3C5JB

Crystal structure of hla dr52c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
187
structure length
182
Chain Sequence
RPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPAKHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title The structure of HLA-DR52c: comparison to other HLA-DRB3 alleles.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 182
sequence length 187
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5jB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c5jB01
1HKLH 4MNGE 3VWKA 3JTTB 1PD6A 1JPGA 1H3XA 1SY6L 3MRGB 3PJSA 1QSEE 2F5BL 4C56E 4I3SL 4P57A 3MOQA 4UV4L 4PB0L 2AJ3B 2FR4B 3BQUC 1TLKA 4YDVB 5D70H 1A9BB 4IM8A 2NY1D 2FEEL 3BT2H 5CEZD 5BZWA 4BFBD 4HGWB 1O5DT 3WNOA 4M7LH 4XGZA 5DURB 3BE1H 3RPKA 3KGRA 4RFOL 4GW4B 3RY6A 2DQHL 2W65B 3UTTD 5EOQH 3CH8A 3MV7B 4NHCH 2FH6A 3FFDA 4HUNB 1K6QL 2DS4A 4LCIH 1WFTA 1A4KB 4F7CB 2Z8VC 1IC5L 2RHEA 2D4FA 2OJEA 2NY5L 5IEKA 4LPXA 4K07A 4MJIA 3QCTH 4Z7OE 2UWEB 3EHBD 5F7EH 1IQWL 3ORJA 2V2XA 4HBQA 1IRAY 4KJYB 3IDGA 3S7GA 3PGFL 3MRJA 1IT9L 2E9JA 2R1XA 5FYKH 1FGNH 2HT4D 5FKAB 5B38G 1IGTB 4PRPD 2PF6A 5DS8B 5GS3A 4NT6B 1AE6H 3K2UL 3OB8A 2SEBA 5FGRA 1I7UB 2FYYA 2OI9C 4G9FD 3O41B 2NX5B 2VLRE 1BQHB 1WZ1L 3I50L 5ANMB 3GSNA 3HZMB 3PL6A 2J6EH 4FQJL 5C7XH 3OKDB 4Y4FC 3QJFB 5HYIA 2R0ZL 4Z8FL 4Q9QH 3CLFH 4Q0XL 4ZPVB 2CDEA 1JF1A 5I9QC 1JV5A 1OLZA 3LKQA 1FVDA 3NACL 3QH3B 4K8RC 4W70A 4OAWB 3QIBD 3ALPA 4WTZG 3WLBB 1EEYB 1CICC 2HTLC 1FAIL 1CDYA 1HDMB 5DRWA 3RVVC 2IGFH 4JZOA 4R90L 4TNVF 2HKHH 4O9HH 5C0CA 1A1OB 3MV8B 4KZEL 5IWLA 1A5FH 4JQIL 1C8PA 3GBMH 4PR5B 4EDXA 4JFQB 5LBSH 5I1CL 1M05B 2ORBH 1OQXA 1C12B 3F58H 1NKRA 4NRZA 1R24B 4OD2A 3KLHC 1L0XA 4RQQB 4GKNA 4LIQE 5KANI 5DWUH 4YC2C 2MJWA 1IARB 2ZJSL 2XA8H 5T1KB 3VRLF 5TE6L 5FM8A 2Y25A 3BH9B 5SWSB 3CFIC 2D9QB 5D2NC 2P8LB 1KTRL 5AYUH 5IB2B 2EE2A 2CKBA 1I3GH 4FMKA 4KK9C 4G43A 5DF0A 1UG9A 1KCSH 3O4OC 4WEBH 5E2TH 5I1HH 2DWDA 3ILQD 4MQ7B 3N1PC 5F3HB 1U93A 1NCBH 2E6JA 4N0YL 5I1KH 3ZE1F 4DTGL 5CAYB 1NDGA 3LKRB 1KEGH 5MEPB 5IFJB 5ISZE 3RWEA 4LSVL 5DK0B 5I71B 2E7HA 1A1NB 4LSPH 1CT8B 1MPAL 3TLRA 3HUJA 3HE7A 3AB0C 2EDWA 4K9EL 1T1YB 4JRWA 3Q6FB 4NC2B 1T7VA 1WITA 1QFWM 1UENA 1U8IA 4PJ9B 1MHPL 2QSCH 1G7IB 5C0AD 1U95A 2ZCLH 3X3GL 4OI9A 1YC8A 3NFPA 2WP3T 3KNBA 3PGDB 4DKEH 3TCLA 4GRMA 3SGKC 2Z92B 1R5IA 1JZ8A 2VQUA 5TH2A 4KTEL 3QEUB 3MACL 1U2HA 4WI9A 4P3WA 3DO7B 3C8HA 1F2XK 3J7HA 5DXWA 4HS3B 4L4VE 4UQ2A 4HAGA 3GNML 5IB3A 1D5XB 3L5WB 4O2CB 1X5YA 3DUUB 1CFSA 4Y5XA 4ZO8A 2NYYC 3RDTD 4YHLL 2H32H 5D9SB 3ET9F 3VMNA 1FSKC 3H9SD 4WI4A 3G6DH 2YD2A 1U41A 4XMLH 4DUWA 3T2QA 1B4JH 1NL0L 1P4IH 2BVPB 1KJVA 3SN6N 2UWEE 5SWZD 1YNLH 1A0QH 5ENWB 4PJHA 1WTLA 5JORB 2K3TA 4JREB 1YNKH 3UZVB 1QP1A 1ZLVK 3QT2A 3MV01 1MHEB 3G9AB 4BSWB 5I76B 4PREB 4JFDD 2YN3A 1NBYB 3GSXB 5BXFA 1LEIA 1X7QA 4X7SL 4XAKE 5EPMA 1LEGA 2BNRA 1DLHA 3TBYA 2WBJA 3REWB 3ZE0F 1CLYL 4JM2B 3BZEA 2EYSA 3DXAA 2IADB 4JY5H 5HYJD 5CSZA 4EIGB 5IR1B 5ANME 2DQGL 3QXVA 1T2XA 5T1LA 3BWAA 5TFSH 5DUBA 2B4CC 5EOCH 3FAWA 1BAFL 2HAZA 3MRKB 3S5LG 4WJ5A 3EDFA 3QULA 1E4KA 5HVFB 1XZ0B 2EDOA 5E94B 4IRSB 2AI0L 3LV3B 3S8WA 3PF2A 1N5YH 2I07B 4NJ9L 2BDNH 4QY8B 4PGJA 3I02A 4ZQKA 1CGWA 1LD9B 1S9WA 3VXRB 12E8H 5KVGL 3GSUA 1UZ6E 4GXUN 2ZUUA 3QIWC 2A6KB 4UT9L 4NQCB 5KJRL 4JY4B 4BM7A 1IAOB 3MV8E 3SDDC 2MPAL 4M6MH 1QRNA 3DWTA 4PJFF 3VXSA 1L0YA 5HGBA 2X4SA 5GGVH 2R0KL 1RURL 3Q48A 4ZTPL 4PTUB 3T08A 5IT2L 1KJ3L 3QNYA 1U8PB 4OGAD 1SEQH 2BC4A 3QPQC 5IVZA 5SWSE 2X4QA 5JW3H 1TETL 4OZHF 4HUUB 1PJ9A 3GSVB 1NFDB 1H8SA 4YFEA 5DMIL 4X9BA 1INQA 1I1YA 4Y5YC 3PXJA 2AXHA 3QDJE 4BK5A 1JZ5A 5CMAB 3EYOA 4MCYB 3ULVD 4FXKB 3MBEB 3U0TA 1A7OL 5T3XE 1MAMH 3OKOA 4NZTL 1DBJH 1YUHA 1VB9A 1JTOA 2E27H 4XNYL 5D93B 1KCKA 3PP4L 3ABZA 1KB5L 4X4YA 2AEPL 4TVPH 1ACYL 2AS5M 4NN5C 4ZOAA 1F6FB 2EE3A 1GGTA 2DJ4A 1I3UA 4WWKA 1DQQB 5GGQH 3QUML 4IRZL 3CIQA 4OCWH 2FSEA 4TRPL 3O6ML 4XNMA 2PYFA 3JTSA 3KVQA 2D7NA 2AQ1A 2F74A 4JPVL 5F97E 5FECB 2XKNA 1CU4L 1WQVT 1VFBB 2BY3A 4OCNC 4DGVL 2IALA 1AXTL 3HRPA 2AKRA 1NBZA 1S7RB 4BKLA 1Z9SA 1QYGL 3O81A 3VXTB 5IW1A 2Y1VA 1NGPH 4MA1B 1G84A 3MA7B 1QQDA 3SE3C 4GXVL 1NPUA 3MODL 1KPVA 2FWOA 1WUNT 4PRBA 1AQKH 4TUKL 1YJDC 2VO5A 4ONFH 4X6BA 1YEHL 4LLMA 3WSQL 4QEGA 5HGGS 4F58L 3ARBA 1A7PH 4NUJB 4S2SB 4OCLC 4LDOB 3QHTC 3LEXA 4LKCB 3D6GA 5EBGA 2IANB 4P9HC 2VLJA 1I8MB 2YPKA 1HWGB 2D0HA 2Y36H 2DYPD 5BO1H 1MAJA 4QF1B 3F12B 3EYVA 3GMNA 1T83C 2ICWI 4U1SA 4Z95H 1YY8B 2BVOB 2VLME 2VLKB 2A6IA 4IMLB 3RTQA 4D3CH 1YMME 3GSOA 3LEYH 4M7KL 4FFWC 2FATL 3ULUD 3CK0H 2EH8H 1IEHA 3LRGA 2HFGH 3WNNA 2JF1A 5GRWA 1MQ8A 4I0PC 4J3UA 5D7IB 1MELA 1FYHB 1PDKA 3VXRE 3D25B 5C0EA 3NAAL 1R5WA 1U42A 3U46A 5GSRB 4OJFH 4NQCE 4C4KO 1RJZA 2IMMA 5T3ZE 1GIGL 1ZHKB 5DYOB 4C54A 5CEXB 2GW5A 1NMBH 4Z7OF 5ETUB 1OCWH 3T8XB 4GMTH 4HKBB 2W60B 3MUY1 5HGAB 3U1SH 1OL0A 3QRGH 5EA0L 4CMHB 3ROOB 1X5JA 5EO9B 3NCCB 4KDVA 3WLWC 1N7MH 4LGSB 1MCWW 4XRCA 3ZDYE 1NFDE 4Y16D 4NPYB 1J8HB 1EO8H 3K7UA 1NKOA 4CVWA 4W68A 3TA3D 5I19L 3GM8A 5DZLA 2Q7NA 1N3NA 1JPTL 2EDDA 2NY4D 1SBSH 1HHKA 3IS0X 5DJAA 4J8RA 