3PU7A

Cu-zn tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical Properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3pu7A00
4BCYA 1DSWA 2WWOA 1E9QA 1E9OB 2GBVA 3KBFA 1TO4A 4N3UA 4N3TA 3CQPA 1SDYA 5CU9A 2WYZA 2AQSA 1OZTG 1RK7A 1ESOA 1IBBA 3KM1A 1F1DA 2VR8A 1SRDA 1CBJA 3KM2A 1IBFA 1F1GA 3GZQA 3GZPA 1TO5A 3RE0A 2C9SA 2R27A 4L05A 1SXNA 2AQTA 1L3NA 4A7SA 2AEOA 3T5WA 1OALA 1PU0A 1QUPA 1KMGA 3H2QA 1YAIA 2V0AA 3KH3A 3LTVA 1S4IA 4MCNA 2ZOWA 3PU7A 3ECWA 3HFFA 1F18A 2APSA 3GZOA 3HOGA 3QQDA 4A7QA 4BCZA 1EJ8A 3L9EA 3L9YA 1Z9NA 3QQDB 1IBDA 3GTTA 1OEZW 4OH2A 1N19A 1PTZA 1JK9A 1IB5A 1FUNA 1EQWA 3K91A 1B4TA 4A7GA 2VR6A 2E47A 3MKGA 2C9VA 1XTMA 1JK9B 2Z7UA 5KBKA 3ECVA 1IBHA 1COBA 2WYTA 2AQRA 1SXBA 1HL5A 2GBUA 2WZ5A 4FF9A 3F7LA 1CB4A 1SXAA 2WZ6A 1XTLA 2AF2A 3MNDA 4A7VA 1SXSA 1SXZA 5KBMA 3GQFA 1AZVA 2AQPA 1MFMA 3SODB 4A7TA 4OJAA 4A7GF 1OZUA 1SOSA 2C9UA 2SODB 2K4WA 1P1VA 4BD4A 1XSOA 1F1AA 2LU5A 1Q0EA 1N18A 1Z9PA 2GBTA 2Z7YA 2WZ0A 1E9PA 3KH4A 2Z7ZA 2Z7WA 2AQNA 2NNXA 4MCMA 1YSOA 2E46A 2WWNA 2JCWA 1SXCA 2XJKA 1BA9A 1E9PB 2ZKWA 1B4LA 2JLPA 1SDAB 4U4IA 1BZOA 1E9QB 3ECUA 3KBEA 5KBLA 1UXLA 1OAJA 3GTVA 4A7UA 1DO5A 2ZKXA 3S0PA 1SPDA 2WKOF 3CE1A 1U3NA 2XJLA 3HW7A 1UXMA 3F7KA 2AQQA 3CQQA 2WKOA 2VR7A 1PZSA 2ZKYA 2Q2LA 4B3EA 1YAZA 1JCVA 1E9OA 1HL4A 3H2PA
chains in the Genus database with same CATH superfamily
4H25A 1J0IA 4J4PA 4GUOA 4FYSA 3PV6B 1E4WH 3EKCA 4BELD 2D9QB 3OAWA 4Z3HA 3HI6H 4LSVL 3VXMD 5E9DD 3DJTA 1MCWM 1NFAA 3BUBA 5GS0D 3QIUA 3LIZH 2FB4H 1I31A 3G5VA 3PWNA 3QDJB 1DE4A 5I15H 4GPVA 1MG2C 4O2FB 3DA0A 3MPCA 1J9RA 2P24A 1NGQH 3SE9H 2XPGB 1GHFH 2L7QA 4E5XB 3AU1B 1A6VL 4XRCB 4ZXBB 4Q58C 3D09A 1MVUA 4I7ZC 4R4BA 2MIZA 1TVBA 4QRTB 4YFDB 3SKMA 1ETA1 2QSVA 4Q0XL 5ADPL 5DEGB 5IQ9B 3S88L 1LYQA 4JN1L 2KH2B 3GHPA 1AAJA 1DQDH 1MFCH 1OAUL 4HH9A 5TQ2L 2ADJB 5TDPA 4YS4A 