5DHVB

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
total genus 25
structure length 110
sequence length 110
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvB00
4OZHE 2XTJC 3TNMB 1JN6B 1OAZH 4HS3A 3NGBB 2HH0H 4PB9L 3QH3B 2NY0D 3G5YA 2XXMB 1CE6A 3RWJB 3KYNB 3QRFM 1WTLA 1OAKH 3UROR 3DYPA 2QR0A 2BC4B 3FCTB 1FYTD 1F45A 5EG6C 4P2RE 4ZO9A 5LAXA 3QUXB 5MEPB 3DUUB 2XZAL 1J8HB 5GGTH 2CKBH 1ZLUH 1NL0L 3AMKA 1I1YB 3L3HB 5IQ9A 1WUNT 2PTTA 3B8YA 2OTUB 4FFVD 5EUOB 1ZS8A 3KNBB 4JVPA 3UBXG 3CFKA 2QADD 3T8XB 2UZIL 5DD5H 4G9DB 4WEMB 5TDPA 5IHUH 4IRJB 5H94A 3V6ZA 4G6JL 4CADA 3SDXB 2VDQH 2OL3L 5SV4A 2JJTA 1H3TA 4UB0L 5C09A 4C56B 2X5PA 4OZ4B 2DLTA 4PJEA 4CRPA 5CP7A 4ZDHB 3BGMB 4BK5A 5DMJB 1T03H 5ACZA 5J6GA 4G80B 3N06B 4OZFB 3QO1A 2R2BB 5CD3A 1A2YB 4ZAKC 5T5NG 1NSNL 1BX2B 4AMKH 1JGLL 3QG7L 3RGVC 2LU4A 2X4TB 2DQDH 3CSBA 1VSCA 4J23A 5KOMC 3VXQA 2X1WL 1C16B 5F70A 1FE8L 3VI3E 3RWJA 3PHOB 1A3QA 4JFXB 4MA3B 1IAIL 4K7FA 5I2IA 4X6DE 1NCWL 3KLAA 2K9UA 3NCYP 4Q2ZA 5J1TC 1AKJB 2X42A 4KI5E 2G2RA 3O0RL 1MCIA 2ZOKA 1J8HA 2L7UA 2NY4B 5IT2H 1R3LA 3FFDA 1FNFA 4YE4H 1ED3A 2DQFA 3RUGE 4YK4B 1FH5H 2NCMA 4NN6B 1ZHBB 1KPUB 3TFKD 5I1LB 3VRLE 1A64A 4P4RB 3U2SA 1F11A 4RNRB 5KSBE 5EN2A 5ANMB 5J9PB 5I8CB 3UDWA 1EHLL 1BGXH 1FYTA 4Y4KD 4ZQKB 1QFWI 1D9KA 5F71A 1EDQA 1YEKL 3OB0H 1FDLL 2YRLA 1KOAA 2F58H 3EO9H 1TETL 4YHPA 5I8KH 5FKPB 1QEWA 2VDML 5CD3B 1DEEB 4NWTL 1D5IH 1L9NA 4KQ3L 5GHWH 1P7HL 1MCLA 4OGYH 1NL0H 4R26H 2DB8A 2I07B 3MMEA 4JRXD 1VACB 4NFBA 1G84A 1D5XB 1KCLA 1QD0A 5BVPH 5T1KD 3RWGA 2OZ4A 4ODTL 1KCVH 3AS1A 3FQWB 3WDHA 1QG3A 5EOQL 4WEBH 3LZFH 4PRHD 5LQBL 2W9EH 2AJUL 2AI0L 3MRFB 5LWYL 3V52L 4OCSH 4EJ1C 3G04A 4HEPG 1QBMH 2ZSWA 3GBML 1RZIA 2E7LC 1MQKL 3NPZB 3HE6D 5D6DA 4U3HA 5HGBA 2IH3B 5GGSY 1ZGLM 4HS8L 4MXQD 5MEQB 5F9OH 4DGYH 3BH8B 3RIAF 3W11C 3MGOA 1I1CA 4S1QL 3NMEA 1RUMH 4YGVB 2GFBB 2FCBA 1AIFB 2NZIA 5B39G 3L3OA 1MCOL 2NX5A 2JCCA 1JUFB 4K3GA 5JXAL 2P8PB 3PXHA 3RAJH 1WLHA 2P7TB 3WXVL 5DS8A 4EDXB 2VLJA 3ULUC 5CHNA 3BGFB 5D7SH 1NGYB 3S98A 4ELKA 2GITA 4G42B 4Y4HD 3QDGD 3X17A 4TSCH 4D94A 4QRPA 1B6DA 3IXAA 3FQXB 4WFFE 5FM5M 5DUPH 4OV6F 4KRLB 3OB8A 4L8DB 3T77B 4K2UH 5CAYB 4PJEF 1QP1A 1TCMA 2BVQB 1UQSB 2W60B 4BFIA 2F58L 3DMMC 4JRYA 2DAVA 3MLVH 2FZ3B 2PTUA 3ALXA 3CVHB 1DUYA 3C6LD 3O45B 1EV2E 2BXYA 2IG2L 5I76A 3O41A 3SGKC 1BVLB 4H26A 4YGVA 1YEEH 4PJFF 5IFAH 4QKXB 4QNPF 3HAEH 1EVUA 3M8OH 3TPUA 1CDGA 5F9JA 2VDQL 5GRVK 4I9WD 4PJGB 4K7PX 4MJ5A 3QEQE 4YHML 3VE0B 1JPGA 1G7HB 1RZ7H 4WI6A 1VHPA 5CHNB 4X9HA 1I1AA 1SVCP 3QNXB 1N7ML 2DQEH 3BRDA 2F53A 3LSOB 1BVZA 1XH3A 4S1RL 3QPXH 1G6VK 1YEDB 3RBSA 3VFSB 4X9BA 1XAUA 2RIKA 2IBBA 2HLAA 1ETZB 4LIQE 4K8RL 3F7PC 4PJXB 4WUUD 3AU1A 5C08D 1OAKL 1E4XL 5I19L 1CFNB 1T7ZA 3MNWB 4NO2B 3EYOB 5GS0D 1MCQA 2Y7QA 1V7ML 4ORZC 4XNMA 3T4AB 4O2FB 5JORB 1K8DA 1QLRA 3EO1B 2OL3H 5CEYA 5SWZB 3DV4A 4N0UA 4LKCA 4JFDA 3E1F1 2Y72A 1F6AB 5CMAA 1Z9SA 2WINA 3EO0B 4QOKE 3C6LB 5EOCH 4CKVX 4JZJA 4NN6C 5A16B 4AIZA 1SJHA 3DV6B 1JE6A 4MJ5B 1QFWM 5C2BL 3TO4C 3MREB 3SO3C 4Z7WB 4LPCA 3H9HB 4QXUL 1QFHA 3RFZC 4R90L 4M61B 3TZVA 4KFZC 1IC1A 3X12B 1FDLH 4ZODA 3VXUD 1X5IA 3V0VA 4TVPD 3BD4A 3G6AB 4OFPA 1V05A 1G9NC 5DEGB 1M71B 2QQLL 4OCLC 4WWKA 1ETZA 3CSYA 3G5ZB 2YSSA 4W4NA 1T0MB 4L8SA 1O7SA 3C2SA 1C08A 2BVEA 4NO2A 3AREB 1MI5A 1LE9B 4U1MB 3JWOC 3RWEA 4RAUA 3TJHC 2GSIA 4O02H 5C0FB 1T7VA 5I1HL 1ORQA 2HN7B 2V2XB 3HE7B 4XXDA 3P0VL 4APQC 1E4XI 4GBXB 1TQBB 3QQ4B 3TVMB 4OCNC 4IJ3C 5C0ND 3BHBA 3T0DA 3T04D 5TDOA 1CZ8H 4IDLA 4YQXH 3GSXB 1CLCA 4WV1C 1QSEA 5IVZB 3ULUF 4XWOD 2FYYA 3L3IB 3NAAH 1NBZA 3S36X 5KZCD 3O2VH 3P4MB 4F57L 2E27L 1ERNA 4MNQE 1V3JA 4XPBH 3D3VE 1ZLWK 4UV7L 5CWSA 1IQWL 4DVRL 1P4BH 4GW1B 2D2OA 1N6QH 1IEAA 3AM8C 5CBAA 1NGQL 4K8RC 3OWEA 3TZVB 4YUEL 2XNAB 5E8DH 4LU5H 3LPFA 2BY2A 2X2YA 4LLQA 5K9KA 4GRWH 1OGTB 5I1EH 1INQB 2W0FB 4JQXA 1MPAH 4C59B 1I3RA 5GS2D 3NZ8A 5DQ9B 4QTHA 1KB5B 4F9PA 5EOTB 2F5AH 3TT1H 4QXTB 1LVEA 4RIRB 4NC2B 1XGYH 1HHKB 3L3GB 4LCYA 3FKUS 3FTGA 3JWDH 3QIBA 2VLRE 5DYOB 1ZVSA 2H9GB 1A7NH 2VZOA 3RY6C 4KUCD 5D1QA 4LGSB 2APXA 2FL5B 3W9EA 1IKFL 5I16B 4JN1L 2CKBA 2BP3A 1LMKA 3ARWA 4URTB 3V8OA 3NIFE 4HSQA 3UYRL 1PKOA 1WBZA 1FVCA 3FZUD 2FD6L 2H2PC 4LFHD 2FYYB 3WHE1 1HNFA 2B8OT 3VXPA 3MLTA 5GS2H 4QF1A 2R1WA 3C5JB 5D2LF 2OTUA 3LIZH 5IK3A 4DW2H 4IHOB 3IDUA 2KPNA 1K3IA 3QG6B 2ICEA 4LEXH 5JNYA 1T22A 3FO9A 5JA9A 4HW6A 4MJIE 3H42L 5IIEB 1T1ZA 1MWAH 1EVTC 2W9DH 3IKCB 3HNSH 3S37L 3ZE0F 3FB8A 3PGFH 1IM9A 3MRQA 3V4PL 5J3HD 4IMKA 5J6GB 4U0RB 4UV4H 4PP1C 5JXEA 3P11L 3K8KA 4WU7A 1WGOA 2QKIA 1KPVB 4QRRB 3D48R 3TA3B 3IDMA 1F97A 4ONGL 5F1SA 1FO0B 1MJ7H 3JSSA 4DVRH 4WUKL 1U8HA 5EZJB 4ORGA 4R4ND 1GC1L 5DRWB 2F74B 2NY4C 3WYRA 4GXVL 1W2KT 1ES0A 4YDVA 4PGEA 1J1XL 5JXEC 1D5IL 4KQ3H 3K7UA 4RQQA 3MSPA 3VXPB 3SDAC 1AE6H 2EXYD 3MUGA 8CGTA 4FQIL 1T6VN 1ZGLA 2YRPA 3RZCC 2J8UA 3OXSA 1BP3B 5FUZL 4K9EH 4EI5D 1BHGA 2CLVA 3EW3B 3QEGL 2A73B 5FUOH 5HDQL 4S10A 4XXCA 5DFTA 4B41A 1KG0A 4JO1H 1J8HD 2RB8A 2FEDC 3X11A 4YH6A 5DD3H 1U91B 4OLZL 4ZFGL 4X4XB 1KJVA 4HJ0C 