LPFA 4LKXA 1TTFA 2F54E 3D39E 4TVSa 1MFDL 2IH1A 1QNZL 3DMMA 5HYSA 2PN5A 4KWUA 4PV8B 4FTVB 4RDQG 1M7DB 3TLRA 4KKBD 1AC6A 4WO4D 3PGCB 4I18A 4HBQA 3WJJC 4UILH 1T03L 4WWKD 2ZKHL 4NC2B 3LY6A 4XAKE 5I75B 2X4OB 3HA0A 2AJVH 5I1GH 4R90L 1E4XH 3T3PE 5HI5C 5JZ7C 1U36A 4NZTL 3A0OA 3S98A 5LQBL 4HUWA 4XBGA 4MMZC 1B2WH 3FQTB 4ZOEA 2RGSA 1UWXH 3VWJC 1MVUA 1LD9A 3NCJL 2UUDK 4O51B 4IS6B 5DUML 4D0CB 4ZDHA 5JXEC 1JGUH 4HSQA 5I16A 3FHAA 4YFLI 5DJ2A 4MAYD 1SBSH 1HWHB 5L8KB 4AM0B 3LQAL 3E8UL 4MCZB 3K80A 5I17B 4UDUA 4OAWB 3QIUB 3NPSC 3WHE0 15C8H 2QKIA 1LEIB 3IDGB 2HLAA 1T3FA 3HG1E 3GRWA 2F19L 3TYFA 4ALAH 1MQKL 3ARDC 4K3DL 4NNXA 3HS0B 3UO1H 3VDAA 5SX4I 2DQTL 2FX8H 4LVNB 1MWAH 5C3LD 1QSEE 1G6VK 1PLGL 5HHNA 2EYSB 8FABA 2A6DA 4YHZH 3KYOB 4FFVC 5L9DH 1JPTL 3KPLA 2AEPL 3WFBH 1YNLL 3EOAB 4LDEB 1LILA 3UJTH 3GUTB 4DZBB 3SDXB 3MZTA 1FVEB 1A1MA 1AXIB 1FDLH 1U8QA 2EDNA 4LCCC 5D7JD 3O3BA 3BW9B 1I7RA 2VJXA 5EBWB 2VDOL 3FZUD 1NBQA 1F8TH 3H9YA 1QFWI 1MCQA 3EJZC 4JFOA 3SDAB 4CGTA 1F11A 4PRNB 4MNHA 4YDJA 4ZSOA 5LKNA 4P48A 3QCVH 3F6LA 3VFSB 3SE8L 4V1DD 5JHLH 1FZJB 4M1CD 1CDGA 1I4FB 1T66D 1YMME 1V5JA 5EWIH 2Y25A 4WFFE 1FE8L 2H3NB 4NHCL 4LLYA 5DRNB 1FRGL 4LCWD 1MRFH 3VG0L 4XNMA 1ZSDA 1BOYA 4JRXA 2ZUSA 2A6JB 2M2DA 1QFUH 4V2CB 3VXMB 4Z7WA 4CU6A 4PJEE 2G5RA 1L6XA 4OIAA 4D0BA 5KN5B 4C56E 4YPGB 3OXSB 3CH8A 3TJEL 1XF2B 1BBDH 2BVQA 5JMRA 1HHJB 5IMOB 5HDQH 1JZ6A 4E42A 3HC0A 4JO3H 1P84K 2OP4H 1KENL 1OD9A 1XZ0A 1AGBA 1FG2A 3G5XA 2EYRA 3Q6GH 5F1KC 4DVRL 3O3AB 5CWSB 3TCLA 2XTJC 3D6GA 1VGEL 2NZ9C 4DAGL 4X6BB 3D85A 4WDIA 2BHZA 2HP4A 4NBXB 1A4KA 2GJZB 2Z92A 1NFIB 3MRGA 5GZNC 2JJTA 3W0WA 3RZCD 3UTPD 4UUJB 2IEPA 4JRXE 2ENSA 2HRPH 1AKJD 2VQTA 5EU3B 1C5BL 3OB0K 2WANA 2EDXA 4JVPA 5F1NA 3HFMH 5SWSB 5HBBA 1G7HB 4ZFGH 1A4JA 1JNHA 3QISA 1J1OL 4UBDC 4KKLD 5I8OL 1JHLL 4X7SL 4PRPD 4N0CD 1R5IA 2OI9B 3VXSB 1KJMA 1ZXQA 2OTWA 3QUMB 1M7DA 1MCOH 1OT2A 4F7CA 4NQEE 4ZFOL 4RCAA 5TDNB 3JTTA 3KPSE 4TVPH 3HKFA 5BVJB 1C1EL 5IB1B 3QCTH 4UB0H 5I1JL 1CZ8L 3HAEA 1D9KC 4GRLB 4E42B 3ZL4H 4PJXA 4OB5H 1BFVH 5HY9A 4U33A 2VLJD 4JGUA 5TDOA 3PWJB 3PIQA 4R26H 1YPZA 2F5AL 5F96H 4NQDE 2Z31B 3F62A 4KPHH 5F3HA 4MAUH 1A6VL 2YZ1A 3ES6B 4NCC2 3QFJA 1BVZA 3FQWB 3KXFE 1NBZB 4OGYH 1VKXB 3CIQA 5DYOB 1LHZA 4KI5C 5HVGB 