1KCWA 3OHXC 1KTDB 3N43F 4ES8A 5I0VA 2FO4A 1EEZA 4FX5A 1V3KA 1WCBA 1RHHA 2I07B 4BUGA 1SUJA 1OEZW 3FOMB 3VVWA 3I6KA 1HNFA 4NPYB 3VQ2C 1IAKB 1UM6H 2DM7A 5KVGL 4PCTA 1JPGA 3TZVC 4DFIA 5LN4A 2Z91B 1XD1A 2K6ZA 5ID1A 2ZXBA 1PX4A 3EGDB 4FTVD 4ELMB 3CIAA 4PJGF 1IQDB 3FN3A 2PWDA 3NGBB 4YVUA 4FJ6A 4FG2A 2AF2A 1IEAB 1HYSD 5L8LB 1TZAA 2X4OB 3VWKB 2CDFB 2BVUA 3RWFB 4XPFH 1OAZH 5DC0A 1HKLH 2C3VA 3QEGH 4JG0L 3INUL 4G9FD 1BEYH 2ZWKA 2CBTA 5D1ZC 4DKFL 1ZT4B 1QSVA 2DQMA 2NUTB 5ILTL 3THMH 1G7IB 3NCMA 4XTRC 4NAMA 3U36B 2I7SA 3V8OA 3K74B 4NKDB 5AKSA 5HVHC 4XNMB 4ETQB 4I3RH 1E7VA 3IT8D 3RU8L 3RIAF 4KJPC 3C9NA 1P5UC 5E24E 1KLFA 2IC2A 3KPRA 5DUJA 5EC2B 4TUJB 5C70A 4PJ9C 5IMOA 3HRZB 1T6WA 4ZUSA 4WCYL 1LO0L 43C9A 4H8WC 2IWFA 2ZD0A 2F58H 1RJLB 4ZQKB 3UZEA 1CXHA 5HDRA 2UZPA 1ND0A 1WICA 5SWSB 4IOIB 2HRPH 1MWAH 2YPVL 2XXMB 4CC4A 1DCEA 5LBSA 3WNLA 4KY1L 5A2JH 3D2UB 2ICCA 4ZFZA 2YAHA 4XXWC 1Z9SA 3CU1A 4KOCA 1Q9WA 4UV7L 5ENWA 2NSMA 3G6DL 1BZDA 5IB5B 2MEJB 3B5GA 4FQQA 1S2EA 3UTQA 5MENE 2EZ0D 4NZTL 1ID5I 4FG0A 5HI3D 2XWJA 1RD6A 3PHAA 5C07D 1YNLH 5L88L 1AQ8A 2ZCZA 4IBLT 2X4TA 1DQVA 4HCGA 1AIFB 4XCFH 2P8MB 1B4JL 1RPKA 2Y7SA 5GS2H 4GAGH 1THAA 4OR1A 3OMNB 4ONFH 1M3IA 3LRKA 4OZ4B 4I4WA 2C9SA 2A73B 2R27A 4Q7DA 1UACL 4I13B 4NFBA 5F9WB 3MRMB 3TBCA 3UPRA 1SHMA 4PS4L 5MHSE 4QRSB 1HI6B 3O4OC 4ZPTA 2GABA 4XWGL 3MLUL 2KT6A 1KGIA 3FQRB 3IDGB 5D70L 2CE6A 2QADD 4MQXC 3V0FA 4DP6X 1KXTA 3CSFA 5C6PB 2UX6A 1XHHA 2JI2A 4YHMH 3QQ3B 5DEFB 1O9WA 3I9GL 5T3ZH 4Z3JA 5C0EB 5E7FA 4OTXL 3MNMA 4MDJA 3D0LB 1OP9A 4ZX6A 1U3JA 3S48A 4N24A 1W2KT 4JFFE 3HB3B 4CDHA 1N6QL 1G4RA 2AQ2A 3HE7C 5LO7A 4G3YH 3AXHA 4YVNA 1UZ6F 1SF3A 3MFFA 3T6WA 2VOTA 4MJ6B 3CVHL 4PRAA 5IFJB 1NC2D 2QVFB 3MRRA 5I1JL 4XN8A 4PJ5E 1PFOA 4RIRB 3JVGC 2JKIS 4AIZA 1KXHA 5E4EB 4I1PA 1EDHA 4D7PA 5C9JB 1D5ZA 3BRGC 2BHZA 4M5YH 4OLYL 2H8PA 2WQWA 4YBLC 3PWPB 