3RKDD 1MCLA 2V17L 5CHNB 4R0LC 3RUGA 3KLSA 2X05A 3RIAK 3VH8B 3U7YL 3FN3A 5DJ6B 1A6VH 4DOHB 3C9NB 3GJEA 1ZHNB 1T1XB 4NDMB 4WW2F 4O02H 5J3HD 4M7JH 3QHZL 2BXZA 4NUGL 1CFNB 3HS0A 3BAEH 1G7QB 3K80A 3RIFK 2N7BA 3VXQA 2VDQH 2FEDC 1W72L 5D1QC 3RWJA 4CL7A 1J05A 3MFGB 2ZSWB 1U3HC 1CDIA 3CX2A 1JN6B 1KTKE 3BD4A 1QKZH 1M7XA 2O61B 1JRHH 1S7SA 2AV1B 2DM4A 1WIOA 4LFHG 5E8OB 3E3QE 3MMEB 3W39A 2Q6WA 5L88L 3DGGB 3FCTA 4P2OA 4XC1H 4YO0B 2HT2C 3ZL4L 2NY0C 4G9DA 4PP2B 1WISA 1NUDA 2YA0A 2CUHA 1HSAB 1FQ9C 2B0SL 1AO7A 3TBVB 2IAMA 4P2RD 4UILL 3O2VH 4FFYH 4Q58C 3P0GB 3WL9B 4JFEE 1X3DA 2H3NA 2J8OA 1S9YB 2LVCA 5DTFB 3D87B 3O6FA 1VKXA 3QUZD 4IS6B 3GSNH 2AK1H 2H2PD 3QEHB 4GMSH 3GMOB 2DRUA 4OLWL 1HH9A 4N8VB 1JPSH 3C09B 1DFBL 1IQDB 1GHFL 4K8RL 1MVUB 4QWWC 5HVHC 1H3WM 4PRHE 1OY3B 4JFOB 3WXVL 2NY1B 1FIGH 1SMAA 3P4NB 2VR4A 3V5KA 1XR9A 1T1ZA 3GMPB 2VLKE 5EUOB 1PY4A 3VW3L 4OCRH 2Z8RA 5IHUH 4ZOBA 5TDPB 1FBIL 3EGSA 4XHJC 5CIPB 2X1WL 1Q9LA 2ED9A 5CJ5A 4YR6B 5CUSL 1EV2E 3UPRA 2WLYA 1FH5H 2YBRB 5FHAH 3P0VL 1LHZA 4LSRH 2O5YH 4YHNA 4ZS6D 4EBQH 3D85A 5TE4L 5EORL 4LL9A 5C6TL 3BP5B 5DK2B 4Y4KD 3HAEG 4HK3J 1HI6B 3C8KA 5EU5A 1EAPA 3BJLA 5D96C 2CKBH 4FZ8L 3BGAA 4H25B 2UWEF 1AY1H 5ICYA 3VD3A 5LG1A 3IFPB 4PRPB 4XXCC 2G75A 3LSOA 3QI9B 3RA7L 1IZJA 2GJ6E 3L3OA 3V5HA 2DLIA 5LGJB 4FXGB 2GIYA 5DUPH 4FNLH 2OTUB 3KXFB 2WQRA 3BP7B 5AEAA 4D9LL 4G9FB 4GXUM 1A6TA 4LNRA 4EUPG 3TCXA 4QRTA 4TSBH 4RZCA 1RUKL 1XIWA 2MKWA 4N90D 2VDNL 3N50A 4XMPH 5SV3A 1S9KC 1RPQA 4KC3B 4EXPX 5MEOA 1ZHBB 3S4SB 1RZIB 4G8IB 2BOBB 2JIXA 1A6WH 3MR9B 3QIBB 2FIKA 4HLZH 4M1GL 8FABB 2ICWB 4H26A 3LS4H 5I8EA 3A67H 4I18A 4P0DA 4RAVB 4LLYB 3MYJA 1NGWB 5E6IC 1FCCA 4N0FA 4K7FB 1U8NB 3EFFA 5EZJB 2F19H 2BY0A 4CVZA 4DOHE 3LQZA 1KIPB 4PUBL 1NGXB 1KCVL 3LZFH 3U2SB 3PHQA 5ACMA 4CN6A 5I74C 3RFZC 1KBGL 4U1NB 3CMGA 5EU6E 5AD0B 2OLDA 4IEFB 5HHOD 1N59B 4MWFB 2HN7B 4WHYG 3VRIA 4F33B 3KPNA 1XF2B 2DI9A 3DX8B 3ISWA 5FA3B 4OLEA 1JFQH 4RIRB 3KPQA 1Q9KB 3B6SA 3ULSA 4ZAKA 3BVNB 5JOFB 4MD4B 2H6PB 4ALAL 3IKCB 3ZKXB 4U6HA 2ITCA 5ID0A 1FZMB 1BBJB 5GS0C 2V9RA 3BN3B 3BKCL 2J8UA 3UX9B 1QBBA 3QCUH 4HDIA 2B4CL 1H8OA 3NFNB 1MCSA 2HJLB 3QUXC 1II4E 1ORQA 2PN5A 4XB8A 5E9DA 4HUMB 4KTYA 1Y6MR 2Z35B 4YFDB 4YHPA 1TCRA 5D7JC 5DVKA 4UNTA 4XHQA 3D9AH 5C0AB 3QDGA 5TGBB 3FTGB 5FYLL 2DM2A 4CRPA 1RQ5A 1T7YA 3MV9A 4L29B 3V0WL 4UV7L 5E1AB 2R2EA 4RX4A 4NO0A 4XC3L 3WXWH 2R2HB 2EYTA 4HFUL 5CD5D 4OLVH 3STZA 1UZ8B 4ZXBA 3GFUA 2AXJA 5FUOH 4HS8H 2AGJH 1CXLA 5GRXG 4WDIB 4NRYB 3R06A 1HQRA 5J9PA 4O4YL 3RDTB 4I4WA 5CJQL 1BEYH 2K7PA 2H9GA 4N8VG 4LHUD 3VXPB 5KOVC 4L8SC 3BPCA 4Y19D 4KK5C 1A6PA 3H3PL 2FHFA 4PBXA 2E7LC 2JJSA 1I9JH 3LD8B 5SWZB 2R56H 4S1DD 3IGAA 5IUSA 4JHBA 2NXYC 2CDFB 1CXIA 2BOCB 5C09A 4F7EA 1EO5A 1T6WA 4EEEA 1KT2B 3GMQB 1IKNC 4HZAA 2CR6A 4JFDB 3MLWL 1S7QB 3GMMB 1S7WA 1QFOA 4YGVB 1U8KB 1YEKL 2ADJB 4PRPE 5BJTA 1V7NH 1WSST 1F6AA 2BXYA 3KXFE 3ZYZA 5C0GB 4HK3N 4G9FE 1LDSA 3VG0L 5HYJB 5F93C 2EXWD 3VA6A 3CJJA 4YXLH 4TULH 5BZDA 3OAUL 5DJ2A 1NGYB 3CUPA 3DHMA 1RJYB 2BRQA 2EO1A 4JM2F 3QDMD 4AJ0A 2CGRH 2YPLD 1ZVYA 3QB7C 4ODSH 3LAFA 4HH9B 2ADFH 4PJ8B 1BLNB 2Z4QB 1WBZA 1KTLA 4UTAL 5DFTA 5DD5H 2YMXL 4CMMB 2I60L 2RCSH 4G6JL 1MFAL 1QEWB 3E6FB 4JG0L 5IQ9B 3B9AA 1FO0B 2FX8L 3D0VB 1WAAE 3FMGH 3V8CA 5CWSA 1OQOA 3K4AA 1UT9A 2KZWA 1UXWB 2VXVH 5HDQH 1ITBB 1UKQA 1KGCD 1YJDL 4PY8J 1KXQE 5KW9L 1EJOH 2AJYH 4I77H 1XF4A 2A2QT 4YK4C 2XN9D 4CAGA 4LCCC 1UM6L 2R8SL 5HHXL 4P9HL 3TC9A 5FGBC 5T33L 5C8JA 4M1DH 1EUUA 2Y07H 3AM8C 3WIHL 3SPVA 2K9UA 3HG1D 1R3HB 1UYWH 1FL6A 5E8DL 3ZDYF 3GJFK 1NFDF 1F11A 1C5DA 1AGBB 3PWVA 4RGOL 4TN9A 3I6KB 5F1KC 3OXRB 4YHZH 1NJ9B 1S3KL 1HILA 2NW3B 2DTML 5IB1A 5GGRY 4IOIA 2VL5B 5IK3A 5GSVB 1HYRC 1YEFL 4NOBA 3TZVD 3ZKMD 1MJJB 2WV3A 3DETC 5IFAH 3OHXB 1FORL 1ZLWK 4HPYL 4OQTL 2W07A 1F90L 4OF3A 6CGTA 1S9VB 2FLBT 4ODUA 2CRMA 4S0SD 3MQIA 3ECBB 2RB8A 1WWCA 1KIUA 2D7OA 4OLUL 3MCKB 1ED3B 2H8PB 1KN4L 2VDPH 3WO4B 3HN3A 4JVPA 1KENL 3HZYB 3SGDH 4QRRA 1OAKL 3FL7A 4FN0A 4O2EB 4YPGB 3FQXA 5CKGA 1BIIB 3FZUD 3DV4B 5SWZE 3VE0B 2FLRT 2HWZH 2D03H 1G7PA 2ZZUT 1U8JA 4GG6B 1DUYB 4V1DA 4OF8A 3AU1A 5BRZD 2PCPB 4IIQB 5E95B 4BZ2L 1FFNB 2DQJL 5I0DA 3EBAA 3MCLL 1QSZA 4UBDD 1KNOA 4JZNA 2BRRH 3L3KB 2DYPB 1A7QL 1G6RB 3RY5A 4ONHB 4NWUL 4XZUB 4HJ0D 4QHUA 2OR9L 1U6AH 4HZLB 5HYJE 2W0FB 3HNVH 3C5ZD 3WKNA 3DRQA 4XPAL 1RUAL 2XWTA 3U6RB 2J12B 3WFZA 1MRCL 15C8H 1J1XL 3LDBC 4OKVA 3L5XL 5K9QI 3NIFE 1RUML 2OZ4L 3BPLB 5H94B 1DN2A 3UJTH 2JCCA 1I1FB 4M6OL 4RA0C 2H1PL 3MREB 4C4KT 1B4RA 4QT5A 4MSWA 2BVTA 4Y4HD 1QBAA 3BKYL 4MZ2A 5DLMH 1F3RB 4JPKH 5HGHA 4B7LA 4QHLB 5E2WL 5I8CB 5D7IF 3GGWA 3QG7L 1IGML 3MRCA 5EZOL 3STLA 5I1AB 1PKQB 3MNWB 4I0KA 4KKBC 5SX5K 5CGMA 2V5TA 1R5VA 4HCRA 4JQXC 3FFCA 3LRSA 4KAQL 3ARGD 2CLRB 4LLQA 3OR6B 2DQDH 4OIAA 2PYEB 1JL8A 1FDLH 3LPFA 2PO6D 1XGTA 2IFFH 4YNYA 5E7FA 2R0WH 4H1LA 4HPOL 5KG9A 3F5WA 4Y16B 3GHEH 1ONQA 3V79C 5EZLB 1OAXL 3MFFA 3KPLA 1EH9A 4PLOB 5K9KB 2NY4B 4QRQB 1OVZA 3UJIH 3W2DH 2ZWLT 2IQ9H 5EUKB 3ULVE 2O5XH 5JOPD 5F3BB 2D3VA 5JPNB 1T5XA 1AR1D 3QHFL 2R1WB 4B53A 4DN3H 2IG2H 4HKXA 4ZODA 5EWIH 