5C09D 2DQHH 4M5ZH 4M4PA 3H3PL 3MRFA 4QRRE 4EVNB 1UVQB 4M7LL 1G6RH 2XZAL 1XIWC 1NBVH 2NXZC 2NW2A 4JJHA 4LSQL 3E6HA 4FHBD 4TRPL 1IAII 4POUB 5EPMA 3SKOB 3FFCD 1RQ5A 3DUUB 5EUOF 4HIHB 1ZVSB 1A5FH 2Q8BL 3OAZH 1DUYA 5GJSH 3NACL 2V2XB 1RUPL 2XZCL 2YD5A 4XVUD 3IU4L 1IL1B 1UXSA 4JN2B 3SEPA 3ZDZE 2A1WH 1HH6A 4JQXA 1LO0H 1X4XA 1YUHB 3V4PL 5C09E 1LK3H 5ALCH 5H8DA 2B4CL 4Z7QE 4PJXF 5FM5O 4YAQB 1RJZB 5F21B 3D2UD 1G9NC 4DGYL 4OZFB 1Z5LB 5J6GA 4NZUH 1QSFD 4AH2B 3EBAA 4G6KL 2R1WA 5HDLA 4YQXH 4JM2B 3HG1B 4XHQA 1G9MH 5IK3A 1FJ1A 4HCRH 4XPBL 4MD4B 2YA2A 4M03A 5CP3H 3S96A 4U2YA 1FIEA 1S7WB 1FNGA 1JTPA 4HFUH 5KANI 1WISA 5I1AB 1NGZB 2V5YA 2UYLA 1A1NA 4OI9A 1J8KA 4G8GA 5KVDH 4GFTB 2DDQH 1FVDB 2XA8L 5DJXA 5I9QB 4OCRH 5J1SC 3LDBC 1HWGB 1BOGA 1UKSA 3FZUC 1BD2E 1F4YL 1TIUA 5AEAA 5CP7B 3TJHD 1GPOL 2ATPB 1A14L 2GTWA 4X7EC 2H26B 2FWOA 2J88L 4U1MB 4NFCA 4RIRA 3HLAA 1I1YB 5KN5A 4HAFA 4OLYL 1A9BA 4X9GA 4DOHE 4ZFFB 1CDBA 5CCKH 3U2SB 1Q9KA 4QY8B 1UZ6E 2CJUL 5FUOL 1T0NA 4ONFL 3FMGH 2AEPH 3WFBL 3MRMA 3DSNA 4X6CF 5E6YA 4JPKH 1UB6A 5BOPA 5JW4Q 4H20L 3D9AH 4AG4L 3O4LD 4MQXD 1UWEH 4O2FA 1Y0LB 4K2UL 4BQ9A 3NA9L 4WV1B 4O02L 1HSBB 4PRBA 3KYKL 4JRYD 4AQ1B 2BERA 4YXLH 1CZ8H 1I9IL 2GK0A 4JFZH 2A73B 3S88H 1DCLA 1NMCC 4UAOB 5CS7A 3VI3E 1D6VH 2GT9B 4JR9H 3ARTA 3DXAD 3BPLC 3IETB 5F9JB 4S1SH 4GW4A 3LKPB 2I25N 2NW2B 1I4FA 3KYKH 3EYUL 2NLJA 1KJ2A 2AQ3A 3ROOB 1T1YA 1WUNT 4DEPB 4M7ZC 5INCB 2ATKA 2Z93A 2K9UA 4PV8A 1G9EA 3V7AG 1R5VB 2YRPA 4GKSA 1U92B 1B2WL 4Y4FB 3QQNA 1L0YA 3PWNB 4F8TA 4NUJB 5LBSH 4GKZB 3T08A 3O6KL 5F3HB 3TYFB 4JAMB 2HJLA 1X5JA 3ISWA 4LPUA 4ONOA 2FLBT 1X5FA 4LLUA 1MCBA 2KH2B 4K2UH 1MNUL 3TEUA 1BBJB 5C0GB 3T0EE 4RWYL 5FOBB 1J86A 3K81A 3E6FA 4L5FL 3CSGA 2J88H 1HILA 3JV6A 4KKLC 2VLRD 5CSGA 3TO2A 5IQ7L 2GK0B 1S9YA 4CU7A 2FZ3B 1NLBH 4U0QB 5DI8A 1V3LA 1EJOL 3S34L 3BDBA 1YEIH 3FONB 4P5TD 3UJIL 4LCCB 3WLBA 3BQUB 5B39B 5CBEB 1LO3H 4OM0L 3Q6FB 3P9MA 4UT6H 5CIPB 5MENA 4MNHB 4I0CC 5EU4A 3QUYC 1T7ZA 4ZPTA 5EZIL 4L8DA 2DQEH 1MH5B 5FFLA 2JIXA 4PGCB 5D93C 3PGCA 3VFUA 5GRJL 5CSBA 3BH8A 4PRPB 5FO9A 3LQMA 2HKFL 1A9BB 1ND0B 4NWUH 3IXAA 4K3JH 5EU5A 2CDGA 2OQJA 5BXFB 1GHFL 3C60B 1UZ8B 5KTEL 4P4KB 2X1WL 3BGMB 1QR1A 3KLSA 2FEEI 3RHWK 3QI9C 1MAMH 1FORL 3OXSA 4J3XA 2X89D 