4HH9B

Anti-human cytomegalovirus (hcmv) fab ke5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
229
structure length
229
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNHGMHWVRQAPGKRLEWVAVISYDGRHEHYADLVKGRFTISRDNSKNTLYLQMNSLRAEDRALYFCAREGLSRDNSGFTGLIDYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab KE5, light chain
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh9B01
2VE6B 4N0CD 3IFNL 3BZDA 1AXTH 3EO0A 1BBDL 3BVNA 3MC0A 4IRSD 4K3EL 2A0LD 5J0BA 2OS7A 1BBJB 4GUPB 1QBLL 2IGFH 1MJ8H 1UJ3A 3I02B 4NQCB 3FOMB 3WNPA 1MHHA 3UCRA 1PEWA 2VQTA 2FYYB 1U91B 3VRIB 12E8L 3QFJA 4HS8L 3OXSB 3AXLA 3QEHA 1GHFH 3OZ9H 4JRYE 6FABL 5FA4B 3HZVB 1DQTA 4YUEL 1EPFA 4J3VA 3GJEA 4I5BA 5KVDH 3JWDH 4F9PC 2B5IC 3ZE1F 3RU8H 1UKQA 5E08H 3VWJB 1ITBB 1NCBH 3HI5L 3I50H 5GGRY 1U2HA 4OCWH 1A7NL 1A9EA 2WW8A 2XICA 5A2IH 5SWZA 4U1NA 4Y8DC 4U4BA 2GI7A 4KK6C 5CCKH 2MPAH 1JRHH 2C1PB 4GKNA 2BNRB 2NW2B 3O4LD 2QL1A 4ELMA 2EIDA 4G6AD 4N0YH 3D39B 4QWWC 2MSPA 5AG8A 1VDGA 5IB3B 1G6VK 3OKOB 4PRBB 5HYIA 1HQ4A 5IFAH 4HPOH 3BMWA 2QADD 5FHAH 4L4TB 2P24B 1BQHA 5IB4B 4FNLH 2FX7H 2VOTA 2DICA 1I7ZB 1NEZB 1FJ1B 5AEAA 3O2VL 2Q76A 4UNVA 2BVPA 4KTEH 3MJ9H 2DTMH 5KANI 2FRGP 2JK5B 1LE9A 3BKYL 4JZOB 5TDPB 3TT3L 4L8CB 3UDWA 2J8UA 2JJUA 2B39A 4ZFZB 3S4SB 4CMHC 3I75B 1I9RH 3JTTB 3TNNB 2DWDB 4UMGA 3UJJH 1ZGLM 4Z18A 1NCNA 4G6MH 5D1XD 1AQDA 4XZUB 2F19H 1OF2A 1L4IA 4PYHA 4NM4H 1KIRA 3O3BA 3H9HA 1WZKA 2WBWB 3C5ZD 1K8IA 5EU7E 3BYTA 5HJ3A 3LKRB 1OT1A 1SVZA 5IQ7L 3KHQA 3QWOA 3QAZB 1ZT7A 5DHXB 3MACL 1TJIL 2ZZUT 3TBTA 4EVNB 4LCWA 4E5XB 2FB4H 5E56A 3V52L 4ZSOA 5FKAB 5GS2D 1HYSD 3DI2B 5LGKA 5DJYA 4ETYA 3GMNB 1SY6H 3MGAA 2R0KL 5IVZB 1IKNA 3K4ZA 4I4WA 3TN0A 5D7LE 4NQDA 5D1QD 5IHLB 2FECL 5IROC 3ZMRA 2FJFB 4U2ZA 4M5ZH 2HJKB 5FUOH 2ZOLA 1R24B 4PRHD 4JDTH 4P0DA 1FQ9C 1P9MA 4JREC 3HG1B 4UOW1 5GISL 1IM3A 2X4QA 5DVKA 1J8HB 4CN4A 5ACMA 4X8JA 4PJIE 2A9NH 2HLAA 2HVJA 1BVKB 2D31A 2KQNA 4L4VA 5DD3L 3PXJA 5FUZH 4H0IA 5CAYB 5B39B 1RZJH 5TH2A 3T0EC 5AWNH 1GZQB 1RZFL 3WXVL 4PJEA 5FGBC 4F2MB 1MF2L 5DQ9A 2QSTA 2ZSVA 2HT4D 5DMGC 4O51A 5K33A 1BEYL 1PFCA 3CFCL 5E95B 1Q0XL 2M1KA 2DYPA 5D70L 1OGTB 4Q6IB 3MOBL 1GOGA 1S9YB 3L5WA 4OZGE 3ZHDA 2AEQL 5E2VH 2IADA 5D7JD 4W6YB 5E2JA 1WSST 3C08H 4ZFGH 3C9NB 4HKJA 4HFWA 4QRRD 3BPCA 4W6WB 3VRJA 4JM2B 1IFHH 2FSEA 2PW1B 3EOBB 4FQIL 3CVIL 1FGVH 1S8DA 2BXZA 4F8QA 5HD8D 3QUXC 4PIRF 1R3JA 4J6RH 3NFPA 2VDOL 5J11B 2D9CA 4UDUA 1G0XA 4RDQG 4QHMB 3VE0A 1UXWA 2N7BA 1EEZA 5L2KB 3BSZH 5K9QG 1LO5B 3ULVL 3IDIA 3NIGE 2AQ2A 1YEJH 2W0FB 1D7FA 1WZLA 4GRWB 3GSUB 5DJDA 1KBGL 2HVKB 2WANA 5E24E 4KVCH 3EW3B 1QSZA 3KJ6L 5SWSE 5JHDE 3AB0C 2W60A 2WBJD 3SO3B 5IB5A 2NY1C 1CFNB 1G7LB 1UCBH 1Q9KA 5ICXA 1C5DB 3GSVB 1OWWA 2NY6B 1X7QA 4U05A 1HXYA 4N5ED 2DL9A 1TDQA 2XPGB 4N1EA 1WTGT 1UWGH 3U46B 1XEDA 4CW1B 1CG9B 4LVOB 3U1SH 1HK6A 1LEIB 3V8OA 3C5SB 3U9PL 3BISA 4YX2L 3BP6A 1EEUA 2AI0H 4OI9A 2IBZY 4NZRH 3FQTA 3S5LG 4O2FA 3LN9A 3D0LA 4P5KA 1BZ9B 3QQ3B 1IM9B 4JJ5B 4KUCD 3K2MC 5J4MA 1XZ0B 1H5BC 4I18B 2BVYA 5IVXF 4PUBH 3QCTH 4A6YH 3ETBF 2JF1A 3WUWA 3W0WD 4M7JH 1DQDH 1T1YB 1ZMYA 1YN7B 3HE6C 4ZS7H 3ARBA 2VLMD 4FQQB 4DW2H 5HHME 1G6RA 4JY4B 1A3LH 4Z8FL 5FUCC 1NGQH 4PP1C 2CIIB 3SGDI 2CJUH 4X4MA 2IANA 2HT3C 4DVRL 2XA3A 1BIIA 2CR3A 3BDYL 5KW9L 5IROA 1PX4A 1E28A 1XF5A 3DWTA 4NNPL 1RK0B 2Z4QA 2Y07L 4QHLA 3CFDA 2PYEB 1HNGA 3O6LH 2XRAL 3FAWA 2FCBA 5C8JA 1CR9H 3LEVL 5DO2C 1MRCH 5E00B 4NO3B 5FYKL 1PYWA 5JXAL 3RWDA 4IRJA 1S3KH 1OD9A 1VFUA 2JKXA 3MBEB 2Q7NA 4LKCA 3VRLE 1DVFC 1FL6B 2VL5A 35C8H 3KPLB 15C8H 4EDXA 2VDNH 1QQDB 4OD2B 1PVHA 2YRPA 1JNLH 3JUYA 1N5AA 3T65A 1QLFA 1SQ2N 2DDQH 1R3KB 4WEBH 3IKCB 5E7BA 4Z7NF 2J5LB 4DEPB 2R69L 1ZT4A 3KWWB 4OFVA 4X6DB 4GSDH 3O81A 1DBAH 1YDPB 3D25B 1BVLA 2FO4A 4Y2DB 5ADOL 3HLAB 3UZQA 5C9JA 4EBQL 3RGVD 4D0DA 1JWSB 2GT9A 4HMEA 2D2OA 3PABA 1FLRL 4MAUH 4GG6F 5FCUH 5EU4A 3WE6B 5L8KB 4FG6C 4FFZH 3NIFF 4UUJA 4M1CD 1H8SA 1JFQH 3RIAK 1D5XA 4PRID 3VI4E 4JCMA 5BZWA 1I9EA 3HZYB 5HHOB 1AGEB 3MV9B 1TFHA 3R0NA 5F7YC 4O9HL 2FATL 3QR2A 3GHBL 3C2SA 4XP9L 3AAZA 2HKFL 4U6VH 3UYRH 4Z7UE 4HQQH 1XF4B 3D3VA 1DZBA 4LCCC 1BF8A 2H2PC 1QFHA 3GMPA 4HXBH 4EDWH 2A74A 3MXWH 3UTSB 3X12B 3MRGB 5DD6A 3FT4A 5DD1L 1EEYB 3VXTA 1GC1L 3U2SB 3G6JF 4NRZB 3WL9B 5C0RH 1IAOA 1FYTB 1A7QH 3NGBB 5CSZB 5C0DA 1RK1A 5KSVB 3EFDL 2GUOA 2UZIH 4M6MH 3RUGB 2PW2B 2IPKA 3MCKA 3OAYH 4J3WA 4XRCB 5J1AB 4PJ7F 5D4QA 2ARJQ 2NY4C 3MCLH 3UTTE 2R9HD 3QUKB 4K3JL 5ID0B 4X9BA 1PKQA 4R8WH 2ED8A 3O4OC 4O2EA 4R7NB 4L5FL 4U1HB 1H3UA 4LQFH 2UWEB 4OZFB 4MAYC 2BNQE 2Q20A 3TIDB 2BNUA 4NM8L 1XGPA 1EO5A 3IAQA 1EJ6A 3ZYZA 1UYWH 4KKLD 5D5MF 2R4SH 3I9GH 3ULUC 3EBAA 4NOFA 3MNWA 4JR9H 1N4XH 2F9BT 1QHPA 3OAYK 4UIKH 5GZOC 1Z0MA 1SJXA 4NC0B 5MEOA 2EO1A 3QNZA 4UT6H 5I9QB 4A2MA 3EIFA 2FL5B 3MLZL 4LPTA 4NWUL 3WXWL 5GS0H 1LGVA 4FTVA 3HE7C 5FAAA 3A0OA 3F12A 4CVZB 5D1ZA 3RKPA 1S7XB 1OPGH 3CZFA 1F6AB 2VXTH 4PPTA 1RIHL 5D2NC 3SQOL 3JWOC 4OZHB 1WICA 4N1HB 1ZT1B 3ZE2F 5IW3A 1J1PH 3ILQC 2J6EA 1NCCL 4KUCF 5A43C 4NN6B 4EUPA 4Y4FB 3MRQB 1FZOA 1KYOK 3OL2A 3QIUD 1CDCA 4RFOH 