4N2CA 3ZTJH 2X87A 5KSBF 4UQCA 1FNFA 1QW8A 1VEOA 3OJMB 4C56A 1Q0EA 2GBTA 1YYML 4ERSL 3T3PE 3AC0A 3K6SB 4QCIA 3V0JA 1KZQA 1Y6KR 5AYUL 2LVEA 2JCWA 1JERA 3O3AB 2VDPB 4JFUA 2FEDC 1WLHA 2FECL 35C8H 4L4TA 4DN3H 4M8QA 5KOVC 3BN9C 2VR9A 3VACA 1ONQB 3KPLA 4EQ2A 3BD3A 4F7TB 5J0BA 4FQCH 5DJCA 1DBKH 2Y6SC 3L2MA 4A7UA 3S37L 1SLWA 1FVCA 4YDNA 4NCDA 2HFFA 2CKBA 2VDOH 1IM9B 2RHEA 2VLJD 2X4PA 1AGEB 3VCLB 3RWIB 3QEQE 2X40A 1I3GL 1FZJB 1DVZA 3QPXH 4FNPA 4K2UL 4F2MA 4DVBA 2NNRA 4FQJH 4M48L 5JXAL 3CFEB 2JQAA 3BUPA 2XZCL 4R7DA 3SDCA 4P46D 4L4VE 1B0IA 4BFGA 1GMIA 3WN6A 4YZWA 1EAJA 4NKOB 1OK0A 1P2CA 1VGEL 2R69A 3LDBB 4YLCA 4HLZG 2NQCA 4PJEA 3BH4A 4H25B 2CMRL 4JN2A 5M7QA 1W8OA 2GJ6E 1K5NB 1E7UA 1HOCB 3MRJB 2A38A 4W4NA 4OGXL 3PWNB 1DE4B 2VSCA 5EOTA 5L2JA 2YEQA 3MLVH 1A7OL 2AQTA 3N1QC 1KTBA 3WN5C 1R3JB 2AEOA 2KZ1B 2FX8H 2X2YA 1BQ5A 1G0YR 4OCWL 3SD2A 4Z3FA 2W65B 2WM0A 3AS0A 3WJLC 1MVUB 1MFDL 1MEXH 3FN0L 3ZPDA 4KZEH 4G6MH 4AE0A 1KOAA 3OD3A 3SKMB 4JRXE 4P3CH 3EHBC 3N5AA 3VTTA 4YXKH 3GMRA 3QXUA 2QGBA 5F1OB 2VZ1A 4XCNA 2E5EA 1XV8A 1TJHH 5HI4D 5TDPB 3S3JA 1NCCH 4K5PA 4WFHE 2FO4B 5I9QB 1WCBB 3FFCA 1RHHB 2V7HA 1A3LH 2WUCH 2FBJL 3H6AA 3L3KA 2BS71 5T3XL 5I5MA 4M5ZH 1YNKL 2W95A 2CGRH 3A6OA 3HKZA 5ID1B 1FBIL 3ABMB 2VERN 1HQ4B 4LVNB 4URKA 1EHLL 3MNVA 5D8JL 5ITBH 3H7BA 3DTUB 3EJYD 2WLYA 5IBTH 5KW9H 3GQFA 1CGVA 4LK4A 5ACMA 2KLSA 4A2MA 2EDKA 2YA2A 4PREB 1XF5A 5JXEC 1EANA 1ZCRA 3OKYA 2MQGA 4DF9A 5E9AA 4GXVH 2C3VB 2VLME 2XKSA 1ZHKB 3DHPA 4J8RA 4LLYB 3E0GA 3INOA 5BRQA 4XB8A 1I8IB 2ZICA 4UQBA 3TCXA 2PWFA 1TT6A 4PRPA 2WXJA 4JL2A 5FM8A 4GO8A 4EN3A 3Q1SL 1RUKH 4R7NA 1A6TA 4E41D 2FE0A 3BXNA 1UVQA 1QEWA 1BG9A 1A6AA 5IMOB 1ZV5A 1L7TL 4NHUA 4ZUSB 1GGCL 3JZYA 3DSNA 4DQOH 3EBHA 4GUPA 5ABDE 2D7TL 4MAZA 3EH4B 1R17A 1ND0B 1AOHA 2E8YA 3K0WA 4F91B 5GXBB 4JJHA 3FTXA 3NZSA 4KQ4H 1FAKT 1KYDA 2A9NL 1Z9SB 4JQVC 