1FNSH

Crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVDWVRQPPGKGLEWLGMIWGDGSTDYNSALKSRLSITKDNSKSQVFLKMNSLQTDDTARYYCVRDPADYGNYDYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN NMC-4 IGG1
publication title von Willebrand factor conformation and adhesive function is modulated by an internalized water molecule.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsH01
3GJFB 3KR3H 1IAKB 1OPGL 3AXLB 5DTFA 3NA9L 4PJHB 4XZUA 3INUL 1KT2A 3AFLA 3MLTB 1AJ7H 1CE6B 3D3VE 1NGZB 4DOHB 1SHMA 3F7YA 4X0KB 4DW2L 3OWEA 1W0YT 3BWUC 4OGXL 5L2KB 3F7RA 5KG9A 2F8XC 3F8UB 4RDQG 1QR4A 3DRQB 3MRHA 4M6NL 4APQD 4ONFL 4X80L 5ID1A 1FO0B 3C9NA 5FYKH 5ALCH 2XTJD 1Q9LB 3IKCB 4KUCF 3PGDA 4XPBL 4JFQB 3WNNA 3EHBC 1NANI 4WWKA 1DVFD 2V2TA 4MXWL 4U1HA 5HJ3B 4M4PA 5JHLL 1CG9A 4L8BB 5C07B 4IMKC 4WDIA 4OLUH 3LHPH 1FCGA 3LPFA 3MACH 1RUKH 2C3XA 4JO3H 3SDXE 3L5WB 1TJIL 2VIRB 3IDYC 2OCFD 5KVGH 5BO1H 4JFDD 4RGMB 4ZXBA 4HGWB 2DIJA 1AQDA 5FF6B 2NY2B 5GSVB 3ARFC 4YFDB 2HN7B 4X83A 2IAMA 5CEZD 4NRZB 4HK3N 3VFSB 4KJQC 1TIUA 3QUKA 3Q3GA 4WHYG 4Y5VC 3ZT5A 3PABB 5LXGH 1J1OL 2F53A 1KCVL 1UA6H 2YXMA 2G75A 4LEOB 3SQBA 1RUPL 3SKMA 1NLBL 1NGXA 1WBZA 5JXEA 4RIRB 4V1DB 5T5FL 4G8GD 1U3ZA 3PDOB 1HDMB 4Q6IA 4JO1H 1MSPA 5L2KD 1VFOA 5AZEH 1OP5K 4HX1A 3IJSA 3PWLA 4TTDC 5I74B 3MRMA 3FQXB 2Z8SA 2AABH 5F6IC 1SEQL 4H20L 1RY7B 2R29H 5HHQB 1HQ4A 5BZDB 5CBAB 2IMMA 5DEZA 2OBGA 4PJ7E 3THML 5CJXA 2FNBA 1RUMH 4GMSH 3HE6B 2AI0L 3H9HB 2XA8L 3MLUH 4QHLB 4EI5C 1MF2H 1B90A 2R56H 2GTZA 5A43C 1Q72L 3MXVH 4HFWA 4GT7A 4ZODA 2H2SD 1DBJH 1J1PL 1L7IH 3GJEB 1CVSC 2NY2D 5IW6A 4KROC 5DS8B 1Z5LB 2EECA 5GS1B 2OI9B 5DJDA 1SYSB 5FA3A 4E41A 4NNYA 2ILLA 4JGUA 5F93C 4LLDB 4UILH 5C0ND 3KNBA 3BPCB 5DO2C 4YDJA 1D6EB 1UXSB 1UENA 5IEKB 2DQFB 2ICEB 4V1DD 5SWSB 4QHMB 1ZHLB 4G42A 4NNPH 4NQDB 3EW3B 4JO4L 3K4ZA 1IGFL 4KKBC 4PJBE 1UCBL 2W59A 4HJ0D 1BVLA 5EPMB 4QTIL 4OLWH 1D6VH 4F7EA 5DRZA 2UZIL 1ZKAA 3ABZA 3QT2A 1UWEL 5HHME 4K7PL 5DQ9B 1HSAA 1WCQA 3MV9A 3UAJC 4GKZA 1CDUA 3ILPA 1U58A 5CSGA 1JGDA 2HFEA 1FBIL 3BSZL 2BSTA 3P9LA 1Q9OA 2W60A 3MNZA 5IG7B 5AYUL 2VL5B 4PJXF 4PLJC 1B4JH 4NZJA 2V7NB 1IEBB 1XCTB 3IJYB 3UTPD 4ZFZA 1EFXB 4ZPVB 3E1F1 1ZV5A 4YHKL 5I1EH 5J13C 1CS6A 1D5IH 1GAFL 3QPQD 1OGTA 1MRFH 4LU5H 3VXUA 1GJIA 4XVTH 4ZPTA 3OXSB 2EIEA 3RVUD 3WDHA 3F7PC 1CFVL 4ODTH 4J3SA 3IS0X 4OSUL 5ALBH 1XH3A 2P8PB 4NN6B 5JW4Q 4WW2F 1XGRA 4A6YA 5ACZA 3D5OF 3R1GL 1A1NB 1ZLSH 4LCCC 1RUAL 4CMMA 4JY4B 1IFHH 4H0IA 4LPCA 5FM5M 5KSVB 5HHXL 2E27H 2I07B 1MHHA 3O2DL 3MJ9A 4AEHL 3SDXF 2LAGB 4LF3B 3KHQA 2QSVA 4NBXB 3IFPB 1MWAL 1WT5C 4JGMA 2JCCB 4L8DA 4DFHA 4RX4D 5C0GB 1O7VA 1CTOA 1LK3H 1U93A 3TNMB 2P8LB 4RSVA 1KELL 35C8H 4CKVX 4S1DD 1OF2B 4ODXB 1NCWH 1AGFB 3QQ9D 1NBYB 4FNLH 4LGSB 1VFUA 2CMRL 2XXCB 5DJCB 5J12B 3DSFH 3NZ8A 4HJGB 4JM2A 3QP3A 1GYAA 4HHAB 5F72S 3CLFH 1MLCB 5TF1H 3HNSH 5IOPB 4KKAC 2CUHA 2VLLB 4Y1AA 1QSEA 1NC2B 4Y5XB 4YR6A 5F3BB 2FATH 3FQNB 5IHUL 4UNTA 1MWAB 2R0WL 1ORQB 3CDYA 4BSJA 3QG6A 4OIIL 1MNUL 1SM3L 4ZUSB 1N5YL 1MFDL 4M4RA 3RPIA 1B88A 4L3ED 1P5UA 3HZYB 1JGVH 1Q1JL 4PJ7F 43C9A 1A3RL 4QKXB 1JNJA 3NGBC 2P5EA 4M1CD 4F37K 3P0VL 3U7YH 2X4SB 2B1HL 3ESVF 1FAIL 3Q5YA 4XNUH 4HXAH 2X44D 3GMOB 2QQNL 4K2UL 3ULVF 3KDMA 4XAKE 3RGHA 5FCUL 1R3LA 2DAVA 4YNYB 4JKWA 5CINH 4TUOA 2IEPA 1NUNB 5I1LA 2FX9H 1JHLL 4UMGA 3CPLB 5FYJE 1S9YA 3D39B 3BW9A 4NJAL 4BK5A 3GM0A 4R0LA 2VABB 3W82A 4PS4H 3NCEB 3T0BA 2GSIB 4OZFB 4ZDHA 3ZDZF 4CU8A 5B8CA 4UB0H 4D8PB 1I3RB 3TJEL 3OXRA 4NZTH 3WFCH 1DN0A 3KPRB 1NC2D 3T08A 3QNYB 1ZGLM 1U41A 4XTRD 1SY6H 2O5XH 3GRWH 4PJBF 4MD5A 4U3CA 3B2VH 1ZA3B 4EKXA 4YFLF 1K6QH 5INCA 4JDVA 4K71C 4U3HA 1TVHB 3CVHH 1NGPL 4D0DA 1N64H 3EO0A 3V7AE 1R3KB 2H26A 2D7MA 1T66C 1C12B 1H8SA 2OXHA 4AH2B 4KZDL 2NY1C 1U2CA 5DD5H 4DK6A 4NBYB 5C86A 1CDJA 3RNQB 5HTSA 4BSVB 4FABL 1T03L 4GXUN 2VUOA 3D69B 1KTDA 4FQJH 5F96H 3P30L 5T1DL 2OL3A 3BHBB 1J0HA 2HMIC 2NY7H 4MJ4A 1HHGA 4D0BA 1QSZA 5E6IC 3ZT7A 5CJQH 1HHIA 3D39D 4L29A 3WFDH 4Y4FA 1ZHBA 1NEZB 3QUZA 4TRPH 3X11B 5BCAA 5I1IH 2ERJB 1A6PA 1CFTA 3HR5B 4OCSL 5C0JB 5IVXF 2ORBL 5IB2A 4JPIB 3VFMB 1X5HA 3KPRD 3ULUL 3L6FB 5DVOA 3TPUA 5ADPH 2X1PA 2DI8A 2AAVA 4PY7B 4U1MB 2QHRL 4YIQA 4XNMB 2OZ4H 4OCNC 1RZ7L 1S7WA 3RFZC 3DVFA 5DTFB 1MI5B 4XZUB 1I4FB 2YRLA 1KT2B 4UAOB 2HTLD 3F7YB 5C3TA 4OCLC 5F3HA 4PGDA 5CUSH 4KRPC 5KG9B 3VH8G 4G3YL 3MRHB 2Z31C 5ID1B 1JIBA 4M5YH 2D7TH 1C5BH 1J88A 5M94B 3PGDB 1CIDA 3JWNC 2FO1A 5EZJA 1E4XL 4NJ9H 3EYUH 2NY0C 4M7LT 5ANMB 2V2TB 1DBAL 4MAYA 4U1HB 3VFPA 4JY5H 1CG9B 4CMHC 1JK8A 1T80A 3BQUA 4WDIB 4OZGB 4QRQA 3FO0H 1OB1A 7CGTA 1JRHI 4XCNA 2WLYA 1GPOH 1WF5A 4ZUTA 3MV8E 2FCBA 1AQDB 3H7LA 1G9NC 3HI1A 3OKEA 4FFWD 4JHZA 3WNKA 4HXBH 2UZYB 3EDJA 4XHJC 1T3FA 4P0DA 3T2NH 4DJMA 1YNLL 1ZGLB 5IBTH 5DJ6B 4LSTH 1FH5H 1FG9C 3LH2H 2F53B 4AENA 1M7XA 4MA1C 5KSAA 1KCRL 3SKMB 1OP9A 5KVEL 1WBZB 4FFZL 2X9XA 1AD9A 5FYKE 4Q6IB 2BMKA 1ZANH 4NP4H 5CP3A 4TULL 3ARBC 1HH6B 5ESAA 1I3GL 5I76B 5I8OH 4NOBA 3MLZH 3IJSB 3PWLB 4Z8FL 1KPUA 5DT1L 2HWZH 3K3QA 3MRMB 3IF1A 3ULUD 2NY5C 3U1SH 2H32A 3S35X 4H26B 4YQXL 4Z78A 3NACL 