3C5JB

Crystal structure of hla dr52c
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
187
structure length
182
Chain Sequence
RPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPAKHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title The structure of HLA-DR52c: comparison to other HLA-DRB3 alleles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 43
structure length 182
sequence length 187
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5jB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c5jB01
1KSRA 5GSRB 5KW9H 3B8SA 3FONB 4XNYH 3BZ4B 2VLJD 1VA9A 2HVKA 3KXFE 2BJMH 4N5UA 4KH2A 3MLZL 4O2FA 4NJ9L 4X80H 1QEWA 2Y36H 1NEUA 1GOHA 5IMMB 1A2YA 1LO0H 4OLXH 4ONHA 4RSVA 5TH2B 2XRAL 4G8EA 2RHEA 2V2XA 2VIRA 1KJVB 4S0TD 3AREC 3QUZD 2IG2L 1EBAA 1X5KA 1RVFH 2BNQA 5I19H 4P23D 3BPLB 2O26U 2F54A 4POUB 5IK3B 2VDLH 3I3DA 5F89A 2BNRE 4U7SA 1QR1A 3C8KB 4NN7B 1MH5B 4N9GA 3AY4A 4TUOB 3N0PB 4U6VL 4NN6B 3TYGH 1I1FB 1HOCB 4Q9RL 1OTUC 1NCBH 4WO4A 2DI9A 5C0JA 1NSNH 4Y19B 2QQLL 3CCHB 2VDQL 3BGAA 3GBML 4Y88A 4GFTB 2H3NB 1XGRB 4G6ML 3TBVA 1NAMB 5GZOD 2XPGB 3RNQA 1HILB 3ULSA 1DVFB 3I6LE 4NWTL 3HRPA 3DLQR 1LP9F 2HFGH 1CGXA 1P6FA 3DUUB 2J8UE 1CDCA 3ZKSD 1H5BC 5EIIB 2HVJB 1ZVSB 4ELME 3JWDC 3D25A 4MHHI 1VPOL 5GIRA 1PKQB 2C7UB 1P69B 2D03H 2OZ4H 4N8CH 5D6CA 3ZSSA 3IU3B 4JY5H 4G43A 3BW9A 1T1WA 1TLKA 4WWKB 2IANA 5INDB 4PPTA 3JSSA 4ODWB 4EBQH 2FL5B 4TSCH 4X98B 5FKPB 3BP4A 1CR9H 1XEDA 2OTWA 3LHPL 3KYNA 4IOIA 5DSCA 1VDGA 3V95A 2ADIA 4EKXA 4QHLA 1RZIA 1X5ZA 4QHNB 4KRPB 4FFZL 3MRJA 5E8PB 2F19H 1NBYA 5ACZB 4NQCE 4NN5B 5HJ3B 1XF1A 3CFCL 4PRID 4YHLL 1LHZA 3LKRB 5HGBB 4ZTPL 4NQDA 2AXGB 3SCMB 4M7LH 4JHWH 5GGUA 3WIFA 5HVFB 1NCCH 3FFCA 1Q0YL 1KCRL 4M48L 3IKCA 1MRDH 2DD8H 4HIJA 5D5ME 5DHVA 3WFBH 2HJKB 3QEUA 4JM2B 3X13B 5JDJA 4BSWB 2ZOLA 4OM0L 4ERSL 4R4NC 3QIWA 1S7XA 4FTVA 4FQHB 1UB5A 1XF5B 3GJFA 4JREB 4PJ9B 3GI8H 2ARJQ 2ICEA 4QNPE 5BS0E 2DIAA 4MXQD 3V7AE 4X6FA 3QSKB 2V2TB 2VL5B 1ZGLP 2GSIA 2R2EA 1A6ZA 4LMQI 4NO3B 5CJQH 3TM6A 2CIKA 2A9NL 1DLFL 2H6PA 5FYKL 4RNRA 4K9EL 3AMLA 5D1XD 3HZMB 3L3GB 1OVZA 3VMOA 3HRZA 2C1PB 4P5TB 3FHQA 4NNPH 3S3PA 2LU7A 3AREA 2Z31C 1GPOH 3DX8A 5DK0B 4LVNB 4P2YA 1ED3A 2E9WA 3K2MC 4XBGA 3S96B 3I75A 1EFXB 1MRCL 3PWNB 1X5JA 3CC5A 3GFUA 3V7MA 2KPNA 5I1HH 2VXVH 2PXYB 1QO3A 4WW2C 1IC7H 1N0LA 2WP3T 2VLKB 1IGIH 1UA6L 1VGKB 4LLUB 3U7WL 4QRPD 5DTFA 1RHHA 2ATKA 2PR4L 1L0YA 3CSYB 2GJ6E 1N59B 3BP5B 3FHAA 3ZKQD 4HFUH 1KJ3H 4E0RA 1F4YH 5ID0A 4WEMB 3DRTA 4Z8FL 5D7LD 1KGCD 2NY6C 4WVRA 1LK3L 5FV1L 1RIVL 5AD0B 4JN1L 5EIQA 3V0WL 1ZV5A 3VGDA 5IW6A 4G9FD 4Y4KD 3G5YA 1FRGL 3QULB 3JV4A 4K8RC 1DUYA 1ERNA 1CLOL 5BV7L 3TPUB 4TSBH 4LSSH 2FO4B 3ZE0E 1FNSL 3I50L 1J87A 2OBGA 1EHAA 4G7YH 4JQIH 4NSKB 4X9GA 5E8NA 3WKNA 4WUKH 5C0IA 5IVZB 4G8GD 5E24E 4TSAL 1K3IA 5JW4R 1K2DB 5CSGA 4ZXBA 3GGWA 1KJ2A 3STBA 2BVQB 2ZSWA 12E8L 3GMMB 3DX9A 4QHUA 3QG7H 1K85A 1PG7X 4P2QE 3TNNA 5KTEH 4NQED 5EBMA 3QUZB 2HJFB 3TCXA 2X4NA 5F7KC 2AEPL 3KYOA 3OKYA 5JHDA 1MFAL 5DRXB 3T3PE 2VXTH 3ZT6A 5FEBA 1M7DA 5J1TC 3KWWB 1DQTA 1B2WH 4ZFFA 5CBEA 3TZVD 1PSKH 1JGEB 3W11D 3EHBC 3OAUL 3GBNH 1QSFB 1HDMB 4U1IB 3ARDA 2ERJB 2VR9A 2WWKT 4OFYD 5SX4I 3TBSB 1NCWH 4ZAKD 3H9SB 1NGQH 4Q2ZA 4XVSH 2J8HA 2LFGA 2DM7A 4KJYA 4KMLB 5F7EH 1I7TB 4NJAL 2YUXA 3WUWB 3WFCL 5BXFA 1KXVC 1JRHI 5MEQA 1OAZL 2JB6B 5I1KL 1IAIH 1AXSB 4HPYH 3TT1H 1HSBB 4C56D 3RWHA 2FWOA 5E8DL 4PJ7B 3PDDA 3H8NA 3Q3GA 4JJ5A 4HT1L 1JYNA 2BMKB 3P9LA 3ZTNL 4LNRA 5DURD 4LSDA 5D8JL 5IVXF 5FUCE 4Z7WB 5GGTA 1S9YB 3KJ6H 4XGZB 2G60L 5CP7A 2VAJA 4JN2A 1GXEA 3GK8L 4JKPL 5C6TH 2FJHB 3C5SA 5DJZB 1O5DT 4G6KH 1DQQA 3NOIA 1FYTD 2QSCH 5F6HI 4BFIB 4U3CA 3CJJA 3V6OE 1TNNA 2FR4B 4NKDA 1I7RA 3U0TB 5FHBH 4CGTA 3GM8A 5D7IA 1E6OL 1NCAL 4F2MB 3ES6B 1BFTA 2V7HA 4UT9L 2KBGA 1HKLL 2ZCHH 3VGBA 4LQFL 1C8PA 1HXYB 5LBSH 5HDQL 2VABA 4JFDA 3BP6B 4OUUB 2IQAA 2R1YA 1D6VL 3ARQA 3GJFK 3HNVL 3DNKA 4K94L 4D0DB 1YUHB 1F42A 4JFXA 5IR1A 5CEXB 1FAIH 2Z92A 3TBWB 1FAKT 4WI5A 2XZAH 1P84J 3P4OA 5I6XB 5EO0A 2NZ9D 2VLME 4DCQA 5E08L 4XRCB 1JV5A 2HLFD 2APVA 1UYWH 3FO2B 2VITB 5I1EL 4P49A 4TTGA 3HFMH 5IMLB 4MDJB 1U91B 1SJHB 1SYVA 1AFVH 3RVXC 3X3FL 4F9PA 5D1XB 4I18B 5I17A 1NBZA 4R8WL 3RNKA 3K7UA 2YEZB 4QRQA 3QUYD 1FC1A 1EHNA 1OAUH 2NY1D 1AP2B 4JY4B 5JLZB 1CQKA 3K8KA 4Z5RB 2JJTC 3FN3A 3OPZL 4L8BA 4NKOB 1MCKA 2J3SA 2J1KA 4FFVC 5LWYH 3DYOA 4MAYD 3EYQC 3FRUB 3A0OA 4GAGL 4U6YA 5D1ZA 1KIPA 3HR6A 3ZDXE 1MCOH 1RU9L 3SHSA 2IH3A 3QNXB 4EUPG 3HC4L 2BSRB 4OKVA 4QRPB 5ADPH 3V5DA 3RX7A 5D7JD 5C2BL 1L6ZA 4GG6A 2J6EL 4X0KA 3GSOA 2VQUA 1NLDL 3ZKMD 3MV8A 4G42B 1E27A 1J1XH 3IDGA 3G6JA 3WYRA 3OKDA 3LN4B 4LEXH 2FBJH 1EHXA 1TMCB 3X11B 3ZE1E 5ESAB 4DAGL 3SGDH 3LKNB 2C5DC 4G9FB 1JWUB 1YEKH 2LAAA 5HHOD 4GXVL 5EUOF 4OIAA 3TJHD 4OIIL 3KPPB 5B3NA 5FGCE 4EN3D 2ZCLH 2C3WA 1ZSDB 2OX5A 3HUJE 5CJOL 3RUGE 4CMMB 1X4XA 2X4UB 3MBXL 1U92A 4O2EA 3OF6D 3DSNA 2CUHA 4K7FA 5ESVB 4G8GB 4K23H 1OY3B 3OTTA 4A6YL 4MD4A 4YPGA 4YBQC 1FNHA 1AO7A 3O3DA 1UVQB 2DWDA 2VLLB 3CK0H 5GRJL 4P5MA 5EOCH 1G7QA 1U8NA 1A7NL 5T1DH 2PYEA 2YC1A 4WUUE 3BISA 1MCLA 