4G9FE 3MR9B 3MV11 4X4YA 4WW2B 3WFDL 3UTZB 4LHQB 1JMXA 4S1QL 1N0LA 4LU5H 1ZKAA 1GGTA 4L29B 4U05A 4O2FB 3QYCA 4IM8A 5DZNA 2XI9A 1LP9A 4JB9L 4X6EA 1VGKA 4GBXA 2FSEA 1WTLA 3LDBB 3UPAA 1S5HB 5C0AD 4OCYL 4WW2C 3BUYA 4BA8A 32C2A 5MENB 4KMTH 2ZCHH 1HCFX 5E6IB 4G6JH 3O6FC 4TTDC 4MDJA 4IS6A 4BQ8A 5CLTA 1X5LA 2CDFA 3R0NA 3R8BB 4OJFL 2E7LC 4ZS7H 2DQCL 4K3HA 3GHBL 3ULVF 5J13C 5DC9B 1YPZF 3ZT7A 4X98B 4I4WB 3VGEA 4P57A 3FO9B 4H26A 4XP6L 3DI3B 2DM2A 2NNAB 5IGXH 1C1EH 2VLRA 3MRPB 4TVPL 4U6YA 2BY0A 3CVHB 5IB2A 4MWFA 2BRRH 1W8OA 5FA3A 3CCHA 3MJ9H 3LD8C 4XNXL 4R97B 4G8FA 3O2DH 1IE5A 2VTFA 4FQ1H 2Q76A 3ZHDA 2PO6D 1VA9A 3EYFA 1AD9A 3VDCA 3CFDB 1AGCB 2QADB 2PR4L 4XAWL 1QLFA 1AGDA 1IM9B 3GJEB 1BOGB 3P11L 4PJHA 4LCCA 2P1YA 2ZOLA 4JY5H 2CIIA 1KN4L 2JK5A 5IKCB 5MERA 5C07D 3QRGL 4H8WL 4CVXB 4RQQA 1ZLSL 1FBIL 1G7QA 4ZSOB 5KTEH 3QUXB 3LSOB 1B90A 4QYOB 5JOPE 3RGVB 2H32A 1WT5C 1KJ3L 2VDNH 1CLZH 4G80B 4HBCL 3VW3H 4KDWA 3TIDB 3QPQC 5AWNH 1LEGB 3T2NL 4QHUA 2KUTA 3I3DA 2XOTA 3OGCA 1XGTA 2J12B 4Y16A 3DBXA 3NZ8A 4OM1L 1NGPH 4OCLC 4JVWA 2DQEL 3KGRA 2YUZA 4KKNA 1MY5A 1C8PA 4QXGH 3QNYA 4PJBB 2G75B 2G60H 1S9YB 2FECI 2F53E 2AXGA 2EYTA 2ZOKB 4I3GA 1AXTL 5D6DC 3MRJB 3L3OB 5MP6L 1ACYH 1N59B 3GSNH 5CZKA 3PDDA 1KCRH 4OZ4A 4KKCC 3SGDI 2HTKC 3MLSL 4X4ZA 4K8RD 3IDJA 5KOVC 3C6LD 4DKAA 5CJXC 4YK4B 1ZVSA 2W07A 1EEQA 3PNWA 2ICWB 4J4PA 2AV1A 3T0WA 3OB8A 1GGIL 4OQTA 2CRIA 3I6LE 5ENWB 1QBAA 4NCDA 1YNTA 2R0LL 3DECA 2HVJB 3DUHA 2AEWA 1GCFA 1CF8H 3PABB 1OWWA 2QEJA 1T1YB 1WFOA 2NXYD 1OP5H 4K07A 1RJCA 3IXTB 5DF0A 2ITCA 4OQ1A 4WW2F 1JP5A 2ESVE 5I73C 1FLRL 2E27L 5EO1A 4UDTB 1H5BB 1P7QB 3W82A 4ONHA 3VRLF 1W72A 1HINL 3MRIB 4AH2A 3O3DB 3MV7A 5GRZA 4I48A 4XCNB 5ADOL 2WP3O 3INUH 1GJIA 4WHYG 3X3FL 4QEGA 4MCYB 3RAJH 1TQCC 3WNLA 4K8RC 4I0PB 1HOCB 4O9HH 1QSED 1KCUH 2FWOB 4MDIA 1I9RH 4PGBA 1I9IH 4UI2A 2A77L 2F74A 3QBTB 5T1DL 1OP3H 2VAJA 4PRHE 4OF7A 3P4NA 5ADOH 3MLUH 2VXVH 2YSSB 3GHEH 1WVZA 3CFEA 4PV9A 1EXUB 3EOYG 3IYLW 4TPRH 4JGMA 3QCTL 3SQOH 2WWMC 2A0LD 5F6HI 3WEXA 4PJ7F 3LQAH 1FH5L 3V4VL 3IXTA 3VRIA 4PGCA 4KZEH 1YA5A 2PXYA 4YUEL 2NLJB 3OAYK 2NY2C 2MKLC 1Z5LA 2AS5M 1UM5H 5F7NC 3VFGH 1T3FB 1E6OH 1RUQL 5H2BA 5J1TC 4WCYL 3ZDYE 3V52L 4LASL 1LEGA 3HHRB 3DV6B 2W60A 3WNMA 3NMEA 2WM0A 2RBLA 