1HQ4B 1NUDA 1JF6A 1LO2H 2UYLA 4LP4A 5L7XL 3UYRH 4WWKD 1CF8H 4LMQI 1JL8A 3EOBB 5D1QC 5I8KH 1J1XH 5D93B 5JW3H 3KYNA 2R4RL 4NM4H 4IDJL 3U4EA 2FJHA 5E94A 3SE9L 1FFNB 4HFWB 4OFPA 4LVHC 4ZXBD 1AO7E 5IW6B 4XXDA 2EE9A 1JZ2A 2IJ0C 1L0YA 2IAMD 5C1MB 2W0KA 3RKPA 3OAYK 1CD9B 1F3DH 2MPAH 2KH2B 1AI1H 1NAMA 1YEKH 4ONHB 4ONOA 2VOTA 2YA0A 4NNYB 4KK9C 4CL7A 5EN2A 2F53D 2PN5A 5AG9A 3KNBB 1WTGT 2V17H 1CLCA 1DFBH 1Q0YL 5HHVL 3SE8H 1X4ZA 4YDJB 1DUYB 3CSGA 5JXED 3R06B 4G42B 4PJAF 4OKVA 3DHMA 1BQHA 4DKEH 4LNRB 3W11C 4XWOD 1U3HC 4NFDA 4IMKA 3IDNB 1AXTH 5DRZB 3TWCL 2NLJA 2CDGA 2W91A 3OR6A 1QLRB 1HSAB 2I5YH 3TESA 3MV9B 1HKLL 4LAQH 4Z9KB 3ILPB 5ISZA 1U58B 1MRCL 5EBGA 4U6YA 2HFEB 4X98A 1Z9MA 2EIBA 4C83A 2ICWI 1OAYH 4YHPA 2BSTB 2B1AL 2W60B 3MNZB 3P9LB 1X4YA 3HI5L 1JWMA 4JFYA 2VDRH 1A5FL 2HKHH 5ETUB 25C8H 4Y16C 1S7XA 1D5BA 4MQTB 4A6YL 1G7LB 2YD3A 2ZUUA 3GIVB 3I02A 3L3KA 1CU4L 5GZOD 5HDQL 1UWGL 2OP4L 4HIXL 4LVNB 3KLAA 5SWQB 3NAAH 1Y6MR 4ZUUB 2RHEA 1T2QL 3IDJA 2ZCLL 2LTQB 4E41D 4KVCL 4DZBA 3MJ9L 4P9HC 2NZ9C 5D1XC 3MUZ1 4P9MH 3BH9A 4ZPTB 4LCWE 3HRZA 5HI3C 1RFDH 1T6VN 4HV8A 3FB6A 2WQ8A 1P4LA 5F1IA 3BP4A 4OLZL 2C1OB 5I1CL 5DMYA 3GI8L 4YHML 1FO0H 2VR5A 3DUSA 4KFZC 4DAGH 3QRGL 1F4AA 1XH3B 2CKBA 1NANH 1IM9A 1LNUA 2Z35A 4M7JH 5J1AA 1XGRB 2DJSA 4LOUD 1RMFH 1T89C 3OG6B 4OGYH 4A6YB 5ACZB 1BREA 2BNRE 2V5YA 4GFTB 3AU1A 4P2CG 5C09E 3ZL4L 4EI5A 5TPWH 4JANB 1MHPL 1RSFA 1MHHB 3MV9D 3C60A 2AJYL 1CFSA 1KEMH 4NQVB 4GJTB 2AQ1A 4N0FA 4L8DB 1A3QA 1UB5A 2O5YH 1U93B 3IDMB 1H0DA 2I25N 1GC1L 3Q6GH 2FGWL 1Y18B 3BT2H 1IGCL 4TVSa 5F7HA 5J4MA 1D9KC 2BOCA 3SO3B 3QA3A 1MVFA 3CMOL 4U2ZA 3EBAA 1JE6A 1RIVL 3NZ8B 4F15C 3T0DA 4JM2B 5HGDA 4PG2A 1B2WL 2Q3ZA 2PO6C 5D7IA 4F9LC 2FB4H 5HYSA 1QSEB 4UQ2A 3VXUD 3OQ3B 4MCYA 2MJWA 3N0PB 4YR6B 3MNVA 3V6OC 5DUPL 2E3VA 3C6LC 3QG6B 3B5GA 2YD7A 3L3JA 1JMXA 5F1NA 4KMQA 1F3JA 5FKPA 3QI9C 4ZTPL 1NMAH 3B6SA 2D7QA 5CZVH 3DNKA 3EDKA 4KDTA 1P4BL 2B2XL 4JCLA 3CFEA 5HYJA 3NH7L 4L8SC 1CZ8H 2P5EB 3QCVL 4I3RL 3MXWL 5FFLA 2YUWA 4JKLA 3X14A 4LSPL 3BPOB 1XGTA 4PLKD 1YY9D 4N0RA 4TUOB 5I1LB 5FO9B 1YMHA 2IANE 1CFQA 4S0TD 3BW9B 4R0LB 5L88L 3IRPX 1IGML 5F6HJ 3X3FL 3Q6FA 2VSDA 4ZDHB 5FAAA 4JM2D 1ZVHA 2VDNL 1RURH 5B8CB 4WUKH 3WIFA 2VLJB 5FM8A 3EYFA 4M6MH 4Q9RH 1DN0B 4Y1AD 1QSED 2MFNA 5BS0E 4NQCA 2E9IA 4F9PC 4Z76A 4LSQL 4LCCA 4PRIE 3DI3B 1IC4H 2D03H 2OL3L 3BKJL 3RJDA 2FX8H 3UJIH 4PGJA 5INCB 4DEPB 4XPTL 4X6DE 2XZAL 5C0BA 4JY6A 1CDCA 4BKLA 3HC4L 3RWJA 3QDJA 1JHTA 5FYLH 3EO0B 1ACYL 1NLDH 1DANU 2H26B 4K9EC 2GSGA 2PETA 2IQ9H 5IR1A 1WT5A 3IDXH 3JZ7A 5FHBL 4D9LH 3H42H 3PDDA 5HYQB 2P5ED 3TT3L 3WJJA 2DTML 1QHOA 1FL5A 4CVXA 4PRAA 2QLVB 3Q5TA 4FN0A 1XF4A 3FKUS 5C08E 4DUXA 4S1QL 3FT3B 4K94L 4IMLA 6FABH 5EO0A 3S9DB 2FYYA 4XWGH 3FCTA 4M7LL 3TFKD 2EE6A 1HHGB 4KTDH 4DGIL 4L29B 3V79C 1UB6A 4Y4FB 3WIIH 3SGEI 1QSFA 3KWWA 3T0VA 4DCQA 2R69H 1CFTB 1MUJA 1JGLH 1C7TA 3SDYH 3P4NB 5IB2B 3TBTA 1T0NB 4OF6A 2Y5TA 3TPUB 2X1QA 2CO7B 2EIDA 3B5TA 4N8VG 3BN9D 4UV4L 4ZFOB 1T04A 3C5SA 4U7SA 4YJZL 1S7WB 3L3HB 1KPRB 3MO1A 3PWVB 3UPRA 4KPHH 2VH5L 4FZEH 4RRPA 1C8PA 4AIOA 1I3VA 4DTGL 2P49B 1WICA 5F3HB 5BV7H 4PGDB 3ZE2F 3LQZB 4K3JH 4UU9A 4LIQL 2HTKD 3D87B 3RVTC 1W72A 1YY8A 4MNGB 3WIHH 2XTLA 1KXVC 5E24E 3ARDA 3CFDA 3TBSA 5EZJB 4I5BB 4FFYH 3BP6A 1T4KA 1A7NL 3MCG1 3K4AA 4CNIA 4MAYB 5IB4A 3VFPB 4YDLC 3QO1A 1JK8B 4FQ1L 3BQUB 2FR4A 4ZUVA 5IVZA 1I8MA 5F88A 4QRQB 4Y4FD 1OB1B 4XP9H 3QUZD 4XCNB 1MJJA 5EIIA 1YECL 2P8MA 3D0LA 2R4SH 3HI1B 4XP1L 5DUMH 4YHIA 4KJWC 2MWCA 1T3FB 1IKFH 2D3VA 1OD9A 4HFUL 1NGWA 4CW1A 1OTSD 4U3XA 4Q58C 1A6AB 4NGHH 3KPNA 4K3GA 5E5MA 2A38A 3TN0A 3GGWA 2DLTA 5KSAB 1W0WA 3IDGA 5IJVA 4XMLL 1ODAA 4NC0B 1I85C 5TQ0L 4LAJH 4GMTL 4EZMA 1AD9B 1QLFA 2XACC 1XR8A 1U8MA 5ESAB 4JZJB 1A6TA 5F7EH 5LGJB 3DBXA 2VXQH 1KPUB 5KVDL 3UZEA 1HNGA 3V95A 5D70H 5E6IA 2H32B 3FN0L 2ARWA 4OJFH 4HS3B 3RBSA 1NAML 4Z78B 4AEIL 5T3XL 5C2BH 1BX2A 2EYRB 1PAMA 1UH2A 3DUUA 1JI2A 4Z6AT 4MAYD 2FH6A 5EWIL 2VR9A 5F7KC 3BQUD 3KYNB 2QADC 2ZPKH 2GCYA 3ZE1E 2NXZC 2FJHB 3Q1SL 1VGEL 1S7TB 5E94B 4M62L 4I2XA 3WLWC 3C5ZC 5IQ9A 4OB5H 5FHAL 5ILTL 5SWZE 4AZ8A 4XXDB 1OQOA 4L5FH 4PRBA 1C5CH 43CAA 4OLVL 3R0NA 3OSKA 1NAMB 4X6DF 3MFGB 3X12A 4I0KA 3F6IA 4RISL 5D7LE 2YD2A 5EN2B 1LDPL 3N1PC 5KSAD 2Z93A 2R8SL 1CTNA 4LFHG 4LKCA 1U8OA 1NEUA 4PRPE 4JG0L 5I1KL 4OKVB 4FQHA 4NQUA 3WL9A 3ZKSD 3K0WA 4YHYC 3FOMA 4KKLC 4UIKH 1BQHB 3X13A 3JTTA 4HUXA 1T2XA 4KGLA 2CDGB 1KSRA 3OR6B 2BVPA 4LSSH 1QFUH 3I50H 3TH4T 1BQSA 2YN5A 2VLKE 4JHBA 1NBVL 2YSSB 3MR9A 2VDKL 5ISZB 4YHOH 3WFEL 4QHUA 3NN8A 4U6YB 1HINH 4X98B 5FGRA 3S8WA 1MFAH 4N90D 4C83B 5LCVL 5DZLA 4YHPB 1C1EL 2VXTL 5IFJA 2HFGL 4ZOBA 1JWMB 2CKBL 4JFYB 1S3KL 4MVBD 3QUMA 2DD8L 1S7XB 1D5BB 5DEGA 5C0AE 3I02B 3T3PE 3VWJC 3KLAB 3FAXA 3CU7A 1LDSA 1M7IA 3ZMRA 3QAZB 1UM4L 5LAXA 2YD8A 4K3EL 2CK0L 1R3JA 4UT9L 3UJTH 5T3XD 4DZBB 3PWJA 1KJ2H 3WKNA 4CVZB 1AHWA 4OCMC 3DETD 3BH9B 3HRZB 4QXTA 1BBDH 3ARBA 4ORGB 4ZS7L 3FB6B 1X5FA 1FHGA 1P4LB 2DRUA 3N85L 5F1IB 3AB0C 3BP4B 3QIBC 1QFWM 4PB9H 3RVXD 1INEL 3DUSB 1MJ8H 4P5TC 1U8IA 5IUSA 5T33H 