3QWOA 5I66B 3T0AA 3VRJA 4Q9QH 3IDJA 1A3LL 5E2TH 3TZVB 2R0ZL 5I1GL 2HKHH 4BA8A 4Q6IC 3FKUS 1DBML 4UNVA 2VSDA 3MUGA 4MNQE 4PS4L 1IVLA 1WZKA 4YX2H 2AK1L 3A6BL 5INCA 4UT7L 1A4KA 4NC0B 4Y5VA 3VE0B 3SJVD 5F44A 5KSVB 1W0YT 3D3VA 1VFAB 1UZ8A 5EZOH 1HK6A 4OZHA 3EYSL 4OBSA 4PLKC 4N0CC 2HT3D 5FO7B 3O81A 5IG7B 15C8L 3X3GL 1YY9C 2UUDK 3MMEB 1BFVH 1HNGA 2EDOA 1YMHA 3GKZA 5T1LA 5CBAA 2JJTA 1S7QB 4BZ1H 3MRQA 4JFZL 1QQDA 4PG9A 3OB0K 5DURB 1W72H 2I9TA 1YEGL 1TJGL 5IQ7L 2ZJSL 4WW1A 4NP4L 4R4BA 3SO3C 2GFBA 3PWPB 5I8KL 5F93C 2NLJB 1QBLH 1BJ8A 3EFFA 5ISZA 4PB0H 4KI5D 3VFNB 2EEDA 3B2VH 1FYTB 1FHGA 5AYUL 2YR3A 5EUKA 4JG0H 1UZ6E 3D39D 4GRMA 3SDAC 3UBXB 4JQXA 1HZHH 3O2WH 4HKXA 3HR5A 2BY2A 3H7BB 4PV9A 2D7QA 3S4SA 3ARGA 2F53B 4P9HH 3BAEL 4LRIC 1T3FA 4N0FA 1MWAH 1XF3A 4M8QA 3SKMB 5F7NC 1NDMA 3CDGB 2PKDA 5JDSB 1WF5A 3VFPA 2X4PA 2IQ9H 4JO1H 1ITCA 3G04A 3TH2T 4GQPH 4LLYB 5DMGD 2SEBA 3ORJA 1TVBA 1QKZH 1AXTH 4ONGL 3C09B 5CINL 3VFOB 5I1LA 3TO4A 4DVBB 1J86A 4QRTB 5I1JH 5FHAL 4NHUA 4WHYG 3RIAK 3C60C 1I8IA 4WFFE 1CGYA 25C8H 4L9LC 3MXVL 3WFZA 1LILA 4LDLB 2A6JA 4FXLA 1I1CA 3T0ED 4PJGF 5KVDL 1NGWB 4UB0L 1SVCP 4DTGL 1MJ7H 3PL6D 4PJFB 1F58L 5KVFH 5L2KD 3OKMA 1T7YA 5DFWH 5DEGA 3QYCA 3QUYB 4HXAL 5FB8B 1IT9H 5SX5H 1TTFA 2VYRE 3MGTB 2NY5L 3CFBB 3MYJA 2FJFA 4M7LT 1T6VN 1EIBA 4R90L 1BBJA 4OCWL 3FZUD 5HHQA 4QOKE 4MAYB 1S7SB 2CLVB 2MPAH 2ZG1A 3BEWA 3EFDL 4S1DC 3O6LL 1A5FL 3CVHH 3RWCA 5D2NB 2IPTL 1R3KB 3C9NA 2QEJA 2XTJE 3C6LC 1JRHL 4U05A 1LDPL 2GAZA 2YK1L 3MQIA 4IS6B 4M9PA 2HFFA 4RX4D 5CILH 3TBTB 1JNNH 3S6CA 2NZIA 2I5YH 1S3KH 4Z7VE 1F97A 1E4KA 4Y5XA 1KELL 5KN5A 3ZKXC 4Y1AE 2LE9A 3W5MA 1A1NA 2AI0H 1ZHNA 5LGHH 1RUMH 3HMWH 1ND0A 5IBTL 2X4RA 2FEEI 4EQ3A 1RD6A 3I6GB 5C0NC 5J11C 2D0GA 4YIQB 5DI8A 4UU9B 1ZWIA 4F7MB 4CBPA 2V9TA 2H8PA 4UDUB 5MEPB 1FL6B 5I16A 2GK0B 2R2BA 1GHFH 4XMKL 2GEEA 5IFJA 4IMLA 1ZS8B 1RUKH 1B4JH 3RWJA 4C58B 2JK5B 2IAMC 4LPVA 5DUPL 4W6XB 2D4FA 5EBWB 1AE6L 3FN9A 3INUL 1NMCB 2DDQL 4DN3L 3FOLA 5FA4B 4AJ0A 2H2PD 1KC5H 4NHCL 3MROB 3V6FA 3WIIH 5ITFA 3R8QA 3UMTA 4YXHH 1G6VK 1UWXH 1LP9A 1BQHA 2XFXB 3QP3A 4D3CH 1FCGA 5DDHB 1R5WB 2D0HA 2P47B 5FO9A 2EYSB 2J88H 4WHDA 3BRGC 4FFYL 1FVEA 4FQPA 3DXAD 1X9QA 3M8OH 3CD4A 3GO1L 5CCKL 1A6WH 2NY7L 3VFTA 5L2JA 1OSZA 3LCYA 3OGCB 3MRLA 3S5LG 3UCRA 1CG9B 5JW5A 4XP9L 1R5VA 3EDDA 1A7RH 3S37L 3RTQD 3NCYP 2HAZA 3C60A 2QADB 1X5FA 4NKIL 1MHHA 4U1LA 2NYYC 4LKXB 2LTQB 5EC1A 5C08D 1JF5A 3TIDB 2W9DL 3SJVB 4GOSA 3O45B 4NKMB 3HS0A 4KGJA 1R3JB 1J8HA 3VI3F 3KR3L 1IZKA 2GT9B 3O4LE 3IU4L 2JJSA 4MQ7B 2DJSA 4RWYL 4QXWA 3RWEB 2BFVH 3HZVB 1N64H 3QDME 1WSST 1YEEL 2VDOL 3MNZB 2P5WD 4PFEA 4F7TB 2HG5B 3VFSB 2GJZA 4G7VL 4JFED 5BV7B 4JKMA 4O58L 1MFCL 1RAMA 3FQWB 1RZGB 4XXDA 1UXSA 4QTHA 1R3LA 3C2SA 3EDFA 2NNAA 1BLNB 3A6CH 3CLFL 3C6LA 5C0BA 4OFPA 3UTQB 2PNDA 4YNYA 2I07B 2H32B 1AH1A 4XX1G 1DEEA 1HIMH 2ZUQB 4PLJC 4LF3B 1IEAA 3D39B 2AERT 4WHTA 5JUEH 1JNLL 1RURH 4WEBH 4M62L 1VEOA 3KXFA 4JKLA 2EKSB 5MI0B 1LO5B 5EWIH 2XXCB 3WO4B 1LE5B 3LQZB 3MCG1 4E41A 4KY1L 4POZD 4OSUH 2FBOJ 4UIKL 3EBAA 5LJYH 3SKJH 4HUVA 1TJIL 2P5EE 4U2YA 4X5WA 1KBGL 4NGHL 5A16A 3QEHB 2EDQA 2VN7A 5FF6B 3QRGL 1U3HD 2YWZA 3O9WD 3ZHDA 4LLMB 2WW8A 4FMFA 5H2BB 2DQJH 1I7ZB 4JDTH 2AEQH 5ADOL 1DDHA 2IAMA 2E5EA 3P4NA 2Q3ZA 3GMRA 3RJDA 4KROD 1YEJL 3AU1A 3JWOH 3GHEH 2UWEE 4R0LC 4WFHD 5DJXA 3L3KB 3VDAA 1G7MB 5K9JH 4PR5A 4KQ3L 3BPCB 4QRUA 1QBMH 3FT2A 2YUZA 1KJ2L 3UJTH 3VXNB 4P5KB 1MCWM 1G9ML 5CZKA 5L2KB 4R26L 2CSPA 3GSQA 5CJBA 4XC1H 1ZKAA 4KMTH 3FO0L 1E6JH 3OSKA 3WS6C 1MI5A 4U1JA 1KCSH 2DWEA 4V1DE 3T4YA 3Q2CA 4AIOA 3T2PA 1CE1L 5DD3L 5TGBA 3UJIL 4UBDC 3C5JB 3QA3B 4RISH 2OLDA 1S8DB 1JGUH 5IB1A 4HJGB 1YN7A 2OR9L 3IAPA 3ULVH 1C12A 3FB6A 3H9YA 4JDVB 5GS3A 3FB8B 2RQ8A 4KQ4L 2CXKA 3RGVD 5E2VL 4HMCA 3RRQA 4UILH 1I8LC 1X7QB 1ZE3C 4KVCL 5BO1H 3WDHA 2DQHL 3IETB 3MXWL 4OLVL 1U3YA 2B39A 1IGYA 3MLYH 3DVIA 4GW5A 3PP4L 4M6OL 4X9HA 1XIWB 2YBRA 4RMUA 1T83C 3NZHL 4FOMA 4NQCA 3KPRD 4XCFH 3PHOA 2YXMA 5L6YL 5D72L 1GVIA 2HT4D 5EO9B 4JRYA 4PJBE 4NRYB 3TJEH 4XAKE 3H7LA 4E5XA 3T77B 5K9OA 5D5MA 4L8CA 1EUTA 4PJCE 5SWSB 1YNLL 3EUUA 5C0FB 1KTDA 3TV3H 1CDIA 2PF6A 2VDKL 2CR3A 2VE6A 5JR1L 3CAFA 4Y2DC 3MCKB 2R1XB 2XQBH 4P4KA 1C5CH 4IRSD 1ZANH 2H9GB 5BS0A 4ODXB 3M1BA 1RUQL 3OKLA 1UEMA 1SMOA 3VWKC 4Q6YA 3W2DH 4PD4K 3SBWA 1T1ZB 3SGEI 1FO0L 2F54D 4JFQB 2MCPH 1TQCC 1WZLA 1YMME 1UJ3C 3EO1A 3P0YL 1RZJH 4TPRL 3WV0A 4X8XA 5HHVL 1NC2A 1E4WL 1UB6B 4GG8B 2CUIA 3HC0B 2DBJA 1AGFB 1PZ5A 4Z7UB 3NBNA 4HIXL 3ARWA 1YQVL 5I9QC 1ES0A 3HE6D 2X4QA 5JMRA 3IDMA 3ARSA 5C0GA 3SDYH 5F70A 4OZIB 3QCVL 4JM4L 5C08B 3G6AB 2CK2A 1S5IH 3FQUA 5DFTA 2VXSL 5EZIH 3P4MA 3PGFL 4FXGA 1CXKA 4WV1C 1NH6A 4IJ3C 4F7CA 4HF5L 4PTTB 2WUCL 4PJEA 5ETUA 3JWNC 5HHXL 1V7MH 5DMIH 1NJ9B 2AGJH 2GJ6A 3OKNA 3NFNB 4I3GA 2EYTB 2IAND 3QO1A 1EEUA 4NUGL 1N7MH 2P5WB 3WS6A 1YPZF 4XPFH 5I8CB 4HXBL 3X12A 4URTB 5IF0B 5D1QC 5LGJB 1JYXA 3OGOE 1KENL 1OGAA 43C9B 4LQ1A 4Z0BL 3WKML 5DJAA 1FG2A 5FYLL 4A6YB 1I4FB 5L88H 3I85A 1F90L 3T2QA 2FEEL 1CDBA 2HKFH 2IGFH 3JTTB 4UMGA 4NQDD 5DS8B 2ZUVA 4JB9H 4AEHH 4CU8A 3FFCD 2BY3A 1JPGA 