4DCQA 2B2XH 4WDIA 4M1DL 1HEZA 3N0PB 1UZ8B 4YIQB 3DX9A 3CH8A 2AJSH 1WVZA 2DL9A 4PY7B 1E4KC 1H8SA 2B4CH 3IDJA 3WV0A 2VIRB 1TCRA 4F7CB 4QWWC 1RU9L 5J11B 3U0PB 5LCVL 2AXFA 2ZCLH 2ADGB 3LKRB 1F8TL 4UT9L 4NC1E 1KELL 5FYLL 3SGDI 3ARGB 1OTSC 1NMAH 2NNAB 3GIVB 4TRPL 5BVPL 1CS6A 4Z7NF 1RUQH 1YNLH 1JYVA 5J57B 1F3DJ 2VL5A 3QXAA 3JVGC 1HHJB 2BX5A 1I8LA 1AFVH 4XP5H 1FC2D 1AR2A 4U7MA 3OKNB 3I75B 3GMMA 1T04B 3K3QA 5E5RB 4JM2C 4HULB 4Y2DD 3HRZB 1CGTA 1XGPA 3P2TA 3VFVA 5FYJL 4XPAL 3OG6B 1PG7X 4MA7H 1UH2A 3KYKL 3EYFA 1JZ7A 1FYTE 3BH8A 3HC3H 2VWEC 1UXSB 3CUPB 5IJKA 3F7VB 5EZIH 3L5WB 5JW4N 5HSFA 1J88A 4HDIB 4ZG1A 5E6IB 3U9UA 4JREB 1FFOA 2GTWB 3QUZD 4M7JL 4QHMA 4JKPL 5DHVB 1J18A 1A02N 1IC7H 4MHHG 1MHEA 1TZIB 2HT2C 1R0AH 1H15B 1DQDL 4QHUA 1MCDA 3K1KC 1RZ8B 3O0RH 1KIPA 4WFGD 5D7IF 4WHCA 4KKLD 2A9ML 2V5TA 4J8RB 2E7LA 4YPJA 4ZTOL 3MOBL 4WW1B 1B88A 3S34L 1GZPB 7FABL 1XGRA 1N26A 4KK8C 4U6YB 4MSWA 4QRSB 5ENWB 4CW1B 3TO2A 1WBYA 3T77A 1UYWL 3KG5A 1U93B 1U3YA 3H0TA 2RR3A 1U8LB 4L4TE 5C0NC 4P2RD 2LVEA 3BN9D 1ZHNA 1ADQA 1IM3B 4JN1H 1P53A 2AV1B 5D72L 5EU5B 1UH3A 1I9IL 4K71B 3MV01 3C6SA 3LKOA 2OJEA 2P42B 1DBJH 4GG6A 4UILL 5JW4R 5CJXC 1S7XA 5F9WB 1G9NL 4L29B 1U42A 3H3BC 5C0RH 2UVEA 4MD5B 3BISA 4XP5L 1IAOB 3ARBA 5F7KC 1OGAA 4OB5L 3AM8A 4YNYA 2ARWA 3QNZB 5DVKA 5F3BA 1N7MH 1MFCL 1KACB 1QNZH 2M1KA 3PGDB 3RDTC 2LU7A 3OR6B 5B22A 5MENA 4JY5H 1XMWA 4R4BB 3MRLA 3PJSA 5HHOB 5JW4M 1EO5A 4TSBH 4MSWB 3S35L 3UYRH 4O9HH 5DVMA 5IFJA 1NBVL 1KTLB 3KJ4C 2YBRA 2DMCA 1TJIH 1A7PH 1DN0A 5B3JF 2BJML 1RVFL 2YPVL 4HIJB 3W2DH 3MRCB 5LGHL 3ME0A 4U6VH 1KSRA 3F58L 2CDFB 4D9QD 1N59B 1BQLL 3QZWG 1OAQH 1QACA 2Y5TA 3IAPA 4DEPC 1IGJB 5J89A 2O26U 2WMPA 1KJ3H 3I3BA 5TDNB 2NZ9C 5IVXA 4BK4A 2OJEB 1T2QH 4FQIH 3B4NA 1RZKL 2W9DL 1R5WA 1Q0YH 2YA0A 3AB0B 2CR6A 3GK8L 1CLZL 4KKCC 1S9VA 1KIUA 3P73B 5I1JH 2NY3D 5DMIH 1I3GH 2BCKB 1Y0LA 1G6RA 3HI1A 3QNZA 5ANME 1A21A 3UJJL 2VLKA 3RWFB 3F7YA 1FLRH 5KSBB 4I0PA 1NC4B 4CN1A 2FLBT 4QXUH 1AD0B 2VC2L 3NAAL 5HHOA 4L3EE 3BE1L 3CPLB 1OTUC 2NLJA 3FAXA 1F4WL 4JN2A 3QZWB 4YPGB 4APQD 2XQYG 4ZUWA 5J11C 3AB0C 3QQNA 3FO0H 2IGFL 4JM4H 3ESUF 4K3EH 3F62A 4H8WH 4RAHA 3ZE1F 3DX6B 4ZO8A 4Z0XB 3TLRA 2G5BA 2E8ZA 3S88L 3BMWA 1RIHH 3QHZH 1MAMH 1IAII 5E8EA 3O4LD 2FBOJ 3BIKA 1EZVY 3MODL 4LHUG 2XN9A 5A1AA 5JOFA 5I15L 1Q0YL 1P2CB 3BP7A 4JM2B 2G60L 3OKLA 2HT4C 3RA7L 1YMMA 4PJ9D 5C0JB 1F6FB 4PJDB 5AWNL 1MWAA 5ICZB 5FYLD 2B5IB 2N56A 5BS0D 1IGCL 4FZEL 3RNQB 2BNQA 3EIFA 1IQWH 1OP5H 3L9RB 2VE6B 1CLYH 1A7PL 4NJAH 3IB4A 1J1PH 1AHWA 1JGUL 1R24B 5HYIA 1OARH 5GIRB 2WUCH 2EDFA 1BZ9A 2V2WB 3TO4B 5CEZD 1JV5A 3CU1A 1TNNA 5JMOC 3RWHA 1JPST 2VDPH 4FQ2H 4LCWB 4Z0BL 5BV7B 4LGRB 1BFVL 5IF0A 3MROB 1U6AL 2VKWA 2Z91A 3RPIB 3UJIL 2QQKH 1CXKA 4LSRH 2HLFD 3QIWD 1S7RB 3ZHDA 3LS5H 1L4IA 4HZAA 1S7QB 2CUHA 3HZKB 1QSEE 3PABB 2CGRH 2H9GA 3MLXH 2OXGA 4TPRL 5IB4B 5D1QB 3FB5B 3CC5B 4R6UA 1QHOA 4X99A 3N1PC 1U3HA 3MJ9L 1F4YH 4LKXA 4O5LL 4LCCB 4YR6A 3WN5B 1ODAA 1F3JA 2ATKB 3ESVF 4P23D 3O6LH 1VDGA 3BPCB 4XP1L 3CLFH 5HHNB 4FQLH 5DMGC 5MEOA 1X5HA 1HSBA 1LEGB 5D5MF 3SDYH 3ZKNC 5I30H 4DWHA 5I1DB 4OCXH 1U8QA 2YEZA 3NCBB 4OFYA 4OCMC 3WJJA 4PJBA 5GRUL 5FHAH 2Q8BH 1UB5A 3F7QA 5DJ8B 5IMKA 2MPAL 3FOLA 4UAOB 1CVSC 1GZQB 4JY4A 3QISA 1WIUA 1P7QD 4Q58C 5C8JA 2JCCF 1CGSL 3IKCA 4IOIB 5DJDA 4NKMA 1G7JB 1EJOH 3ARQA 4JG1L 3MZTA 4YXKL 2EYSA 1QRNA 2MQCA 3KWWB 5IB5A 1BD2A 5BRZB 4ONOA 2JK5B 2ZNXA 1WT5C 3H9SE 3KPOA 5FUOL 5L9DL 4XNXL 2AJXL 1A5FL 2YWZA 2PR4L 4OJFL 2Z8VC 2DL2A 43CAA 4TNVK 1KLGB 4CU8A 2BRRL 4BUHA 1ZT7A 2PF6A 4CN4A 3IAQA 4EXKA 3FB5A 5DJ6A 3MNZB 5FM4A 3SE4A 1RVFH 3H8NA 3MRMB 3ULVL 4XCYB 1XGTB 2EZ0D 4LKXB 1HWHB 4Z76A 1IEHA 1WJ3A 4GKZB 5F7MC 5IBLD 2EECA 1T1XB 1F8TH 4UT9H 4HJ0D 5MEOB 5KJRL 1ZA6A 3RZCB 1EBAA 3TESA 5HI5D 1CFVH 3FT4A 3VFRB 3NH7L 4JCLA 4XVJH 1N64H 1CFSB 3BZDA 5CILH 4PJEE 3DYMA 2VITB 4NQDA 4WFGE 4MCZA 3VJ6A 4TQEL 4UDUA 3I02A 3CH1B 3SKMB 4EBQH 1CXFA 1BOYA 5JIKA 5D7LD 4F9LC 2XV6B 1AC6A 1GRWA 1FZJB 5IHZA 3OKKB 4TUOB 5C09B 5DMGD 1RUKH 1VFUA 1SQ2N 1LHZA 4LVNC 5AZ2H 1JWMB 5KVFL 3F7RA 2H3NA 4PGDB 5TF1L 4OAWA 5DWUH 3QJFA 5FO9B 1MRCL 2JJSA 4TULH 2N1KA 2DM7A 3OJDB 1F3RB 1DQQB 1M4KA 4Z7QE 1CU4H 3ARDC 1MFAH 2OQJA 3SDAA 5KS9E 1I4FA 4GRLC 2OYPA 2AKRB 1KLGA 1L0QA 3AMLA 2ICWA 5E2UL 3MOAH 3FCTA 1N6UA 4PJ5A 4E0RA 4XCYA 5JR1H 2MJWA 4UI2A 4WO4B 5C0DA 4M7KL 1WTGT 3T0EB 4AQ1B 1T5WB 3FB6B 1PFCA 1V8HA 1CFTB 4XMPL 1R3LB 3L5XL 5IMMA 2J5LC 5C0IA 4BZ1L 3W5NA 1M7IB 1SYSA 1NPUA 4OFIA 4CJ1A 3QEQA 4P46C 3EGSA 4E41D 1A4KB 4L3AA 4CVUA 1UXSA 4NQDB 3EO9L 3Q3GB 3O2DH 2XTJB 4WRLA 2DQJH 3HAEA 2FH8A 1DQLL 2R9HD 1F11B 2NXZC 1IC7L 5HGAB 2YMXL 1BZ7B 3CXDL 3MLPA 5ICXB 5GGQL 2VDLH 4MWFA 5HJ3A 3QUMB 1BBDH 2R2BA 3ARGD 3G9AB 2HFFB 1IEBA 5D71L 2P45B 4MJ2A 3P0YL 2AVGA 4OD1L 3LQZA 4HFWB 5TPWH 4KU1A 4OCSL 4EI6B 1IVLA 3MXWH 2NR6D 2P5EA 4NO3B 4V1DA 4EN3C 5E00B 4UTAH 1JZ3A 1GGCH 4MX7B 5EB9A 3SEPA 4KZDH 5L8JB 4PRPB 1MCWM 32C2B 4PJDF 4M1CD 3T0EA 4I18B 1FSKB 1NCTA 2ZG2A 3Q2CA 3VDAA 1NMCC 4X7TB 1T0NB 3DBXA 4F37K 2XOTA 4EI5B 1OAUL 2JIXB 3BP6B 4KZEH 