1FNSH

Crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
225
structure length
220
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVDWVRQPPGKGLEWLGMIWGDGSTDYNSALKSRLSITKDNSKSQVFLKMNSLQTDDTARYYCVRDPADYGNYDYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN NMC-4 IGG1
publication title von Willebrand factor conformation and adhesive function is modulated by an internalized water molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsH01
4HULB 4JPIA 1JNNH 1I1AA 3RY6C 3LN4A 3LV3B 2WBJC 2R4RL 1BREA 4PBVC 1NGYB 4JR9H 4PJEA 3SE4C 3P4OB 2VDRL 3HC0B 4XBGB 4ENEC 5FECA 5ENWB 4PJXA 5L7XH 4NO0A 4QRTB 1U3HB 3O3EA 3CX5K 1DQTA 4Y5YB 3GJFH 1Z9MA 4PYGA 4IOSD 4TVPD 2EC9U 3WLWC 4KJPC 1T66C 4HK3J 3WE6A 3IB4A 1HHIB 4APQD 1S5IH 2UVFA 4N8VG 1MJ7L 3JWDL 2NPLX 1I9IH 1R5IA 4TUOA 4AMKH 4Q9QL 4ZDHB 1G1CA 1KIPA 3F58L 4WO4C 3MPCA 1YEGL 5MEOA 4K2UL 4HT1H 1GCFA 1S7UA 1YNLL 2MQ0A 5GIRA 1MPAL 1O7VA 1IEAA 3SDXF 5CEYB 2IAMC 3BT2H 1UWXK 4JQXC 1ZANH 3OR6B 3RIAK 1J87A 2NXYD 1XGPB 5IHZB 1NGZA 3H9HA 5D6DA 2DYPA 4HWBL 4ZOAA 2G9HB 1DUYA 5HYSA 5GGSB 1IAKB 2Q76B 4RMTA 5DQ9A 3QXDA 4XP5L 2WQRA 3MA7A 1BIHA 5C8JB 1TCRA 4GRMA 4HK0A 4IMKA 2OR9L 2X5PA 3TO2B 4BH8A 4JO4H 2BVTA 1QSFB 2GFBA 4I3GA 3VXMD 3CU1A 9CGTA 4IRJA 1TTFA 3EYSL 2GJZB 3JSSA 2ED8A 4RGND 1DN2A 2GI7A 4RX4D 4PJCF 3T0AA 4DGVH 1F4WH 5AWNH 2F54A 4OZHF 4TNWF 5SWZA 4U1JB 3GM0A 1R6VA 3MV8A 4XVTH 3UPCA 1U8MA 5DRNB 2EXYC 4PRAB 1A47A 3VG0L 4X4ME 4AK1A 2P7TB 4IRSB 4ZD3L 3GHEL 5KVDH 4Y0GA 2P47B 2WW8A 4X8JA 1F3DH 4PG9B 3WFEH 3LB6D 2XTJC 1S3KH 3HFMH 1H8SA 5DLMH 2NTFB 3H42H 3D18A 3U1SH 5IKCB 1I8KB 2AS5M 2R1WA 4OQTH 3CXHK 1R3HA 2H6PB 4HFWA 2A6JB 2CK2A 4QY8A 5INDB 1QA9A 4NNPH 3EOBA 1D5MB 4Y19E 1G6RA 1CLCA 1G7IA 4BELD 4P23C 4OCLC 4Z95H 3WV0A 1T21B 3D3VD 2X4NA 3CSPA 2A74A 2A6DB 2VZUA 4X7TA 5HSFA 1VENA 5KN5B 2BNQB 2XZZA 3O2DA 2GJ6B 4DW2L 1LEKA 1Y0LA 1P7QD 1YDPA 1ZHNA 5FO8B 1C12A 3D3VB 5FKAB 5EIVA 3MCLH 1FGNH 3RWHA 3R06B 4WTZA 4G8EB 4X6DE 3DUHA 2BMKA 3BGAA 3VGBA 2DJUA 2NR6C 3SDAD 4CUCA 1BM3L 3UTZB 3ZKSD 4AIOA 4TUJB 3A67H 1EMTL 3IFPB 3P73A 4URTB 3RWEA 1U9KA 3BP6A 5BZWA 4FQLH 4KJWC 4HQQL 3ZYZA 1CD1A 3I85A 1SBSH 2R4SL 1T03L 3BP4A 3C5SA 4OIIL 5C0CD 1QBLL 4Y1AA 1GAFH 4G8GB 3MRKB 3PWUA 1FG9C 5DUPH 1A7NL 2IF7A 1J5OL 5LGHL 1OGAA 1XZ0B 1P5UA 2CMRH 3WKNA 3W11C 1A1NB 3NABH 2DD8L 4YHML 1RK0A 1BBJA 4WY7H 5A2JH 3MYJA 4K3JH 3EYQD 2OP4H 2OL3L 2EDEA 4Y4KC 3SDXB 4I5BA 1AY1H 3BIKA 4DZBB 2X70B 3GMQB 3NN8A 3D39D 5JIIA 1FG2A 4MMXC 3WFCH 2QQKH 4C56D 2E7HA 1AHWC 4K3DL 1G7JA 4FNLL 4JE4B 1NSNH 5JMOC 1A6ZA 7FABH 2CGRL 5MHSD 4JVWA 5JIKA 2YPLA 3D87B 4XI5D 3S88H 4Z7VF 5HHQB 1MVFA 2ID5A 3RUGB 4HAGA 2WK2A 2IG2L 1YJDC 4WI2A 3H0TA 3BXNA 4Y16D 5JUEH 1G84A 4NIKB 4Q6IA 5BXFA 4YNYB 5KTEH 1O5DT 5IW6A 5C07D 3TJEL 3KPRE 2CQVA 5E6IA 4PJIF 1MVUB 2OLDA 1QVOB 4PJCB 3UJTH 1ZS8B 1EGJL 5DUBA 4OZHB 3VFSB 2L7UA 4I3SH 3IDMB 5C07B 4U6TA 3GBNH 2BHYA 1CICD 2C4XA 4YHOH 5JDSB 2R39A 1B90A 5D7SH 3V5HA 4OCYL 4HAFA 1U95A 3JUZA 1QYGH 1BGXL 3GRWH 4LRIA 5KS9E 1RZGA 2YRPA 4NRXA 5HYQA 3T0WA 4N0RA 3ZDZF 3ULUD 2BOBA 4OKDA 1BPVA 3MUGB 3F7VA 3OKEA 3CCHA 3IDYC 5B39G 4FQCL 4QXGH 1YECL 3E6HB 1RURH 5C0FA 4XBPB 1FN4A 3DTXB 3LS5H 3O81A 3X3FL 3V79C 2C3VB 3KPTA 5GRVK 5T3ZE 4GJTB 3EHBC 4M3KB 3BQUB 3S5LG 3C5ZC 4IMLB 3FO0H 4Z7NF 5AZ2L 4K3EH 1YEDA 2FEEI 4LSSH 3RTQA 1JNHB 1T1ZB 4EJ1C 1CGXA 3T4AB 2I9TB 5E03A 2NNAA 5T1LB 2ERJB 4I13B 5EBMA 3TT1L 5JOFB 3OSKA 4OLWL 3M45A 3O6LL 4P99A 5KJRH 2HVJB 3TN0B 3R1GL 5LCVL 3DMMD 5A1AA 1S78D 1IGJA 5FYJL 4L3CA 1AD9B 1OWWA 2D0HA 2R1YB 2ZCHL 3ZDXE 3VWJB 3G9AB 3QUZC 2Z35B 5IIEB 4C58B 1A6WL 3VFOB 4Z7UE 4OCXH 2D31B 1NEZG 1RZFH 3C9NA 2EKJA 3V4VL 5IFHL 3GSUB 2H2SC 5DJDA 2QV2A 4CNIA 2XG4A 1L9MA 3TBWB 4LSPL 3TPUA 4ETYA 3L1OL 1RIUH 1CLZL 3RL1A 3GI9L 1VEMA 3WNNA 4RNRB 4OLUL 4MJ5A 2BVPB 2CXKA 2NLJB 2ZP0T 5IVXF 3C09C 1A2YB 3UTSB 5CD3A 1QR1A 3W2DH 1CLYH 2VLRD 4M03A 4MAYB 3S36H 1KJ2H 4TNVF 2QKIB 4LAJH 2CXGA 3MC0A 4UOW0 3F7YB 3AU1A 5LAXA 5D7KD 3SCMD 4P57B 3I2CL 5FO9B 1J0YA 3I50L 2IFFH 2P4AB 4ODHH 4Z7VB 3HZYA 1FFOB 1NUGA 2ESVD 2Y36L 4JFZL 5IQ7L 2EDLA 4KJQC 1F97A 1FYTE 4HWBA 2X41A 2VDKL 1MJJA 1SJVA 1N6VA 5HYFA 4G5ZH 4PJIB 3U7WL 1PZUB 5MP6H 2CR3A 1JVKA 3QQ4B 3I02B 3PL6C 1QBMH 3HUJF 5C0GA 1YQVH 5DD1L 1F6LL 2F9BT 4NZTH 5GGUB 2RCSL 3RY4A 2AI0L 5EA0H 1EHLH 3H7LA 2W07A 2WP3T 1FL6A 2JK5B 2HFGL 1KXTB 5DSCA 3VFNB 1KB9K 4I18B 5JNYB 2A6KB 4KQ4H 2FJFA 2OSLA 4PJFE 3RGVD 4MD0B 4OD2A 3HMWH 4M7ZB 5J1AA 3I3DA 2FD6L 5F97E 2FGWL 3VXUB 4OFYA 4HHAB 4LK4A 2NY6B 1KPUB 5JHLH 5E9DB 5D71H 1K85A 4LDOB 5F6IC 3RGVB 4P46C 2DDQL 1U8KB 4JB9L 1R3JB 2UZIH 4JLRB 4BFGA 4E5XA 3QDGB 3D25A 5CZXD 2KH2B 5JXAH 3RP1A 4L8DA 1S9WA 4RZCB 5K93A 1T4KA 3L9RB 5SWSB 2DI8A 2R0LL 3BKMH 3PGFH 3VG9C 2FB4H 4U1HA 3ABZA 3S37L 3NZ8A 2E7CA 5EN2B 3SQBA 4KZEL 4M6OH 4PRDA 1KF9B 3OAYH 3MLVL 4FQHA 2WLZA 3V6OC 4QRRA 4L29B 3VXRE 3WMSA 2VN7A 2HFFA 3L3IA 1SY6L 1FIEA 2HLFD 3PDGA 4HZLB 3DUUB 4P4KD 4X5WA 1WIOA 1UM4H 3SJVB 2O5XL 4BZ1H 1PD6A 4G6KH 5LGJA 4G9DB 4WFFE 4RCAA 5D1XC 1WFOA 1B0RB 1N4XL 3GMOA 3QIUB 1OP3H 5I76A 4L4TA 3AREB 3JV6B 4WU5B 