2XZZA 4H20L 4EVNA 1T83A 2R1WA 3ZTJH 2R0LH 5EU5A 5EA0L 3L3DB 2DLFL 3KYKL 3MREB 4FQQA 4DVRH 1KIQA 4L4TA 3CLEH 3OKKB 1U8OA 2K1MA 4Q7DA 3UPRA 1Q9KB 1U3HB 3VXUA 3DHMA 3LPGA 4K2UH 1FL3B 5K93A 3WXWH 3BSZH 1SM3H 4FQIL 1Q9WA 4M5ZL 1BREA 2Y06H 4Y19E 2E9IA 1NFDB 4KROB 4TOYL 5F1SA 4YE4L 2CJUH 4M5YL 1RJZA 1T4KA 3E6HA 3F5WA 4H0GA 4FQLH 4RFNC 3BPOC 1AQDB 1U58A 3ZMRA 4HMEA 3V0VA 1U3JA 5HSFA 1OM3L 5F9OL 3O6FC 1MIML 5E6IC 3O2VH 4H88H 1PKQE 2B5IC 4OLYL 4K3JH 3QI9C 4LHUG 3MRCA 3NIGE 4GMTL 3D0VA 2B1HH 2HTKD 4OT1L 4ISVA 4JFHD 4QXUH 3RZWA 5ESQA 4Q0XH 5LCVH 4C55A 3W0WB 4Y16A 1NAKH 1EEYB 3W81A 2ZUYA 1MNUH 3P0VL 4ZFGH 1ONQB 2BOCB 4OZFG 4WV1A 3DV4A 3ZHLA 5IV2A 4KKAD 1HCFX 3MRHA 3SGJC 4C54A 2LVEA 4FABL 2V5SA 4IIQA 1KPRB 1SY6H 4XZUA 1MPAH 3FQRB 3KPRB 1IFHH 5D1QA 3K81A 4FZEL 4Y4HA 5F1NA 1DUZB 1U2HA 3B3IA 5EOTA 2Q7NA 1ZLVK 3TN0A 3MRNA 2HVKB 3U83A 4O2FB 4HKJA 1T7XA 1ZTXL 3HNTH 1QEWB 1JZ5A 4MJ6A 1A2YB 4XCYA 4ZXBD 4DFHA 4YGVA 4LGRB 5H37G 3MLPA 1F3DJ 1KCVL 1QFUH 4ONHB 3NAAH 2OZ4A 1LGVA 4G8EB 2V2XB 2VIRB 3BN9D 3ULVE 2VUOA 2R4RH 1V3LA 2CK0L 5JHDD 3GMLA 2BNQB 2FX8L 5FYJE 4WTZA 4J3XA 4JVPA 2F54B 4I5BA 5IHZA 5F89B 5GRWA 5J0BA 2HFEA 1WISA 3DIFA 2Q6WA 1JZ7A 1QR1B 1NBVL 3BUTA 2P24A 4N9GB 3ARDD 2HWZH 2QV2A 2HT2C 4ZNEE 2C1OA 1A6VH 2OP4L 4WO4B 5CD5C 5C0JB 4I9WE 5DJ2A 2VLKE 3STLA 5E99H 1ZLWH 4WY7H 3TIEA 3TBVB 5IHUL 1AQKL 4HWEL 4PJIF 3RNQB 1QSVA 3ULSB 5FM4A 1N0XL 4MQTB 2R15A 2CDEA 1U41A 2V17H 2YD2A 3DMMC 5GIRB 3D25B 4JPIA 3IXTA 3MOBH 4BM7A 4E9LA 5D6CB 3LSOA 3WD5L 3KPMA 2PO6D 5BRZA 1JTTA 4G43B 2IBBA 2Z9TA 3BW9B 1T1WB 2DI8A 2IANB 1TJHL 4D9QD 3PHSA 4ZPVA 2QLVB 1WBXA 3BP4B 1Z5LA 1QYGL 3VXMA 2OTWB 3KYNB 4IOIB 4GSDH 4JKKA 5DSCB 4HCRH 1FGVH 4FG6C 2ADIB 4DEPB 4QHLB 1RZIB 4AYFA 1TCMA 2XY2A 3PDOA 1MEXH 4IDLA 3VXRA 3MRJB 4KV5E 1J0KA 3CFDA 1NBYB 1I8MA 1VFBA 5DXWA 3RHWF 1P1ZA 5GHWH 2VXUH 5M94B 5IESL 2AXFA 4NQDB 5GGUB 3WIFB 3FAXA 2OJZL 4WI7A 3FFCB 3NCMA 4AG4H 3QDAA 1MCRA 3ETBF 3IKCB 1IQWH 4GXUN 4OF6A 3SGJA 4HIJB 4CMHC 4N5ED 5DHVB 1NDGA 3QEUB 5CGMA 2ZOLB 1XGUA 5ELIA 5B8CC 3QIBA 5EH1A 4PBVC 3QIWB 1S7XB 4FTVB 4S1QL 1UB5B 3MLZH 3GJFB 3QHZH 4OUOA 3IAGC 2DQEL 4RQQA 3VI4E 3JXAA 1VEPA 5DF0A 3MUJA 2Q76A 2ICEB 1V3JA 1IILE 3LIZL 1CQYA 4X6FB 3N9GL 1QSFE 2GSIB 2R2EB 4WUUA 1A6ZB 3SDCD 2CIKB 2IG2H 2H6PB 1R3HA 3LD8C 4RNRB 4UINH 4XNMA 4PP1D 3HRZB 1EJOL 4GJTB 3MLTA 5BOPA 1DL7L 4KUCD 3AREB 2HTLC 3DX8B 2VZ3A 4GO6B 3K3QA 4DK6A 1ED3B 4LK4A 4XBGB 2JJUA 3I75B 1JPST 4PB9L 5KBNC 1HHHA 3CC5B 1S9WA 4NPYA 1PAMA 4G6MH 4PJ7E 1QO3B 5ERWA 5D1ZD 5F7FA 4N90D 5HVHC 3BD4A 4NWTH 4YUEL 4WI4A 2F5AL 3IS0X 3DYPA 3HB3C 2VN4A 4Z7WE 3S36L 5FYLD 4YEEA 5DTFB 1OP5H 1RHHB 2ATKB 4ODUA 1KACB 3N06B 5C0CD 2NY4C 2H2SC 2XY1A 4R96A 3TGXA 3MV8D 4E0RB 5ID0B 3DRTB 5IM7A 1B0GA 5D96C 2DIJA 1DBAL 2WQ8A 2A9ML 4YAQA 1QSEA 1CLZL 1R6VA 5IW6B 4RRPG 4F8TA 3G5YB 3GHBL 2NTSP 4EDWL 3JV4B 1DUYB 4S11A 4H25A 3NIFE 4KPHH 4LNVA 1E4XH 4H1LG 4KI1A 4ZTPH 5E8NB 1RZ8A 1X5IA 3QAZC 4G3YH 5CEZL 1BD2A 2GCYA 3BE1L 3QUKA 1Q0YH 5C0IB 3NFSH 4NWUH 4M48H 4UNUA 4JO2H 3MV9A 5I1IL 1EO8H 1HHIA 4M03A 4ZXBB 3GGWB 1KJ2B 1RZKC 2ZSWB 3DX9B 5DJ0A 4QHUB 1YYLH 3ESVF 3TNNB 5EBMB 2X4NB 3ARBC 3KYOB 5SWZA 5JHDB 2FO1A 1FE8H 4LIQH 3EDJA 4KUZL 4XH2A 5B8CA 5JOFA 3BH9A 2ICWA 1M7DB 1QD0A 1QG3A 4LCIL 4ZFFB 5CBEB 3D2UA 1DLFH 3T3ME 3ARDB 4NM4H 3EO0A 4K9EH 5IEHA 2P49B 4I3RL 1OARH 1GGBH 3V4UH 4EQ2A 2AJUH 3FB7A 4OD1L 3D3VD 4Q2ZB 2B4CL 4KJYB 5I15L 4M4PA 4QRPE 1INEL 1CD8A 2FATH 2FD6L 2GY7B 3C8HA 2DQTH 3K2UH 3O8XC 4O00A 3NN8A 5BXFB 3QUXA 3CXHK 4MDIA 1MFBH 3U0WH 4XTRD 5AZ2H 5MEQB 4QRRD 1DQLH 2EZ0C 3BDXA 5T1LD 1KLGA 3KPSD 3RWHB 2FWOB 1N5AA 2MNUA 4WI2A 4KZEL 1CFQA 3Q3GB 4JJ5B 4MXWL 1BJ1J 5F9AC 1KGCE 3U7WH 4XVJL 4JPKH 3P9LB 4LNRB 4NUJA 2N7AA 2VDPL 2PR4H 4CL7A 1AD0A 4AH2A 4LL9A 4G9FE 5KSAA 5CP7B 4JN2B 4KZDL 1KPVA 2WSKA 4K3GA 3VXQA 4FZ8L 3C5SB 3O0RH 1DQQB 2B0SL 4X7DC 1UG9A 4FFWD 3CMOL 1CTOA 4NKDB 4YHZH 1I7RB 3E2HC 4MB4A 3E3QE 5D7IB 3ARGD 32C2A 2V7HB 3R1GH 5CUSL 1YZZA 4G8GE 1J5OL 3HNSL 3U79A 2NY6B 3OX8A 2VABB 1U6AH 4JFDB 3L5WA 1CLOH 2UYLA 2IQAB 2R1YB 2FEDD 4OF7A 3WJLA 1K4DA 5E95B 1Z6JT 3I50H 2VAAA 1VENA 4X6CF 3NTCL 4JFXB 1IM9A 5IR1B 5KOVC 2Z92B 3TT3L 2X05A 3TO4D 4TSAH 4BZYA 3P4OB 1FZOA 1SJVA 4M6MH 5EO0B 4R9HA 3TLRA 2APTA 4DCQB 12E8H 1KCUL 3DSFL 4MNHA 1M05A 5A2FA 1JV5B 2X1XR 1TQBC 1CS6A 4GRWH 4N68A 4L3CA 3UDWA 4D94A 3WLBA 1MFAH 1SYVB 5FA3A 2EDEA 1GZPA 4RMWA 1B0RA 5J3HD 4M6AA 5I17B 1NBZB 4BQBA 7FABL 5FGBC 1WEJH 2XKNA 2V9RA 3OAUH 4M4RA 3RNKB 4F58H 4QRQB 4LRNL 3RZCC 3MRGA 3ZE0F 3DI3B 4L8BB 5HI3D 1F45A 4PGDA 1I8KA 3N1MC 4DK3A 3LMJL 4U6YB 5D1ZB 4S2SA 3DO7A 1KIPB 1IGCL 4HZLA 5CZXC 3RKPA 2D7MA 4U6TA 4LPYA 4XVUD 5HDOA 3WFCH 2IH3B 4HMDA 4TVSa 1CF8L 2ESVA 4XAWH 4OKVB 1WBYA 3PWPE 3HAEH 1OAZH 5I1KH 3V5DB 1MAKA 4HG4J 4GG6B 5LKNA 5E8DH 4XPTL 4PTUA 1FYTE 3LPFA 1CLCA 2R0WL 1UM4L 4X0KB 3GSOB 3O8XA 4HT1H 5HYFA 4KHXL 3MV8B 4ZS6D 1E27B 3IDGB 2VDRH 4J3VA 4PRHA 2EXYC 2F53E 3G6JB 3QIUC 3OKDB 3SE3C 3IS1X 2APWA 2YPVH 4RA3A 3PWLA 5TPWL 3RVTD 2JCCA 5TQ2H 2VB5A 3BXNA 3CGTA 5F21B 4JHZA 2ZUUA 4OJFL 2D9QB 1YNKH 1M7IA 1KF9B 1NKRA 2JELL 