4DKAA 4HCRL 1HHGA 2XTJD 3KXFA 1KIQB 5GRXG 4C83B 3MA9L 5IB3B 1A6UL 2E9JA 3QUKB 4P4KB 3GEWB 2X70B 4HUXA 4E41B 2AABL 2APTA 5ACMA 1IL1B 5CD5C 1AO7A 4FS0A 2GFBA 3NFSL 1MFAL 3QDMB 1I9RL 3SJVA 3U46A 4XBEL 5M7QA 1CT8A 1I9EA 3WFBH 4YUEH 4MWFB 4OZGE 4XWOC 4YHPB 5FYJE 1QFUL 2C3HA 3BESR 4JHBA 1UEYA 1EEYB 1Q9OB 1BIIB 1YJDC 3GMRA 4JO2H 3PIQB 4PGCB 1T21B 2O61A 2IADA 1P84K 2IAND 2HLFC 4H0HB 3H9ZA 3K81A 4P2OB 1MJJB 3MLUH 1OTSD 4XWGL 4L3CB 4X98B 5KTEL 4GLRI 4V1DB 3S35X 2VR9A 2HT3D 1AR1D 3VXRE 2MFNA 2V17H 5JW4Q 1FAIL 1IAKA 3BUTA 5GXBB 3MRFA 2NYYD 3MRJB 4GMTH 3REWA 1DN0B 2OI9B 4FXKB 1BQHA 5D93B 4OFDA 5AUMB 3FMGL 4QLRA 1K4CA 3CVHH 2X7LA 3N1FC 2KH2B 3KPMA 3DIFA 3U9PL 2XWJA 4XVSL 3DETC 1UM4H 4D3CH 5DHXB 4MXVE 4L1HA 3NZHH 3RIFK 4LRIC 4K07A 5E94A 1WZ1H 4TVPH 1X9QA 4KPHL 2FX9H 4RA0C 3GIZL 1A6PA 3VG9B 4Z8FL 5IV2A 1MWAL 3UAJD 1A6AB 4ZS7L 2DQGH 3BDYL 5HGDB 2Z8WC 4HJGB 4G7VH 4BM7A 3KPNA 3DARA 2EH7L 1GGTA 2IADB 5JO5B 2A83A 1YEIH 4TVPE 3QXDB 1PY4A 2Q3AA 3PGCB 4NHUA 6FABH 3UJJH 5IOPB 1IC4L 1BFTA 3P30L 3ZTNH 3MLYL 5D96B 4UQ3B 5JHDB 3MFFA 4JY6A 5F9DC 1QRND 3MCLH 4MVBD 2R29L 4JDVB 1CDCA 4N0YL 1X6NA 4HF5H 5J8OA 2CKNA 3PXJA 1P7QA 4NRYA 4ONHB 1HQ4B 1JHKH 4PJ9C 5DZOA 5D7KD 5CZXD 3OHXA 4OI7A 2FB4L 3VG9C 3L7FA 5I6XB 3MPCA 4Q0XL 3VH8G 1VA9A 3VDCA 4M8QB 5DJ0B 3WIFA 4Z7UA 4IIQA 4J3TA 5CEYB 4K71C 1MRFL 3RTQB 4HBCH 4BZ1H 4K9EL 3RUGA 2R0KL 4LL9A 1H3XA 3TVMD 2YPLE 3HPJA 1BMGA 3VXTB 4AL8H 5IR1B 3QO0A 3D18B 3SHSA 1JTPA 3TJHD 1JPGB 3VFNA 3ORJA 1LDPH 4Y1AB 2J88H 5EOCJ 5D7JC 3T0BA 4IMLA 1U2CA 2P5EE 3DXAA 1BZ9B 4WFEE 3V5DA 3OAUL 2R0LH 2DLFH 1BAFL 2APFA 4YDIL 4FXGB 3WUWA 3FL7A 3SGKA 4Y2DC 1W8NA 1EIBA 3UTSB 4GRWE 5C71A 1RK1B 4OUUB 2MKWA 2ZUXA 2YUWA 3VWKA 1FZMB 2CMRL 4P5TB 3AREA 4O2CB 3OHXB 5CSZB 5EBMA 3S96A 4Y5VB 1YNKH 2R0WL 3S36L 4TPRH 5KN5B 3V4UL 1V7NL 1DJSA 3B2UD 3M17B 4RGNB 5I17B 3GM0A 4HUUB 3BKJL 2GK0B 5SWZE 2DD8H 4HKJB 3RDTA 4CUCA 3RP1A 4MJ6B 2PCPB 3C08H 4P3WA 2R4RH 4Z7VA 5SWZD 4L4JA 5HI3C 5A3IC 2A38A 4XPBL 5E2TL 1S78C 2O93L 2Q76A 1MJ8H 2Y1VA 3MREA 4BH8A 4I0CC 4HMDA 5B39B 1N4XL 4J7RA 1QRNE 3KPPA 3V6OC 3MV7B 1NCCL 1JHLH 1DLFH 3L7EA 4L1DA 4HWBA 2A6IB 4D0CB 2CSPA 4WUUA 5C08A 2A74B 4UU9A 4BKLA 2X89A 1G7JA 4UNTA 4UTBH 5BRZE 1CXHA 1T0MA 2J8OA 4FG6C 2CUIA 5DSCA 25C8L 5AG9A 2UWEF 4XNYH 5DQ9A 2R15A 3W81A 3CAFA 2O5YL 4I0PD 3GBLA 1BQUA 5ERWA 2AABH 4RA3A 3OPZL 2C3WA 4PJ8C 4HJJL 5BO1H 2KUTA 3VW3H 1A4JB 3O3BA 4L3EB 1ZVYA 5D2NA 1XGTA 3I6GB 1JHTB 1Y6KR 3PP4L 4Z76B 5D70L 3H7BA 5L6YL 2B0SL 1L7TH 4B7LA 3IJSA 5A3ID 3QCVH 2YUZA 2R1WB 1ZA6B 3RZCA 5EULV 3NFNB 3EZ8A 4NWUH 5GS3A 3FT4B 1FC1A 3TBYA 4ODSH 4ZTOH 3QI9C 3G6DH 4DN4H 3OBAA 5KVGL 1KJMB 5EA0L 4MAYC 1JZ5A 4M93B 1W72A 3GIZH 4JFYB 4XBGA 3BUYA 5CJ5A 3UC0H 2CH8A 4HIXH 3LMJL 4LLAA 3IJHA 2G9HA 1JMXA 2EICA 3MTRA 3PDGA 2IH1B 3MRPB 3DUHA 4LRNH 1T89A 4ZS6C 4AM0B 1DQLH 2OQJB 2VDKL 4G8IB 4NRXA 4UILH 3VXMA 1A7RH 3MV9A 3QH3A 2BFVL 4XBPB 1ZTXL 3MYZA 2PETA 5EZJA 1I7UA 1HH9A 3I6GA 4JHAH 1RHHA 5KVEH 2M2DA 1VCAA 2B20A 5HGGS 4D0BA 2C7UA 2ILLA 3L3JA 4P23C 2F54B 1MFNA 3HUJF 2IPUG 5F9AC 1NFDB 8FABB 1S5HB 5BV7L 4NIKB 4X7DC 2OZ4L 1SM3L 1WWAX 4L9LA 4WWKC 2P5WA 5HD8D 3TA3C 5HHMD 1SEBA 1VB9A 4KK5C 2XG4A 1TVBB 3U4AA 4JY5L 3REVA 5J06A 4Q97A 4X5WB 2B4CL 4LBEB 1NAMH 4PRHB 5DK3A 4BQ8A 4H1LH 1XEDA 2QLVB 1XCTB 3WFEL 4WDIB 3MUZ1 3Q6GH 2CDGB 2YN3A 3R8QA 1IZJA 4LSVH 1W0YT 2DWEB 4RMRA 1DBBL 2D4DA 3X3GL 3Q6FB 4OGAC 1N5AB 4PRDB 3WDIA 1X5AA 3ZDZF 1T5XB 5F1NA 4JANA 4MVBC 1UM6L 1YECL 3TPKA 1J86A 1WIPA 3CSGA 4G8IA 3IU4L 3S5LB 5H35B 1CICC 2HG5B 5EU6E 3KDMA 1DSFL 3MV9B 4GH7B 3VWJB 5I8EB 3VA6A 3LB6C 2C1OB 3O8XA 3WSQL 3P3YA 1OAYH 4TUJB 4XP9L 3R8BB 1MAJA 4XB7A 4L4VB 5LAXB 5EOQH 3BW9B 3OR7A 4PLOB 3L3JB 4QTIL 1KXVC 4FHBD 5TE7L 2ZOKB 4OSUL 1XGPB 2FHBA 4YK4C 4FTVA 1UXWB 1JPSH 3GZKA 3GBNH 5IB3A 2P48B 3TH3T 3KXFD 3VMOA 3UYPA 4IJ3B 2VZ3A 3AY4C 1SJEA 4ZOEA 5IFHH 4NZRL 3QDMA 4LP5A 3IU3A 3DYOA 1ZLUK 5E4IA 4F3FA 4KV5F 4F7TB 1Z0NA 3SCMD 2NY7L 2HFTA 4OZFA 2ZPKL 2Y06L 3MRBB 3UZVB 1Q9OA 3EYUH 5K9JH 5CP7B 1CI5A 5I9QB 3H6JA 5HHQB 5DRZB 1TXKA 2Y5EA 3LKRA 3NBNA 3LZFL 5LQBH 3FOMA 1LD9A 3MRRB 2IFFL 1T83C 2OXHA 2OBGA 4ZOAA 1I7ZB 4YBQD 3WFDH 1B0RB 3X13B 4NGHL 4PLKC 4Q2ZB 4C56D 3JV4A 5L2JB 3BN9C 5J13B 5BZDB 4MD4A 4U1LB 5C09D 5T33L 4N0CD 4Q6IA 4DKDC 2DWDA 2Y36H 3EFDL 5D7LE 4I5BB 1JNNH 1CIUA 2JJWA 3V5HB 1INEL 1G9NH 3N9GL 1F4YL 4TSAH 2R2CA 2H2SD 4OLVH 1JF6A 3PQYB 2QADB 5T1DH 2Z9TA 4DAGL 1MNUL 2EDYA 4OLXL 2GJ6D 2P43B 4JQVA 4U1IA 1CFBA 2BY0A 1S7VA 7CGTA 5I9QC 1AI1H 3PQYD 2VLLB 4G6AC 3TEUA 3IFLL 3LKNB 1ZHBA 2ZCLL 4TUKL 4RNRA 4Q6IC 1HI6B 5D1ZB 2E3VA 4M62L 2Q86A 4MD5A 1LNUA 4DQOH 3D9AH 3S35H 3L3KB 4HWUA 4HUKB 1MY7A 1OSPH 2MMXA 4W6XB 5CUSL 4XPAH 3C6LC 3SDAD 4Z7OE 3RVUC 1G1YA 4K2UL 4YHOH 1P4BL 3LKSA 3GSVB 5GGVL 2LFGA 2I27N 3F58H 5GS1B 3H9SD 4YFDB 3QFJD 2XYCA 5HHXH 2I07A 2OP4L 1IGYB 3WO4C 2C3XA 1MLBB 3ARFD 5TF0A 3R0MA 1MCHA 4LNRA 3WHXB 1MVUB 2NXYB 5IWLA 1DANU 3L6FB 4JG0L 1GJIA 1P7QB 5L7XL 3E6FA 4WTXA 4OLUL 2PUQT 1RZIB 5C0CB 3V6FB 1ZXQA 4UIMA 4QXGH 1F13A 2EE9A 3PWJB 3BXNB 4N0RA 5EIIB 