3ARFD 3KYKH 1RJCA 1K5NA 1NCUA 3B2UD 3DYMA 2GKIA 3QO1A 3O3BA 2X89D 1U8MB 1BX2B 3RAJL 1HZHL 3ZO0A 3TO2B 1TJHL 3MXVL 4ZNEE 4PJDA 2W91A 4KWUA 3VFWA 3MRIA 4AH2A 4QXUH 1E4XI 1M7DA 2CH8A 4X80H 5F44A 1MHHA 3WHE0 3IDJA 1J87A 3RBSA 1NC4D 3LHPH 4QXWA 1LNUB 4J7RA 2HT3D 3T0WA 2VNCA 4PJCA 2HJKA 5JA9A 1AGDB 4C57C 2IH1B 4NRXB 4K3JH 4GUPB 4YDKH 4TSAL 1F8TL 4MAYB 1B0GB 5GGSB 3VGBA 1CK0L 1HIML 2FO1A 1YPZB 4R6UA 3GUTB 4OKDA 4BSVB 2P5WA 5IW3A 2IPTH 4X98B 2V2WA 1YMHB 3WN5A 4RNRB 4P2RB 3QQ9C 5E5MB 4X9GA 1WZMA 3UAJC 1N0XH 1OARH 4GG6E 1T21B 2ARJA 2AXGB 2OL3H 3F7YA 4Z7WB 5DO2D 5J56B 4M8VA 4XTRD 3SDAD 3CFDB 3A6CH 4Z5RB 3RU8H 4OV5A 4X0KB 5DD1H 4LVHB 4OLZL 4J12A 4F57L 3QYCA 3K4DA 3D18A 3T65A 2X7LA 4NC1E 4HEPG 2VOTA 1HSBA 5TPWL 1K2DB 3ZHKA 1S7TA 3TO4A 3BFOA 4H20H 4WIQA 2JELL 4A6YL 4D0CA 1ZKAA 3OGCA 3UJJL 3V0VA 2BVYA 2QQNL 2JJUA 1ZGLA 1WEJL 1T20B 2FRGP 5EUOF 3RVXC 5KS9B 4PY7A 2CLVB 3JZ7A 2PR4H 3IYLW 4LVEA 2ZPKL 4Z77B 1NCAL 1DANT 3MJ7A 1F4YL 4RDQG 3MNZA 5IBLC 3OJMB 5I18L 1YQ2A 3W9DB 1R0AH 2QADB 2OBGA 1MCWM 1E4WL 4LSSH 2I9LB 4G8GA 5HYFA 1P7QA 1RZ7H 1MEXL 3E6HB 1EAJA 5EC1B 1K3ZA 1FPTL 3K46A 5GS0L 1PKQE 3SY0B 4G7YL 3NCEB 1ZA3B 1QRKA 1ZLVH 4KK6C 4RBPH 2FEEI 4LLWA 2PYEE 1S5IH 4IRJA 1UVQA 1SMOA 3BUYA 4CJ0A 4X6DE 5F1NB 1HH6A 1Y6KR 1RZKC 2FBJL 3DV6A 3HI5L 4UUJA 2UVFA 3RWIB 2QQLH 2XY2A 3NBNA 1GVIA 2I27N 5HHQB 5TF1L 4YQXL 5DJ0B 5KAQF 2VQ1A 4FZEL 5FDWA 1NCCH 3PWUB 4GRLA 4PD4K 4U6TA 4W6WB 4XBGA 1EJ6A 4WFFD 3SO3C 3X12A 1JK8A 4AEHH 1QA9B 3QPXL 3HE6D 2N56A 3CDGA 1M7IA 1RK1A 2NW2B 3C6SA 4NO5B 1NUNB 3K81A 1K4DA 2NY6D 5TQ2L 1NAMB 5F7HA 2PKDA 3TIEA 5HHOB 4J1UB 4NM4H 3T04D 4CNIB 1MCDA 1XCTA 3HNTL 2YRLA 4H88H 1CLCA 3WKMH 2ZKHH 2EDQA 3OKLB 3RL1B 3IJHA 5JHDA 5ALBH 4LAQL 4IDJL 1S7UA 4HIXL 1YPZE 1PKOA 2XYCA 1Q1JL 1T22B 3VFMB 1ZOXA 3ZTJG 3RNKA 1CXFA 4UT7L 2HFEA 4O5LH 3BMWA 1NGZB 4TPRL 2WIIA 3CNKA 4P2RE 1HHHB 4DCQA 3VD4A 5FO8A 3WNKA 3V52H 2NTFB 4NKOA 1S5HA 4Z7WE 2WANA 4XAWH 1TPXB 1CF8L 4NQVA 5HHPB 1F3JA 3LN5B 3TNMB 3TT1L 2X41A 4P23A 2EKSB 2HVKB 2Q8AH 3BP4A 5ITBH 2X1PA 2VE6A 5B8CB 5DFWH 1FFOA 5GRYA 3WFDL 5F21B 3PDOA 5DMKB 3IAPA 3QIUD 4POZC 5B39A 4UB0H 3IXTB 4JM2C 4WHCA 4BH7A 4WFHE 4F15B 3FQWB 4XVSL 4XVTH 5EU4A 5KS9E 3IAGC 1QRND 4G5ZH 4LHUB 1U58A 3W9EA 5IMKB 1KB5A 4Y19B 4LBEA 5D7SL 4JRXA 4IRSC 4ODWB 3VGHA 4MXQD 3VXME 5J6GB 1MCOL 1SYSA 4KGJA 1RHHB 4R3SA 1DANU 2VSCA 2KQMA 3IETB 1KJ2L 3MLRH 3BQUD 5DD0L 1RSFA 1T1WB 1QSFA 1J9CT 3X13B 2EE6A 3W82A 2GFBB 4LLUA 2NZ9C 4WI7A 2FL5B 3BDYH 3CXDH 3AY4A 3UBXG 1BOYA 2YUWA 2IMNA 3EYUH 4PD4J 3GMRA 2PXYA 1RZFL 3BH8B 1MJ7L 4BA8A 1UA6L 3GIZL 4Z7UA 2OR7A 3DURB 1G0DA 5JQHC 3QDMB 1CE6B 1D6EB 5C3LD 2XWJB 2YPLB 5JHLL 1OF2A 5BOPA 1NC2A 4GKSA 2QKIB 1BQUA 1JWSA 1VADA 1ZT7B 1UM5H 3W11C 4E42B 1IGIL 1H9VA 1T7XA 4HQQH 4M48L 5LWYL 4PY8I 25C8L 3MBEC 5K9JH 3GKWL 3NIFF 1FV1B 4R4BA 5H35B 1RU9H 3HR5B 3C87A 2E9IA 1C5CH 3TJHC 3PQYA 1JJUA 1VEMA 1XGPA 2D7QA 5F7NC 5HHOE 5TDNB 3W5MA 4W6XB 5INDA 5ILTH 4WCYH 5E5RB 3MRPA 3D3VE 1ZGLP 1I8IB 3UCRA 1J1OH 2XKUA 3GK8L 5IESH 2CO7B 4JAMB 3QO0B 2XN9B 4MA7L 4U7KA 4Y4FD 1UWGH 5FO9A 5CBAB 2GCYB 3GI8H 4J2XA 1RZGA 3T1FA 4NO2A 1TVBA 5IVOA 1JCKA 3P73A 3HG1B 5DRXA 5D2LA 1A1MA 5ADPH 1DEEB 3S35X 3V2AR 1IEAB 1CICD 4OTXL 3L3HA 4X5LA 3E3QC 3RVVD 3WNLA 4HFWA 4Q9CA 4YDIH 2DQFB 5DSCA 3MLSL 4PJAA 1NLDH 4K7PL 1FFPA 4CADB 5HD8D 5C0FA 2A74B 5D7KD 4MA1C 3ULVF 3EYFB 1JMXA 4LAJH 3RTQD 1F58H 2CK0L 1WT5A 4YHOL 3RGVC 1Q9WB 4NGHL 3X14A 2X09A 2N7AA 3TZVB 1OTSC 5HHMD 2F5BH 1NFIB 1T89C 1CFQB 1OM3L 4UV4H 2PW2A 1IILE 3OJDA 4KK9D 5BV7H 3T3PE 2YHGA 3EJZC 3BZ4B 4P5MB 1CTNA 4XWGL 3B9KA 4EQ3A 4X5XA 3PDGA 3FONB 2EIZA 1A14L 2APVA 2FDBP 5ESQB 4MJ6A 2BCKA 4Y19E 5EBMA 3HLAB 4HCRH 1XT5A 5JXED 1DQJA 5J57B 4DFIA 3FN0L 2L7JA 3CDFA 5ADOL 1NCWL 5EBWB 4M02A 3GSQA 4Y1AD 1A47A 4FQQB 4X6FA 9CGTA 5HI4C 5BRZB 5IV2B 5MERA 2CR3A 5E8NB 2NY5H 4Q6IA 1JHTB 2FO4B 1B9ZA 3VWJA 5FCUL 3SDXA 3LN4A 1JPFA 3C08L 4GG6F 1ZANL 3D2UB 2F54D 4X8XA 5B3JE 3CDCA 4NWTH 3OKNA 1BF8A 1H0DA 3PGFH 3MGOA 4GFTB 1FJ1A 1IT9H 1S7VA 3C5ZB 3ES6A 4CMHC 1DLFL 3K2UH 5AG8A 1N8ZA 4NNPL 1MIEL 3QDME 4HWZB 2XFXA 5FUZH 2YPLE 3LQAH 3JBG7 3I50H 4Y2DA 4G42A 4FQIH 5KSAD 4LSUL 5C07D 3RI5F 1QSVA 1KIRB 2DQIL 4NFCA 3QZWG 4NQXA 5A16B 5DEFA 4ZUVA 4MD0B 3JXAA 4Q0XH 2RJMA 4LSTH 1MH5B 4QLRA 2N1KA 1Q0YH 3NACH 5C0NC 4JKMA 4P49A 3G04B 4DKFL 2I9TB 4HIEA 1KCUL 2KBGA 2NNAA 1FAIH 3CCHB 3QEGL 3TFKC 5J1TC 4QXGH 4TNVK 3DYPA 3PGCB 2AXFA 2K1MA 1DE4B 3ARGB 3MJ8A 4R90H 4J4PA 4U1KB 1AXIB 1JNNH 4JJ5B 4GSDL 3CZJA 4M4RA 2VXUL 1LK3H 4JQIH 3WJJC 3CLEH 3O8XA 5DJZB 4F2MB 4HLJA 4KJQC 3P0YL 5I1CH 4WI3A 5GS2D 3B9EA 2XPGA 2EDXA 2XOTA 3V4PH 2L7UA 2DD8L 4JO4H 3QWRA 5FYLD 1CD8A 3PJSB 4BFIB 5MENA 2ZJSH 1V3MA 5TE6H 2P44B 3P9WB 2Y7QA 4P57B 3QIWD 4GLRI 3RZWA 4FQCL 5CGTA 1AP2B 3SDDD 3ARFB 2EH7L 3FRPA 5BZWB 2VC2L 2X4RB 4N0YH 2YR3A 3AMLA 4DTGH 5DRZA 4XGZB 3MO1B 3SGJA 1DEDA 5ESAB 1J86A 1P4LA 4LSVH 1V8HA 4TVPE 4EN3C 1XAUA 3ARDC 1MPAH 2FECL 4Z76B 3IFNL 2B39A 3C09C 3QPQD 3MOBL 3BX7C 3N06B 3FFDB 3QNXA 1KLUA 1YN7A 1NC4B 1KULA 3QXUA 1MHPH 2GJJA 1TVDA 2OJEB 3W81A 1DQMH 3KYOA 5DZOA 5DMJB 