3G08A 3GKWH 3QDGD 1DSFH 3BH9A 5HXMA 1S7TA 1A7RH 4Y16B 4I3SL 3OAUH 2J2ZA 1IAMA 3MGTB 1JGDB 5D7IF 4PGDA 1RHHB 5CWSA 3TWCH 4ZFFA 2QBWA 2HFTA 4WTXA 5DHVB 1MLBB 1LD9B 1P2CA 4RGMC 2X5PA 3D2UB 4OLYH 5KSBE 5CBEB 3QZWB 5CUSH 4PJCA 3WFEH 4BZ2L 1MHPH 1IC4H 3WN5B 3B5GA 3SY0B 5DJ6A 5C08E 1G7PA 3NABH 3LZFL 2ZCLH 1A7PL 3U0WH 1T89A 1PDKA 4MA7H 3S7GA 1VEMA 2NXYD 3NCJL 5DD5H 1NFIA 3SDXB 1EUTA 5HHPA 2YPLE 4ZDHA 2YK1L 1BIHA 1ORQA 3FFDB 4W68A 4U7MA 4LASL 1TCRB 4K7FA 4U3XA 5AUMB 2DQEL 3HRPA 5I19H 3HC3H 5C2BL 5HPMA 2RB8A 3I2CL 1JWMA 4NNYA 1I8LC 3GIZH 4D0BA 2OCFD 1VADA 1MI5A 4MDIB 2VTFA 4JDVB 3BKJL 4AIXA 3QPQC 4JHWL 4PS4H 3KPNB 2H3NA 4FFYL 3S37L 3T0ED 4WI3A 1QRND 4BSWA 2Z35B 3E6HB 1K3ZA 1FFRA 5F1OB 5GS1B 2LAAA 5DMGD 4HCRL 4XMKL 3KPSE 4KRPC 4PB9H 4QOKE 1YEFH 2VLJA 5IHUL 1JZ4A 4HWNA 5AYUH 5JIIA 2DQDL 5TE6H 4YNYB 4PGJA 4P2YA 5H37G 4NT6A 1KJ2H 2QHRH 3QIWA 3UAJC 1KJ3L 3PL6B 5GQBA 5GGTA 2ICEB 3U0PB 3THMH 4ERSH 4PGCB 1BFSA 3QUXD 5E8DL 1L7TH 2V7NA 3NCMA 3S3JA 3QHFH 1U41A 2I5YL 5MP6H 3BX7C 1FNGB 5GZNC 1F90H 3KPRD 4OFYA 2YPKA 4CAGA 1WBYA 4ODWB 3EGSA 4GRWH 4LLVA 3FRUB 4RX4D 3L1OH 4BFIA 4HK0B 5IHZB 1H0DB 1YEHL 2PKDA 4MJ4A 4XP1L 4D9LH 4DAGL 3MZGB 3ROOB 3O9WA 3GO1L 4PLJD 1HSBA 4UBDD 1Q72H 1T80A 4G6KL 4ZXBB 4G42A 2HTLD 1T03H 3O11A 4Y1AD 3HS0B 5ESAA 1NGZA 4JFPB 2VR9A 4G8IA 1GGTA 2YHGA 5EZJB 3WJJC 1P4LB 3A6OA 1BD2D 5F7EL 1OAYL 1NAMA 2ITDB 2YC1B 2P8PB 5JZ7C 1VEPA 2P5EA 1MQKH 5D2NA 3IU3B 2F54A 4LOUC 4GT7A 4PGEB 4FFVD 3QJHA 1CLYL 2XV6B 3T0WA 1OP5H 1U8NB 5EDXA 1SEBB 4L3ED 1FFOA 4WY7L 5F7DB 1T1XA 3MO1B 4PJFB 1FPTL 1AP2A 1X6LA 4HAGA 2AAVA 3UYOD 1MRFH 3PQYB 1G9NL 3FOLB 1F3JB 1XR8B 1YECH 4YBQC 1AGCB 1EJOH 3BWAA 5BJTA 5T1KA 5F9AC 5CD3A 4XMPL 2BVQA 4HHAA 3UPAA 3KPMB 1VKXB 2NXZC 3BPLB 2DTSA 1I8KB 3U79A 4N0UA 8CGTA 1TJHL 1OSZA 3ARDC 4KV5F 1DQJA 4FQ1H 4OB5H 4HZLA 4V2CB 5IMLA 1JF5A 2VC2H 4J1UA 1ZLSL 3N9GL 5T1MB 2HT2C 3ZHLA 2HT3D 2QR0B 4YFEA 3FRPA 3F62A 4XC3L 2FIRT 1MNUL 1FIGH 1HKLL 4MA1C 4PJHF 1R3IL 1A1NA 2F8VA 2A6DA 4XBEH 4XPAH 3OG4B 3TO4D 1MCOL 3QUYB 3FHAA 4OGAC 4F7EA 2P7TB 5EUKB 4OKVB 5D93B 4JB9L 2VQ1B 3EZJB 4JPWH 5CEYB 1CVSC 4XC1L 1ND0B 3R06B 3OJDB 4P2RE 1W72L 3P30H 3JV5A 1KNOA 4JVWA 3RNQB 4P46B 2LAGB 5I1AA 4N1CA 1NBYA 2NQCA 1M7IB 4QRSA 4Z7WE 3GSOB 1Y18A 4ZODA 5FB8B 5JXEC 3KLDA 1CLOL 1N64H 1R5VB 4C83B 1IKFH 1CDGA 2AQ3A 1T1WB 1ZA6A 4PG9A 3QRFM 3VXSD 3R4DA 4TTGA 1KB5B 1NGWA 2Z91B 3H0TA 4V1DB 4G43B 1DBBL 2MQ0A 4M61A 5ANMA 3QP3A 1KPVA 4E9LA 4Y5XB 5EIIA 1MH5B 2XZZA 2V9QA 3QUZC 4LK4A 5AZEL 1LK3L 1NSNL 5T33H 1YJDH 4MD4B 4DVBB 4LVEA 4NCDA 3SCMC 2HFEA 3CXHK 3BJ91 1QSEA 3HUJA 3ARGC 5IM7B 2HJFB 4X4XA 4Z7QE 3O3EA 3UO1L 1VPOH 2AJZA 5D6CB 1CFSB 3LKOB 4LGRB 3ISWA 2X4OB 5DJZA 4M7LH 5ITFA 4ZPVA 3SKJH 1DBJH 1WZMA 1ZHLB 4IMKC 4PTUB 4IRZL 2CH8A 4NQEB 1NANH 2H2PD 1RVFH 3VJ6A 2GY7B 5BRZA 3ZDYF 5K9JH 5J6GB 2UYLB 3G5YA 4KRNA 2R2HB 4M8QB 3NA9H 1Q9LB 2CMRL 3L95B 1Q94B 1IZJA 3NN8A 1JYVA 4G9FD 1K8DA 5I66A 5DJ8B 5CBAB 4LU5H 2AV1A 2M2DA 4ENEC 3O8XC 3BEWB 4RIRA 4WDIA 1JF1B 2NY5C 2R15A 1NFDF 3A6BH 2OYPA 5B8CC 5T1DH 4OZFH 3S34H 1A6TA 2QQLL 1J05A 1KFAL 1MRDH 4NZTH 2FBJH 3LN5B 1U92A 1KB9K 1QBAA 3DMMC 2VXSH 3MRDA 3OGOE 3BGMA 2CXKA 4MAYD 1JIBA 1SYSA 5BVPH 3SQBA 4U1KA 2J4WL 4KZEL 3ULUD 3U7WL 3LB6C 4BZ1H 4XPGH 4N0RA 1KCKA 25C8L 4KJYA 1K2DB 3O6MH 4BKLB 1BFVL 1VGEH 5EZIL 1ULVA 1NANI 1YMMD 1CFTA 5LG1A 3DSNA 1G6RL 4UILL 4ALAH 1INEL 1CT8B 3LMJL 5EUOB 3HE7D 4LHUB 3QCUH 4M6NH 5IJKC 1S7WA 1XIWC 2R56L 3KPOB 3PWJB 4JG0H 4ODTH 4LSPH 3VFWA 4LEOA 1F4YL 1IQDA 4Z7VF 3U36B 2ZCHL 1QEWA 4HWEL 2BY0A 3FT2B 2WUBH 4M7KL 2IPUK 4L8DB 5GGSB 4WO4D 2ATPA 2G5BB 1U3ZA 1I8MB 3HI1B 1NBVL 4QXGL 3KYKL 4G3YL 2CRYA 5LBSL 5C9KA 5IFJA 4MX7A 5DD0H 1S9VA 3OKNA 2F58H 3GSWA 5KANG 1XCQA 4XAWL 3TCLA 2C4XA 3FHQA 4H1LH 1D9KC 1N59B 4KMTL 1WFTA 3QUMB 3VW3L 4PJBF 1OB1A 2DN7A 1ZHKA 4OD3L 1SHMA 2ESVB 1JZ5A 3T4AB 4IIQA 5DUML 3FB7A 1X4XA 2JJVA 3DYOA 4GKZB 3QFDB 2FD6L 2P5WE 2BFVL 3P4NB 3PNWB 2YN5A 2ADGA 4YHKL 3PV7A 1N6VA 2VIRA 1PAMA 1P4BL 2J8OA 2QLVB 1I7TB 4PJAB 3T08A 2AJ3A 4HSQA 3MA7A 4LRIC 5LGJA 1KELH 4OFDA 3LKSB 4M6OH 3GRWA 4PRHE 4UAOB 5I1KH 1AI1H 3E6FA 4YXKL 1FSKC 4Z78A 4U1LB 1MFEH 4OBSA 5IVXA 3ZDXE 4JFXB 2CD0A 4NKDB 4YHLH 3OJVC 5HYJD 5EH1A 5L6YL 4QGYA 4PTTB 5DGQA 2ICCA 3SCMA 1T0NA 3INUH 4WU5B 3TO2B 2BXYA 3AS3A 3FT3B 4I77H 4R2GC 3LPFA 3AC0A 1HHIB 3SDDA 2DWEA 2VDMH 2QSCL 5INDB 2E7MA 3CFIC 3OKLA 5E9DB 3F8UB 3PWPB 5TPWL 5EPMA 1BM3L 1KCLA 4F7MB 2DF3A 2AQ1A 2GKIA 1U3YA 4M1GL 4YR6B 4IMKA 1X3DA 2NY2C 2R0ZH 3CX5K 4S2SA 4EIZC 2OR9L 4ACPA 4QRRE 4NP4L 3H3PH 5KN5A 2RQ8A 2C5DC 1NGXA 3PJSA 3BT2L 3GHEL 4GBXA 2VLKB 4P2QA 3QQ4B 3EO9H 4C57C 1M7DB 3UAJD 3O8XA 4Y19B 4CADA 4H0GA 4WNQB 3LSOB 4XXCC 3DX7B 4OD1H 1E4XL 4JGJA 4DQOH 2JIXB 1URLA 3F7VA 2MCPH 5KSAA 2X4SA 3OKMB 1WUNT 3HMXA 1U3JA 1EA9C 1IQWL 1KULA 3T77B 3RY6C 4RMUA 1LDPH 5GZND 4PV8B 1YNTB 2ZOKA 1A1OA 1CE6B 2GEEA 5JNYB 2BSED 3VXNA 1ONQB 3WFZA 5I16B 1QBLH 2ZKHL 3V6FB 3H6JA 3R8BB 4JJHA 3DROB 4Q9RL 4E41B 3QNXA 2OL3L 2IH3A 3QIBB 1B4JH 3VG0L 4ONHB 4B41A 2R29H 3MRJB 2FNBA 2O5XL 5CMAA 4N68A 4DZ8A 1UM6L 2A6JA 2AEPH 2BOCB 