3PU7A

Cu-zn tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
b'ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical Properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3pu7A00
3F7KA 1E9QA 4U4IA 4BCYA 5KBMA 1IBHA 1AZVA 3GTTA 1OZTG 3MNDA 2AQRA 2Z7YA 1EQWA 2C9UA 3QQDA 4A7SA 2AQQA 4BCZA 1JK9A 2AQSA 2LU5A 2WZ0A 2WWOA 3KBEA 1IBBA 1DSWA 2Z7UA 1XTLA 5KBKA 2C9SA 2WWNA 1PU0A 3GQFA 1XTMA 1E9PB 1KMGA 1EJ8A 2WYTA 4L05A 4A7UA 1CBJA 2JCWA 1SXCA 1QUPA 1YAIA 2ZKYA 1N19A 1SOSA 1UXMA 3ECWA 2GBVA 5CU9A 3HFFA 1S4IA 3MKGA 1E9QB 4N3TA 1CB4A 3GZQA 1FUNA 2SODB 2GBTA 1P1VA 2E47A 3KM1A 1L3NA 3KH3A 1BZOA 1DO5A 1Q0EA 2Z7WA 1IBFA 2WZ5A 3QQDB 1OAJA 3CQPA 3F7LA 4FF9A 1MFMA 4B3EA 1IBDA 1SXZA 3CE1A 3KM2A 3RE0A 1SXNA 3GTVA 1XSOA 4A7TA 2K4WA 1E9OA 3PU7A 4N3UA 2WKOA 1HL5A 1Z9NA 2WYZA 3K91A 3KH4A 2ZOWA 3CQQA 4A7GA 2VR6A 3L9EA 3S0PA 1JCVA 1RK7A 2Q2LA 1ESOA 1COBA 1TO4A 4OH2A 1IB5A 1SXBA 3HOGA 1SPDA 1N18A 1TO5A 4MCMA 1F18A 4OJAA 1OALA 1HL4A 1YSOA 1Z9PA 2WZ6A 1JK9B 1BA9A 2VR7A 1PTZA 1OZUA 1SXSA 2APSA 5KBLA 1E9PA 2NNXA 1SRDA 3SODB 1B4LA 3LTVA 2Z7ZA 1YAZA 2AQPA 1UXLA 1F1AA 1F1DA 2VR8A 3KBFA 3L9YA 3T5WA 3H2QA 2C9VA 2XJLA 1U3NA 3ECVA 2V0AA 2WKOF 1OEZW 4MCNA 3HW7A 4A7GF 4A7VA 1B4TA 1PZSA 4A7QA 2AF2A 2AQNA 1SDAB 1SDYA 3GZPA 2AQTA 1E9OB 2ZKXA 1SXAA 2E46A 1F1GA 3ECUA 2ZKWA 2AEOA 3H2PA 2R27A 2GBUA 3GZOA 4BD4A 2JLPA 2XJKA
chains in the Genus database with same CATH superfamily
3VTMA 4L8SA 4DVRL 4I9WE 4PG9A 4X6BB 2IMNA 4F2EA 3S5LA 5L4JA 4JPQA 3JWOC 4QTFA 3RZWA 2ARJQ 4YE0A 3LRSB 4BKLB 5KVEL 1H0DA 4R90H 2CK0H 3GMQB 4Q2ZB 4A1RA 1V10A 3ES6B 4I85A 4TUJB 1NPNA 3TVMB 3FT2B 1BXUA 1DVXA 3WKQA 4XN8A 5DK2B 4F33B 1FE8H 3MRPA 3PUCA 5T1KB 1MRFH 1XGZA 2WSPA 4XC3L 5D93C 4HMDA 5IMMA 1OQOA 3WL9B 4ABVA 3T0WA 5A2BA 1U8HB 5DZNA 1O6TA 1V8HA 5D7JA 5E6YA 1FJ1B 1ZGLP 4N9GB 2VQUA 4YDKL 1G6RH 5T1DL 5B3JF 2G2RA 4JPIB 2H1PL 2ZOKA 5CZKA 3IU3A 3NIDE 3U7YH 1JIBA 4ODWB 1PZBA 1WRFA 1GIGL 3HBPA 1IT9H 2JXMA 3KBPA 4HS3B 5TPWH 5GSVB 3TA3C 5DS8A 4CGUB 3IGLA 4MZRA 2ZWSA 5E2VH 5I15L 1YJDH 5DT1H 1HSAA 1EFXB 2ZYHA 4RQQB 1IAIL 1DJSA 4FLHA 4O02L 2UYLB 2F6AA 5IR1A 4NZUH 3ZTNH 1BEXA 4NRZB 5TDOB 4XMTA 1TQVA 3ECBA 3MOQA 2VDKB 1I3UA 1LP9A 2BFVH 4LF3B 3KGUA 1Z5LA 2HCZX 4GAJL 5B38B 5HI5C 1NDTA 4M8VA 5JW4Q 3THML 1FNSL 3SE8H 1PCSA 4MA1C 5CLWA 4FG0A 5T1LD 3Q6GH 5MHSD 4DEWA 3EBIA 2JMRA 3GHBL 4LT7A 4UIMA 3AG4B 3VFMB 4TV3A 4L4VD 3QEHB 4RBPK 2DIJA 3QUZD 3ILEA 5GIRB 2VXTL 1YMMD 4HISA 2Y2WA 4UZUA 3MUY1 3D18A 4BDVA 4UT6H 5TK2A 1KB9K 3BDXA 3KPRA 3BHBA 1TQWA 4KQ4H 3SCMA 2GJ6E 3MACL 4NUMA 2KZWA 4L3EA 4A6YB 5L8LB 4L9LC 2APBA 3IEAA 4Y5YC 1YUHB 4HIIA 5JORB 2BVUA 3GSUA 1GL4B 3ZHFA 1SJEB 3L9RA 2ADFL 2ZKXA 2WLLA 3WUWG 2Y7LA 4JO2L 5D2LE 1MWOA 3MU3A 3MI6A 2DMGA 3PV6A 2YD9A 3R0MA 3EJYC 1Q94A 4AGQA 3GHPA 4WI0A 3K6SA 5GISL 5C9JA 2JJWA 3PWJB 2PETA 4LLDA 4AIZA 2NY5L 3AMLA 4R6UA 3VXPB 4NQSA 5I30H 4QCIB 1QVOA 2DQGL 3V6ZA 3PCYA 3ZTCC 3OQRA 1HXYA 3HKFA 2EDXA 1N8ZB 1Z32X 3ZOAA 1A3QA 1JVOA 3RG1C 4UQBA 4H20L 3SO3B 2B08A 3NFSL 4NQTA 2C7UB 2BVQA 2B20A 2BP8A 5I1GH 1MHEB 2V2WB 3BCDA 2DD8H 2R83A 4D9LH 3T1FB 2BHZA 1BVLA 2WTRA 3KYOB 3SKNB 1WSST 1LL1A 2WLZA 2WXKA 3ZQXA 1T5WA 3B9VA 1HHIA 1RH8A 3L3DA 4UCFA 2LAAA 1R33A 3OQ3B 4CUCA 1B0RB 4LGSB 3ATDA 1HILB 3ZQWA 5A3IC 4QJ5B 1AD9B 4HJEA 3N9GH 4NUGL 2OPCA 4KHXL 1N64L 5FR3A 1MJUL 5ANMB 4BZ2L 1T21A 3NJNA 1AGFA 2YXFA 2G4EA 3LN4B 4BH8B 3S36X 5EF0A 1IEAA 3L6FA 3LNDA 3BMVA 3WIAA 1RJZB 3BAWA 4Q9QL 3HPLA 1J0KA 2GJ6B 2WXGA 2VR6A 5A2CA 1MW1A 5CJXC 4YDVB 3SY6A 2AGJL 4XVUC 3QH3B 3N6YA 5C7ZA 2EDQA 4JDZA 5AKVA 1SYVB 2P43B 4H8WC 4XXDB 2XQBH 4MJIB 3CC5A 4LQFL 1ZIBA 3CFBA 4DKEL 1FQ9C 3FQ1A 1RVFH 4IRSC 2GB2A 5D2LB 1UUNA 2BP0B 5E51A 3AY4C 1KLGB 3WFEL 2J20A 2Z1PA 4O5LH 1ND0A 4J1UB 4NQXA 1PAMA 1C1EL 2IBGA 5MP6L 1OOWA 2OJEB 5C08D 1XL6A 3RRQA 3V9CA 3KWXA 2X4UA 2HRPH 1P84K 4WTZA 2YBGA 4GFTB 5TK4A 5D71L 2D7TL 2JKRM 2G2NA 4ONFL 2QV4A 4NGHL 1D5BB 4H1LB 1MW2A 5F7EL 3HHRB 2B5IC 4OZGE 4G9DA 5FA3B 1J1PH 4A7GF 3RIKA 2B77A 5AOZA 5B22A 4ZFZB 1AJ7L 1SDDB 2R1XA 3AG1B 1WPCA 2KLTA 4AENB 1NWPA 3PHOA 4O02A 4B9ZA 4LP4A 1OLLA 4MYPA 2Z91A 4N8PA 4CC4C 2CMRH 2X28A 5I76A 4TSCL 2R2EB 1ZJBA 1YEEH 3SGKC 3BZEB 1GZPA 4K7PX 3I2CL 3EZJB 5J3HD 1L0YA 2CZNA 2V37A 5DWUH 4JRXD 1KCWA 4GYBA 4WENB 1NQBA 4IRJB 4TUOB 3FRUA 3SPVA 1UH4A 2XI9A 5EZLB 3KWTA 4U1IB 3QG6A 2LVEA 3JT0A 3QWRA 3QRFM 2FBJH 4F37F 1E6OH 3HI1B 3CPLA 1LP9E 5CWSB 5CHNB 5D6CB 2FH6A 2IGFH 2XU9A 4UIKH 4EVNA 1KIQB 1SHXA 2EDJA 5AKRA 3AU1A 5DO8A 1U3HD 1EGJL 3POCA 1HYRC 1YYLH 1FLTX 4UDTA 5CUSL 3WKYA 5IFJA 1BPVA 5C0IB 5DDHB 4L8SB 5F0PB 2DQDL 2LLLA 4PG9B 4JK0D 1ZANH 1E27A 4X9YA 1KEML 1SBSH 3S5LB 4KXAA 4ELMA 2X4TB 1I53A 2I85A 3ILQD 3KHQA 3KPRE 4KO9A 1H0DB 3ATEA 4FYRA 4L3EE 4JM4H 2AEPL 3NA9L 1S3RA 4UQDA 4RMBA 5CCGE 3LPGA 1QFWM 3RY6A 1OTUC 1KB3A 3DX8A 3ZDXE 4YDZA 1TJGL 1MHCB 3MRPB 4L23A 4U31A 3NIGB 5KOMC 3DVNA 4CN6A 4L1BA 1BJMA 2OJZL 1GOGA 1NLDH 3CZJA 1A8ZA 5D7JB 1ODUA 1VADA 2OMUA 1TIUA 3HPJA 4HF5L 1JHTA 1WCQA 4L1SA 3P3UA 3IU3B 3LNEA 2PCFA 3L4WA 3QW9A 5KSAA 2EUZA 2JXMB 1ZPUA 