1S7WA 3MLSH 1OPGL 4G7YL 3HE7A 2CRYA 4PJ8C 3ALXA 1U0QA 2J8UA 4NZRH 4MDIB 3TVMA 4ZO7A 1A64A 3CUPA 3EYQC 3MLTA 3S3SA 4YPJA 1KENH 1ZLWK 4HWBH 2A6IA 5F6IB 3RWJB 1Q0XL 3S3PA 1OTUD 2GJ6D 4LSPH 5F3BA 2DJSA 1RUAL 5F1NB 4EUPH 4J3TA 5BRZE 3TN0D 1J1XL 4PPTA 3MRBB 5E99L 4QY8A 3T2NH 1OY3B 5GGVY 3B2VH 4R2GC 2YPLB 3VG0H 5J06A 3O45B 1LK3L 2OCFD 5ALCL 4OM0H 2EE9A 3ETBF 3QFDA 1U8JA 3VXPA 4GS7B 4NKDA 2ZCLH 4P4KC 4E5XA 3ESVF 3NIGF 4H26B 2MTPA 4HAGA 4YR6A 1E4KA 3TH4T 4RMRA 4ZTPL 3VFSA 2I5YL 1CICB 2QQLL 5IVXE 1TVDA 1DUZA 5JIKA 4WHYH 3JV0A 3V52H 1OSZB 3FHQA 4UZGA 3GI8H 1QFOA 5EFIB 4KGJA 4LSUL 1O5DT 3EFFB 3HB3D 4LSQH 4XXCC 5A3ID 4XPAL 4PY7B 1PEZA 3TYGH 1KCVH 3D5OF 1F90L 1I1AC 2UWEA 4PJ5D 1IGJB 3I9GL 2NR6D 2F54B 3D39B 4HGWB 2IAMD 1HHGB 5JA9A 1S8DB 1RVFL 3P9MB 1V3JA 3I84A 4JQVC 1MWAL 4XNQA 2D9QB 1IMHC 3NAAL 5DRWB 2EDLA 3V6FB 3P4MB 5ABDE 1PBYA 5DJ0B 3S35H 4MNGA 1C16B 1QR4A 3UYPA 1CI5A 2CXKA 2R56L 1QFWH 4MXQD 4G3YL 2A77H 2F5BH 4U1JB 4IMLB 4S1SL 3TCLB 4QGYA 1ZANL 4MXVE 1KULA 4RFOH 3KS0J 3BP5B 3VMNA 1UZ8A 5DWUH 1S78C 4KI1A 4PRPE 2BNUA 4NPYA 5I1CL 3WXWL 3KWWA 2C4XA 4M3JA 1S5IH 5DDHB 3UTTB 5F70A 4JKKA 1Y18B 2H8PA 4BFEA 1T89A 1FZOB 3VDBA 1F13A 4ERSH 3NCJH 3QR2A 2IAMC 3MA7A 2YN5A 2O5XL 4ZPVA 4MD4A 1H3PH 4MQTB 4JHBA 5FO7B 4G7VH 1YDPB 4NZTH 3VXUB 3X12A 3WFDH 2EDFA 5CLWA 4GAGH 1T1ZA 4OFIA 5AAMA 4ODSL 3U83A 1W2KT 3U1SH 3N9GL 2R0LH 3WJLA 3QQ9C 5IW3A 5SWZB 5B39G 5C0JB 3TPKA 1YY9D 2GTZB 1UQSB 5FIEA 3DYOA 2V5RA 4QO1A 5J11C 1FIGH 4NQUA 3VD7A 1UA6H 3AS2A 4LVNC 3BJLA 4X6CB 1MIMH 1ZA6B 2CIIB 2JK5B 2VDQL 2A38A 3HI5H 4OF3A 3HC4L 2VDLL 4EOWH 5IQ9B 4G6ML 2X4SA 4F15C 5AYUL 3MUY1 4WI8A 1NCWL 3N50A 1I9EA 2ADGB 1PYWB 4UDTA 5T3ZE 2X1QA 3ME0A 5HDOA 1GOGA 2HMID 2DIBA 1LO3L 3E6HB 4EUPB 1FFQA 4NO5A 3MOAL 4Z7UE 1YC8A 3HE7D 1IRAY 4KV5F 1NCNA 5E00B 4LQFH 3F7QA 1U8LB 4LSPL 5DQDH 4YHMH 4NN7B 1F6AA 1AHWC 2CUIA 1A2YB 3CH1A 3RZWA 1YEGL 3KJ4C 4QRPE 5D6CA 3RX5A 3RWCB 3RWHA 3BI9X 2BSRA 1G1YA 4M8QB 1UCTA 5KSBA 2YSSA 3BYYA 4RSVA 4OZIB 4XCEB 1R3KA 1EEYA 4XH2B 1AXSB 4GAGL 4LDLB 2QR0A 4G8GB 1PKQE 4UIKH 2L7UA 1WCBA 2ZP0T 1RJLA 5EORH 1AGFA 2ATKB 2Z93B 5IHZB 2GSGA 4MDJB 5HGBB 4NQTA 1HDMB 1OSPL 1AJ7L 3O6FB 3IU3A 3QQ4B 3ULUH 1VACB 1UB5B 1NC2A 3BAEL 4OGXL 2CR3A 2X70B 3JSSA 1Y6KR 2JJSC 