2I24N 1WJ3A 3EAKA 1XCTA 4LQFH 4LOUC 1OD9A 4WTXA 3LV3A 1U92B 4QLRA 4BKLA 4RGNC 3PDGA 2BVOA 4O2EB 2DTML 2F58H 4K7FB 1C1EL 3CSBA 5DFVC 1X5HA 4MD4B 4YPGB 4KK5C 4YDJA 4TYUA 1QP1A 4NRXA 2A6KA 1AO7B 1ZT4A 3O3DB 2DWDB 3QQ9C 3F7PC 4P5MB 1G7QB 5B38G 1CWVA 1U8NB 3B43A 4PJFE 1W72A 3U7YL 5MENA 3PJSA 2PYEB 2YC1B 1P6AB 1IAII 4MJIA 4XCEA 3QWOB 1WIUA 3VRJB 2H45A 3IDJB 4LCWA 5DQDL 3KGRA 1YPZA 3MUGB 1CDYA 4C4KT 3QXVA 4GW4A 5INCB 3A67L 1A4KB 4Y5VB 2ICWI 3JTSA 3LVEA 1BVLA 4N9OB 5D2NE 1B6UA 3D3VB 3IKKA 1MWAA 2VH5L 1UZ8B 1FIGL 4DN4H 5DYOA 4OZHB 3BKCL 2O5ZL 5E00A 3LQAH 4WI8A 3P9MA 2OS7A 1MCWW 3ARTA 4OD2A 1SVZA 3SY0A 4XWOD 1YMHB 5T1LB 5CBAB 2MQ0A 3OKOA 4Z7QF 3L7FA 4M8VA 5KANI 3MRQB 2RCSL 3HC4H 1UWEH 1EEQA 4MXVF 1QQDB 4PG9B 5KW9L 4G6FD 4OV5A 5KVEH 4MCYA 4XHJC 4XNYL 1LE9A 2I9TB 7CGTA 1WFUA 2BJML 4UI2A 4R4BB 4WW1B 5CEZD 1WZ1L 2GFBB 4ZS7H 2VQ1A 4KKLC 5HHOE 4YEFA 4ZMAT 3EFFB 5ISZB 5J7CC 2RBLA 3BPLC 1LO0L 1JGLL 5E7FA 5EUKB 3Q6FA 5GGVY 3MLSH 4GRMB 4NN7C 5FYKE 4HKXB 4JQVC 2X9WA 3HR5B 2WUBH 3NACH 4PV9B 3BGFC 2DYPD 4DAGH 4NN6C 3ARGB 3S4SB 5I19L 3KPTA 1T3FB 1MCDA 4N0FB 3AM8A 4D0CA 5C1MB 1XF3B 4GXVH 4M8QB 4E41D 5J06A 5A2JH 1NDMB 5J13B 3SE3A 2VDLL 1ZLUK 2XN9D 3VFPB 2X4PB 2AQ3A 4PRDA 3PGDA 3TYGL 2AAVA 1DVFC 1NCBL 2SEBB 3MBXH 3CVHA 1NSNL 1TVBB 1IMHC 3TF7C 4NFCA 3VGAC 5I1LB 1UENA 4JFFA 3TO4B 1MY5A 4U4BA 4NHUB 1I8IB 1GIGL 2E27H 4RAUA 3HC3H 2HFGL 2VZOA 3DETC 5DVKA 3MJ9H 2A73A 1F00I 4ZQKA 3LB6D 4KRNA 4WWKC 2A6JB 1GRWA 4KWUA 3EJZD 3Q48A 3SJVE 5KSBA 4TUJA 3HG1A 1P7KA 2D03L 2OZ4L 1XR8A 3OKMB 4N1EA 4N8CL 1A3LH 5D7KD 3SKOA 5I1GH 4CDGC 5DEGB 1DBMH 1HYSC 4HJ0C 4EBQL 1AGEA 1AR1D 1D5XA 4J2XA 1WWBX 4TSCL 1UWGH 3P9WB 1UKSA 2IEPA 3MYJB 4KRPC 2FJFB 4ZUTA 4NN5C 5DRZA 4F57L 1BBJB 3QHFL 4PJ5A 1CR9L 5HHQB 3JWOC 4NO0A 4XXCA 4AM0A 3SGDI 3BEWB 4ZO8A 1GAFH 3SCMC 4PP2A 4PY7A 4I0PC 1XF4A 3RWCB 3C9NB 4PJXF 5C9KA 1KN4L 2GJJA 15C8H 2F19L 4JM2C 1OGTA 2GAZB 4HHAA 2WK2A 1HEZA 2HFFB 2NR6C 4KI5E 4IHOA 4JHWL 1NCCL 5T3ZD 2DQUL 3D39E 4Y5XB 1BZQK 3WFBL 4LLAA 5KN5B 4GKZA 1CE6A 1CFTA 3PIQA 1A1NB 1ZHNB 1ND0B 4NP4H 1JNHA 2X4RB 5I8KH 2YSSA 2ICCA 5DI8B 1JPTH 1I1RA 4M6NH 2ATPA 5JIIA 1ZWIB 2K9UA 4GUPA 2H8PB 5I16B 2R2BB 3ULVC 2EDWA 4XWGL 4P5TC 5IFJB 4IMLB 4M3JA 5CJQL 3SO3B 3RWJB 5ABDE 2E6JA 1KJMA 3DPBA 5IBUG 4LVNC 1S5HA 4JHAH 1EVTC 2BVPA 3WHXA 2CDFA 4LLWA 2HLAA 3TFKC 1JGVH 3BT2H 3NCJH 1H3WM 4P4KD 2NXYD 3EGSA 4NNPL 3FOLB 3SDDC 2PXYC 1NGZA 1NBQA 1GPOL 3V6FB 5ITFB 2AKRA 5HXMA 1LP9B 1BQHB 4WGVB 2FB4L 2RGSA 5GS2D 5FO9B 4ONGH 5HYQA 4B5EA 2VLRD 1FVEB 5DVLA 2VXVL 5I1HL 5L2KE 5E4EB 1IC7L 4HIIA 4P2CG 2AJZA 5J6HA 1IGIL 3VFTB 5L2JB 1NC2D 2MHAA 1OSZB 5F8RC 3MXVH 3MRLB 4HQQH 2GW5A 2FHCA 5JW5B 2CR6A 3CX2A 1R5VB 4UB0H 3C60B 4DTGH 1P7QD 2WAHA 1X5GA 3I02A 1MHHB 4U1LB 4GRLA 3FRPG 4HFUL 2WBKA 4P2OD 5EC1B 1KJ3L 1F4YL 4FQ2H 3HS0B 1J8HB 3NPSB 5IUSA 4F37F 1N6VA 2JB5H 2ZPKH 2E7HA 3B9KA 4N0YH 4TQEH 1XFPA 2GUOA 3IYLW 4PJ8D 4OCWH 4HIHA 3L3IA 4R97B 3O6LH 4YDVA 1T2XA 3I2CH 1C08A 5FOBA 2X6MA 2GJZB 3NIDF 3TVMA 3VW3H 1LDPH 2YK1H 4LSSL 4L29A 4XXDB 3ILQD 1UXSB 4QTHB 1R3LB 4G7YL 1OGAD 2CRYA 2NNAB 4LARH 4U2ZA 4I0PA 3QG6A 1SQ2N 2AK4A 3QUZC 2BZDA 3C6LB 1FLTX 5C0BB 5D93C 4P23C 5SWSE 4YNYB 4B7IA 1DEEB 5HYJA 1IEAB 4MQSB 1JWMA 3REVA 1H15A 4WHTB 5KTEL 4JEGB 4RA0C 3KXFB 2EDTA 2NY0D 2ERJC 1HQRA 1AGBA 1J0JA 3RQ3A 2VXTL 4NCC1 4E41B 4HUVB 1B2WL 4X5WB 1N6QH 4NNXA 1PSKL 5A16B 4DGVL 4GRWF 4L4TD 5GZOC 2DM4A 1D6EA 3Q1SH 2Z8WC 3RBGA 3VXUD 2DDQH 1JZ8A 1NCWL 2WQRA 1DDHB 2IAMB 3P4NB 3GMRB 3CFJA 3P11H 4XVSL 3MRMA 3AU1B 2YD6A 3BDYL 4Z7OF 4Z7UE 5DJXB 4J4PD 2VL4A 3SDDA 4PR5B 1IGTA 4QRUB 4OZIE 3FT2B 1IAIL 3GO1H 5C08E 3VD9A 4HPYL 3TT1L 1NKOA 2V5YA 4MAUH 1FLRL 4TVPE 3GSQB 4OCSH 4XP9H 4M61A 1F6FB 1D5MA 5ANMA 1MI5B 3KJ6L 4U1JB 2DWEB 4X5LA 3T4YB 2P5WE 5TGBB 2W9DH 3UZQA 3NCYS 4G6KL 2OMNA 5IB1B 1YN7B 3DX7A 4Y16D 1UWXK 3IU4H 1SYSA 1C12B 1JI1A 3FB6B 3OAYK 3OJDA 1LEKA 2YA2A 4IDJL 2MOVA 2ZCHL 5LBSL 2C3GA 2COQA 5JPMA 1IGYB 1QA9A 3EJJX 5I6XC 1MFCH 4GW5B 2BX5A 2VLJA 2YBRB 4FHBD 5E8EA 1P7HL 2F9BT 3PV7A 4NQCB 3VXSD 4AL8H 3PHOB 4FQXA 1FAIL 4WENB 4RWHA 4JRYB 4LMQE 2X41A 4Y4HD 3ARVA 1K3ZA 2BVYA 4QF1A 4M7KH 1NUGA 5BMFL 1G84A 5D1XC 1H3XA 1WLHA 2Z93A 4E5XB 4Y5YA 5K9OB 5D5MB 4L8CB 3TN0D 1UYWL 1JNLH 5AUMA 1FBIH 2YUWA 2IPUG 5IW3A 4KHTH 1KTDB 1J05A 3HFML 4P23A 5ITBL 1AFVL 2VE6B 1NEZA 5EG6C 4P4KB 1NFDE 3RWFA 2NXYB 4P46A 5BS0B 2BERA 3M1BB 3V6ZA 2RFXA 4WFHE 3OKLB 3QRGH 4OGAD 3D9AH 2PW1A 2PTTA 2GK2A 2AEWA 1QBBA 5ADOH 4X6EA 3DVGA 5LWYL 3RIFF 5CKAA 3JV6A 2QJDA 3CVIH 2BK8A 3EO1B 4L1DA 5MHSE 5K9QI 1NC2B 3IDNA 2IADA 3LOWA 2EDLA 5F96H 4J6RL 5ADPL 2AP2A 1PZ5B 5IW1A 3UZVB 3FQTA 1Q1JH 1ES0B 2X4QB 1XF2A 3IDMB 5C0GB 2BHYA 1CYGA 4H0HB 3W0WE 3GB7A 3FQUB 1A1MA 4Y4KC 4YHOH 3P4MB 4FXGB 3RHWK 3QB7C 4ZFZA 1WWCA 5DD5H 1CE1H 3UJIH 2FBJL 4F7CB 1EZVX 4PJEB 5ETUB 1ZVYA 2GJ6B 3OKNB 4N8VG 5E5UB 3QO1B 2WINA 1NUDA 1HH6A 2BOBA 3P30H 1UKTA 2E8YA 3BVNA 4WI3A 5JW4M 3X12B 4RFEA 3TBYA 1F6AA 5DZLA 4KQ4H 3KPRE 1F5WA 1MIEH 2YD8A 3CDCA 4PRIA 4MLSA 4X6CA 4AY0A 5I8OH 1OGAB 3HE7D 4C57C 1ZXQA 4I8DA 5DJAB 1FG2B 3VXRD 3C87A 3PP4H 2M26A 