5JQHC 4FMKA 1CGSH 2X87A 2HRLA 2ICWJ 5DS8B 1PF3A 3CJJA 3CFDA 3K4AA 5D1QE 4DPRA 5C2BH 2LU4A 2BINA 3N50A 5A16A 1H8NA 1HSAB 1YQVH 1QOKA 5CEZH 1U41A 5IR1B 4BZ2A 3L2NA 3OZ9L 4CC1A 3RDJA 1QZ1A 3VFGL 5C0ND 3ECBB 4GLRI 1K8IB 1J10A 2E56A 2XVBA 3ZHNA 1LP9B 4OZFA 5CILH 5JQ6H 2N1TE 4Y2DC 1Z5LB 1ZA3A 2WANA 1XAUA 5EIIG 5HVWA 3TBVA 4UIMB 1HKLL 4FHKA 4OKDA 2PN5A 5LQBH 1MCHA 5F71A 2O4EA 2BSED 3WCYA 5KTEL 5DURD 3FCSB 3CFJA 3E1F1 3BHBB 1KTCA 3MLYL 3SCMB 4YHIB 4F92B 5GS1A 4YSDA 1KYDA 5BVJB 4JDTL 5IVXA 4L3EB 2PWDA 4IHOA 4AVIA 4CILA 5KVEE 2JFCA 3KXFB 4LSPH 4BFRA 3CFMA 3BGMA 4DN4L 1XF1A 4HIIB 3X11A 4FX5A 1UACL 3O8XA 1E4KC 3UDWA 1DSWA 1AXTL 2WKGA 1GR7A 1FYTD 2WLLB 2XY1A 5IF0B 3QDJB 4GRWF 3WS6C 1F3JB 3JWOH 1ORQA 4NZTH 2G9KA 1GYAA 3X3GL 5J56B 3TBBA 4AQZA 1Q94B 2KUTA 4TVPH 3K6SB 4WI0B 2LABA 2Y6TE 1AD0B 4QTIL 4NKIH 4NQSB 2VZSA 1XD1A 4S1QH 3CMGA 1DEEA 1FH5L 1FNLA 2OYPA 3V6ZB 5AB2A 4QRRA 2CBMA 4G7QB 4X6CA 2WUBH 3HLAA 3QHFL 1EUTA 3FQTA 3QIWA 4FFVD 1S6NA 2EIDA 2EYRA 1UJTA 1BAWA 3ISWA 2G75B 3MTXA 2VMDA 2OTPA 4KUZH 5AW2B 3RU8L 3X2QB 3VYNA 1NCTA 1HC1A 1OTSC 4FQIH 3FB5B 4IRJC 1CDYA 2NY6B 3EF4A 5L6YL 1BVLB 2WB7A 4MBRA 4N2MA 3COOA 1H5BA 1R0AL 2XZAL 5ESVA 1EEYB 2FCBA 2I26N 4GH7B 2GUYA 1P7KB 2EIMB 3P4NA 4MQSB 3TBSB 1T7ZA 2AK4B 5DQJA 3VJ6B 1EGJA 2D03H 1G7HA 2NXZD 4PGCA 3VH8A 2J5WA 4OB5H 2D7PA 43CAA 5CR1A 1DJHA 1CICD 1EO8H 2NZIA 3TPUA 3RTQB 3CDGB 1I1AB 3O3EB 4PY8I 2ADYA 3QO1A 4TS6A 3HPLB 3VXSD 3R4DA 2QSVA 3GD1C 1UWXK 1JYVA 5GZOA 4KJQD 4JDZB 4F15B 1MH5A 2XWEA 4PRDB 1KBGH 2FO4A 3CFBB 3PQYD 3MTRA 1DFBL 3EOAA 5EZIL 2B1HH 5GGQL 4Y0GA 1HCVA 1NCWH 4MZ3A 5TH2B 1PX4A 3RI5K 4A7QA 4ELME 2YAHA 2OZ4H 4IEFA 3X12A 1LEIA 2OTWA 2WGNB 4JFHE 4PJHB 3O45A 4UZGA 4PWIA 5DD0H 2R0LL 3QUKA 2YIHA 2X4UB 1LK2A 4XCEA 2XA8H 2B1OA 1W0YT 1RZFH 1KENH 4FG6D 1LD9A 1UJ3A 3EOTH 1AKJD 4K15A 1K3IA 2I25N 3RAJL 1A25A 4QY8A 1Z3GL 4ZYKA 2Y7MA 3N40F 4R2GB 2R1XB 3DBSA 2Y06L 4D0DA 1X5MA 3N85L 1SEQH 3PHOB 2AEQH 3ZRCC 5JW5B 4Y1AD 4D0CA 3NZUA 2YGVA 3EJTA 5KBKA 3JUYA 4G43A 3IXAB 1JZJA 2E59A 4MMXC 4GKOA 2XXMB 3WXWH 1XIWB 4GQPH 4KTEL 3HAEG 3E8UL 2X5PA 2R51A 1W0WB 2AJUL 2F7IA 4U6XA 5JA8B 3C6LA 3FS9A 1BFVL 2SODB 3QQXA 4LPCA 3STZA 5I18H 3SPVB 5JHDA 3KM1A 3GIZL 1BEYL 2BVPA 1IAOB 1VJSA 1OW0A 3QG6B 4G6FB 1FGVH 3NIGF 5D1XD 1ZMYA 2CGYA 4G8GD 3JYCA 1JFQH 3U1PA 1WYJA 3CPLB 4HUWB 1NMAH 1A7RL 2IJ0C 2KLRA 3JYBA 2VLLB 3DBXA 4Z7QE 1A1MA 3IJYA 4PJ5D 2OK0L 8FABB 4N8VA 2Y1YA 2QSCL 3AU1B 3I3BA 1FFQA 5AYQA 5ID0A 2HX9A 2R29L 5FO7B 4CSSA 4PRNB 4YGVB 4BM7A 1UQSB 4FQXA 4IU2B 35C8L 4PP1D 3T6ZA 5DEFA 4TMPA 4AUYA 2A9BA 3NFNB 3IVKB 4M43H 1TYEB 3D39D 3DYPA 3VWJD 3K71B 1T1XA 3QIBB 3RQ3A 5IVXE 1S9WB 2AABL 3BP7A 3ZO9A 4ZMYA 1U8KB 2EQDA 2HTLD 3GLZA 1D7DA 4FTVA 4H8WH 4PJ9A 4YHOH 3APNA 4P4RA 1IE4A 3E3QC 5D1ZI 2P42B 3US0A 3RL2A 1UWEL 4HKBA 4R5XA 1J18A 3QR0A 5DUBB 4P23D 4KO7A 4JG5A 4JANA 2C3XA 3CX5J 3DVNB 2WXHA 2YKLL 5FFOA 1ZHBB 3U83A 3DX0A 3FFOA 2GY7B 5A2FA 4BFEA 4YHYC 2ZXAA 5IVNA 2VDOH 2XZCL 1VADB 4GT0A 3L17A 1PPIA 3UZVA 3W81A 2W07B 5DJ6A 3E2HB 4X6EB 2TSAA 1LEGB 4R9HA 3RWCA 1AQ8A 5D7IB 5B3NA 2XQ0A 3WTUA 2XVKA 3QEQA 5KSAB 3VCLB 3QCUH 3A6BL 1LILA 4MDRA 3O11B 4AC2A 5F7DA 3CFDB 1D9KB 4QRRE 4EN2A 3TWCH 3FOLB 2C3HA 4X6CE 4WI9A 3VXRA 3VW3L 1SJVA 3S4SA 2DMHA 4ZS6D 4U1NA 2IXQA 2UXTA 4UT7H 4DGUA 5F9JA 2BLFA 4W9JC 5FHBH 5MEPA 5ESAA 4AI7A 3HAEH 1ROWA 3R19A 3T6QC 2J7LA 3ARPA 4OZFB 1I9RH 4XPBH 3Q5OA 1TTAA 1XX9C 4P9HL 2MQGA 3RTQC 1I1AC 4HEMA 4Z7QB 1ZA3B 4HCRH 4H8HA 5CEZD 25C8L 3CD4A 2A73A 3WO4B 5EO1A 4JPVL 4YSQA 2XX0A 3TBVB 2AMUA 3QNFA 4Y4FD 3LEYL 4F15C 1A3RH 4Q56A 1INEL 1OGPA 4D0BA 2HAZA 5GXBB 3F2LA 4WGKA 4MZIA 5KG9B 3QULB 1PMYA 4WDIA 3LXCA 1IKFH 2Z31D 3CFJB 4GBXA 5D7KD 4LLUA 5F1NA 5GS1B 3D51A 3FBKA 4R26L 1TR7A 1TJHH 1OAXL 5GGRA 2RAMA 4HXAH 3BUTA 1F58L 4MD4B 2E4FA 4O2EB 4Y19D 1JZDC 3S2AA 1NC4A 3CGTA 4H88H 2EYSA 3BE1L 4OKVB 3X11B 1T83A 4DSYA 4XP6L 3UC0H 1TCRA 5D4JA 3N1MC 1ZV2A 4FQ2L 5ITFA 1NCHA 1TMQA 5EEXA 1ORQB 4G70B 2NY2B 4UUJA 3NJMA 4ZSOA 3RNKA 1G0XA 4R97B 1W0VB 5TJWK 2QR0A 2X1OA 4CSTA 1AZNA 1P4BH 4LPUA 4H1LG 4BE6A 4KHTH 4R2GC 2X6VA 4DGVH 4NP4L 4QKXB 1S7RA 3GXMA 3T4AA 1JRHH 3MJ7B 3IFLL 1DEEB 3WTSA 4TVPD 5EU7E 2XKNB 4JKNA 1E8YA 3HLAB 3FQTB 1KTLA 4FC3E 1XIWC 2BSSA 3CFIC 3DO4A 4CDHA 5FB8B 3QEGH 1D2OA 4QRPD 1OAQL 1P4IL 1Z7JA 1XZ0A 1CE6A 2BDNH 2IPKA 4WNQB 5FOJA 1SLUA 5L2KD 5BRZA 1G7PA 1ERNA 2UVEA 2NNCA 4JL2A 4BCXA 5ESVB 4LPVA 1CURA 4UQ3B 3VRLE 4JBSA 4GRWH 1IBGH 4J2QA 2K6ZA 4PWGA 2WKOF 3P4NB 5HI4C 3NK3A 1ZLUH 1E5AA 1MIEH 4FCAA 3G08B 4GXUN 2R29A 5DQJB 4MCNA 4P05A 1G7HB 2MQ3A 3VH8B 4CVWA 3H54A 4ICXA 3TA3D 5JHDE 43CAB 1M7UA 3NP3A 1UUSA 4Q74A 4NKOB 4E2OA 4W9HC 1BIHA 5J12B 1GW6A 1GS7A 3UJJH 3QS3A 4OV6F 4AW7A 5IM7A 2VXSH 5FUZL 1Y1UA 1IC7L 3PREA 2JTYA 3QIBC 2D9QB 4PTUA 1QSFA 4OCSH 2C4FU 4AEEA 2D31B 4Z0XA 3S48A 3QFJD 4HDIA 1A47A 3PPSA 1TFPA 5I66A 1MH5B 2V9RA 1TFHA 5LGHL 3RY4A 1JS4A 5ERWB 3MROA 1BVKA 5D7EA 5HI5D 2VUOA 4M1GL 2NQ3A 4AJWA 4F80A 2YEZA 4YJZL 1FYHB 3SE9L 2LT9A 2OTWB 5E4IA 2FYVA 1G7LB 1KN4H 1KYUA 3PDGA 4M48L 4YZFF 4H0HB 4WO4A 4UNIA 