2Y5TB 4XCNA 2A6KA 5DT1H 3KPSD 3BZ4B 2QHRL 5J1SC 2WWKO 4LPUA 3VXSD 1UGNA 2WBWB 4GG6B 4F9LA 3SY0A 3EDEA 3TN0A 5E9DA 2VL4A 4NQCB 3C60A 1UZ6F 4KXZI 4U1SA 4YDJB 3U79A 3PNWB 2JCCB 1CICA 4XPTL 5D1QD 5H2BA 5DS8B 1NAMA 1A9EB 4P57B 4QGTA 3GSRA 2DYPD 4Y1AA 3SKUD 2FSEA 2IBZY 3QIBD 1UM5H 3EFDH 1QR4A 4HXAL 5FUCE 4U7KA 3DVNB 2IEPA 5ETUB 4HH9B 3UYOD 3KYMA 1EHNA 1AR1C 2I9TB 2CK2A 3FQXA 3V0AC 3ES6B 4JR9L 4C58B 1I3UA 2Q8AL 4MNHB 1CE1L 2MCG1 3E3QC 1U41A 4YPGA 5FGRA 5IW1B 5KAQF 3H3PL 2J8UE 3DRQA 2AK4A 4S0TD 1OWRM 1EK3A 1IKNA 1ND0B 4WTWA 5F88B 3T1FB 3WFBL 5DZNA 2X4SB 3MUHL 3MBXH 3TJEH 4MDIA 3MR9B 5MERB 1IFHH 5HVHB 3DOSA 4J6RL 3RGHA 5M95B 3QA3A 4LPXA 4XNYL 2OCFD 1W8OA 4JGMA 3UTPE 1EA9C 5I66B 2BSED 2G75A 2VR4A 2D9CA 4G8GD 4LSVL 1SY6H 4KKBD 4MJ6A 5GGVY 5F9JB 4FRWA 4U1SB 4Y16C 1F6LL 1HYRC 3O4LB 4LVOC 1G7QA 3GJFB 4LVNB 1G7HA 4UMGA 3VFGH 1JHKL 4AIXA 3BEWA 4PJGA 2V9RA 1S5IH 4MYWB 4H0GA 4WNQB 2GY7B 1MI5D 3O3EA 1J0YA 1H3PH 5I1KH 3L7EB 2F8VA 4OIIL 5ETUA 3QWOA 4OT1H 3O6MH 1LO5A 2P8LB 1UWXH 2CJUH 4N0CC 3CMGA 4XAWH 3EYUL 4NRZA 3WFHB 3BPNB 3BIAX 4OB5H 4QYOB 2YZ8A 2KZWA 2ZCHL 2EH7H 4AT6B 1SMOA 4OV5A 2HVJB 2R0KH 2YSSB 3MBEC 1F02I 1N0XH 4LARL 5BQ7B 3EJZC 4ZSOA 2SEBB 1YA5A 4LHUB 1XGYL 4MLSA 5SV3A 5DR5L 5F72S 3GM8A 2CGRL 1CFNA 3MNWA 1VKXA 4LQ1A 4OCYH 3R0NA 3W2DL 5CEZH 5GISL 2M26A 5IJVA 3W0WA 3CLEH 2H8PA 3HLAA 2YA1A 5D2NE 4XXCC 4ELMF 4ERSL 3BWAA 3ZKND 1MWAB 5ICZA 1Z9LA 1G7PB 1QSEB 4IM8A 1HE7A 5BOZG 1T1YA 3NN8B 2V9QA 1Q1JH 3E2HB 4HXBH 4WY7L 3U6RB 2X4UA 4HPOL 2VXUH 4JZJB 4AIZB 1A6VH 5CZKA 2D31A 5GRJH 1WEJL 2AXGB 4MA7L 2UYLB 4M61A 1KJMA 1KGCE 5FGBA 5DD6B 5DJ8A 2C1PA 3Q5TA 1EUUA 4G6KH 5F9WC 2VXTH 1NUNB 2AJ3B 4P5MA 1JNLH 1F00I 4WUUE 1OT1A 4KJQD 5AYQA 5C08E 3MLUL 4H88H 1QBAA 3V4PH 2HMID 1YEKH 1KTDB 1TNMA 4JB9H 1V3LA 1DQJA 1UWGH 1QPXA 5T5NF 1FNHA 5L9DH 1J0KA 4MNQA 4NT6B 5DR5H 1J8KA 1MI5B 2IPKA 2R1XB 1F3DH 5FGBC 2Z31C 1QLFB 1CGWA 4RWYL 2B1AH 1HN1A 4GFTB 1EAJA 2PNDA 4FQXC 5KW9L 1NCBL 4OD3H 1FL3A 1WFNA 1IBGL 3DWTA 3QQ4A 5AD0A 2H26B 4YBLB 1ORQB 2HN7A 2V2XA 3HE7A 1CGUA 4P2QB 4P4KC 4R7NB 4WEBL 3BPLC 4ODTH 4KDTC 2F15A 4RGND 5CWSB 2QBWA 2P1YA 2DI9A 1CD1B 1C7SA 2WUBH 3GSUB 1JRHI 4KI5F 3TYGH 3HA0A 2XKNB 1YQ2A 4PRIB 2DKSA 1MQ8A 1UVQA 1DE4B 1G7LA 1IEAB 4PJ5E 5CBAB 2H6PA 4P2QE 4XX1G 4MZ3A 1X5LA 3V4VL 3TWCH 3GRWL 4KJYB 1MLCB 4WUKH 4AJ0A 2YPLA 5HYJE 5JXAH 4HH8A 1I9IH 4Y4HA 2PW2A 4M7LL 4X6EB 4XVSH 4PJFE 1NFKA 1BFVH 5HHVH 1CR9L 5HGHB 3QCTL 4WTZG 4D8PB 2A6JA 3TA3A 1YEJL 4Y1AD 3H3PH 3G6DL 3WJJC 1N5YL 4MQTB 4GG6E 4PG2A 2OR9H 4LAQL 3LEVL 3I50H 3PQYE 3IFOA 1RURH 4NQCD 5B38G 3T3MF 5EUOE 1FNEA 1MY5A 4NYLB 4XVUC 3QNYA 3K4ZA 4RGOH 1MH5B 1GGIL 1NEZA 2DQCH 1DQTA 2NXYC 4KKCD 3KPSB 1JPSL 5E1AA 1CXLA 1K8IB 3G5VA 5C3LD 4Z7VF 1OY3B 3MLYH 4P2YA 4OGXL 4PLNC 3OXSB 1YYML 3IRPX 4K3JL 3HE6A 2ADFL 4L4TD 3FJTA 5SWSB 2W07A 3BPOC 4NQEE 3A6OA 4KGLA 5JQHC 3NCMA 4Y2DB 2EKSA 3I6KB 2YUVA 2F8XC 3OTTA 3SE4C 4FP8H 1W72L 4PLKD 5JHDD 1MCSA 2HFFA 4F15C 3IDIB 4OKVB 5LXGL 4EQ3A 3FRPG 2ZKHH 5FYJH 2PYFA 3K46A 4HUNB 2HRPL 3GSQB 4JG1H 4QRRA 2P8MB 4PRNA 4W4OC 1I7ZA 4WO4A 2XY1A 3D1MC 5FDYA 4X5XA 1YEGL 3QWRA 5JTWA 3I75A 1IGIL 3O3AB 2ARJA 2ICWI 2X41A 3QCUH 2DI7A 3VFVB 2PXYD 3DUUA 3BKCL 1LK2B 1P5UA 4GW4B 4GRWF 4U1IB 5DJCA 1G9EA 1KEMH 2NTFB 1SHMA 1CU4L 2CLVB 5GHWL 3B6SA 4LCCC 3OGCB 4MJIB 4KMTH 4KRMB 4KUCF 5EORL 5D9SA 3LKQB 1TENA 1JF1A 1QFUH 2LU3A 2Q86B 3OKEB 1KJ2A 1GYAA 3GMOA 1IQDB 5F7DB 3AS2A 4C56A 1UZ8A 4CVXB 1Q72H 1LO3L 3VA2C 4V1DD 3BGMA 1BIHA 3U48A 1NAML 3LQZB 4HFWA 2LE9A 4K94H 3DUSB 4N8CH 1GH7A 5ITBL 1ZHKA 3EAKA 5I19H 5I0DA 4UT6L 3W39A 5L0QC 3ARGA 1GC1H 5GJTL 2P44B 4RRPG 5D8JH 2KBGA 4KTEH 5TQ0H 1S9YA 2FH6A 1VADB 2D7NA 4HXBL 4YHNA 1KCKA 1J7VR 2CKBL 3ZHKA 1CLYL 4G8FA 1U8PA 1XF3A 1ZLVH 4DTGL 2I25N 4MJID 4FQ1L 1QR1B 5L88L 3PP4H 1AXSB 4AH2B 5K9JL 3EYFB 4P4KD 1PAMA 3TH2T 4PLJC 5IHLB 1WWCA 4LSUL 4LLVA 5HVGB 3ZKSD 2A6KB 4HUWA 5JPNA 4Z8FH 1FVEA 4OZIB 1ZT1A 1EO8H 5LXGH 3L5WA 4BSWB 1JPFA 2X4OB 5HDBF 2W92A 4DK6A 1KENH 2PXYB 4EUPH 4PJXF 3S6CA 1MCNA 5F93C 4KMQA 3TP4A 5JLZA 4YDJA 3QSKB 3OKEA 2WQRA 3VWJD 1DQML 1FYTB 2XZCH 1UCTA 3QQ3A 1CVRA 2CRMA 2HMIC 3TNNA 3I9GH 5GGRY 4OLYL 3SGJA 4QHUB 1MJJA 2XIDA 4YLQT 6FABL 4LLUA 1U3JA 1C12A 4X0KB 1UWEL 1RY7B 4ZAKD 1Z3GH 4U6YA 1S3KH 3KYMB 5E5UB 3IFNL 5C07A 3W39B 4GAJH 4G3YL 5DUBB 4FQLL 4Z77A 5DJXB 4M8VA 3MRDB 4DK3A 2DM2A 1JGVL 5ALBH 4JDVA 1T7YA 1AD9B 1L7IL 1P84J 4Q9CA 5B4MD 3VH8B 4LLMA 3I50L 3LS4H 3CK0L 4N1EA 3ZLQC 4M6MH 4GRLB 4UTAL 1I3GL 3L7FB 3MRHB 5MHSD 1HXMA 4DGIH 1HZHL 2PR4H 1LEIB 3S9DB 3D0LB 4YHZH 2JELH 5KZCB 2X4QB 4MAUL 5J1AB 2H41A 4OLWL 5ADPL 5DMKA 1OB1A 4HIHA 5IV2B 3QEUA 4TNWK 3GMQA 1MHPH 4H25B 1W0VA 4EDXA 2CRZA 1RJYA 3ALPA 4O58H 3HKFA 2YXFA 3N9GH 2GAZB 4TSAL 4N1CA 4QY8B 1CFQA 1WCBA 4RMQA 5E8OA 2HJLB 7FABH 3WUWG 3T3PF 3SE8H 1TVDA 3UTSE 3O6KL 2ADJB 2E7BA 5DK0B 1LO5B 3ROOA 5C07B 1J1XH 3FHAA 4PJCF 2AJUH 3UP1A 2GITB 1SBSL 4G42A 3SDCD 4CJ0A 5HPMB 1FYHB 4JFOA 4NN7C 3ZYZA 1AD9A 1OCWL 1WZ1L 4UZGA 1LO2H 1FO0H 1CD8A 4QRUB 4QRQA 3KR3L 4YO0A 1TJHH 3DGGA 3OF6D 4PB0H 4JRYB 