5EU6D 1T89C 4M6OH 5CJXA 3MLXL 5I18H 5F7YC 1G7JA 5L6YH 5D72H 3TZVC 2UUDH 3W11C 1AKJD 5EOCL 4PRAA 2GTWA 2WIMA 4MD0A 5T1DL 2NY0B 1JPGB 3E0GA 4EVNB 5F9DC 5EORH 3QIBD 2R1WB 4ZAKC 4Q9QL 5EU5B 3OB0H 3H2WA 4FQQB 3UPRB 1KIQB 1OAKH 2F54E 4L4TB 1U8OB 3VGEA 2HP4A 2VDKH 2L4OA 2Y07H 5JR1H 2BXYA 4WDIA 3VXUB 4YX2L 2CUMA 2F5BH 1RUQH 1Q9WB 1AJ7H 1EA9C 1J9CT 5EZOL 1FO0H 1RJZB 1T4KB 3E6HB 3F5WB 1D5ZA 4AENA 1U58B 4P3DA 4PJBF 3BWAA 3V0VB 1BFVL 3BGMA 1SY6A 3QJFA 3O2DH 1KPUA 1O7VA 5E9DA 4BZ1L 3U4AA 1PKOA 1D5IL 3SOBH 5CAYB 4PJCF 1W72L 4HIXH 1YQVH 1GCFA 3RDTA 3MRCB 4RFOL 1IQDA 3D0VB 2VKXA 2IANE 2PETA 4X9BA 4GKNA 4ISVB 4PB0L 2VXSH 5ESQB 3PGFH 3B2VL 5D7LA 3ZT7A 1KG0A 2XXMB 3S88H 2EICA 5I9QB 3KPNA 1MJUH 1QTYT 4Y16B 1HZHL 5E0QA 2O61A 4YFEA 2E6PA 4ZPTA 4P9HL 4Y4KA 3CX5J 1BZ9A 1TDQA 3O41A 4NUGH 1MWAL 5IROC 4WV1B 2MQ3A 3DV4B 4F33A 4HXBH 4IJ3B 1AHWC 5IV2B 1B9ZA 4U1HA 1QSED 4FQ1L 2IQ9L 3MRHB 4NQDE 2NZ9C 4JO1L 4UT6H 1L9MA 3FFCE 4IIQB 2HLFC 4Z77A 2XA8H 3EYFA 4XZUB 1JI2A 1QKZL 5T1MA 1C16A 2WBJD 2O93L 1AXTL 1PYWA 5IJVA 5D1QB 3OL2A 1BX2A 3QHTC 4FTVE 4Y4HB 5F1NB 5I1JL 4XPGH 2XG4A 1VB9A 3B3IB 5EOTB 1UKQA 25C8L 2WP3O 3TN0B 3MRNB 1BD2D 1Z0NA 4NQEA 4XBEH 3QUYC 4HKJB 4NC1E 2R29H 2NY1C 1ZGLA 3U4EA 3DV6A 4MJ6B 4XCYB 4YGVB 1MJ7L 2HMID 1WAAE 3EKCA 3Q5OA 4B41A 4MZ3A 4PLOB 4NQXA 4MAYC 3K46A 2IMMA 1G0XA 4ZOBA 3ZDYF 3HPJA 2PCPA 5EU4A 3GMLB 5D2NC 4YJZL 4KK6D 3MRKA 4ZAKA 3LRHA 4FQIH 2UZYB 4I5BB 4UOW0 5DD6A 3D2UD 4M5ZH 4L4JA 2HFEB 2Q6WB 3DIFB 5IHZB 2G5BA 1OQOA 5ILTL 2P24B 5D7JC 2MPAL 4TOYH 2I27N 3DUSA 1SJXA 2EIZA 4YE4H 4HCRA 2C1OB 1EEZA 4G6JH 4F7PA 3PWJA 3ZKMC 4MJ2A 3WNOA 3J8F7 3STLB 5DJ2B 4M1DH 5EFIA 3TIEB 1IEHA 2VISA 4KDWA 1OM3H 1A9EA 4C56A 1JNNL 5F9OH 3U9PH 3V4VL 4RFNB 1RJCA 2I5YL 2VZUA 1S3KL 4FXKA 4CNIA 5GZND 2Y6SD 4QCIA 4OLYH 3QUXD 2KKQA 2CDEB 4I48A 5J6GA 5LGHL 3HMWL 4GMTH 4JPIB 4OT1H 3IXTB 4EN3C 1BFOA 3LSOB 4UDTA 4OI7A 3KPMB 5BRZB 3CH1A 1DBJH 3S36X 8FABA 1J88A 4K9EC 1R3IH 1NMCC 1EXUA 4M43L 4MX7A 1DQJA 1BQSA 4ZPVB 5KSAD 4J3WA 3WL9A 1RUKL 1B4JL 5JTWA 5HGAA 1WBXB 4M7ZC 1Z5LB 5E2UL 4ENED 3VXMB 2AS5M 3QQNA 4NFDA 2WWKO 4LVOC 1IGJA 1VFOA 3PDOB 1KC5L 3VXRB 3SN6N 3CFDB 4GXUM 2X4OA 1VFBB 4YXHL 1I8MB 3IFOA 1P1ZB 5IROA 4D3CL 2AXFB 3MR9A 3NIGF 3ZDZE 1AHWA 1QFPA 1Z9LA 2J88L 4NZUH 5BW7C 2A77L 3M8OL 3N50A 3N1QC 1NDGB 1XGUB 2DLTA 3QIBB 1TCRA 2LTQC 5ENWA 5JHDE 1FZMA 2HRPH 4LHJB 3MLRH 3D1MC 1ZTXH 4RQQB 5GSVA 5IJKC 1K9TA 5IMOA 5EC2A 3O3BA 1A7RL 5DHXB 3TESA 2Q76B 1HN1A 43CAA 1DP0A 4RMSA 5FUOH 2Z91A 4G9DA 1MFDH 2HT3C 2Q86A 2YD7A 4WUUB 3IDIA 5AAMA 2CK0H 1T2QH 1MAML 1R3HB 3KS0H 4PJXA 4XNMB 4LPXA 1JN6A 2XV6B 3I3EA 3MLTB 5BV7C 4IRZH 2BFVL 1N64L 1EDQA 1FIEA 1UXWA 3L5XL 1JZ3A 1EAJA 2DTSA 4LHUD 1GGTA 4KI5C 1HHHB 1S9WB 4NPYB 5D7JA 5ERWB 4HWEH 4JRXD 4Z7NE 3A6CL 1I9RH 4D9QE 2ESVD 3QJHA 4OGYH 2D31A 2DKSA 3MRRA 3WO4C 1HIML 5ALBL 4ODUB 2OYPA 5M7QA 1J0ZA 1A7OL 1JPSL 5JUEL 1RURL 4WEBL 1TZIA 3WD5H 3UP1A 1EMTH 4R96B 5C8JA 2RB8A 5DMGC 5EWIL 1UM6L 2B1AL 3LPWA 5DC9B 1TJHH 5HHOA 5D7IE 4PRHD 5IM7B 1B0GB 3SKJL 5IQ9A 5JA9A 4EN3A 4YAQB 2X4SA 1QYGH 4FP8H 1QSEB 3U9UA 1NC4A 1PEWA 2VO5A 2AEQL 2XTLA 3T0EC 2DQGL 4H25B 3JWOL 3GHEL 4LLVA 4QEGA 4X9FA 3PL6C 1CIUA 5EZLA 1RZ8B 3BZEA 2OJZH 1BD2B 2GCYB 2CH8A 3QUKB 2EDJA 1BF2A 1VADA 3MV9B 3LQMA 4MNGA 3TNMA 1QBML 1HHIB 3UJTL 4KK9D 5DJ0B 4S1QH 3CU1A 3FCTA 2DQEH 3FZUC 3PABA 4KMTL 4IOFD 4LASH 5MEND 3PF2A 4KKCD 5SWZB 1ORSA 2OI9B 1KCSL 1S9VA 2EDYA 4XH2B 4MJID 5B8CB 1D5BA 5JOFB 2MWCA 2ICWB 3BH9B 4JG1H 3P40A 3S34H 3D2UB 4RISL 4DUWA 3ILPA 4NZRH 4WFGD 4KXZH 2G5RA 2BVTA 1VCAA 3RY6A 3EO0B 3O11A 1NMBH 4M3KB 4PY8I 3R8BB 5IEHB 3LH2L 1T66D 1FNEA 4BZ2L 3GMNA 4IBLT 1FL5A 4UILL 2D0FA 3FB7B 3RU8L 5DT1H 3DWTA 5FYLE 5BO1L 3LD8B 3SE4C 3REWA 4LEOA 3WHE0 1EAPA 4TNWK 2KH2B 3MLYL 3NN8B 5E2WH 4GG6E 4ODTL 4DQOH 3QUXB 4MDIB 3VI4F 3QDJA 5JIHA 3MV8E 4XCFL 1KLGB 1N5AB 1FSKC 3OB8A 4XP1H 1CFQB 3G6JE 2L7JA 4XC3H 5HD8D 2IMNA 4NUJB 3ULUH 2OXGA 1EFQA 1AD0B 1OCWL 2Z35A 4AH2B 4NT6A 5KSAB 4OCNC 1MUJA 1P5VA 2H2PC 2YPLD 1KPVB 1T0PB 3S3JA 1WZMA 4IOSD 3VXQB 4WNQA 2ILLA 3EOTL 3JVGA 2XQBL 1KIRA 4Y2OA 1BGXH 1C5CL 1KB9K 1ZANL 3L5HA 5B22A 1EK3A 1ZT1A 1YNTA 4CVZA 1TVHA 1FV1A 32C2B 4HUWA 3WNPA 3U4BL 4PJ7F 3CFIC 5EOQH 4HULB 3EIFA 4GS7B 3OX8B 3UTPE 3L5WB 2B7DT 2UYLB 3ME0A 4Z7WF 3RTQC 1JGDA 1AO7E 1K4DB 5C3TA 1RZJL 2VAAB 2UVFA 1H8SA 5CEZH 5F9JA 2PYEE 3U36A 1IM9B 1RUAH 4M1GH 4JFFD 3HAEA 3T0EA 4RMVA 1FZOB 4BQ9A 1P4LA 3PL6A 4MNHB 4X7SL 1M05B 1LD9A 3SDYL 2PN5A 3QAZB 2QKIA 1QPPA 2O5YH 1S5IL 4L3CB 1ETZA 5EZIL 4K3EH 3WLBB 5EO1A 2DQDH 1IM3A 3GSUA 5FA3B 3HG1D 2J2ZA 1GZPB 3D3VE 1B0RB 3O6KL 1TZGL 4MQXD 4OZHE 5DMIL 1BVZA 2AGJL 1BEYH 2XKNB 1RZ7L 1IC5L 2NX5D 3MRGB 2D9CA 2FNBA 1DQMH 2A6DA 1N7ML 1P53A 5HGGS 4XPFL 1SEQH 2E7MA 3KLSA 5E5MA 4PGDB 4WI6A 1I8KB 4NO0D 3BUYA 5F1IA 1OT2A 3DO7B 4S2SB 4XB7A 3CXHJ 4HZLB 1INEH 4TRPL 3LKOA 2AJSL 2ESVB 3BJLA 4RAVA 1WBYB 1R24A 2VOTA 5L88L 3L9RA 4POZC 5ISZE 2HKFL 5T3XH 1BOGA 4JB9L 4PTUB 4AEHL 2VZSA 2UZXB 2P8MA 3O8XB 2R56H 3BIKA 2Z8VC 1U3HC 3O9WC 3QFJA 4ODSH 2D2OA 4PRHB 3T3MF 2R0LL 4QY8A 1OQXA 3CLEL 4FZ8H 4YR6A 5FDWA 