1D5XA 4L29B 5F1IA 5D2NA 4FTVE 5E5MB 2V8MA 3VFSB 4OFQA 1TSRA 4N4YB 3TH3T 1RZGA 4PJ6A 5DTFA 4EI6A 2O72A 2XFXB 2VMCA 3E2HC 5D70H 2WZPD 1RU9L 1T5XA 1UJ3B 1HH9A 5EEVA 1HN1A 4OIIL 1D6VH 4QUOA 3ARFB 3ARBB 4H1LH 5AOKA 3BVDB 4QY8B 1D9KC 2WLJA 4ZYKB 1ILUA 4D0DB 2YGPA 3S5YA 4U6TA 4G8FA 2DMBA 2GHZA 3CDZA 1EVUA 3MR9A 5AUMA 4D0CB 3UEQA 2EECA 5JZ7C 4XAKD 1IIIA 1AO7A 2AEWA 1G4MA 3BUQA 3QEQE 4RMQA 3HZKA 4KI5E 5AW7B 4MQXC 3AWGA 5DVMA 3SYQA 2ZAIA 2B14A 4OLUL 4RFNB 1KCSH 4UT9H 5EOCL 4M5YL 3VXRE 4D7BA 3DRTA 3HS8A 3BXNA 3C6LB 1BJ1J 2EXTA 2F5BH 2QPSA 3I75B 3S96B 1BBJA 32C2A 3ZE1B 2BVPB 3D8MA 2CHZA 3R7QA 1E5ZA 4JE0A 4WNJA 5ADOL 5F3FA 1YVLA 3WN5A 4RVBA 1A1MB 2P5WB 4ZO8A 4N8VB 2OQJB 3MJ9H 2HMIC 5ID0B 3AXLA 4RFOH 2B3RA 4EI0A 3TTSA 5D7IF 2VZ1A 2E3VA 1Q9OB 2JQZA 3RWDA 4RGNB 3WGVB 1RZQA 1SOXA 5A3ID 1F1AA 1F42A 5EO9B 5FGBC 5EF3A 2DQUL 3BKYL 1J0IA 1H15A 3DLQR 1T1XB 4FFZL 4PS8A 1BD2A 2AXGA 2DQJL 3FFCA 3FMGL 2XSKA 4FTVB 1X6LA 4PWKA 4ANVA 2VISA 4P4RB 1R3KB 3RL2B 1KCKA 1YC8A 2CO3A 2FSEB 1SEBA 3QEUB 4A63A 1T04A 4JANB 4XVUD 4V33A 3GM8A 1CMOA 3RYMA 4MAUL 1CUOA 1FDLL 1BZ7A 1QLFA 2ATPB 2A83A 5DEJA 4ZSOE 4XP4H 1CLOL 1JGDA 5DD6B 3BAKA 4HSCX 1EV2E 3VXNA 2VM9A 4JY6A 2VW4A 4HEPG 3L81A 4G6ML 4IRSD 3ZMRA 4YXHL 3MGOA 5E7BA 5T1KD 1EXUB 3QEQB 3V10A 2PWEA 3RUGE 3BPNB 4CVUA 5IHWA 3Q9QA 2Q76A 2Q7YA 5T5NF 1FFOB 1W6WA 4XP9L 2YA1A 2TSBA 2Y72A 5EA0L 2GSGA 1NSNL 3ZE2B 3UAJC 3LMJL 4U1NB 1MFCL 2IXQB 3MRCA 1RUMH 1U9KA 4AM0A 5F9JB 5FC9A 2ZWNA 1XSJA 4PRBA 1H6FA 5MEPB 4IIZA 5E03A 1K8DA 5BRZE 1KWGA 2VH5L 2PYED 1O6SA 5F9WB 4AEHH 1WA2X 3FQXB 3MNVA 4QXUH 3WNOA 4DPCX 1QBLH 5DVOA 5J12C 5ICYA 3D34A 1L7TL 2D0GA 1XEDA 2A73B 4GXUM 5EO1B 5C09D 3MRMB 4D9RE 3GIVA 1JZ2A 3TZVB 4N90E 3BZFA 3GFUA 3MQIA 2WHVA 3FU0A 1UM4L 3BAEH 4HJ1A 5SX5H 3W11D 1TU2A 3Q1EA 2P5PA 3A4FA 3K91A 1L3WA 1DSFL 3TJEL 1XH3A 5C3TA 2VABA 4D8PA 4JHBA 1BQUA 5GGRB 3VO0A 3VTTA 2AJVH 1ZGLM 2YQ2A 5G4OA 1QSFE 2NNFA 2NSQA 3OVUB 2EYSB 4FNUA 2VUKA 2YWYA 4U1HA 3K74B 1TCRB 4DP2X 5DWPA 2FD6L 2BHFA 4L1LA 1RJYA 3MXVH 6FABL 1W16A 4C54A 3Q2WA 4GO6B 4Q6YA 1CGYA 4KKNA 5ICZA 5I9QC 3ARFC 3ARBC 3NSYA 1B6DA 2QTEA 4L3FA 3NQKA 1X5HA 2GYSA 3QORC 1RHHA 2WLNA 1RZKL 4NRXA 5D2NE 4YS4A 1S7RB 2YXVA 1ADWA 4QMEA 3FU7A 2J8HA 4UV7L 5DMKB 2EIJB 1KTLB 1NFDA 5IFAL 3B3IB 4RFNC 4C4KO 1JZ6A 2VL4A 2BW5A 2MEJB 3S37H 4RMSA 4XN9A 2IPKB 2DWDA 3DK2A 1J5HA 1U8LB 1AO7E 1GW0A 2J6WA 3QCVH 1NCIA 2DEYX 3BIBX 2ZSWA 4CN1A 2VZOA 3HUJA 3O9WB 1KJ3H 3VXTA 1OSPL 2NY1B 1N9PA 1WS7A 3QAQA 1GKEA 4M62L 5FX3A 3T6VA 3GTTA 1A65A 1NUNB 2WXOA 4P06A 4GUPA 5DD3L 4ZPVB 4LOUC 2Z7YA 4XMLH 3UADA 1NC2B 4W6YB 2BSBA 4RGNC 3SDAB 3WIIL 2EP6A 1L9QA 3MREB 5DHEA 3AWEA 2Y3AA 3VACA 2XTSA 5BUPA 1DDTA 2JJSC 4FFZA 2XQYK 4TLTA 3A4AA 4LL9A 3KAAA 2F68X 3BWSA 3MJWA 4PTUB 3L2LA 5LO7A 4HDIB 3SSGA 3T6XA 3IXTA 1AQMA 1P9MA 4Y2DD 2VLME 4QXGH 2ZJSL 4AKQA 2FX9L 3VSTA 4JJOA 4JREC 3U1QA 3MRIB 1RAMA 2CO1A 1ZPLA 1TLKA 2UZYB 1R17A 2YEZB 3HI6L 1WLHA 2VE6B 4IYKA 1A6UH 5EMYA 4W9LC 1BD2E 1PSKL 3FFCE 1D5XB 3BLBA 1QEWA 3LH9A 4MJID 4R7DA 3D05A 2M83A 4Y2NA 4GUOA 1WTLA 5CSZB 4EI6B 1QHOA 1EVTC 4NN6C 4IJ3C 1NCCH 1T5XB 3Q3GA 4Y5VA 1HH9B 3BESR 4O2FA 3BPNC 3O4OB 3NCEB 5IHZB 3HC4H 1IQDA 1SY6H 2XUWA 4BKTC 1T1YB 4UTBL 1M56B 2QQNH 4G8FB 1KV3A 3PNWA 5C0EA 3D85A 3MR9B 3WFHB 2GC4C 4BSWB 1SYSA 1AO7B 4L1TA 5DS2A 3UC2A 2Y1ZA 4DKDC 3BRGC 4POZD 2OSWA 5L4FA 2VXUH 1VRSA 1J0JA 3BZ5A 5AL0A 3GBDA 4FNPA 1OGTA 4JO3L 2BNQD 4DKAA 4XOBA 4MD5A 3DRTB 5B8CB 2FYYA 4JRYA 3MZTA 2GEQA 3L5WB 1QW9A 4QXTB 5A6MA 1EZVX 2PYFA 1JNLH 1ZOXA 2P48B 3CU7A 3NCCB 4WUUB 3TCLA 4DJMA 1SN2A 1UH3A 2CHXA 4OJDH 1DANU 3OX8B 5HJDA 4X80L 5LCVH 4UMSA 2MOGA 1ECZA 4BFOA 4JO1L 3LKOA 1OTSD 1XF5A 1RIHL 1WZAA 1DE4A 1FL5A 2WJ5A 5E1AA 4NKMA 2WSKA 3AXLB 1PW3A 3KCPB 3DV4A 3DVGA 3NJXA 3VSUA 1J5IA 5E6RB 5I8OL 2QVKA 5T5NG 3RWDB 1EMTH 4PV1C 2F8VA 1RLWA 4F2FA 1KLFA 1S78C 4NS0A 1FVEB 1ZHLB 4UOW1 2YPLB 3I85A 4F7PA 2C9PA 4EIZC 3I6KA 5EBLA 2EXSA 3FFCB 1PVHA 2P9RA 5HYQA 2X2HA 1RK0A 4JFUA 1ZA6B 4NBZB 3EG9B 4P5TA 5F72S 4BCZA 5GGVY 4YHZH 3PLYA 3MLTB 3PP4L 1SEBB 4JKPL 2EC9U 4YFLI 3O3UN 1F4WL 1HHJB 2OMVB 4P2RB 4S2SA 1EAPA 3GS7A 1NGYA 1Q0XL 1CD9B 1QLFB 3VI3A 2A83B 1H8OA 1QI3A 4PUBH 4U33A 4OSUL 3VXNB 2EH8L 1ZLSL 1IJNA 3SGEH 4U6HB 1K4DA 3BSZL 3U4AA 1MCOH 2BSTA 3EH5B 3MGOB 4JR9L 2X4QB 3IE9A 4LSSL 4HVBA 2DM2A 1WK0A 5I6PA 3DJRA 4PJAB 4YZWA 2Q76B 5EC2A 3KPOA 4AYMC 2W80C 2J1WA 2XRAL 1NFDE 2GSGB 5TQ0L 1F4AA 2WQSA 3O9WC 2NY1C 3QHTC 3TEXA 3U30C 4K2UL 3QPXH 1AGBB 2WIIA 4IGBB 3LKNB 3UROR 2YRZA 3BRDA 2CJSA 5IUSA 2DYRB 3MNVB 3SDAC 1FHGA 4S1DC 5M95B 5HD8C 3HUJE 1GGCL 1PLGH 1Y6MR 2VXVL 3LEVH 1TTGA 4HLZG 1B0WA 3H7BA 3BZFB 3CQFA 1SFHA 1EEZA 3EBGA 3WE6A 5A1AA 2K9FB 5AFAA 4E5XA 3P0VL 3FO1A 1W72H 3SE6A 4C56B 1XH3B 1FNFA 3D4YA 2OMXA 4JMNA 3QG7L 5AWNL 1DQTA 1KTDA 3MCKA 5MEND 3FK3A 3KBFA 4FS0A 2BOBA 4FZEL 5GRJL 3FFDA 1OCWL 2CRMA 4I2XB 4MMYB 4U1HB 5TE4L 1DHKA 1BFOB 1R5VA 2X6AA 1PZSA 4GEJA 2VQTA 4Y5XB 2Q5BA 3CSGA 3HNSL 5ICZB 3E6FB 1KN2L 4I48B 1XF2B 1K4CA 4TL4A 1UB5A 2D4FA 4I0CC 1NKOA 4N1HB 4DZBA 2V2TA 4UTBA 1RHHB 3D2UD 