5GZND 1MNUL 3LNDA 1OGTB 3H53A 4YHNB 1M6OA 1GZQB 3UABA 1Q9WB 5C1MB 4P3DA 5A3IC 5D7JC 2A6IA 4H4NA 4MXVF 1YG9A 2CUMA 3RWHB 5E2WH 3B8YA 3RA7H 4R97C 2H45A 3QFJB 2C3WA 2X4TB 3KJ4C 4R8WH 2CCVA 2E7DA 1HIML 2GW5A 3QDMB 4PJ8A 3IU3A 2XY1A 3BH8A 3RVVC 1DUYA 1NDTA 2M1KA 3T2OA 4PGJA 5C0BA 4HZ1A 3EH2A 1T7YA 1OVZA 4OIIH 3GBNL 5B7EA 3HJEA 3BO8A 1U8MB 3TBSB 2Z4QB 3MRBB 3UPRB 3I74A 2YQGA 3EYQD 5SV3A 2J71A 5LWYL 1I7RB 2IV9A 1JMZA 4PRHD 3EOAB 5CLTA 4ZPTB 3FU9A 3SPCA 1AI1H 1X5HA 2Y36L 3HG2A 3W9EA 3GGWB 1H3PH 1U2CA 1NLBH 2OAAA 1KXTB 1PD6A 2AZUA 3RJDA 4FKEA 1C7SA 2ZWZA 1T04A 3C8DA 3VXSA 3K1DA 3HG0A 1ZJBA 4HJEA 4MDJB 3ULUD 2VXQA 2Y5TA 4GXFA 5EA0L 4NQDE 3LXAA 3R18A 3NCCB 1ZLEA 5DVPA 1KJ2L 1XTLA 2ZOUA 4FXKB 2W07A 3NCXA 4PRAB 3MRRB 1IEBA 4DUVA 2E4FA 2FJHA 3HS0A 2B4CH 3BKYL 4JO2L 5FYKU 1G5AA 2ERJC 2QLVB 1U8CA 1KDIA 3V6OC 4LSTL 4YAQA 3MRFB 3I6GA 3ARDA 1D5ZB 4WTQA 4ODSH 5DSCA 4P2RD 4JE4B 2H8PB 2JIXD 2AEQL 1T3FA 3DRQA 1HE8A 1AXSA 2FR4A 1J8HD 4AVIA 5KSBA 1DJYA 2YS4A 4FQ2L 2YC1A 3SBQA 2PETA 5L4FA 4TYUA 4QCIB 3FMGH 3OLDA 1QVOA 4AKPA 1SFDA 4ZSOE 5LGJA 3HG1D 4PSPA 4PPTA 3SKUD 3JV6A 4M8QB 1KPRA 2X6CA 2X89D 3KPLB 1YQVL 3JYCA 2PW1A 4Z7UA 2X44D 4L1LA 4TLTA 3LKSB 1SJEA 1FVCB 5CGBA 3MRCA 3NACL 3AB0C 2CKBB 2XA8L 3FU7A 2EC9U 2X4PB 1HCYA 1KWKA 1I8MA 2NY5C 2KZWA 4Q2ZA 2QQNH 4WW2B 1AQHA 3BE1H 1HL4A 3H54A 5T5FL 3O11B 4R7DB 4WENB 2XWZA 1EBAA 3QG6A 2FUQA 3QDGB 3A6BH 3FTZA 4JZOA 4WK4B 2D3JA 3VQ1C 1NAKL 3KVDD 4MCZB 3P0VL 4GXUM 5GRJH 1IM3B 3H42L 5E23A 2O5YH 9CGTA 1QG3A 4PJEB 2IANE 1U8HB 1TZGH 1BLNB 2YPLE 3FB7A 1M71A 5F1IA 1MHCB 1NOFA 4KX7A 3EYVA 1C12A 3CMOL 1CGSH 3F65A 4WSJA 3RHWF 1SXNA 1F6AB 3CG8A 3DYPA 3G6JB 3TEYA 4JHWL 1XIWD 3QZLA 2NY0B 5L2JB 3DHUA 3UTTD 1Q1JH 4F8PA 3EO9L 4GRWH 1MCRA 4YSDA 1KCUH 3KLSA 1EO8H 2OPCA 4A2HA 1YA5A 1MAKA 1PQZA 5IQNA 5E8NA 4ZS7L 1N8OE 4MMXC 2XG5A 3MO1A 4Q56A 4Y2DB 4YMPA 