2DQHL 4XP5H 2HH0L 4UNUA 3UBXA 1KBGL 2ICCA 3E8UH 3KJ4B 3P9WB 2VXSH 3B5HA 4HJJL 4YBQD 1KG0A 4UINH 1I3RA 1JPST 3D2UB 4XBEH 5DK2B 1I7RB 2NYYD 3QUKB 2GTWB 4R7DA 4H88H 2WBJD 3WIIL 3IFOA 5L8LB 1LDSA 1DP0A 4OZFG 5FGRA 5TQ0H 5D1XA 4XBEL 3CFKA 3KDMB 3MBED 4KTEL 3ZSTA 2AV1B 4I2XB 2YWZA 1DN0A 3QUZB 1WZMA 2D0GA 5JOFA 3EYVB 3RVTD 3TBYB 1EMTH 1ZTXL 4GRMB 4X6DE 3ZKXC 2XRAL 2JB6B 3GIZL 5FUOH 3MZGB 4EN3A 4MD0B 4RFEB 4WWKC 5KZCD 1C5CL 1Y0LA 1J8HE 2I26N 3GI8L 1N5AA 4U1SB 3IDNB 4OZFA 3T0EC 1VSCA 5HVHB 5IR1A 1PG7H 4GQ9H 3QFJE 3LZFL 4YHOH 1UJ3C 2D7MA 3H3BC 5DS8B 2FHFA 1QACA 4ZTPH 4OKDA 3HMXH 4LLVA 2VITB 3AFLA 3P4NB 3WCYA 1OAUH 4XVJL 4FFWD 1RZFL 3BN9C 4TOYL 3RWEB 5A2IH 5DK2A 2OJZH 1IARB 2OTUB 4K7PL 4JHAL 3C5SB 4U4BA 1BD2B 5C3TA 2VR4A 4JFOB 4K3JL 3QEGL 5J7CC 1N6QL 3L7FA 3F5WA 4RAVA 4WEMB 1XMWA 3ZTNH 2Y06L 3LS4L 4PYGA 5INDA 1R5IB 2NXZD 2APFA 4EQ2A 3BO8B 5J56B 4ZFZA 4DUVA 1X4YA 4I3SH 3IFLL 1UA6L 3S97C 4JFFD 4UIMA 4ZSOE 1I85C 4JY6A 2A74A 2EIDA 1BLNA 4NKQB 5DHVA 3CFJB 3RNQB 5ACZB 3VI3F 3DMMB 2OLDA 4NHCH 5HYSB 4GRLD 4YDVA 5DEGB 1TNMA 1RULH 4YQXL 2XXCB 1NGPL 2HLFC 4OM1H 5JPNA 2Q1EA 1NLBL 1WWWX 2BC4A 2NY0B 4P46D 4EI5D 3PP4L 3WIHA 1S9WB 1KYOJ 2XN9A 5GJSL 5AWNL 1WAAA 4G7VL 2LVEA 5C86A 1GVIA 4GRLA 2X5PA 1M05B 4KI5E 4QXUL 2XWJB 1WEJL 2EKSA 4WI7A 4MZ2A 1AQKL 4HWEH 2A9MH 4WUUE 1CFBA 4JHAH 3IFNH 1BVLA 4HLJA 4M1DL 3MMEA 3SGEI 1U8JB 3D87B 4D0CA 1S5IL 4PRDA 5E8EA 3ZKMC 1LD9B 5LBSL 2Y5EA 2WWKT 4Y5VC 5KS9A 1QP1A 4G42A 3MUHL 3S4SB 4YBHA 1HK6A 3CD4A 5JNYA 1QVOA 1EXUA 5ITBH 4DGIH 3Q6FA 3Q5YA 2J8UF 5ID1A 1QSEA 2IWGA 3KPRA 5LAXB 1C5CH 2XNAB 1U93B 1JGLL 5E70A 1G6RL 3L6FA 2VXQL 5I30H 1FFOB 2FO4B 2CRZA 4R9HA 3OF6D 3TT3L 4UNVA 4HUUB 4OFYA 4ALAL 3JV4A 4S1RH 3VRJA 5DQJA 3QEUB 4NGHL 3U6RB 4YDVB 5DEGA 5GPRA 4AY0A 4FFZH 1YEFH 4URTB 1RZIA 2YC1A 4O5LH 4X6FB 3TBTB 2X4QB 4U7SA 1T1WB 3LPWA 2R1XB 3TT3H 1UKTA 1EIBA 6FABL 5KAQF 1J1PH 1Q1JH 2UY7A 4JQIH 3MRNA 4AIZA 5C8JB 5I1AA 3C5ZC 4G9FB 4WFEE 4YDKH 5L88H 5E2TH 1PGRB 5E8DL 2Q6WB 3DNKA 3U0PA 2XG4A 5DO2D 1F4HA 3DXAA 2MHAB 2AXGB 3RFZC 4FQPA 4ONFH 5LQBH 4R0LB 4XWOD 2ARJB 4N0YH 2ZUWA 3MRFB 4EVNA 3CDYA 3BAEH 3ZKSD 1OAYH 2ZNWA 3K4AA 2I07B 1T66C 2AJVL 3AAZB 5I1GL 3EW3B 3C8HA 5JO5A 5J6HB 1MIEH 2E7CA 4LCYA 5CMAA 5E8PA 3O4LB 5CD5C 1CFNB 