3X3GH 5J8OA 2NY1C 5DC0A 1EHAA 5L9DH 3NIGE 3SE4C 4KTEH 3MRMB 3WDHA 2ZOLA 4WHTB 2V2XB 5GRUL 3SKJH 4MX7B 3MRJB 1X9QA 2R1XB 2Z8WC 4GS7B 4RMWA 4I9WE 2SEBB 4YHLH 5DFVD 1HN1A 1YPZF 1A22B 5CZVH 1RZKL 4PJXA 3C60A 1G7MB 2XIDA 5BRZE 2CD0A 4JG1H 4UT6L 2DQUL 3SDAB 1NL0H 1ZA6A 1NFKA 1IEBA 2P8MB 4YEEA 3BXNA 4F8QA 1OAYH 2P5EA 2IH3B 4RA3A 4RFNB 3RJDA 4Z7WF 5T3XL 1BZ7A 2HA1A 5E56A 1EEZB 2HT4C 1FVCB 3KHQA 1FVDB 5JLZA 3QI9C 1MY5A 4NOFA 1H5BC 1RULL 4J6RL 2GSGA 4QNPF 4X83A 4JZOB 1VGKA 4I2XA 1QFUH 1GC1C 4JFHE 5BW7C 1JNHA 3RWDB 2XNAB 4MA8L 1QZ1A 2FGZA 3TIDA 1TZIA 2DKSA 5E4EB 3RPIB 1BAFH 4L9LB 4OD2B 2WNGA 1HHIA 1T6VN 5KS9F 2AI0H 5D7LD 2CRZA 4QRPA 5IW6B 1CS6A 1AD9A 4HUKB 2YD6A 1N6QH 1VACA 2P47B 4G43B 4CVXB 1LO3L 4UT9H 5KJRH 1MJ8H 1MQKH 5KANG 5E2JA 2VQTA 3KLAA 4YLQT 2MPAH 5ERWB 2W0LA 1YNTA 3NH7L 2VDKH 1NDGB 4LRIC 5EIVA 4NO3A 3DX6A 1VFAA 4O51A 1NQBA 2R0KH 1RURH 4UDTB 4YZFF 4YHKL 3B3IB 4LF3B 2LTQB 3HUJB 1EFXA 5IT2H 3HE7B 1OP5K 3VD7A 2XA3A 5E9DD 3QSKB 2AERT 4HWEL 4ZFZA 1P53A 1TETH 3GKZA 3VMPA 4YDLC 4DFHA 1U95B 1KEML 1TVHA 3NFPB 4LCWD 4ISVB 5DMIH 5E8PB 3MV9D 3ZKXC 2VAJA 5I1IL 3N1MC 5GGUA 1MFDH 3RRQA 3HE6B 1BZ9B 1I85A 1AD0B 5D72L 1NCDL 1A7OH 4NZTH 4UQ2B 1LP9B 2LVEA 3KPSA 4XNYH 4J23A 2NY6B 2D4DA 5HYSA 1HQ4A 5F9OL 2DOCA 3EO9L 1CFSB 5SWQA 3PP4H 1JF6A 1QD0A 4EUPA 4PGDB 4Z0XA 1KB5H 4XPBL 2FHBA 1ACYH 1W8NA 3S3SA 1OAUL 2ZCKL 4MJIE 1X4ZA 5DQJA 5FKPA 2WBWB 3HMWL 4IRZH 5T3ZL 1R3JB 3O6MH 4MJ5B 3VJ6B 5E2UL 4X9IA 1T7WA 3VFSB 3S3PA 5BXFB 4LPVA 3U4BL 1RZJH 3GRWA 4JPVH 1WCBB 1OLLA 1PEZA 2BNRB 3ZYJA 1DLHB 4N0UB 2WZPD 5J7CC 3PNWA 1PYWA 4DGVH 1YYMH 3SE3A 4PJEA 1QYGH 43C9A 3LD8C 4M7ZB 4D8PB 2FIRT 1CDJA 3QXAA 3GJFH 3OAYH 4E0RA 5T1LB 4BQ9A 3KS0H 5DUBB 1JWUB 1Z5LA 4JHWL 2FEDD 4TUKH 5D1QD 5E99L 3MRDA 1YEHH 3QULB 3EOYG 4ZOEA 2YUZA 2MCG1 5CLTA 4ZS7H 5C9JB 3HMXA 1LMKA 1FZOA 3P4MB 3QIUB 2B1HL 2VAAA 3I02B 1UADC 4ZQKB 3DI2B 1HKFA 4NM8H 1S9WB 5HYQA 4OZFA 2HT2D 3IDYB 5ICZA 2NY0D 5B3NA 4WFGD 3PWPD 4H5SB 4UU9A 4WUUA 1QRNB 1CLOH 5JUEH 3L3JA 1JGUL 4ETYA 1B90A 3G9VA 1SEBA 3UZQA 2FATH 2X2YA 3WUWG 3H9HA 2APBA 4XP9H 2JJTC 2LFGA 2MTPA 4P3DA 4PJ8C 1P1ZA 4FQLH 2R29L 3TYGL 3KPPA 4FFVC 2BC4B 3L5IA 5CS7A 5IVZB 4HWBL 3BQUB 4PJGB 3NAAH 4ZPTA 1EA9C 4AEIH 2C3HA 1Q72H 4KY1L 1G9EA 3UTZA 3TF7C 4PJBB 1GIGH 2J4WH 3CH1A 3U0TB 3OKOB 5DMGD 1FZJB 1H15B 1YUHB 4XHJD 2OK0L 1FG9C 1V7ML 4BH8B 2RFXA 3HUJE 4TYUA 5EA0H 1CFVL 4JQVC 3O0RL 4X4YB 5HPMA 2Y5TB 5SV4A 1FHGA 3HZKA 1QFWL 4TTGA 1E28B 1PG7H 5IF0A 2EKJA 1W72B 4G6AC 4WFFE 3N85L 3ULVC 3TBWA 5IQ7L 4JE4B 1JPTH 4Y88A 4FQXA 3LRHA 4PS4H 3I3BA 5KSBB 2FSEB 5HHVL 3IU4H 5JDSA 4MCZA 1N0LA 4XNMB 2PYFB 1URLA 2G2RA 2V17H 1LP9E 2FNBA 3T2NL 3MXWL 4AENA 2HLAA 2PTVA 2F74B 5FIEA 4RRPA 1B2WL 2OI9B 3U7YH 1P6AB 5EC2B 2YK1L 3O9WA 3AREC 5GS1A 3O3UN 1HHJA 3NCJH 4NUGH 4E41A 3REVA 1OTUD 2F9BT 3M1BA 4Y4FB 2YD7A 4HH8A 4HLZG 4LPWA 5EO0A 4IOSD 5CBEB 1X5KA 1KPVB 4PJHE 1U3HA 3F62A 1AKJD 3NZ8A 3RZCA 4X6BB 4LLMB 4ZG1A 1QO3A 3H3KA 3LEXB 1CICB 2YPKB 4M43H 5TDOA 2FX7L 5E6ID 3WO4C 5AWNL 2BNRE 2CUIA 4N0UE 4XP6L 5FM4A 3ZL4H 1AI1H 3DXAE 3MJ9L 4JLRB 3U4EA 4NZRL 1ULVA 1CFTB 2A6IB 3G6AA 3RTQB 2LE9A 4N1HB 1YQVL 4FTVD 2B0SH 3ME0A 4WGWB 1X5AA 3BKMH 1BF2A 4U1LA 3G08B 3UTSA 1HNFA 4MJ2A 3WJLC 4OFDA 5HHMB 4FA8A 4OLWH 5F7LB 1IM9A 3FB6B 1DDHA 1DFBH 1GHFH 1Y6NR 4K8RH 5T1MB 4AY0A 2XZCL 2WMPA 3MV11 1DQLL 3KYNB 3S37H 2VXTL 3ARUA 4PJ5A 4NC1C 1UH3A 4KJPD 1K4CA 4FQHA 4I48A 4W81A 1QRNE 5GHWL 2G5RA 2GK0A 3VXSE 4LNVA 3O4LD 4JVUA 4DAGH 3SEPA 3OKKA 2ESVA 3DX9B 1DQDL 1N4XL 5GISH 4CDHA 2ADIA 4Y1AB 2YSSA 3P0VH 4JHAL 4HGMA 1YEIL 2UZIH 4ZFOA 5CSBA 4HC1A 5EORH 5KN5A 3ARPA 4D94A 5C6TH 5H2BA 1N3NB 3LMJL 1NAKL 4AG4H 1HHKB 2F54B 3SO5A 4PJBE 1T2QH 5DJAB 1LGVA 5JA8B 3L1OL 1TZGH 1U92A 2IFGA 1D6VH 3O45A 1XF5A 1SJEB 2W59A 2EEBA 4HKJA 3QUKA 1U8OB 3B43A 4Y16C 4KK5D 3BRDA 1I8KA 1P69B 4JGJA 1HNGA 2D7TH 5EU7E 5C0JA 5KSAB 4PV8A 4OUUB 5C07B 3TJEL 2NY4C 1FE8L 2NXYD 5EOTA 1NH6A 3IFOB 4U6VH 2Q1EA 3AFLA 3RWCB 1EPFA 4G8EA 5DC4B 3T0EA 3VXQB 1BBDH 2FB4L 1J05B 4BYHA 1A3RL 3NN8A 1WWWX 2L4OA 3MLTA 3VFPB 2EIDA 2BNQA 4PGBA 1I7TB 2XACC 1JNLL 4LLAA 4QTHA 5K59E 4X6EA 5J3HC 2VDML 2A73B 2Q6WB 2C4XA 3CPLA 3CFJA 3QFJD 3R4DA 3WFBL 4HUXA 4P2OB 3FO9B 4PUBH 3BZFA 2I25N 3OL2A 1OGAD 4DGIH 2NLJB 1TNNA 4BQ6A 3M8OH 2BHZA 2OYPA 3V5DA 2VH5H 1XCQB 2BFVL 4CW1B 1H3UA 3O6FB 5HYEA 2YUXA 3QXDA 3TH4T 4KHTL 1OW0A 3LOWA 4MAYC 2OX5A 5EN2B 3IDXL 5HY9B 2VLJE 1EVUA 1X6NA 2DLFH 2GY7B 3CZFB 1Z2KA 3SDDB 1VHPA 3V5KB 4QHNA 5D7KE 1XR9B 2YEZA 4ALAH 4PGEA 4U6XA 1LO5A 4Z7NE 2AJUL 1GC1L 3OWEA 1GZPA 4PG9A 1C16B 4KVNL 3BKCH 2WUCH 4M61A 4P5TD 2H2PC 2VIRB 4P2QA 2Q3ZA 3H7LA 1CVSC 4X99B 4ZFGH 5HHME 1MF2L 3A6BL 4LVHC 5KBNC 1OP9A 3B4NA 3LIZL 3S34H 2OJZL 5BVJB 4YHNB 5D1XA 4NJAH 3TBSA 1FVEA 2ZUXA 3NCYS 4DGYH 2R23A 1T03L 4XC3H 3EFDL 5A3IC 1G7HA 4HFUH 1A7NL 1DVFD 5EU5B 2DL9A 1IM3A 3BPNB 2X4PB 4ONGL 5IOPB 4GRWB 1R3IL 2ID5A 2G75B 3LSOB 2NY7L 3GB7B 2X4UA 3PHOB 3RWGA 1I9IL 2APTA 4NQDD 3KR3H 1A6TB 4JANB 3OF6A 2JB6B 3QUYD 4PJFA 2QADC 4NCC2 5F7MC 1QSED 1UM4L 4C56D 5IBUB 4RZCB 4WV1A 4OM1L 3DETD 3WEXA 1A3LH 3HNSL 3M17A 