1BECA 3HNTH 5I18L 1GHFL 3D69B 4R26H 4KUCF 2HKHL 1KLUB 3T3PF 3BRFA 2UZXB 2NX5D 3BHBA 3DIFB 4JPVL 5DQDH 5DYOA 1XEDA 4JCMA 5DK0A 4EBQH 5E2UL 5J56B 4KHXH 5IVXB 4LSTH 4D9QD 2MQCA 1AGCB 3BPNC 4XP1L 5IBTH 1JPFA 4ODUA 1M71A 2JJTC 3O3UN 4KUZL 2OL3A 1I1FA 1I1CA 2JIXA 3ULSB 2J6EH 1T1YA 2H45A 5FCUH 4R4BA 5E0QA 3CZJA 1TZGH 2EH7L 1WSST 2CLZA 3PQYE 5F6HI 1ED3B 4YHKL 5C9JB 4GKZA 1U41A 2IBBA 4NNYB 1F58H 4F2MA 2OTUA 3TNNA 4Z7QE 5SX4H 4F33B 5LXGH 2VLLA 4PD4K 5H37H 4NC1E 1JWSB 5CFHA 2XWBB 4S1QL 4ZYKA 1ODAA 3HUJB 3MNWB 2JJSA 5IFAL 4JFFE 5IM7B 2BCKB 4G9FB 4P2YA 3X3GL 1UB5A 1NGPH 3LPWA 5I8EA 3FAXA 1NCDL 1BX2A 4JAMB 5DWUH 2VZ3A 3EZ8A 2X42A 4IOIA 2AQ3A 5ACLA 3MBXH 1EGJA 3DNKA 2IPTH 1KJVB 1QKZH 5ALCH 4PY8J 5IROA 3GIVA 4Y4HB 3ZL4H 3JWOL 1JZ2A 2HTKC 3FN0H 3F5WA 1BVKA 2BVQB 5HHOA 1BBDH 4OM1H 2LABA 4OLYL 3KDMB 2FDBP 1MH5A 5DJYB 1S7XB 1YEHL 5IFJB 1IMHC 3OX8A 1YNKH 1J1XH 2YWYA 1XMWA 1MCOH 4P2RB 3MLWL 4NO3B 2SEBA 2CLVA 2GITB 4PP1C 2CKBH 3HR5A 3GJFK 3JVGA 4ZTPL 3VXSA 1N2RA 1HNGA 2DQJH 4QGTA 3WKML 2PW2A 2DQGH 3T8XA 1X3DA 4E41D 5DFTA 1MHCB 4QRSA 1KCSH 5GGSY 3G6AB 3UBXG 2DM4A 3WJJC 3MLZH 4KTYA 4JRXD 2XWTA 1HWGB 1YN7B 2XICA 3MV7A 4ZXBA 3EO1A 1NGWA 2EDQA 3IDIA 1S9VB 3BN9D 3FOMA 1AKJD 4E41B 2YPLD 3C2AL 4WCYH 2HTLC 4NKIH 1MLBA 1UACL 2YK1L 3NZHH 3GGWB 4M5ZH 4K9EC 3B8YA 5EFIA 1MI5E 5C6PB 1NBZA 3MRHB 3FTGA 2VLMD 4GFTB 3UXFA 1AKJB 4PRHE 3IFLH 4OF5A 5HTSA 1BD2A 1W0WB 3SDDB 1NGYA 2HH0H 3N9GH 3P4OA 4OTXL 5ECJE 3WNOA 3HC0A 4Z7WF 1OD9A 3CFKB 1D9KB 2UV3A 2FIRT 5CLTA 2MTPA 1U3HA 2Y6SD 1EZVX 1MCPH 4Y5YA 2APFA 4FG6C 3TCLA 5DD6B 3DVNB 1MNUH 3C6LD 3VGAC 5F7DB 3QWQB 4NZRH 1ZMYA 5BJTB 1WWAX 3PGDA 4O2CB 4U7KA 3O4OC 4CMHB 4WVRA 1M6OA 4JHWH 3HG1E 5FHBH 2WBKA 2YHGA 2V17L 3C6LB 1JZ5A 1F4XL 4JFDD 3OF6D 2ICES 1IAOA 1MIEL 5LBSH 4UTBH 2CJUL 4XCYB 1JGLL 3KPNB 3PWNB 3RGHA 2W60B 4BZYA 3BDYL 1FAIL 3IYLW 4B0MM 5CEYA 1K8DB 3ECBA 1QFWH 3SKOB 2A6IB 2HKFL 3ARFD 4P0DA 4WDIB 5DTFB 3OR6A 2BY3A 5IHZA 1IT9H 3HLAB 1OTTC 2G9HA 5CGMA 5GGSA 1IAKA 2Q76A 2V2TB 2CRZA 3VCLB 5J57B 1MCQA 1JYVA 3ARFB 4YBLB 2PYED 3D1MC 1RZ8B 3HE6C 4XZUB 2MHAB 3VI4F 3LIZH 5C8JA 4MNQD 1RFDL 3RKPA 1B6UA 2ED7A 5F3BB 3L7FB 1AJ7L 3WHE1 3V7AG 3JZ7A 1TVHA 1QSFA 4M48L 3LQMA 1BZQK 3GIZL 2AXGA 5DURD 5HBBA 4LKXB 1AD0A 1KSRA 2AJZB 4KY1L 4PV9B 4JFYB 3QHZL 4U6VH 3SKNA 4XRCB 3SBWC 4JREC 5HDBE 4NQSA 1M7IB 4L1HA 2XA8L 3LKPB 1WQVT 4U1JA 3TZVB 3BGMB 1F42A 3KLAB 4PRAA 3CH1B 1W0VA 4YO0A 2P7TA 4IRSA 3MRFB 3ZE0F 5IQ9A 5DMGC 5TDNA 3TV3L 1KB5H 3BZFB 4ZFFB 4TVPE 2E27L 4W4OC 2YUWA 3EIFA 3MZGB 1DVFC 3T04D 5A3ID 4JFEE 5TJWK 2QQLH 2NTFA 3DSFL 4MD5B 2AKRB 1IGCH 3MXWH 3QCVL 3CXDL 4H0GA 5BW7C 3DETD 3TVMA 3WJLA 2H6PA 4K71B 1CT8B 1WAAF 4MXWH 2A6JA 2IBZX 5F9WC 3GMRB 4KMLB 4M1DL 5CS7A 2BZDA 3MRMA 1D5MA 1RVFH 3N85H 5A2KH 4PJ7F 5D7IF 1GZPB 5L8LB 2P5WD 3NFSL 4TULH 4LVHB 4K3GA 4HS8H 2ZCLL 4LHQB 2A6DA 3FB8A 4PJAF 5KN5A 3G5VA 1WLHA 1CDHA 2GJ6A 5GS0H 4PJ9C 1SY6A 4LRNL 2P5WB 2VE6A 1FZJA 1K5NB 2O93L 4JJ5B 4M1GH 3R06A 4Z7WB 3B9KC 4JFPB 3VA6A 4G8EA 5C0BA 4Z76B 8CGTA 5F7LB 3UTZA 5IBLD 5FKPB 4TUJA 3QXVA 3UMTA 1NLBH 1FBIH 3IFPA 4I2XB 1CXKA 3NFNA 1CFSA 1EV2E 3M8OH 1OAYH 3VXME 1WK0A 4PJ8C 1K3ZA 2FEEL 4X98B 2FEDC 4WHDA 3PGCB 1GIGH 3HAEH 4RGNE 4E9LA 4G8GA 3MRKA 1L7IL 3BKJL 1XZ0A 4UI2A 4YBQC 1A1NA 1OTSC 4IIQA 2AJ3B 4KVNL 2OQJB 1YEKH 2MNUA 1MF2L 2EDOA 3KYMB 3QHFH 4MA7L 5T3ZH 1P7HL 4OZIE 3SDXA 1I3VA 1U8NB 2GW5A 4GW1B 4KI5D 4MVBC 1H3TA 4WFED 4HUVB 4LPVA 4DZBA 4OI9A 4R9HA 4Y5XB 3VXQB 4YXHH 2X70A 3GMQA 3NIDE 2FH8A 3PV6B 1EO8H 1YEIH 2Y1VA 3KYAA 3OPZL 4YDIH 3FRPG 4WENB 4JG1H 1VADB 1B0GA 3BJLA 3GSOA 4CRPA 4HUXB 1IM3B 4ZFGL 1NFIA 4JM2C 5CSZB 5HDLA 5DJCB 3WIIL 3QQ3B 1JZ6A 3QUXB 5EOTB 1OHQA 4L8BA 5FM5M 5CINL 3DGGB 1DSFH 3EO0A 3UTOA 3BFOA 3MRIA 4LQFH 4XMPH 1N6QL 4YNYA 3MRDA 5MI0C 1B4JL 5HI3D 4A6YB 2NY1D 1U8PA 4YZFE 2D03L 1MVUA 1FL5B 1QVOA 1ZE3C 4DGYL 4PJCA 2HG5B 2GT9B 4L4TD 1DBBL 3NCJH 4OZHA 3IDUA 1HZHH 3UO1L 4NKDB 3VFSA 1YNTB 3CC5B 2XRAL 3IDMA 3RA7H 1T5XA 2HFTA 5J11C 4YQXH 4QLRA 3VH8G 1CDIA 4UTAH 2EDKA 1KULA 2PW1B 2XKNB 3HC3H 3HCVA 3WO4C 3EDEA 3L3JA 3O8XB 1DLFH 3QA3B 3T0XA 1CFQB 5GGTH 2FBJL 1NCTA 4ERSH 5C0AA 4XPGL 2BHUA 2B2XH 4NM4L 1KTKE 2MSPA 4RGMB 5C0CE 3HC4L 2Y07H 4LMQE 1IC1A 3DX9B 1RAMA 2D7QA 4XHJC 3PHOB 3MSPA 4PJBE 1FVDA 2Q6WA 3VI3F 4G6ML 4PJ7B 3VFMB 5D7IB 1CZ8L 3NCYS 4JPWH 3RI5K 4XBPA 5TDPB 1ZXQA 2OBGA 3X14B 5TPWH 4BQCA 3DX7B 2W0FA 3D0VB 5EU4B 3CUPA 3EAKA 4PJAB 2C3VA 4LOUD 5TFSL 2V5TA 3FHAA 2EDNA 4R4FL 1JHLL 3D39E 3BQUA 5ITFA 4IMLA 3EFFB 4OUUB 4C56E 1JNHA 1T1ZA 4NFDA 4P5MB 3MGOA 2BVEA 1CD8A 3G04B 4XP4H 3LMJL 1HKLH 5MHSE 5JOFA 2DL2A 3G5YB 3TN0A 1AR1C 1DR9A 5GRUL 1F8TL 1GOGA 4OB5L 5D2LE 4NWTL 2LAAA 3QDMD 2VITA 5BVPH 4KKBC 3SGDI 3VWJA 4XAKD 1NFDE 2Z35A 4NN6C 2LU4A 3DROA 3HB3D 4XCFL 1MJ7H 1H8OA 5DFWH 3JWDH 1AGDB 5HHOD 4Q9QH 2EDXA 1IAMA 3F58H 5J8OA 2V6HA 1PX3A 1RJYB 3INUL 1Z5LB 4LSQL 1YEGH 2PTVA 5KVGH 5GJTH 5T5NG 4ELME 2G75B 1PLGL 5JXEC 5I17B 3C2SA 3KYKL 3ISWA 2XZAL 2VDML 1OAUH 3BPOB 3VFUA 2IAND 4R4ND 3QG6B 1A2YA 2VABA 3OBAA 4U4BA 3UTSA 5HD8D 1A6TB 1FNAA 3VXSD 5JZ7D 1HH9A 3CFDB 4BFIB 