1NCAL 4GG6A 2DQIL 1JPST 3QJFB 4GH7B 2CQVA 4NCC2 3QA3B 4YUEH 1CF8H 1HDMA 4OQTH 4WUUD 4AEHH 3TJHC 1MLCB 2QSVA 4ORZC 1G7IB 5IW6B 3GBNL 3JWDC 4QRPE 5SWZE 1HQRA 2AJYL 2Q86B 2J6EL 4PJXB 3A67H 4LOUD 2JCCE 5SWQB 3MFGB 3P77B 1FZKA 1ORSA 5C09A 2D7OA 2JB6A 3CDGB 4HIHA 5GGUA 4F9LC 2OR7A 4KROB 5IKCA 4JRWA 1M6OB 1NCWL 3G6DL 4O4YL 2W91A 1B90A 1KLFA 1VFMA 2OZ4H 4UTAL 3G6JA 4E0RA 3TZVC 3GBMH 4ZO8A 2FHCA 2XN9D 2DAVA 5I71C 4TNVF 4Q0XL 5EIQA 5TQ0L 1L6ZA 4CNIB 2OQJB 3VFNB 3EOTH 3KYMA 4MJIB 2WNGA 4LLUB 4HUKB 3V6OA 3RY4A 3S88L 4PJ7A 1JGEA 1AQKH 4DN3H 4D9RE 3ARDD 3BGFB 5DSCA 3CSYB 5C0JA 4AIOA 2EDOA 3HTLX 1KCRL 2K7PA 3B5TA 1BVZA 4JFFB 1E6OH 1YMHB 1ZEAL 3TT3H 4JO3H 1NBZA 1G7MA 1UZ8A 1T7VA 4QHUA 5D5MA 1EAPA 5TDOA 4OCSL 4M02A 1T5XA 5FYJH 5AZ2L 4OGAD 5F71A 1JK8A 3SPVA 2C3VB 4Y89A 1J0YA 4NKOA 1MFDH 1ZA3A 4JM2F 1DBMH 2E27L 3PUCA 2VDLL 4XNYL 3SBWA 3QRGH 4IOFD 4YBHA 2GJ6D 1I1FB 2E8ZA 3QEGL 4UQ2B 3MLRH 5T3XH 3NOIA 4K8RH 1U8IB 1INQA 1W0WB 3C6LB 2H32A 3LKQB 4HBQA 3V5DB 3MACH 1TJIH 1FVDB 1QPPA 5JXED 2ZUSA 2VZVA 3UZEA 4GMSL 1R5WB 4HJ0D 4NQDE 4GRWF 4ORGB 1D5MA 1KXVC 3QPXL 3T3ME 1FFNA 5FDWB 2IF7A 5FYJU 4WTZA 1U95A 3TESA 5KG9A 3BRFA 2IMMA 2AW2A 5I1HL 3P4OB 3AS2A 3NIDE 1CK0H 3GJFA 3QXAB 4RWYL 4U1MA 3D85D 1ZOXA 3KLAA 4PRIE 4X4YA 5DJXB 1DUYB 1TIUA 2WIIA 4K07A 4L4VE 4TUKH 3QI9A 5DUPH 5CEZD 4HWZA 1WFNA 5F7HA 3RY6A 1IBGH 5ILTL 4U1SA 2H9GB 4UDTA 5DD3H 3AGVA 4XPFL 4PJEE 1J0KA 3ARGD 1NCDL 5LXGH 5DK0A 3M45A 5HGAA 4P2OC 1KXQE 3SKMA 1I1CA 1PZ5B 3B8YA 1RZJC 5C0BD 3OB0H 5I8OH 3Q0HA 1VGKA 2BCKB 1AGFB 4JZNA 3CFCH 4XTRC 1BGXL 3TBSA 1CD0A 3M07A 5D70H 1UJ3B 1KTKE 1WAAF 1MHHB 3QH3A 5HYSA 4JO4L 3MOAL 2BRQA 2APTA 3V7AE 4HWUA 5K9OA 3IFLH 5B3JF 1NAML 3QEHB 3ZSTA 1GRWA 2X4RB 5CZXD 1AGDA 4BFGA 5IJVA 5LVEA 3JWOL 4P4KD 5HHVH 5TDNA 4PGZA 4YHIA 1OWRM 4XCFH 4RZCA 4NJAL 2WUCL 2XTJB 4OT1L 1U93B 2DBLL 4F9LA 4WHYH 3CXDL 2XWJA 2JB5L 4NPYA 3JUZA 3D0VA 3DMMD 1LNUA 2PYFB 2AJSL 4JY5H 3ULVH 5DI8A 1UM5H 1RUPH 3UEZA 1LO3H 3K4AA 1GPOH 3P9MB 2X1XR 4HIEB 3BAEH 3FQXB 4AM0A 1MY7A 3ULSB 3ZL4H 2N4IA 1KBGH 4TVPD 3MLUH 1ED3A 3QXWA 1GVIA 3UBXG 5EB9A 5HDBF 2YUVA 1YPZA 5DZOA 5J3HC 1QFWM 1ZXQA 3SDYH 3X14B 5HVWA 2P44B 3WDJA 2A6IA 5GRXG 1DTUA 3LD8C 3TBVB 4LSVH 1XIWD 5FYLL 4Y4HD 4HGMA 1P7KA 3MA9H 1XGTB 1HYRC 1NMCC 3SE8L 5KVEH 4KK8C 3RVVD 4X7SL 3MJ9A 5C0CB 3RZCA 1Q0YH 4R3SA 3V8CA 3WO4C 4JFYB 4FMFA 4IOSD 3T0DA 2FO1A 1A02N 1AFVH 2EDEA 3H8NA 4F80A 5E8NB 3QUMH 3AVEA 3OAZH 1KSRA 1GCFA 4LCIH 5IIEA 4F33A 3EYUL 3GBLA 4ODUB 3QG7L 3VA2C 1D9KD 4H5SB 3VFMA 4JRYB 2F53A 3C5JA 1XR9A 5TF1H 1Q9OA 1G7JB 2Q3AA 5GSVB 1MVUB 1D5IL 4M48L 1JN6B 3MRNA 4LARL 4OCRL 4JFZH 5D96C 5JUEL 1JWUA 3CK0H 4NO0A 5F97E 1I1AB 1RZKL 4UQ3A 1MFBH 4FZEH 1A7BA 4PRPA 1FE8H 3ZTJH 4GXVH 3OR7A 3O45B 2VLRA 1QSFD 3BDYH 3Q6FA 2GSIA 2APFA 1NEZG 4UB0H 1DEEA 5DJYB 5EFIB 5DRZA 1ZGLA 1RAMA 1FDLH 2I27N 3F58L 2R1YB 4F8TA 2Y07H 1FL3A 3B2VH 2G60L 4FQXB 1BREA 3VFPB 2V5YA 3HAEA 1LHZA 1A6VL 1U3HB 1QFWI 1RU9L 2XQBH 2Y72A 4TNWK 4MYWB 1S5HA 3S4SG 3T0EE 2EKSA 1TZGL 4XCCL 3B9KA 5ERWB 1A0QH 5I1LB 4PJ9A 2EE2A 3VXRD 1AIFB 4X6CB 4YDIL 3RTQB 1A6AB 1JNNL 4L8BA 4XNMB 4PJHA 3TH4T 4BYHA 5JW4Q 4PJ8D 3L7FA 4K55A 2UWEF 3L9RB 4HX1A 3DIFA 5KZCD 3DO7B 5EOQL 2VO5A 3B3IB 3ZKND 2GJZA 4QO1A 4O02L 2GITA 2HJLB 3IDXL 5IFHL 3SKNA 2IPTH 3S8WA 3HC0A 3DGGA 1TQCB 2DM7A 4M5YH 2IADB 5DS8B 2IG2L 4YIQA 2VWEC 5JQ6L 1DFBL 5GGQH 3NACH 4HUUA 4HWBL 4OUUB 3KPRE 3WNOA 1IT9H 4OF8A 3CFEB 3EDJA 5MHSD 4JO2H 1KGCD 1UVQB 1VB9A 4OZHF 3VXMB 1ZTXH 4X80L 5DFVD 1J8KA 5DVMA 1PZUB 1VACB 2H26B 2EH8L 5C6TL 1FYHB 1TJGL 2OSLB 3BDXA 1P5VA 3PGFL 4Y8AA 2I60H 4RGNB 2XG5A 5EBWB 4XB8A 1RY7B 2R0WH 4O9HH 3PWUB 2D7PA 1HKFA 3D3VE 4OTXL 4MQSB 4KY1L 5D7LB 1WBZB 2MFNA 3MGOA 1FH5H 3DGCR 2G9HA 2DQTL 5SV3A 5I1CL 1EFXA 2IALB 2X4TA 5DMKB 1AKJD 1BD2E 2D7QA 3T3PE 5DJDB 1CLZL 5D9SA 3LPGA 4Q9QH 1HHJA 5F88B 1KC5H 3HPJB 4LNRA 1DQMH 2B1AL 3EFDH 4XI5C 4PJIB 5SX4I 3ARFB 3VWJC 1F4WH 2LQRA 4I48B 1LEGA 2ADJB 4I9WD 4PJDF 4LSTL 4X7TA 2X41A 2YXFA 4K3JH 4NGHL 2GFBA 3OHXB 3MLYH 3LOWA 3O6KL 2XXCB 5HHXL 4NHCL 3SDXF 4LSUL 4KZDL 2AK4A 4IDJL 4OZGB 3LRGA 3TZVD 3BKCL 1T3FA 5ALBL 4JPVL 4A6YA 4YC2C 5C0ND 1AE6L 2DQGL 5FUCE 1JHLL 4YZFE 4NSKB 1KLGA 4ELKA 1A7OL 4ZTPH 2Z93B 1NFDA 1P4IH 4JGUA 2V17L 3A6CL 4XP5H 5ALCH 5I8EB 4JFDA 4LMQE 1ETZB 5GS0C 1GXEA 1AJ7L 1LK2A 3GI8L 3L5XH 1I9IH 1YUHB 5T1LD 1GGIL 4PY7B 5DC0A 1BJ8A 2XFXB 1TETL 3GZKA 1PY9A 4F7TB 5ADPH 1NCCH 3VGEA 4DN4L 1XGUB 5L88H 3DV6B 3QDJB 2YS4A 1FZJB 1MCEA 4OFPA 5CEZL 4NKIH 1T21B 3H9SD 3NZ8A 4LVNB 1T66C 5SWSB 5JHDB 1AO7A 3CFJB 1VFAB 3W39B 1LILA 4I3SH 4S0SD 4RFNC 2HP4A 2X40A 5F7FA 1I8IB 1MCDA 4UNTA 2C1OA 2P8MB 1M05A 3MNZB 3RWDB 4IRJB 4Z7VA 4QRUB 2FJGA 1A4KA 1Z3GH 2P8LA 4BSJA 5KVFL 1RZ7L 5ELIA 3VXSE 4KAQH 4MNQD 3EO1A 3MV11 2Q7YA 1IGYA 1SEQL 2ZSWA 3MREB 1YY8B 4UIMB 2RGSA 5ESQA 2V7HB 4JN1H 1F3RB 4Z9KB 5JPNB 3CC5A 3O3DB 5GHWH 4RQQB 5IMKB 1J18A 1BVLB 1ZVHA 2NY5L 4NO2B 5D2LB 3HFML 4RFEA 5I0DA 5DTFA 4JKPH 4C56D 3DNKA 1ZS8A 4MA8H 2YKLH 5HY9B 1MI5E 2VE6A 3HMXL 2PXYC 4OIIL 2O5ZH 4MJ5B 5HHMB 2ZP0T 2PTTB 1JHTB 1BBJA 3HC4H 1RUKH 4Y7MA 