1AJ7H 1MRCL 5GGTA 1YY8B 1ITCA 5D7JC 1CDJA 3MRRA 1Z2KA 3GBNH 5IFHL 4QHMA 5HDQL 2EEBA 4S1QH 4MD0A 2AEQL 4PJXB 4RFEA 4APQD 2HJFA 4JFPB 5ELIA 4OFDA 3TJEH 1MAML 3C6LA 1A3RL 5E9DE 3P2TA 1KN2L 4TVPD 2FBJH 5C1MB 1JWMA 2AEIT 1I7ZB 1QYGH 3RWGB 5FYKH 3CZJA 2HKFH 3WHE1 1NC4D 5T3XE 1K6QL 1OGAA 4CW1B 1IBGH 2XZQL 2D3VA 2R4SL 3L5HA 5I75C 1EHNA 4X4XB 5MHSD 2I9LB 2IQAB 4PY8I 4GW5B 4FABH 3K3QA 5FM8A 1QRNB 5EC2B 1MFAH 3GK8H 3MBEB 2OI9C 4HWBL 3TFKC 2DB8A 1IAIL 1Q9OA 4JFDB 4PJ9B 2R8SL 2B4CH 4C57C 2QQQA 3FL7A 1K8IA 2NY5L 1U2HA 5EWIL 2MOVA 4FQ2H 1MUJB 2JIXD 4XVJH 5I1EH 2K7PA 5GISL 3QXWA 3GJEA 3K2UH 1F02I 4X7TB 5IHBA 3NACH 1OP3K 3DX9A 1M4KA 2BCKA 4GQ9L 4D0DB 1T89C 3O81A 4H25B 3VFNB 5C9JA 5IJVB 3ARGB 4YDKL 1HIMH 4L8CA 3CC5A 3IVKB 1JHKL 4Y19E 2V7NA 2EDRA 1BM3L 4X6CA 4HUUA 1QLEL 1L9MA 1JFQL 1R3KB 1NCUA 4KUZL 4BZYA 1EVTC 2CK2A 2D7PA 4M5ZL 4PJEB 4X4MA 5KG9A 4P23C 2IFFH 3H7BA 3IB4A 2RAMA 4W6YB 4I18B 4Q0XL 3W39A 1C7SA 2Q8AL 3KG5A 3FB5B 1HDMA 3WMSA 3MV8A 5C0AB 2NCMA 4WEUD 3VU2A 2V2TB 3SGKA 5DJZB 3ARFC 1KPUA 3BPNC 5D93B 1HHIA 3S9DB 1X6NA 1W72H 5JW5A 4TUJB 1T1XA 3C6LC 3QDJD 2F19H 5DMIH 2R2HB 1HH9B 1VB9A 2WNGA 5I1CH 4KMQA 5ESVB 4LGSB 2BVEA 4QHNB 3BD3A 3UTTD 3QULA 4JZNB 4LCIL 2XV6B 3IDJB 2NY7L 2BK8A 5GRUH 3ZLQC 5IWLA 3UX9B 2EDOA 3SKOA 3F12B 3GMMB 2VLKD 2AJUL 5HGHA 3IFOB 3FT4B 1RZKH 1T03H 2BSTA 4XBPB 2BDNL 1RJLB 3LCYA 1QBLH 1ZLUK 1DTUA 3FFDA 3LEXA 5SWZA 1Y6MR 3NZ8B 4OKVA 4R90H 2H1PL 3AU1A 1FLTX 4CDHA 1EHLH 5MP6H 4FQLH 3RWGA 2EDYA 3GMLA 4JHWH 2VERN 1CGSL 1SY6H 4F7PB 1QYGL 3HMWH 1DQMH 2X4RA 3NIFE 4QXGL 3I6GB 2YRZA 5JZ7D 3PF2A 1YQVH 5L8JB 4HIIB 4NNPH 2R69L 1BBDL 1U8QB 2NZIA 1CD9B 4CMHC 3W9DA 3BXNB 3W0WD 4F58H 3RZCA 5KW9H 3BKCL 2EE3A 1BAFL 2P8PB 1JGVH 3DVNB 1N26A 2ARWA 5JHDD 2MMXA 3Q1SH 2AVGA 4NKOB 3PWNA 1Q9LB 1ZHNB 25C8H 4EI5B 5K9OB 4FG6C 2L4OA 3ZE0E 1M7XA 4WIQA 2LE9A 3L3DA 3HI6L 3P73A 4F58L 5IB4A 5JHDB 4XPHH 4PJAB 1WT5A 3M1BA 5IMKA 4U6HB 1B6UA 5C0CA 2GJ6E 2A74B 4DQOH 1KJ3H 2IJ0C 2QQNL 5HYIA 3IAPA 1MLCA 3FJTA 5KSAD 1CXIA 1J1PL 4U31A 2EIZA 1AFVL 3BGMA 1QR1B 2CLRA 1EK3A 3S4SG 4G7YH 3TN0A 2P8LA 3QNXB 1N3NA 4KDTA 3TO4D 5IJKA 1IGFH 1YMHA 4KK8C 3C9NB 3A6BL 3B2UC 1HSAB 3CPLA 5F7EL 5C92A 3L5JA 1EJ6A 4LASH 4DCQA 5D7IF 1Z3GH 3G5ZA 4DTGH 4OCXL 4FRWA 2AXFB 3I6LD 