2V6HA 5CS7A 1R5IA 2CKBB 3FQWA 1IM9B 1LNUB 2Z35B 5F7DB 3V4UL 3PG2A 5J1AB 3TA3A 5J11B 3SE4C 4KI1A 1WUNT 4O2CB 3CFCH 3REWA 3AU1B 2P5WE 4O9HL 4OV6F 2WUCH 4ZSOA 1A7OL 1JRHH 4EI5B 1JF1A 3G6JF 4KHXL 3C60B 3VCLA 1FRGH 2Q8BH 5JQ6H 1DQQB 5ISZD 4N0FB 1YA5A 3ZKXB 4WCYL 3W9DA 5HHNA 4KROB 4PJ5A 4OZHF 1UB5B 2E8ZA 5C6TH 2AEPH 5DQJB 4MZ3A 3FT4A 4KJQD 3QCUL 1H0DB 2EE2A 3MOBH 1XF2A 5AWNL 5E03A 2A1WL 3MRDA 3VRJA 2K7QA 2XIDA 1ZSDA 2BOCB 3W9EB 4HUKB 1ERNA 3QA3B 3T2QA 3TYFA 5D2LE 3GKWL 5HGDB 1AY1L 4P4RB 4XP5L 2I9TA 3OKOA 1KULA 5D7IB 2DQCH 3AMLA 5HYSB 4UQ2B 4MCYB 1LD9B 4PIRF 4P3DA 5IIEA 4EEEA 5MI0C 5DMIL 3BXNA 2DL9A 4DKFH 4TTDD 1AKJA 1F4YH 1U36A 1U3HA 3LS5L 3L3JB 5F7WC 2YA2A 3VFRA 1A9EA 1F3JB 1IM9D 1L7TL 1TFHA 5FKPB 3B6SB 2YS4A 4LGPB 2CUIA 2XQYG 1ND0A 3CFEB 3IFLL 5EU7E 3U0TA 5HYJB 3HTLX 5GJTH 4EI5D 3LDBC 3ZE1F 3C60D 2VLME 3LQMA 5CMAA 2FHBA 3R4DA 2QR0A 3ARSA 5D2NC 2DDQL 4J1UA 4N1EA 4U1NA 4KROD 1XGTB 5CJOH 1BJ1J 4ODVH 5C0CA 5KOVC 5EC2A 1YMHB 3VMOA 2HJLB 3QDHA 3NA4A 1CFQB 4Y4KC 2VWEC 2A77H 4XAWH 3DV4A 2FDBP 4P2RB 3Q6FB 1G1CA 4HPOL 4ACPA 3UZVB 3WIFB 4ZD3H 4X9HA 4NQCB 4QNPF 2FH8A 4P2QB 4HW6A 3W39A 3BKML 1UYWL 1T89A 4LCCB 1UKSA 4QXUL 2OJEA 2BCKA 5EOQH 5KW9H 4OFYA 4OI9A 1QFOA 3T0EC 5DC4B 4X5LA 5C0BB 4JY6B 5GHWH 4Z95H 3RTQC 5DD3H 4BKLB 3PL6C 2RQ8A 3RWJB 3O4LA 5I75B 5L9DH 3UAJD 5HYJD 2GSGB 1PG7W 2MNUA 5IR1B 3KPPA 1BHGA 4XPFH 5T1KA 1QLEL 4Q6YA 4RQQA 4LSRL 1FL5B 4BZ2H 4CVXB 1YN6A 2NY4B 2SEBA 4KJPC 3BISA 1XF3A 2BVOA 1XF4B 3BZDA 4QEGA 1BFTA 4B50A 3VI3F 1WZ1L 4Z7OE 3NIDE 1UACH 1D9KA 4GRLA 4IMLB 5FDWA 2N56A 5EO0B 2FYYB 3FCTB 3OKNA 4JFEE 3SKOA 5DD6A 4KRMB 1MCWW 4HWBA 1UB6B 2CR3A 3NPZB 1QSFB 3KWWB 2VUYA 4DCQB 4JFFE 3V6OA 1S9XA 1OAXH 4OFKA 2Q8AL 1GZQA 2EYTA 4H88L 4YHLH 2VAAA 1PBYA 1UWXH 4FXKA 1J18A 2VLRE 3P11H 4LLUB 3O4OC 1W72L 3TBTB 2Y5TB 4NQCD 5SX4I 1CXKA 2OJZL 4MA8L 3BZ4A 4JR9L 4KK8C 3K7UA 3LS4L 1T04B 3C5SB 1KCSH 3WFZA 2OQJA 3T77A 1ZVSA 1ZK9A 4WY7L 3MO1B 3H3KA 3N1MC 4X4ZA 4F58H 5C0BD 3UPRB 1JYWA 1IM3A 4GW4A 5GSRA 3QDJD 4OD3L 4PPTA 5J06A 2V9QA 4WU7A 3MCLL 4PYHA 2YKLH 1K8DA 1XF1A 1NAKH 4WI7A 3O3EB 4M9OA 1OGAB 4UU9B 2WQRA 4GAFB 3QXAA 1A1OA 1W72B 2BVQA 2NY4D 5EORL 1T83C 3JUZA 5B21A 3ARDB 1RZ8A 3CFDB 3K8MA 3TBSB 4PP2A 3BGAA 4PJCE 3BP6B 1PW3A 1T4KB 3V2AR 5ECJE 4CNIB 2D2OA 1IVLA 2BHYA 5D2LF 1C16A 3QO1B 2VQ1B 5FOBA 2WZPD 4RWYH 4ZUVB 5IVZB 1I8MB 4WHTA 5F88B 2X70A 2ZCHL 4QOKA 1QSFD 3EFFA 5HGHB 3I2CL 4UTAL 3KLSA 3B9KC 4OLEA 2AJSH 1G7PA 5EIIB 3HPJB 4OQ1A 5GS0L 1MELA 3D0LB 2HH0L 3UZQA 2A83A 2B4CL 1V3KA 1YYLH 4CW1B 1DL7H 3WO3B 3KPNB 5E5MB 5D71H 4YPJA 3V6FA 4PJIA 4UT7H 5DRWA 5GRXG 3TN0B 5AZ2H 3GGWB 3BKYH 5TE4H 3P0YH 1W0WB 3BAEH 5IJVB 1TJGL 4JFHD 4Z0BL 1SJVA 1NMBL 2FHCA 4GAJH 3QPXL 1FVCB 1QLFB 2CIIA 2X09A 4YDKL 3MROB 1XR8B 1AQKH 1YNKH 1U8MB 2V2WA 1J0ZA 2QQKL 1HHJA 2EIZB 1YEFL 3RX5A 1A6VL 4KY1L 1VGKA 4BYHA 3ZYZA 3U82B 2PW2A 1FGVH 3MLSL 3ARDD 1N6QL 5E70A 1BX2B 1CYGA 4HCRH 1BMGA 3WYRA 3DUUB 4LRNL 3QCTH 4QGYA 1A47A 4TVPH 4YWGL 3U30C 2GCYB 1G6RA 1QSVA 3UTOA 1WBXA 2VZTA 3U0WL 4BZ1H 4I2XB 1ZLUK 5IQ9B 1J8KA 2Y07H 3N9GL 4P23A 5E2VH 3A0OA 5A2KH 1NMCC 3LRSB 2PYEE 4LCUA 5JUEH 3EKCA 3LIZH 4JFZL 1WWBX 2HRPL 3X12B 4WU5B 3RDTC 5FA4A 5CLWA 3TN0D 4QXWA 1T66D 1FORH 2DQEH 1T7ZA 2Z93B 1FG2A 2NY1D 3D48R 1AXSB 2ZNWA 4LKCB 2WUBH 1U8OB 5D72H 1M6OA 4YX2L 1FIEA 1YEJH 5I15L 3QUML 4FQHB 3WL9B 2EZ0C 5IQ7H 3FOMB 2DOCA 5T3ZL 4Z7OF 1CGSH 5GS0D 2YWZA 3MLRH 3NIDF 2NY0B 4LSVH 2I60L 3RU8H 3JTTB 4HUXB 5E6ID 3TIDA 1FJ1A 3WFBL 2DKUA 4PJEA 4IOSD 3SGEH 3TNNA 1S9WA 2BVPB 1MCQA 5CGYD 3A6BH 1QKZL 1AH1A 3EFDL 4F8TA 4O51A 5DSCA 1F00I 4QHUB 4JRXE 4N0CC 1RZIB 4LLVB 4WEMB 1P4IL 2A9MH 2NY5L 5IFJB 3QULA 5E08L 4OF8A 3QUMB 3IT8D 1RUQL 2EICA 2W38A 4ZOAA 4NRXA 2D9CA 4H8WL 4MA1B 4OUOA 1M7IB 1KJVA 1I85A 3V52H 4JFXA 4EOWH 3MLVH 5GS2D 2WBJC 1R3JB 2X9YA 5L8KB 1IC5L 4YHZH 3ALXA 3OAUL 1QUNA 3PWJB 1FNAA 1AHWB 2GJ6E 5D7SL 4QXTB 4Y2DC 1GGBL 4KTEH 3ARBB 2R2HA 1LHZA 5CP7A 4D2NA 3UC0H 2JB5L 1A4KA 5EOCJ 3QEQA 1JNNL 1R5IB 5DVKA 3FQWB 4HT1L 5F7UA 4QRPE 1ZTXL 1LO4L 3TA3B 2JB6A 2CPCA 3E2HC 1DCLA 2DBLL 2NY0D 1XGPA 1ZGLP 4PJCF 1QZ1A 4H0GA 3REWB 3P73A 2CJUH 4OD1H 2RAMA 4OCYL 3WSQH 1KC5L 4ZSOB 3I84A 1JF1B 4EN3B 2UUDK 4CAGA 2OTWA 4CJ1A 3PWPE 2CD0A 3VCLB 4XMPL 5I18L 4EQ2A 2ZOKB 4RNRA 5HHNB 2AW2A 3W9DB 2NY6C 4EDXA 4PJ5B 3CXHK 4XHJD 3FT4B 4YDIL 2A74A 5LBSH 1XF2B 1TPXB 1LO5A 1MFBH 5T3ZD 3VRJB 2M2DA 5MP6H 2X9WA 3VI4E 1CE1H 1HQRA 3B9DA 5JHDE 3MV11 4XB7A 3H9SE 4KQ4L 2HLFC 5BMFH 1U6AH 3BJ91 4XPAH 2I9TB 5J57B 3OKOB 4AG4L 3FRPG 3NCMA 1AR2A 4P3DB 3ARBD 5JPNA 3OHXA 1YUHA 3BXNB 2EEDA 2H8PA 2WWKO 1AKJB 2QQLH 1OD7A 1BEYL 1Z0NA 3GSUB 2CDEB 5HDBE 3SDDB 3VFRB 3QZWA 1EGJH 3TA3D 4QHNB 2LQRA 1ND0B 5FUZL 2ARJQ 3U0TB 3V4PH 4ZO8A 4RGNB 1ZMYA 3FONA 3VXTB 4UZGA 1FFOA 5IMOB 3CAFA 3L3OA 4Y4HC 2BXZA 2W1NA 3GB7B 5CMAB 2AVGA 2QR0B 5F71A 4LHUA 4WO4A 3VWJA 3B43A 4HC1H 4J1UB 4U1NB 4PJ5D 1IT9L 1KB5B 2GKIA 3F58L 1AE6L 2CLRA 5C0CB 5CD5C 5EC2B 5LQBH 5K9JL 3HMXA 3MRNA 4G8FB 4KK9D 1I7UA 3FZUC 2YUVA 1F3RB 4MJ5A 3U9PL 1MJUL 1IE5A 3T0EE 2P24A 4EJ1C 1WJ3A 1DANT 1UJ3B 4U1SA 4P5TA 