1A6WH 3ECUA 4ZS7L 4NRXB 3O6MH 4HWBH 2G3ZA 3BKCH 1LK3H 2VOTA 5CAYB 1T2QL 3D2TA 3B5TA 5HHOA 1JWSA 3G6JF 3KVQA 5JIQA 5IJBC 5E2UH 4CJ0A 2ED7A 4NC1C 5D1ZA 3TN0A 3OAWA 5DQDH 2IH1A 1V3LA 3SQRA 4RCAA 2DLEA 2Y22A 4QOKD 5B8CC 1IZJA 1CJYA 1OP4A 2AZUA 2X12A 4X4MA 1WF5A 4OGXL 4MJ6A 2E6QA 4Z7UA 1MDTA 4WHTA 1S3KH 5CEYB 4AG4L 2ZSWB 3UAAA 5CZXC 5IFHL 2YJQA 1PNDA 2IAMC 4YHKH 1TZGH 3GMOA 2BCKB 4OLVL 3VXTB 2D3LA 5ACZB 5FUOH 1R5WA 3RX7A 4JRYE 5JHBA 1K3ZA 1RZPA 3K8MA 1NM9A 1SXZA 2EJ1A 2UZXA 1SVZA 3T2LA 2LTQB 3GXNA 4HLZH 5F0MB 1DQJA 1P6AB 1VFUA 2DQEH 4ZFFA 5KN5B 3RKPA 4XWGL 3TO4A 5T3ZD 2AW2A 2AK4D 3KVPA 3N06B 3QXWA 4WCYL 3OF6A 5EF1A 1KXQA 4KOCA 1M2VB 4EXPX 4NWUL 1QBAA 3RTQD 5FCUL 1I1AD 4AITA 4MXWH 4I5BB 2EINB 1BQHA 4LLYA 5H35B 2JB5H 4N0FB 2DQHH 1NMCC 1W15A 1UATA 2FEEI 4E9TA 2XACC 1MN4A 5LJYH 1NLBH 1QUNB 2H1LM 3ASWA 3BSZA 5BQDA 2V9TA 2FHFA 3HG1A 3MLRL 2BNRD 4XH2A 4Y5VB 1XDTT 2XKUA 4M93B 2CCVA 3F58L 4IOSD 4BUHA 4PBWD 1IQDB 3VI3E 3ZDZE 3AG2B 4W9GC 4BQ9A 1U3NA 1Z5HA 2Y07L 2NZ1A 2EH7L 3PNWB 1EA9C 3WEXB 1FH2A 3D85B 1SYSB 5KVDL 2ROYA 5LWYH 4B27A 1IFHL 7FABH 1DL7L 2VAAA 4S1SL 2MH4A 4IGBC 4L4TD 5D7SL 5DMGD 4M8QB 1E9OB 5I5JA 4PGBA 4NPYA 1A6AB 3MHZA 4KKRA 4R2GD 3GRWL 2ZQKA 3M6DA 3EGSA 2AJZB 2XWXA 3JVGA 2WVTA 2FYYB 4JRYB 3MFFA 1AH1A 1FRGL 4AWJC 2Q7NA 1D5RA 3EO9H 1ACCA 4L5FL 4L37A 1DJXA 1BECA 2ZXEB 3LQAL 3UTPD 2VDNH 1XIWD 1BAFL 3OHXB 4B97A 2YD0A 1JK9A 3S3CB 4N86A 1FV1B 2VR4A 4JGUA 4XNYL 3FO0H 2K6WA 5B39G 4NKMB 5K1JA 3SE3C 3UBXI 1RULL 4G6FD 1UT1A 1JWUA 2VN7A 1JPSH 5C0CD 1DQLH 1SN0A 1YAIA 4PHZA 4ATWA 4PJAF 5I8KH 5EFIA 2XN9A 1H8SA 2C1PB 5F97E 1V7NL 3FW6A 3V5DA 4ONOA 3ZDYF 1WZ1L 3NJHA 4F7PB 4Y5XC 4YHPB 5CKAA 3UEZA 3CPUA 5EBLB 5LBSH 2F74B 2GY5A 2E47A 5F7AA 3SGDI 1WGVA 3UG4A 5LNGA 3CN0A 4KY2A 2CHWA 3EDJA 1D7CA 4PJBF 2V3EA 4MLIA 2WXRA 1L6PA 3CVHB 3LQZA 4W6WB 4N2HA 3ZHLA 2B59A 1EAPB 3QIBD 5CCJA 5JLZA 3VI3B 4KZCA 3ZDZB 4N2KA 2F1BA 1DJYA 4OUOA 3ATFA 4OCYL 3ZL1A 3QUYA 5ELIA 2N0KA 1CZ8L 4GSDH 3FPXA 3IN0A 4RBPH 3C60C 1K4DB 5SX4H 3FULA 1GCFA 2ICCA 3SQOL 1QLRA 3BZ4A 3HOGA 2IPTH 2FWLB 5HHOE 4YAQB 3IPBA 5EC2B 3U79A 3KPOB 4CNIB 4YN3A 4V11A 5FGCE 4E9QA 3MRDA 1CBVH 4HGWA 4CRPA 4GG8A 5EULV 4MNQA 3H1ZA 3SPIA 2K8MA 4MXVE 4D3CH 3UTSB 1MCEA 1OF2A 3MGTA 2WIIB 5IB1A 1PX3A 1ZTXH 4AMKL 1KJ2H 3CHSA 4Z7UE 3RB7A 1E67A 2ETWA 4FQPA 5FO8A 1T89A 2ZYRA 2WCGA 1T03L 4U6VH 4E68A 1AOHA 4L8BA 3FB6A 1ACYH 4OF3A 5JZ7D 2J6EL 2UXVA 3PAYA 1B4TA 1M6UA 4M7KH 3CCHB 5EN2A 3MCG1 4FQCH 5FW7A 3V0DA 2CBOA 2I9LA 3ORJA 4MQXD 3SQBA 3WE6B 3VI4B 2WQWA 1AHWA 2O30A 3B4NA 1KTDB 1MCQA 1J88A 1MCJA 1J05A 4G7SB 1I7TA 3QSKB 1KXQE 4AQ8A 1LLAA 1CR9H 1JZIA 2J21A 2WP3O 2FVNA 3FFDB 1NJ9A 3QXVA 4I7ZC 1NFKA 3RI5F 4NO0D 5DZOA 1U8JA 1FG9C 4B0MB 4YK4C 2ZP0T 2C9UA 3CAFA 4A37A 3MUUA 2VDMB 2WZ0A 3S6CA 4FMFA 2RCSH 3H4FA 3S88L 2HMID 2F19L 1XCQA 1ZWIB 3GBML 2J73A 3REWA 4XRCB 4DZBB 2V2TB 1RURL 2HYMA 2VR3A 2NNRA 4NRYB 4XNMB 3LRGA 1YMHA 5D6DC 5ISZA 4XNXH 1OWWA 5INDA 5E4EC 5KUMA 2UY7B 3BVNB 1JP5A 2B3IA 2BZDA 3O3AA 1O75A 2QQKH 1AGDB 1D6EB 5EU6A 2DI8A 3GJEA 4JVWA 4X42A 2OFQA 3L7FB 2AV1A 3TYGH 3GRWA 2J4WL 4K3JH 1YEDA 2WZ5A 3DSNB 4OLWH 4AIEA 2IH1B 4GAYA 4B96A 5G2NA 1XB6A 5C0RL 3U4EB 1N0XH 4OD1L 5CBEA 1RFDL 3LZFH 2WZAA 4WHTB 4IU3A 3HEIB 3UTZA 3WNJA 4ZQKA 1TKWA 5FK9A 2WO2B 4YC2B 3RGVA 3OHXC 2YAEA 3GMOB 2W59A 2YZ1A 4OD3L 3U25A 5I6NA 1GAFL 5HHPB 3JWDL 3P0GB 1R5WB 3LZQA 1JGVH 4IBLT 3L16A 4L2LA 3KPSD 3NCYS 4CKQA 1ZRUA 3I02B 5CINL 3QCTH 3BUBA 4TQPA 4U1SA 3UAJD 1FI8C 3TO4B 2EEFA 4A67A 4YO0A 2YA0A 3PXJA 4K7PL 3RA7H 3TL5A 2DBJA 2VDRB 4OCXH 5B3SB 2F7OA 3DARA 2BCMA 2CWRA 2AJYH 4KFZC 4U6YB 1OV8A 3EOYG 1FCGA 1BQHB 4HPYL 3H3PL 4LLYB 3OKKB 3VG0H 3UXFA 1WHPA 4Y4HB 3PIQA 1HL9A 3GS4A 1IM3A 2XN9E 1WAAF 3P1VA 4NM4H 4HJSA 5F3HA 3RDTB 2VW6A 2YK1H 4WK2B 4N2CA 3T2NL 4JFQB 5IMOA 3OKYA 4OGAC 5I0VA 2DIAA 1S9YB 4M7LH 4LOVA 5DHMC 3CZKA 2QGBA 1WUNT 1ZDQA 1A7BA 5FXCH 3QJVB 4FNLL 4XPFH 1ML0A 3HG1B 4H8PA 4U49A 4AV5A 5J57B 4MA8L 2ZAHA 4XH2B 5KYUB 4MXQD 1UC6A 2E7DA 2VITA 4MNGB 2IADB 2YRBA 1AZZC 1MNUH 1BAGA 4M6NL 5GRZA 5ADPH 2AEOA 5DR5H 2VLRA 4RRPA 1HDMA 4JZNA 4NNXA 2WAHA 4MWFA 4NKDA 1DANT 1NMBH 4NZJA 3KPQB 3FB8B 1QBML 1RJCA 3DDFA 4LRIC 1RLBA 2VAAB 3ARFD 3ARBD 3O3BA 1XF4B 2Z7UA 5DFVC 4OFIA 2Z4TA 3OZLA 1OVZA 3QORD 4HG4K 3EZ8A 4GXFA 3EGSB 4OF8A 5E9DE 3BD5A 2QGEA 4XPHH 1H3PL 2J6EA 3EO1A 2FAUA 5E1QA 1N6QH 4NO2A 4KTGA 4MNQE 5FEBA 3L5XL 5K9OB 1CT8B 4ALAL 3B5HA 4L37B 1AR2A 4PY7A 4GKNA 4MS8D 5FYLL 2PO6B 3K2MC 1YY8B 4KITB 1W80A 2VMJA 1L3NA 4F7MB 2R4RL 4PI2A 4YDLB 5BS0A 5ITBL 4JO4H 3BWAA 2EC9T 4K07A 2Z92B 3NCXA 1NICA 2ZOTA 4LBEB 2FJHA 5BZWA 4EOWL 4PVLA 4DZ8A 2PW1A 4OGYL 5EUKA 4LEXL 2XLLA 3D0VA 2AJXH 4U0RC 1WBXA 3QE5A 2W8CA 2XN9B 4L3CA 4LPYA 1UM5H 1BVZA 3DIFB 5GJSL 1GC1L 2XWJA 1GY2A 3S3PA 5AZEL 1TJMA 1BZQK 1BGXL 2PTTA 3UL4A 5E9DB 1SPDA 2A6KA 3E6HA 4RGND 1ASOA 4G1EB 2HX8A 1JNNL 5IESL 2YRLA 2YC1A 4KXCA 4CBZA 1VESA 5JLZB 1JHLH 1CGVA 1HVXA 2J3SA 3ZE0B 4YHML 5B1JA 3ISYA 3VUAA 3ZYJA 4AH2A 3N44B 4W9FC 3RWFB 5I1KL 4J8QA 5HHNA 1ZSDA 2EDBA 3DVFA 1UA6H 5ISZE 2TRYA 