4GUPA 5CZVH 4OZ4B 3I02A 4NQCA 1RUML 4R4BB 1HE7A 2CK0H 5F1NB 3C6SB 1JE6A 1VA9A 4MS8C 3SJVB 2FYYA 4TVPL 4PJFF 1U91A 4P2OD 3VRIA 2R2BB 3VH8B 2NY3B 5MERB 3OXSA 3NCEB 3FO1B 3DETC 4MMXC 1JGUH 1X5JA 3FN9A 5FA4A 4MQXD 3HZVA 3AAZB 1DDHA 2XY1A 2DQDH 1UWEL 4HPYL 3B4NA 1ZK9A 1MFAH 4OIBA 3J8F7 3AMLA 1OW0C 3GMPB 4JM2C 5CLWA 1KEGL 4LAJH 1WFUA 1OT2A 3VWJA 3OF6D 3VD4A 4NQSB 3JBG7 5IP4A 3VXQB 4I3RL 4YHMH 2CUMA 2KPNA 2B4CH 1T5WB 5J11C 5MEND 5EBMB 5CD5D 5T5FL 3WLBB 3DBXB 2W0KA 3VFRB 2C1PA 3N1FC 2BNRA 2NW2A 1NEUA 4HT1H 4TSCL 3TV3L 1JF6A 5JW3L 3OQ3B 3MLWL 3ULUE 3IFOB 4G8FB 5C70A 5IB3A 3OKOA 4PRBA 2AABL 4DAGH 1S5IL 3EZ8A 3RRQA 1YMME 4L4TA 5IB4A 3GO1H 1NLDL 4I0KA 2ICWJ 1RFDH 4HIJB 1F13A 4G6KH 5J3HD 1I7ZA 1YEGH 2R0LL 1NEZA 1FJ1A 1K6QL 4K7PY 4Q2ZB 4UU9B 5DA0B 5D2NE 5MEOB 3QNZB 3ARED 2NY6C 2CLRB 2JK5A 2F54E 4JZOA 5E99L 1FIEA 2CDGB 5TDPA 1E4WL 4L8CA 1CS6A 4KK8D 3BE1H 2LU4A 3TPKA 1QR1B 1UA6H 4ZFZA 3S4SA 3OR6B 1CGSH 3I75A 3JTTA 3TNNA 4KHXL 5IEKA 2ADFH 2DWDA 3ILPB 4F7PB 1BHGA 4Z7UB 4HV8B 1R5IB 3FONB 4GMTL 1I1RA 4XZUA 5T3ZL 3TBYB 1ADQA 5D7SH 1GGYA 3LKRA 5DURB 2E6PA 3FAXA 3IT8D 1MEXH 3CSBA 1S9XB 5LCVL 1PLGH 4EVNA 4E5XA 4LF3B 3NA4A 4N0UE 4WGVB 3MXVH 5IWLA 4WI4A 2FX8L 4PGDB 5FKAA 5MEQB 3BH8B 2AK1L 5FYLE 2OK0L 4RAUB 3GMNA 3ROLB 1TJHH 5IVZA 3K74B 1P2CB 4HKZB 5FDYA 5FM8A 2WLZA 3RDTB 2NY0D 4NKQB 2FJFA 3MLVL 4GQ9H 2HJKA 3X3GL 2B2XL 1F4XL 4OF7A 4P5TB 5FOBB 1TTUA 3N0PB 4LLYB 1R24A 1D5BB 1KCVL 5FV2A 5JORB 3HG1A 4U7SA 3DRTA 1J8HA 3F5WB 3FFCD 4GFTB 4MXQD 2VZ1A 1N3NB 1Z6JT 4GOSA 1W8OA 4LVHB 1NH6A 3B2UC 5B39A 1GZQA 4LPVA 5F9OH 1AXTL 4F2MA 3QG6B 1MCBA 3VMPA 2E5EA 2VH5L 4NRXB 5E6IC 4H1LG 2IGFL 1MJ8L 3VWKB 5KJRH 1KIQB 4Q6IA 3HR5B 3DV4B 1S9YA 4QRQA 2J5LC 2L7UA 3VMNA 4M7ZB 1CGXA 1GHFL 4FXKB 4ZOEA 5ANME 2BVEA 3OZ9L 1H9VA 3QZWG 4Y2DC 5F8QC 4JM2A 1WEJH 2PW1A 3EOBA 1PX3A 3DXAD 4IBLT 5HYQB 1KN2H 1JTTA 2EDKA 1OTTC 5KVDL 3JWDL 5HTSA 4L9LB 4Q9CA 3QCVH 4JDZB 3RU8L 2VITB 4MA3B 4XP4H 5EUOF 5E08L 3MODH 4ODBD 2QQQA 4QHMA 3I50L 4OCWL 5L2KA 3HUJE 4CVUA 1JMZA 1LO5A 4XPBH 1YJDC 5CCKL 4I13B 2MPAL 1JRHL 3G9AB 2W0FA 4KRLB 3CAFA 2E8YA 5HYJA 5C08B 3GSUA 2HVKA 1WBYB 4N0YL 4GQPH 1BAFH 1A5FH 3SGKA 2HTKC 4W81A 3TGXA 4X99B 5CSBA 1EIBA 3GFUA 5IFAL 2YPLB 1NCTA 4HPOL 1CFNA 1E27B 3WS3B 3KLHC 5FHAL 1C5DA 4WUUE 3GNMH 5IW1B 1W2KT 1V3MA 4FNLL 2FX7L 3RHWK 1R6VA 2NX5D 3KXFD 5CP7B 3L6FB 4OLUL 4KTEL 2W9DH 2JLLA 3U46A 3MJ9L 1CG9A 3FN3A 4CW1A 2DTML 1LEIA 1WWWX 3C5SA 3WMSA 5DMIL 5MEPB 2D7NA 2XZCH 1LO0H 3FO2B 2P5EB 5ID1B 2B1HL 1ZE3C 3VFUA 1BZ9A 3QQ3A 1X5AA 1IM9A 4JJ5A 4WFHD 5BW7C 1WAAA 1I9RL 1XZ0A 3KPSB 4QOKB 4O2CB 4I18A 3L3OA 2P49B 3UJJL 3D39D 4G6ML 5C92A 5KOVC 4C4KT 4NM4L 3C60B 1MELA 1T1YA 1YN7A 5I9QC 3NTCH 1NDMB 3WS6C 2LE9A 4JY4A 4IS6A 1JMXA 1Z0NA 3GIVA 5DJ0B 1LP9E 4BQ6A 2CIIA 1G6RH 1I3GH 5ISZB 4AG4H 2DJSA 2FB4L 4OQ1A 1IAKB 3ZYIA 3W82A 3BPNB 3M1BB 2P4AB 1BZ7B 3REWB 4G8GB 4GRMB 1F4YH 1S7SB 1SY6L 2ZCHH 3ARSA 3H9ZA 3RFZC 1DQJB 1RK0A 4NIKB 4M7KH 2PYEA 2XQYG 4NN6C 5FK9B 1CICD 3MRBB 2BVOB 1CIDA 5E00A 3MR9B 2Q87A 4M5ZL 4NO3A 4YDVB 1UEMA 1LDSA 5E4EB 2R23B 1B9ZA 4PJ5D 2I9TB 2GJ6E 4Y16C 1MHCB 5ITBH 5TF0A 1T66D 4KMTH 3MBEA 3W81A 5GRZA 2A9NL 1NGPL 1FL6A 3RIFK 3KPLA 4KKNA 1HN1A 4R4FH 2FZ3A 1QQDA 2FD6H 4OD2A 1RZJL 3UTZA 4F15B 5AWNL 3MV8B 2ZPKH 4RA3A 5CP3A 4DCQB 1RJZB 2D4FA 1OTUC 1R3KA 1SJHB 3IKCA 4XVUC 3KPPB 1EGJA 3TVMC 2XN9A 4FQPA 1YDPA 4CMMB 3D25A 1MIEH 3O6FB 2YD5A 3HLAA 5E2VL 1KEMH 1HWHB 1JWSA 5D71H 5EOCJ 3C08L 1ZA6B 4ZFGL 2DQCH 4MD0B 3LPWA 4IOIB 1DN0B 4CVXB 5EULV 1IFHL 3MV01 5CEZE 1ACZA 4TYUA 2EDRA 5EIIB 4LSDA 1F6LL 1S78D 4J6RL 5L6YH 2O5YH 5HHOA 1AGEA 2PXYD 3MV9A 1NUGA 3L3HB 3TNMB 4PJXF 5C0BE 3BSZL 4JKMA 5DMJB 1BM3H 1TPXB 2X1WL 2B0SH 3FQNB 3PP4H 3UYPA 1XF4A 4ISVB 5FO9A 5GS1C 3RVTC 3QWRA 1I85A 3UTSA 3X12A 3MRGA 4KVCL 1U8LA 4R90H 1O7SA 1EEYA 1TZIB 3U2SA 1X5ZA 2DLFH 4NP4H 4NRZA 3WL9A 5ITFB 5CSZA 1FYTA 3VGAB 1F5WA 4M03A 1QD0A 1RPQA 5KSVA 3WDIA 2D7MA 4DKEH 3STZB 1UCBL 3RUGA 2PW2A 3TH3T 3QDMB 4P2RB 4XRCA 5DC9B 5J1AA 2GAZB 4C59B 1F42A 4NZJA 4R6UA 1N5YH 2I26N 5L9DH 3I3BA 2VRAA 1UWGL 5ID0A 3U1SL 2EDLA 4UOJA 4HUNB 2VDPH 4L29B 4R7NA 4U1HA 3P0GB 1FLTX 2UWEA 2AI0L 2VKXA 4OZFA 1EVTC 4NZRL 3IFPB 1JGVH 5JDJA 4R9HA 3TIDA 4TVPE 5I1DB 3WFDH 1ITCA 4FHBD 2WK2A 3SDCB 1G9EA 1CVRA 2ZKHH 4PUBL 5DT1H 3QCTL 3WS6A 1J9CT 4A6YL 2FL5A 4ZXBC 4GG6E 1SYSB 2EXWC 1Z2KA 4M7JL 3TBWB 1UM6H 4CVZA 3ORJA 4JE4B 4YK4B 1S7XA 4ZS7L 3FZUC 2DQIH 4ZFOL 1F6AA 3LRHA 4DW2L 2QTEA 2N7AA 1FNHA 1NGQL 4IRSB 1D3CA 1K4DB 4OZHA 1IEBB 4CDGC 1A6PA 1ZT1A 4N90D 2APBA 3LRSB 3BKMH 1S7WB 3GBNH 3D5OF 4Y4FA 3MRQA 2J6EH 2EDQA 3MV7D 4YDKL 2EH7H 1NJ9B 1NKOA 1SBSL 4EUPH 1K4CB 1ZWIB 2L7JA 4M6AA 3TA3C 3O6LL 4O58H 1CR9L 1MRCL 2WBKA 3MGTA 1JGDA 1TMCB 3DARA 3QEQD 4Z95H 4PV9B 1S3KL 1ZGLP 4NUJB 1FFPB 5DHVA 1ZHKB 1MLBA 1LD9A 4WHYG 4PJ7E 2HH0H 3D2UA 5CBEA 1J86A 3AMKA 3QZWA 35C8L 15C8L 2GTWB 1N6UA 3BPLC 2Q8BH 3WN5A 1FNEB 3SY0A 7FABH 1QSFE 1OGAD 4OIAA 1JNLL 3IDMB 3O4LB 2DDQL 4WEBL 1EHLL 5BS0D 4GSDL 3EJJX 4LHUG 3SDXA 3ZYJA 2X2YA 1DBAL 3CCHB 3D48R 4M9PA 3FFDA 4Z77B 2EE6A 1TCRA 3QUYC 4WWKC 