2ZZUT 1G0YR 4RDQF 4NO0B 5INCB 1HILB 3B9AA 5DEFB 3NCCB 5E2JA 3RZCD 5BXFB 1QTYT 1FPTH 4OGXH 4F7EA 3SPVA 1TJGH 2E5EA 3LV3A 4O51B 5EC1A 2LV4A 4YDLC 2RBLA 5L2KE 4Y5YB 3CZFB 3TBVA 1YC7A 4KROC 1XZ0B 3VGDA 3QUXC 3CDCA 4K55A 5E6YA 1LILA 5EBLB 1MQKH 4A2MA 1HNGA 5DVOA 3DXAB 4JPWH 1CDUA 4G9FE 1R24A 4FFZL 2VKXA 3O4OC 4HV8B 3QXWA 3QUYC 5CGYD 1QBLL 3LRHA 4LVHB 5BRZD 3FT3B 5FYKE 1T20B 5EH1A 1NBYA 3Q5YA 3QIUC 2GTZB 4MDJB 4PJXA 4JN2B 1NAKL 4DOHE 2X9YA 2IPKB 2R1XA 3QHFL 4YDLB 1OW0A 4F8TA 1NGXB 2DQJL 4J4PC 4PTTA 1FN4A 3DJ9A 3BIKB 5I17A 4X9GA 1RJLB 2E7CA 3DV4B 3DVIA 4RGNE 4FQ1H 1ZVHA 3BX7C 4R0LB 3CZJA 1MREL 4PP2B 4PJDA 1KJ2L 4X5LA 2PCPA 3D2UA 4Z7VB 2R0LL 4YR6B 5J6HB 5D2LB 1C1EL 4FQHB 3DXAE 3DRTB 1OF2A 2E6PA 5D93C 3SOBL 3PE9A 3BP5A 4HK0B 1CQKA 1TDQA 3C5ZB 4X6CA 4B50A 5ITFA 4CU7A 3W5MA 5EDXA 2XKNA 4WFFD 2WV3A 3VFOB 2HJFA 4AL8L 2DIJA 5JA8B 4XC3H 3V0VB 1I75A 5GZND 3C9NB 3L3DA 4JFQB 5F3HA 2BZDA 4LHUD 4KK6D 1GGIH 5C8JB 4X8JB 5T3XL 4ZOBA 2G9HB 2NY5L 4F58H 3PG2A 5E7FA 4HHAA 1FE8H 3O9WA 5CEZE 4Y4HB 1QO3A 3EYQC 3HMXL 3ARRA 4JPKL 5DVNA 4XNQB 1E4WL 1C08B 5E5MA 1JVKA 4Y5XB 2NTSP 1W0WB 4XXDB 1N64L 3SDDC 2W38A 3IETA 4Z95H 5CJBA 4J2XA 3IFOB 5T1LB 3WKML 4FFZH 3KPQB 5D1QC 5TDOB 2XRAH 2V7NB 8FABA 3DRTA 5BV7H 3NFNA 1LEGA 1QKZH 3STLA 1AGEB 3QWQB 2AK1H 3C5SA 1QUNA 3RWIA 2M8XA 1UWEH 5C6TL 4OCWH 2D4FA 2MCPH 5GGTL 1LDSA 3CSPA 4I2XB 5IEHA 4XZUA 1IILE 2IC2A 4OLYH 1XF2A 3TIDA 5DUML 2J6EH 1YY8A 1O7VA 5K9KB 1I3RB 1QRNB 4J3WA 5DA0B 4ZXBA 1UWXK 4APQB 1L0XA 4IOIA 5DJDB 5KS9A 4HHAB 3S4SB 4CN6A 3QJFB 5AG8A 3V6OE 4OKVA 5HY9B 4YX2L 5DJZA 2X9XA 1P4LA 1ZHLA 5HVHC 5F7WC 3FTGB 1BWWA 3C09B 5I8OL 5GGSB 1FO0L 2C3VB 2JF1A 3MYJA 5C0AE 2EDTA 5L8LB 2DYPA 1ULVA 4J3UA 1FNLA 3QIBB 4XMKL 3IGAB 4M6ML 3A6BH 1RJCA 3JTSB 2AQ1A 3VXRA 1ZA3A 4N90E 1NC2B 2W1NA 3VG0H 5EBWA 2VO5A 2ZUSA 5IMMB 4O58L 1I7TB 3NTCH 4JKKA 3P9MA 1KN2L 1GGYA 2AGJH 2VC2H 4GRMB 4XHQA 3VXSB 2GW5A 1PYWA 5GRZA 1F58L 3REVB 3ZE2E 1DCLA 2ZG3A 3I02B 1YPZA 2JB5H 3DVGA 1RU9H 4OZGA 2VITA 3N85L 3QUMH 3B5HA 4NP4H 2H1PL 1TTUA 2VQ1B 3SGEH 1AKJD 2P49B 2DQTH 3IU3B 1ORSB 1OGAE 2IFFH 3SKMA 1GHFL 5C0CD 1A7OL 1X6LA 1YJDH 1P7KB 4GMSL 5ESVB 2CQVA 4OAWB 2NXYD 4D9QE 3NABH 2P24B 1YMHA 4ZUTA 3GK8H 1FH5L 1JCKA 3KAAA 3HB3D 4YHLL 3JXAA 1RZGA 4J4PD 3OKOB 4G7YH 3RX8A 1JGDA 4P2OD 4ZAKA 3RNKB 5DJZB 4AG4L 2AKRA 1LD9B 3UX9B 4PJDE 3G5YB 3TYGL 5GSVA 4B53A 2YXMA 1MEXH 1ADQH 4K7PH 4ZUUA 1NAKH 2EH8H 3QRGL 3WDJA 2R4SL 2Z0BA 3VMPA 3ZKXB 1BAFH 1KB9J 1V5JA 5F1IB 3TBWB 3RJQB 2AEQL 3RWCA 3C8KA 2XZQH 5D1ZD 3CX2A 2ERJC 2D9QB 5BVJA 4DVBA 5EUKB 3SCMC 4YEFA 1MHHB 4TN9A 3V95A 1CFTA 4MNGE 3PQYA 3ARGC 2RJMA 4K23H 1YQVL 4W81A 4C83A 3GSNH 3V6ZB 3ARXA 4IOSD 3X11B 3HAEB 1J1OL 4BSWA 5I6XC 3PUCA 4ZNCD 1K3ZA 4L4VE 4F7TA 3QUXD 5LGJA 4YHKL 1BGXL 1FFPA 3EBAA 5ALCH 2CMRH 5ESVA 3CFIC 2WNGA 4HKBA 4D0DB 2DM4A 3RTQC 2P24A 1UJ3B 2BDNH 2X6MA 1YEHL 2NY0B 3LRGA 4Z78B 5I1CH 4D9LH 3VWKC 2NW2B 4X83A 4BFEA 4LFHG 1U8KA 1C12B 5D72H 4AYFA 1NCCH 3QIUA 2NNAA 3GIVA 2P5EB 1II4E 4NO3A 2ZSVA 4JFXA 4MA3A 3A67L 2CLZB 2VLMD 3EFFA 5B21A 5HI4D 5KSVB 3HRZA 3REWB 2ZJSL 1E6JL 4N9OB 4AENB 1BM3H 3LEYH 4U6HA 3OKNA 3U7WL 4MXWL 1NMBL 1MFEH 5C0BE 4WVRA 4QOKA 1HHGB 2G2RB 5KSBF 4M7ZC 3SDDB 3BXNA 5EIIA 4EI5A 1DL7L 3MRNA 3ARZA 3T8XA 1DVFA 5IVNA 3KXFB 1TZGH 5DQJB 3ZE1E 4FTVD 4HX1B 1CDYA 4NZUL 3U2SB 1AGDB 1J0IA 1I85C 1QSFA 4NQSB 1UWGL 3UZEA 1WV7T 5BO1L 3MJ9H 3K8MA 2Q7YA 5LVEA 4F37F 4U1GC 3QWRD 1HKLH 5DMKB 1SMAA 1O0VA 4M02A 2E7MA 1VFMA 1NCBH 2EYRA 4G80A 4NNYB 2B39A 2RFXB 2WM0A 4J8RA 2RAMA 1A9BB 3DO7B 3BEVA 2FECL 1CQYA 1VERA 3MGTB 2EIBA 1NEZG 1MHCA 3LDBC 4HUMB 1GSMA 2QEJA 2XKUA 3WS6C 4GOSA 1R3KB 2A6DA 5C0CA 2I26N 3CXHK 1RZ7L 3L5JA 4Y4KC 3KPRE 1TMCB 3JTTA 3MJ8B 5ALCL 4UINH 5INCA 3MLSL 3SDDA 3WFDL 2X09A 4QHLB 4GAYB 3JWDL 4M1GH 3HR5B 4ZUVA 4J3VA 1QRKA 4NZUH 3BT2L 2P5WD 2WP3O 5F7EH 3FQUB 3KS0J 3VFTB 5BCAA 1EZVX 3C8DA 1OSZA 1AIFA 5IBTH 1KCUL 3U0WL 4M1CC 1U8MA 4NP4L 3O6ML 1A9EA 3MCKA 1WFUA 4GSDL 4N9GB 2EYRB 4H8WC 5EC2B 2DTML 3HC4L 1OPGH 1XZ0A 1B2WH 4HJGA 3G6JA 2CDEA 3HCVB 5L88H 4PYGA 3MOBH 3SQOH 3IDNB 3GNMH 4U1KB 5MENB 5IOPA 4MJ4A 1R5VA 4DKEH 4C56E 4WO4C 4UQ3A 1KNOA 1UCBL 4LVEA 1KLFA 1D5XA 3GHEL 4YGAB 3SKJL 3VG0L 3GO1H 1T1WB 3MC0A 3IXAB 2DMBA 4P46A 3A6BL 3F12A 5DQDH 2EXWD 4LSSH 4BQBA 4ETYA 3X14B 5IROA 1EBPA 3FFCD 2VAJA 4CDGC 4JDZA 3BO8A 1H0DA 4PIRF 5IKCB 4J1UA 4M48L 4PRPE 3FN0H 2FZ3A 3GGWB 3MLZL 2J4WH 4Z7UB 4P9MH 3MJ7B 4GKNB 2E6JA 5TDNA 5IVXB 1YJDL 4OLEA 2Y06H 4XPFH 2XI9A 3BRGC 3OQ3B 3DNKA 5HDQH 2CD0A 4QRRE 5C7XH 3EUUA 5F8RC 1S7SB 2WUBL 1K5NB 1VEOA 3GNML 3IFPB 4X6DA 1ADQL 3JZ7A 3UMTA 1OP3H 5T3ZH 4C57C 5CP3A 1NUGA 3CPLA 5K59E 3ARDB 2VQUA 4P48A 4BQCA 4FXGA 1NBVH 1FL6A 4OSUH 1KCSL 2A74A 4UU9B 4AMKL 1IMHC 2R0ZH 2E27H 3EYSL 2HTLD 2VZUA 2AJZA 3IVKB 4NUJB 1FZMA 5F96L 1QO3B 1EMTL 1OP9A 4NZJA 3P0GB 2Y7QB 5IJKC 4UUJA 3U0TB 4KUZH 2AEWA 1R3HB 5GGUA 1L0YA 4PG9B 1H0DB 4MQSB 3EO1A 3MV7D 4HGKC 3PL6D 3L95B 4IDJL 1EEZA 4KKAC 3UPCA 5BS0B 2BNQD 3B83A 4GAFB 3C60C 3K4DA 4RBPH 5E4EB 5LBSH 1FQ9C 2FBJH 4WI8A 3VFPA 3EOBB 4PGBA 