4G6MH 4YC2B 3GMLA 1RZGA 4LMQE 3ARWA 4S11A 5IT2L 2OJEB 3BUYA 2BCKB 3W11D 2AJUL 1AKJD 5CD3A 4QYOA 4OV5A 4CU7A 3KPLA 1U3HD 1VKXA 1ORSA 1UXWA 4HWBL 1VA9A 5ERWA 5ID0A 4Z7UE 3KYMA 1I1YA 2RCSH 4X4XA 5CKAA 4R4FL 1DE4A 5E2TH 5GZNC 3KPPB 1EH9A 4NZUL 4ONGH 1JGUL 4XMKL 1G1YA 2FECL 3OV6A 5T1KB 2VAJA 2J88L 5CEXA 4HZLA 5F9OL 1YN6B 3TJHC 3UO1H 4QRUA 1XF3B 1QOKA 2BVOB 4PTTA 1UM5H 3D3VB 4WFGE 5E8DL 4GW5A 1TVBA 4MYWB 2KUTA 1CL7H 4GRLB 2HT2D 4Y5YC 5HXMA 5FDWB 5C0CD 1A0QL 3OKNB 1DQLH 4F15B 3SKOB 5DD6B 1OT2A 4QF1A 3VFGH 2PXYB 2N1KA 3RY4A 2NZ9D 4GG6A 4LPUA 3QG7H 5HI3D 3BPLB 5LWYL 1IC7L 1AC6A 1S9XB 5GGVH 2EYTB 1H3PH 4K7FB 1YEHL 2JELH 4R6UA 1WFTA 4JHWL 4FXKB 2VDQL 1B3JA 3GK8L 4R90L 5GRVL 2IFFL 2XN9A 3OB0H 3GNMH 1AIFA 3BZEA 4FQCH 3SDXB 2FD6L 2OQJB 2YHGA 3C6SA 1ZVSB 3T77B 2G60H 4OFYD 3MLYL 5JZ7C 5FGCB 3PF2A 4G6KH 3IDUA 2XKSA 4D9RE 1TETH 3CXHJ 1G7IA 4GW4B 2FJFB 2WWMD 3LN4A 3O4LD 4UDUB 5GSRB 2B20A 1TQBC 1EEYA 2XQBH 4NC1E 5DA4A 5BZWA 3U4BL 1YEEL 4MX7A 3TZVA 1OW0C 5F6HI 4LDLB 4Z7QE 5ESQA 4ALAL 4Z7WA 3BRDA 5T1KD 4Y2OA 3QXAB 3SKNA 4DZ8A 4X99A 1A1OB 2BVQB 3MPCA 2DQIL 4APQC 1A3LL 4PRHE 2DM7A 2JF1A 1XCQA 1RZ8B 2XTJC 4X7FC 1T6WA 1D9KD 4GRLD 5HYIA 1S7RA 2BSRB 4PP2B 4MXVF 1MFEL 1RVFL 3MRRA 3O2WH 4ELMF 3VI4F 1EMTL 1C16B 3PQYA 2AJVL 5FOBB 4JZNA 3KS0J 4ODUA 3O6MH 5F7FA 5C0RL 3EFFB 2UVEA 4DW2H 4YAQA 5IFAH 2VXVH 4LQFL 4YE4L 1CT8A 3RHWF 1G7PB 1FLTX 1JPTH 1XT5A 3RWGA 4ONFH 4X80H 1L0QA 1X9QA 2A83B 3IGAB 4FQLL 5HDBF 3V6FB 3D2UB 2BXYA 1A6UH 4MXWH 2MMXA 2X4RA 2BY3A 5CIPH 2BNUB 1G6RL 1Q9KA 5D8JL 3ARUA 3Q48A 4N0UA 2AJ3A 1U91A 2CIIB 3F62A 5TFSL 1PFCA 2IC2A 2FBOJ 3CDCA 5J8OA 4PJDE 5FV2A 3QFDA 1VGKB 2PW2B 1A64A 1TCMA 5KANI 3STLA 3C2AH 5AG8A 5BXFA 4PJBB 1DBBH 1KLGA 2XWTA 4R4BA 4YFLI 1SEBB 4QOKD 4LCIL 1G6RB 1G9EA 4NUJA 1N2RA 4KK6D 1WBXB 4JB9L 1T0PB 3RI5F 5HHMB 2EDYA 4HF5H 2C7UA 5GRUL 2XZQL 4P23B 2H2SC 2VTFA 4XCFL 4RGMC 1YC8A 3CFJA 2HFTA 1RQ5A 4JEGB 3MRQA 2EEBA 4LCUB 5JR1H 2B7DT 1SEQH 3PGFL 4OTXH 3GIZL 1HILA 4KUZL 1SMOA 1HI6B 2OXGA 2MQ3A 4Z7UF 5HHPA 1OP5H 5T5NF 3EO9L 5C0NC 4I3SL 2Z92B 4NHCH 2EKJA 1M6OB 1F4XH 1T83A 4Z77A 4O2FA 3U36A 3CX2A 4NWUH 4Q2ZB 1DQJB 2VN4A 1IC1A 3MBXL 2RIKA 4LCWA 1F2QA 4HJ0C 4WFFE 4NQTA 4G9FA 4FG6D 1DLHA 5I74C 4YXLH 3MOAL 1D7FA 1DZBA 3TIDB 1FJ1B 1A21A 1WEJL 3G9AB 3TNNB 5KSBE 1HIMH 4MJIA 3BN3B 1MEXL 4O51B 2BNRA 5DSCB 5DLML 1H15A 5I30H 1VDGA 5I6XC 3WD5L 1WAAA 1FZJA 4XC3L 5F7YC 5SX4H 3HUJE 3HE6C 2GAZA 3QULB 3P2TA 4TNVF 5HHMD 3FMGH 3IFNH 4MS8C 4OAWA 15C8H 1A7QH 4PLOB 4FXLA 4N8CH 3EOTL 5CSBA 4OIBA 4NRXB 4QTIH 4P23D 3B9EA 4ERSH 3HG1E 1KG0B 3GSQA 1QP1A 2VC2H 2FBJH 2C1PA 3VXRE 2Q7NA 2AGJL 5GJSL 5GS1C 2OI9C 4XNZB 1HEZA 4M61A 2K1MA 2OR9H 4K55A 4XRCA 4QRRE 2G9HB 2R2HB 5CP7B 3V8OA 2HAZA 4G5ZL 3P9WB 1FQ9C 3RVUC 3RVTD 4OFVA 3QEQB 4R8WL 4LGRB 2XG5A 4H5SB 3DX7A 4L1HA 3LKQA 5SX5H 4ODSL 1XGPB 1G84A 4WFEE 3RWFA 3P73B 1JZ7A 2AK1L 1NBZB 5IB1A 1I8IA 1RZJH 1DBMH 4PV9A 2OTWB 3GHBH 2NW3B 3MLWL 4DVRH 3CH1A 3L95A 1KN4H 1S9VA 3WCYA 1O0VA 2NXYB 1KBGH 4G8IA 1IZJA 4HWZA 4R26H 1EHLL 4NHUA 3O0RH 4KJWD 4EDXB 3CFIC 2DS4A 3V0VA 5FK9B 2IG2H 1FV1B 3RNKA 1N4XH 4XBEL 1LO5B 4WUUE 3RDTA 3BO8A 4P4KC 1E4WH 3QQ9C 1H3WM 4XPGH 2R0LL 1HQRB 1E6JL 5HY9A 1QVOA 2X5PA 3L5HA 2EDRA 4UBDD 5I19H 2CRMA 3V4VL 1RJCA 1YJDL 3FAWA 4UI2A 5CLTA 5E2WH 5JPNB 3OHXB 4OLXL 1EHAA 2H8PB 3T1FA 1QRNE 4U6XA 2H41A 3RVWD 4GRWF 5DJXB 3N1GC 1RULH 3QEQD 4HK3J 4HKXA 3E8UL 3QZWB 3LKPA 3HMXL 3GFUA 3FB7B 5BS0A 4HWEL 5EFIA 5GGUA 1DR9A 2F74A 4NN6C 3GBNH 3HNVH 4ZYKA 3M8OL 1TNNA 4HIIA 2QADD 4TQEH 3OGOE 1EV2E 2IPKA 4HBQA 1A4JA 1FFOB 4X6FB 2BFVL 3DWTA 3WLWD 5CZKA 1LQSR 4LHUB 2NXYD 4WO4B 1XGQA 1OCWH 2EH7H 3GMPA 4PJGA 2O26U 2DLFH 1S8DA 1BD2A 2CLRB 3MGOA 3MRLA 5F7MC 3OZ9L 1DDHA 2C9AA 3M07A 2ZJSL 4RBPH 2LAAA 4G7VL 2VN7A 3MRNB 4NYLA 5C08A 4Y2DA 4EBQL 2EH8L 2P24B 4CN6A 1MCOL 5J12C 2ZKHH 4U1SB 4EQ3A 4P5TB 3G6DH 2X4NA 3QUXA 4U2YA 2J5LB 5H35A 5JIPA 1RZGB 5EIQA 4L9LC 4PJFA 1FC2D 5SV4A 4KKLD 4Y5XC 4HIEB 3HZVA 3BUYB 4XTRC 5GGQL 5CD3B 1SY6A 1A22B 5H94A 3KPLB 1RZKH 3GRWA 5FKAA 5L2JB 1VKXB 2BNQE 1CBVL 2WP3O 3GMMA 2XOTA 1UXWB 5ERWB 3P3YA 5ID0B 1IGIH 3HNTH 3MREA 2ADJB 3RIAF 5KSBF 3KYMB 1I1YB 2RJMA 4YBLC 4X4XB 3CVHA 1DE4B 3RHWK 3ZLQC 2G2RA 3TYGL 4M1DL 4Q9QL 3HMWH 2AXGB 1QQDA 4Y19E 5CEXB 4HZLB 3HUJF 4U05A 5L6YH 1CLOL 4PTTB 3L3IA 3OMZA 4GG8B 5IW1B 4LHUD 1TVBB 4WO4D 5JPMB 5C7XL 4OZIE 3JV4A 4YXKL 4ZOEA 2BSSA 5F70A 1U8QA 5CHNA 1VADA 3KR3L 3I6GA 2BRRH 3SJVE 2A73B 3I75A 1YC7A 4GG6B 1JZ8A 2X4OA 5JW5A 1AJ7L 4Z7VF 1JWSA 5KOMC 2A2QT 2VXUH 5I73B 1A7BA 4L1DA 3NCJH 4P5TD 2X4TA 3OAZK 5GISH 3BEVA 3QO0A 4JPKH 3VD4A 2XN9B 1Z9SA 4MQXD 3UPCA 1AIFB 3BZEB 5H2BA 2OK0H 5FYKL 3TF7C 1ED3A 3MV8B 2VO5A 2DI9A 4LNVA 2OZ4A 3BD5A 1ZAGA 3O81A 5I17A 1G7IB 3LN4B 1EEYB 1NQBA 5BZWB 4OLUL 4Y4HA 3LHPL 3RI5K 2HTLC 3QEHA 4MX7B 3MACL 4JO3L 3TZVB 1RUKL 3V5KA 1QHPA 1F6AA 1NH6A 5KVGL 5BO1L 4YZFE 4Z7WB 2HP4A 3STZB 4BA8A 3SKNB 4DZ8B 4X99B 1IRAY 1E4KA 4O2EB 3TV3H 4CN4A 1XCQB 2CUMA 2IWGA 3NOIA 1S7RB 5LXGL 3MRRB 1LP9E 2YPLA 3S96A 1EEUA 3P4LA 3BZFA 3PQYB 1UA6L 5DGRA 5LJYH 2EO1A 2W65B 1U2HA 3T1WA 