4WEBL 2QLVB 1SYVA 1RUQH 2X70A 4D3CH 4CVZB 4EI6A 3DX7A 2XZAH 3O2DL 5DT1L 4Y2OA 2YBRB 3VXNB 1J0KA 4QKXB 3O9WC 1HYRC 4YDLC 5GRUL 1FNLA 4P2RE 4WI5A 4RDQF 4JR9L 3FFCE 5DWUL 2XTJD 3ZE2F 2A6KA 4IHOB 5DJCB 1SBSL 3B3IB 1G7QB 3MFGB 5F96L 5GGSY 1XGQA 5HI5D 1JK8A 4KMTL 1P4BH 2N7BA 4OGXH 5IW1B 2Z35B 5EO0A 4OF6A 1FAIH 4Y4HB 3WFCH 4OCYH 4XNQB 3VFOB 4BSWA 3QDMA 4CJ1A 5HHOB 1UENA 1X4ZA 2IPUG 4K94H 3HN3A 1GH7A 4HX1A 2EKSB 1G1CA 4HKZA 3TH3T 3WE6B 1L6ZA 4ISVB 3W81A 2DLTA 3BE1H 3HPJA 4GKNA 1ZT7B 4ONGL 43C9A 4KRNA 5CJQH 3VFPA 1UKQA 1X5GA 4JREC 1J1OH 1ERNA 4WVRA 3IDXH 4P2CG 1AFVH 4UILL 4Z8FL 1JNLL 3IDMB 1R24A 4OBSA 2SEBA 2ATPA 1I3GL 3D18B 4NNYB 1I8MB 1OARL 4RMQA 3QWOA 3U0TA 4KI5D 3PWPB 3L9RB 5D7IA 4DWHA 1NGXB 5INDB 5GGVL 5DJ2B 4MA1C 2R2EB 1R3IH 5DUPH 1OP9A 4MYWB 1DZBA 4OLEA 4MXWL 4WHDA 5KVDL 3UJJL 1UXSB 1IEBB 3RGVC 3S5LG 4L8CB 4OUOA 5DJ8A 4G9FA 3RA7L 4LAQH 3DHJA 4IRJD 5C0JA 2EZ0C 4BYHA 1RZFH 3MRKB 4TOYH 4L9LB 2P5EA 1VACA 3HMXL 1CFTA 4NNPL 1ETZB 5J9PA 1YQVL 1JZ2A 3O4LA 2XIDA 1NCBL 3WFHB 5FYKL 4ZAKD 2XN9B 1EBAA 1R3HB 5F89A 3LN5B 3MRQB 5E24E 3QNZB 3MJ7A 4GMTL 3V9FA 1NC2D 2ARJA 4TSBL 1YYLL 3UDWC 2EDEA 3GSXA 4P2OA 5I1LB 4OLVL 4JM2A 4PB9H 2CLVA 4Z6AT 3LKPA 4U0RC 4BKLA 4P0DA 3KYMB 5ICYA 5C08D 3QIUA 3QCVL 2WP3T 2WQ8A 1Z6JT 4BJLA 2PCPB 4C4KT 4X5WA 1JVKA 2VDNL 3CXHJ 4HPYL 3ARUA 1G7JB 2IG2L 2VDOH 5I2IA 2A9NH 1RZKL 1CU4H 1KB9K 3V0WL 1P7QD 4S0TD 2DKSA 1QZ1A 5GGSB 4J2XA 3X11B 3OAUH 1G7PB 3U4BH 1MCLA 4TSAL 2W0FB 1DBBL 3VG9B 3U6RA 1JPTH 2C1PA 3X13A 1FNSH 5D1ZB 3KPPA 3RDTA 1TCRB 4IOIB 3KPMB 3V0VB 2Z31A 3N1FC 4ORGB 4HZAA 4JQIL 3G5YA 1KEGL 3IFPA 1W72B 4JPIB 2F5AH 4ETYA 1NLDL 3GHEL 3SCMA 1TZHB 4OB5L 5FO8A 3BYTA 5L7XH 3G5ZB 1VEPA 3UTOA 4JFFB 1S9XB 4QNPF 4LIQE 1Z3GL 4Q0XH 4ZUUA 4RISL 1F11B 4YZFF 5EU6D 2J8UB 2Q76B 1B3JA 1CFSA 1WBYB 5T3ZH 5DK0A 4MB5A 1CE6B 1RZGA 3N1MC 1T6VN 2OR9H 3IAGC 4GO6B 2ZPKL 4QHMB 1DUYB 2DQDL 3R8QA 5E5MA 1JPFA 3T0XA 4GLRI 5EU3A 3TA3C 5E94B 4ZUWA 2HRPL 5KOMC 1JYNA 4Z0XB 1MRDH 3QCUL 5CUSH 3MRBA 1YJDC 1UH4A 1ZHLB 5DMGC 4PG9A 2LFGA 1PVHA 5TGBA 3TM6A 5I1EL 1KEMH 1IZKA 3SE9L 1JF1A 3MRHA 3PWVB 4JPWL 4Y1AE 1D6EA 2AGJL 4A2LA 2R0ZL 1MJ8L 4BQCA 5DR5L 1RY7B 1HI6B 2WWKO 3LKSB 2ADIB 3FO0L 1AP2B 1MFDH 3HNSH 5TDOB 5F9WC 3Q48A 2ZCKH 5L2KA 4J3VA 