4JDZA 4KROC 1BPVA 4GKOA 3VD7A 3PWLB 4EUPH 1JHLH 2JCCB 4K2UL 2B0SH 3BXNB 4NO2A 3WXWL 2B20A 5HYIA 1A22B 1M7IB 2C4FU 4F9LC 3MJ8A 1XCTB 2CJUL 4F15B 3HNSH 3LV3B 4FQLL 4FN0A 4B0MM 4BKLB 1BIHA 2BVOB 5T3ZH 1QLRA 3E2HB 3DXAA 1FJ1A 3ECBA 5HDBE 1HHJA 5C09D 3OKEA 4YDJB 4LHQB 3UAJD 3NTCH 4NRXB 4F37K 5C9JA 2A6KB 3O2VL 3EJYD 1ZT4B 1YYML 4H88L 1WCQA 3E8UH 5MENB 4K3JL 3RTQA 1R0AL 1W72B 2EDHA 3PJSB 4U3HA 3DSFH 2B1HL 4MJIB 4XCEB 1KXTB 3D6GA 4UV7H 2NXZD 4QXUL 1N8ZA 1OWWA 1ZLVH 4LCWB 3VRIA 5LCVL 1YPZB 5C92A 3S7GA 4IMKC 5HGDA 4U1SA 2VSCA 5MERA 4GW4B 4GRLD 1TQBB 1MNUL 1H0DA 3JTSB 1BVLB 4ZFGL 3T09A 4LRNH 3WFEH 3MFGB 1MWAB 3OHXA 4M02A 5DYOB 2AEIT 2HT4C 2JKXA 5GS2H 3WUWG 5E00B 4JFEA 3B9KD 3P9MB 4NQUA 1H9VA 4OD2B 4GBXA 4F80A 3SY0B 1IGCH 1SY6L 1T5WA 2DQFA 1MPAL 1WBZA 3STZA 3NH7H 3OKOB 1IFHL 3L7FB 5FIEA 3TVMD 2XACC 2CDGA 1EBPA 1CF8H 2MCG1 4UZGA 3GM0A 1OW0A 4GW1A 1NLBL 4OV5B 1OTTD 3MOQA 4YBHA 4MCYB 5LG1A 1ZHKA 2X89A 1PGRB 1LE9B 4IRSC 3MRFA 4XPTH 2EE9A 3MJ9A 2KUTA 2AK4D 2R0WH 1UM4H 2VQ1B 3EYUH 1CLYH 1F11A 3HNTL 1SHMA 3VD4A 3W9DA 2NY5C 3FL7A 1QFUL 3NAAL 3Q6FB 4U1MA 4S1DD 5TPWH 3O9WA 3VD5A 3QZWA 3VRLF 3SO5A 4WO4C 4D0CB 2J4WH 4OJFH 1LP9E 3EOAA 1BMGA 2NW2A 4PRDB 2HWZL 5F88A 3PGDB 2M2DA 4WWID 1A6VL 1K4CA 1JCKA 2F74A 3CVHB 3KPQA 1ULVA 1LQSR 1QRKA 2DTMH 5JQ6H 5E99L 4JFFB 4WY7L 5DK2A 4LFHD 4F9LA 4NYLA 3CXDL 4K07A 1KT2A 4RAUB 1JWSA 4RGNB 2A73B 4JZNA 4ZQKB 2ORBL 1EZVY 4PJHA 2V17L 5KSBB 5JOPD 4TUJB 1T21A 3HG1B 4JO4H 1P7KB 2BNRD 2XWJA 1J8HE 1XR8B 5FKAA 2PUQT 3SKOB 5DQDH 4EEEA 4OZGF 5D4QA 5IVOA 2JIXA 1ZT7A 1AGEB 4WHYH 1D5XB 3MUHL 2QQKH 3A67H 5B3JF 4ZUTB 2OL3H 3RGVA 5DRZB 4BK5A 4Y4FD 1ZEAH 4PJ5B 4L5FL 4N0UA 4NO0B 2R2CA 4AM0B 1FIGH 4GSDL 3WCYA 3ABZA 4HCRL 3BKCH 2O5ZH 4PP2B 4PY7B 1XF4B 3AB0B 1Y6KR 1MEXL 5CEZE 1J1PH 1U8LA 1OGTB 4HHAB 5GHWL 2VXUL 4CADA 1HEZB 5C0BE 4KTDH 4IHOB 1EGJA 5GGQL 4KFZC 5IGXH 1VKXA 4Y8DC 5CJ8A 4AG4L 2RCSH 2Q8AH 2X1QA 2OK0H 2EXWD 4GKZB 1CE6B 1CFTB 3PIQB 2XICA 4NC1C 4UQ3A 5F1OB 1T1XA 1WZ1H 1JNHB 4FQXD 3QHZL 3LZFL 4MA3A 5IKCA 1FNLA 2YSSB 5J9PA 4E41E 3RIFK 2ATPB 2CKBA 5TE7H 4GUPB 1FYHB 5GS0H 3SKNA 1JGLH 4YXLL 4IRSA 1A3RL 5BQ7A 1FC2D 4AEEA 1KJMB 5JORA 3CZJA 1S5HB 2BVPB 3WHXB 2CDFB 1FPTH 4LLWB 2HLAB 5BCAA 4UINL 5DZNA 5B39G 3EGSB 4P46D 1Z2KA 3F58H 1NGZB 4DKDC 3BGFB 2AKRB 2HTKC 4AIZA 3OZ9H 4QGTA 3ARFA 4GQ9H 4PLJD 5HYQB 3SE9L 4HIIB 2AJZB 3HE6A 5J6HB 3NZ8A 1GIGH 2MHAB 5F3HA 1MI5E 3VGAB 1EX0A 5HHMD 1IRAY 5HPMA 3TA3D 1G7PA 3D0LA 3V5KA 4I0CC 1CFVH 3I02B 2FH8A 4KKAC 4GRLB 3FT3A 5FDYA 3BRFA 2O5XH 3E1F1 3RX5A 5DA0B 5DWUH 3FO9A 3MBEA 1U8IA 3ULUF 4FQJH 1NUNB 5M95B 1RFDH 1GSMA 4L8SC 3B9KB 4M7JH 2GUOB 2P8PA 3QHFH 4F57H 3K1DA 4ETYA 1NANH 1MQKH 1F4HA 4HIHB 3L3IB 4S1SH 4YDVB 2HH0H 1C08B 3GIVA 5FOBB 5EOCJ 3MODL 3RVUD 3HI5H 5DUBA 1KN4H 3TVMB 2X1PA 4CVXA 3RA7L 4KPHL 4ZXBC 1E4XL 4L29B 1GZQA 4JRYE 1RK0A 1G9MC 2KZ1B 4PRPA 4G3YL 2FECI 4I0PB 3BN9C 3QG6B 5HBBA 3NFSL 2AK4B 4NWUL 3ARYA 2DQUH 4MCZA 3MO1A 4JO2L 5J57B 1XZ0A 1EO8L 3QXDA 2W1NA 3OR7A 3DO3A 4LSPH 3MLVH 5HYJB 3WLWD 3UBXG 1JWMB 3REVB 1H15B 1YYLL 5DA4A 2K3TA 1L4IA 3ARDC 2AV7A 1HQRB 1FE8L 4LIQL 1AGBB 4XWGH 5C07A 3T0WA 3S35L 4FS0A 4RZCA 1YN6A 4NNXB 5I1DA 1WAAA 1D6EB 4NM4L 3EZ8A 5I75B 1T0MA 1OARL 1GGBL 3V4UL 2LU4A 3HLAA 2AJUL 3CFJB 3MRMB 1MHCA 2NPLX 2FB4H 1NPUA 1BM3L 5CFHA 2FATL 3O3EA 3K2UL 4P2QD 1D9KA 2DQTL 4J3OC 4TNVK 5A2LH 3SDDB 1DN0A 1IGTB 3U0WL 1MFBL 3IDXH 4XPHH 5AZ2L 2FYYA 4LAQL 3UO1H 2NY3D 1DQLL 2GTZA 5KZCB 5E9DD 3RPKA 5DMJB 2HYMA 5D70H 4JPKL 4M61B 4JANA 1D5MB 4PJEE 5ANMB 3RDTD 1MJJA 4CUCA 2H1PH 3GUTA 2DOCA 5HVGB 4P4RA 3O0RL 4BELD 3GKWL 3DX7B 4YHZL 5C7XH 1SYSB 5D71H 3JV0A 4ZSOA 1I9IH 3OJDB 1OGAE 4N5EC 4L3EA 1LEKB 1TZHA 4NM8H 3R1GL 1NCUA 3T0DA 4DJMA 1HCVA 1U6AL 4QXGL 3LRSA 4L8SA 5JPMB 1QA9B 4Z76A 3C5ZA 2MKWA 2VLJB 5E8EB 4DKEL 3SDCC 2ADFH 4FQXB 1LO2H 2ZG3A 2C4FT 4M6ML 4QF1B 5IT2L 4F9PC 1UCBL 4PP1C 5FUZL 2Z93B 4L4TE 4Y5YB 1P4BH 1MLBA 2NTFA 5AUMB 3VXUE 5ICXA 3S97C 1J05B 5D93B 3L5JA 4P23B 1BQLH 1NEZB 3RWFB 4P46B 4WEUD 3AMKA 4DGVH 1WEJL 3V6ZB 2RFXB 4AK1A 4F58L 2XQYG 5D1ZC 5C0RH 2FLBT 2PW1B 4D9LL 1F3JA 2PTTB 3H42L 4NZTH 4PJAF 4X6EB 3BMWA 5KSUA 3DVGB 3JWDH 1H3VA 1DEDA 2W38A 3JV6B 1YJDL 2VLMD 4LSTH 3BDYH 5B4MD 5HI5D 2X09A 1IKFH 3IDNB 2IADB 3BESR 4XAWL 4MB5A 5HHMB 5IW1B 3FQTB 1FLRH 4K55A 1BFSA 1WWAX 5EUOE 4EXPX 1XF2B 3F8UB 2PO6A 1A4JA 4KK8D 3GB7B 3WE6A 1A1MB 3I3BA 2Z4QA 2QL1A 2VDRL 4ZFZB 4EIZC 3VG0L 2ZSVA 1S7RA 2EDBA 3BO8A 2YPVL 1ZLSL 3BQUA 4Y8AA 1PG7W 4YC2C 5TQ2L 2CQVA 3WIHH 2WINB 3EYVA 4UNTA 1HH6B 2BOBB 1IGMH 3BVNB 3B9VA 2AJXH 3GSNH 4O02L 3L7EA 4UUJA 1TFHA 1YNKL 3MRBA 4RFEB 3TBYB 1F6AB 2Q3AA 4IDJH 1K5NA 1FGNH 4PRIB 1FQ9C 4KDTC 3I9GH 5MP6L 4X6CB 4OZIF 1FO0A 3W5NA 3GSWA 2N4IA 2F58L 4M1CD 1DTUA 5DRWA 3OJMB 3O2DA 3NPZB 1G7JB 1PX3A 2IPKA 4JCMA 1A6UH 5EB9A 1FVCA 5F7DA 1LO4H 4LP5A 4PRAB 4QWWD 5TDPA 2GTWB 3N85H 4MD0B 4YHPA 3VXPA 1OTSD 3WSQL 5BMFH 3H3BC 3D18A 2CKNA 5JPNA 2ED8A 3K8MA 4Y5VC 3SDCA 2YPKA 3IFLH 3QPQD 5ITBH 4WDIB 3BH8A 1YEFH 2IH1A 5IFHH 5E1AA 5IHBA 5F3BA 4RAHA 4XTRC 2DI7A 5KS9A 2OSLA 3K4ZA 4HUUA 4DN4L 3P77A 4DZ8A 3UEZA 3LQAL 