5KVDE 4KZEH 3VI4F 3MAWA 1QLRB 1JV5A 4LSDA 4ORGB 5K9QG 2VC2B 4OF7A 4NAQA 3AITA 5GS3A 2F18A 3B9KA 5EU6E 4J3UA 1NH6A 3BFQG 4LNRB 1YEFH 4K73A 2WQRA 3CTTA 3MGAA 4XWOC 4FNSA 4YC2C 3WJMB 1U2HA 2D3JA 3SDXA 4GG8B 4MNQB 4PJDB 2GCYB 4RLDA 1RIVH 2E46A 1T0NA 3B1TA 4XMKH 4YLCA 1EZSA 5ABDE 1YYMH 2Q8AH 4OTXH 1OF2B 4L5FE 3QJFA 3MYJA 1CN4A 3KNBA 4H0GA 4I8DA 2P47B 4U7KA 5T5FL 3A21A 1Q1JH 2D73A 3BKJH 1EX0A 2A9NH 3WIHL 3BP4B 3FB6B 2BO0A 2OI9C 3MNDA 3SGJA 4HS6A 4OQTL 3S3DB 3QQDA 4LEBA 2BFGA 1B9ZA 2AAVA 4JHAL 4WZ9A 3T6WA 3DURA 2C9SA 5IW1B 4ELKA 3NACL 2X4OA 4HUXA 4X7SL 1QW8A 3B8YA 4ES8A 4Y4HC 1HXMA 1QUPA 2KPNA 1R1CA 3RDTC 4KV5F 1J05B 1I7TB 1FNEA 3QZOA 1R3JB 5I5RA 3L7EB 4MJHA 3VXUA 2NQCA 2NW3B 3UPAA 2BJML 2X4SA 1L7IH 1KCRL 4GW4A 3WBDA 4EZLA 1G87A 3D9AL 1DO5A 2CGRL 5JXEA 2DF3A 1LWRA 1MELA 2QT6A 2X53A 4A2FA 1E5CA 3EH1A 1S9XA 2ZF9A 4ERSH 3T3PB 3REWB 1QLEH 3NA4A 4UM9A 3ZO0A 3UZQA 4YUEL 1OP5K 3K1KC 3WHXB 2H3KA 1YMHB 1S78D 1Z2KA 1PLBA 4JCLA 4LCYB 4Y7OC 3C5ZB 3RWIA 3W9DA 1KIUA 2JI2A 3KLSA 2P4AB 1IC1A 3O3AB 4OJFL 5CFHA 1XH1A 2W9EL 1A64A 2PW2A 4HG4J 4R83A 1M3JA 2VLRE 1MCKA 3C09B 1J5OL 1IGFL 1ZLWK 4DW2H 1YEDB 4PH8A 1CFVH 2WN2A 2ZCKH 3U36A 4AV4A 2W60B 2VDLH 4JO8A 4UTAL 5LNDA 4GAYB 1QA9B 4JFEA 3PJSA 4LCWA 2IH3A 3CSBA 2FEEL 2Z8WC 4XVSH 5K9KA 2PO6C 5DUMH 3UTZB 4ZQKB 5FK9B 4R0LA 4M5TA 1MFAH 2BS71 3L3OA 5JOEA 4YDLC 2A74B 4HT1L 2IWFA 1OCCB 1DLHA 4YFDB 2B1AH 4HLEA 1O9VA 4XBPB 1MRDH 4XVOA 3BPLC 3IDGB 4YSTA 5T3XL 3KLAA 4PJ7A 5IEKA 1FZOB 3MJ8A 4U1SB 4QXVA 4DP1X 3O9WD 5IMLA 5BS0E 4OZGF 2VNCA 4ODHH 2APVA 5AOIA 4RAUB 2FGZA 1XCWA 3NDZE 4DOHE 1P69B 5J6SA 4RIRA 1UWGH 1NC2D 1AIFA 3ZXAC 3SDAD 4G11A 5DGQA 4NP9A 2XIBA 5CMAA 3PWPA 1TT6A 4S1DD 4YQXH 3H9SA 5HD8D 3B2DC 3PIQB 3DHPA 3LKQA 1GS6X 3KLDA 4AGPA 3GLDA 1QHPA 1WWCA 5GZNA 2YD2A 4LZKA 4ODVH 1T2XA 1HQRB 3OMIB 5CFAA 5GGTH 1U93A 4MNHB 5BO1H 5GPRA 3P4MB 2BOLA 3FO2B 3GRGA 3C2AH 3BYYA 4CC0A 4GI9A 3ZUCA 4QHMA 3SOBL 3KJ4B 4G80A 1ASPA 2WYTA 4O51B 2Y7OA 4U1GB 1TZAA 4PEEA 2Y36L 4LKXA 1A4CA 1A9VA 1SJHA 3NSFA 3K2UH 2I5YL 4NNXB 3WNKA 3O0RL 2Q7AA 4MWFB 4NKDB 2XXCB 5CCKL 2QLYA 3GWJA 3GSVA 1EAJA 3FCGA 4UV4L 2VSCA 4NFCA 5C07B 5IMMB 2WNKA 1WV7T 4P46A 2QADB 1WGOA 2DKMA 3LN5A 3WNPA 5T5FA 5K59F 3JTBA 4TPRL 1PJ9A 4FJZA 3QDGB 1SM3H 2ADGB 3WIHA 3A3YB 3OM3B 4WFED 2DLFL 5BVPL 3EO1B 2DWEB 3KH4A 3SDXE 4XCFH 2XZQH 4OQTA 2YOAA 3TCXA 5KJRL 3AM8C 3KEHA 1PD0A 2D2OA 3QZNA 5LN4A 3ZDXF 4PW3A 1NAKL 4JFDB 2A5UA 1L9RA 4EQ2A 2FL5B 4B7IA 4BV1A 5HVGB 1SXBA 3BKMH 5CEXA 1ADQH 5A43C 3ZE0F 4JDVA 4UWQB 3MX0A 3GEFA 3BWAB 1HHKA 4XMUA 3N44F 4I4WB 3BI9X 1E5BA 1HQ4A 2O61A 4DZ8B 4GT7A 1G1KA 4WUUD 1SXSA 4HBCH 1E9PA 3QAZB 3UG5A 5JPMB 2AI0L 5CZXD 4DHLA 3TO2B 1HI6A 2YR3A 2IAMD 2NY4B 1P6FA 5MI0B 1N0LB 3WO3B 5FM4A 1G1CA 1OGSA 4IBSA 4FFWC 4PJDF 1MQ8A 1KIPA 7PCYA 5GHWH 1JXFA 3WTTA 4F91B 3E6HB 3QC6X 2AEIT 3NJKA 3VXUE 1SOQA 1JPFA 4B9GA 1XBRA 4LEOB 1X5ZA 1A7OL 2YPLD 3C5ZC 4HC1L 1XF3A 4F7CA 5DJ8A 2YC1B 3CVHH 5EZOH 3WJLA 4RSYA 5CJOH 2YEVB 4K94C 4Y2OA 2WB1A 3C09C 3AXIA 4JY4A 5DJ0B 1YHPA 4UTAA 4PJCB 3QNYA 1VDGA 5HHNB 3UBGA 4AOFA 2BX5A 3PGFL 3G04A 4H7VA 3BH4A 2NDFA 4TUKL 1KACB 4M6OH 4JDEA 4P2RD 5HDLA 3TPKA 3B9KB 3WD5H 3PXHA 1UZGA 3HR5A 2NYYC 5IQ9A 5AAMA 5IGXL 3HG2A 1BFSA 3OR6A 5JDSB 1SMOA 3DYMA 2L0DA 5KUKA 4G9FA 3IRCA 4RDBA 2HWZH 2B0SL 2WWOA 1F11A 4B41A 4KAQL 3CFNA 5EOQH 4TSBH 2A74C 4LMQI 1PU0A 3O2WH 3ULSA 3EDEA 5C0BA 4HK0B 5J13B 2NUTA 4JFEE 1ZVYA 2BOCA 4ZMOA 3S34H 3MYJB 2GFBA 3KNBB 4LCWE 4R84A 5FYLE 3PF2A 1N19A 3MBWA 1AFVH 1MLCA 3T3PF 3PGDB 4XVJH 5HDRA 2FO1A 2ERJB 4V1DA 1LEKB 3WFCL 1J1OL 1NBVL 4FLSA 3RIAK 1MFUA 3CDYA 1EDQA 1XMWA 2WJ7A 4K23L 3QQDB 4XXCA 4PLOB 3VB8A 3V5KA 4DO5A 3V6BR 3QWQB 3EJQA 3G6DL 3PY9A 1DVFA 4PJ7E 2CLRA 4BZ1L 2X4OB 4HUXB 1GJIA 1I7UA 5E8PA 5E08L 1HXMB 3CZFA 4NWTL 3AREA 2R4SH 1DTUA 3VMPA 1GPOL 4Y9BA 1F02I 2DICA 4WUKL 1PZDA 1OB1A 1RSFA 2EEXA 3VXUB 2BRRH 1E8WA 1MJ8H 5E6IA 4GW4B 5F93C 1LE5A 5D5MB 2YBRB 1BBDH 3GB7A 3W39A 3PWPE 1S5HA 3WFBH 3RPBA 4C56D 3H9SE 1U58A 3MRKB 3AZUA 2KC0A 4HUVA 1YNKL 2VDMH 1S9XB 3DC0A 3O2VL 4KZDL 2FJGA 3NJGA 1UZ8B 5H4YA 3PL6A 4UM9B 3UBXA 1GZHC 3OKLA 5KYXB 4WI5A 4G5ZL 4PV9A 2ZOOA 5BO0D 4F8PA 1NBZA 2E7LA 2IDSA 5E94A 4YWGH 3RWIB 3W9DB 1KIUB 2FQEA 2Y7QA 3GSQA 2WV3A 2YUVA 4RZCA 2PW2B 3NH7H 2YOCA 4TL5A 1K5NB 1EANA 3GMMA 5HI3C 2UX7A 2GSMB 2N4IA 3A5VA 4Y9GA 5ECJE 3VD9A 3QQ4B 4ZBJA 3LPFA 4DUWA 3WJJC 4ZMQA 3F62A 4YBLB 2P5EA 2OCCB 1PG7H 4HFUH 4ABQA 1NPJA 5JW3L 1K6QL 4F7TA 3KYMB 5K9KB 2QDVA 3PHQA 5C86A 1HOEA 1JN6B 3C5XA 3PGCB 1SOKA 5DGRA 2F1EA 3U2JA 1I8MA 3CWGA 1UYWH 1NL0H 3C60D 3A47A 3MNZB 1JUFB 1RSYA 3JV6A 3MRRA 4H2CA 4RWYL 1JZ4A 1QKZH 5CGTA 4Q9RL 2PABA 3RKDC 3GZOA 1SQMA 4Z23A 3ULVC 3V7AE 3OSKA 3DX7A 4Q8BA 4U4IA 3DSFL 1J8HB 4HZLA 5IEKB 3KLAB 1UOKA 4K9EC 4PJ7B 1F6FB 3K0YA 4F3FB 1FLRL 3SDCA 3MJ8B 4FFYH 2NY4C 5AZ2H 5MI0C 3IDJA 5IMLB 1KDJA 2H2SC 4KK9C 4XBEH 3TJPA 4LIQL 4W9ZA 3UAEA 1QSEA 3MRLB 2HH0L 1G1OA 2VDRH 4RIRB 3WENA 3KLQA 3FSWA 1U91A 5FUCC 1AIFB 3K2KA 5LAXA 2VLJE 3NFPB 5CMAB 3PWPB 4BUGA 3H9YA 4HC1A 3R1GH 5EUOB 4POYA 3LKQB 3NJIA 