2F54E 4G7VL 4NZJA 4LARL 3MLWH 1PFCA 4Q2ZA 5F9JB 1YEKH 4DK3A 1I3VA 2YKLL 4H26B 3EOTL 4OZHA 5AZEL 5I8EB 1NANI 4I18B 1MI5A 3RUGE 3MYJB 3P4OB 3LB6C 1MWAL 5FXCH 5HJ3A 1FL5A 4R9HA 3EFFB 4CVZB 3LKNB 5KTEH 1FFRA 4ZD3L 1G9MH 3LQZB 1K8IB 2P24B 2R15A 4D9RE 1AGCA 5DR5H 5EIIA 2YS4A 1OHQA 4F3FA 2F58H 3O2DA 4TSCL 1UB5A 2EDJA 4F9LC 2RR3A 1IFHL 3QWOB 4XCEA 4EOWH 5I6XB 2EECA 5CP3A 3THML 3IVKB 5F9AC 1JWMA 4ZUUA 3SOBL 1HINL 3BIKA 1AXSA 3B6SB 2I26N 2I60H 4LASH 3U4AA 4G6JH 1MFAH 1U8LB 4M9PA 2VLLB 3GMLA 4NKIL 2FX8H 2ITCB 3C6LA 1O0VA 3GRWH 2APWA 4MAUL 5D1ZC 2VZTA 3VFUA 2VLRD 3FT3B 3VRJB 2G5BB 4OIIL 4FABL 1YJDH 2IBZY 4XCYA 5E9DB 5FGBA 4HKZA 4YHPB 1TCRB 1B6DA 1PGRB 2C1PB 5DD6A 1UM6H 2P7TB 3A0OA 5HHXH 2R8SH 2MSPA 3HUJF 3FO0L 3MV9B 4OF5A 4ENED 5IMOB 2R2EB 3HMXH 4WW1B 3PHSA 3RL2A 2HLFC 2EYTB 4PTTA 4UINH 3V4UL 2KUTA 4KKBD 4JFZH 4OZFH 1BMGA 4HD9A 3MNVA 2WM0A 4OCYL 4RGOH 1HQRB 2VABA 1QBMH 5J9PB 1U8HB 4OGZA 2ENYA 1TPXC 4MD5A 2H9GB 1N5AB 3TT3L 5F6IB 1LP9F 1IZKA 2EDKA 1BJ1H 4IMKA 1EK3A 4P59L 1JHLH 4OZ4B 3V6OA 3IGAB 1YEFH 5C92A 4F7EB 1FO0L 1YEGL 5KSVB 3D48R 2AJVH 3RX7A 3VFOA 2VYRE 3MC0A 1FORH 1N2RA 1E6OH 4HPYH 2AJZB 4F15C 1F90H 4JPWL 4LPCA 3MROA 4G3YL 1XR8A 4GRWE 3CFBB 1I8LA 4LEOA 3HHRB 5BJTB 3IS1X 3S36H 2IPUG 4OLUH 1F6AB 1YA5A 1UCTA 3LS5L 1KN4H 1J7VR 4YHMH 4RAHA 2LABA 2V2TA 2VB5A 5T5NF 2YOCA 3IF1A 1OAKH 1GRWA 1UXSB 5TF0A 2HJFA 1A6ZA 4MXVE 4NQSB 5DJ2B 3V6ZB 2R4SH 1BFOA 5D1QB 5I16A 1TJGL 5MEQA 3ULVL 3MLYL 3DARA 1CI5A 3DUSA 4BZ2H 4MZ3A 5EFIA 1MCKA 5BS0A 1CDBA 4L4VD 3S88L 1OAQL 1D9KA 1A7QH 2NY0B 3U0PB 3PWPB 3V6BR 3WFCL 3DTXB 3EOBB 2OR9H 3L7EB 3KPMB 1WTGT 3QQ9D 4JM4L 4P46A 4XPAH 1RUAH 2Y72A 4HWNA 1P6FA 3UAJD 4HIHB 3GSRA 4HV8A 5KSUA 4EI5A 4XVUC 3NA9H 1J1XH 3JVGA 4G8FA 2OXHA 5HVHB 4BK4A 3L5XH 2D7PA 4GW5B 4APQD 2QR0A 3CVHA 4WW2A 1ZTXH 1NUGA 3CFEA 3WUZA 4KXZI 2DM3A 2G60H 4NCDA 3SPVB 5DQ9B 2HMIC 4YUEH 3SKNA 1IGMH 4LOUC 4PJGF 5EZOH 5J13C 3CFKA 4HIJA 1C5DB 1MCPL 2J8UE 5E00A 4JKWA 1JGDB 4KAQH 5FYJD 3RVXD 3BSZH 4MNHA 4PJBF 4OF0A 5E9DE 1JGEA 1D5ZA 2WINA 3QDGE 2ERJB 3L5JA 4PV9A 2QSVA 1QLFB 3TBTA 5IBLD 5ITFA 1G6RL 3MV9E 5IK3B 1OAXH 3AS0A 2GSIB 1U8QA 3ZYIA 5D96B 1T4KB 1BP3B 3FOMA 1F6LL 4NN7C 1QLRB 4WO4C 5HVWA 2Y5EA 4OLYL 5I75B 4JFPB 3QHFH 6FABH 2A1WL 4KK6D 4OCXH 3SKMB 1OSZB 3S35L 1QFPA 3FQUA 1MLCA 2APXA 5KSBF 3JTTA 1OT2A 3MRGA 3O3EB 3U0WH 3RAJH 1HZHH 4EVNB 1VFUA 4ORGA 1IAIL 4UOW0 1H3VA 1VEOA 4ERSL 1TJHH 1JE6A 3MXVH 3TZVC 2WIMA 4LQ1A 1FN4A 5M95B 2AJ3A 5SWSD 3MGTB 3BEWB 1UJ3A 5JOEA 5K59F 2FR4A 5DD3L 5FAAA 5C09E 4AK1A 1AKJB 3EZJB 1G7PB 4ODVH 1U8JB 1IMHC 3GBNL 3QDJD 1NANH 2W65A 1ZWIA 1F8TH 4PGZA 3MV7A 4ZSOA 4OV6F 1CK0H 2W0KA 4PRDB 2GUOA 4F7CA 5JMOC 4GO6B 4QHUB 3FZUC 2BERA 4A6YB 2DL2A 2YXMA 2UWEA 3NZHH 3U9UB 2WP3O 1MCIA 2FJGA 1BGXL 2XZZA 4LDLB 4Z7NF 2CXKA 4GQ9L 5JR1H 4UBDC 4KJYA 4OZGB 4S10A 4ZUSB 2X9WA 3CMOH 1ADQL 1N26A 4L4JA 5FKAA 1IGTA 5DS8A 4HJ0C 4OLZH 3AUVA 1I7UA 1QLEL 3C5ZC 5BV7B 1J1PL 4QT5B 3I9GH 2QJDA 1GGIL 3KJ6H 3O41A 2NX5A 1BQHA 1ORSA 4WY7L 3O4LB 5TPWH 4JPIB 3MRCB 3STLB 1CG9B 2JELH 5LGHL 3QJFA 2PETA 4X7EC 7FABH 3UJJH 2NZIA 3LRSB 4U7MA 2QQNH 4J4PD 3CVIH 1GGBH 4ZPVA 1WEJH 4Q9RH 4CDGC 5EO1B 3QH3A 1JI1A 3L3DA 3QEQD 1YYLL 4OZIB 1RZ8B 4OD3L 4OAWA 3WLBA 2ZPKH 1EEYA 4H1LB 3F5WB 3QG6A 5F7DB 1F4YH 3SBWA 1HDMA 5CJOL 2W1NA 3MFFB 3KPLB 5F6HJ 1E4WH 4R26L 2BJML 3MV8A 4NZDA 4POZD 3S3JA 1Q38A 5BMFL 1EFQA 4L3CB 1MEXH 3ZTNL 3H42L 5GS0H 2D7MA 2VLMD 3ARGC 4JFYB 4JFQA 4K3EL 2VRAA 4MNQA 3HB3C 1C12A 4G7YH 1YMMD 4R97B 1R24A 1HKLL 4HKXB 4K7PY 4BELD 3EZ8A 5JIIA 2GTZA 3BH9A 4IRSD 4PJDB 2NXYB 5IB2A 3VXOA 4UQ3A 3MRIB 4AH2B 2FBJH 1M7DB 4GW1B 1MHHB 3BT2L 4U1MB 4MQ7A 5F3HA 1PX4A 4NQCD 1DBAL 5MEPA 3BE1L 5IFJA 2NZ9D 3ARFC 1T0NB 1UC6A 2C3GA 3ARTA 2A77H 1CT8A 5EOQL 4MA3A 3VXNB 2HVJB 4O00A 5L8JB 3Q6FA 1CTOA 5DK3A 3QFJB 3RY6C 2DLGA 3Q3GA 4PJ9A 3QCVL 1OGAB 1ZSDA 1G7IA 1I7ZA 4PLNC 4MHHI 3FO1A 3QCTL 2R4RL 2HT3C 3DMMA 3QEUA 3HNTH 1FRGH 4V1DE 1MNUH 3DO7A 3FHAA 2JKXA 2ZG1A 5FK9A 4HS3A 4JFXB 3OPZL 5E2VH 3RBGA 1FGNL 4OV5B 4Q7DA 3L5WA 3DUUA 3QQ4B 1AE6L 3CFCL 4LAQH 2ZOKB 1OP5H 3X3FH 5D9SA 5FHBL 1G1YA 5INCB 1Q1JH 3TJHD 4LFHD 1WBYA 4YBQD 4GS7C 3T65B 4UT7H 4XP4H 1QVOB 2BVPA 1S7TB 4TPRH 4P5TB 3TO4B 3UXFA 3BMVA 2J6EL 3IAQA 1BZQK 3B2VL 5JORA 5DO2C 3V0VB 4XTRC 3Q6GH 4Q9QL 3CLFL 2R39A 4YK4B 4LCCB 4BSWA 3PL6C 5I76A 4PREA 4FXLA 2D0FA 1MLBB 1JZ2A 1NBYA 2VXSH 4RFNC 3X17A 3TT1H 1CCZA 2JCCE 1FL3B 5CP3H 2R1YB 1IGFH 2IGFL 1KJ2B 3REWA 1EXUB 1DVFB 5IVXA 2IADA 1P7QB 4XI5D 3O6KL 2XZAH 2ORBL 2EIEA 5IWLC 5E4IA 2C5DC 3FFCE 3MRKA 1XZ0A 4JFED 4LLWB 5DWUL 43CAB 3LV3A 1OGTB 2DMKA 4NQDB 1F3DJ 5E4EC 3RGVD 2Y9RT 4KZDH 2X4TB 3AVEA 1UVQB 4GRWF 3BUYB 1I1AD 3QUYB 1QSEB 1LD9A 1WVZA 4C56B 5AYUL 3VXRA 2Q20A 1OTSD 1I3GL 2FECI 3ZKSD 1MCOH 1OTTC 3MLZL 4JY4A 4PRHD 3SE9L 1AJ7H 4YAQA 5I1HL 3WS6A 1NCBL 5I1KL 4CU7A 1KEGL 3EJZD 4MXVF 3U7WL 2VLKD 5AAMA 1J0ZA 5FDWB 1N64L 4KDWA 4GRLB 1FNGB 4LSPL 4PTUA 4XBGB 3X12B 1T2JA 1NLBH 3T4YB 1U8PA 1EEUA 5B38B 4KQ4H 4MDJA 3CDGB 4NQEA 1CIUA 4LDEB 3HE7C 4HUUA 4PJDE 1K4DB 1NFDA 1UA6H 3GIZH 4RAUA 3D69A 1F2QA 5CSGA 3EDEA 