2QADB 5I18L 2P48B 5AUMA 4F3FB 4OCSH 5T3ZE 2QJDA 5D93C 4MAUL 5FCUL 1LO4H 1IZKA 3R8QA 4MDIA 3U4EB 3VXRE 4FFZL 4XNYH 4JDVA 4ODVH 2YD4A 4P46C 3G5XA 3KPNA 4BQBA 1NLBH 1KJMB 1JFQL 3MQIA 2Z35A 2C7UB 3E6HA 3UJIH 2YN3A 2QHLA 2M26A 1DE4B 5E6ID 3IJHB 5EPMB 4K8RC 4WI5A 1MSPA 3DVNB 4U6VL 2DQFB 3W2DH 4HQQL 4GAYB 5F70A 4YNYA 1OTSD 1M7XA 1C16B 5D1XB 3MXWL 4Z0XB 4XNUH 4Y5XC 5C0RL 2FHBA 3C5ZB 3PL6A 2PO6C 2ICEA 4HZAA 3U0PA 4PGCA 1OTTD 5LJYH 1MFCL 2UZIL 5I1HH 5GGTH 4QTIL 4M6ML 2E7LC 1NL0H 5A2JH 3RL1B 4HW6A 5E8OB 3ZTJG 1QKZH 4LBEB 3V2AR 1JTPA 2JJSC 9CGTA 2APWA 4ODWA 3MCLL 3GEWB 3FRUA 3GMRB 3BZEB 3P11H 4HK0A 5IHZA 1H0DA 3GSQA 5F44A 5D1QB 4R8WL 5DJCB 5E03A 4LQFL 4QRTB 3O2WH 5DDHB 1OHQA 1AXSB 3ROOA 4JPKH 1AR1D 1UM4H 4ZXBA 3QXVA 1UYWL 2V5TA 4PRHB 1CGYA 2R4SL 4IJ3B 3HS0A 1VCAA 5J12C 5EU6D 4JFPA 4TUOB 4UIKL 3JVGA 1J5OL 1P4LA 4UT6L 2A73B 2ITDA 2YC1A 2P8PA 3S35X 3ZT7A 5GS0L 3IU3A 1NAMH 1K5NB 4PJ8A 4M43H 5C0GB 1OPGL 1Q9WA 4PGEA 1RD6A 4I9WE 4OQTA 4P3DB 1Y6MR 1XGQB 3JWNC 5I2IB 3HZKB 5J7CC 1U8NA 3EJZC 3OSKA 1SEBA 5F7DA 3MO1A 2OP4H 1UADC 2L0DA 4PJFA 1J1PL 1KIPB 3WV0A 1BQUA 2X1PA 3FMGH 3MROB 4HH9B 2PUQT 3AY4C 4RFOL 3FB8B 5D7JB 2ZUUA 3FOLA 1ADQL 1F3JA 5IOPB 4HG4K 1DSFL 1ORSB 1XR8A 3SDAD 4CL7A 3L3KA 1IGFH 4QRRB 1JYWA 1A7RL 1NUFA 1XFPA 3OAUL 3EYQC 2Y06H 1YPZE 3ULVC 3IU4H 2OZ4A 3U4BH 4OZIE 5EG6C 3TWCL 4ONGH 3EJYC 4K23H 3KPMA 1VKXA 1I8KA 2BRRH 1YYLH 1T6VN 4OLYL 5KVGH 2BK8A 5CUSL 3WFEL 1MHPL 1J0JA 2QR0A 3MRCB 4H20H 5D6DA 4PG2C 3NABL 5F96H 5C6WH 2X09A 4Y4KD 5EBLB 2ZCLL 5JDSB 3MRKB 1NPUA 4JQXC 4EN3C 3K8MA 3O3AB 2P7TA 5EUKA 4YFLI 2VISB 5DD5L 2AERT 2VQ1A 2WBJB 5CEYA 1ND0A 3R06A 4DKFH 5L2JB 3OJDA 4PLOB 4HS6B 1MAKA 4G6FD 3NCYS 2FECI 3RNQA 5I19L 3HC3L 3UZVB 4P46A 1B6DA 1IGJB 4P23C 4QHNB 1JZ3A 5GGRB 3V95A 3GIZL 1ZA3B 3BHBB 1OD7A 1M7IA 3L7EB 4ZO7A 5IBUB 3GSOA 1UZ6E 4WEMB 1KJVA 5FB8A 4PJGB 1CDYA 3BP7B 1R5VA 4C83A 5JUEH 4PRPE 5IK3B 1RZKH 4H25A 1T1WA 1O7VA 2JCCB 4XVUD 3GGWB 3X3FH 4U3HA 3TVMD 4FQCH 1KB5A 4PB9L 1ZLUH 1YEFL 2Z91A 3BZFB 4G43A 3T8XB 1G0YR 5TE6L 4Y5XA 2AEWA 2ZUXA 1JCKA 1MH5A 4PR5B 3QSKB 2AKRB 3UTQB 5TJWK 2DI8A 1F3DJ 5FGSA 2BOBB 3FQRB 4WFGE 3W0WB 2IMNA 2F5BH 2E7LA 1WVZA 4JFEE 2HFGH 3DSFL 4MD4A 4DVBA 3TP4A 2JJSA 1W0VB 3WO3B 2X4UB 1L7TL 5D7IB 4PJIF 2VKWA 3QO0B 2UV3A 5IM7A 3B9EA 5LQBH 2YPVL 1ZLUK 3QHFL 4NN7B 1TZGH 1UXSB 1IGMH 1F90L 5D6CA 4KI5C 3WIHA 1CFSA 4HKXA 2E9JA 1WCBB 2X4OA 2VAAB 3L1OL 3L3IB 4U1SB 5FF6B 1D6VL 2XT1B 1ZHLA 4PTUA 4NQEA 4D9LL 3S35H 2EDXA 5SX5H 1J1XH 1GOHA 3T2OA 5J6GA 2UYLA 2R2HA 4M8QA 4WW1B 1Q9LA 4OZGF 4S1RH 3L95A 1T03L 4ONOA 4L8SB 4RAHA 4JQVA 4ZAKD 4X9HA 1EZVY 5CBAA 3QH3B 1UEYA 3BEWA 4AEIH 1MQKL 3L5HA 1JF1A 3Q3GB 1T6WA 3ELAT 5C0AD 4JN2A 2YBRB 4ETQB 1OP3H 2VN4A 3WCYA 4YHIB 3ESUF 2Z8SA 3LN5A 1GGUA 43C9B 2RJMA 3GM8A 1M4KA 4OLVH 2CUIA 3T0AA 3E2HC 3VD3A 3NIGF 3UTTD 1MRFL 3LY6A 4C56A 2ARWA 1CXFA 3FL7A 5M94B 3RGVB 4FMKA 1YECL 3QIBC 1K2DA 2J3SA 1EJOL 4BKLA 2YD7A 4N9GB 2EDDA 4I0PD 3D69B 2BNQD 1OP3K 5EUOA 4LHUA 3PWJA 3KPOA 4MCYB 2VJXA 3RI5F 1A22B 4PRIB 5C07D 3IJSB 3U36A 4FQ1L 3BW9B 3DUSB 2IH1B 1XT5A 3FT2A 5GGSA 3ES6B 2G5BA 2VC2L 5I75B 2GHWB 3E3QC 3HI1A 4GAJH 1FIGL 4ESKA 3PIQB 2HMIC 4J3OC 4WI7A 3CVHB 4MWFB 3LS5H 4BZYA 4LSTH 2LV4A 4K3GA 4KROC 4XBEL 5KAQF 3TA3D 1HSAB 1N59A 2OTWB 3CU7A 5EC1B 3QUMA 2Y6SC 2AK4E 5J13C 2VDQH 2ESVA 3T4AA 3PQYD 3EDKA 4JPWL 3EDEA 4ODSH 2DI9A 5IIEB 1BPVA 4GKZA 5DA4A 5D2LF 3P30L 1N8ZB 3P4NA 3BKCH 5J6HB 1PJ9A 3PNWA 1U8OB 3L5IA 1XR9B 2HYMA 4URTB 3GB7B 1Z9OA 4GRLC 2LTQB 3OKDB 3BGFC 1I7TA 4J8RB 4M4PA 3SHSA 1N64L 4KJWD 2JJTA 1JWUB 1OY3B 3CD4A 1IKFL 3LKSA 4ZOAA 4TSBH 3L3GB 4U1LA 1B4RA 4QTHB 3GRWH 3VFVA 4JFXA 1BQHG 1MCJA 3N85H 4NKDA 4J2XA 4WWKD 5FM5O 1OAXH 3MJ8B 5J9PB 3N1MC 4PTTA 2BHUA 3TO2A 1NGYB 3FT3A 5T33L 1T83C 1U8PB 1FL3B 4QXWA 1VENA 1HHIA 1F11B 1YJDL 4FN0A 1XF2B 5INDA 1DANT 2KDGA 3HAEB 4NCC1 5E9DA 3GDBA 4WIQA 3PWPA 4U0QB 1NDGB 4F7MA 1L0XA 1RIUL 1BJ1J 1IC1A 3VRLF 1S5HB 1ZHBB 4YR6A 3C6LC 2P46B 1VPOL 3MMEB 3QIUB 2ADIB 4JY6B 4M7LL 4OFIA 3SGEH 3QDGB 3ABZA 3SKJL 1DBJL 3HN3A 1SEQH 4PJHB 4WRLA 1PSKH 3QQ9C 1RVFL 5K9JL 5FO7B 2VLKA 3FN0H 4KGLA 4MB4A 2ITCB 3QQ4A 5JOEA 2DLEA 2VWEE 3NA9L 1M7DA 2Z31C 5SV4A 1CFQB 4Y19A 4WNQA 3LSOA 1FCCA 3SGJA 2PO6D 3DX7A 4HBCH 1IAIH 4HGWB 2VLLB 3EKCA 1FNSH 4JHAL 4RMWA 3SKNB 4GW5A 3OKMA 1PW3A 2EEDA 2DOCA 2A9MH 5I1GH 3A6BL 1YNTA 4PV8A 3L3DA 4OIIH 3VI4F 5T1DL 1CE6A 4NQCE 3S34L 5JNYA 1ONQA 1MRDL 2EIZB 2FBJL 2OJEB 3DROA 4E41A 2NXYB 5A3ID 3QIBA 4Z7UF 4ONHA 5BVPL 3MRJA 1UJ3C 3VD5A 2BOCA 3WHXA 4JREB 4XPGL 4BZ1L 3QJFA 4UT9H 2NX5E 1EBPA 3O6ML 4XBGB 1VGEL 3KXFE 3QA3A 4HPYH 2XWBB 4FP8L 4ALAL 1QP1A 1MLCA 4KQ3H 1G7IA 5IW6A 3QCUL 4M6NL 1QUNA 4R26H 5DF0A 2Q86A 3T0EB 4PJXA 1QRNB 1R0AH 5SWQA 4R4ND 3P77A 3X17A 4I3RH 3KNBB 2WUBL 3P2TA 4PB0L 3CDGA 5IMMB 4XVTH 2B4CC 3D39E 1QRKA 5DD0L 1GOFA 2F58L 3MUGB 1DUZB 4EEEA 1DANU 1PGRB 4YXHH 4L4TE 1MCWW 4YPJA 1JPTH 1I9JH 3BD5A 2OQJA 4MJIA 3ULVD 2EDNA 3MCG1 4LLUA 3KYOB 3QUXB 4TULH 1T3FB 1A14H 2R0LH 3CSYA 4N8VB 3KPRB 3MTRA 3B9DA 3TIEB 4JFFA 1YMHA 4UZGA 4WCYH 3MNVB 1V8HA 3K46A 1KELL 2X4NB 4EN3D 