3ZHLA 4MA3B 5CEZE 4YXHH 3VW3H 1I1AB 2W92A 1VEOA 2UV3A 1CT8B 1SJEA 3BVNA 2ERJC 3HZMA 4ODHH 4JO1L 3MFFA 2BZDA 5AZEL 3V0WH 3RWGB 2EYSB 4PJHE 2XN9D 4PV8A 3EYVB 2AABL 4A2MA 4B53A 4G8GE 5JLZB 5FM4A 2R29L 5FECB 3UP1A 3D6GA 3CNKA 2ZSWA 2X4RB 4OF5A 4JPWH 2LV4A 2JK5B 1Q9KB 1RUML 4GMSL 4TNVK 4N0UB 4UAOC 3MLUL 2W0FA 2AJ3B 1MF2L 1TZHA 1U91B 1J11A 1EJOH 1F8TH 2R56L 1IQDB 4XVUC 5EUOA 1EA9C 1S7QA 4U6TA 3TZVD 4F3FA 1JNLH 5D7LA 3FTGB 3MXVL 1KB5H 3MRKB 5ABDE 3DVIA 1JUFA 1DBJL 1L7IL 3QFDB 2JJWA 2F8VA 1UVQA 5I9QB 3QDGE 4PRPA 1GGUA 5FYKD 2F5BH 5JMOC 5ICXA 1FZOA 2YA1A 4MNQE 1KLGB 2XWTB 3D85A 4UILL 3VH8A 3PQYD 5FEBA 1EVUA 1G6VK 1TZIA 4NUJB 1N2RB 4U1KB 3QHFH 2V2XA 4JQIH 2VMFA 5HHOA 2EDXA 1WBYA 2C7UB 4NNPL 2VLKA 4G9DA 1L6ZA 4JRYA 3BRGC 4Z8FH 2AV1A 3HAEG 5E8OB 2VDMH 3CFJB 4WFHD 3U7WL 3MRQB 1F11B 3QQNA 3J8F7 1BPVA 2AEQH 4CBPA 1CGUA 4X6CE 1QA9A 3EDDA 1D6VL 3S34H 1HILB 3S5LB 3WHXA 4V1DE 3QDAA 3RY5A 1EEQA 5HHPB 3E3QE 5CJBA 3GMRA 5EZOH 3LV3B 2Z8RA 4I77H 2Q20A 5JXEC 4KJPD 4Z77B 4O2FB 1FGNH 3HI6H 3MTRA 5IWLC 2UWEE 1M05A 4Q6IC 4TSAH 3DIFB 1X5AA 2DMCA 4OF0A 2Y9RT 6CGTA 4LCWB 4OZIF 4O58H 1B4JL 1DLHB 1MCJA 2ARJA 2JJSC 1RIHH 5I1EL 4NCC2 4XPHH 5DK0A 1MRFL 4LU5L 4L8CA 2BNRB 2X6MA 3ZDYE 1H15B 4XVTL 5D93C 1AGBA 5CJXC 2ESVA 4K8RH 3OAYH 4Z0XA 1QNZH 4XH2B 2P5WA 1MVUA 1WC7A 2GAZB 3JWDH 3UTPE 4X7CC 4KK8D 4ODTL 2O5ZH 3L5IA 2D31A 4OAWB 3E0GA 3JBG7 5ALBL 4UT6H 2XWJA 4GBXA 5GZOC 1YPZE 3GSQB 1ZLSL 4NT6A 1IFHL 4URTB 2C1PB 3TWCH 1OWWA 2OTUA 2F15A 4ZQKA 5D5ME 4M61B 4Y89A 3WN5B 3FOLA 3HAEH 2E27L 1LE5A 5KANG 1BM3H 2G5BA 1UZ6E 2X7LB 5C9JB 1MRCH 1MIEH 3VGDA 4YZFF 2B0SH 4LCYA 4L4TA 4IS6A 1LK3L 1FO0A 4PJ9C 3DX7B 35C8L 1NCWL 3IKCA 5AAWA 3ULSA 4LCWD 3D18A 4JFQA 4Q9BA 4LOUC 4JHAH 3RWFB 4FNLL 5IP4A 5IB1B 4G6FD 4L8BA 5C07A 3DSFL 4MJID 3MJ9H 3CLFL 4N1HB 5TF1L 3HNSL 1V3JA 3CH1B 3L95B 4L4VA 3L5WA 3FRUA 1S9VB 2BNRD 2N7BA 2VIRA 1IQWH 5IBUG 5JA9A 2FATL 4HWZB 4NHUB 1MCBA 4HGWA 5JTWA 4KXZH 2X41A 2EDKA 1Z3GH 3QNXB 4I1NB 1N7MH 4BJLA 5TE7H 3V0VB 2DL2A 2FZ3A 4PJHF 1IBGH 2H9GB 3RNKB 3RIAK 4NKDA 3ULVH 3BO8B 4XX1G 1TNMA 2EC9U 2HA1A 5EU6E 3O6FB 4LVNC 5HY9B 3TH2T 1QVOB 4LEOA 1JGVL 1K4DA 1KLFA 2XG4A 5JXAH 1F13A 2IANB 2LTQC 3U7YL 2AJYH 5HPOA 4XNUL 1X5XA 2K7PA 4HXAL 3T1FB 1T5WB 4JCMA 2DQGH 4L3EE 4U6XB 4GAYB 1V7NH 1DQMH 4HKXB 5CINL 5TJWK 3LKPB 2FX9L 1TTFA 4NRYA 5BS0B 3VGAC 4XCYB 5EFIB 4HPYH 3P4MB 2F74B 5BZDA 2APVA 1S78D 1F6FB 1PKQA 4PRIB 3QWQB 4PS4L 2IPKB 1JZ6A 1A4JB 3HE6A 4QHLA 4UB0L 5D4QA 2IBGA 4NZTL 4TSCH 2O93L 3WFCL 1IAIM 5CJ8A 2D7OA 1JZ4A 1XGQB 1GOHA 5I1HH 3GMPB 4PJGB 1SY6L 2EXYD 2O5XL 3GRWL 3ZTJG 1S8DB 1OWRM 5D9SA 3MGOB 3ZE0E 3B2VL 2VITA 3Q0HA 4PLKC 1YY9C 1DDHB 1K6QL 4M1GH 4ZTPH 4X6CF 3RDTD 4NYLB 5C08B 1YYMH 1ZVYA 3CVHL 4Y2DB 2EDWA 1N64L 3SO3C 4JM4H 2BY1A 4F7PA 4CADA 2X40A 5F21B 3ZYOA 2HJKB 3X3GH 1D6EA 1UXSA 4JFEA 2X10A 4RGOL 1OQXA 5E5UB 1M71A 2X4NB 2ICEA 3QUXB 2WIIB 3IAQA 5SWSA 3QISA 5H35B 5DD5L 2IADA 4NQDA 4PJFB 3P40A 4JPVH 3HZVB 4KK5C 3MRFA 5EPMA 5H94B 4UOW0 4FQJL 5F96L 5FKAB 3GMMB 2NY7L 5EBWA 4PBXA 5BS0D 1GC1C 5IHZA 8CGTA 5CJQL 1IGMH 3WFDL 3RAJH 3CVHB 1B4RA 4TRPL 3WO4C 5I1IL 4N0CD 5MEOA 3ZDYF 1QQDB 4XP6H 3C8HA 3CVIH 1NFDE 2Q76A 3D39E 1PYWB 3L3IB 1KXQE 4P4KA 5ADPL 3JV4B 3MV01 3RUGE 1U8QB 3BPOC 4UQ3A 1BD2D 2WINB 5CHNB 2OZ4L 2Z4QA 5D7KD 2BHZA 3I6GB 1EFXA 4ZPVA 3I75B 1CGVA 5C08D 4BZYA 5D5MF 1BJ8A 4KI5D 5JW5B 2ADIA 4Y2DD 3UBXI 4X4MA 2P44B 1DJSA 3OXSA 2DI7A 1UZ6F 1MLBA 5CUSL 4KV5E 3BEVB 3QO0B 3QUXD 3NPSB 4FOMA 3JTSA 2VZVA 4M5YL 2D7TL 1C5BL 5KS9A 5H2BB 1X3DA 1N0LA 3KHOA 3FFCE 3BN9C 2E9BA 4X8JA 3DO3A 4LHUG 4NJ9L 3EYUL 3V7AG 4DEPC 1U8NB 4CVUA 5KSVA 5I17B 4JY5L 2KZWA 1DTUA 1L4IA 3JV0A 4BH8A 1VCAA 3FO0L 4NIKB 3QEHB 3V5KB 1F6AB 1GPOL 4BK4A 5HDOA 4EI6A 3RVVD 2EDFA 2PUQT 2JCCA 2XZCH 3MYJA 3RRQA 5C0GA 1GH7A 4HXBL 2HTKC 2NPLX 4X5XA 2P8LA 5H37G 4W6YB 4ODXA 3RWCA 1BFVH 3T2NL 4FTVE 3BIKA 3WIHA 5IBTL 2YPLB 4LSTL 1FH5L 4HKZA 3BZFB 2VDOH 3LH2L 4F33A 1FE8H 2DWDA 4HHAA 4N1CA 5FYJH 4YO0A 4L9LA 2VLLA 4UTBH 3H8NA 4Y5XA 3KPQB 1SJEB 3HZMB 5F3BA 1EUUA 4NP4L 1ZANL 4KRLB 4C59B 1ORQA 2D0FA 4U49A 5J9PA 3MLZL 3KPOB 2ICES 5C0EA 2HWZL 4PV8B 1MQKH 4I48A 3OR7A 5ICZA 3ALWA 3QHTC 3VGEA 3B9AA 3FT2B 3U1SL 4OM0H 4AMKH 4DKAA 4P2OA 4KWUA 1OTSC 1LO2L 4LHJB 1GOGA 3UYRL 1CF8L 2ZSWB 5CKGA 5I8KL 3HZYA 1J1XL 5I2IA 4WWID 1HYRC 5JW3L 3DGGA 3VXOA 2DQUH 2VISA 4N8VA 4GKSB 4Y4HD 3ULUE 1AC0A 1LEGA 2R15A 1TZHB 4NM4L 1UH4A 2W9EH 1DQDH 5EO9A 1S7QB 4NWTH 5D7LB 3QNZA 3B5HA 2XRAH 2HKFH 1JUFB 5CD5D 3IS1X 1P9MC 5KJRH 1NCDH 5KAQF 3U6RA 4POZD 5K9QG 3NIFF 4PRPB 1S5IH 2MPAL 1F4WH 4LP5A 1AI1L 1YEKL 2WLZA 5ICXB 1FZOB 3TBVA 4OIAA 2YPLD 2VABA 5J3HD 3VH8B 3HKFA 4MAYC 5H37H 1E4JA 2V17L 2XY1A 2YMXH 1DFBL 3LEVH 1TZIB 3SE8L 4U6VH 4HEPG 5HHOB 2ZUTA 4H25A 1WBYB 1II4E 1VEMA 1BGXH 2VLKB 3CH8A 4G9DB 3O2VH 4R9HA 2AV1B 1ZA3A 4DKEL 4JRXA 2Q86A 4OZ4A 3KYOB 1QA9B 4MA7H 4P46B 3WHXB 1AXTL 5DYOB 1FIGH 1TQBB 1IMHC 4Y0GA 4NO3B 3C08H 3T4YA 1QBLH 3OKKA 2I5YL 5GZND 3UEZA 5IKCA 4LAQL 3GJFK 5KSAC 4O4YH 4C57C 4J3UA 5E99H 2E6QA 2QJDA 3TJHD 3B9VA 1OAYL 3VE0A 2JTDA 2GQHA 1M05B 