5JPMA 4D0DB 3FB8B 3FQNA 3QFDB 5HI4D 4DZ8A 3H0TB 3FB7A 2DAVA 4MCYA 5JHLH 2AEIT 4P3CL 4Y2OA 1BHGA 3H9ZA 4U1IB 1TIUA 3MBEA 1V5JA 1TITA 4PJCE 1J0YA 3ARQA 3R1GH 4RMRA 2UUDH 1KPUB 4M48H 1L7TL 5LWYH 3IJHB 3UO1H 1LDPL 1ZS8B 3OAZK 2XTLA 3GSWB 1A4JA 3DBXB 4QGYA 2J2ZA 2GJ6D 4CBPA 3G6DL 4LU5L 4XMLL 1B4JL 5E03A 1Z0MA 2VLRB 1DQQA 2WIIB 1DCLA 1UWEH 2Z31D 4DCQB 1UB6B 1A0QL 4LSQH 3LDBB 5FFLA 2GY5A 1YNKL 2ZG3A 3GK8H 3LKPA 3DROB 5JW5B 4Z78A 4MA7H 1UH2A 4DUXA 5DVMA 1AGFB 5FECA 2YUVA 3PE9A 5C0ND 1MHCB 3BP4B 1SJVA 2E6QA 1S7RA 1U91B 5EDXA 3EO0B 4FMFA 4RMTA 3VXTA 2B7DT 3MA7A 3Q1SL 4KDTC 1P4BL 3MLSH 4BH7B 4YIQA 4M7ZC 5EU6D 4NUJA 4S2SA 4WUUD 5EU4B 1F4AA 3W9EB 1N5YL 4LKCA 4W4OA 3HC4L 2IANA 1I8MA 4LBEB 4JRXB 4NGHH 4E9LA 1EEQA 4HXAH 12E8L 1BVKA 4QF1A 1X5LA 3CVHH 1SYSB 4R3SB 4F37F 2BVOA 3C5JA 4I13B 1JZ4A 3HRZB 4R2GD 4IMLA 3IDYC 1OM3H 1I3RB 4MYWB 5GGVL 4ZUTB 3SGEH 3CD4A 3CXHK 1U2CA 2BVQB 2EDYA 1A14H 3VCLB 4LLDA 4NQDE 2NXZD 2X1QA 4MXQC 4EN3D 5JW3L 3ARDD 5D7IA 3H7BB 4TUOA 4RISH 3ROLA 1HCFX 5GSRA 3UROR 1NCWH 3BI9X 5LVEA 2W9EL 1OF2B 2YZ8A 5DYOA 4FHBD 5CEXA 4Z7QE 4GKSB 2IBZX 3NTCL 3INUH 1MAML 1VADB 2VISB 1DBJL 5ETUA 2E27L 2C3WA 3T8XA 1SBBA 4HKBA 2W60A 4L4VB 4DKAA 3C08H 1CBVL 1ZANH 3I75A 5I8OH 4ZDHA 4FQXD 5HGDB 3ROOA 5EO9A 4TVPL 1L6ZA 4OFYD 1J8HA 1X4YA 1XGPB 1DLFH 1D7FA 1FGVL 1MIEH 2W0PA 5EU7C 5INDB 4OCWL 1INDL 5GQBA 5I2IB 1KCLA 5C08D 4KUCD 4APQB 1MFCH 3RI5K 3S5LB 4LSUH 3LVEA 4YXHH 1JGLH 5JXAL 3T1FB 5JHDE 4NO2B 3VH8A 4GAYA 4GG8B 1LEKB 3QI9D 1ZHNA 4UDUB 4JY6A 1T1XA 3RY4A 3L3HB 4DKFH 3KXFD 3NFSH 1NGPL 1QTYT 2DTSA 1CFNA 1YECL 1DBKH 3D39A 4HFWB 4X9HA 3T4AB 3W0WA 5IMMA 3UYOD 4ZO9A 1AQKL 5C0FB 4ONFL 2XY1A 3SE8L 1HE7A 3WUWA 3QA3A 3ZHLA 3ELAT 3ARBC 3C2AL 2Y36L 3P77B 3UTSD 2DD8H 4L3AA 5E8OA 1A7BA 3L3GB 2CMRL 1AIFA 4Z95L 4IDLA 3B5GA 4WUKH 1B3JA 1HSAA 5HD8C 2PW2B 3OJDB 1TNMA 3LEYL 4OSUH 3WL9A 5HPOA 3BDXA 4J3SA 2A9NL 4PJ5D 3CK0L 4N1EA 5DTFA 2EH7H 3RTQC 3VDCA 4YBLC 2VC2H 4IS6A 1OT1A 3QEHA 4U05A 5I17A 1NGQL 4HUWA 2UZYB 4MXWL 4MJ6B 4N5EC 3ETBF 3CXHJ 5EBMB 4JRXE 1J10A 2X70B 1DQJB 2CIKA 3WFHA 4M3JA 3P4NA 1D3CA 4OGXH 1DTUA 4GH7B 4X6FB 3SE4A 3GMPA 1MOEA 2P43B 1MY7A 3QDJB 5B39G 5EUOA 2W92A 1QFWI 3SO3B 5JW4Q 3VMOA 1G9NC 3UTTA 2ZNWA 3SDXB 4Y5VA 3U1SL 4K23H 5CIPA 1M6OA 5J4MA 3QRGL 4YR6A 4H0IA 4JKPL 1RIVL 4G6KH 4ZTOH 3OKNB 1J18A 1I7RB 3K74B 3TVMA 5JXEC 3MGOB 2C3VA 1N7ML 3JUZA 1KV3A 4F8TA 1EO8L 4F9PA 5A1AA 1N8ZB 4GAJH 3BP5A 5DK2A 3AAZA 1WF5A 3WHXB 2XFXB 3J8F7 1JUFA 1XH3A 4UT6H 1HI6A 3FHQA 3IKKA 1CD1B 2DQUH 2WAHA 5HBBA 3MSPA 1DUZB 4H25A 3NPZB 4XPGH 5MP6L 1VDGA 4PRPA 2ZUWA 3VG9C 5DQDH 2GTWB 4X6CB 5DEFB 3DX7B 4XNXH 1ROWA 4OZGF 5L0QB 5T3XH 4EI6B 2XWBB 3BGFC 3M07A 1A6VL 2X44D 5IJVB 3BP7A 1RK0B 4G9FA 1O7VA 5C0RH 4WVRA 4O02L 3WNMA 2B1AH 2EC9T 1CGXA 3PQYE 5BW7A 2EEDA 5F6HI 4AQOA 4J3TA 3HI1B 1AHWA 4N9GB 2AXFB 4Z18A 1KFAH 5KSAC 3R8BB 4KMLB 1B0RB 4MA8H 1ZHBA 3S4SA 1LE9B 1RZIA 3QEQB 4G8IA 2BOBA 3QIBA 4KK8D 2BSSB 8FABA 2ICWA 4WENB 3QR2A 1UACL 5HDBF 2Q87A 4AYFA 2VDOL 4LLYA 4M9OA 3VXUD 4OD1L 1NGWA 5FEBA 2BZDA 3CAFA 5ALCL 5EZJA 3MUZ1 4XH2A 1VFMA 1JTPA 4XC1L 4NBZB 4OZIF 1KIPA 3JWOC 3U48A 1NGXA 4MB4A 4N0CD 4WI8A 3VI3E 1W0VB 4UAOB 4P2OC 5ABDE 4U1NA 3MRHA 3K0WA 1YMMB 2MWCA 4FFYL 4MWFA 3IFLH 5FYJE 4Z7VA 4F33A 3P11L 1XF2A 5E8EB 3DX8A 3GSNL 3C5SB 2IAMC 3OJVC 4GMSL 5FA3A 5DRZB 1CGTA 4U3CA 2GYSA 2AK4D 3O6FC 1FNEB 1NDMB 4YHKH 1ITCA 4PJ8D 5IG7B 1Q9KA 4FFVD 4KI5E 4YPJA 4I3RL 3BVNA 5JOFA 5F1SA 3ZKNC 2H6PA 2GJZB 3IKCA 2DMCA 3FOLA 4UTBL 1FZMA 4K3HA 1CXKA 3BIAX 3O6LL 4K94H 4PJDF 3KYOB 1KEMH 4OCRL 2B8OT 3D0LA 4U33A 5I1IH 3NFNA 2HJLA 2OQJB 1SJXA 2ICEB 4JR9H 1G0YR 2Z35A 2CDGA 4L8DA 3TWCL 1GXEA 1NCDH 4PLJD 1IGJA 4NHUB 2IWGA 1N6VA 5C0AA 3FTGA 4LSRL 3ZE2E 4L29A 5F9OH 4EBQL 3V7AE 1IC4L 3T0XA 1BJ8A 3EO9H 5E1AA 2ZG2A 4O58H 3H3BC 2R2HA 3BHBB 2Z91A 3PV6A 3OF6D 1JZ7A 1ZA6B 1WJ3A 2DQCL 4G6AD 3T0BA 4NRYA 3SDXE 3BXNB 3HMWH 5T3ZH 3RDTA 4XNQB 3BPNC 1OAZL 3MLXH 1BZ7B 4FNLL 2QV2A 3H9SA 3VXPA 4GQPH 3KPRD 3MRFB 5DFVC 5MHSE 3V7AG 3U4BH 2IPKB 4TSBL 4HK0A 5ACZB 5DVOA 4LK4A 4G6ML 4I2XB 3ARED 1F4XL 5IGXL 1KT2A 3GMQA 2R2CA 3MRRA 4PRID 4JFDA 1S7QA 3GMMA 4K7PX 1XIWC 1A6WL 2R9HC 3TIDB 1U8KA 2ADJA 3L3IB 3RQ3A 3A67L 4HXBH 4X6CE 3HPJA 4GKZB 5E99H 2NMSA 1IBGH 3VFNB 3D1MC 5HHNB 2F19L 2FX9L 3K8KA 3IDNA 1QNZL 2GK2A 4I18C 5EU3B 5HYJA 3FJTA 2G9HA 3GO1L 2B1HH 1BIHA 1VACB 5HI5D 1KXVC 4K2UH 1CL7L 5F7WC 4C55A 2H45A 2EC9U 3DJ9A 4JFEB 2MCPH 1HHGA 3KLAB 3FAXA 3QEQE 1YNTB 3RGVB 5C3TA 4TOYH 4NO3B 1JGUH 1BLNA 1I1AB 3JWDC 1G0XA 4OGYH 1HK6A 1JFQL 5I6XC 3O11A 5J89A 5DEGA 5CP7A 1EFXB 4PGCA 4PRHB 1QEWA 1ZT4B 3E6FA 3TYGH 5IQ9A 1J0JA 1FO0A 3D0VA 4HWBH 2GHWB 1LO0L 3DSFL 4OFVA 3UEZA 1CQKA 4ZAKC 1UXWA 3HAEB 4YGAB 1IL1A 3QCUL 3U30B 1AGEB 2WWKT 2X10A 3RNQA 4DUVA 5IP4A 3SDYL 3PIQB 3EKCA 5H37H 5DGQA 3LN9A 2FJHB 5I1JH 2DM7A 2VZSA 4XMKL 1GOFA 2P42B 3L6FA 5L6YH 4R8WL 2X40A 4Q6YA 2OK0H 4OFPA 1Y0LA 1J12A 1PZUB 2A6DB 1LO2L 1V7MH 5HYSB 3UDWC 4ELKA 5CILL 1TQBB 2VITB 3N9GH 4EUPB 1JYVA 3KAAA 1QR1B 2YPVL 1EHXA 3WXWL 1M1SA 1QFWH 5ID1A 4ZMAT 4QO1A 3E0GA 4HS8L 3VFTB 1AGBA 3ZDZE 5T1DL 