4K3DH 1VFBA 4YHKL 4ZW7A 3GMRB 1F3DJ 1U3YA 2YR3A 4OCXH 1DVXA 5CKGA 3BYYA 4UIKL 4J3TA 4YFLF 5HYIA 2FTAA 3BSZL 3LSOA 4U7SA 4WEBL 1R4XA 2FECI 1YN6A 3FFCB 2XFXA 4DKTA 5TDNA 3L3KB 2EADA 4W4OC 1LP9E 5DURD 3GHBL 3U82B 4UNVA 2YARA 1W80A 3C08L 5FDWA 3T0ED 4I77L 4JR9L 4NQSB 4LQ1A 5IVXA 1D5BA 5H37G 2W0KA 3BD4A 4UAOC 4F8OA 4Y2LA 4NZUL 3NUKA 1YMMB 1WWBX 2X4NB 3CDGA 5E1GA 4TNEA 2L8AA 4MJJA 4DUWA 2DI8A 3BPOC 3QUZC 4P07A 3NVQA 1QBBA 3DV4A 1G9NH 3S96A 4J8RB 2KDGA 2IDQA 2YK1H 1PKQA 3A4EA 5IB3B 2OQJB 5LNGA 4G6FB 2XJKA 4IEFA 1KIRA 3V4VB 2ZUYA 4Z7VB 1XF3A 3F64A 1A6TB 4N9OB 4R7NB 3H9HA 5SWZD 1P7QD 1QEWB 1UT9A 1C1EH 1AFVH 5L2KB 4OKVA 4DAGL 4L1BA 1S3KH 2D73A 4AI7A 4D2NA 3BQUB 4XNZC 3VI3F 3OLIA 4YK4C 1FFPA 4LLDA 4C8XA 5F3FA 4FCAA 1KEGL 3MOQA 1E5CA 1LO3L 4RLDA 4M6OL 2Q7NA 3KLHD 1H19A 3TEUA 4WFFD 1HSAA 1CF8H 3UYPA 5CU9A 3FPXA 4CA4A 5GS1A 5JMOC 1YEEH 3UBGA 3ZE2E 2BSEA 2OXGA 1JZGA 4Y16A 6PCYA 3CZFB 2HA1A 3NT0A 1IBGL 2NY7L 4KXZH 4Y4KC 2OFQA 1SEQL 3GZPA 1NC4A 4TUOB 1JV2A 4KKBD 4M02A 1RSYA 4BRVA 1JNLL 4MD0A 3BH8B 1XB6A 3IKKA 1DUYB 1NPUA 1R33A 4PJIB 4YDJB 1HCVA 5C71A 1QSFA 1YEKL 1SMDA 1TU2B 2DJSA 3SZKC 5D7IF 2Y5QA 4APQC 2QVIA 4P99A 3BAJA 3TBWB 3JWNH 4NO5A 5K9KA 1QFWH 3VXNA 4MWFB 4P2OA 3W9EB 5CP7A 1QPPA 1F2QA 1KGWA 2JLLA 3VRLE 4BFEA 4NX0A 5EFIA 4XI5D 4POUB 2H32A 4GJTB 4PV1C 2BFVL 5FYJU 3VXSB 1TTGA 3ZQWA 4Z1PA 4PHZA 1MXDA 1DQLH 1X5GA 7TAAA 1JPSL 5I8KL 1BJ1H 2EEFA 2YRPA 3DDGA 4YFLI 4ZAKD 3CVIH 3EO1B 3GO1H 5C0AD 4LLMA 2F74A 5C0CD 2W07B 3SY0B 3ZE0F 4OZGE 3QJSB 2FJHB 3VXUD 3DIVA 2ICWI 3ARED 5HI5D 4Q9CA 4YHZL 4DEUA 4YAQB 2LGNA 2IG2H 4F58H 5FHBL 5E08L 1I85A 4PD4K 1GXEA 5DMIL 5DSCB 4MCMA 1CDIA 2CCWA 5KBPA 1FAIH 5E8OB 1T3FB 5FO9A 5FV1L 2A4CA 1AKJA 2EECA 5DUBA 3OM3B 5CHNA 4JO1H 2YC1B 3SKNB 3F01A 3BP4A 1H8LA 3A6CH 3DJSA 5E8PB 1YUKB 1BAFH 1MPAL 4OZHA 2ARJA 5C09A 1KPRB 4LSRL 1RZPA 5K9OA 