4M6OL 4PJ5E 1RULH 5I1KL 2V2TB 2C3VA 4XWOC 1MFEL 1A6ZB 3UDWC 4OFKA 4Y1AB 4YHLL 1JHKH 5I8CB 4B5EA 2KUTA 3QXDB 1BD2B 3L3JB 1ERNA 3S3SA 2BSSB 1I1FA 3INUL 4J3UA 4I77L 3O2DH 4P23D 4UQ2A 1HEZA 4WV1B 1ES0B 1W0WA 2VDML 3C6LA 5I1EH 3LKQA 3VXOB 4Z0BH 3V5DA 1FVDA 5LCVH 1CD9B 2CUHA 2H32H 3KJ4C 2NPLX 4KPHH 4L3EB 1QTYT 5KSBF 1HOCA 1U6AH 2WQ8A 4FOMA 3P0VH 3Q5OA 2AK1H 4LFHD 4ORGA 3TEUA 2CRMA 2R0ZL 2P8LB 2D3VA 3BESR 4X6BA 1UJTA 2G2RB 3H3PL 5A16B 4LPCA 3WUWG 3IETB 4ZNEE 1H5BB 4EQ3A 2ZSWB 4APQD 5FOJA 1SMAA 4JO1H 4DGVH 3P4OA 3QXAA 2B2XH 5ESQB 1C8PA 4RMVA 4LAQH 3EO9L 5DJXA 1V7MH 1DUYA 3GJFH 5EA0H 1GZPA 4PJBB 1H3PH 1U3HC 5E7FA 5FM5M 4OD1L 5EWIH 2H9GA 3RWEB 3SE9H 4NOBA 3IAGC 2MCPL 3H42H 4LGPB 1K3IA 1P1ZA 1QHOA 2DQUH 5FYKD 1AH1A 1ZS8B 1LDPL 4JRXD 2VABB 3MLSH 1PZ5A 5KS9E 3RTQC 2BHYA 1FRGH 2BCKA 1AGFA 1L9MA 2W07A 3U82B 2ICWB 2VH5H 4LLWB 4YFLF 3TO4B 2IBZX 4NDMB 4HMDA 3J7HA 4J4PC 4HFUH 3GJFK 4YXLH 3S96B 1B4JL 5BVJB 2R29L 1FL5B 2FGZA 2UVFA 5I1IH 2X4RA 2AEPL 1ZSDB 1TQCC 2I25N 1TVDA 1DDHB 3H9YA 1DL7H 1CF8L 3IDYB 5EZLB 3IDJA 4OQTL 2OMBA 4AEHL 5C3LD 1U93A 1JPGB 5F3HB 3A67L 3IAPA 3ZKMD 4WUKH 5IBLC 4ZYKB 1S7VB 2PYFA 4OF5A 3VXSB 4GRWE 5T5NF 5JQHC 1QLRB 2L4OA 3P9MA 1EO7A 4RGNC 1YEKL 4HIEA 2FHFA 1FVEB 1H8OA 3FQXA 5CGYD 3ULSA 2VNCA 1F97A 2YD3A 2OZ4L 2EZ0D 3GBML 1FAKT 5L0QC 3X14A 3B5HA 3TBVA 2E7CA 3EOTL 3VH8G 2NCMA 4HJJH 2X89A 5I74B 4AY0A 3OBAA 2CGRH 4N90E 3ZHKA 1AQKL 1XGTA 1CDBA 4DN3L 5C0CA 3ARFC 3MV7E 3CVHH 4OLUH 4JFYA 4NKMB 1YQ2A 5H94B 5DMIH 5E8NA 3V4PH 3T1FB 3WFBL 2D03H 1E6OL 4YHOH 2B1HH 3VXUD 3VGHA 4JO3L 4LCCB 3CPLA 2X1OA 2X44D 1WAAE 4ODUA 5BMFH 5JIPA 2NZ9C 3KPQB 3HPLB 3QEQE 4XPHL 4JFQB 3RZWA 5FYJL 4H5SA 1A2YB 4JRYA 2Y6SD 1JZ7A 3DUHA 3U30B 5IEKB 4QXTB 1G7JA 1MFDL 4TOYH 1DBML 1CLCA 4G9FB 4ZTOH 5GSVA 1MVUA 1EDQA 3QRGL 4WHCA 2OM5A 4N9OB 3RWFA 1JN6A 5HI4C 2EDFA 2IAMD 1OGAE 3S5LB 1YNLH 3BEVB 3BYYA 4TQEH 1JZ2A 4X5WA 1I1AA 1NC4D 3MLRL 5B38B 5T3XL 4K8RL 2EICA 3GK8H 5IT2H 5ESVB 2EXYC 1ODAA 5BS0E 4GRLD 3ME0A 3ZTNH 2CLZB 3ARBC 3O45A 2P5WD 3PV6A 5HI5D 2IWGA 4OF0A 2E9WA 2Y5TB 4MAYB 2HLFC 4L3CB 5EFIA 2FEEI 1P7QD 2R1YA 2DM4A 4OGZA 1T7XA 4YBLB 5HSFA 2IFFH 2DQJH 4FQXA 3VFPA 3S36X 4XCYB 3VGBA 2ZCKH 1U3HA 4OV6F 3UMTA 3GMQB 3HAEH 1D6EB 1YMMB 1CK0L 1NC2D 1BWWA 1HINH 4X7CC 3HE7B 4DKAA 4TUKL 5ERWA 3DRTB 4NC2B 1EK3A 5DUPL 5I1LA 2R2CA 5F6IB 1IBGL 1AIFA 1NGPH 4X6CA 4EUPG 2NNAB 3RTQA 4IRJC 1A6AA 4WO4B 4XNMA 1U0QA 2A1WH 2ZG1A 4WFFE 4TNWF 3VI3E 4Z7WF 5LXGL 2W59A 2E9BA 3OPZH 3L9RA 4J4PA 3DO7A 2WSKA 1QPXA 3FTGB 4X6DE 43CAB 4G8EB 2IJ0C 5I8OL 3B3IA 2RCSH 5GJTH 1EMTH 3N50A 4OJFH 1FGNH 2HJLA 3QQ9D 1TVBB 4QRQB 5JW4M 4JM4H 4F57H 5DS8A 2F8XC 2Z31D 2LVEA 2Z8WC 3IFLL 1CL7I 4OUUA 5H8DA 2UVEA 4BH8A 3DUUB 4PD4K 4ZS6C 2CDFB 5HHVL 3CFEA 3OXRB 4XCFL 1UVQA 4RGMB 5DC4B 3B43A 3BQUD 3WLWC 5E8EB 2P47B 2R1XB 3VXMA 2COQA 2HRPH 4OAWB 3U9UA 1KCSH 1VACA 4KTYA 2H26A 3ZE0E 2OSLA 4NO5B 5EBWA 4Z7QF 3PWUA 1HILA 4LSSH 4HJGB 4KGJA 4NN5B 5D7LA 1WBZA 4JY5L 1UM5L 1RUPL 5EU6E 3UTSE 1LO3L 1VFOA 5CINL 5DWUH 1GPOL 2IALA 3DTXB 1IGIL 1A8JH 3G9VA 5GGVH 5DMKA 3BAEL 5HYJB 1S9KC 3ZL4L 4ZUVB 1FYTE 3MLUL 5F88A 3HPJA 2E6QA 3SDYL 3QFJD 4H88H 4K3DH 3RUGE 2I07B 3LQAH 4PJIA 3ARFA 3KGRA 3SGDH 4I48A 2XKUA 4HIXH 4LSVL 4OKDA 5I73B 1U9KA 3MA9L 1DBKH 2X42A 5KVEL 2ADJA 1EAJA 1NMBL 1Q0YL 1GSMA 4ZUTB 5JMRA 3OHXA 1AFVL 1ZVYA 3QUML 4QRPD 4CBPA 5SWZD 4LCIL 3CX2A 4NBYB 4PLKC 4ONFH 4S1SH 4OZGA 4Z5RB 3VFUB 1B0RB 3VFGH 4KJPD 3WHE0 4OGXH 4ZUUB 3UC0H 2B20A 2H45A 1OAQL 4MNGB 3BIKB 5TF1L 3L3OB 2XY2A 4NSKA 1CGUA 2OXHA 2Z93A 4U1JB 4JFZL 3JV4A 5I8EA 1F00I 1ETZA 3CK0L 4OZHE 2DMCA 3ARXA 3V4VH 3QNYB 1MFBL 3PGCB 3ZKQD 4FZEL 1YUHA 4IS6B 3GIVB 4RMRA 4PY7A 1CFVL 4K9EH 3S36H 1FE8L 2XFXA 3PWVB 5D1ZC 4GXVL 4F7TA 4FXGB 4F37F 1XGUA 2QQNH 3DV6A 4D9RD 3QDJA 1FZJA 4UB0L 4NC1C 4YDKH 3CFKB 2EYRB 3WEXB 1SBSH 1FDLL 1FG9C 5EU5A 3V6ZB 2J88H 1T21A 5BXFA 3B2VL 5SWSA 5JHDA 3CFJA 4KJQD 1VFAA 3W39A 2WWKT 2X4PB 3P4LA 4R97B 1KTLB 1KCUL 2GCYB 4JCLA 2XQBL 3JV6B 1I8IA 4WUUB 1PG7X 3CXHJ 2P8MA 3MNZA 3PDGA 4I2XB 4QRUA 2OMNA 5AG9A 1A0QL 1S9WB 4NHUB 5HDQH 3HNVH 3N06B 1CBVL 1H3WM 5BV7B 1HH6B 3RNKB 4W4OA 3MREA 2FZ3B 2MKLC 1YY8A 4UIMA 4XX1G 2Q1EA 3UTZB 2V7HA 3SKUD 1NUDA 1YN6B 5KSUB 2A2QT 4LCWD 4YPGB 5JPNA 4B50A 1EHLH 2X9YA 3MUHL 3O3DA 1QFUH 3R1GH 1AD9B 2XN9B 4P5TC 4RQQA 2A6KB 5IMKA 4QYOB 2CLVB 4X98B 4NO2A 2IPTL 5D2LA 4EZMA 3TN0D 4M5YL 4NQDD 1T89C 4LPXA 5I18H 2Q6WB 5HY9A 5JA9A 3AUVA 5GGQL 1LMKA 3NACL 3PDOB 1IT9L 4MJ5A 4Y4KA 1J88A 3ARDB 3FRPG 2PTTA 1JHTA 1RJLB 4JO2L 3BRDA 4OZ4A 1CE1L 4R4BA 5F1NA 3C6SA 1ZTXL 3SJVA 1F58H 1E4XI 4EI5A 4L4VD 2R2BA 3VH8A 2APXA 5MERA 1P5UA 4JEGB 2I60L 3VWKC 4CU7A 3FO1A 2R0WL 3OX8B 3HB3C 4DK6A 4DFHA 4MCZB 1KN4L 4M7ZC 1FH5L 5FO9B 1MCLA 2DYPD 3ZYOA 2NW3B 4BM7A 1U8LB 2MWCA 2BMKB 1EHAA 4Q9QL 2GJ6B 4NQSA 4TVSa 3VGDA 5C0AE 1KC5L 1IGTB 3VXQA 1DQML 3F7YB 4MZ3A 1T5WA 1MFCH 3WIIH 5EBMA 3SE3A 4ZG1A 4K3HA 3WLBA 3DBXA 1F4WL 4QTIH 5JW4N 3QIWC 3VFRA 3HCVB 4KXZI 1AGBA 4XP6H 1HHGB 3RX7A 5DEFB 5FECB 2K3TA 1BQSA 4XH2B 1KV3A 5EC2B 4LMQI 3ZT5A 4KK6D 3IFOA 4G8FA 5DUBB 3MLYL 2UZXB 