5H35A 1D5ZB 2KDGA 4ALAL 1OP3H 4AENB 4P3DB 4D9RD 4EOWL 3BWAB 1V7NH 3JUZA 3BGMB 3QJFB 1KPUB 4HGWA 1ZLUH 1M1SA 5E9DB 2HRLA 4YXKH 5DEZA 4J6RH 4P99A 1UWEL 4JFYA 5KVEL 3HZYA 2V2WA 5BRZE 3RDTB 4DKAA 3H3PL 1IQDB 4JQXC 5C0CA 5I1AA 4LGPB 4ZS7L 1NFDF 4GKNB 3ARGC 3BOVA 2IBZY 5D7LB 2A74A 1KG0B 2EH7L 3QXTA 3VXME 5J13C 3MLSL 3KPNB 5E70A 2O61B 2WUBL 2FEDC 3NACL 4OQ1A 1J0HA 4JLRA 4ZPTB 4Y4KB 1BZ9B 3O41B 3BD5A 3VXRE 1UJTA 2H41A 2GYSA 4F33B 4ZG1A 1T03H 3TO4C 4U1HB 4X6DF 1G0YR 5EULV 3QNYA 4MMZC 3HHRB 4Z77B 2FECL 1CK0H 1NC4D 3EYFB 4BK4A 1FFPA 1C16B 5T1MB 1BQUA 2QTEA 1PYWB 4R2GD 5IJVB 1I3VA 4PJDA 1BX2B 3MLXH 3MOAL 4KDTA 4BH8A 1FORL 4HDIA 4Q58C 4MS8D 5J3HC 2E27L 1MHPH 3SDXA 3HC3L 4OZFH 3MJ9L 4NQEB 5A40E 5B39A 4O51A 1ZGLB 4LVHB 3U4EB 3DV6B 5DJDA 1FNGA 1INQA 5AZEH 2FCBA 5HI3C 4XNUH 4AT6A 4HS3A 4NQXB 3SE8L 1I75A 3HPJB 2PCPB 5EU4B 1RHFA 2FZ3A 4XVUC 1UWGL 1CGUA 1QBAA 3MRKB 4ZAKB 5DD6B 1T20A 5EBGA 5AYQA 2G5BB 5I71B 1MREH 1GAFL 3DUSB 2EIZB 2YKLH 3UPCA 1EEZB 1X5XA 4KTEL 4F7PB 5H37H 3PWJB 1A1OA 1E4KC 4Y5XC 1G0DA 1FP5A 2QSVA 1MVUA 4ZS6C 4LU5H 3MGAA 4QRRA 3LKPA 5EFIB 5I74C 4RGMC 2R4SL 2VISB 1GGCH 3WN5C 1A9EB 2YHGA 3KPSA 4C56B 4JVUA 1WWWX 1RZFH 4ONFH 4BFEA 3QDGA 2BC4A 1D5IH 4CNIB 1YECL 2CPCA 4FXKB 3MCLH 4QCIB 3RVTC 2K7QA 3QDJD 4I48B 5J6GB 2FIKA 4RFOH 1VFMA 1RMFH 1QNZL 1JNJA 4PREA 1JPTL 1BFOB 3O3UN 4UDTB 4M6NL 5D2LF 4QOKD 1CXIA 4BFBD 3CH1B 5DQ9A 8FABB 1UQSA 4BH7A 2WANA 1QSEE 1EXUB 3IDUA 4MX7B 1DQJB 4BSJA 3MRPA 2XTJD 3WL9B 1H8NA 4QTIH 5HGAB 3CZFA 4JHAL 1FH5H 3NCJL 1JGVL 3BT2L 4LCCA 4TUKL 1IGJB 1EO5A 3L3OA 4FQ1H 5E4EC 5LAXA 4Y1AD 4X4ZA 4YDLC 1BD2E 2X4OB 3IFOB 2P46B 3T4AA 2X10A 3MV9E 4P3WA 3MR9B 1EGJL 1ZA6A 1AHWB 3K8LA 4UOW1 4RMTA 1J0YA 3OR6A 1REIA 2ADGA 5K33A 1P2CA 4ZUUA 1TCRB 5CGYD 5ENWB 5SWZE 1FZMB 2EEBA 4OZGA 3QEGH 3U2SA 4HQQL 5GSVB 4WIQA 5IMOB 2CKBL 5EC2B 3O3BB 3NPSC 5GRXG 43CAB 4PUBH 2Z91B 1UADC 2JJSC 4G9DB 3IXAA 2Q86B 4EI5D 3K4AA 2A0LD 3IDIB 4FQ2L 4R97C 4KKBD 2NY1B 3QXUA 4XWOC 4PJXB 5IB4A 2JB5L 2ZPKL 4N0YL 4TQEL 1JN6B 4O5LH 5ILTH 1S7UA 1UXWB 5SWQA 3LKQA 3T08A 1Z3GH 3I2CL 4OAWA 3MGOA 4L8DA 4LLQA 4O4YH 3VW3L 1A6PA 1SBSH 1TIUA 1R5IA 3BKML 2HJLA 5D7JB 1JF1A 4X7TA 4BSVA 5F6IB 3BN3B 3V4VH 2DRUA 4LARL 2Z0BA 1QLFA 3DOSA 1T7VA 3IAQA 4EJ1C 5EBLA 3ET9F 3SQBA 1Y18A 2N56A 2R8SH 3QJHB 4ZO9A 2D31B 3MRRB 4YZFE 5GGSA 3WN5A 1TNMA 3O4LD 4HGMA 5DQJA 2F8VA 4ZNCD 1U8KA 3BKYH 1TZIB 5FV2A 5C8JB 5DJ8A 5LGKA 5HHOB 4M43H 1JIBA 3QFJD 1AIFA 1N6QL 5IQ9B 5DGRA 4EN3B 2X4SB 5E2UH 2B4CC 2JJWA 2BY0A 3NMEA 3Q1SL 3U9UB 1MHEA 5F9WB 2ARWA 1NC4B 1NFIA 4QHMA 2YOCA 3E6FA 4JKWA 6CGTA 3LB6C 1W0WA 3BWUC 4M7ZB 1BAFH 3P11L 3EJZC 5E56A 3BD3A 4Z6AT 4Q9CA 4LLVB 3D69A 3OAYH 1PEZA 5BZWA 4LSRH 5EZLB 3BZEB 2EH8H 4LVOB 3EDEA 3R4DA 4CU7A 4TTDD 4NOFA 4IRJA 2A77H 3TNMB 1VADB 4MNGB 4JCLA 1I1AA 5J12B 1AR1C 4I2XA 3VG9B 4MAUL 2NW3A 2P5ED 5CKGA 4U7KA 3FCTB 2VKWA 2QSQA 3GEWB 4OCSL 4YDKH 3PABB 4XP4L 1ZK9A 3T2NH 1B88A 5FCUL 1ORSB 2Y7QA 1S9VB 1D5BB 4KJWC 3DGCR 4H1LH 4HAGA 1WITA 3MNVA 2CMRH 3ILPB 5MEOA 9CGTA 1MAMH 3CFEA 2EO9A 3O11B 1ACYH 1ZHLA 1FNEB 3GMNB 1FL5B 2YN3A 3I84A 3L5XH 3QXWA 2VUYA 2ESVE 3REWB 4LEOB 3DECA 1DBKH 1EAPB 4LBEA 4K7PL 2P8LA 2QQNH 4GBXD 3QDJB 5DJ6A 4V1DD 4AL8L 2W92A 3GIZH 1WICA 3MRIA 4PRHE 4HWZA 4M7KL 4JPVL 5ALBH 2X89D 4P4KC 1LMKA 4YDIH 3G6DH 4X5XA 2NXYC 4XVTL 1A7OH 1JPSH 1JTPA 2Z35B 4NT6B 4HSQA 4GRWB 2JCCE 1FBIL 1MUJB 4KHTL 4MB3A 2DYPA 3GMPA 1UM6H 2B1AH 4WNQB 1KULA 3SBWC 2AXJA 4OLUH 5C0EA 1KIRB 1ZHBA 2BSSA 3N1GC 5TE4H 5F72S 4C4KO 1ZT1B 2XN9A 1YNTB 4CVZB 1TVHB 2XI9A 3D9AL 1FV1B 4HUWB 3DROA 1MVFA 4Z7NF 5F97E 1LNUA 2XZQH 4WW2F 4XAKD 2DQGH 3CVIL 1JGDB 4ZFOA 4RGOL 3KLDA 3ROLA 5MENE 2EIBA 4P2OC 5F9JB 3U36B 5CZVH 5F96L 4MJIE 4PY8J 3HAEB 3T0EB 1HKFA 2QHLA 4XP6H 1Q1JL 5GGRA 1P4LB 4LCWE 1AGDA 2YRLA 3PL6B 2ED9A 3WHE1 1YPZE 1LD9B 4KDVA 5D7IF 2Z8RA 4PJ8C 2QKIB 4W68A 1ETZB 5IHLB 4YHOL 5EO1B 1XCQA 2JJVA 3PQYA 1IM3B 1CIDA 3GSUB 5DD5L 2VQTA 1NL0H 2VDMH 1FZKA 2EC8A 1CBVL 3BZFA 3ESUF 1YMMD 4KRLB 4EUPA 5HHNA 3ILQC 1QHPA 2BCKA 2A6DB 3P30L 2JIXD 3THML 3LH2H 3BJ91 2W91A 3WFHA 4JAMA 4BZ2H 5E5MB 3T0VA 1B6DA 1MIEL 3RU8H 1JYVA 5F1IB 3BUYB 5JXEA 5I8OL 3OXSA 4X4MA 1L6XA 4HWBL 3T0XA 3LKOB 5GS1A 1GH7A 3RPIA 1U8MA 4J1UA 1KB5A 2NY0C 4ODTH 1M4KA 5I18L 4RAVB 1R24B 1E0OB 3NA9H 3L9RB 1A7PH 3RBSA 2EIEA 1XR9A 5JZ7D 3MTRA 1BOGB 3ZHKA 1U93A 2G9HA 2P8MB 3BEVA 5CHNA 3BIKB 4OI8A 5EORL 1OCWH 3QFJB 3RVWD 3C2AH 3QBTB 4TULH 4K71B 1FSKB 1MRFH 5ID1A 4HH8A 1OAKL 2OJEA 4OLEA 4QY8B 4YR6B 5FDWB 4JDZB 2Y07L 3EOTH 3B5GA 3R0MA 4J4PC 4PJAA 1V3MA 4NO2B 5ACMA 3OV6A 2FX9H 2F5BL 4M93C 1NMAH 1AJ7L 1JHKL 2EO1A 4GG6F 3ZL4H 3MJ8B 3U4BH 5K59F 4KXZI 4JFFE 4WFED 5KG9A 2VLRA 1QLRB 4HJJL 3DXAB 1FJ1B 3ECBB 4RGNE 1JYWA 2AABL 1NGPH 3O2DL 1HHJB 3OKEB 1SJEA 1CD1A 5C9JB 5IVXA 3ARFD 3SOBL 5KSBE 3MSPA 3HG1E 3HKFA 3RTQB 1V05A 3VWJA 1V5JA 2DAVA 4Y16C 3BIBX 1P7QA 4OB5H 1NCNA 2VRAA 4X7SH 1LVEA 5I0ZA 2A6IA 4P2OA 4YQXH 1Q0XH 2YD9A 1N8ZB 3VRIB 4CVUA 5GRUL 1NGXA 3S88L 5J1SC 4PV8A 1JJUA 2VZ1A 3K80A 5HGDB 1MJUL 4PJ5E 4U1SB 5MERB 2IALA 1JTOA 3O4OC 4PJ8A 4G6AD 3O6KH 1TZGH 1H0DB 1RZ7H 