5D7LD 2VDRL 2HKHL 5HGAB 25C8L 3DX9B 1H3UA 2EDTA 4JZJC 4F7MA 3LEYH 1CDHA 3EDFA 3RUGF 1WWWX 4J6RH 1GGCH 3NAAL 4NKIH 4PRPD 3NZHH 4D9QD 4RCAA 5ICYA 3GSNH 2Y23A 4AQOA 4HWUA 3D85D 4XHQA 2BVYA 3LN5A 4P9ML 1AGBB 2ESVB 3JVGC 5C0JA 1RFDL 4Z0XB 2P5WB 1SVZA 1MVUB 1WC7B 3PIQB 4QXGH 4JPIA 3VFMA 3LMJH 5HHOD 1FO0L 2IH1A 1K9TA 2D31B 4RFNB 3E6HA 4DAGL 4PJXE 4E41E 1T7VA 2VLKD 4U1MA 1BZ7A 5DR5H 2XWJB 1BJ1H 4JRYD 1U95A 2OR8A 4GBXB 4OGYL 4XNMA 1RMFL 3PJSB 5AAMA 4NT6B 2OTUB 1MI5A 4ZQKB 2ICCA 1I4FA 4KC3B 4MMZC 3KPSE 1Z9OA 5TPWL 3FOLB 5DGQA 1NBVH 1LE5B 4PUBL 2G5BB 1KJ2A 4AIZB 3DETC 1KEML 3BEWA 5D2LB 2X1WL 4LCYB 4NQEA 4L4TB 1S7UB 3RVXC 4IS6B 2O5YL 1NUFA 2IPTH 2DD8H 1E6OH 1KOAA 3Q6GL 3ULSB 3D18B 4NN5B 4UIMA 3MUHL 3BT2L 4M9PA 4U7MA 5ANMA 4XP4H 3LKOB 3G04A 3GO1H 3OGCA 3V5HA 4OZGA 5EU4A 4L4VB 1D5ZA 2FB4L 3FRUB 3S5LG 1FFRA 4O02H 1YZZA 2ESVD 2ZG3A 4TTGA 2P5WD 2FWOB 1J0IA 5FUCE 2FZ3B 4ISVA 4NKDB 1QBML 1ZGLA 1NMAL 5DJ6A 3VXUE 4GBXD 5CZVL 3BP5A 5HI5C 1FNSH 1A7PH 2FSEA 4X7SH 3TCXA 3I6KB 3CFBB 5E00A 2A6JA 3OF6A 1K4DB 4I4WA 5ACMA 3QAZC 1CZ8L 3VXNB 3KPMB 4HUNB 4N9GA 4AIXA 5A3ID 5IWLA 3ULUF 2X2YA 4U1JA 1CCZA 2BSED 2IQAA 5EOTA 3AAZA 2CH8A 2A0LC 3QDME 2KDGA 4OLYH 3QJHA 1HH6A 3PV6A 4YBQD 5I76A 3HR6A 4R7DB 1BFSA 4NSKA 4NKOA 4L4TD 4LVOB 3ZSTA 4P48A 2JJSA 5GIRB 3GI9H 4H26A 1WZMA 4NRYB 1G7HA 5LKNA 4LHQB 3PGCA 3EOBA 1PKQB 5J11C 1I9RL 2KBGA 2VDPH 1NCBL 5F8QC 1U8LA 5I6XB 2DLIA 5C07D 1AY1H 3IDIA 1CDGA 2A9NH 4RFOH 1RURL 4WUKL 1EXUA 4M6ML 4L4VD 4Q9RL 3C60C 2VKXA 3ULVE 1FFNA 4P3CL 1OTTC 5FO8A 3ZKXC 4ZTOH 4CU6A 1IC4L 2D03L 4L3CA 5D9SB 2VQTA 2VITB 2FX8L 4J4PC 4XNXH 3UJIL 2PR4H 1X5YA 4P5MB 3CDGA 4J8RA 4ONHA 4Y1AE 2Y06H 3QUYA 5KSUA 5DRXB 5FYLL 4F7PB 5AEAA 1NLDL 1A14H 4CADB 3ZDZE 2ZUQB 5D96B 2IQ9L 3IDXL 4D9LL 4JFEB 1DUYA 3H42L 3L5JA 4PG2C 1KCLA 1M71B 3R06A 1PGRB 5I71B 2IADB 4PJ9A 2YPKB 5DA0B 1BAFH 2DDQH 4JFFB 3MRFB 2YR3A 3ZHDA 1K8IB 4LNRA 5AYQA 4RMQA 6FABL 2VLRB 4XWGL 3CUPA 3IDNA 1H3GA 5EBWB 5K33A 3MCKA 4WI2A 5IHZB 1QLRA 4KTDL 2D9QB 3GBML 3WIIL 4FHBD 5D7JB 4KDTC 1J05A 5SX5K 4AEEA 5MEOB 2R69L 3KYKL 1JGLL 3SDYL 3HE6D 2ICWA 3SQOH 1CICA 2RR3A 4ZO6A 4MS8D 3EYOA 2Q76B 5J6GA 5ETUA 5EZLB 4P4KB 3EYSH 1G7LA 3GIVA 3ETBF 2AK4E 4OUUA 4WI4A 4IJ3B 3C8DA 4UQ3B 1T1WA 2Z4QB 1REIA 5GPRA 1KCKA 5SWQA 3UTTA 4C56A 4TUKH 4XX1E 4ZUUA 4KPHL 4RA0C 4FZEL 5A2JH 1PKOA 5B22A 2ADIB 4WHCA 2DJ4A 2P7TB 1HXMA 1ZLVH 1MJ7H 1S7SA 5BV7L 2BDNH 4G43A 5IVXE 1MLBB 3EIFA 3QSKB 3EGSA 2FRGP 1FVEA 1IARB 4JFED 4K3JL 4LSRH 2C1OA 1ZEAH 5SWSD 3JTSB 3OKYA 4NQDD 1J12A 4JN1H 3RP1A 5KS9B 4MWFA 2XPGA 4FP8H 3WIHL 3U9UA 1CXLA 5A16B 1J5OH 4X8JB 1FLRH 1D5MB 4FFYL 3TCLA 5HBBA 4OCRH 1R3HA 2YPVH 4JANA 4BH8B 3WMSA 3NTCH 5I75C 1MFCH 1EAJA 4XP9L 2HG5A 3QFJE 5FYLD 4JO2H 2VNCA 4NQVA 5BV7B 4KJYB 2NX5A 3VXMA 4EI6B 2ZWLT 3MYJB 3GZKA 3MRIA 3ZO0A 2R4SL 5DUML 3WJJC 3W2DL 4X5XB 3IDMA 1CD0A 3FQUA 2NY4C 3RWCB 1IKFL 4P4KD 1A7RH 3TBWA 3BIKB 1Y18A 3DX6B 4NGHL 3VA6A 4PJDA 4HKZB 3AS2A 4F33B 1FAKT 1EFXD 2DWDB 4NCDA 2CR6A 4YO0B 1T1ZA 4XVSH 3QXTA 3L7FB 4L9LB 4RBPK 5IROC 3TLRA 4FMKA 4PJ8C 1U8HA 3LN9A 5F7EL 5J9PB 4AL8H 2VXQL 3SCMC 5C0EB 4K23L 4I48B 3OR7B 5ICZB 5D70L 4OJFL 3FB5B 4P2OB 4YBLB 3U79A 1IL1A 5C2BL 3K8KA 2AXFA 1QYGH 3PUCA 3BUTA 5I2IB 2E9JA 2PYEB 3DGGB 3VXOB 2VISB 1JGEB 2ZPKL 4N8VB 3SGKA 1PY4A 1LEGB 1G9MH 4EVNA 5EO9B 5HGBA 4TN9A 1H3TA 4LPVA 1U9KA 4OF7A 3UBXG 3QNZB 3VGFA 5EOCH 4OB5L 4DN4H 5I1GH 3VU2A 1P7KA 4L5FL 1HNFA 2ZUWA 1C5CL 1WWAX 3U6RB 4JM2F 4OT1H 5FO9A 4JJHA 4GUPB 4JG1H 2DLHA 2VZUA 4P57A 3MLXH 3TBVB 3ARDC 1TTGA 1TXKA 3P0GB 1TQCB 4D3CH 5L8JB 5IJKA 3ROLA 3L7EA 1JTTA 2HT4D 4HCRA 5HVFB 4LIQE 2VLJA 3KPTA 2EE3A 4MSWA 1RZJC 1BF2A 3DARA 4H25B 1TDQA 1FC1A 5JIHA 4RA3A 4UIKL 2XY2A 3J7HA 3LAFA 4JRXB 4I0PA 2Q86B 4OZ4B 1QD0A 1HHHB 4P2OD 3FL7A 3T4YB 4LSSL 1QFUL 3I50L 3OKKB 3TN0C 5IKCB 4NOFA 4JDTH 3TT1H 4U0RB 1ZHNB 1BVKB 5HYQA 1DQTA 4YHOL 2FX7H 2IF7A 4WNQA 5BQ7A 4TOYH 1HINL 5E5RB 1JV5A 1MFAL 1OAUH 4R4NC 3VE0B 4PJAE 4LSDA 2BRQA 4GXUM 4JJ5A 4J23A 1KFAH 1NL0H 4HMDA 2VJXA 3FT3A 3WE6A 1V3MA 1MHEA 2NCMA 4F7MB 1AFVH 5GS0C 1KEGH 1GZPB 2EDQA 2HT3D 4BQ8A 5D1ZB 3D9AH 1BOGA 4UNVA 5F1KC 4N90E 1OARH 1R5WB 2B4CC 3MQIA 1ZLUH 4LBEA 5ICYB 1BIHA 3UJTL 1KYOK 5CGYC 3C8KA 1KJ2L 3QEGH 3LN5B 1G9NH 1BBDL 3P4NA 1X5ZA 2DBJA 4PB9L 1EO7A 1T0NA 1L9MA 2IH1B 3T2OA 1MJ8L 1JMZA 3E6HB 5T33L 3PWPB 5T3ZH 1BZ7B 3IAPA 2D4FA 4ZFOA 1U95B 5F44A 3L3HA 1KPRA 3K2UL 4JRXD 3S36X 3PWVA 3LEXA 4U0QB 3CFCL 4XT1C 4ZNEA 2WUCL 2E8YA 3EFDH 4QY8B 4WUUA 1KJ2B 4P3WA 4NKQB 4LL9A 4XXCC 1FFQA 1FRGL 2Q8BL 5JQ6L 1SMAA 3BEWB 3BOVA 3IU4H 3LQZA 4RAHA 3GEWB 1P9MA 3H9SB 4NQEB 1YN7A 2AJXH 1CI5A 1X5IA 5C6TL 2AEPL 1IAIH 2L7UA 4MNGA 3NCYP 5BJTA 3MOBL 2HFFA 3H7BA 4UIMB 5JIKA 4I5BA 5ADOH 4OQTH 1QRNA 4RAVB 4DGYH 2EC9T 3AREA 3G04B 1RZKC 3OGCB 3V5HB 3O41B 3WXWH 3OAUH 2BJMH 1KJMB 3R8QA 5IVNA 3NFSH 5EU4B 2E5EA 2DQCL 1D5ZB 3QIWA 3BI9X 2FGZA 2D0HA 1LILA 2Q3AA 5CBEA 4DKFL 1OAQH 1A6ZA 3S88H 1F4YL 1RJLB 3ZYJA 1ZTXH 2GEEA 1ROWA 4ISVB 4R3SA 3VRIA 2I24N 1MH5A 1A6AA 2DBLH 5HYEA 1SVCP 4KAQH 4YDVA 3BP5B 3SGJA 3EAKA 4WV1C 2FSEB 2LVEA 5MEQA 