1R3LB 1BOGB 4PN6A 1QYGL 4Z7UB 4EF3A 4NJ9L 1XEDA 2DQEL 2IMMA 1S7XB 3W0WA 5I6XB 2AAVA 1HINL 1KBPA 3NJIA 5EU6A 2DPKA 1KBGL 2UZYA 3RVUD 1UKSA 3VH8A 3ULVL 3DNKA 4BZ2L 1IGTA 5DJXA 2CR3A 5KSUA 2C9XA 4MJID 4JFYA 4IRSA 4DGUA 2Z92A 3TZVD 2DYSB 1LLAA 4N0FA 3OPZH 5LGHH 3V2AR 3LXBA 2HT3D 3LY6A 4HP5A 3PL6A 2Y2TA 5E94B 1RMFH 4KZDL 3UO1H 1U30A 2B59A 1CD1B 2F9BT 3EYVB 1J5CA 1C12B 4F7PB 5F0LB 1MVYA 3LRLA 4P2QB 1XSJA 4P49A 3H6JA 1FNLA 5GRVK 4IMLA 2WZAA 1V7NL 4F1SA 4MMZA 3ZX1A 3DOIA 2XN9A 1MCSA 4NOBA 1S46A 2QKSA 4JY6B 4AUYA 3R06A 3IFPB 5E2JA 5T1DH 1AD0A 2XV2A 4XTRD 2ICEB 3D39A 2GY5A 1EJOH 2LOEA 2K78A 4JPWH 4K7PH 4ZMWA 2ESVA 3IDYB 2NOYA 1VFBB 2WXFA 4MXQC 1UD8A 5F6IB 5DHVB 4KMLB 4UCFA 4DEPB 4PJ9D 4NLHA 3ETSA 5KBKA 3LV3A 1JFQL 4MZ3A 5A2KH 5TFSH 3IRZA 4FTDA 3CHPA 1XMWA 3EADA 5J57B 3NIDB 2C7FA 4HAFA 3P1VA 3UJTH 4U1KB 5TDNB 3WAJA 1HSBA 1H6FA 5INDB 2ICWA 3ZMRA 1F56A 1MJ8H 1W8NA 2ZKHH 3O45A 4LLWA 2J7LA 4RFNB 1BFOA 4WV1A 1KC5L 1L9MA 1OHZA 2YBGA 1MQKL 2XZZA 1D5BB 2SODB 1J1PH 2BK8A 3QUMH 5J9PB 3C12A 3I84A 1I82A 1F4HA 4NHCH 5IW1A 3MMEA 4KUZH 2PO6A 3GSOA 3HS9A 4Y19A 1OF2A 3T77A 1A1OB 2P28B 3P2BA 1CMOA 2R29H 1IBYA 4PJ7B 4JVWA 2BLFA 5DUML 1JXKA 3G5YB 1A47A 5JW5B 5ITFB 5I6PA 1J5OL 4GG6E 4NUGH 4DGWC 2XA3A 3EOTH 3S96B 3KPOB 3O2WL 4BUHA 3O2DL 4IEFB 1KIRB 3ZKXC 1JN6A 5HSFA 3B8SA 4QDGA 2Z4TA 4JFED 4GRWE 4R0LA 1RZKH 1DJIA 5CBAB 4P4KC 4XNQB 2D2OA 2Z31B 4HALA 4AXWA 5ACZA 4ZFQA 1CXLA 4ELMF 3RGVC 3H9HB 3T2LA 2VISA 5IQLA 2B5IC 4TLUA 1UH4A 2J1ZA 3FQUA 5DD1L 4OKVB 3VGHA 5EOQH 5HHXL 2FL5A 2L0DA 3WTSA 2HUEA 4HUKB 5CZVH 5I1GH 3QJHA 4G1MA 3O0LA 4TSAH 1FFPB 4UDUB 3TJEH 5EF1A 3VI3A 2OMZB 4AEEA 4KHXL 4N3TA 2XETA 4GLRI 4NO0A 1TEYA 5DO2D 5T1JA 2BDNH 4U1IA 4ABVA 2VR8A 4G7QB 3IJ9A 4QF1A 3LX9A 1LDPL 2XIDA 3M86A 2OXGB 7PAZA 2UZIH 3GZQA 3NCBB 3P54A 5C6TL 5ICYA 5I76A 1PY0A 1VFMA 4XH2A 1ZXQA 3ZR5A 4HV8A 4MCYB 