3BUYB 5HGDB 2ICWI 3DPBA 4JFHE 4WI6A 2Y7QB 1RUAH 3ESVF 1BFTA 4LIQH 4MDJB 4QXUH 5I0ZA 3BDBA 5GIRB 4JVPA 4HIJA 4QWWD 5IESH 3D85B 1YEIH 4ZUWA 5IR1A 5EORH 5C07E 4Q2ZA 4UU9A 3O9WC 2O61B 1J5OH 1Y6NR 4L4JA 5MI0B 2DLHA 2CLRA 5FHBH 2FJHB 2CDEB 5GRUL 4ZTPL 1P4IL 2CDGA 2FEDC 4XP5L 3ARGB 4PJGF 5ALCL 1IMHC 3OGCB 4NQVB 5EU3B 3L5XL 1QR1A 2XG4A 1EO8H 1I9IL 5C0BB 2JCCF 3OR6A 4LQ1A 1B0GB 3CLFH 3ILPA 1FORH 5ADPL 4F7PA 4Z7UA 3PQYE 1FO0B 4HV8A 1R5IA 5L88L 3FONA 1PG7H 1BQLL 3TBYA 3P3YA 2C3WA 3LEXB 3OTTA 4IMLB 2WV3A 1ADQH 2R39A 4NKIL 3BGAA 4G7YL 2XZAH 1QVOB 32C2B 4P4KB 2X9WA 3C60C 5K9QI 4KKBC 1S9XA 4LF3A 5HI4D 4NZDA 5DHYB 5MEQA 3BH8A 1RURH 4RAUA 5B8CB 3RVWC 4XBPA 5TGBB 3ROLA 1Z3GL 2DQHH 5CIPB 4HKZA 2EXYD 1JPFB 3RDTA 3CX5J 3CLEH 3BPNC 4KAQL 3TFKC 3ARBD 1GIGL 3DMMB 1SYVB 1U8HB 2HLFD 4P5TA 4PJDB 5FOBA 4LLYA 2BNQA 4GLRI 4JN1L 2IAND 1D5BA 5JORA 5HI3C 4LSQH 8FABB 5FCSH 3WNKA 3F5WA 1UG9A 4MZ2A 5FYJE 2P1YA 5GHWL 2JJWA 3U4AA 1N3NA 1EV2E 3VFOB 1HNFA 4JKPL 5CJOH 2MQCA 1XIWB 4MA8L 2YKLL 4UOW0 4Y4HB 4WI8A 3QG6A 2O5ZL 3HC4L 1RUKL 3NAAH 4NRXA 5CZVL 3VWKA 5E1HB 4H0HB 4AZ8A 1KIQA 3IJYB 3G5XB 3HR5A 4ZNCD 2CK0L 3DV4A 5HYEA 1L7IH 4MXWH 3U0TB 4TNVK 4OV5B 3EYVB 3GUTB 1V3KA 4V1DE 5F7LB 4FXKA 1D9KB 1JGUL 4W6XB 4Q74A 3V5KA 1RZKC 3T3MF 1NAKH 3GKZA 5HYQA 5C0EB 1U8KB 3NFSH 4ZQKB 4PREB 1MFAL 4L9LA 5C7XH 4JDZA 2ORBH 2VITA 4MA3A 3S6CA 3NIDF 1S7QB 1SBBA 4ZS6D 5E8PB 4YHML 3DSFH 3JTSA 4OCYH 2B4CL 3RAJH 2VXQL 5KSBA 1XF3A 4Y5YB 2YPVH 1MPAH 3N1GC 1QSFB 5C08A 4HT1L 2YD1A 5IGXH 5E2TH 1TPXC 1WZ1H 4X7EC 3HKFA 1FSKB 4X99A 2SEBB 1BF2A 1D6VH 3GSQB 2YPLA 4DUWA 1E27A 3WS3A 2R4RH 5IW1A 1RFDL 3VGAC 4AT6B 3HMWH 4S11A 3V0VB 2UY6A 1TENA 3D3VD 1YEGL 5HHQB 2AJVH 4PRDB 5KTEH 3G6AB 2WINB 5CP7A 3HZMB 3L6FA 3P4MB 2NY1D 2X7LA 3VXRB 1BOGB 3OG6B 5MEPA 1AHWB 4FQJH 3FO2A 5ID1A 2ZUTA 4WHTB 4PRNB 2P42B 3BE1L 4AQOA 4PJ8B 3PGDB 1Q9WB 4MGXA 5CZKA 5KZCB 1UA6L 2EE3A 3SN6N 1CGSL 3SEPA 3KPSA 2AGJH 3ARWA 4JZJB 4QOKA 1Z5LB 4O2CA 2ADFL 5TQ2H 5JHLH 3N1QC 3ULVE 4PLKD 4YGAB 3SDCC 1G7QB 3NCCB 5D7SL 3C60A 2YD9A 5F1IB 1IE5A 2HKHH 3MRRB 1A6WH 1NDMA 3L3KB 3BFOA 4KK9C 5DJ0A 4RCAA 4LRNL 1XMWA 2NR6C 5TE4H 5ISZA 4YK4C 1MEXL 1PLGL 2W92A 3BOVA 4P99A 4N0CC 2EDJA 3MXVL 1IAKA 5EO9B 5EOCH 1OP5K 3HE6D 3M1BA 1BZ7A 3LS4H 4IRSC 4G8GA 3REWA 4GRMA 3QWQB 1S7SA 2CRIA 4P5MB 4FTVD 1MJJB 4PP1D 5D1ZD 4F7CB 5FK9A 3VGGA 3MRBA 2BVOA 4XXDB 3MR9A 3D6GA 4YDVA 1KTDA 4GQ9L 2R23A 5IHBA 1AKJB 1UB5B 2I9TA 3ARVA 2HFFB 1MHCA 2X6MA 1RZGB 4UT7H 3WIFB 2GTZA 5CEXB 5DO2D 4R0LB 2OBGA 1EHNA 2GIYA 4OLXH 4KUZH 3VCLB 2NTFB 3DX9B 4MJ6B 1OM3H 5BV7H 3MV8A 4IIQC 4DCQA 5F9OL 1RJZA 5C0IB 4OSUH 4EIGB 4Z7OE 1SJHA 1QNZH 5CP3H 3KPPA 3BO8B 4PJAE 4JGMA 1DVFD 1F6FB 2EYTB 1IC7L 3FJTA 4LCYB 5KJRL 3VFSB 4CMMA 1EGJH 3O6FA 1KJVB 3I6GA 3FQUB 4G6AC 4UTBL 4AIZB 3TC9A 3LDBB 3G5VB 4D9QE 4H25B 1LO2H 4LSRL 3DO3A 4MD0A 3TZVB 3CMGA 4IOIA 1DN0A 4CVXA 5I71B 4NQUA 1WEJL 4XAKD 2QADC 1KN2L 5J1TC 3QCVL 3BI9X 4XP4L 4OZIB 2EYSB 5FYKE 3IRZA 1MCHA 3MODL 5B3NA 3L3HA 4JRXE 3TNMA 4KI5E 1MAJA 5CJQH 4FG6D 4S1QH 5IEHB 5DZNA 4XPBL 5GJSH 5T1LB 4P2CG 1RIUH 3FQNA 4YGVB 4ISVA 1IGCH 3SDDC 2ZUYA 4PGBB 1MI5D 4HKXB 1BAFL 1TZIA 1A5FL 5IBUG 1J1OH 5F9WC 1XH3B 2VLKE 3H9SB 3CIQA 3STZA 4QLRA 4BUHA 2PETA 4OLZH 1EERB 2VLJD 3GNML 2BSTB 4GS7B 3C5ZC 3QDMA 4P2RA 3REVB 1J87A 2GAZA 2DJ4A 4AQ1B 4GBXC 4QHKI 2W9DL 1HHKB 4JHAH 3QIWD 4L29A 4MNQB 2XZCL 1LO0L 3TPUB 3IFPA 4MLIA 4WTZG 4JN2B 2NY4D 4LGSB 4PYGA 2AXFA 5I1DA 5KSAC 1X5LA 2YUXA 4MLSA 2KQMA 1V3LA 2DB8A 2F15A 5D1QC 3SDCA 5F3BB 4HIIB 4OFYD 4FQHB 3UJTL 3STLB 4AL8H 3V5HB 3TBWA 2YRLA 3BJLA 3T3PF 4C56B 4RNRB 1T20B 3I6KA 3F7PC 3NTCL 5GZOD 3O9WD 2YWYA 4OCNC 3MOQA 4IRSA 1K4DA 4FP8H 1IEBA 1I3GL 2PN5A 4AG4L 3E3QE 3BXNB 2D4DA 1MY5A 3LRSA 2E6JA 2PCPB 4KFZC 1MAMH 3VXUE 3OKEB 2E7BA 3F7RA 4P2OB 2HT4C 1NJ9A 3JSSA 1K4CA 4M00A 1OAZH 3RL2B 1ZWIA 2QV2A 3H7LA 5HYSG 1FV1A 3PWNB 4PB0H 3FO0H 4WW2B 2FBOJ 3DX6B 3ILQD 2F54D 1BMGA 2CKNA 2G75B 5DJ2A 5FV1L 4FFWC 1WFOA 4PV9A 5ITBL 1MWAB 4NUJA 2WZPD 1FFPA 4LCUB 1SMOA 1MVFA 1BFOB 3WFHB 4TPRL 5HD8C 1IC5H 2RHEA 3SKOB 5DHVH 4R96B 1TCMA 2VL4A 2GTWA 5F21B 5MENB 4R4FL 1FNEA 2IQ9H 2NTSP 4YZFF 1YQVH 2BJMH 1K85A 2ZPKL 5T1KD 3RVWD 3IDMA 3GSRB 3O4LA 3DRQA 3E8UH 3V6OC 1CQKA 2LVCA 5AYQA 1MIEL 3CCHA 1JNHA 3Q6GL 1C12B 4Z77A 1ROWA 5FYLD 1F8TH 4P9MH 1KEML 4F3FA 5HI3D 5D71L 3D9AL 5CLTA 2DQCL 1IL1B 1QA9B 4LPYA 5DEGB 2WBJC 2EDYA 5I1JH 2NMSA 3VFVB 1CZ8H 5CFHA 1HZHH 3U4EA 3LD8B 3AREB 3RWJB 1KJMA 5EO1B 3D1MC 1UWXH 4N5EC 2C7UA 2O5YL 4QNPE 4PRAB 1NMCB 3SBWC 2ZJSH 4OCXH 1DE4A 4UINL 5IQ9B 5AAWA 3QPQD 1XCTB 3IJHA 4W4NA 4XHJC 3TYFB 3WO4B 3DVNA 2DQFA 3PP4L 2B0SL 4XGZB 4GAYA 3SE4A 5JTWA 3VMOA 1C16A 5D1XA 3QULB 4Z0XA 4ODXB 3VG9C 4HS3B 4YHYB 3S9DB 4R90L 1U8QB 4KRPD 4RDQF 1SM3H 2DLFL 3KHOA 3C5ZA 3P40A 2DIAA 4DKEL 1E6JL 5FXCH 1I1YB 5C0FB 3RL1A 2HN7B 5E8OA 1KENH 5D96B 4S1DC 4C54A 5JW5B 4LBEA 3RWGB 1JP5A 3LH2H 1N5YL 3GMRA 5L9DL 3BZEA 3V9FA 3BZ4B 4U49A 3DVGB 4ZFOB 3K2UH 2VDPL 4GW5B 2NY0B 3QI9C 5D1QA 5DJCA 5DQDH 4DGIH 4QRTA 5DDHA 3I84A 2HWZH 1AXSA 1JGVL 2A83B 3KS0J 3L3DB 2VYRE 4KVNL 4MXVE 