4PY7A 3ULUE 2WWMC 4K8RD 2IANB 5F6HJ 1L4IA 1JK8B 2VMFA 4P57A 2VZTA 1OB1B 1ACZA 1ND0B 3MV7D 2AK1L 5EC1B 4ZXBD 3T0ED 2OR9H 4Z7VA 1FFOA 3RPKA 5DMIL 1ZA6B 2AJSL 3X17A 2BJML 5CEZD 1HIML 2CRIA 4PG2C 5M94B 1CBVL 4ZAKB 4GLRI 1QO3A 5JIPA 4OGAC 1NAMA 4OCWH 4PJIA 2H26A 3VE0B 2Y5EA 2BC4B 1EEYB 2J1KA 3QQ4A 3MCG1 3I02A 3U4BL 4M7LT 4I3RL 3JV0A 1NC4D 5GGUA 4KZDL 3KPPB 4HX1A 3OAYK 4XHQA 4KDTA 3VGEA 1K4DB 3SDCD 1LO3H 1UZ8B 3PE9A 3PXJA 4YGAB 4U2YA 1KC5L 4JO1H 5TQ2L 3VFNA 5HVHC 2XWJB 3Q6FA 5JNYA 4XC1L 5FYKD 2DKMA 4ZPTA 4FFWD 3SDCB 4UBDD 1GL4B 2CLRB 4X9GA 1OP3K 1J11A 2ZCKL 3VXUA 1UEYA 4HUWB 2E7MA 2NY3D 5E9DA 2JB5L 1QSEA 2VXVL 3K80A 4ZUSB 4DKAA 3D0LA 4PJGA 4G7YH 3MUZ1 1U8KA 1Q9LB 3GO1L 3QIBC 4JLRA 1DQML 3MZTA 1A5FH 3TIEB 3FQUB 3QDGA 4FTVD 1KNOB 3O41B 4GXVL 3G6JF 2NY3B 1JZ3A 4WHCA 1JI2A 4RZCA 1CXHA 5SWSA 3FO9A 4U7SA 4XNQB 5DD3L 4DVBB 3W81A 2VLRE 5IT2H 5AD0B 4S1DC 5EN2A 3QEQB 3HA0A 4AEIH 4YR6B 5CKAA 2HWZL 4ODXB 2PR4H 3HPLB 1Z9OA 2CK0L 1YEFH 1MRDL 4L29A 5ALBL 4WWKB 2M26A 3AMLA 2ESVE 4LLAA 4ODTL 2Q20A 3PABB 4L1DA 4NM8H 3SJVA 3P11L 2YPVL 2R4SH 1T03H 2QADC 2YOCA 1IZJA 3TFKC 1PY4A 1B0RA 5LG1A 3QIUA 1QBLH 5DJ6B 3BP7B 2BNUA 4FMKA 4PJ5A 5ID0B 4EDWL 5KSVB 3JV6A 5LGHH 3DI2B 4NC1C 4YHMH 5GGRB 5FGCB 2D0FA 3ESUF 1SHMA 2UYLB 5F71A 2R0KH 2VXUL 3W39B 4X0KB 1NCCL 3QCTH 1DUZB 4PJXE 4OGXL 2UY7A 2VR4A 2HMIC 5EUKB 1CF8H 4I4WB 4P5TC 5C86A 4LASL 5L6YL 5T3XD 1J86A 3ZTNL 2MPAH 4EN3A 2I60L 4K3DH 3FZUC 1JTTA 3DPBA 3OKKB 1FH5L 2W9LA 3VRLF 4KQ3L 5CJQL 4P3CH 3GNML 3ULSA 1DQJB 2Z8WC 4XXDA 3TVMD 2EO9A 4RMVA 4WUKL 2GAZB 2IG2H 5MEPB 2DBJA 3VWKD 4X9IA 4Y2DB 3TCXA 4TSCH 5C9JA 4NNYA 3OKDB 3B9AA 2E9JA 3LQAC 2X9WA 4HXBL 5I1IH 4QO1A 4XNMB 4F33A 2I5YL 1JWSA 3NPSC 4KRMB 4QOKB 2G5BA 3HUJA 1FDLL 5IM7A 1GGCH 5GISH 4G9FA 4QHKI 3G08B 1T1WB 3PIQB 4UINL 3BD3A 4A6YL 1QEWA 2PXYC 4J23A 4LEOB 4OGYL 3I75B 4XB8A 1HQRB 1BGXH 1SMOA 2N1KA 3U36B 3D2UD 5CHNA 3MRPB 1EVTC 3TH4T 3VXPB 4KK5C 1D5XA 2H32H 4LLWB 3BWUC 4Y2OA 4D0BA 5K9QG 4RA0C 2BVQA 1HNFA 1WBXA 3KDMA 1PBYA 1MCIA 3DX8A 3J7HA 4HWUA 6FABH 4UT9L 1OCWL 3QUYC 2VAJA 2NW3A 2IQ9H 1J8HB 4FQCH 4R90L 4WV1B 5IFJA 2F54E 2HN7B 2F8VA 1MFNA 3GSNA 2KZWA 3X11B 4P2RA 1AO7A 4J3XA 4KK8D 4NO3A 5EO9B 1H15B 3VFWA 2NX5E 3BZEB 1MWAB 3FFDA 3X3FH 5F3HB 3G6JB 12E8L 1LO2L 1XCQB 3P0VH 2RQ8A 5D6CA 5JTWA 2YUVA 5E2JA 4D9LH 1UEMA 1BQHG 1OW0A 4HXAH 1XAUA 4D9QE 5AZ2H 2ADGB 3U79A 1IQDB 4OZFG 3O4LD 1XIWC 4M7KL 5CBEB 5J6GA 3WUWG 2OJEB 4EVNB 3AB0B 2V7HB 5HJ3A 1YN7A 3KJ4B 4OLWH 2P8MB 3O6LH 5ANMA 4M1CC 2GTWB 3R1GH 5LCVH 3HE7B 5KVEL 4PJHE 3GGWA 4QT5B 1V3JA 4HIEA 4XCCL 1WBYB 5LGKA 3VRIB 1A6WH 3MRHA 1MCDA 2F19L 2OXGA 1Y6MR 2V9TA 3IRZA 5IFHH 5C3TA 3QIWB 3QSKB 5IMLA 2ZOLA 3WHE0 3U7YH 3SDDA 3L1OH 3U0TB 3MV9B 4OFIA 3VD3A 4Y4FC 3CFKA 1D9KA 3MRLA 5IHBA 5IOPB 4OI7A 2W92A 4MXVF 2CDFB 4OCSL 1XGTA 4LNRB 3BYTA 3TNMA 3VGFA 3DVNA 5E2WH 4E0RA 3S34L 5L0QB 3N1PC 5C0AD 2HYMA 1IRAY 5BJTA 4O2CA 3I2CH 2X1OA 1JP5A 3QPXH 1CWVA 4YHNA 4XGZA 5IQ7H 2FO4A 1OGAE 4HMDA 3KPNA 2B0SL 5AG8A 4ONOA 2W60A 1WBZB 4HJJH 1OLLA 1K8DA 4XMLL 3SKOA 1CE1L 2A6IA 3U7WH 5C9KA 4RFNC 3ZE2E 5KW9L 3QNYA 3HLAA 4R6UA 1GGIL 3OB8A 4LP5A 2V2TA 1J12A 2AI0H 1FC2D 3MMEB 3VCLA 1X5LA 4JY6B 2JELH 4APQC 4JRXE 1BFVL 1BVLA 2HFGH 1RZ8A 1RSFA 2MHAA 1IKNA 4U1MB 4XZUA 1IEBA 2ZG1A 4R2GD 5I74B 1ES0B 3OAZH 5F3BA 3L7FA 2YPLE 3QEUA 4M3JA 2XY1A 2FZ3A 4LKXA 1W72B 1MHEB 4F58L 2FD6H 4HKBA 4WUUB 4QCIB 5GS1C 4XRCA 4P3DB 3SKJL 1MFEL 2EE6A 2WBJB 3ARBD 5HYSG 1CFVH 4JVPA 5TGBB 4Q9RL 2NXYC 4QRPB 3SGKC 5SWQB 5IUSA 2QSVA 5K59E 1WEJH 4XWOD 3BGMA 2ZSWB 3CH1A 2RHEA 4CVXA 2AK4B 1P84K 3PNWB 3B43A 3LEVH 2HT3D 4MQ7B 4WJ5B 1ZHBA 1P4LA 4J3OC 3S37H 3ET9F 4OLXL 1TVBB 5EBWA 4KZEH 1YMMB 4I0PC 4GG6A 1XGRB 1ZLUH 4MD5A 2R69L 5DJ2B 5CJXA 5D8JL 2W9DL 1KIQA 4RDQG 4WO4B 4RGNC 4DUVA 1JGDB 4JFDE 5KZCB 4HF5L 1T3FB 4K7FA 2O5XH 3VMPA 1WZMA 4NN5B 2FIKB 2IAMB 4PP2B 4R96B 5BRZD 3WUZA 1CVRA 4PRPA 1UVQA 2WINA 1N4XH 4MSWB 4JKPL 4YHIB 1BZ7A 1MFDL 1I7UB 2OTPA 4F9PA 3ILQD 3QDHA 1L6ZA 1JHTB 4RMSA 5I18H 4LPXA 1GHFH 2AV1B 5DJ0B 3WSQH 4EI5A 4D0DB 1NLDH 2L7JA 1K5NA 3H3KA 3LB6C 4G6JH 4P2QD 4WI5A 2FH6A 2JCCF 4JJ5A 4Z7WA 1E6OH 4GMSH 2PYEE 3W5NA 4Z76A 4M8QB 5IR1A 3KLHD 4RQQB 1L0XA 1YYLH 4MNQE 4JDZB 5EO0B 5J0BA 3LAFA 2ARJB 4M61A 3PWPA 4PIRF 4TSAL 5FKPA 1SMAA 5GRVL 4OCMC 4P2QB 2P1YA 5JW5B 4I2XA 3H8NA 1LO0L 5CWSA 4TYUA 3VFPB 3HRZA 5D7LB 1MY5A 5IMMA 1CDCA 3S3JA 3DXAB 5CP3H 5IEKA 2AJYH 3PGCA 3NAAL 2XXCB 4CDGC 1OF2B 5E56A 3DX6B 1S9YA 2EH7H 1F45A 1QSED 2DOCA 5IV2B 4WTZG 5DD0H 1EJOH 3QDJD 4M62L 3KYMA 2F53D 4M4RA 5IB2B 5KG9B 4LCWA 4GW1A 3RPIB 3QXAB 4WI7A 4GKNA 4JRYB 3F8UB 1ZKAA 4U3XA 4Y5XA 4JQIH 2VXSL 4S1QH 2XTJB 1RUQH 2P8PA 2GY7B 3REWA 5DEGB 3SDAC 4V1DD 4JKLA 5IFAH 3JV4B 4H88L 2R56H 4N0UB 4XPTH 5KANG 5DD5H 1VADA 1NCDH 4HUXA 1IM3A 3UX9B 3AVEA 1SJEA 5K9JL 2HJLB 4ZO9A 5I2IB 1P6AB 1F4HA 2FATH 3QQ3A 3QUXA 4P23B 5EOTA 4PB9L 3DGGA 1I3GL 4NO2B 1JYWA 3JWOH 4DUXA 1FNSL 3QPQD 5DK3A 5CGTA 2A9ML 3EYQC 4N0YH 4OLYH 3QNXB 1LWRA 3OAUL 3GMPB 1FL5A 1HINH 4UIMB 3ZZ1A 4HSQA 4PJ5D 5IW3A 3CC5A 1RIHH 5B8CB 3JXAA 1P4IL 1T7WA 3IAPA 3MLWH 4MNGE 