1IAIM 4XO9A 5F9DC 5KS9B 1HZKA 2XZQL 3PQYA 1NC4B 4WZ9A 1JV2B 4EIZC 1FYTE 1TSHA 1MI5E 4PRBA 2DQTH 3IKCA 1FFOA 3CFNA 3MGAA 3MRGB 4QJ5B 5A7BA 5D5ME 5LAPA 3FQTB 4LLVA 4BGDA 1TTFA 1UURA 1QSFB 3TBVB 1E5YA 3WEMA 5IWLA 7FABL 2IPUK 4K55A 1Z2KA 1OE2A 2ED9A 4LHUG 3OSKA 3Q1EA 4NZRL 1CI3M 4LARL 4PR5B 1T03H 1TIUA 2GIMA 3EFFB 3JTSB 3P4MB 2PABA 3VXNB 5EZIH 1JI2A 1X44A 1GY2A 2F53E 3RKPA 3BN9D 3C60A 1AYOA 4ODTH 5FYLH 4P59L 1JZDC 2Y6SD 2H32B 1IUZA 3POHA 3VH8G 1MY7A 2MPAH 1ZLDA 4WO0A 2V4LA 2N56A 5GGRY 4KROB 1SEBA 2I5YH 5KYWA 3HMXL 4P57A 1JG9A 4KU1A 3O3EA 3OQ3B 3ARGA 3M07A 3QCTL 3H3KA 4R3SB 4LLMB 3V10A 4K3JL 4F57L 3G5WA 2DDQL 2GTZA 3JZ7A 4ICWA 4DO6A 4ZW3A 5FA4A 3ERXA 1ZA6A 3QIBD 4UT7L 4V1DA 2GUYA 5AWNL 3O4LB 4X42A 4Y5XC 3BAKA 4RAUB 3BMWA 3VM7A 3W3BA 4O9HH 1E4XL 3M7FB 1IKFH 4PTUB 2F6AA 1AY1L 5CCKL 1N0LB 5JMRA 2BM3A 3BKMH 1JXDA 5DD0H 1T1WB 4TV3A 1LGVA 2FSEA 4H2CA 2UWEE 1U42A 1AKJB 5MERA 2KERA 2RFXA 3V0DA 3K4ZA 4HLZH 1WZAA 1XGYL 3BP4B 4ORZC 2O93L 3KL5A 4C47A 1TNMA 2WIIB 1VA9A 3PAYA 4OZHB 3EJRA 1O5PA 5C09B 2UVEA 3M1OA 3JWNE 5CN1A 3OZKA 2GBAA 4PRIB 2Y7QA 3EHBD 1A3RL 4H1LA 3TT1H 3BFQG 3D51A 3QR1A 4BXVA 4IOSA 2VLRA 2QGEA 4WKXA 3ZKMC 2WQAA 3CBJB 5GJSL 2ADIA 2PYED 3QIWD 2UZYB 5IJDC 2TSAA 1BGXH 2XRAH 2ENYA 1IGTB 5DJXB 4ZUUA 1JTTA 1P53A 2R9HC 4Q74A 3BZFB 3EFDH 4NQXB 4QHKJ 2VDLB 1CUOA 1DQMH 2Z92B 3D2TA 4NGHL 4N0FB 5C0DB 2RACA 4PJDE 4PLJC 1UOKA 5J12B 3PL6B 3IJ8A 2E86A 3UJIL 4NUJB 4NFCA 3P9MB 2BWDA 5LBSH 4G7YH 4JG5A 1GCYA 1N2RA 5GJTL 3EYOA 3GINA 4Q4IA 3ILEA 1R24A 5FYKH 3SDYH 1Z7JA 1CQKA 3U0TB 3OR7B 3QJOA 3WHXA 3ALXA 4UTAA 1R3KA 4KI1A 3BZEA 5JXED 4ONGL 3DKHA 3ES6B 5F44A 2X1OA 5SWQB 2ZAGA 1YY8A 4MMZB 3MV8E 2OCCB 5DJYA 4RMRA 4BSVA 1AD0B 4Q6IB 2ATPB 3PABA 3UTSE 2EINB 3D39B 3WKYA 2P44B 4MJ5B 4UT6H 2H1PH 3VU2A 3OKNA 4MA1B 5H2BA 4XBPA 3ZK0A 1WSST 4NQCA 4IOFD 1F3DH 3Q9PA 1CR9L 2NTFA 3TM6A 