2HJFA 3UTQB 2R23A 5E00B 2A6JB 5F1OB 1MI5D 3PWNA 4M5ZH 4I4WB 4OFIA 4WTZG 5TQ2H 1J0YA 4N9GB 5GJTL 4XVUD 1CLZH 3L3DB 1AHWC 4U1JB 2IQAB 5EOTB 3T4AA 3AAZB 3BMWA 3KLDA 3QJHB 4ZG1A 3PV6B 4JZJA 1C5DA 4ZO9A 2FEEI 5DFWH 5LGJA 4EXPX 3O3DA 4NQED 2CXKA 4NSKB 1QG3A 4NKOB 2UUDH 5CJOL 3WUWB 5DQDH 2BOBB 4ODVL 4HS3A 3ARPA 4F57H 1G7HB 4KQ3H 1EGJA 5KVFH 2EYRA 3TA3C 3MV7E 3PGCB 5I1JH 2A77L 4XAWL 4LFHD 1JPGA 2Q87A 1U8LB 4H8WC 3JVGA 4XBGA 2JJTA 5ITBH 3IDIB 4DN3H 2ATKA 3S35L 4ETYA 4EN3C 4AY0A 1EXUB 2D0GA 4ZD3L 3A6CH 1S7TA 1S7VA 4Z7UB 1OAKH 1FL3B 5FO8B 5TDNB 12E8H 4JQXA 5HD8C 4HC1A 2OX5A 4L3CB 3CX5K 3O8XA 5EOQL 5KW9L 2A6DA 3CDGB 3LZFH 4J8RB 4P9HH 1TPXC 4Z95L 5GHWL 5DD3L 3SBWC 3QUYB 5KSUB 3MC0A 4OZIA 5L9DL 3KS0H 5JIIA 1PSKL 3PXJA 3OF6D 3CD4A 4XI5C 2QKIB 1E28B 4XPFL 3BESR 3PP3K 4XVJH 5JA8B 3SJVA 4PJ9B 4BZ2L 1Z2KA 1LWRA 4HG4K 1KYOJ 4LKXA 2DQTH 4MB4A 5E4EB 1UACL 5DWUH 5HYJE 1AE6H 1Z6JT 3BD4A 3UTSA 3CUPB 3FRPA 3I85A 1KCUH 5DFVC 3UYPA 3SDDC 3MCKB 3G08A 3ORJA 1PX3A 5C2UB 4GSDH 5DJZA 2GY5A 1J05B 2YSSA 3H3BC 4XBPB 1LEIA 1K85A 3WNOA 1OAXL 4RGNC 1PJ9A 5FGBA 2IGFH 2ICWB 4O00A 4YHLL 1CICB 4EDWH 3P11L 4IIQB 4WVRA 3EYOB 5J6GB 4KDWA 5IT2H 5A1AA 4OUUB 1KCSL 2HT2C 1T1WB 1MY5A 3LRHA 3UTTB 4C56B 1PLGH 4F58L 1BF8A 4M48H 4WEBH 4NQCE 1ONQB 3D25A 4PRHB 3NCFB 1D5XA 4CVZA 4HJJH 3QUYD 5E7BA 1HXMB 4G7YH 2D4DA 5EC1B 4LPWA 2YKLL 1S7SB 4ORGA 1FYTE 1LP9A 4BFIA 1FNHA 3B2UD 1SJHA 4G43B 1NAKL 4XMKH 2ITDA 3EGSB 1FVEB 1CK0H 1UJ3C 1U3YA 1JTPA 4XC1H 5C0BE 4H1LB 4PJ9D 1E27B 1P69B 4YC2C 5J0BA 4MWFB 3VGAB 3QDJE 2XPGB 2Y7QA 5F7DA 3U9UB 1F90H 4M7KH 4U1IA 1A02N 3TCLB 4O2CA 1KACB 3C87A 1R3HB 4GAGH 4RWYL 5DD1L 1EBPA 2WWMC 3G5XA 2HG5B 5C0IA 4G6JH 5F97E 4PGEB 1KPVA 3ZE2E 1NKRA 1DQQA 2NX5B 2AJSL 1P53A 4ODBD 3VXMB 1INDH 5INDB 1CICD 3MRIB 4J4PA 5DQJA 4FFVC 3FQUB 5F9AC 1IZKA 3TBWB 1YYLL 1QSFE 4IBLT 1MCSA 1DL7L 4U6HB 4GRLC 5D71L 3W9EA 4UT7L 4PJDB 5JOFA 5AZ2L 1YEIH 4X8XA 3UTTD 3BKYL 5TE4L 3P0YL 4C56D 5C3LD 3BAEL 4S0SD 4P4RA 4CDHA 2QSTA 2PXYC 3LKSA 1T1ZB 3QDGA 3WDIA 2V9TA 4GAJL 1LD9A 2C3VA 3OPZH 3DMMA 1T21A 3BPLC 1U8HB 1P6FA 4LPTA 2EC8A 4MNQA 1AQKL 1YNKL 1AP2A 5DUBA 4JFHE 5BRZE 3JWDC 1FGVL 1NDMA 1IL1B 5TDOA 4AT6A 1MFEH 2F8OA 4K9EH 5EB9A 2AXFB 3WO4B 4HCRL 3OBAA 4IOFC 5EZIH 4YGAB 3QCTL 1RIUH 3CX5J 5DEFA 4TVPL 5CIPA 3RL1A 4EVNB 4LSUH 5HGBB 4ELKA 4BZ1L 2NX5D 3VXMD 2BY0A 1MCEA 1P7KB 1QFHA 2Y07L 5DC9B 3VFVA 4JQVC 5MENE 5E2VL 4MD0A 2HJLA 1OHQA 1TJHH 4P57B 5JUEL 4LRIA 3LIZL 1FFPA 2UWEA 3BYYA 2N4IA 3ROLB 4P2RA 3L7EB 4JLRB 4S10A 5FCSH 2QSCH 5FYJU 4HG4J 1FORL 5J56B 2DQEL 4PREA 4JKMA 3CXDH 5C92A 3ZDXE 2M1KA 4MSWB 1TITA 2WUBL 3JWOH 4Q7DA 5D72L 4MJ2A 5GGTA 4KK6C 2R0KH 5KSBB 1FSKB 4P2QA 1YEJL 4KK5D 3TC9A 5IQ7L 1TLKA 2NQCA 4FS0A 3RQ3A 1CGSL 3MLRL 1AGEA 4WGVB 4LSVL 4I0PB 4UINH 3RU8L 3AUVA 5E2UH 3QH3A 1B0GA 2F19H 3STBA 2X4QA 1WZKA 4XCCH 4G8EB 3A6BL 5KVMC 1YPZA 4ZO7A 5BW7A 4WNQB 3QWOA 5BQ7B 1JV5B 4BSWA 4JB9H 2A9ML 3DLQR 4I18A 4JJ5B 5TE6H 2C3HA 3B8YA 5F9WB 4ZFOL 5CZXC 2YD4A 3B8SA 4DQOH 2MSPA 2FJGA 3KYAA 3WE6B 1MHEB 2V5TA 1NSNH 1GOFA 4FG6C 4F8QA 3RKDD 3SPVA 1BOGB 4EIZC 3V52L 4LBEB 2BY2A 4EOWL 3MLVL 4S2SA 4I2XE 4YHZL 5E1AA 5IROA 3C8KB 4PJ8A 1LK2A 2F5AH 4MD4A 4KTEL 4KZEH 5IVOA 4PGBA 2VLJD 3SCMA 4TVPD 4LLUA 3UC0L 5B39G 1WIUA 3DVNA 2GJJA 4WI8A 5DD0H 4P23C 3VMPA 4CVWA 5IB3B 4I0PD 3LEXB 3VG9B 3BH8B 5TH2A 2CJUL 4OD1L 2R0ZH 3WSQL 2YEZB 4K3DH 1FL6A 4OD2A 1XGYH 1K4CA 1F02I 1MCWM 1J10A 4HK0A 4WUUB 4FQXC 4ZFGH 1T20A 5DLMH 3HC3H 4X9FA 3SN6N 4PGCA 4QGTA 5EU6A 3O3EA 2R9HC 2IBZY 1OGAA 4M6OH 3VGBA 3B3IA 1YN7B 1JZ3A 2XYCA 3SOBH 1BQLH 3LQAC 3KXFE 5LBSL 3V5DB 3WKMH 5BJTB 3VFUA 5EUKB 4CRPA 1FPTH 2HFFB 3H7BB 3RWHA 1MFBL 4AJ0A 3S3PA 5MP6L 1QRNB 1CE1L 3AREB 2VQ1A 3G6JE 5BMFL 1U6AL 3O45A 4XPAL 3SDAA 1A9BB 2FIKB 2XKNA 5HGHA 5FV1L 3QIWB 5AD0A 3F7QA 1GIGH 1R24A 5T3ZE 1R3IH 1OAZH 4WFED 2EDNA 3HPJA 4OZHE 5CBEB 1ZXQA 3IETB 1T7YA 1VPOH 1A6ZB 3HRPA 2QQLL 3CZJA 3ILQC 2NY3B 4Y88A 3RZCB 4S1RH 4R3SB 3VRIB 4E0RA 1MH5B 2PTUA 1EGJL 3I3BA 4YDVB 5MEQB 2HJFB 2R23B 1DBKH 3V4PL 3PWNB 4MCZA 2AERT 1KB9K 1A2YA 4XNZC 4UBDC 4WUUD 1FNEA 1FVCA 4IOIA 3TEUA 1S9KC 1NUGA 1NFIA 2COQA 4X9GA 3T4AB 5DHVH 1CGXA 3MROA 3O11A 3K80A 1C5DB 2EIZA 2ZSVA 4HC1L 5FYKU 3O3DB 1R5VA 4IDLA 1NCCH 1T1XA 1JWUA 3RVWC 1CQKA 3SE3A 4NDMB 1RJYA 5LQBL 2XFXB 3WLBA 2Z0BA 1OL0A 1OTUC 3SDCA 1JPGB 1MREH 1QRND 2ITCA 2H45A 3ARED 4XBGB 4WW1A 2ATKB 4R7NA 2BNQB 4LPYA 1OM3H 3U0PA 3ZDXF 3UDWA 3QIWD 4G6ML 1S7VB 3MRCB 1IEAA 1J0KA 1F4HA 3CIQA 2NXYC 2P1YA 3O8XB 3LRSA 3D0VA 1X44A 2NY3D 1FNFA 2A6DB 3LD8B 1NFDA 4WU5A 2R1YA 1GRWA 2QQQA 3RGVA 4XXCA 4OZIB 1N3NA 2RCSL 5E2TL 2CGRH 1L9NA 1AXSA 4ONGL 5GGRB 4PB0H 4QNPE 3DX8A 3SJVB 3T65A 1H5BA 3UO1L 2YWYA 1UM5L 4LKXB 1EIBA 1CL7L 3WHE0 3UTSB 4X6BA 1DQLL 5ELIA 3RBGA 5IBLD 5E9DE 4B5EA 5ACLA 2ZZUT 3MMEA 3VFGL 3G08B 5DJZB 3QBTB 2UY6A 4FQIH 5HVHC 4J3VA 1ACZA 3FFCA 1LEIB 3HLAA 4QT5A 1UEMA 1GGIH 5GGVL 4N9OB 1WLHA 4AYFA 1H3PL 1RZFH 5C0CE 1RZIA 4LLVA 4A2LA 2E6PA 3WDJA 4RMUA 3TIEA 3VI3E 5I1AA 1LO0H 4NO5A 1YJDC 3GNML 3MUJA 4WO4C 4FQCL 4DUWA 4MMXC 4UNUA 4WV1A 4WRLA 2ZG2A 