4WI8A 3UC0H 4NKOB 2UWEF 4O5LL 1S5HA 3FQNB 4P2OA 4U3HA 2PW1A 4WGWB 4ZTPH 3STZB 3ZTJG 4LIQE 4XI5C 5GGVL 3QA3A 3U0PB 1CFQA 3L3OB 1A7OL 3F12A 3KPSB 1MWAL 4WTWA 4Y16C 4EN3D 2VKWA 3BESR 4KAQH 2AQ2A 4C59B 4YK4C 5D5MF 4L4VD 1KBGL 3DX9A 1WAAA 4JG0L 1VKXB 5IWLC 5FK9A 3CVHH 4IJ3C 4N68A 1LK2A 3C2AH 4OFVA 2FJGB 3VFMA 3FMGL 1UACH 3Q3GB 4Y4KB 5E8EB 2NXZD 4P59L 1KIUA 5TDPA 2DLTA 3X14A 1ZT1B 4XNZC 5CKGA 3NTCL 3DX7A 4KI5E 1CICC 3C60D 1HHKB 4PJAA 5EU4A 2WSKA 1UJ3C 1EVUA 1DEEB 4HGWB 1F11A 3LY6A 1N64H 2X9YA 2ZJSH 4ZUTB 1JPTL 1AHWB 4OUUA 5JMRA 4OTXH 4R0LA 2JCCB 1ZA3B 1DFBL 1CGSH 1RU9L 2YKLL 1JNLL 3OG4B 3ULUC 3DRQB 5CUSH 4EEEA 1OWRM 1P2CA 1LP9F 2YMXL 3UPAA 1WZLA 4KXZH 3G5YA 3WXWL 3UZVB 4MD4A 4J12A 5D1QD 4LARH 2QSCL 4Q7DA 1UENA 1YUHA 3K81A 4CJ0A 4YH6A 3RQ3A 5BQ7A 1DQDL 1UWGL 4WEBL 1AGDA 5J06A 3FT4B 4L8SA 4CMMA 2FR4B 2V17H 4L4TE 2FLBT 5I0DA 1F4XH 3QFJA 3GSWA 2ORBH 1RJYA 2Z8SA 25C8L 1JF1B 2G75A 3FCTA 3E3QE 4ZUWB 5I17A 2MCPL 3BDYH 1FAIH 3C5JA 2IBGA 1DBMH 1IFHH 1A1OA 4FS0A 2HKFH 4UIKL 4LPCA 4YHYC 1RUKH 3CLFH 3ZHDA 5HPMB 1A6TA 3FQRA 3S4SB 3DMMC 4RMUA 2EDFA 1BIIB 1S78C 1E27B 4WI4A 5E8PA 4R8WL 2EIBA 2R2BA 3DV6B 1JK8A 2DLEA 2V2WB 1SYVA 3IDYB 3MJ9A 5BVJB 1OB1A 2XNAB 1TITA 4NGHH 2V5MA 2YN3A 5DMJB 5F70A 4JN1H 3WO3B 5EC1A 1MRFL 4LLQB 3OJDB 4M48H 4X6CE 3GIZH 1JPSL 1I9RL 2E7BA 4HMCA 1WZKA 4KY1H 4ZAKA 4L9LC 4Y5VA 1JN6B 2B1AL 3BKCL 3C5ZB 4RMWA 1CLOH 5ACZB 4UT7H 5KSUA 4HKXB 2OZ4A 1FIGH 2XA8H 2PYFB 5EU6D 1JTOA 1W72L 1QLEH 2ADFL 3NCEB 5GGRY 3KPPA 3WS3A 1Q94A 3R8BB 1K4DA 2UWEB 1AQKL 5KOMC 5AG9A 3SCMC 1KTDB 4I48B 2YSSA 1K4CA 3P77B 4J3TA 4MA8H 2XWJA 3QO0A 1KXVC 3KJ6L 3ZKMD 2O26U 3QUZB 1U8LB 3MTRA 2WWKT 3U6RB 5TF0A 3RZWA 3FO2A 4XAKE 2A0LD 3CXDH 3RVVC 4WTXA 4TOYL 1FO0B 5D5MB 4XTRD 3BRDA 2J4WL 5HHOE 2VXTL 2DLHA 4HUWA 4M1DH 1HXYA 3L3HA 1OD7A 4RGOL 3P0YL 4ZUSA 3V5KA 5I1HH 3NFSH 4YBHA 1J0IA 1XGQB 1JMXA 3TBYA 4YAQB 5CIPB 5JHDA 4JZJB 1KNOA 3O41A 4NQCD 5L2KD 1G7LA 1IKFL 3OR7A 1DANT 1CFNA 4XNQA 4DVBA 3VXSE 2VXQL 5AD0A 4MA1C 3QEQA 1JNNL 4U1SB 4YR6A 4ODXA 3HPLA 3RGVC 2YXFA 3BWAB 4MDIA 1G7HB 1NKOA 1NFKA 5F1IA 4F9LA 2ZUWA 2EDJA 2DQCH 1LP9B 3B5GA 1M1SA 3MV7E 4WWKA 3T0EE 5FGBC 4PFEA 3QISA 1Z2KA 3MCKB 5CEZE 4LDEB 4NPYB 4LKCB 3FO1B 3CDCA 2R9HD 5EZJB 1Q9WA 5FDWB 4GRLD 1MCNA 4XNUL 1S5IL 2RIKA 4F7EA 3KXFB 5IBUB 3PL6B 5CZXC 5EU3B 3BP7A 5ID0A 5I1AB 1UXWA 3BKJH 1QLFA 1I9IL 1OAQL 3G5XA 1LDPH 1REIA 5F7HA 3E6FA 1BD2E 3DBXB 4KVNH 5GGRA 3UJJL 4MCZB 4HT1L 1MF2H 2UYLA 5GGVY 5AYQA 1FFNB 4X5XA 5L9DL 1TJIH 1I9EA 2X4OB 4G6AD 5E94B 4FQPA 1K9TA 4FRWA 4X0KA 1DUZA 1KJ2B 5D2NE 3VDCA 5EUKA 1FJ1A 4RIRA 1RD6A 2HLFC 5FYKE 4P4KC 5I6XC 1WCBB 5A16B 3OL2A 1YA5A 5FUZH 4HS3B 3HZVB 4QYOB 3UTTB 1A7BA 4O2FA 2IMMA 5F6IB 4S0TD 3JWNC 5JW4M 4P46B 2E8YA 2QBWA 3V9FA 4X6EA 1WWBX 1P1ZA 3QQNA 1ACYH 4AL8L 2HJKA 4QHMA 3T4YB 4Y2DA 2OI9C 4NZUH 3QH3B 4MZ3A 5KVMC 4U2ZA 1JZ8A 3OKDA 2D03H 1HCVA 4PRPD 3HI6L 3VG9B 4XT1C 1PEZA 4XNMA 2YD4A 4DGVL 5JA9A 3UO1H 1F4WL 4QOKA 5AWNL 4DN4H 2XRAH 5J3HD 1BOGB 3G08A 5DEZA 4G7VH 4EI5D 3PIQA 4UU9B 3S8WA 4Z0BL 2DQDH 3BE1H 3UYOD 5CJ5A 4LEOA 3C8HA 3OKMA 3F62A 1HQRA 5KSBA 3U36A 3NCMA 5KVDL 3STBA 3MRPA 4NQDD 4QHUB 3IF1B 3VXPA 3PWPD 4F57H 1MJUL 2FBJH 5D1XB 1KPRA 1UZ6E 1KEML 2QQQA 3CK0H 4NT6B 3HFML 4W6YB 3PDOA 4C83B 3U1SL 2Y4SA 1T5WB 4UB0H 4OQTL 4HD9A 5E1AA 3SGJA 4D94A 1Z9LA 2WQ8A 2BX5A 5J6HB 1GC1H 5J9PB 1J8HA 4Q58C 4WV1A 3KHQA 2HN7A 1BQSA 5E00B 4JRWA 1J1PH 5GRZA 5EO9A 1H15A 5C6TL 3BZEA 1MWAA 4NP4H 4Z95L 3MR9B 3G6JA 2UUDK 5AUMA 4LCWD 1XCQA 5TFSH 1FNFA 4R4FH 1JHLH 3BPNB 3LKOB 4ZTOL 5T3XE 3NCBB 3RNKA 1PSKH 1DLHB 2VC2L 1IQDA 2XKUA 3GJEA 1XF5B 5E5MA 3MNZB 3MCLL 1FGNL 1NH6A 2OJEA 2V7HA 3LMJH 5BS0B 2R2EA 2ITDA 3C8DA 4QXWA 2DQTL 2P8MA 2GK0B 2GTWA 5GRUH 2NMSA 3HE7A 4PRNA 2M2DA 4NWTH 3LQZB 3ZMRA 1U2CA 1Q1JL 3VFGL 3DECA 2E5EA 4QT5A 4FABH 4FQLL 4XCFH 5H8DA 1GC1C 3VRIA 1SBSL 4Q9BA 2CDGB 4HUUA 3M17A 2EDTA 4PV8A 5C0EA 4LCUB 1YJDL 1GAFL 3QIWA 3INUH 4PPTA 4LSQH 1AFVH 5E6ZA 3NABL 1PLGH 1WJ3A 3MV9A 4GRWE 4DZ8A 4ONGL 4WY7L 1MCJA 2DIAA 1UG9A 2XZAH 4K3JL 3LOWA 1S9XA 2AV7B 2OP4L 4F7MA 5BOZG 1AY1L 2OTWA 4Z78B 5C0BE 4ZO8A 4ZUUB 5IW1B 3LKQA 3OAZK 2VQTA 4FP8L 2ATKB 2DF3A 2CDFA 4P2OD 3O3DB 1G9MH 3BN9C 5I9QC 1S7VB 2HFEB 2NY4D 3IDNB 1B4RA 1A22B 1A14H 4KMTL 2VH5H 3I6KA 5C0IB 5CJBA 3M07A 4U0QB 5ESAA 3WIHH 3EYFB 1NSNL 4Q6IC 4G6FD 4GW5B 1XF3A 7FABL 5DDHB 2AK1H 5DMIH 3S88L 1VGEL 3IDGA 2AJSH 2BJMH 1HIMH 4PB0H 1ZVYA 1JRHI 4WW1A 5DT1H 4G6FB 1CBVH 3H7BA 1MHPL 5KTEL 5HGHB 4Y8DC 3SDXE 4J4PA 1N26A 2EE2A 2EO1A 4LF3A 2Y6SC 3U4BH 2Q8BL 3TWCH 5DVLA 2P45B 4RA3A 4ONHB 3H3PH 3PP4H 1ZLUK 3C6LC 1II4E 3O4LE 4NCC1 5E2TH 3MMEA 4B41A 1H3WM 5I30L 4JY6A 4E42B 1SJHB 1G9MC 3GBNL 3L3KB 4U1MA 5D7SL 1BAFH 3PDDA 1KC5H 5TQ2H 3TH2T 3CIQA 4OLZH 1ES0A 3O3BA 1QYGL 1UC6A 3NA9H 1PZ5B 1XH3B 5CSBA 1RHHB 4LQ1A 1QBBA 4XVJL 1MCSA 1W72A 1MHEA 2O61B 3GSVA 4H0HB 1K6QH 1VFAA 3HZMB 1AR2A 3LS4L 2ZCKH 4QCIA 4P3DA 4NBZB 1KOAA 1NGXB 2JB5H 3T2PA 2VXVH 2OM5A 3SE4A 5TGBA 4QRPA 3QFJD 5SWQA 3EOYG 5TH2B 1I1RA 1FO0L 1KTLB 2ZSWA 3WFHB 4GXVH 3UDWC 2AK4A 4Z5RB 2ICWJ 5DJAB 4HPYH 1EHNA 2FX7L 