5C6WH 3RDTD 5DUPL 3BRFA 5T1LD 1NANI 2X4UB 3ZKXC 4BH8B 3QPQC 1HYSD 4YDKL 3C8HA 1MJUL 3QJHB 4LSSL 1SJHB 2KZ1B 3DV6A 4S2SB 4M6NL 1CIDA 3ARED 4K3HA 1DE4A 2IBGA 5TE6H 4EOWL 4U1HB 5HYJA 3H9HA 3OX8A 3HN3A 1D5ZB 1EUTA 3P0YH 4POZC 4OM0H 5LGKA 3DMMD 1D5MB 5CLTA 3ULVH 4ZOCA 5I1IL 3B3IB 3ZTJG 3S4SA 1A7QL 4KK9C 1NJ9A 1WZLA 2VSCA 4XPFL 1NBQA 2HKHH 2FNBA 2EE6A 5HHVL 3RKDC 1NCAL 4ZD3H 1NANH 1FCGA 1YN7B 4UAOC 2NY0C 4L8CA 1JYNA 3HC0A 5AD0B 5I8OH 2V2TA 5FEBA 1NMBH 1K8DB 2NY3B 4XTRD 3STZA 3T2PA 1OLLA 4R7NA 5JDSA 1HH9B 4IRZH 3VXRB 4Y8DC 3FO1A 5JPMA 3TVMA 1GGBL 4JPIB 1D6EB 3PDOB 4KC3B 4JZOB 4XCEA 4UOW1 4X7SH 1NGPH 1EGJL 3C6LA 1J1PL 1DVFC 5DD1H 1PKQE 5HHXL 5A43C 1ZT4B 5GRWA 1MREH 3DSFH 1A0QL 3C5ZC 5I1DA 4LHQB 1PQZB 1R5IB 5EO0A 1UKSA 3QEHB 4MCYB 4PJBB 5L2KB 1HQRA 5CGMA 2DTMH 3HC4H 2GHWB 1RIVH 1HHHA 2ZKHL 2W0FA 5TQ2H 4NKMB 5DRXB 3G6AA 4HC1A 3D69A 4OZFH 3PGFL 4XVTH 1C5DA 1NLBH 1YMHB 4F7PA 3SDCA 2XA3A 2WIMA 3PWPA 15C8H 4JRWA 1HSAB 3UZQA 2COQA 2QSCL 3P77B 4ZSOE 3RKDD 4OLZH 3AVEA 3DURA 1YN7A 4PJAA 1I7RA 3VXUE 2VAAA 3GKZA 3RL1B 3O8XB 2GQHA 1XIWC 4EIGB 4L4VA 2XICA 2ERJB 3O2VL 3MNZA 2AEQH 1TTGA 4RAVB 4PBWD 4NZRH 5I16A 1BJMA 3WJLC 2C4XA 3O3AA 4KKLC 4KI1A 2I60H 4HQQL 4N5EC 3WUZA 4MNGB 3FQNA 3VFUA 2X1QA 4OLVL 3MRKA 4W70A 1OP3K 3RGVB 2DJUA 4PRAB 5DC9B 2LQRA 1U95B 4R3SB 4JHWH 1SEBB 3RQ3A 5KVMC 1ZSDA 2DQGL 3NA9H 1JZ8A 5JNYB 4X6CF 2PYEB 4YHMH 4UDUB 3OKKA 4OQTL 4I4WB 2BVOB 3AAZB 3O9WC 3ISWA 1U8OA 5FV2A 4YAQA 3SDCB 3R06A 1D9KB 1JWMA 3UC0L 4OCYL 5C07D 3QXUA 3H9SA 1MRDL 4PS4L 5HHQA 1N5AA 1X5XA 4PRDA 3S5LA 1I1FB 3MRRA 2J6EL 3ULUL 4UOW0 1EFXA 3TNMA 1MNUH 4J12A 4PJCB 5LGHH 4TUJA 1TVHA 5TGBB 2ZCKH 4HGMA 3BKYH 4Q6YA 5I8EA 2VDNH 5E6ID 2ADIB 3PWVA 5I1EL 3EFFB 3MLWH 1IAMA 2AERT 3BH9A 3MV7E 4C55A 5LWYH 4OZIE 1CG9B 5F89A 4AENA 4RFOL 6CGTA 4LEXL 1NLDH 3ARUA 5D7IB 1HXYB 4R7DB 3QEQB 5SX4I 4RQQB 4Z7OF 3S4SG 1UB6A 4POUB 3PWNB 1S7VB 4DFHA 5DC4B 4C4KT 1DN2A 4U1GB 4NQSA 1QVOB 3LN9A 4RZCB 4WW2B 4TTGA 4PJIA 3SE3C 1IGMH 2VUOA 1KB5H 4I3GA 4BQ9A 2NX5B 1FNSL 2Y4SA 2JB5L 5H37H 2PN5A 1UM6H 1KB9K 2IQ9L 3B9EA 3LN5B 4FQ2L 3WLWD 3E3QE 3TBTB 1W72H 3MV8B 2UZIH 5KS9F 4CDHA 5K93A 1J05A 5BMFL 4PRBA 2J2ZA 3IYLW 2F8OA 1N4XH 5JOPD 1MOEA 1NH6A 9CGTA 1CE6B 1KEML 1FO0A 1TVHB 3VXQB 4KDWA 3QXAB 4EKXA 4NZDA 2XPGB 3ARFC 4CNIA 4M7KH 2A6DB 3PHQA 1PGRB 1YNTB 3BQUB 1MVUA 4I5BA 4JPVH 2D03L 1U8PB 4ZUSB 4WJ5A 4HG4J 2JB6B 3U82B 4OF6A 1AQDA 4XPHL 1QNZL 5HYQB 1C5CH 1JPTH 1CXIA 1KIQA 3PWJA 1IC4H 4RBPK 3MUGB 3OXRA 4LLWB 4F33B 4RMUA 4BFIB 4ODBD 1MUJB 2OR8A 5GGRA 1VGEL 3IT8D 4U7SA 4TNVF 4C54A 4JHZA 1DUZB 3SY0B 4CADB 5F7EL 3OZ9L 4WHTB 5FYKL 5K33A 3B9VA 1U91A 1VFBA 4HGWA 4ONFH 3N50A 4G8EA 5JLZB 5KAQG 5T3ZE 3C60B 1FNSH 2X1XR 3SJVB 43C9A 4BJLA 3CVIH 4HFUL 1Z2KA 4WO4D 3K2UL 4UQ2A 5E56A 2CLRB 1CF8H 5AZEL 1NCDH 4P2CG 4QRRD 5FGSA 5IGXH 3LVEA 4P9HL 5C9KA 1RZ8A 1WBXA 2BOCB 1BX2A 1XCQB 2F54E 3LEXB 1NEUA 1R5VB 5EZLB 3LAFA 3IXTA 3OMZA 4LGPB 2OK0H 3WKMH 2A9NL 4K7FB 1JZ6A 4F57H 1DLHB 3JUYA 1Q0XL 1YNTA 3BQUA 3CFBA 4YBQC 4UT6H 2UVFA 3U7YH 3RVVD 2DQEL 4J3XA 5D7LA 4UIMB 5GGQH 4IRZL 2VDMH 4IRJD 2QQNH 3ARYA 1VGKB 4JKLA 4JFDE 4KDTA 4L5FL 5K9QI 1BQHB 3OXRB 1TETH 3HMXA 3F8UB 2Q1EA 3WHE0 2X1PA 4RRPA 4KVCH 4OD1H 4O2FA 4O4YL 3FFCE 1YEJH 1DZBA 3ZDZE 12E8L 4DGVL 4MA1B 3BWUC 3QDJA 3SPVB 5C1MB 3H42H 4FNLL 4M5YH 4HIHB 1OB1B 4YFLF 1J12A 5I74C 1BOGA 5H37G 1MCWW 2OSLB 5FOBA 1S7SA 3LMJH 1UYWH 4HC1H 4Y2OA 5IMOA 5DRNB 4U05A 4FFWC 1YPZF 3VXSE 4P57A 4RX4A 1FZKA 5E08H 2HJKB 1U36A 1JIBA 1MCPL 4Y4FC 4G6AD 3WXWL 3BE1H 3DVNA 4W6YB 2Z35A 4Y8AA 2UUDK 3V0WL 1RFDH 5IHBA 2AEPH 5HYSB 4FTVE 3D87B 2YC1A 3LB6D 1WBYB 3CFBB 2GJ6E 4MNHA 3KJ6H 5GGVH 2AS5M 1R0AL 1A1NA 5JR1L 4XC1L 2R23B 3JUZA 4JFPA 4GSDH 5HYJD 3WFZA 2X4SA 4PJFB 1FN4B 5I73B 4YBHA 4P9HH 5EO1A 3TV3H 4P99A 1XF1A 5AZEH 5I15H 5MERA 1IGJA 1T4KA 2D7MA 3SGDH 1DUYB 1Q72L 2IQAB 3D2UB 2NMSA 4OF5A 4XGZB 1J0HA 2HKHL 3CCHA 3B2VH 5EZOH 2MNUA 2R56H 4GBXD 1U3HD 2DQIL 1Q9KB 3HFMH 4XPGL 2DIAA 2X4NB 3HE7D 1KIRA 1H3GA 5GRVL 1Y18A 5C2BH 2BJMH 2YPVH 4MA8H 1Q0XH 1YEIL 4LOUC 4WNQA 4NJAL 2XWTA 1WFOA 4L5FH 2HJFB 3S97C 2HJKA 3BEWB 4HV8A 5A2JH 2C1PB 3Q1SL 5ISZE 3KPTA 4D9RD 1I1AB 4N5UA 1D5ZA 2ITDA 5CSGA 2XFXB 3QIWB 3VD4A 1D5MA 4AQOA 3WLWC 4GG8B 1K4DB 1TQCC 3M8OL 3WFCH 3VXUB 4R96B 3O9WB 2FWOB 4JO3H 2SEBA 1CCZA 3HG1D 4QTHB 1EFQA 1HHIA 4NM4H 2W65B 5IB1A 4G6JH 1DP0A 2BNRB 5IVOA 4G7VL 4ODWB 2ZNWA 3KR3H 3CVHA 3BZFA 1NLBL 1RUAH 3T2NH 1AO7E 1P6AB 4ISVB 3OKLB 2UWEA 5T1LA 3AC0A 5JPMB 4OCWL 2VMFA 5FO7A 3V0WH 2X1OA 1KXTB 3SE9L 4P2QD 3BP4A 4JM2D 4NQXA 3VDBA 2XN9D 3K74B 2VNCA 3EO0A 3CFDB 4GS7C 1BF2A 5DD1L 3EOAB 3Q5OA 3E2HC 3LDBB 1IGFH 2A1WH 1MCCA 5CZVH 1G9MH 4OT1L 4LLYA 3CFEB 1G7IB 1T22B 3FO9B 3TFKC 1CFVL 5C9JA 3Q48A 1YY8B 3G6JE 2EDWA 3MROA 3DROB 3MOQA 4G9FB 3D85A 4GKSB 4IRSD 1XIWD 3TIEB 1PZ5B 5DTFA 4R97B 1LO4L 1AP2B 2HVKA 4Q9QH 2IAMC 4AG4H 3O4LE 1A3LH 2YR3A 4Y5XA 1NC4D 3RY5A 2PTVA 3GHBL 4Q7DA 5GGSA 1RSFA 4PJAB 1LE9A 2FIRT 5IB4A 4RX4D 4I77L 3HUJB 3SGEI 1D6VH 5BS0E 1N0LA 3VD9A 3EOTH 4OGZA 5FB8B 5C0JA 5IW3A 3STLB 3UTZA 