4N3TA 1OT1A 1JGUH 4HX1B 5KANG 4HJ0C 1X9UA 5C0FA 5MERA 3F00A 4GXVL 1WO2A 5CP3H 4HS8H 1GKOA 3NZ8B 1OANA 3QQNA 4LKXB 4X7TB 2IGLA 5I0ZA 3CQQA 1JYWA 1FAKT 2BIOA 4Q0XL 3IDXL 3ZIYA 1DBJL 1PIFA 3PPEA 2D3VA 3ULVF 1II4E 3K6DA 4K5MA 4EZJA 3GSVB 3PHSA 4LPXA 3JV5A 4ZOBA 3GMPB 2I9TA 3INOA 4JFYA 4P46B 5IHUL 2PXYC 3LEXB 3O6FA 5J13C 2E76C 4OZHB 1HL4A 4WF7A 1I8IA 2GITB 3IAPA 3MLVL 1BQKA 3FSOA 1C5BH 5IJVA 4GAGL 1JZ7A 1IQWH 1H5BC 1RUKH 3DMMA 1FZMB 2X4RB 4G9FE 4YHLH 5FDYA 4ZW8A 4DQAA 1E7VA 1R5IB 4FXTA 3KGTA 2EVFA 3DI3B 1L4IA 3US9A 4Z9KB 3K2IA 4MB5A 1Y6KR 5F44A 5IW6A 5T3XE 4BZ1A 1INDL 1LO3H 4FXKB 2N7BA 1IGCH 3AQZA 1A5FH 3TBYA 4JDVB 3B34A 2R2BA 3KYNB 5JNYA 3ROOB 1HHKB 4X8JA 3OG4B 5IHLB 4V1DE 2WUCL 2KYIA 2ZX6A 1DVZA 1HQ4B 4NXKA 2FWOA 4PJCF 2QEJA 3BOVA 1YEIH 5F7UA 4M61A 2HVJA 2CUMA 1MI5D 1ZK5A 3VFPA 1Z9SA 3IJSA 2E9BA 2H3XC 4AT6A 1S7WA 1AS6A 4X4KA 4UINL 3O2DL 4DETA 2JB6A 4OI7A 3WDJA 3IM1A 1LMIA 1KIPB 4NHUA 3A24A 5IVZA 4DNLA 2MQ0A 3KBHE 3F84A 4LAQH 3Q1SH 1JPFB 1YYCA 3SDDC 5AVXB 2CALA 5KSUA 4IDJH 2XTJB 1ITBB 2BS9A 4I3SH 3T0EC 4F7CB 1P0SE 1VA9A 3F5WA 4E9WA 1OPGL 3EFFA 3Q06A 5JA9A 4GRLC 4AKOA 4OLYL 2R39A 1IL1A 4HLJA 4ZW3A 2JCWA 1RL1A 3M1CA 1A6VH 3FOMA 2XQYG 5HJBA 3R06B 4OF6A 1C5CH 3APMA 3QHZL 1RMFH 5IBUB 2N3JA 4NB7A 1OAZL 3E0GA 4BSJA 2QGDA 3B5GA 5E99L 1B4JH 1JD9A 2VC2H 3VFVA 4D9QE 4OGAD 5T1LA 3JVFC 4JG0H 5FV2A 1SLVA 4JL1A 4I1NB 3PDDA 1DJZA 3CQPA 1FGNL 4G9FB 4L4VA 5F88A 3BQUA 3ML8A 3QRGH 3LS5H 1KB5L 1KY7A 1YMMA 1PZ5B 2XG5A 4PJXA 4R4ND 3ULSB 5C0BB 1A8JH 2NUTB 3BP6A 4ZAKA 5D5MF 1AS7A 3BD4A 1U8PB 3UCQA 2RMNA 4RH4A 5DO2C 4DP5X 3MBWB 2GTWA 4AJ0A 1UTDA 3TURA 1Y0LB 1QMUA 3FF7A 4V1DB 3VNYA 3G6AB 5LXGL 2EIKB 3MODL 3UTSD 1X4ZA 4FI8A 4AL8C 3EYSH 4HIXL 1F18A 5DFVD 1VHPA 5K1NA 1BG9A 1KG0B 2CLRB 5SWZD 4MA3B 4F2MA 1I7UB 1CWVA 4KTDH 5T33H 3DJTA 3EYFA 3VFRA 5IEHA 3AS2A 3CZFB 3AREB 2E5EA 3P2DA 4NC2B 1BW8A 4MHHG 4ZUWA 3ESMA 1KT2A 2H8PB 4ANXA 1QSEE 4P48A 3GHEH 3BPOB 2YUXA 1KBKA 5I1EH 1AVAA 3GSWB 4R90L 1PG7W 2CK0L 3N5AA 2BSDA 2UV3A 5I5IA 1E6JH 1KJMB 1LE5B 1U8OB 5H37A 4G42B 4NHCH 4JZJB 3MBEA 1NDMA 3DPBA 4O58H 4HUVB 2M1KA 2FJGB 2FB4H 3PL6B 1FE8L 4ZW6A 1IU1A 1MRFL 3OKLB 1I7ZA 4B5ZA 1KZQA 3D50A 1NBZB 2MOQA 3D4CA 4FNTA 5DEZA 3WY3A 4EKXA 5HBBA 1EEQA 1G6RL 2Y7QB 3SZ6A 4NNPH 5EBMB 2ORBH 3IRZA 5J9PB 1T3FA 5DJCA 3U7YL 5I8CB 3GMMB 1M1SA 4ZW7A 1AIZA 1IT9L 2J5LB 4K94H 5E9NA 5TPWL 5C7XH 1QR4A 4M5ZH 3HFMH 4X0NA 4NBYB 2P5EB 5E2VL 1YJDL 4R7VA 5DT1L 3WIFA 2YXMA 4N1CA 1U33A 2FK9A 1P4UA 5EUOF 3N04A 5IROD 1IGMH 3PHQB 5IV2B 4MB1A 3L48A 4NZUL 4OFKA 3ZTNL 3NGBC 1N3NA 4WJKB 3L3HB 2HKFH 1GOFA 4FXKC 1W8OA 4GPVA 3NZHH 2WBJB 3JV6B 1U3YA 4K8RC 1F5WA 4ZUVB 2BFVL 1YEKH 4NQCE 4X0KA 4KRPC 5ETUA 2VZVA 4GSQA 1JPGA 4J7RA 2A3TA 5HDOA 2AJSH 3DX7B 3ZYIA 2KHAA 3Q6GL 3T0AA 3ZTJH 4PIBA 4XWOD 3O2DA 4J4PC 2DB8A 4AEIH 1YPZF 3UTOA 1G0DA 4DCQB 4UOJA 2J12B 3TH2T 2VRKA 4UT6L 1DEDA 4GBXC 1QNIA 1MOEA 4KQ4L 1TETH 4EDWH 1U91B 4G7YH 2MOVA 5LAXB 2ID5A 2ESVD 2ZZUT 1AG0A 4YL9A 4MQ7B 1IGJB 3IDMA 2XTJC 3LIUA 3U7AA 4HIQA 4LU5H 4NYLA 2A0LC 1DQKA 2V9UA 3F83A 1KNOB 4BJLA 2FJFA 4LLMB 4DH2A 5MERB 3NCJH 3RGBA 3UZEC 4P3DA 4XBGB 4HKJA 3NSJA 4EKJA 1A6ZB 5CN1A 4Y4HD 2RALA 3K8KA 3M07A 2CR3A 4JRXA 2P1YA 4FP8H 2RQEA 5I30L 4EJ1C 4XP1H 1CXHA 4NENB 3P0YH 4L8CA 3CSFA 4KXDA 1O7VA 1KB5A 3HMWH 5HHXH 3FRPA 1UFUA 1UHVA 2J25A 4J12A 4JFYB 5J6GB 3BEWA 3II2A 4LCUA 5EF2A 4BRVA 2OMTB 2VERA 5I1GL 5ACMA 4QNPE 5KS9A 5DSCA 2DD8L 1GYUA 4K3HA 4AZ8A 4YDNA 2QQQA 5MHSE 1U3HA 1W8NA 4Y8DC 5IJVB 4ZOCA 3QO0A 4L4VE 5F7NC 3GSRA 4S1RH 3PWLA 3RFZC 1BYNA 1ORSA 5J6HA 1EEUA 2H0FA 1YMME 4I88A 4PJXE 1A2YA 5GGRY 3LD8B 2VN6A 3N9GL 4ZXBC 2BVOA 4NNYA 2Q86B 5IW6B 1LYQA 4HHAB 1IGIH 5DJYB 1Q90A 4IKJA 3W38A 4X8JB 3UH8A 4NZFA 5I17B 1JRHI 4LIQE 4M8UA 4CMHB 4PJGF 5LG1A 3ZU8A 3OXRA 3WSQH 3ULVH 4M61B 2HVJB 2GBAA 2PO6D 3BPOC 1EAQA 4YEEA 2ZONA 3EJPA 5IP4A 1Z9SB 4K9EH 5ES4B 3RUGF 1QX1A 3BVWA 1BWWA 4UB0H 1M71B 3BLKA 2XQBL 3M1BA 2KI6A 4F2ME 4JZJC 4PI0A 2EDYA 2C8NA 3FN0H 3L1EA 4J27A 5HHQA 1RVFL 2I7SA 2ZCHH 1TYJA 3VQ2C 2BY1A 4HUKB 4NHUB 5TF1H 5IVZB 2V3FA 1WT5C 4O5LL 1KUMA 2EC8A 5DZPA 1HZKA 5IK3A 1RUPH 5AENA 4WO4C 5IIEB 1G6RA 3P3TA 5DRXA 5C0AD 3E1ZA 3QNXB 1CDCA 3HJ0A 4XMZA 5GS0C 1X7QA 2Z3FA 4ABUA 2HRPL 5CIPB 4F9PA 3VD7A 3EFFB 4WFFD 3FUIA 3HA0A 1WFNA 5K33A 2XBZA 5E9DD 5EPMA 1WHOA 5ENWA 4JKLA 2J5LC 3D25A 1ETA1 2Y5TA 5BZXA 4MMZC 4QRUB 4WW2A 2ZOWA 2GKIA 3X3FH 4FYTA 1J1PL 1UCTA 1FL3A 3UO1L 3OKOA 1CU4H 2H2PC 4Z3TA 3VFVB 3AXHA 5CCHE 3FCTB 1G1YA 4PG2C 2CMRL 1RZJC 1F2XK 4L4VB 1B88A 2ROXA 2V7NA 5F88B 4OIBA 1AYRA 1ZHKA 5AOMA 4MX7A 3QUZB 1YEEL 3N41F 4PJXB 4O2CA 2M2DA 3E9UA 3I2CH 1VFAA 4M1DH 2BSEA 3VFNA 5EORH 1CXLA 3GYRA 4FI7A 5DWUL 3S97C 4DO6A 3ZKXB 3C5JA 4X6FB 4H13C 4XNQA 4R96B 4WV1A 1EIBA 2EUWA 3CU1A 3D6GA 1ZD6A 3HRPA 3TS8A 1KPUA 1TVHA 4P5MB 3EXLA 2FBJL 1YECH 1E6OL 4LKCA 4WI3A 4Z7OE 1DLFH 1TXKA 1FYTA 4HGMA 2IGFL 3VGDA 1E4HA 1SMAA 4TQEH 1KTRL 3IWVA 4UIKL 3T77B 3KL3A 4C4UA 5EN3A 3PP3K 1F0LA 4EBQH 3DX4A 3MYZA 2Z35B 1YYLL 3NJLA 3RURA 4Z3EA 3VFRB 1K5WA 5IEHB 4TM9A 4KKLC 2EKJA 5EBWB 