4MQ7A 2P49B 4WJ5A 3VGAB 3AMKA 1FNGB 1G6VK 1TVBA 4OZ4B 1YMMA 5KAQF 1AC6A 4UUJB 2NQCA 4K3EL 3O4OB 4LSSL 5DJ2A 5C0AE 2CK0H 1MRDH 1NDGB 5ALBH 4TPRL 4WO4A 1K8IB 4XVUD 1X5YA 5JR1L 4X7SL 3QFDA 3MFGB 4L3ED 2LU7A 1JFQL 4HS6B 3DVFA 2FIKA 2IAMA 4PP2A 4R96A 1E6JH 4MSWA 4JQXA 2ZUYA 4NJ9L 1PG7W 1I7UA 4L8CB 5KS9F 2DS4A 3QI9A 1HHGA 1TPXC 1S7QB 1RZFL 3BEWB 3EKCA 3GJFA 4G43B 4D0DA 5A3IC 3S5LB 2Y06H 1EEQA 3HE6B 3OXSB 1RJLA 1NCCH 4JY4A 4M8QA 4TTDD 5ICYB 1MCEA 3DETC 4JM2F 1CE6B 1FV1B 4RQQA 1VA9A 5B22A 5EO0A 3KG5A 5DI8A 1IJ9A 2CSPA 3RWJB 3VFPA 4Y19B 3W2DL 3ZTNH 3BSZH 5D7LA 4JREB 1KJ2L 5JQ6L 5FOBB 4PBWD 5CJQH 3A6BL 4KC3B 1XGUB 3GNMH 5GGQL 3CMOL 2D4FA 3ARGD 3KR3H 4ZS7H 2IFFL 3L6FB 1OY3B 2AQ1A 4I0KA 3ZYIA 1H3PH 2BSRB 5LVEA 3IFOB 5F72S 5LWYH 1HYSD 2EICA 2RFXB 1A1MB 2VDPH 4YGVB 5LQBH 1I1YB 5KG9A 2VISB 1EX0A 1FZOB 5F9DC 3R4DA 5I8OH 3RPIA 1RUPH 3ARDA 5B38B 2XTLA 1DVFB 2I5YH 1QQDB 4DQOL 4NSKA 5MP6L 2MWCA 5DEGA 1FDLH 3ZDXF 1T80A 4N0UA 4PJDA 4P5KA 1EPFA 4A6YH 4NZTL 2V9QA 4Z7UF 3K8MA 2HA1A 1EHLL 3CD4A 3V5DB 4OGYH 1U0QA 2AEQL 4J8RB 2AGJH 3WD5L 1INEL 1FPTH 4KQ4L 4NO2A 5BRZE 1JF6A 1GZQB 1U8OB 1RULL 1QTYT 3P0GB 5I8KL 1VFMA 4KI5C 4UIMA 4O58H 4KV5E 3CSYB 5FV1L 4R90H 4UILL 5JHLL 4S1SL 5E08L 3H3BC 3KWWA 3PWJB 4S1RL 3TLRA 3IKCB 3NH7L 5E2VL 5EWIH 1OT2A 2UZIL 2XFXB 5JOPE 12E8H 2YC1B 4OQTA 4LVNC 3WXVH 5JXAL 3CX5J 1CDBA 4OLVL 4BSJA 4YDVA 1OTSD 4PJ8B 4DKFL 3VGGA 4M7KH 3UYPA 3C87A 3KPRB 3UBXI 4RWHA 3ZDZE 2EH8H 2HJFB 4M43H 5CBAB 2Z4QB 5HI3C 2DTSA 2NY1C 4BH7A 1VKXA 2R0ZH 3T2OA 4N8CL 5KVEH 1OAZL 1SEQH 1QSEE 3W9EB 1A9EB 2X89D 3O6FD 3QDJE 4X80H 5E8EA 4U1NA 1UM4L 2F53E 4PJGE 3ARRA 4MB4A 1NJ9A 4BZ1L 4G6KL 3E3QC 3E2HC 1HHKA 3FONA 3FT2B 2VLJD 4OD1L 2X05A 1DEEA 5KS9B 5T1KD 4HGWA 1KELL 1T6WA 2FBOJ 5HHPB 2ATPB 4ZUTA 1R5VB 4V1DE 3RWFB 3T1FB 2XQYK 4PJFF 5EBGA 3RNQB 2ZNWA 1Q38A 3PP3H 2JCCA 4AIXA 3RWIB 2ARWA 1ZT7B 3DRQA 4JM2B 4QKXB 2FGZA 4EBQL 1T20A 5D7JA 1MAMH 3HAEB 1NKRA 3REVB 4XPBL 5JW4N 5MI0B 3MQIA 4LSTL 3S34H 1V3KA 5IBTL 4LBEB 4QTHB 5FF6B 3UEZA 3W0WD 1IM9D 4QRUB 3GSXA 2EDHA 4EQ3A 4JZNB 4LOUC 2D7TH 5FCUL 4PJ5E 1SVCP 2DQFB 4UNUA 3D5OF 2QHRH 1JF1A 1D5IH 2N7BA 2IADA 4ZUWA 1IM9B 4MJ2A 4U49A 4OBSA 1F13A 3TC9A 4HUNB 3FKUS 1CE1H 1YPZE 3WO4B 4NO5B 1QLRB 1F58L 3LKRB 2Q8AL 1RK1A 5HPMA 4N0FB 3S4SA 1QRNA 1UH3A 2WIIA 3OWEA 1E27A 3SY0B 4JANA 3P4MB 4GW4B 1NGPL 3WFZA 3LRSB 4Z7UB 5IROC 4L4VE 3O11B 3HB3C 3CXHJ 5BVJA 1SJXA 3HZKA 2XNAA 5CEZH 2HVKB 3IS1X 3QXWA 2IALB 3O9WA 3MBXL 4HC1L 3V8CA 2P44B 4NZJA 5ALCL 2EKSA 3ZL4L 3QXTA 5CMAB 3FN0L 5BV7C 2EEBA 2MMXA 1BBDL 3SKJH 5ACZA 1CU4L 4I8DA 3ZT7A 3K4AA 4R4NC 4K9EL 4X4XA 4Q9RH 2FO1A 3GRWA 3JVGC 3I3EA 1EHXA 5HD8C 1GYAA 1MCLA 3JTTA 1J1XL 1FYTD 5JDJA 5JIHA 4K8RC 1NC2A 4R97C 2ZUXA 1IGTA 3P77A 5FM8A 3E1F1 1CR9L 1HQ4B 4ONFH 3RAJL 4U1KA 3UCRA 3T0EC 4U0RC 4ZXBC 2YPKB 3QUZA 1BJMA 3CFCL 4NN6B 2DQJL 1FYTB 3L95B 1F2QA 3T65B 3OXRB 2DQGL 2VIRA 2R69H 4AH2B 1EA9C 4P4RB 2X09A 1KCSL 5D8JH 5I75C 2W9DH 1FNHA 3EYVB 3CFBB 4Z7QF 4KRPD 4CVWA 3U46B 2OR7A 5FB8B 4HF5H 2J88H 2R8SL 1CD0A 1J18A 1D3CA 3CGTA 4M8VA 4MX7A 3NZHL 2WWMD 5DRWB 4M5ZL 4YDLC 4HKJB 2GYSA 1AO7E 4KRPB 1JTPA 4M02A 4PGEB 4NKMA 3GBLA 5D2NC 3IFLL 2CIIA 3VDAA 1UJTA 2VLKD 3QCUH 4MJID 4PJFB 3NCFB 3N1MC 4RAUA 4FFWC 3N9GL 1G7HA 1X4ZA 1UQSB 3NGBC 1NBVL 1PQZB 4UBDC 2P5EA 1ORQB 3DHJA 2NY3C 5ANME 2V5RA 3VJ6B 5A43C 2EEDA 1KCLA 1MNUL 5GZND 3FO1A 3U9PH 5EZJA 5C08D 5FDWA 1MFAH 1JBJA 4NZRL 5I0ZA 3L3DB 5FA3B 3KXFA 5D96C 3NAAH 3PL6A 1KG0B 4MHHI 4JHWL 5I1AA 2PF6A 3BOVA 5ERWB 2X7LB 5C09A 2O5ZH 5ISZA 5EU6E 1R3LA 4XCNA 1SM3L 3DBXA 2YZ1A 5LBSL 4J1UB 4MCZA 4KKLD 1FFNA 3E0GA 3SGDH 4YDJB 4WFFD 3VXRB 5F7YC 2OMNA 5HVHB 1CGTA 5T3XH 1GH7A 1KJ2A 4H25A 4LVEA 4DOHE 5JW3H 5ESQB 4N1EA 4IS6B 4KRLB 1A7PH 1IT9L 5HHVH 2H1PL 3AS2A 2YBRB 1WCBA 1OSZB 2D9CA 1NAKL 2R23B 3CFJB 4HS3A 3HZVA 2B39A 2ILLA 3OKNB 5E6YA 2WBWB 3EDJA 2FWOA 2MKLC 3QYCA 2Y23A 3TO4A 3U9UA 5MEND 1KCUH 2AP2A 2NY0D 3FT3A 3QIBB 3IAGC 1X6LA 2UZYB 2EE3A 1ZLSH 3EZJB 4K94L 1FNSH 3T4YA 4M5YH 2JJUA 4X5LA 4NQCE 3OAUH 5L2KE 4U6VL 2YN5A 3V52H 1OTUD 1S9KC 3BPCB 3K1KC 3QI9D 1WZ1L 3MRQA 5FYKU 4LHUB 2PKDA 1BOGA 1P4IH 1H3VA 4PRBA 3V6OA 3CMGA 4KTEH 3F7PC 1A0QL 5KSAD 2C7UB 4P9ML 1QFUH 1IGFH 1OAXL 2D7OA 1MLCB 6CGTA 3MRBB 2F5BH 4NRYA 5C0ND 4DEPC 2LVEA 1UXSA 3TVMC 4QHUA 3IF1A 2Y7QA 4NUJB 2QADB 2YS4A 3EJZD 2Z31A 1LEGB 5D1XA 1RJZA 3PQYB 4BZ2H 1W2KT 4OIBA 4NT6A 1FHGA 4D3CH 3VWKC 2QQLL 2X1XR 2RR3A 3KAAA 1T5WA 2BNRA 1PKQE 1LO5B 1ITBB 1QACA 2HMID 4JG0H 5GHWH 5J6HA 5J9PA 1NPUA 4JFFB 1F00I 3FMGH 1UM6H 3N85L 5E00A 3ULVE 5DR5H 3RZCA 5IF0A 1X5AA 4JFXB 2YZ8A 2FL5B 3NTCH 4XMKL 4HS8L 4QRQB 4P5TB 1PG7X 1EXUB 1JWMB 1UADC 4AEHH 3ARDD 1JPTH 1CGWA 1MHHA 5FUCE 3K46A 4YWGL 4P49A 1I7TA 1KLFA 1XF1A 1DFBH 5M95B 1RU9H 2YKLH 3MNZA 4GG6E 1JNLH 4M1GL 1LHZA 1A6AA 2YMXH 2N56A 4GAYB 2VYRE 3V6ZB 2O5YL 5HDBF 1CTNA 2W38A 3K8KA 4H8WC 2ICEB 3LQZA 5F9JA 4CKVX 1ROWA 2FJHA 3QEGH 3DO7B 4IIQC 2X10A 4KK8C 3RWDB 1DQDH 1UWGH 4WEBH 3BN3B 4PRPE 1BQLH 3NPSB 4LCUA 1GIGL 1XCTB 1MAKA 3OV6A 1BFSA 5EB9A 4GAGH 4WHYH 4LU5L 5AAMA 1FZMB 2R1XA 4XWGL 3BO8A 4ZSOA 1E28B 