4E5XA 3EYSH 2FX7H 1XGQB 4O2EA 3FMGH 1RZKC 3A6CH 2YD1A 3CFDA 1ZK9A 1OAYL 1C1EH 4GAGL 1A7BA 5FA3A 3TM6A 2J8UB 3FONB 4JAMB 5BJTA 1RIHL 4TOYL 2EKSB 3I6KA 5ICYB 2VQ1A 1G7LB 4YQXL 3GB7A 2OX5A 5C0GB 1M71A 1JGEB 4JDTL 4XH2B 4O5LH 1NQBA 2Z91B 3T2NL 4JFEB 4K94C 4Q9QL 4YIQA 35C8H 3IDYB 2YPLB 4L8SB 3D3VB 4OCRL 5JUEL 5ILTH 2N7AA 1A47A 3L1OH 2NY5H 4X6EA 2EDJA 4D8PA 4OD3L 1H5BA 4S1SH 4RAUB 5T3ZD 2YD8A 1HHKA 3QUYB 4GQ9L 1BBDL 4PJCA 1JFQL 4XP4L 4H1LG 4DJMA 4PR5B 4XC1H 5DYOA 2Z8RA 1AGFB 5DD5L 5TGBA 4F80A 2YD5A 3OV6A 3MCG1 1H8NA 4KK6C 4DN3H 2E9BA 3C2AL 4OM1L 3OG4B 3W9EB 3VFGL 4G8GB 3BH9B 2ED9A 5D7SL 1FG9C 4E42A 5I1GH 1NDMB 2ATKA 3UTTD 1WBZB 1AE6L 2IF7A 1ZKAA 1RIUL 2YN5A 1QA9B 3OKYA 3FQTB 4YWGH 1GGCL 4M00A 3HE6B 4AEIL 1YPZB 2AJVH 5IQ7H 3NPSC 3FB7B 2HP4A 3EDFA 3M07A 1PY9A 4X6BB 5C7XL 4KQ4H 3VCLB 1EHLH 4NN5C 2VISB 4XPGH 3O11A 4X7SL 3E8UH 3QUZC 2HA1A 1IGTA 2HRLA 4P9HC 5CCKH 5JOPE 4YXHL 2DWEA 3MRGB 1IQDA 1MHEB 5F7DA 1BD2B 4JFEA 5EZIL 4JRXB 3HTLX 4NUGL 5HYEA 2R0ZL 2OLDA 4X6DF 2ZUWA 3TBTA 5FKPA 4KTDL 2IANA 4XNUL 1FGNL 4LCWE 3ZT7A 1ZANL 1KCVL 3QQ9C 1TPXB 1YDPB 4PJ5B 4K3EL 3QIUB 1FHGA 2ICWB 2VWEE 2NY1C 5CJQL 1U8JA 3WIHA 1MAKA 4E0RB 3HZVA 2VRAA 4E42B 3QUZB 4LLDA 2OR9L 4LAQH 3OR7B 5E8PB 1CYGA 4KGJA 5TH2B 3RVTD 2OMBA 3OKDB 5DLML 4AH2A 3FQTA 3KHOA 4PUBL 3ARPA 3OJVC 3QG6A 4PS4H 4RGMB 5ADOL 3ARBC 5FYJU 5HGBB 2AV1A 3U7AA 1BEYH 5FYKD 2NY4D 3LPGA 1A7RL 3OGCA 3B5GA 3C6SB 4HBQA 5D7JD 1EERB 4OZFG 3O11B 2OTWA 5ABDE 4WHYG 1V7MH 2EXYC 4GQ9H 2H32B 3DLQR 5FOJA 4ONFL 3MRBA 5FK9A 1M1SA 3IS0X 3VGGA 1DBBH 2DLHA 5ICXA 4JG0H 5KVDL 3QFJB 3WL9A 4FQXB 4NC1C 1NGWB 2FR4A 3FOMB 3LS4L 1WQVT 2EZ0C 4NKIH 3ZKMD 2QKIB 5KSAA 3SDAB 1EFXD 1A1MB 3LKPA 3RVXD 4F7CA 3S34H 4AEIH 1XR8A 5IQ7L 3OAZH 3GSNA 3VXOB 5SX5K 5DF0A 3ULUD 4ELKB 2VXSL 3ZKQD 3MRLB 3TBSA 3D39D 3GO1L 3SKOA 4J4PA 2D3VA 5EU6D 2VL5B 2ESVA 4QHNB 1ES0B 1I9JH 3NCFB 5MEPA 1E6OH 4LCIL 1DR9A 3RY6A 3CMOL 3MRHA 5ADPH 3MXVL 1LO0L 3UAJC 3FN0L 5KANG 4GO6B 4HUXB 4E41A 1YMME 2QL1A 3NIGF 2PXYA 2YS4A 4HS6A 3LD8C 2WBJA 4KV5E 2FECI 3HI6H 2MTPA 5TE4L 1ZOXA 4X4XA 2DDQL 2EDBA 1LE5B 3TT3H 4OZ4A 4PJEB 2OR7A 4JO1L 1CR9H 4YXKH 1TZIA 5HHME 2XACC 3SKJH 3GI8L 4FQXA 5GPRA 4TOYH 3L5XH 1G6RB 4XP6L 4E9LA 3IDNA 4L3CA 3T08A 2NY2D 2L7JA 4HAGA 2HT2D 5GJTH 1FFNB 5DDHB 3V4VH 1AD0A 4X98A 2IALB 1GGBH 2J88L 2Z93B 1IM9D 1IAKB 1MELA 3PF2A 2FJHA 4A6YA 4K7PY 4OFVA 4JREC 3MUJA 2DM3A 3OB0K 5IB2A 2DQFB 3INUH 2BNQE 4PY8J 3O6FC 3BMVA 3MUY1 4RFNC 4JO2L 5ID0A 3IFLH 1KC5L 3FQUA 1ZMYA 1AGBA 4YXLH 5JORA 5CIPA 3HG1E 5D1XB 1EXUA 3ZDYF 3LKOB 5J1AA 2G60H 3RA7H 3G6JF 2NY6C 3QEUB 4YWGL 5EC1B 1YMMB 5DHVA 2EYTB 4OGAD 1XR9B 4L4VD 3ZZ1A 1RJYB 4OUOA 2J6EA 5CCKL 1QFWH 1EH9A 2MQ0A 3MV9D 4M6NH 3CX5J 3L9RA 4QY8A 2RGSA 3TYFA 1I9JL 3RHWK 4CGTA 1JGUH 1JRHL 4N90D 4DAGH 3FHQA 4WW1A 2WK2A 1CFQB 1WCBB 5IBUG 4JFOB 4O00A 3EDJA 5DEGA 5IFJB 5MHSE 4PJGF 1NUDA 1ONQA 5TE4H 3RY4A 4YJZL 2LAAA 5JHLH 3DMMA 3H0TB 1E28B 5T3XD 5IB2B 4NBYB 1NCAH 4JFFD 1TPXC 1OAZL 3NZHL 3MLXL 1I8KA 1OQOA 4MDIB 1JYXA 4NQEB 2HYMA 4HKXA 3C09C 4V1DE 1MSPA 4ZPTB 5BV7C 1H5BC 4HUVA 1Y6MR 2F54D 4M1GL 1F42A 4OZHA 1PSKH 2ADFH 1GCFA 4L29A 4LPVA 3MLSH 5ACLA 2J12B 3GSXA 4O9HL 4LCCA 3RUGB 1VPOL 3IJYB 2OTPA 3VFNB 2O5XH 2W0PA 3S3SA 1F5WA 5T3XH 3QDJE 1IRAY 2NQCA 2VDOH 1A0QH 1MF2L 4PPTA 5F6IB 4P3CH 1AJ7H 2IPTH 5FCSH 1JNJA 2GYSA 5IBLC 2EEDA 3O3EB 3PDDA 3L3DB 4JFQA 5IVXE 1YECH 1HCFX 2QHLA 2B5IC 3MACL 3EDDA 1P9MC 4KJQC 3TH4T 4KI5C 3QFDB 1A14H 1ZANH 2EDDA 4UNUA 1PZ5A 5DTFB 3DHJA 1NJ9B 1CLZH 4LHUA 3LQAH 4XP9H 4XNXH 3LS5L 5C2UB 4OUUA 5CEXB 1TZHA 5I1CL 4XAKE 4FQCL 4GUPB 1ZVSB 4P5TC 1N6QL 1QLEH 2YHGA 2E8YA 4RISH 2EIDA 2R69H 3RTQA 3B9KC 4M3JA 5FB8A 2RCSL 2NY1B 2BRQA 3DX8A 1T1YB 1RUQL 2ZOLA 3D18A 1E6JH 5F6HI 1T1XA 2AGJL 3RVUD 4ENEC 4S2SA 5KVEL 1F90H 1NMAL 4XVJL 4DTGH 1DDHB 3DSFL 1GXEA 2YD4A 2Q6WB 4M93C 1H3PL 4RMWA 5FA3B 1RURL 2VE6A 1CFSA 1SBBA 3RVWD 1R3JB 4I0PB 1M05A 1CLOH 3SGJC 1SVZA 2GUOA 3GJFH 2ZJSH 3OF6A 1HHHB 4HK3J 2DJSA 3UPRA 3U36B 4QT5B 3GUTB 2CRYA 4WUUB 4Y89A 2VLRD 2AJ3A 5C08B 1D3CA 4ALAH 5J4MA 1JZ4A 4L8SC 3LY6A 1Q94B 3T65B 4ZFFA 3UTSA 1IM9B 1JWSB 2F53D 4BH7B 5FO8B 3FO2B 3L1OL 2EDQA 3E6HB 1FIGL 4RDQG 5ILTL 5JUEH 3J8F7 4FFVC 5MI0B 1W0WA 3HC0B 4ODVL 1DQQA 1VFOA 5ESAB 1JN6A 3F65A 1F58H 5KG9B 1INEH 5FYKH 1KN2H 3K0WA 3DX7A 3Q1SH 3KJ4B 3HI6L 5C0BD 1OARL 4NSKB 1FAKT 1IC5L 4NPYB 3BFOA 1D6EA 3PDOA 4GXVH 3OJ2C 2HFEA 2IPTL 4PG2C 1F6AA 5CMAB 3WIHL 1WEJH 1GPOH 4PGEB 4YDVB 4GRWB 1T5WA 3HE6C 4MQ7B 5HVWA 5DVLA 4NNXA 4U6TA 4U2ZA 1SBSH 1NFIA 5B38B 4Z7WA 1CD9B 3TBYB 3GMLB 3D9AL 1YEGH 4IBLT 5E6ZA 3UJTH 4RMTA 4IEFB 3TIDB 2A6IA 1FFQA 4IRJA 4D0CA 4KHTL 4XP6H 1CDHA 5IMKB 1TTFA 2F53E 2V7HB 2B2XL 1MCOH 3BSZL 5JMRA 2PW1A 3VI4F 3I3EA 5HDBE 3MLRL 3HNTL 1QLEL 1KULA 1R6VA 3KWWA 3MRIB 4S1QH 2IH1A 3MRPA 3VRJB 4PJHA 1T83A 5ACZB 4O4YH 3QDGB 3ROLB 1JTOA 4HJJH 4R97C 4R4NC 1F2XK 3HMWL 2ED8A 2KQNA 2VLJD 3RL1A 1Y6NR 2BNUA 4LP4A 4GAGH 2ZUQC 5HHPB 4FQXD 1KBGL 3DX7B 5E00A 4Y1AE 3A67H 2Q87A 4MQXD 3MRMA 5JIHA 3MBEB 2D03H 2VLJE 4J3SA 2MQ3A 4KROB 1NC2A 5E9DD 