4KQ3H 2EYRB 5GGTL 3I6KA 3N85H 3FRPG 5IQ7H 4ZXBC 1BEYL 5HHVH 3OXRA 1IGYB 2GJ6B 3EO1B 2OTWB 4KPHH 1ZVSA 1LQSR 3CSPA 2PYED 2NW3A 2P48B 2X4OA 2Z31B 3IB4A 1B2WH 3ZZ1A 5F6IC 4AIOA 1BREA 4PJXE 1EHLL 3OHXA 4HAFA 2YK1H 1AC6A 2JJSC 43C9B 3UC0L 3BEVA 2LU3A 3AXLB 4E0RB 1S9VA 3DPBA 5SX4I 3ECBA 1X4XA 1ED3A 5BVPH 2ZUSA 2P5EE 3W5NA 3TNNB 1S9XB 1YY9C 1FZOB 2C7UA 1IKFH 5BS0D 4YXLL 1BIIA 2VAAB 2FX7H 4TULL 5AWNH 3GHBL 1P7KA 5HYQB 3VE0A 1D9KD 1F4HA 4DWHA 5ICZB 4I2XE 4XP6H 5EU6B 4MQXD 2AQ3A 1HWHB 4WUUB 2X6MA 4NZRH 4IIQA 5ICXB 1FFNA 3BW9B 2A38A 1YQVH 2ADFL 2WSKA 4UIKH 4WGVB 4C83B 3L3KA 2DYPA 2PTTB 4EI5D 3MLUL 4YH6A 2RCSL 4ONHA 1P1ZB 4MAYD 4U6YA 4O2FA 5DUML 1GL4B 4QRPE 4HZLA 2EXYD 4R2GB 3E8UH 5DRNA 3P30H 1CZ8H 2MHAA 4DN4H 1DQLH 3I3DA 4ZPTB 1T7ZA 3MA9H 5HDQL 5IEHB 2HH0H 3QRFM 5GHWH 2NXZB 1RY7B 3CH1B 4L1HA 1EJOL 4I77L 4EN3B 2VL4A 3ARDB 3BZDA 1D5MB 5KVDH 1I1FA 5CD3B 5J0BA 1VGEH 2E7CA 1DQDH 5F89B 2Y07L 3MRQB 4HT1L 4LGPB 3WCYA 3P9LA 4JHAH 4QHLA 1UYWL 1EGJA 3MNWA 4JO1L 5A3ID 2CLRA 5GJSL 3LMJH 5E7BA 1NAKH 4FQXB 4WFHD 5DMGC 1J5OL 3LKOB 5L2JB 5LAXB 5JDSB 5EOCJ 5IKCA 1VSCA 4YHZL 3BYTA 4WHDA 3L1OH 3E2HB 2G2RB 3KPSE 4AENB 3HCVA 3TA3A 1CGUA 2C4FT 3O2WL 5KOMC 5K33A 2ERJC 5K9KA 4QRQA 5IFAL 3OKMB 3VXMD 4ETQA 2QADD 5EUKA 1RIUL 5C08B 1CR9L 1NEZA 3AGVA 4MDIB 1FE8H 4WU5A 4QOKD 5CEZH 2A6JA 2R1WA 1L9MA 5DJCA 5EO0B 2AV7B 1G9NL 3DNKA 2KPNA 3NZ8B 1FG2B 2BHYA 2EIBA 3KDMB 1QFHA 2ITDB 5E70A 1QBLH 5FYKD 5I75C 4JFFA 3FB5B 3MJ6A 2C26A 1U8MA 1BX2A 1H5BB 3TO2A 1Q0XL 5CIPH 5HYSG 5TDOB 3ARRA 3LB6D 4X9FA 2OL3A 4MVBD 4S1QL 2VERN 2HWZL 4HULB 1RJLB 1OTUC 1LNUA 5I1GL 3VI3F 1JIBA 1AGDA 2IH1A 4NRXA 4GUPA 3CC5B 4Y8AA 2BRRL 1B0GA 3UTSB 3VI4E 1UWXH 1ZEAL 4UOJA 2DJUA 5EG6C 4JVWA 1BVLA 3L9RB 3OKEB 4KHTH 1YPZA 4OB5L 5F88A 3GUTA 5DJXA 1U6AL 4BSVA 3HNVL 3IDXH 2RAMA 4XP1L 2DBLL 4JDTH 4P2RA 4KI5F 4BFGA 5GGRA 4PJ5B 1UZ6F 4IJ3B 3QUZA 5D1ZD 2AJUH 1GC1H 1K4CB 4FQHB 4I48B 4WUUE 4X7FC 3S6CA 4Z7WA 3VFRB 4KVNH 3D3VD 4QHKJ 3I2CH 3UJTL 2WLZA 4X0KA 2RQ8A 5FUCE 4NQTA 1TTGA 2B2XL 1T0MB 4M5YL 4OQ1A 1I9EA 4NP4H 1MF2H 4YDLB 3HI6H 1JZ3A 3A6BH 2YSSB 5DLML 4W4NA 3JWOL 3ZE2F 2OJZH 5BV7C 4OZFG 4KJPC 2OM5A 5KN5B 3IRZA 1DR9A 1PQZA 3T1WA 2HLFD 5JTWA 1T03H 3EFDH 3A6OA 1A7NH 1T20A 5KS9A 1UEMA 2CLVA 3MUGA 4X4XB 3TH3T 3IDIB 1ZT1A 4Z77A 1U92B 3QDAA 4ONGH 1MWAB 5D6CA 3SDXF 1R3IH 4MNQD 1XF5B 1X5HA 1BVZA 5I8KH 4HKJB 5DT1H 4Z9KB 4Y4KA 3IJYA 4M62L 2I9LA 2W9DH 3W2DL 1I8KB 4YX2L 2O5XL 3E6HA 4KRPC 5EC1A 5C0JB 4PV8B 5F96L 1IAII 5EOTB 4OCSL 5DHVB 4DN3L 2IG2L 5EWIL 3BGMB 3HTLX 4CJ1A 1KC5L 4N9OB 1S8DA 4AMKL 2R0LH 4G7VH 4PBVC 1P5UA 1KACB 4R97C 4M8QB 1S7XB 2IBBA 1D5BB 1GOGA 1IAIM 1L4IA 4B7IA 3EOTH 5AZEH 2H26A 4X6CF 4HW6A 5ESVB 4P48A 4XBPA 4X80L 3UTQA 1PZ5A 3CPLB 3LQAC 1AFVH 4CUCA 3RWIA 4Q74A 1T3FA 3HFML 5HHQA 5C08E 4XNZB 2C4FU 4E41E 5SX4H 3FT4B 5CJXC 3IDMB 3V5DB 3VXUB 4P5KA 3DMMD 3JV4A 3IXAB 2XV6B 4KRLB 1QA9A 1IFHH 5IIEA 3QXDB 3DUHA 1BFSA 5F8RC 3WS3B 1K8DB 2DWEA 3ARYA 4NO5A 2DIBA 2IPTL 3SOBH 5IVNA 2AJSH 4RRPG 1MAKA 1NAMA 4J1UA 5C6WH 4CNIA 4NKIH 3JV5A 2Q7YA 4PGEB 4U6XB 1LO5B 3WN5C 3RVTC 2D9CA 4PG9B 1KG0B 4MAUH 4FS0A 5EBLA 2AK4B 3RU8L 4XVUD 1XGRB 3OKLA 3RL1A 3P4LA 5DD1L 5I1EL 3UTSE 4WI5A 4FABH 1XGYL 3VFMA 4ODXA 1YEJL 4G6FD 2FGWH 4FRWA 2XTJD 3FO0H 4HUVA 1HHHA 3TBSB 1MCFA 1FVEB 2HMID 4PJ5E 1GGCL 2JB5L 2R23B 1BJMA 2NTFA 3ILPB 2Z8SA 1G7HB 4LOUD 4P5TC 3TO4C 2CKNA 1A3QA 3MRBB 3BPOB 4RMUA 3ZDZF 2PR4L 3G5YB 3JWDL 3LN5A 2VDLL 2W38A 1KSRA 4OBRA 2X4UB 2HVKA 4DQOL 1R0AL 4XBEL 3TT3H 1MCQA 5B8CA 5BCAA 4LSSL 5F7FA 3ZT6A 1RZ7L 1JTTA 1M71A 1FLRH 5CLWA 4JZJA 2Q3AA 4P59H 4H8WH 3PWNA 1DVFC 5GGSY 4NNYB 5JZ7C 4XCCL 5GIRB 1FO0H 3WEXB 1YEGH 3K3QA 3M17B 4WO4D 2EO9A 3T77B 4LHUA 5IMKA 5MI0B 1G7JA 4G3YH 3KPRB 4R7NB 4Q2ZB 4Y19A 5J11C 2HFFA 1MI5B 2WUBL 2KH2B 4TVPD 5J6GA 5HJ3B 1FL5B 1EERB 2ZUVA 3AREB 3QUYC 3RVWD 1RHHA 3UBXI 1F13A 3KYMA 4NQED 3IETA 2BP3A 4PRIB 3BO8A 1MFEL 1AGCB 1T1WA 2J1KA 1ZAGA 4L5FL 4NKDA 5EIIB 3X13A 5IB5B 4LVOC 1CDCA 1NCCL 3G5ZA 2GFBA 4ZFFB 4P2CG 3ULVH 4AEHL 3T0EE 5IROA 3MLYH 4GRLC 2ATKB 3BH8A 2ICES 3BIKB 1AXSB 3S88H 3BN9D 3QDMA 4P4KD 1D6EA 4I9WD 2XWJA 2YPLA 3WFCH 5IFHH 4N8CL 5CCKL 3VGAB 3OR7B 4JM4H 2QKIA 4D9QE 4E42A 4BJLA 2LU7A 1R3KB 3VXUE 4GBXD 2A83B 5JO5B 4HG4J 3X11B 2B20A 1FV1A 1YN6A 3D2UD 5H35A 3HR5A 4PP1D 1AC0A 4N0RA 1DQTA 5DD6B 5JW4N 1Y18A 3JV6B 1NMCB 1X6LA 3V52L 1RUQL 1DZBA 5IJKA 1H8NA 1I8IA 1UQSA 4Q9BA 2BSTB 4PTTB 3NA4A 4JAMA 4JFHD 1KYOK 2XN9A 4PG2A 2EDBA 2AK4E 3MNVB 2GCYA 3NABL 1SY6A 2YRZA 4ELMB 2DLEA 2DIJA 4KMTH 4MD5B 3HG1A 1RI8A 1DEEA 1BQLH 3ZE0E 4P23C 2NR6D 2ZUQB 1FNSL 1IEAA 4ENEC 5C0BD 4UB0L 4POUB 1G6RH 1KN2L 1MSPA 4XCNB 2A74A 2XKSA 1KTDB 2FCBA 4XVTL 2P8PB 3UTOA 3EYFA 1X5ZA 3SCMD 3HB3D 3ULUH 2JJVA 3U83A 1Q9WA 4LEOB 5FO7A 3S35H 3EUUA 1OPGH 4K71B 4X6DB 3VWKD 2UYLB 3MJGX 4LEXH 4OM0H 1NFIA 5EIQA 2V2TB 1CFQA 3IF1B 3MLRL 4PJFE 5KZCD 2HJFB 3BWUC 5HXMA 4XP5L 1TCMA 3BDYL 5MEQB 1V05A 3FONA 1A6AB 1MREH 3RP1A 1EGJH 2H41A 5ESQA 4RGND 4F7PB 3KPRE 1Q9OA 2O5ZH 5BS0B 1MVFA 1RZJC 1TZHB 4BQBA 1X5GA 3VI4F 1MI5E 1F97A 1D9KB 4U0RC 4FOMA 4Z6AT 4LCUA 4KTDH 