3T2PA 3DX3A 5L0QB 4HOMA 1ZANL 3G5XA 1SBSL 2R7EA 2JJTC 4APQC 5E1GA 4F57H 4ZPTB 3DX6A 1RCYA 4JM4L 1HCFX 4GSXA 1KDIA 4KU1A 2YUZA 1E28A 1XFPA 2HB0A 3KS0J 1OZTG 1IKOP 4XPTH 4F7EB 4E42B 2YN5A 1UXSA 1YY9C 2NLJA 5IZ7A 3VDCA 3VQ1C 2NTFB 1ET8A 2V5RA 1I7ZB 4WU7A 1NLDL 3VFTA 1T2JA 1YNTA 2MCPH 1THAA 3QPQC 2VWEC 2B39A 4NCC2 5CJQH 2EYTA 3L3KB 3IN2A 4FFWD 3T2OA 4JRXE 1OSZA 5DJCB 1DVQA 1EAOA 1IFGA 2YA2A 4FA7B 1MUJA 2UY6A 1CGSL 2A9AA 4TLKA 5IWLA 1E65A 1NEPA 2ZSVA 1CICA 4QT5A 4NDMA 1U8QA 5H94A 3M17B 4XXWA 3MRHA 5C2BL 3C5ZD 1ES0B 3EUUA 5I1CH 4JKKA 3TYFB 1YQVL 5F3BB 1A3LH 2QTVA 2V8LA 3VXSA 2F54A 5C3LD 1WFJA 4M8RA 4OJCA 2FTAA 5CEZL 3W0WD 2IFFH 2P8MA 1RY7B 5KS9E 4LGRB 1N3NB 1KLUB 2VUYA 5JUEH 3WV0A 4FNQA 3V0JA 2KDYA 4HIEB 5CILL 1N2RA 3CDFA 1MWAH 1TZHB 4X0KB 3NCFB 3PQYA 4N2FA 3LV3A 4X5PA 1VSCA 5DK0A 5ETUB 4EEEA 4CMHC 3CH1A 3Q8FA 3BH8A 5EIQA 2PUQT 3W2DH 4W70A 3PDOB 3TWYA 3TT3H 5IOKA 1HESA 4CDGC 4Q9CA 4W81A 1F45A 3RWHA 1T5KA 3L4XA 5C08B 5LQBL 5FECB 1M53A 3SYAA 4AIOA 2CLVA 4AL8H 3DX9B 1IAIM 4OBSA 4PCSA 3K5RA 2CKBH 5GS2H 2CR0A 5GGUA 4LSPL 3TXAA 2VB5A 1F56A 3CN1A 4I18A 3WUWA 1ZLUK 3BAIA 3HNTH 5KVFH 1KPVA 4LSUH 1P5UA 4FD0A 4U3SA 4ZUUA 3B7SA 3T0VA 1UEYA 2DQIH 1CTOA 1XSKA 2FJFB 1XBDA 2BIHA 2IBZY 3JWOL 4NZTL 4RNRA 4X9IA 2QKIA 1HS6A 5BUGA 4LSQH 4P3DB 6PCYA 4TVPL 4XCNA 3I74A 4U3CA 4IK7A 4A2HA 2DIBA 1D5IH 3QDMB 3ZVVA 1JTOA 2BH0A 3GNMH 1WAPA 2DEXX 3A22A 4NKIL 2RTTA 5ALCH 1ZT4A 4WI2A 3BUIA 4L8CB 3MLUH 4S1QL 5I1IH 1KB5B 2QZ5A 2J2ZA 5D1XA 3QUZC 1U8MA 2WM0A 1KXTA 2WUBL 2Y1VA 1MCWW 3ELQA 3ULUC 2IDCA 1EH9A 4RISH 5E1HB 3BEWB 2ARJA 1KYOK 3C8DA 2EDDA 3ESOA 4KUZL 1KGXA 4PJ5A 5HYJB 4EDXB 3B2MA 4FQIL 4HK3N 4OCMC 1CDHA 3FTSA 1U3HB 2KDGA 5E95B 4IBQA 4B6ZA 3ASNB 2EDLA 3QO0B 4WKZA 2VO8A 1IKNA 3GSRB 4ZMVA 3HE6B 1JTTA 5J6HB 1CD0A 1RPQA 4P5KB 4QR7A 5C07D 1A2YB 2XPGB 1JNHB 4OF5A 4D94A 3D39A 5K1VA 4NNYB 2ZX7A 3VWJA 1VZIA 3FN9A 3QDGD 2D03L 1G0YR 3MO1B 2PF6A 1DQDH 1INQB 4OB5L 4J3VA 5EWIH 4F8QA 4AV0A 1EO8L 1CB4A 1NDGA 3HZMB 4K8RH 5DVPA 4HAGA 5L0QC 4B9FA 4P23A 2E74C 3OJ2C 3OXRB 1FYTE 5D4QA 4N9OB 1AR1C 2CLZA 4GIAA 4YX2H 5L88H 2J8UB 3Q6FA 2FIRT 3M1BB 4GKLA 1TF4A 1KBGL 4HKXB 1WBZA 2WK2A 3RKDD 2B2XH 4XAWH 5HDBE 5HHQB 2ATAA 2B1HL 2CDFA 4XT1C 3ULVD 4PJEA 1NCWL 4PJFF 5I1HH 3ULUF 2XPZA 2AZAA 3EDDA 1WDAA 2OZ4L 5J06A 2G60H 4MDIB 1JSYA 4QHNA 1TNNA 2JCCB 3QZWA 4L9DA 2NY4D 4LOFA 5IK3B 5DRXB 1J7VR 2H2SD 1CFSB 4KK9D 4MYWB 3MZGB 1SJXA 5DD0L 1X7QB 3I9GH 2XA8L 2HN7A 1BZ9A 1JTPA 3B9AA 1RZFL 4EUPG 1KENL 5E0QA 1G7QA 2YJLA 3NG5A 3U0WH 3EOTL 3D25B 5TQ2H 2F53B 2E27H 5BV7B 1IC4H 5TGBB 4LVHB 2CU9A 3O0LA 1MZYA 2BY3A 5HHME 3OKOB 1SEQL 1WWAX 3FTZA 2AEQL 5FGRA 1FVCB 4HJ0D 3V6FA 2X2JA 3VXOA 5IMKB 1ONQA 2EIEA 1ZXKA 2V3DA 5JR1H 3RILA 4YR6A 3K5SA 2BNUA 4N87A 4GIOA 3AFLA 4ZX3A 2N01B 3S35H 1V27A 1ZHKB 3ETTA 2L7UA 3IS0X 4MX7B 2A77H 2ZUXA 4ZMTA 3KWVA 3DHJA 3VFNB 1MAJA 4K0OA 5HJGA 3WXWL 5LXVA 3FYEB 4WEMB 4NOBA 3SJVB 1AP2B 2Z31A 2NT1A 3FTGA 5FYKL 1A1OA 4MS6A 3VXSE 1S5IH 4AGNA 2F54E 3VFUA 2DI9A 4FQLH 2WBWB 3V79C 1I1CA 5C0GA 5I18L 1M6OB 1C7TA 4L0PB 1FGVL 2W9LA 3U4BH 1JK8B 1JFQL 2QQLH 4LKCB 4KMTH 1NMAL 2PXYD 4GQQA 3N1GC 1MNNA 3PQYE 3OAYK 4GKSB 5K5YA 1XCTA 2OULB 3AROA 2ATKA 1MG3C 5JO5A 3KPMA 3QVAA 4N5UA 4PN6A 1NGWA 1CL7H 4R7LA 3LKSA 2WCPA 2RB8A 4KMLB 1NBQA 1I1RA 1M1XB 2CHNA 2V4LA 2X2IA 3BPCA 3PV7A 5HDBB 1L9MA 1URIA 4X4YB 5J5EA 4LMQE 4ES9A 3N42F 2OX5A 4M43L 1IEHA 5EU3B 4MA7H 2R7EB 4MD0B 1IRAY 4PCTA 1XGRA 4NJAH 2ENQA 2RGSA 3C5SA 5JOFA 4JMXA 1KGJA 4YHOL 1X5YA 2DMKA 2LFEA 4H8WL 1WAEA 3FF8A 4JFSA 4QRPA 2OV0A 1AGCB 2BP5M 3TBWA 3FUNA 2ZYIA 3G5YA 3MLXH 5L2KA 2CKNA 5GZOD 2E6JA 2HLAB 4RAVA 3V4UH 3JQOB 2DQFA 4Z7VF 3K6IA 4WU7B 2EXWC 2EDHA 5HPMB 4WY7H 2VDOL 1YNTB 4JGNA 2DJMA 4EUPH 4BXSV 3FUDA 5GS0H 1VACB 4AE0A 1OSZB 3KVDD 4BWTA 2X6BA 3DTXA 5CBAA 1ILSA 3DRQB 3N43F 3QCUL 5IJKA 4X9FA 1MUJB 3TA3A 4HSQA 1LWJA 2ZUVA 3MV9B 1A7PH 3P77B 4F27A 2MTPA 5H94B 3SDDD 5D1XE 3MRHB 2COQA 3TWCL 3T0ED 3HE6C 4MDJB 1JAEA 3QB7C 4ODUA 3UYRH 3GMLA 4LHUA 1IAKA 2PPAA 4BKSC 4UT7L 4PJ5E 2K3TA 4GRLD 2VQ1B 2W5PA 3V4VB 3TFKC 2L7EA 3MLWH 5FHBL 5FGSA 1RZJH 3QFJA 3ZKQD 5EIIA 5LB1A 1NBCA 2XOTA 4KH9A 1D5MA 1I9RL 4HJUA 4XPBL 3DV6A 2NTSP 5DK0B 3LV3B 2EDTA 3NZSA 4HCRL 1VKXA 4BFIA 3F12B 5C0DA 2XBTA 4F93B 3D39E 1FN4A 3BZDA 2C9VA 3PWVA 1A21A 2YRPA 2JKLA 3AS3A 3SZKC 2D0HA 3MRGB 4Z78B 2CDEA 1IKFL 2WZPA 5I6MA 2OZ4A 4AYDC 4NFDA 1KXVC 5LGJA 1AKJB 1WS8A 4YSRA 2H9GB 2ZUQC 4XO5A 5DO2D 5FCSH 3B7UX 1ASQA 4L9LA 5JHDD 4HXAL 4URKA 1NUDA 5INCB 4H88L 4I18B 4QF1A 5F2FA 2H6PA 3UC0L 4Y1AB 4ZUUB 4JVPA 4OIAA 3QWNA 1IM9A 3DXAD 4PJEE 4PQXA 1KTBA 4RNRB 4BBWA 5GS2D 5IG7B 1HEZA 4JG9A 4ZMNA 5BV7C 4LVHC 5CNHA 1E3ZA 1P4BL 2LHAA 1MF2H 4KHTL 4G1MA 2ZPKH 4DGVL 2X4PB 2DW5A 1Y18B 3EH4B 1JRHL 2XA3A 4J6IA 3V0VA 1ZT4B 1L0XA 3VGEA 3EUDA 1AHKA 4G8GB 4PJ9D 2GG1A 3SBPA 5D1ZC 2J8UF 3EH3B 3P9LA 2G30A 3QEGL 3NEEA 1PZAA 2DQTH 4QRSA 4PJ5B 4DUVA 5CEZE 1XCXA 2BDNL 4Z3GA 1WA0X 3L3IA 5AVUB 3AS0A 1CIUA 4TNWK 4DAGH 1ZVNA 2O6EA 4FNRA 1F6AA 2WXQA 3O6LH 1T4WA 2EAEA 4P2QD 1D7BA 1E4XH 3AMKA 2JCCF 1IBGL 