1IC5H 4IIQC 1K6QH 2KZWA 4YHKH 3MBED 3OHXB 1QFOA 4JFEB 4Y4HC 1XH3A 1GOFA 4UT6L 3VFRA 5KVGH 4GBXB 3FMGH 1B3JA 3N1FC 3TN0C 2XA8L 1T5WB 2DQFB 3HMXL 4XHQA 1WBZB 4KJQD 3STZB 4TRPH 2AJSH 3AS0A 2CDGB 5EPMA 4GW1B 5HDLA 4J23A 4XPGL 2MSPA 1QRNA 2RAMA 1ZHKB 1OWRM 5IWLC 4PRPD 3MRFB 3NFPA 3HI1A 4XBEL 1T1YA 2R29L 4OGAC 1F11B 1XMWA 4QGYA 3W9DB 4MJ4A 5E4IA 3UTSA 1MELA 3DYMA 3WJJA 4U1MB 1HINH 3T2OA 1RV6X 1U8HA 3O9WB 5F7WC 4HFWA 1ADQL 3H9HA 3QZWB 3CIQA 2XT1B 4A2MA 5C07D 2OL3A 4YFLF 3EOAB 4PJ9D 2NW2B 5F88B 2VXQH 4G6JL 1K4CB 4J4PA 2F74B 3GRWA 3KPQB 3B83A 3TH3T 2WIIA 3W39A 4M1DL 1F4WH 2W9EL 5DK2B 1CZ8L 4NYLB 4JZOA 4X4XA 2ARJA 3U9PL 1YDPA 1KT2B 1CGWA 3D5OF 1JWSB 1OL0A 1D9KD 3AXLA 4AEFA 1YYMH 3MJ6A 2DQCH 4MA7L 1IBGL 4JZNB 1R0AH 3I6KA 2HN7A 4PJHB 4NZDA 5FYJD 4PRNA 4JY6A 1YEIL 2VWEE 3C8DA 1T21B 4XBPA 2XWJB 1IGFH 2WWMD 5F8QC 5FKAB 1DBJL 5EUOA 1S7WA 2MTPA 1R3IL 4Q97A 3QQ4A 1UACL 1S7TA 4KJPD 3MZTA 1FCCA 3HE7C 2JIXB 1ZT7B 4X6DA 1KYOJ 4I9WD 3U6RA 3PUCA 1AD9A 4ONOA 3RGVB 4RDQF 4N0UB 1Q38A 1Q9OA 5E1HB 2Y5EA 4R4FH 4L3ED 1U8LB 4OCRH 2AK4E 3GZKA 3QIBC 4HH9A 4CADB 5DJCA 5I30H 3VXSA 2KL6A 2W60A 5ICZA 1EHLL 4KGLA 5CEYA 1VKXB 4NZUL 5HYJE 4XMPH 1NLBH 3C5ZD 2QR0A 1IC1A 5IBLD 1GC1H 3MUY1 4UQ3B 2HRPL 2P7TA 1T1XB 5JW3L 4MA3B 3FJTA 3MLRL 4WGWB 5IKCB 3LDBB 5J9PB 2FSEA 1YY8A 3PWUA 1MAJA 2CKBB 5FUOL 2W0FA 3SKNB 2VTFA 5IWLA 4IRSB 1MFDL 3LEYH 5BQ7B 1G6RH 1CICA 4BJLA 5JORB 1T2QL 5I76A 4P3CH 4C59B 3M17A 3MACL 5T5FL 2FGWH 3V9FA 2CD0A 4HPOH 3TO2A 4IRZL 2B2XL 3GMQA 3S35X 1CFNA 3S5LA 1D7FA 1I85A 5F7MC 5IB3A 4AIZB 5HPOA 3L3HA 3ARFB 2NMSA 5JOPE 4EDXA 1KEMH 2FRGP 3CXDH 2ITDA 4HEME 3TP4A 3HE6B 3NZ8B 1QSFD 3VDCA 1I9RL 5D2LA 4RMRA 3IFPA 5F3HB 5ANME 5CS7A 2ORBH 4HK0A 4OGYL 3LN5A 1A14H 3ZT5A 4ZOAA 3H9SD 5HPMB 2EYRA 5LXGL 1DZBA 1G7PB 3D0LB 3ALXA 3V5KB 4HX1A 3DRQA 3OG6B 1EMTL 3FT3B 3UTTA 2AW2A 4Z18A 1RJYA 3GBLA 5F1KC 3FO9B 3J7HA 4I4WA 3MBEB 1U8IB 2WBJC 1PJ9A 2OQJA 4FP8L 3BQUD 1UEYA 2CIIA 2P8PB 4L5FH 5GXBB 1CT8A 5GRYA 3HE7A 1BWWA 3GIVB 2VC2H 2VLJE 5DUBB 3L1OH 5EU6A 4CVXB 1RUPL 4APQA 1GZQB 2P42B 4JR9L 2HMIC 1RK0B 2K7PA 4PRPB 1CU4H 5GGQH 1AKJA 4PJGA 4MCZB 3MO1B 3VGFA 1XZ0B 2OI9C 1WV7T 1KOAA 3QXDB 4KK6C 3OR7B 1BJMA 3RAJH 3WNKA 5SV4A 1MF2H 1DANU 3LZFH 4F7EA 1OPGH 2Y25A 4LASL 4ZO7A 3S4SG 1FFQA 2AV7B 4YXLH 4XNXH 1A3RH 3QR2A 5C07B 4JG1L 5I0DA 3S34L 4RZCB 1YN6B 1G7IA 4HUNB 3V0AC 5I1DB 4NZRL 3BMVA 4OGZA 2CLRA 1MCQA 3NCEB 3ZE2F 1NMBL 4ZOCA 1LK2A 1T0MB 5AEAA 1ZA3A 5GZNC 2Y6SC 3QUXC 1A6AA 3F7YA 3HLAB 5DT1L 4XI5D 1MHCB 4P57A 5HHME 4RDQG 3CMGA 2VR5A 2V5RA 3O3EB 1D9KB 5E2WL 1OAYH 3FO1A 1DN0B 4ZTOL 4G8IA 4DQOL 1JVKA 2FYYB 3SE9H 3C08L 4YK4C 1WTLA 5KSAC 4HS8H 2GTZB 4XP1L 4ENEC 4XC3L 4KVNH 3ULUL 4JANB 2W0LA 3LS5L 1MJJB 2AVGA 3GUTB 3DUHA 4AZ8A 5C86A 3MC0A 4P4RB 4W6WB 4WI9A 1CTNA 1BGXL 1IAMA 4GS7C 5DVMA 3MJ7A 4PRIE 1VHPA 5FM5O 1C5BH 4X6CE 1MJ8H 2ZOKA 4ZSOB 3WJLC 4D0BA 4NIKB 4L3EB 5CMAA 1TZHB 5TFSL 4U1NA 4NRZA 5DHYA 3KLHD 5EOQL 3KJ4C 2WBJA 3MODH 1H5BA 3B6SA 1U8PA 3LRSB 4L8SB 4D8PA 3K1KC 3RA7H 2ZKHH 2EKJA 4Z76B 2J8UF 3C5ZB 1X3DA 2XG5A 2DIBA 4ELMF 4JRWA 4PGBA 3UDWC 1PY9A 1RUAL 4M1GL 4KAQH 1QVOA 3KPLA 4WU5A 4MVBD 4GAJH 3F6LA 3QISA 4N1HB 1INDH 2FH6A 1MLBB 2NTFB 2O5YL 2C3VA 3GNML 4K3EL 5ICXB 5C0AA 1G7HA 2DQDL 1AI1H 2E9BA 3S35H 5I73C 1BEYL 3F7RA 4UIMA 1DQML 3WIHA 3Q6GH 1HI6A 1BQHG 1F3JB 1SEQL 3FOMA 3GSNA 4OF5A 4DZBA 4ZDHA 5KSUB 2XNAA 5E9DE 4POYA 5D5MF 1NANI 4ZFOL 3R06A 1ACZA 4R7NA 3PHQA 1BM3H 3GSVA 2W0PA 2ZCKH 1TETH 1PQZA 4GH7B 4LAQH 3D85A 1T0NA 4QNPF 1XGTA 5T3XL 1PX4A 2X4TA 2C4XA 3QDGD 1JZ2A 5D7LE 5E94A 1CVRA 1A4JB 2PO6B 1NGYA 2R56L 3OQ3B 3WE6B 3SQOH 4OIBA 3P3YA 3ELAT 2Z4QB 4U3XA 2Z31A 4ODSL 5D7SH 1ORQA 4H0IA 3SPVA 5JIPA 2ZSVB 2ED7A 1S7RB 3BO8B 2CGRL 3BQUB 4O9HH 4QT5A 1CI5A 4HLZG 3MLWH 1JHLL 4F15C 1JZ4A 2R69H 2I60H 3PWVA 1JL8A 4HG4K 3GKWH 2FX7H 3EYVB 4WW2A 1L7TH 2IFFH 3L7EB 4UUJB 3MRBB 3PWPD 1TVDA 1PDKA 1K5NB 4KK9C 4ZYKA 1EH9A 5A3ID 1FO0B 2LVCA 1BBDL 4KTYA 4O2CA 4QXGH 3GSWB 5T3ZL 1P4IL 4IOFC 1FVDA 1A6TA 4PLNC 4HK3J 3BPNB 4KKCC 1KB5L 2BRQA 3RVVD 3GJEA 4U0RB 4X7CC 5DRWB 4NQEE 1WFTA 2F53D 4LSQL 4DKEH 5J56B 1PLGL 3UROR 4PJEF 5JO5A 5J4MA 2IPKB 4BQ6A 5K9KA 4OM1H 1FVCB 2P48B 5F7DB 3E8UL 5TDPB 5IT2H 4YHPB 3VXPB 5ECJE 4DKFL 1UCBH 5FUZH 3D18B 5JPNB 1T66C 4UV7L 3SDCB 2YPKB 3QXAA 1FFOA 4YH6A 4P9HC 4LPCA 4YBLC 4MSWA 1N5YL 1LWRA 5BJTA 1G9EA 3BH8B 1PD6A 2BNUA 2IH1B 4Z7QE 5E1AB 1JE6A 2Y9RT 5F3BB 3VXOA 5BZDA 3WFEL 1KTKE 4MXVE 2YUVA 5KS9B 4D9LH 2OSLB 4HUUB 4LDOB 4OTXL 3IVKA 3P77B 4DZ8B 4LHUA 4LLDA 3H42H 4JVWA 1J18A 5H35B 5IP4A 4C56E 5HD8C 2WLYA 2I9LA 1YJDH 2E3VA 4JRXA 4CDHA 1KCLA 4QXTA 3EW3B 3JUYA 3NH7L 4HGWB 3T1FA 1T6WA 2DLGA 1OF2A 1RULL 5F6HJ 1AY1H 2P4AB 4JFYB 3EOYG 3HZYB 2V2WB 4L3AA 3T3PF 4OZFA 5C0CB 4L4VA 5I1AB 4HS6A 5JHLH 3LN9A 1S9KC 1NCDH 4XCNA 3EYUL 1CLYL 4JO3H 2ZUTA 3GI9H 2V5TA 4H26A 3WDJA 3AM8C 2A74B 5I1CH 3F62A 3VG0H 3V6BR 2BHZA 3DURA 3GSRA 1ZLSH 1N4XH 1TPXB 4JLRB 1G7LA 5DMKA 4S1RH 1BIIA 4TVPL 5L0QB 3V4PH 2J4WL 1SBBA 4O02H 2BRRH 4CJ1A 3CUPA 4YO0A 2PYFA 4LSUH 1RZKH 3U0PA 5ALCH 3IJHA 4B50A 1YEHH 3QNYB 4YC2B 5MP6H 3UJJL 4M