3LKSB 2PXYB 2PTTB 2MCPH 2WZPD 1C7TA 2A77H 3QHFL 5T3ZL 4Z78A 3FB7B 4ZUUA 1KB9J 3O3DA 4YXHL 2J6EA 3PWPE 4UQ2B 1EO8L 1N3NB 3MROB 2HFEA 3IDNA 4YDIL 1MI5B 4WNQB 1NCUA 5DS8B 5JORB 3QUYB 3EYFA 3BH8A 4PRHB 4GW5A 4HZAA 5DDHA 5T33L 1MREH 1MRFH 2GSIB 2EYTB 1JPSH 5HY9B 1I9RH 4K7PX 1BQHA 1DSFL 1HOCB 1KIRA 5E8NB 4LQFL 4XMPL 1CXFA 4PUBL 1B9ZA 5HGHA 2B1AH 1ZVSB 4LCWE 4AEEA 4H26A 5F21B 1HXMB 1XIWB 1HZHL 4GKOA 2V5YA 4ONHA 2ZKHH 2X4SA 3RA7L 4NZDA 2HLAB 2Q86A 1RZIB 4GOSA 4HLZG 1SJHA 1AQKH 4PGDB 4YQXL 1XR9A 3L3KA 3HG1B 1N0LA 3PWVB 3UJIH 5C71A 1RV6X 1UA6L 3KJ6H 4DUWA 1PZ5A 1ZVHA 5I15L 5D7JD 4O4YH 2WM0A 1KYOK 4LVOC 5H94B 4ERSL 4OZIF 4TOYH 2WWKO 4O2EA 5HDQH 2B2XL 1N5AB 3HZMA 3EJJX 4J3UA 4Y7MA 2Y07L 2VXTH 3EBAA 3NIDF 1NGXA 4EUPH 1BOYA 4U1LA 4ZPVB 5F88A 2CKBA 2DIBA 2RBLA 4Y4FB 1LE5A 2XIDA 5TDOB 3V6BR 2R2CA 3WFHA 1T04B 3V0VB 5TPWL 5EIIB 1IKFH 4LEXH 1AQDA 2DLIA 4R2GC 3RU8L 2VXQH 1H0DA 4LMQI 4OZ4A 3QZWB 4O51B 4UUJA 2QSQA 3ARWA 5C0RL 2WANA 1I85C 3DRTA 4YZFF 1MCCA 1NDGA 3G6DL 2FX8L 4XP4L 5I16B 1NDMB 1HKLL 1K8IA 5E8DH 1QD0A 2VDQH 3B2VH 3ARBC 3B6SB 4FQ2L 4OLEA 4LCCC 3O9WD 4ZQKB 3MRCB 2DWDB 4HS6A 4UAOC 4JFED 5BVPL 2H41A 4XWOC 1FFPB 4X4MA 4RFNB 5E1HB 4XNUH 2NY7L 4ORGA 1A6PA 1ZTXL 2F5AH 1CK0H 3SGEI 1MY7A 2VAAB 2VDNH 1OAQH 5E5UB 2HT3C 3BEWA 2DIJA 3WNKA 4G43A 4JFEB 2J8UA 4UZGA 3UJJH 5KVGL 5GJTL 4APQB 5L9DH 4BK5A 1I7ZB 3EOAB 2IPKB 3MOQA 2KQMA 5B3NA 5KBNC 4U3CA 1QFPA 1CN4A 1OAUL 4NN5C 5DJ8B 3Q6GL 1NC2D 4PJBF 4UDTB 1K2DB 5D9SA 4BQ9A 1NUFA 1BLNA 4WU7B 4ZOCA 5GS1B 3SBWA 2CIKB 5HHXH 1H8NA 1OGTA 1X7QB 3F7RA 3TA3A 4HH8A 4L3AA 4L5FL 2APWA 2NXYB 4DVRH 3ILQC 5EBLA 4MQTB 3QFJE 5E99H 3H9SD 4NFCA 2BSRA 2AXJA 3IFOA 3RUGF 4AL8H 4I0PD 1A1MA 5DQJB 1I1YA 2FYYB 2IH1A 1FZOA 2X4RB 5B38A 3HI6H 2GEEA 5EOQL 1M05B 4OCWL 2VQ1B 4QF1B 3KLHC 2AJXH 4LLYA 2Q7YB 4I0PB 5J7CC 4KJYB 3TJHD 4PY8I 3VXMB 5BW7A 1LE9A 1NFDF 1E4XH 4PRID 4Z0BH 3FQTB 1JHKL 3P4NB 5GSVB 3B9EA 4RGNB 4TSBL 3V5DA 4MWFB 3RHWF 1LO3L 5ADPL 1N59B 3SE3C 4J8RA 3GI8L 5FOJA 4X6BB 3I9GL 4JO1L 1N0XH 4F7PA 3QJFA 4BSVB 3Q5TA 4PLKD 1MJUH 4L3EE 4ELMF 1NANI 1WCQA 1KEMH 4U33A 3H2WA 4OZIB 1GZQA 1U8OA 5K9QI 1NMCC 2C4FU 4I77L 5DRZA 4B53A 1TZHB 4PJ9A 2JB6B 3QWOB 5IMKB 4BSWA 2JJWA 1IQWL 3MFFB 4X4YA 1WC7B 1KB5A 3B9KA 1BWWA 3PP3K 2VUYA 3RDTD 5ISZD 1CGYA 3V4PL 3ULUF 1FVEB 4G7YL 4Q0XH 5C6TH 1J0HA 1IEHA 2XFXA 4YHLH 1A5FL 3IJSB 2YC1A 4KXZI 1KGCD 3DLQR 1AE6H 1X5FA 4ZTOH 1LNUB 1Q0YH 3KPMB 4PJ8A 2X44D 5IT2L 2VC2H 3ZDYE 4AEIL 4FQXD 4LLMB 3KPRA 3QPQC 1S8DB 2PR4L 5B8CC 2HJFA 2Z4QA 1YEFL 1RUAL 2DQTH 4J3SA 5EZOL 4XP9L 1P7QB 1DN0A 5ACMA 3W9EA 1J1OH 1F90H 4XXCC 1Q1JH 1CCZA 3VFGH 4NM8L 1WIUA 4OF0A 3UTQB 4N9GB 5ICXB 1WVZA 4HLJA 2V7NB 5DJZA 1TIUA 5JHDE 3FT2A 2D4DA 1T83A 4KMQA 3SDAB 1P7KA 1YJDH 5KS9A 4OV6F 1JWUA 1P5VA 4NNXB 2VQUA 2DKUA 1NCBH 3RWFA 3T1FA 1CG9B 5DFVD 5IG7B 1G7MB 3QUKB 4ONGH 3LQAL 5C0CB 3IXTA 4EN3C 1IC4L 2R0KL 3FQWB 1ZT7A 4H1LH 4JM2A 3QCTL 2VR9A 4FP8H 4PJBB 4ETQA 3HAEA 1CF8L 4LSRL 4LNVA 4X7CC 4MJ6B 4POZD 5SX5H 1U91A 2MPAL 2Z31D 4KMTH 4LBEA 4QTHA 3ZSSA 2CO7B 2NXZC 4YC2C 3L3GB 5B3JE 4CJ1A 4G80A 3C60C 4JZNA 4KKCD 4P3CL 4JHBA 5CEXB 2BNRD 3D39B 3FRUB 2VZOA 1VGEH 2DQFA 4C56B 3L5WB 2YRLA 1MHPH 1OQOA 3FFCD 5ITBL 4TSCL 3RZCD 1O7SA 1BFTA 3MLTB 1QLRA 1FZKB 4AENB 1YEEL 2Q8BH 1H5BC 1TZIB 5C0DB 5I1IL 2I07B 4N0FA 2AEIT 2FX9H 4Y16B 5D1QC 1NFDB 4YK4B 1GGCL 5GISL 3DYOA 3OKLA 5I30H 1A7QH 4GW4A 4XCEB 3LRSA 3T2QA 3D85D 2JF1A 4IJ3B 2NTSP 5FXCH 2HVKA 1J8KA 2BVOB 2ZG2A 3L7EB 3MJ7B 2IALA 1KCKA 4ELMB 4XNZB 2BHZA 4XVJH 2XACC 4GBXD 1CICB 3MLRL 3MACH 2A73B 1UJ3B 3OTTA 3AS1A 4HH9A 5CMAA 3K74B 1C08B 4PJXF 2VLJE 3LS4H 3IU3A 6FABL 1MFBH 4WW2C 3B83A 3GDBA 2IQ9L 2L4OA 4FFZL 2E9IA 2R29L 4XVSL 2B1HL 4WIQA 5HDOA 2XI9A 1FO0H 5F7WC 5GGTA 1UWEL 5EO1B 3AFLA 3GMMB 2FX7H 4C4KO 4G8IB 32C2A 3P0VL 5KSBE 1HQ4A 4Q6YA 3S7GA 4D9LL 4HWZB 2YPKA 3U2SB 1MUJB 4HXAL 4RBPH 3CVHB 3WN5C 2LTQC 3L95A 3T65A 5CIPH 3OXRA 3MGAA 1KJ3H 4AH2A 5DC4B 3W0WE 4P4RA 4MAUH 3EYVA 4AQOA 4TPRH 4G42B 2M1KA 3K4ZA 3U46A 3OGCB 7CGTA 3GB7B 4CN6A 5FB8A 5JR1H 4X7SH 4RSVA 5JXEA 3KYOB 4WRLA 1C16A 3VFVA 4XX1G 1JFQH 3T3MF 5DRWA 4HKJA 4YHYB 3ES6A 4NQED 3TF7C 5HGDB 4NJ9H 4ZFOB 3CLEH 5HI4C 4PGEA 4MNHB 1ADQH 3DMMB 2V2XA 3BD4A 2Z8RA 4QNPE 5DK2B 4MA3B 5ADOH 3ZKMC 4F80A 4KDWA 3U7YL 3NPZB 3B5HA 1ZEAL 4BKLA 4NQXA 1YN6A 2A0LC 2DWEA 4J3VA 4OZFB 4UT6H 4F7CB 4RFEB 4TVPL 4XTRC 4ZUVB 3WUWB 4JZJC 1AIFA 1ORQA 1ZT4B 3MBED 3VJ6A 2PUQT 1Z3GL 4PG2A 2HAZA 4Q97A 3C6SB 3RVUD 1AP2A 4L9LB 4F7TB 5E2WL 4K55A 5JQ6H 4YFDB 2X4PB 3A6BH 4Z77B 5GGQH 4XB7A 4GG8B 5FYLD 1J88A 3CMOH 3E8UH 1KG0A 3EYOA 3P30H 3QPXL 4YHPB 4XP6L 5I8CB 3GUTB 1JI1A 4YWGH 2VLRB 3OB0H 1U8QB 5DVMA 1NMBL 3SCMB 3RVVD 2Z92A 4HJJL 2ADIB 3GMLA 4HUMB 4GT7A 1VESA 1KJMA 3HMXL 1DL7H 2ESVB 2GUOB 5FUOL 1V3LA 4DQOH 2PO6D 43CAB 2VDLH 4U1GC 1IKNC 5T1MA 4PJHF 1ZWIB 1G0YR 2YBRA 4J2XA 5KANI 1I1AD 4MGXA 2CDEB 1DQQB 3CFJA 3D48R 3NCCB 2R9HC 1TCMA 1HHHB 4GRLC 2JELL 1E4KC 4YE4L 5ILTH 1VHPA 2AEQH 4NO0D 3WD5H 1INEH 3KGRA 4OQ1A 5E70A 5IHUH 1FCGA 1NCWH 3QIBA 4X6FB 3BEVB 3ZKND 3ULVC 2BK8A 1RULH 3LN5B 4PJXB 1U93B 3U7AA 