5D8JH 5DJAA 3O6KL 4ELDA 2E9JA 4RAHA 4TNEA 4UQIM 1MIEL 3VWJB 4A7GA 1R3LA 4KI5D 1EXGA 5LGYA 3IF1B 5B3JE 3T65B 3RIAF 3CHOA 5J1TC 2GTZA 1B0GB 3ARGB 3VXRD 4OJYA 2HVKB 4OFDA 5GGSB 1EUUA 4X6BA 4PVMA 3UJJL 3V55A 1BF5A 5CJXA 4P23B 2VXSL 4PWEA 1GTNA 1C9SA 2CLZB 4OVVA 5KAQF 3GMQA 4Q2ZA 3RWGA 4OCSL 4W9KC 3QISA 2YSSA 3Q6FB 3ES6A 5AD0B 1GHFH 4TUJA 4X6DB 4YDIH 1CG9B 1X5AA 4K8RD 5FAAA 3S9DB 3FT2A 3LCYA 1QFUH 3PAUA 3E9TA 4KRPD 4NUPA 4IRSA 2GT9A 5DK2A 1NGZB 3RY5A 4HETA 5T1KA 3TASA 4HV8B 3WL9A 1GTFA 4A2DA 3H6JA 4N0RA 1ZTMA 1ULVA 4TVPE 1KN4L 4DQOH 4J4PD 1FJ1A 1CYXA 3ILPB 3FYIB 4XX1G 5FKAB 1MCIA 3ARWA 2IFGA 4PGEA 2HN7B 4QRPE 5ILTH 4GBXD 5CIPH 5CO1A 1UOWA 5D70L 4ODWA 3TNMA 1N8OE 1P5VA 3D52A 1G7QB 2CAKA 4FG4A 4FZ8H 4MJ5B 4HS3A 4QHKJ 4EF3A 5L2KE 1D6VL 5GSVA 2NY3C 4HSAC 1Y1DA 3UTTD 1BDYA 1YN6B 2RHEA 2JE8A 2YMXH 2CNZA 3GSNH 4RQQA 2A0LD 1KZYA 3O41B 3U48A 5C09A 2Y5QA 4KRLB 3V6FB 3VXOB 4CC4A 5IQLA 4XB8A 5KSVA 4XNZB 1KCUH 1CFMA 2BNUB 2CBQA 4Q58C 4W4OC 4Y4FB 5DRWB 5CM1A 4G83A 3SGKA 2Q1EA 2AQRA 4LF3A 2WYIA 4HCRA 4ZODA 1KCSL 3ULUH 1HIMH 3FTGB 4UT9L 5B38A 3SBQA 5TFSH 2F5BL 5A2AA 4LCCB 3VFUB 4BA8A 2VQ4A 5C0GB 1USQA 3VFMA 4U1KB 4Y19B 3JTSB 3QEHA 1FFTB 1OP5H 4IHBA 3ARYA 4AK1A 5E9AA 4AC4A 4N6RB 5JPNB 3FSAA 5DQ9A 4JKMA 3E7JA 1S7SB 4GMTH 5I6XB 3BGFB 5AAWC 2ZXBA 1XCTB 1KFAH 3MJ9L 1K9TA 2ARWA 5BRZD 4PJ8C 3KPMB 1MEXH 3CFUA 4GMSH 2OYKA 5ECGA 4RFOL 1VFMA 4N2IA 1CD1A 2XWRA 3CZLA 2DQ6A 3LKSB 4BEIA 1ZLWH 3VB9A 5JORA 3BPCB 5D1QB 1SJEA 3NIFB 4DESA 3CZUB 3AS1A 4ZMAT 4D9RD 1NEZG 1FZKA 4ZXBD 5MEOA 4IBWA 5GRUH 3Q48A 4Q97A 3C5SB 5ICXA 5HDWA 1FL6B 2EUVA 4YSOA 1L9NA 1COBA 3PWJA 2J44A 4BINA 1Z1WA 3V9EA 1NGPH 3SKJH 1KGYE 3D0AA 3P40A 5I19H 4HMEA 1BXAA 5L2KB 4CVXA 4QCIA 4AE1A 4XAKE 2P24B 4RAVB 1QSFD 1RIUH 3LNIA 2PPEA 4CVZA 4XP4L 5L9DH 1NCDH 1JMXA 4PJIF 4QRQA 3SKUD 2HVBA 1MHEA 2V2WA 1ED3B 1M57B 3TJHC 5CBAB 1EXHA 3SKNA 3KYOA 1S9VB 4FG2A 15C8H 3VWKB 4U2YA 2X44D 4WO4D 1IGYB 1KGCD 2NZ9C 3KYKH 1B0RA 4ODUB 5GS0D 3QR1A 4NM8H 5FYKE 1AD9A 3OKMB 4WU5A 3UMTA 3CFKB 4N68A 1OOAA 1RUML 4N2OA 2ITDB 1FFRA 5ANMA 3QFJB 3LN4A 5EIIB 4P4KC 4BH8A 4AEHL 1AZUA 1D5MB 2R69H 1RJZA 3ARGC 4QXUL 4Y2DA 2W91A 5AW9B 1QBLL 4W9IC 1VKXB 4BFIB 4YDVA 1HOCB 1QWUA 1A4JA 2YQBA 4PRAA 4LCIH 5I6KA 1XHHA 1PBYA 4PRIE 2YKKA 4XXDA 4MJIA 3BAEL 1ODAA 4B3VA 4H44C 2L04A 1IJ9A 5SX4I 3ETSA 1UD5A 4GP8B 3TEYA 4E5XG 2BP0A 2ADJA 2EIZB 5LGJB 2Z6FA 4N2BA 1DJWA 4WTWA 4NO5B 2AJVL 4Y5YB 5DUJA 1VEMA 4AQ8C 9CGTA 2OJEA 4ZFGH 3KWWA 1Q9LB 1ID5I 1E4KA 3GI9H 2MCG1 4CSPA 3IDIB 2Z34A 1UWYA 3HS9A 3MXVL 3WS6A 1N5YH 3MKGA 2ZTBA 1MRCH 4U7SA 4AMWA 1D5BA 4H1LA 1KYAA 1DBAH 4KVCH 1S7QA 3BVTA 3TF7C 4ZFZA 1SDDA 4KKLD 2AQ2A 3BWZA 4G1MB 3CE1A 4XCCH 2JV6A 4O9HH 1UA3A 5I74C 2NSXA 5DC2A 4APQD 5HGHA 5I5MA 2ZWKA 2OTUB 2FT8A 2K8QA 4JJHA 1QZNA 5KAQG 4XNZC 2X6UA 1QG3A 1OM3H 5IQNA 2R2EA 3AG3B 3TNNA 3BZEA 4UT9A 4GW1A 2H26B 2OYLA 4DGYH 3GUTA 5CP7A 4TRPH 4X6DF 3S37L 4H2AA 2DM4A 4IRJA 1YY9D 4LCCC 4W9EC 4TUOA 4X4XA 5C09E 2F8XC 5EZLA 3AB0C 4I3RH 1QFWH 4U1IA 3QYMA 1W8EA 3QCVL 1F6AB 1R47A 3LXAA 4JFFD 5I1JH 4QPEA 5EO0A 2ICWI 4MRBA 1QSVA 3QPQD 5CHNA 3MNWA 4E9SA 5DJAB 1KJ3L 3DX2A 1GJWA 3MJ9A 3BGFC 1R3LB 2A1WH 5JIPA 2IOOA 3QPKA 4K5LA 3CZEA 4XMLL 1BIIA 5IT2H 5DDHA 4RA3A 4ANUA 5D1QC 3OC8A 4JM0A 4FQJH 2HT2C 2VN3A 2X4TA 5JHLH 1C12A 5EEUA 4B50A 4OZIB 2NCMA 4XE0A 3WXVH 3RWGB 3L1OH 3MA9H 4NCC1 2YSSB 2NW2A 1C08B 3RX5A 4XE5B 1TQTA 4RSVA 4QXGL 2HT4C 4IRSB 3ZZSA 2GT9B 3BEVB 4GW5B 3U0PB 3HZVB 4GG6F 1MHCA 4I89A 3ZBMA 4XC1H 2O93L 2F2HA 3MKKA 2AQ1A 3VGHA 3FTVA 4LE8A 1BX2A 3TCTA 5KWYC 2QPUA 1A6UL 2VDOB 1U2YA 2WTOA 4UU9A 4PGEB 4MCYB 1LDSA 1LMKA 3UO8B 3Q7JA 3TNMB 3EYUH 1KCVH 1NCCL 1P5VB 3L95A 5HYSG 1S7TB 4AQOA 1ICTA 4J3BA 2AV7B 3FHQA 5DJZA 2PYEB 3EHBC 5E70A 2B5IB 1GOHA 3VWKC 3HC4L 1SY6L 3AC0A 3ETBF 5BV7H 1FFNA 4PB9H 2QQNL 4DK5A 3VXMB 1ZGLB 5C09B 3CSPA 4HJJH 3LH2H 3HAEB 5KSVB 3NIFF 2R56H 4MMXA 2WO3B 1SF5A 1H19A 1K8IA 3U9PH 4PWFA 2VXUL 1QASA 1A1NA 1T0OA 1EK3A 1HH6A 2LR4A 4GRWE 4OLEA 2IO5A 1G7JA 1O6VA 3V8CA 3B9DA 1JNLL 3SYPA 4K3EH 5ANME 3SY0B 3ZMEA 2X9YA 1G7IA 4A66A 3M7FB 4KTYA 3ULUD 1SMDA 3QS2A 1JF1B 3C87A 3QBTB 5DQ9B 3FCSA 5LCVL 1XAKA 1T1WA 4YHIA 2VTFA 2W95A 3GM0A 2F61A 4WJ5A 5BVJA 1H8LA 4B9IA 3C12A 3KJ6H 3KXFA 5E7FA 2ZE0A 1QRNB 1CD1B 3P11H 1EMTL 3D2UA 4MJIE 2V5SA 4XB3A 4J8RA 4JG1H 4DPBX 1PTZA 1FPTH 3CXHJ 5IF0A 3QDJA 3NEOA 1R3HA 1FZKB 1F3JA 2PR4H 5MEOB 1X7SA 1O5PA 4AVJA 3HC3H 2UZIH 5ICXB 5JIMA 4LK4A 4U1MB 4YHZL 1AD0A 3MLPA 1AKPA 3RNQA 3QXAB 4QOKA 1OP9A 4CVXB 4NZRH 5E8EA 1AR1D 2ZXWB 1MVYA 2QVMA 1YEJH 4HEPA 1GGIH 3SBWC 1LXMA 4PUBL 4CVZB 3P9MA 5KBNC 4G3YH 1XL4A 2WVSA 2G75A 4QRQB 3ZT5A 1MCOL 5FYJE 3FB5A 4KC3B 2MCAA 3ZKMC 2X2UA 3CZGA 4HAFA 4S0SD 2GUOA 1UH2A 2R0ZH 1PZ2A 4GRWB 1H3WM 3EIFA 3OKDB 1EEYA 4GRMB 1E9QA 4BGLA 3Q05A 3NSCA 4TKWA 1IBHA 1FWXA 3DOSB 4WU5B 3DETC 3ARDB 1P7KA 3TBSA 4Z8FH 2J43A 2DWSA 4KUCF 2AK4A 3OHMB 4KFMA 5F1OB 3VJ6A 3QPXL 2OSXA 3V4VH 1BZ8A 2DWYA 3FT3B 3ARRA 2WXFA 3RTQA 4K5PA 3CDGA 1XR9A 1I1AA 3O3EA 4Y2DB 5F7LB 4L05A 1AXIB 5IW3A 2C9XA 3DDGA 4ANWA 1HHHB 2Y25A