5IV2A 1NSNH 1YDPB 2CQVA 4NYLA 4PRIE 2NTSP 5F1OB 4WWID 3U9PL 1UM5L 4DVBB 4H0HB 4HQQL 2X5PA 4EI5B 3MLPA 4MJID 1BGXH 5K9JL 4GQ9H 3WDJA 1H3GA 4UI2A 1TQCC 1MFNA 4QHMA 2QR0B 1RU9L 3U36B 1C5CL 3TEUA 4WW2B 4CVUA 1CE1H 1QLEH 3UPCA 5GRJL 4HWZA 5ILTL 2M26A 4WCYL 2ZUTA 2Z93B 2DQTL 5DDHA 3HC0B 3CFKB 3CU7A 4NN6C 4X4ZA 3D39D 2ENSA 2DIAA 5FGSA 3SJVA 5E00B 5LGHH 3GI8L 5A16A 4RWYL 2WW8A 4APQC 4R4FL 3PL6D 3LKSB 1KYOJ 4WNQB 4XPTH 4U2ZA 4Y4HA 1PSKH 1JVKA 3G04A 1D5ZB 2WINB 4MS8D 1JYNA 4YDIL 2VXQH 1IAMA 2GQHA 4LPTA 4S1SL 1ZV5A 4U31A 3PGCA 5CJOH 2XQBL 3ARGA 4U1KA 2XQYK 4ODTL 1SYVB 4JJ5A 3RGHA 1P2CA 2PO6A 5C0CD 1KIQB 1NMAL 3SKOB 1F58L 4PJ7B 4K3EH 3UBXB 1MRFH 1FNAA 3OQ3B 1LO4L 3IJSA 4ELME 4HHAB 3FQUB 1MLCB 1BWMA 3VGEA 2MFNA 4BFIA 3VXMB 1WT5C 4HJGB 1NBVL 1F42A 4ORGB 1P84J 5A2JH 2EEAA 4KI5C 3OX8A 1FN4B 2EZ0C 4KROD 3V6OE 1OTTD 1UJ3B 4QOKB 5BV7L 3S96B 1AP2A 4NSKB 1INEL 4ODHH 3MRNB 5AZ2L 3Q0HA 3ARFA 5EZIL 2X4RA 4WU7B 4KUCF 2X89A 1DBAH 4U1JB 4NZUL 1IVLA 3MO1A 3OZ9H 1FAKT 3B9KC 5ESAA 4HCRL 1ZWIB 1A6UH 4YHIA 3C8DA 4WTWA 4Z76A 2D2OA 5GGVY 4N68A 4ZSOB 5E08L 4JDVB 1NC4A 3O3AB 1MCEA 2GUOB 3HE7D 2V7NB 3TVMD 3QCVH 35C8L 1OWRM 4JGUA 5M94B 3OGOE 2R4RH 1WK0A 4LKXB 4WI2A 2FJGB 1DN0B 3MRMA 4Q6IC 4WHTA 1A7RL 4QHKI 5CKAA 1GH7A 4NWTL 3VWJC 4NKMB 2K7QA 2X9XA 2R69L 4MX7A 3OPZH 5BS0E 4OT1L 2YC1B 2UV3A 1MRDL 1CIDA 2JK5B 3ZSTA 3CFCH 1RHFA 5FHBH 5FUZL 1G7MA 5D1ZB 3LQAL 3MRLB 2JE8A 1ORSB 1WBXA 1WAAF 3D3VB 3EDDA 4U7SA 4FQIL 1J0HA 3HZVB 3SDAA 2P8MA 2C1OB 4JDZB 3B2VH 4Y2DC 2IH3A 3WD5H 2IQAA 4LSTL 3GI9H 1EEZA 1FVCA 1Q0YL 3L3DB 2BNUB 5DVLA 2FBOJ 5L0QC 2IPUK 3QG6B 3TN0A 1HEZB 4QXGL 1JHKL 2VUOA 1JGVL 1MCNA 4ESKA 2BNRD 5IM7A 3ZT7A 5E0QA 3RWDA 3RJQB 2XNAA 2F5AH 2WBJD 3G6JB 1JNNL 1EIBA 3PWJB 5I66A 3D5OF 1NAMH 2CJUH 1LK3L 3O6KH 1RVFL 3DXAD 3CLEL 3WBDA 2DKMA 4J4PC 4MNQB 5GZND 1QOKA 5T1LD 3RPIA 2Y4SA 4L9LA 3V4PL 5AAWA 1D5IH 4JO4L 3O8XC 2HYMA 3SQOH 5IW6A 3VFVB 2XRAL 3WFEL 2GTZB 3MUJA 2ARJQ 5K9OB 5DI8B 3VXOB 4UQ3B 4XPFL 4CVXA 3DI3B 2XZQL 3MLZH 3SE9H 1CGSL 5ERWA 4PJIB 4XB7A 4UAOC 3MPCA 3U7WH 4PJ7E 5E1HB 2BMKB 4JN2B 2EDHA 2H32B 5J12B 4JRYA 1N64H 4UDTA 3VXSD 3B3IA 1RFDL 4UIMA 4JKLA 4JO2L 4LF3A 4MA3B 3SGJC 5D5MB 5JW4M 3Q3GB 3QUMA 2N4IA 2A9MH 1ZSDB 2JTDA 1DQML 3ESVF 1I7ZB 4TNWF 4ISVA 5E8PA 4QOKE 3FO1B 4PRNA 2PUQT 5L9DL 2Q76B 3DMMB 3DVGA 4KRNA 3L95A 4ZO7A 5FYKE 3HE6A 1BZ9A 3QZWB 4LP5A 1AD0A 4P3CH 2VUYA 5T5FH 3SKJL 5FK9B 1GCFA 2DF3A 2V5SA 1LP9A 2GITB 4MHHG 4N1CA 4V2BA 3SDCA 1ES0B 1L7TH 1LDPH 3MV7E 1E4XH 4ZSOE 1VPOH 3QQ3B 1BD2A 1CXEA 4PGDA 5CZVL 3GJFA 4ZUWB 4JG1L 4LU5H 1WBYB 4FP8H 1UCBH 4X4MA 4LCYB 3I84A 4FFZL 3H6JA 2ATPA 1C7SA 1R3LA 3C60C 1UGNA 1HCVA 4WWKD 1OAYL 1R3JA 3UMTA 4RBPK 4YXKL 2ED8A 4MJ5A 5TE7H 3VJ6A 5J6HB 3O3DA 3BISA 1GZQA 3NCYP 1ZHLB 3VFSA 4G6FB 1FIEA 2Q8BL 4X5WB 2XTJB 2XXMB 1WCBA 1P9MC 4N0UA 4YBQC 5D8JH 1E6JL 3TYFB 1JRHI 1F4WL 1QFUL 3EYSH 4KDTA 2F53A 5J13B 2MQCA 1AQDA 5IVXB 4R96A 2NX5E 4D8PA 2PW1A 4X8JB 4A2LA 1JF5A 3Q1SH 1P4BH 1JWUA 3VDBA 4HIIB 1KPRB 4QYOB 1T5WB 1Z3GL 5C9JA 3DVFA 4PFEA 1ND0A 3HC4H 3ARBD 3P4MA 3QIUA 2NY3D 1N6QL 5HDOA 3FQRB 1FYTA 2VLJD 3ARVA 4FQ2H 4XI5C 1C08A 1HOCB 4F37K 4LMQE 1MJ8L 4NN7B 4YAQB 4H5SA 5GGTA 1MQKL 4WO4B 1BQHG 3G6JE 5C0DA 1EBAA 2DB8A 1KLGB 2JJWA 4U1HA 2VDKL 1GPOL 1SM3H 5AUMA 3G5VA 1T04B 4MNQE 3DHJA 2QSQA 3BOVA 3KPOB 1MUJA 4Z0BL 1I1AC 1L7IL 3EOAB 4N5ED 3FT2A 1WFNA 4MDJB 4NCC1 3B8SA 1LE5A 4NQEB 2J5LB 1BECA 1SY6H 3BQUA 2D31B 2I5YL 4M93C 3OMZA 2HKFL 4XPHL 1Z6JT 3FQTB 4I3SH 4PJGA 3D69B 4RAUB 5JPMB 2E8ZA 3ZT5A 4PB0H 4AIZB 3FQNB 2M2DA 1MFDL 4DZ8B 2W9EH 3FB7B 4PJIE 1KCRL 4NNXA 2UY6A 2XI9A 4PJBA 4YDJB 4U2YA 2J88L 2HG5B 3U30C 3NTCH 3V7MA 5KVEL 1FZJA 1H15A 3KG5A 3HPLB 2AABL 1I85C 4RFOH 3L7FA 4BH8A 2DQHH 4DVRL 1CBVH 1A4JB 3EJYD 4P4KB 5D5ME 4LIQL 4V2CB 4XXDA 1G9MC 2Y5TA 1K6QH 4LPUA 1E28A 1IC5H 1TQBC 4QCIB 3RWFB 2AEQL 3V8OA 1IJ9A 1FGVH 1W72A 4GBXB 2F8XC 4AM0B 1INDH 5KSBA 1IQWH 3LKPB 4L8BA 4Z78B 1WFOA 4YWGL 1A2YB 5FOBA 5JXAH 1RZJL 1UJTA 5TQ0L 4L8CB 4X7CC 3CSYB 1YYML 4KHXL 4RDQF 5IBTL 2P45B 5EC2A 2Z31C 4G80A 5LXGL 4DKDC 1XGUA 5L8KB 4Y4FA 3RKPA 4GJTB 1YECH 1WZ1H 4YIQB 4D9RD 5CBEA 3P3YA 4U4BA 4FQJH 1E27B 3SE8H 1CL7I 2FZ3B 2R0ZH 4Z8FH 4ZS7L 4LLVA 1CICA 4ELMF 5C0BB 4AIXA 2HRLA 2XTJE 1FC2D 3I6LD 3C2AH 4HS6B 3BIBX 4JB9L 3H2WA 4JO3L 4NM8L 2GT9B 1BVKB 3PUCA 3EYQC 3I6GA 3GDBA 2CMRH 4M3KB 3C5JB 4JLRA 5IVXE 3HA0A 1CFTA 4P2OD 1CLOL 5JUEL 1TENA 3SCMB 4KZEH 5GJTL 5C0IA 2BY1A 2CSPA 2KZ1B 2A9NH 3G08A 1AO7D 5IB4B 2NQCA 2IAMD 4XP9L 2OR8A 1V3JA 4FQLL 3UYRL 2AP2A 3VWKB 1CLZL 4LLDB 3O6FD 5D2NA 1NGQH 1JPGB 4MXWH 5FUCC 3FB6A 5HTSA 5T1MA 2OS7A 5JQ6L 5KZCB 4PYHA 4TUOB 3KYNA 4X6DF 3ROLB 3ZKND 4AEIL 1Q72L 5I73B 4R2GC 3ZKQD 4HBCL 2X4NA 3F7RA 1EVTC 1HYSD 3B9VA 2J4WL 2EDTA 3KYAA 4RGNB 5B21A 1UEYA 4M1CD 5C1MB 1DJSA 3QAZB 1W0WA 5FYJL 1KUMA 4C58B 5JXEA 2NXZC 3DX9A 4MB3A 3I75B 4ZDHB 2VR9A 4JKPH 1RIVH 4Y1AA 5FB8A 2VN4A 4K9EH 4U1GB 4NQEE 5K93A 1I1CA 1F02I 3QXTA 3SGKA 1CYGA 1PG7L 3OSKA 5IEKB 4H0GA 4R4ND 4MJIB 1U9KA 3D85D 4PS4L 2F54A 4F7MA 3IU4L 3MACH 5MP6H 4FQXC 3IDGB 1CXHA 3GNMH 1IGCL 4ORZC 1SJEA 5L8LB