5I1CL 5I8KH 4DFIA 4G6AC 1V7MH 3O3EB 2J8OA 4MA1B 4UILH 4S1SH 4MJIE 2VLKE 5E08H 3BPCA 1CFVL 1X44A 4LHUA 4S1RH 4Z9KB 2JE8A 5FUCC 3NH7H 1WEJL 5E2VH 5IESH 2K1MA 3T1WA 2C7UA 2DQEL 4LL9A 3EGSA 3S35L 1MLCA 5EUOA 3MRBA 4Z0XA 1C5CL 4X9FA 1ZLWH 4JDVA 4HCRL 2L0DA 5D1ZA 3LEVL 4OLVH 3BP5A 3S98A 4DKFH 1GRWA 1LEGA 3BRGC 2VR5A 1S7UB 5C08E 2DYPD 1PJ9A 4JQVC 3ZE2F 1LO5A 4OF3A 4KWUA 3TA3D 2AABL 1VSCA 2A9NL 4QHNB 4N8CH 2I26N 1OAZH 1UGNA 1NGZB 4JFFA 4F9PC 1CGVA 3V0WL 5GRYA 5J3HC 1EFXA 2YWZA 5DQ9B 4JFXA 2FL5A 3TH3T 4EI5C 2H3NB 5F1OB 4DJMA 4P5TA 3KPOB 4ISVA 4OD1H 1EXUA 2AK4E 1C1EL 1TCRB 4IRJD 1KELH 5IK3B 1JWMA 2XN9A 4P4KB 1LILA 3C08H 5GSRB 5I6XB 3UPRB 2PCPA 3ILPA 4N1CA 2GFBB 2F54D 1ORSB 3WSQL 4PR5A 1NLDL 4G6JL 1T7VA 1A4JA 5SWZD 1V7NL 1EAPA 3OKOB 3MV8D 4IRJB 1E6OL 4GMSL 3HRPA 3TESA 4D9RE 3EJYD 1YYLL 1OSPH 5MENE 3CSGA 2F54B 1PG7L 5CJ8A 2ICEA 3PV7A 2OI9B 4S2SA 1X5KA 4XPBH 5K59F 5DHVH 2NX5B 3DO7A 1U8MB 3RWDA 3LPFA 4QHLA 4NHCL 2AJYL 5GQBA 2PN5A 4KROD 5SV3A 2E6PA 1I8LC 1EBAA 1FZMA 4X7EC 1E28A 3LKSA 2PXYA 1CIDA 2PTTA 5DD0L 1EJOL 3D18B 4FN0A 4TQEH 3ARXA 1V8HA 2R1WB 3V7AE 4C54A 2Y5TB 3FB7A 4H20H 1EEZB 3BX7C 2WUCH 1IL1B 2Q8AH 4LGRB 4JQIL 1WFNA 5K9KB 3EOBB 1RUQL 4PJHB 1N3NA 3MROA 4XC3H 1LVEA 2R56L 2VN4A 4XPTL 5DD5L 2R2HA 1DANU 3CDGB 5IEHB 4ZOBA 5FM4A 3SHSA 5E5RB 4ELKA 1CD9B 5MEQB 2APTA 1LEKB 4HC1H 5DEFB 1YDPB 2EYTA 1ZHNB 4IDJL 2FATL 5AEAA 5HYJA 3R8QA 3VU2A 1HOCA 1IGYA 3RWHB 3ZYJA 5DMKB 2DMBA 3OGOE 2EDYA 1BZ9B 3ZT5A 1ZVSA 4N0YL 1CU4H 3H6JA 1HINL 2PETA 1DDHA 4K9EH 4WHYG 1HXMA 4Y1AD 4DK6A 4P2OC 1XIWA 1B0WA 3ROLB 4F3FB 3P73B 2OYPA 4G3YH 4FA8A 1OGAD 5A40E 1RIHL 4KTDH 5BZWB 4N0UE 4PJDE 2HLAA 1CD1B 2NY4C 3VD4A 2H32A 3UC0L 3C5SB 3P9MA 4K7PL 2XPGB 3HG1A 4CADA 3PWVA 1EIBA 1CR9H 5C2BH 3RAJH 1FC1A 1OGAB 5E7FA 3CFCH 2BVUA 3MREB 5I1LA 3ULUL 5H94A 1ZV5A 1BBJB 4YXLH 2H8PA 1KTRL 2V5SA 4OBRA 5EORH 1PVHA 4KAQL 3LRHA 5EOCJ 3GZKA 3BIKB 2QQNL 4D2NA 4JN2B 3T2NL 3DOSA 4QEGA 3CVHL 2R8SH 1FG2B 4CVZB 4CN4A 4Y4FA 4YIQB 4LLVB 1X9QA 1JCKA 1SEBB 4D8PB 5TDOA 1G7JB 4JRXB 3QJHA 4HIIA 1QZ1A 4R0LC 5EIIA 4LCYA 3BH9B 2YPLB 5E6ID 5I9QB 2ADJB 1N64L 2GHWB 2ZJSL 1TENA 4HGMA 3LV3A 4KGJA 3QZWA 4O51A 1DBKH 1MRCL 4Q6IB 5BXFB 4ZFOL 1CGSL 4XBGA 5ENWA 1NBVH 4QRTA 3B9DA 5CUSL 5EOCL 1NDMA 4DTGH 5DUBB 4L8SC 4ZQKA 3MO1B 2DWDA 4LARL 3R0NA 3GEWB 1HHIA 1U3YA 3V5HB 4FQJH 5IVOA 4N5ED 1CL7I 1U95B 1E4JA 1HYRC 4HJGB 1RZGB 4ZDHA 1SM3H 2ORBL 3LPGA 1JZ7A 4BYHA 4APQA 2EIDA 1MAJA 5INCB 3EOAA 4KRNA 2J5LC 4MXQD 4K3HA 1DBML 3OKEB 1IFHL 4JM4H 5DJ8A 3QUMH 4JFDB 1UYWH 1RUKL 3CLFL 1XGPA 4XVUC 2H1PH 4UDTA 3KNBB 4WU7A 5C0FB 5GS1A 1NAKH 1DBJL 4KI5F 4UV4L 4CVUA 3RTQD 1X7QA 4M9PA 4MLIA 4Z8FH 1KV3A 4YFEA 3V6FB 2FSEB 4NGHL 5HHNB 4XPFH 1F6FB 4JN1L 3FJTA 4MQSB 5KOVC 3TO2A 4RMRA 1CDUA 4K94H 5DQJA 2XT1B 2Z9TA 3RKDD 2FYYA 2PYEB 4W6WB 1R3IL 2NNAB 4S10A 4LSVH 5I1KL 4MNQB 4X7DC 2GJZA 5EBMB 4TTDC 3MLPA 2VQ1A 3RIFK 1CLOL 4UT7L 3QQ9D 4U05A 2Q7YA 1U2HA 1WZ1H 1FIGL 5DURB 3VXMA 1QRNE 4LGSB 3MGTB 1QLEL 4AY0A 1A0QH 3P4NA 1WGOA 5GSVA 1JRHH 5DRNA 4P9MH 1OAXH 5HHMD 3F6IA 1N59A 4YPGB 3ARGC 4BSVA 4MA8L 1WISA 4HIXH 4PG9A 2LQRA 5CGYD 3U4EB 4OZIA 1HYSC 2NY5H 4XNYH 5IKCA 1I8KA 1TPXB 1TZHA 1X5ZA 4OV5B 1L0YA 5IMKA 4K94C 1CXIA 1HH6B 4EDXB 1IZKA 5INDA 4LAQH 4MS8C 2OJZH 4PS4H 4YJZL 5I1HL 4XMKH 1LGVA 4IEFB 3MUY1 5B21A 1T21A 3AU1B 3GSQB 5K9OB 4OM0L 4NHUB 2BNQA 3N50A 3HZYB 2C9AA 4X6CF 1WT5C 3M1BB 2E6QA 1WTLA 3KPMA 3HNVL 1HSAB 5FO7B 3WFDL 2JTDA 5SX5K 4AEFA 1C7SA 4I9WD 5FO8A 3D3VA 5FKAA 1MJJB 1S8DA 4D0CB 5DVNA 2AJUL 4JKWA 3ZE1E 3UTPD 2K9UA 2BRRH 2O5YH 2DQCL 1QNZH 3MOAH 1H3UA 5B4MD 1P7QA 2NY5C 2P24B 3H9SE 1GXEA 4R7NB 1T2QH 1FRGL 1CI5A 4MNGB 4KH2A 2BVYA 4N9GA 5ICXA 4HIJB 4U7MA 2V7NA 2NZIA 5DSCB 2NW2B 4K7PY 5J89A 4NNXA 4LU5H 4OFYD 1LDPL 4XWGH 3EW3B 2FJFB 3MLYH 4PRIE 3QUKA 3WIFB 1VFBB 5I66B 3AS0A 1F3RB 5C0CA 4OD2B 1TJIL 1DQLH 5CP3A 5GRJH 1TJHH 2NY2D 1Q72H 3OMZA 3MNVB 2ZUVA 1VPOH 2P5EE 4MJ6A 3W82A 3VXTB 4ZMAT 3B2UD 3O6FC 1YY9D 2HT4D 3DV4B 5EULV 3L3GA 5FUZL 3D25B 1S9WB 5CEXA 5T33H 5L2JB 3D39A 4ORZC 4HWNA 4QRRD 4BQ6A 5HHQA 4U1HB 1Q9KB 5C09E 3RUGA 3NZ8B 5ISZE 3L5WA 5GS2D 1ACYL 4PRDB 4PUBH 4LVNB 1MQKL 4NZUL 2AJVH 4OZGE 4FQHB 1KGCE 3O2DL 1A7RL 2ICCA 3HPJB 5EZIL 1ZS8A 5C0DA 3HNSH 4TUKH 4RBPK 1W8NA 1VDGA 4X5WB 5E7BA 1WFUA 4DN4L 5GRWA 5T5FL 4NYLB 5LGJB 5C07A 4G7VL 2NY1B 5E95B 3AY4A 5JDSA 1QG3A 2DQDL 3BE1L 1P4BH 4FXGB 5I76B 4L4TB 1UA6H 3L7EA 5I15H 1Z6JT 3QRGH 1INDL 1FLTX 1I4FB 4F57L 3E2HB 4HIHB 1MCBA 1UJ3A 3CK0L 1JGVL 1U6AL 3BHBB 1X4XA 5DYOB 3MUGA 4UB0L 5DK0B 1FNEB 3S4SG 3WCYA 2JIXD 1GC1L 2C1PB 1IGIL 3E6HA 4RFOH 1LD9B 2AXHA 1C8PA 2VZSA 1J1PL 4OCNC 3DTXA 3U4AA 4CGTA 4IBLT 4NP4L 2R0WH 1T1YB 43C9B 3RU8H 4X6CB 4HWZA 1BEYH 2K7QA 1MUJA 3CVHA 2GQHA 1PSKL 5C0RH 3T4AA 4M93C 2I9TA 1YMHB 3G6DH 3X12B 5T1LA 2FX8H 2YA0A 4G42A 2BNRE 3TNNB 1CDYA 4M6ML 4JDTL 2VLLB 2HVJA 3OB0K 4FQ2H 1X5XA 1ZHLB 4J7RA 4XAWH 4JHZA 1AD9A 2R1YA 3H9ZA 15C8H 1VGKB 1UB5B 4FABL 4UQ3B 2AAVA 3FFCE 5I8EB 2NY7H 5IIEA 5HGDA 4JGMA 1ZTXH 3LH2L 2DQUL 3VFOA 2D31A 2OR8A 3DHMA 3DMMA 4IOIB 3V95A 1I9JH 4KPHH 4U6HB 5AYUH 3GSUA 