3QHZH 1R6VA 3O8XD 1CXHA 2G60L 4YEEA 2DKSA 4G6KL 4I0CC 1U92A 2WMPA 3VD7A 1TETL 3D25B 3WUWG 1D5XB 5GRJH 4KH2A 2XQBL 5JNYA 4FTVA 3TYGH 4BFIB 1LP9B 1ITBB 1SJHB 2ITDB 2FLRT 1KUMA 1RV6X 2H2PD 3SJVD 1N0XH 2J5LC 1TMCB 3O4LE 4MQXC 1KIQA 2Y7QB 2DIAA 4PGZA 4U1IB 2M8XA 3UTSD 4X7EC 3GSRA 5T5NG 3O2WL 2Y72A 3KJ6H 2GK0A 4HGKC 4EN3A 1MRDH 3O6ML 4LQ1A 1KIRA 3G5XB 5C0IB 4B41A 4G8GB 3S36H 5IFAL 1KPVB 2VXVL 1QBBA 4EUPG 3WEXA 3MRPA 2ZOKA 2ZOLA 1JPTL 4QRSB 2J3SA 5DMGC 1KB9J 5ITFB 1EO8H 5HI5D 2J1KA 3SBWA 3V6OE 5BVPH 5JOFB 3BP7A 3K1DA 1A6UL 5GRYA 3OAZH 3NBNA 5HGGS 2C3GA 1V7MH 3LKSB 4KMLB 3GSVA 1KV3A 1DLFL 3S97C 3QDGB 5D6DC 2MCPH 2A0LD 2C3VB 3DMMB 1T21B 4N0YH 4PTUA 4MNQB 5I73C 3EOYG 1AP2B 5FGCE 3WNPA 5DUBB 3GSUA 2CDEA 4NZRH 5GGSA 3SDDA 4AM0B 4DVBA 1NDMB 1HYSC 1IJ9A 1A6WH 5TDOB 4AT6B 3C2AL 4GO6B 4QHNA 4OCWH 1OSZA 3IXTA 4X6EB 1DBBL 4LARL 3M17B 1MHCA 2BC4B 1LO3L 2V5RA 3VXTA 1H9VA 5DEFB 1FVDA 4O5LL 5CIPB 5IMOA 3RL1B 4X6CB 5GGTL 4Z7NF 1FDLH 4X4YB 1R0AH 4X9BA 4ELKB 2H1PH 1OTTD 3GB7A 5IV2A 4QCIA 3TZVC 4HGMA 4HF5L 1MCPH 1N8ZA 4LASH 1TZGH 2ADFH 1NGQH 3VFVB 2F58H 1KB5A 4J4PD 4UDTA 4MD0B 1QFWL 4N5ED 3TM6A 5JR1L 4QOKE 4OTXL 4EUPH 3RJQB 5JOPD 1J8HE 1DUZA 1FFPB 2UWEB 3EZ8A 4G8FA 1P84K 4H1LG 1QFPA 4FQ2H 5JDJA 1V3LA 2YN3A 2P45B 3G5VA 4M02A 3S37H 3LPGA 4PREB 2DQHH 5F1SA 1UJ3A 2PTTA 5C8JA 1S5HB 3QDGD 4NHCL 1F4XL 1I1AC 3DMMD 3BE1H 4PJIE 4MNQD 4NWUL 3ET9F 5GRWA 3PHSA 2BX5A 4HS6A 4C54A 1Q94A 3BDBA 1AGEB 1F2XK 1ZLVK 2E7HA 3DXAE 4S1SL 3AS0A 3QH3B 4YXLL 2AS5M 1Q0XH 1B0GB 4W6WB 2X4QB 4PJXA 1HIML 4N8PA 1OLZA 5B3NA 4RWHA 1YPZB 5B38G 4OM1H 5I30L 3QWOB 3ARGA 4WHYH 5L0QB 4BSWB 4FZ8H 4I18B 5D5MB 3KPSA 2VXSH 3D3VA 3FMGL 3IFNL 15C8L 1A7QL 4K7PX 5M7QA 3BX7C 1WZLA 4N8CL 2FJGB 1ITCA 1CGTA 3U7WH 1K3ZA 4ERSL 1EJ6A 4U4BA 1HOCB 3SPVB 1DSFH 2VC2L 2FBJL 2PXYA 5CWSB 5I9QC 3C09C 3MGTA 4S2SB 1WSST 4WW2A 5E1AB 4P2RD 4PJ8B 1LK2B 2OR9L 4MD4B 5JMRA 3QEUA 4K7FA 1F58H 4LLYA 4PGBB 2XI9A 2JJVA 3SCMB 4H1LH 2AJZA 5IHLB 4AK1A 4P2QD 3DVNB 1BBJA 1CR9H 5LGHH 3EJZC 3SDXA 3MRGA 2J8UE 2C4FU 4TSBH 3ZSSA 4NQSA 3CLEH 3VGGA 5TH2B 4PP1D 2XT1B 1B9ZA 1UM6H 2J8HA 3OX8A 1FL6B 1DBML 1RZJL 2FJFA 4OD2B 1K4CB 4UDUA 2NTFA 3EJJX 4HZAA 4HK0B 3GHBL 3IVKA 4DVRL 1T20B 3HAEA 3WXVH 1I9JH 1WGOA 1KN4L 4PGCB 5EU6B 2KZ1B 5DZOA 1KBGL 4JQVA 4R26L 3B3IB 3O0RL 2D7PA 4IRJA 3KLHD 3RY6C 2MTPA 4N5UA 4PJEE 3GBLA 5EU3A 1YQ2A 4OBSA 5HI4D 4WI6A 1N5AA 2IG2L 4GLRI 3VFUB 4MLIA 1BP3B 5CILH 1FN4A 1N4XL 4PY8I 3RWHB 1JHKH 2BSRA 2BERA 4XNYH 3QDMA 1E4WL 4GRWH 1WQVT 4UV7H 4XPGL 4L3EB 3A67H 3EYQD 3N06B 4IRZH 3LPWA 3HHRB 1RU9H 5EBMB 3O45B 1BFOA 5I19L 3SDAB 1UG9A 2XKNB 3H2WA 5AD0B 2VDLH 4PJ8D 1R24B 5E2WL 1JF5A 4R2GC 3HB3C 4PJ7A 2DWEB 3SCMD 5MHSE 4ZS6C 5IMMA 3VFNA 1I9IH 1BOYA 5BVJB 3IGAA 3T0AA 1YEGH 3ZYIA 2FLBT 1RULL 2PKDA 2YD6A 3O3BA 4E0RB 3TBYA 5CCKH 4C4KT 3GMQA 3MA9H 3D2UA 4I9WD 2XXMB 2KL6A 1U8JB 4WI5A 3GBNL 3HNVL 5DVLA 4MJ6A 4MCZB 1J9CT 2BNUA 4TQEL 3EJYC 3MODH 3QEQE 1A2YB 1SBSH 2J4WH 3WN5C 1FNEB 4IOIB 1NFIB 3WJLA 1VENA 3O11B 5EU6D 1P84J 1G0YR 1M1SA 4BH7A 2D7NA 1OCWL 1OGAD 2ZSVB 2EH7L 1R5VB 1T1XB 2DLFL 1JWUB 4Q0XH 5T1LA 1RJYB 3WLBB 1JBJA 5C71A 3DV6A 2GITA 5FB8A 3AROA 4PJBA 5DVNA 3SDCB 5JOPE 2ITCB 3MBEA 1S78C 3FN9A 2RBLA 2GJZA 4WW1B 2QTEA 5F8RC 4R7NB 1SEBA 1OSPH 1W2KT 2AV7A 2ZKHL 3SDAD 3U0PB 2DM3A 3UCRA 3G6DL 3GSXB 1L6XA 1MPAH 1IEAB 3OTTA 4MAUH 3DROB 4PJIF 2ED8A 4M43H 4LEXH 3WBDA 2EXYC 1RZKL 3D0VB 4G6AD 1NCNA 1NFDB 4MDJA 2R1YB 1HI6A 3O6LH 1IGIL 4FQXA 3HNTL 4MXQD 3RGVB 1KGCE 1N3NB 4BFEA 1SJXA 5I0DA 2AK4A 1V5JA 3O6FC 3RUGB 2CIKB 4LLQB 4GXVH 5FIEA 5IESH 2Z92A 3HMWL 4R4ND 3FO2A 3DX8B 3CK0H 3T65B 1H5BB 4ZFFA 4J12A 4NO0A 5L6YL 1BZQK 1NCAH 1RK1A 4YLQT 2J6EH 3WNMA 4Q2ZA 1DQJA 3O3UN 1UFUA 5IVXA 1T0MA 5J7CC 3MJ8A 1JPSH 4DGVH 3L5XH 4X6BB 4HQQH 2Z8WC 3MMEB 3H3PH 2DN7A 1CD1A 2BRRL 2CRYA 4ZNCD 5FO7A 1HN1A 3SDCD 2AEIT 3FFCB 3T04D 3HLAB 4QT5B 2Q1EA 5EA0H 1WVZA 1Y6KR 4YFEA 2YD1A 2VXUL 1MCFA 5I66A 4OFDA 4RGOH 1AGCA 3DVGA 5IFHH 3NCJL 4IEFB 4J2XA 3GHEH 5GISL 2K9UA 3MZTA 4JPKL 3TIEB 5I1AB 4NO5B 1G9MC 3NABH 1MAKA 2OK0L 3QFJA 2UY7A 4WV1B 3W5NA 2IBBA 1KG0A 4YGVB 2J8UF 5C6PB 1C7SA 2IALA 3O6KH 1U92B 4BUHA 4TPRH 3H6JA 5FUOH 4HUVA 3RGVD 5JNYB 4FTVB 4KI5C 3ZTNH 2G9HA 3LVEA 5BOPA 3B83A 3RA7H 3I6LD 3RZWA 5TF0A 5K59E 3MUGB 4OCXH 3QUXC 4PJEF 1HZHH 4HS8H 4IRSC 1BLNA 1KJ3H 1F42A 1KIQB 4H5SA 3TV3L 5EU5A 1KIUA 1KN2H 3KJ4B 4HKBB 4KKCC 2B5IB 4NM8H 3GSRB 1NBZA 2ZCKH 3FB8A 2GK0B 3BWAA 3VW3L 1KIRB 4YXHL 2NW3A 3FFCD 4JVUA 1XEDA 3WEXB 3TVMA 3MRPB 4ODHL 2ZOLB 3IU3A 3BGMA 3RVVC 5E0QA 3V0WL 5CFHA 1WTLA 5FK9A 1FV1A 3C9NB 3VMNA 2EDOA 4GG6E 4PRDA 4RAUA 4ESKA 4MXVE 5C6WH 3I9GH 4WWKB 1EZVY 4ELME 4R97C 3BP7B 3GKZA 4JPWL 5F9JA 7FABH 4M8QA 2XN9E 3GSVB 4KUCD 3G6AA 3NCCB 4FTVD 3WNLA 5IGXH 2E7BA 1EJOL 1F8TL 3S4SG 4PTUB 1JNLL 2NMSA 2JKXA 2YZ1A 1KB5L 1UGNA 1BQUA 4ZXBB 3ZKMC 5DJXA 5E95B 4OKDA 2ZNXA 3LSOA 1MCRA 2IAMB 3NPSC 5GGSB 4DVBB 4E9LA 1NJ9A 4PYGA 1CLYH 3FB7A 3QUKB 4MB5A 3Q3GB 2F5BL 4P59H 1KENH 1CD8A 1CGYA 5D2NE 4XB8A 1E4XI 1OSZB 3IXTB 4KVNH 4Z7WE 1MHCB 2G75B 4EN3D 1FVDB 2W9DH 4X6FA 1NGXB 1EK3A