3UO1L 3RPKA 4HC1L 3L3IA 4XTRC 3P4OB 3QNYB 5EBWB 3D39E 1FP5A 5D7IA 1I1YA 3L3HA 2WBJD 4IOFC 4DKFH 3EYQD 4NCC2 1NKRA 4I77H 3P9MB 1U8QB 2Y36L 5T33H 1VPOH 4RZCA 1RZJH 2HFGL 3ILPB 4LCUA 4ODVH 1OGTA 2CDGA 2MHAB 1T6WA 2VN7A 1K85A 4DN3L 1YN6A 3U9UB 3MV8E 1MFBH 3MJ9A 5EU6A 1P7KA 4Z7WE 1P6FA 1QSVA 2VERN 1AXTH 1FJ1B 3W9DB 1CGSH 4TUKH 1WAAF 1QEWB 5KOVC 1KIPB 3OJDA 1MFEL 4JM4L 3KPLA 1DEEA 4ZUUB 3CD4A 2AW2A 5C6PB 4QHKI 2I5YL 1J9CT 1XF4B 3HNVH 5EA0H 5T3ZL 3HR6A 1JWUB 2XA8L 3CFJB 1PZUB 2CKBB 5GS0L 5IG7B 1BBJB 5HBBA 1P5VA 3GJFK 2VXQL 3TBWA 4GKZA 1UG9A 2DKMA 2HTKD 4CMHC 2YD6A 5D7IE 4OD2B 4GW4A 2NYYC 4DVBB 2VDRH 3RL2B 1N3NB 5IK3B 2IFGA 1DQDH 3SDXE 4NWTH 4GAJL 4GT7A 1KYOJ 1NCUA 3LQAC 1A4KA 4PYHA 1AGDA 4KJWC 4XNUH 3MOAL 4MJIA 4X5WA 3MGOB 4P4RA 4FABL 5IIEA 3NGBC 4ERSH 4GMSH 3CVHL 2Y25A 1PKQA 4PJ7A 3UTTB 4Q9BA 2OI9C 5I8CA 5DT1L 3V7AG 1KJ2H 1YN6B 1CL7H 3V52H 2H2PD 1AXTL 4E41E 4YHIB 3S88H 1RULH 4F2MB 4N8VB 4NNYA 4M03A 1V7NH 4CVXA 1FJ1A 3RU8L 3FRUB 2FHCA 4JE4B 4NDMA 4Z78A 5EU7C 3BIBX 1XCQA 3KPLB 2AV7A 2LVCA 5F9OL 3WNMA 4DGYL 3BYTA 5MP6H 1KFAL 3MGTA 5KTEH 1BQSA 2IBZX 5FM8A 1OW0C 2YD7A 1JNLL 3GSWB 3PJSB 4BFGA 5A2IH 3P9LB 4JQXC 2QR0B 3I6LD 1UM5L 4OF7A 2FIKB 3U7YL 1FIEA 1MEXL 4K7PL 2VH5L 4U1LA 2ID5A 3GMPB 3QDMD 1VFAB 1FGNH 4L8DA 4Z7UF 32C2A 1QR1A 3MJ8A 5IVXF 4G8FB 3ULVC 3MRNB 3QI9A 5EUOA 5KVDH 3UTTE 3K8LA 3HR5A 4L4TA 2D0FA 2WWKT 1U92A 5A2FA 2FEDD 1FBIL 5CIPB 2JIXD 3UBXA 2QADC 5T3XE 3LH2H 25C8H 3O45A 3ZYIA 4FQQA 1CZ8L 4G8EB 1TJHL 3ZDXF 5D1ZA 3UTTA 1V3MA 4UDTA 1KJVB 3QEGH 4DCQB 1A5FH 3V5KB 3QUMA 3L3KA 1I8IB 4OF8A 4KJPC 2RFXA 4BUGA 4F2MA 1LNUB 3QQ3B 1RPQA 5C0EA 3E0GA 5I71C 1PX4A 3GMRB 4G8GE 3LEXA 1OAUH 3CMOH 4U3CA 2AV7B 4EI5C 3IXTB 3AXLA 5B3NA 1E27A 1FNAA 4LLUB 3LKSB 3JV5A 3GSOA 3LIZL 2ZUYA 1J87A 4N0YH 1IGYA 3L6FA 2O5XL 4NM8H 3VFSA 4PRPA 3U1SL 1YEEL 4ZXBD 5FFLA 2J1KA 3LN4B 1AKJA 1QQDB 3GMPA 2EEAA 1PBYA 4GRLA 5FUCC 5FYJD 2X40A 4N0UE 4NQDD 3DX6A 1LEIA 5AUMA 3JWOL 5IKCA 5EO1B 3D0VA 4LDLB 3GGWA 3HNSL 5IUSA 3DIFB 3O6FB 3BGAA 1IL1A 4F7MA 4Y4FD 1OSZB 4G6FB 3MX0A 4WWID 4Y16B 3VFWB 4KQ4L 4PGJA 3UEZA 4QGYA 1C7TA 3MCKB 4NQCA 3F5WA 1W0VB 3V5KA 4LEOA 3NFSH 3GSRB 1XT5A 1Y18B 4DW2L 3VGAB 1CICB 5F7UA 1S3KL 2J8UF 4BZ2L 4X4YA 4OIIH 2FD6H 2FSEB 3HCVA 1JNHA 4W68A 4XRCB 2I9LA 3C2AH 4WY7H 2ICWJ 2WIIB 5DFWH 1EAPA 4B0MM 2XXCB 3OKMB 3O9WD 2AK4B 1XIWA 1NUFA 4ZTPL 2CRIA 1RZJC 2CIKA 4NBXB 3JV6B 1DBKH 1KCRL 2XA8H 4ZNEA 1ND0A 4ELMB 4CMMB 1DBMH 4XPTH 1ZHNB 5EOCL 4LF3B 4B7IA 2UUDH 3RWEB 5SWQA 3QIWC 3VGAC 5DJ2A 5FGCE 4R2GD 3BO8B 3KPMB 2H45A 5TF1H 3ULUH 5C0FA 5AZ2L 4JJ5A 5E70A 1JK8A 1HOCA 2FATH 2X4RA 4LASL 2G75B 3UTQA 4YXHH 1OL0A 1U3HB 4PFEA 2IG2H 4XNZC 3BT2H 4EVNA 5E2WH 1FORH 4WENB 2VZTA 3D2UD 4PJBF 1BREA 3KJ6L 1U6AH 2EIEA 2P8PA 2Q8BL 2XWTB 5DURB 2F5BH 3W0WD 2P7TA 3V7MA 4YNYB 4I0PC 1S8DB 5B3JE 3PL6A 4HMEA 4DN4L 5IEKA 4MAYD 3WXVH 1JF5A 3R4DA 3SE8L 3PGDA 3PGCA 4NHUB 4YZFF 3NCEB 1AFVL 2NXZD 1RZFL 4QRPE 1D5BB 4QRPB 5E99H 4JY6B 2VXQH 4XHJC 3OAZK 4RCAA 5K9OB 1JWSA 5C0CE 2FX8L 4AT6A 4JM2F 2NXZB 1Q9LB 5AEAA 1A3LL 4WI5A 1A6ZB 1R3HA 2VXVL 2WLYA 3QP3A 4A6YL 2D0GA 4ODWA 4MAYB 4CU6A 1FIGH 4L8CB 3IAGC 2K7QA 5KG9A 2ZWLT 3KPRB 4JFHE 3CVIL 5JDSB 5IJVB 3I2CH 1CK0L 1I7UB 5KJRH 1RJZB 1WAAE 1AI1L 2JLLA 4K3DL 4EVNB 4EN3B 1CE1H 1N6VA 2OZ4H 3P4MA 1WCQA 4KK5D 3WS3A 3MLTB 1J8HE 3NFPB 4LSUH 5GS0C 1S8DA 4I18C 1RMFH 4X4ME 4XAWL 1NMCB 4WU5B 3KPPB 1UACL 4IMLB 5ICYA 4X4ZA 3UTOA 1IKFH 2DICA 4G43A 2FRGP 5IM7A 1IE5A 1Z9OA 4GBXC 2DMKA 3PWPB 1SY6A 1KB5A 4PJHB 3V6BR 1PJ9A 1S7TA 4U1NA 12E8H 5F1NB 3CU7A 4DGVH 2V2TB 2DQTL 1VKXB 1FGVL 3O8XC 2G5BB 4Y5VA 4M7ZB 5B4MC 1B6UA 4LNVA 1I8MB 2QQQA 1B4JL 4XB8A 4KUZL 2C1OA 1JGVH 5ALBL 1RZFH 3B9KD 1MI5E 3U83A 2V7NA 5D2NB 1TZGL 5L0QB 2W0KA 4KVNL 3EHBC 3DSNA 3C60D 4PJ9B 3DI2B 4G6FD 4KKAD 3RVVC 1MCPH 3SO5A 2UZYB 2YA2A 3DHMA 4WI9A 4XC3L 1B0WA 2I5YH 1M7IA 1JGLH 1L9MA 2BSSB 5L2KA 5IMLB 1XF2B 3VW3L 1T1ZB 2V2WA 4RMSA 1NCWH 1JZ2A 1MFBL 5KS9B 4F15B 4KJYA 2EDOA 2RCSH 3G5ZA 5IBUB 4F7PB 4JZNB 5IESH 1SYVA 1WSST 4ZO7A 2OS7A 3IDJB 1IEBB 3G08A 2GSIB 1INDL 1AGCA 1AGFA 1LO4H 4U33A 1UCBH 1YDPA 1CL7L 3O3DB 3KYNA 4DKEL 1A4JA 2VZVA 5GGTA 4ORGB 2OM5A 1JHTA 3FQRA 2XY2A 2WWMC 2AJYL 5DJAB 1MCFA 3I6LE 5D96C 5K59F 2DWDB 1FLRL 5DJYB 5ITBH 4NGHH 3X3FL 3VXSA 3QXTA 1QSFD 1ZS8B 3KNBA 5FIEA 1UB6B 5DMYA 1ED3B 1I7TA 5E1AB 2YEZB 1FG2B 1DVFD 1OLZA 2PYEA 4ZMAT 2VISA 4P2RA 4P4KA 2Z31A 3BPNC 5B8CA 4OZHF 3BUYB 1OTUD 1B4JH 4HIIB 3MRGA 2F5AL 3TT1L 4ZYKB 2ESVD 3SDXA 3VD5A 5EN2B 1U8OB 2WBJC 1XCTA 4IOFD 4OBSA 1KJ3L 1MCEA 4KRPC 4ZQKA 1ITCA 1JP5A 1TCRB 2Q7NA 4ZO6A 3ZYOA 4ZTPH 5ID1B 2VZ1A 3QO1B 5F6HJ 4PRNB 1WF5A 5E4EC 5FYKU 3V2AR 4K3JH 1TQCB 4ODXA 4X6FB 1VACA 2A9NH 5DJ6B 3ULVD 1D9KD 1GC1C 1J0JA 2VH5H 4UNVA 2C7UB 4NYLA 1LDPL 4OLUH 2I60L 2Y6SC 5I2IB 2EDNA 1JNNL 1T04A 1VFAA 1U93A 4PREA 3RAJL 3B43A 4JHAL 4Z18A 1Z3GL 5D7JA 3HRPA 2DDQH 1MJ8L 5GZNC 5GS1C 3MQIA 4P5KB 1RAMA 3CUPA 1MCRA 3GI8H 3H7LA 5SWSA 4K3DH 3UBXB 4P2RB 4HLJA 2NTFA 2CUMA 4Y2DA 2H32A 4YHLH 1N8ZA 3T2OA 1MIML 4WW2A 5FK9B 1G0DA 3MRQB 1H15A 1OM3H