3QDMB 4MA3A 1UZ6F 1AFVL 4O00A 5GZOD 3TBWA 1J0JA 4RWYH 3O2WH 1UB6B 1BVKB 3OHXB 4RNRA 1N8ZB 4F7CA 5HHOB 4ZUVA 2YD1A 2BVPA 3Q6GH 4JZOB 2DLFH 4KRPC 2NLJA 2D0GA 2Z93B 3HS0B 1G9ML 1RJCA 5DVKA 2MCG1 1Z0MA 4L9LA 4MAYA 5BV7B 4F15C 5EZLB 5HVWA 1A14L 1Q8MA 1BFOB 2VH5L 2QKIA 2X4PA 2CLVB 3F7YA 4L5FH 3WIHL 4GG8A 4YHPA 5FO9A 3BAEH 5I8CA 3GUTA 3DARA 3VXSB 5I19H 4J4PC 4EI6B 1EO7A 3T8XB 1U8QA 1KFAL 4ZSOE 4DN3L 4PB0L 4QRSB 3SCMA 4N0CD 5DT1L 4R97B 2CD0A 3NIGE 2ADIA 4YEEA 4IDLA 5CLWA 2XWTB 4Y89A 1ZLWK 5EOQH 3MV7B 4U0RB 1MCHA 4ZXBB 3T0EB 5I71C 2ESVA 4X9BA 1NGWB 4KKNA 3FOMB 4OFPA 3TWCL 2DM2A 1BD2D 5I75B 3H3PL 3PP4L 4TVSa 5IBUG 1EEUA 5GZNC 5E2TL 4LPYA 1JHKH 5EFIB 5FYJD 4TSBH 3KYNB 1PY9A 3RVTD 1HHHA 3S6CA 5CCKL 2JK5A 5ADPH 3C8KB 3GI8H 1S7WB 1BAFL 3SE9L 3I9GH 4KDVA 1U3HD 4OLZL 4I18A 1NC4B 1A4KB 1BD2B 3NA9L 1UKSA 4OF8A 4ALAL 2A6KA 4POYA 4AQ1B 4X6FA 1R0AL 4YDLB 4GRWF 3BEVA 5LKNA 4MDJB 4KKLC 4I77H 1C5BL 4MD0A 4JO3L 5DGQA 4NQEE 3LN5A 1U93A 3BKYH 5D2NB 1K6QL 4KK9D 3ZKXB 1IQWH 3RFZC 1NL0L 4FHBD 4DWHA 4HHAA 3TCLB 1KPUA 4P2CG 5C3LD 1PEWA 3ARQA 4PLJD 2VL4A 3RGVA 1VFOA 1VACB 3V4PH 1FE8H 3NGBB 1EJ6A 1R3JA 3BMWA 2BERA 5FCSH 1L7TL 3PGDB 5FGBA 3PWLB 4EIGB 4MMZC 1M6OB 3V0AC 4HPYL 3L9RA 4EKXA 3NA4A 1IAOB 1OAKH 1RI8A 4JPKH 2NY0C 2WUBH 5D96B 4FTVB 3PHQB 1DBAH 1RUAH 1W8OA 3ECBB 3MXVH 5FYLE 5EZOH 4XP9H 4QHNA 1N6UA 2Z8VC 1JPGB 4HZLA 3DUUA 4WFGE 1OTUC 3AGVA 3QI9C 5A2IH 5IJVB 4F37K 2AXFB 1QSFD 4G9DA 2VJXA 2H3NA 3K0WA 1OT1A 1MCWW 1E6JL 3KPOA 5KSAC 4FFYL 2C3HA 5IK3A 1YEJL 1FSKC 3AREA 4P4KA 5C0NC 5GSRA 1NUNB 5I1GH 3UPRA 3O6ML 4WU5A 1TVHB 4GH7B 1QPXA 3D69A 1ORSA 5I1DB 3EJZC 2AXGB 3LQAH 4UDUB 3S97C 5JO5B 1KLUA 2GSGB 1AD0B 2Y06L 1IC4H 4PJEE 3OKOA 3DIFA 4LIQL 3SKNB 4IRSD 4NQSB 5IVXA 4LSRH 1DZBA 4FOMA 3O0RL 1AGCA 3BSZL 2NX5A 1JNJA 2V9RA 1H9VA 1W0VB 4YO0B 4AM0B 4UNVA 2LVCA 4S11A 3D9AH 3NVQA 5IQ9B 3ELAT 5TDNB 3KR3L 4ZS7L 2QSTA 3ARDC 1AXTL 3K3QA 1ZOXA 1H3PL 5LWYL 4Z7OF 2J8UE 2VDPL 5LQBL 4DEPB 5ITBH 1ED3A 5D93C 5I8OL 2Y5TA 3TVMB 1RUPL 1EEZA 4HBQA 1IL1A 1CL7L 1YEEH 4HPOL 2BNQD 2XWBA 2NZ9D 2CPCA 3MRMB 5K9KA 4PJHA 2GJ6D 3VWKB 3MNWA 3P40A 2BCKA 2B4CH 4W81A 3HI1B 5EPMB 4JAMA 4ZO7A 3FB8B 3CDGA 5IEHA 4HFUH 3G5VB 5MEQA 5C0BD 1BP3B 5IVNA 2HT2D 2AGJL 4ODSH 5DEFA 2VE6B 3I6GB 1FPTL 1KJVA 1FZJB 4GRWB 3D6GA 4JO2H 3MLRH 2OCFD 4Y4HA 5DMKA 4CU8A 3SPVB 3IVKB 3O2VH 1BZ9A 5C0BB 1NQBA 1E4WL 1GJIA 3D2UB 5DJYA 3TBTB 1XFPA 1S7XA 4HMEA 4O58L 4G8GD 2IFGA 4FFZH 2BDNH 2R29H 4XVSH 3ROLA 4F3FA 5D72H 4K07A 2B1HH 1ZGLP 2YD9A 1T0PB 3NFNB 1CFSB 1MIML 35C8H 5SWZE 1UWEH 3MV8E 5EWIL 2XPGA 2GITA 4Q74A 5T1DH 4HG4K 3PF2A 4FZ8H 3WXVL 1I7RB 2B4CC 5H37G 5JLZB 3MREA 3AM8A 1U8JB 3BD5A 4IIQB 1V05A 5IMOB 1MHCA 2IH3B 4C55A 3G6AA 4FFVC 2EH8L 4M43L 1ZSDB 4JN2A 1S9VA 3QULB 5CP7B 2R0ZL 3CSBA 4LDLB 4E41A 4CVZA 4YIQA 1SEQL 3O4LB 4LLVA 4X80L 1SEBA 3MLXH 4RMQA 4D8PA 4JRXA 3TEUA 2W59A 3L5XH 1B0GB 3GSOB 2F74B 2D2OA 1AKJA 3BH9A 4EZMA 1NFIB 2ADJA 4TRPH 4L8BB 2H9GB 5D7JC 1W0WA 3EO0B 4GUPB 3RX8A 3MRIB 1ZEAH 2XZQL 5F7EH 3MRDB 4TVPH 5ICZB 1U8PB 4KV5F 2C4FT 1Z3GH 4HKZB 1MAML 5DD6A 3MO1A 3JV5A 1XGYH 5F7DA 1SVZA 1T5XB 3MA9L 4LCIL 1JE6A 1L0QA 1BJ1J 1IARB 4XP6H 4Y1AE 4HJGA 3QR2A 3SOBL 2D7TL 1C5DB 3C6LA 3HCVB 1NEUA 2X1PA 1J10A 1EK3A 5F1SA 3L3JB 5BV7L 2ENYA 1IBGL 3VW3H 4XCYA 1E4XI 3AAZB 2QHRL 1NMBH 5C0AB 3PWNA 1D5IL 5INCA 3TPKA 5HGBB 5GRXG 2AERT 3HMXH 5FIEA 5FUOH 4JFDA 3WIHA 3OF6A 4WDIA 5DTFA 4LVOB 1FVDB 2Q6WB 2MQ3A 5HI5C 1BHGA 4K8RL 4GXUM 3KNBA 4PGCB 4PJGF 3BQUD 3QEHB 1JGUL 3O9WC 2D3VA 4EXPX 3ARFA 2W0FB 3CUPB 3CJJA 4YE4H 4MB3A 1WV7T 3V6FA 1LK3H 2AEWA 5T1LD 2FSEA 2WP3O 3QT2A 5HHNA 5CEZL 1CGUA 1NBYB 5ITFB 4YLQT 5DA4A 4J6RL 3TN0D 1EFQA 3UDWA 1MEXL 2YD3A 2PYEA 3MGOB 5I1CH 2AJZA 5BOPA 3VWJD 4PV9A 4MNQA 4JFYA 4R2GB 5E8OB 1F4AA 3RL2B 3WS6A 1LEIB 1AXSB 1N5YH 1M7DB 4NQUA 4N90D 3RX5A 1M7IA 1MJ8L 3WLBB 3LKPA 4FQIH 5DHYB 2VITB 3MGTA 2XOTA 3TZVA 5L8KB 3KLAA 3DROB 2D7NA 2E7LA 3MOBL 4KU1A 2DQEH 3S35H 3GHBL 1C5CH 3MRFA 3ARBB 2X4UB 5FYKL 4HCRH 1HWHB 4LCCB 4YPGA 3BZFA 4ZFFA 4ONFL 3IFNH 4UAOB 5TE4L 3UZQA 4EUPB 1TJGL 3UTSD 3U4EA 1INQB 3LD8C 1CDJA 5B38G 2AKRA 4MAYD 4OFDA 3Q5OA 1YPZF 3VFUB 4OV5A 2JJVA 2AABH 1HH6A 3MUHL 4KVCL 2A9NH 1CT8A 5F9OH 4EDXA 3GMRA 2VABB 3IAQA 2J88L 3RIFF 3V0WH 1HH9B 1GZPA 3TJHC 5FA4B 2VRAA 3LRGA 4PY7B 2VZVA 1A02N 4V2CB 3GSQA 2FECI 1C1EH 5K9OA 5TE6H 4NHUA 2FNBA 3M1BA 5FO7A 1HSAA 2P5WA 3DUSB 3QCUL 4PLKC 3RRQA 5BRZB 3S96B 3QAZC 4D0CA 1V7NH 4JFPA 1NGQH 1QO3B 5FGRA 1NAMB 5JOPD 2H26B 3CZFB 1PG7H 2VSCA 3KS0J 2P24A 3VXNB 5BMFL 4R7NA 5I1EL 4MNGA 1URLA 1UH2A 3RDTC 4HX1B 4M7LL 3CPLB 4HIJA 3U9PL 2NYYD 1TMCB 1D7FA 1MFAL 4X98A 1IC7L 4OAWB 4NHCH 2ED9A 5CZVH 2NW2A 3J8F7 3OJ2C 3Q6FB 5BCAA 5KAQG 3VXUD 1TQCC 2NY6D 2O5ZL 3P3YA 4ZPTB 5E9DD 2AJ3A 1SYSB 2OQJA 3WIFA 1VFBA 1AGFB 4QXUL 5I66A 5H2BB 4FQXC 2I9LB 3FB5B 1U8NA 4Z6AT 5HHME 1L6XA 4HUVA 1RZJH 1OPGL 5T3XL 1B3JA 1T1XB 3QDGD 5F44A 3VXQA 5JW3L 1QSEB 3MNVA 3SGEH 2ZPKH 3QDJB 3IDXL 5SWSD 3PV6A 1A7PL 1NMCB 2F53B 2K7PA 3D0LB 4PJGB 5HHVL 3TO4C 3VXTA 4DAGL 3DV4A 3SN6N 2HRLA 4OJFH 1WIPA 4LFHG 4XBEL 2BRQA 4WW2F 2KBGA