1N0LA 3HAEG 1QSED 3R0MA 3WFDL 4PRHA 4I1NB 4OM0H 2MJWA 3QFJE 4TUOA 3FFCB 3PWLB 5DT1L 2A73A 1UQSB 3P0YH 4EJ1C 1K5NA 1MCPH 4CN1A 3WHXB 5C0GA 2AJUH 5BRZD 4U0RC 5TE7H 4P3DA 1KG0B 1XGQA 2AJXH 5I2IA 3HZKA 4NRYB 5JZ7D 1KIPA 4RAVB 3BKML 4XVSL 2WP3T 2X10A 4HH9A 3MROA 2Z92B 2EH7L 3FB8A 5D7JA 4KTDH 1N26A 2CSPA 5IOPA 5IVOA 4QRRA 1R3HB 3ULUF 2XQYK 4JPIB 4O58L 4ELME 1EUUA 5DK2B 4YH6A 1P84J 1YEKH 4WJ5B 4WGWB 3DXAB 1FN4B 4G9DB 3MRFB 4YHPB 3BQUA 5E2WH 3FCTB 4Z95L 3ZKXB 4TTDC 1NQBA 4YBQD 3ZDZE 3ARTA 4EXKA 4KK9D 1H3TA 4RISH 3P9LB 2HH0L 4WU7B 4OM1H 2BC4B 4X9FA 1CDJA 3MRHB 2Q8BL 5C0CE 1F3DH 3MRCA 3MJ7B 7FABL 2YMXH 4N0FB 4X0KB 3WKMH 2NXZD 4GAGL 4NYLB 4YDJB 3UBXB 5EBLA 5JDSA 1S7RB 3MRKA 2J12B 5I75C 3O3AA 1QBMH 2AEIT 1CQYA 2VISA 2HT2D 2J8UE 2J8HA 4HCRA 5IBTH 3WFBH 2WBJA 1FFQA 3RZCC 1GAFH 1J12A 1JPSH 5L2JA 5GRYA 1JI2A 4HS6A 4XPHH 4ZPTB 1G9MH 1IGJA 2CXGA 1UH2A 4QHNA 4X9GA 4HD9A 5GGRA 1LO4L 2C3HA 5JR1H 4XVJH 1FZMB 2NX5B 1XGYH 3BHBA 4JHBA 3KXFB 3L7EA 3EFFB 4ODVL 5GXBB 4GAFB 1NLBL 4PJGA 2AXGB 3BP7A 3O2DA 4EQ2A 3UJIL 4QRPA 4CJ0A 4LLQB 5IK3A 2R9HC 1XAUA 1HEZB 2OTUB 2JCCA 1J0IA 2LTQC 4LCWE 3GGWA 5I30L 4ZSOE 4OF6A 2MHAB 3BZFA 4TN9A 3T8XA 2XKNB 4TRPH 1KB5H 3W2DL 2X9XA 1EVUA 1HOCB 3RX5A 4PR5A 3BD4A 2AKRA 3UTQA 4DZBB 4KKLC 3D18B 4N8VG 2K7QA 2BOBA 3FQRA 5J56B 3W0WA 1MREH 2OI9C 4X6BB 4O00A 4QCIB 5D7KD 4XNUL 3HR6A 3TF7C 2ZNXA 5ABDE 2FR4B 4YC2B 4YHZH 4FABH 1W0VA 2X4UA 5D7IA 5GGTL 3KR3H 3QO0A 2BDNH 3QUZD 2V2XB 1NL0L 5E4IA 1RZIB 1N2RB 1UXSA 1C5BH 1GZPB 2PR4H 1QKZL 4X6CE 3SOBH 3DYMA 4J23A 5I15H 1MCSA 1WCBA 3P11L 2VAAA 3SCMD 2MCG1 1CXEA 3L3IA 3WIHH 5FF6A 1WF5A 1YEEH 3B9KC 1P1ZB 3SDDD 3LV3B 4PJ9C 3QIUC 1CICB 3O2WL 4P57B 3W11C 4JPKL 3UPRA 4HLJA 5JOPE 4XNZB 3WD5H 4WW1A 1UM4L 1AD0B 3LEYH 1JRHI 4PJ5B 4L8SA 1EXUB 1BLNB 5BCAA 2VZUA 1DLHB 3AU1A 4MD5B 4RFNB 1OQXA 3IRPX 3Q3GA 3GSXB 2YBRA 4ETQA 4M43L 2W9EH 3X13B 4GBXD 4P2QD 4ZUSB 4U6YB 3VXME 4WWID 4ENED 3O8XD 3IDJB 2OP4L 3HUJF 3OB0K 43C9A 4RGNE 2F74B 5CGMA 4ZD3H 2VDRH 3I6LD 2ENYA 2B8OT 3FMGL 5KSAD 1FAIH 2MTPA 1I7UB 4LEXH 3RGVA 2NXYC 4K2UH 1IGFL 4HUWB 4N9GA 4KK5C 5CINH 1IGIH 4TSAH 2Y06L 3D69A 1JTOA 3IU4L 1YYML 2E7HA 3VXPB 1YEDB 3C09C 4OGYH 5DRWB 3U4BL 4MCYA 5DVNA 2DLGA 3CSPA 3LB6D 4ONGL 4PRIA 4BSVB 4K23L 3IJSA 2V9TA 2PXYB 2BRRL 1W72A 1YYLL 3LN4B 4RRPG 3BW9A 3DUSA 2IH1A 1ACYH 4H8WH 3ES6A 1CGVA 5KVGL 2NY7H 3QO1B 3LQAC 4BQ8A 4H20L 3O0RL 3PIQA 4X6FA 5F96L 4LDOB 3CVHA 2ED9A 4RMTA 2NYYC 4MWFA 4UV4L 4GJTB 3VD9A 3C2AH 1NMBH 4GW1B 4GG8B 5KS9B 3FB6B 1HSAA 4PBVC 2OTWA 3BIBX 5EC1A 5ACLA 1BJ1H 3MRPB 4JLRB 1MWAH 4M3KB 5IB1B 3DHJA 3H7BB 4KHTH 4DKFL 5C09D 4HXAH 4F9PA 1QFWH 3CPLB 4P3CH 4FFWD 1N8ZA 2H8PB 3VDAA 5J6HA 2D7TH 5E5MB 1OAQH 3QEUB 1U8OA 5GSRB 1T1ZA 1KJ2B 4KWUA 3GB7A 4ZO6A 2CR6A 2HG5A 1AY1H 2Q3ZA 3OKDA 3RWFB 4J8RA 1LP9F 3OMZA 4RBPH 1INDH 1Z9MA 1OAKH 4G5ZH 3RWHB 1GGBH 4X5WB 3CDCA 4X4ME 2IANE 3X3FL 1QLEH 2VR4A 3OAZK 3L3GA 4HUXB 1CFVH 4FQCL 3PDDA 4QTHA 3BP5B 4Q9BA 4LKXB 3QDJE 1T04B 2GW5A 1DQQB 4K9EC 4PLJC 3PV6B 4UBDC 4BQ9A 1ZVSB 3MJ8A 5J9PA 5ICYB 2YEZB 3IGAB 2HTLC 3B6SB 3PHQA 1NGYA 2QQKL 1X4YA 2F5BL 2M8XA 1U8PA 3DECA 1F11A 3QDAA 4X83A 1XF2A 2HFGL 4RBPK 5CILH 1JNJA 3RY5A 1NDGA 1HH9B 1KCUH 1YZZA 1A47A 1ZHBA 2P45B 5T3ZD 4WV1C 5LQBL 5K93A 4R2GD 1C5CH 4FFVC 4AH2B 1IGML 4DGYH 1A4JB 3MMEA 3QIUA 2ADIA 3MV7B 2C26A 1A3RH 4JY6A 4XHJD 5E6ZA 4KMLB 3K81A 4HAFA 4NJ9H 1CBVH 3QDGA 4AEFA 3CSGA 5F72S 3S35L 1ZLVH 1J1XL 5BZDA 4HMCA 5FO7A 3V7MA 5B38G 2NY2D 2ITCA 5I8KH 4S1RL 1CFQA 3PXHA 3QEQB 1RIVH 2YA0A 2Q8AL 5D2LE 5CSGA 4LLDB 1X5YA 4HGWA 2VLLA 2R8SH 1OSPH 4O5LH 3OKKB 3CH8A 3G04A 4OUOA 5SX4H 4P49A 1VEOA 4AEIL 4K7PX 4S1DD 4F58H 4X5XB 2YUWA 3MYJB 3MRMB 3WYRA 1OGAB 2VAJA 4BH8B 5CKAA 2EIZA 1ZLVK 1MJUH 3SJVE 2OJEA 3MPCA 1H8NA 1LVEA 1I75A 3QI9D 1E0OB 4BA8A 5BS0B 1CE1H 4ZOCA 3U9UB 4OLVL 3IDNB 5L8LB 2Y36H 3LHPH 4RWHA 3TO4C 5HYFA 2AP2A 1HILB 1KN4H 4XBGA 5B39G 4IM8A 4YFDB 1QR4A 2XWBA 1KLUB 1H15B 3B83A 1MJ7L 2IBGA 5GGVY 3QB7C 3NZHH 4FQLL 3T0EA 2YA1A 1QRNA 1UENA 3FQWA 2FH8A 3IDYC 5GRVK 5FGBA 1LE5B 3GMLB 5B22A 3KNBA 1RSFA 5IMMA 5FIEA 3TJHD 5E6IB 4GAJL 3WNMA 3ARZA 5K9KB 5FA3B 4PP2B 3MUGA 4U1IB 1DUZA 3LS5L 2VZ3A 1PKQE 4YHNB 2VQUA 1WWCA 3EHBC 4HEME 1OCWH 4IHOB 1N7MH 2VDQL 5I6XB 3PHOA 3IDUA 1QFPA 3KG5A 3KYOA 4ODSL 1BECA 3QUXA 1I3RB 4TTDD 1H3XA 4N8VA 5I74C 3KPRA 4LPWA 4FTVE 4XWGH 5BQ7B 4RX4A 3TIEA 1T4KB 2W65B 3Q1SH 5FFLA 5GRUH 1T2XA 3MNVA 5LGHH 3JV4B 3LKPB 4NC1E 4G80B 3O41B 2X4NA 1HCFX 2V2TA 5H2BB 4TSBL 2F8OA 3IXTA 3GRWL 1A6ZA 1B2WH 5CJBA 5I17B 3N85L 5BO1L 4Y1AA 4D8PB 3RZCD 5EU6B 5I8CA 1BQLH 1OAXL 3QXDA 1BD2A 2YWZA 5FO8B 4U6XB 3L3JA 2BSSA 3U30C 4M93B 5C6PB 4POYA 5EU5B 1CDHA 2A77H 3RJDA 4G7YH 5BXFB 1C1EH 4WV1A 1ES0A 1QSVA 3VXOA 1MCQA 2GSGB 4AMKH 2F53D 4L3EA 1J0HA 2AXJA 4P4RB 4Q97A 3QAZC 5E70A 4PJCE 3UBXI 3IB4A 2G2RA 5IWLC 4AJ0A 5A16A 4NO0D 1GIGH 3IETA 3NH7H 1H5BA 3SDAB 4K94H 4FXLA 4XAKE 5DRXB 4YBLC 1PSKL 4K7PH 4PRPD 3FN0L 1F2QA 2OL3A 2VLRD 4YAQB 4PJBA 3HE6A 1U58B 4KKCC 3RWIB 3UTPD 3MRIA 3RA7H 4HBCL 2D9QB 5IG7B 1IAIL 3EYOB 4LPUA 3RWEA 4HC1H 1FNSL 2V5MA 1FVCA 2BSRB 3LIZH