2HWZH 4BQ6A 3WN5A 1CLCA 4NQDA 2VIRA 4PS4H 3TO2B 4PRHB 1OSZA 4P5TC 3MCG1 4DGYH 1GHFH 2XWTA 4M6NL 1DQML 4F7PA 3EZJB 2XACC 3HMWL 4Q74A 1FRGH 1P5VA 2ICWA 4YHLH 1KLGB 3CMGA 3KPSB 2UWEB 5GRJH 5C0RL 1BIIB 5HXMA 3TCXA 5FA4A 1INQA 4PJ9D 5CGYD 5GRVL 1IAKB 5EN2A 4LPTA 4N8CH 1XIWB 4ODSH 5ITFA 3AMKA 2HYMA 1UM4H 5GGQL 1RUPH 2XZCH 4X99A 2XQYK 2I27N 2HG5A 4ETQA 5IFHH 1J18A 3QDJE 1FV1A 1PDKA 4OZHE 4QRPB 3UPRA 1OGTB 5GJTL 5J13B 4GG8B 2EKJA 4IRJA 4MLIA 2VZVA 1JV5A 1D5XA 3PWUA 1PD6A 2V2WB 5IVZB 5FECA 1FDLL 5HY9B 5GS0D 3S34H 1BD2D 2Y36L 4TYUA 3VFWA 5BZWB 4XVUC 2BVPB 1CGUA 4WGVB 4F57H 5ANMB 5DJAB 1N5YH 5DHVH 3MRCB 3ULVE 5EBGA 1G7LB 1JPSH 5E2TL 4I0PA 5E8DH 3I2CL 3A6CH 3T0AA 2FIKA 1IC7H 1ZT4A 1BD2A 1ONQB 4I5BB 5EB9A 3T65B 3EOTL 1SM3H 4LLQA 1NBVL 2NPLX 2VR9A 4HIEB 4FQ1L 4JFEA 4HUXB 2ADJA 5KSBE 1AE6H 4K3EL 3BZ4A 2GI7A 3WIFB 2EE2A 4X83A 5C0AA 1S5HA 4OGYL 4PJIE 5EZJA 2O61B 1CFNA 3UTSD 1P6AB 4IBLT 3ZKNC 2PTUA 2BVTA 2J8HA 1I3UA 4PLJD 5D96C 4XP6H 1MREH 3VRIB 1BFVL 3PXJA 5SV4A 3WV0A 4PR5B 2VUOA 4KJPD 1JGLH 1F4AA 3J8F7 2I60H 2D03L 4JDTH 2DLEA 5EH1A 2BSTB 4WW2A 4K71C 4P59L 4LLMA 1FLRH 1AQDB 2LU4A 1AH1A 4YFLF 1TJGH 3EDEA 2MQCA 2X4UB 2YXFA 5E1AB 5H2BB 3RL2A 5DMKB 3VWKB 4WENB 4UOW0 3BFOA 5EO0B 5GGRY 4ODXA 1OGAE 1KT2B 4G8EB 5IBUB 3TBWB 1FNGB 5GZOC 3OR7B 3VMPA 4QXUH 1KPVB 3STZA 2DI9A 3QFJB 5BW7C 4LU5L 3S35X 1Q94A 3L1OL 5J4MA 4H1LB 3NCYS 1KCRL 1ZHNA 3U4EA 3VXNA 1RV6X 5F3BB 4PB9L 1QSEB 4D8PA 4UQ2B 2N4IA 4L1DA 3GSNL 1CQYA 1T0MB 2DTML 4XC3L 2FR4B 3BP6A 1KTDA 1KC5H 4HC1L 3RNKB 3W9DB 3RKPA 3M07A 1NUGA 3S36H 2X4PB 4ZXBB 4M93C 1OAQL 2J8OA 1NMBL 2C3VA 4G43A 5IMMA 1EFQA 1SVZA 1D7FA 1BFTA 4Q9BA 1WWAX 3KHQA 1P2CA 3Q3GA 4BZ1H 4LAQL 4DN4L 3RA7H 2YK1H 2R0WH 5LXGL 1MRCH 2NY4B 1U92A 2YEZB 5ANME 3FTGB 1DL7H 2P42B 3X12B 4AENA 1MCNA 3MV9B 3VFGL 4GKZA 1UGNA 4G6MH 2FBOJ 1U91B 1A4KB 1LDPL 5CD5D 2EDBA 3WIHH 5E00A 1HHIB 1LP9B 1TZIB 2JE8A 4WDIB 1KIUA 4Z95L 4JFFA 1YN6B 1MCEA 4ZUVB 2VZ3A 4GW4B 5L9DL 4L5FH 2AJXL 2Y6SC 3OKMB 1DBMH 2BNRE 3MLZH 1MOEA 5DURB 1LP9F 1H3XA 3BQUA 4OZ4B 2Q3AA 5CJQL 3QEQE 3IU4H 4F7TA 4JFXB 4G5ZH 5FGCB 3H3KA 4UT9L 3OBAA 4IDLA 1I9RL 1A6TB 2CQVA 1YEHL 1DVFD 1NUFA 1BBJA 1EFXB 1MH5A 3T77A 1NL0H 1MQKH 3UMTA 1P9MA 4NO2B 1HI6A 1EHAA 1NFDB 5DD1L 3PE9A 4OT1L 5EO1B