1UJTA 2ZP9A 4GAJL 2WSKA 3V52L 5BVPL 5J1TC 3VGAB 3GXNA 3IVKB 3V0IA 4M4RA 2JXMA 5E5RB 3ZKQD 4YHOL 5MEQA 4XMPL 2WXMA 5CD5C 5MEPA 1IFGA 3EUDA 2WLLA 4K7PX 3D08A 3O45B 3BVXA 4LLWB 4M43L 4WI5A 1M9SA 3CC5B 1BFOB 4OM0H 3WXWL 5DFVC 1AJ7L 1U92B 4WO4B 5L9DL 4Y7MA 1I7UB 2DQDH 3ROOA 3CZGA 1LO2H 1DVFC 1N9PA 2YRLA 2F8VA 1UWXH 3GSOB 3MCLL 2ID5A 4MTMA 4Y19B 1U8LB 3T77B 5A3ID 5D7JD 3FT9A 3HR6A 2IADA 1QSEA 5ANME 1V7ML 4PBDA 5I74B 3HBZA 1OPGH 4CW1A 1U8IB 5IQOA 2CKBL 2HKHL 2E3VA 4YR6B 1E4KC 1XH3A 2WAHA 3B2PA 2JFCA 4R0LB 1NSNH 4FI8A 4FQXB 2ADFH 3LEVH 4H13C 4JHAL 5GSRA 4AXWB 3MGTB 3ZDXE 1BQLH 5ACZB 4PB0L 5JQ6H 1CICA 5LXGL 5AZEL 3I3DA 3X1EA 3D3VE 3I9IA 2MQCA 1XR9A 3A22A 4D9RD 4QRPB 4H7VA 2FL5B 2OJZL 4HWBL 2NY6D 1EPFA 1F42A 4LOEA 5K1JA 5EF3A 3WUWA 5E99L 4BKLB 3AUWB 3MCKB 4ORGB 2VZ3A 1RUQL 3OAYH 4MDIA 1A7NH 1DQQA 4WI6A 3VFWB 1BVZA 4YDKH 5KG9B 4Y4HD 3EZJB 2NY2C 3O8XC 4ISVA 1Q94A 2V9QA 1HHKA 5I6MA 3C5ZA 5IEHA 4MVBC 4QF1B 3PHQB 4M1CC 4YDLC 4DPAX 1SDDA 4HV8B 5E5MB 3QUXB 3JWOL 1Y0LA 4D3CH 3FCSA 4MA7L 4OCRL 3UZVA 1GYVA 4PRBB 2R69H 4XNAA 4DH2A 3IJ7A 3APFA 2E9BA 3JWDL 3KXFE 3SDAB 3H55A 2IBZX 4N1HB 3NZ8A 1SBSH 1HH6A 2CCLA 2E6PA 4LLVB 3H3BC 3VNZA 1CCZA 2E27H 3WELA 4AENA 2B77A 4Y2OA 1YPZA 4K5LA 3QO1A 3HVNA 1Q0XH 3AS2A 3A4DA 4LESA 4LP8A 4QEGA 5E2VH 3O2VH 2GT9A 3QFDA 5AAMA 2R0KL 1ZSHA 3PWPE 1NZRA 3TWYA 2CK0H 3BKJL 5DD3H 1ES0A 4LU5L 4WTWA 5DJ0A 4BRJA 4JK0D 2BO0A 3X1GA 5KSVB 3QNZA 3ZE1F 5LN8A 1JRHI 3FQXA 1M1XA 1AZVA 4E9WA 1BYPA 1F4YL 3I3EA 1MFMA 4TSCL 2W59A 1FQ9C 2B7DT 5KYWB 3V4VL 2VJ8A 4G9DA 4OSUL 4DP8X 5DJ8A 5AUMB 1Q9OB 1F4XH 1TZ8A 4HD9A 2K6YA 3GSNA 5H35A 2HFTA 1QKZL 2BSCA 2CHNA 5LDUA 2NY1B 5FA4B 4I5BB 1ZA6B 5EN3A 1J8SA 2QTEA 3EYSH 5DWUH 2DOCA 3FT4B 2ICWJ 5FYJL 1KBBA 5C7XL 4LBEB 4LCCB 4HK0B 1T83C 3IJSA 1G0XA 1GJUA 4OV5A 1OM3L 3P4NB 1G6VK 2D2CC 2FSEB 5IJBC 3GTVA 1DBML 1I8KA 5MERB 1CI5A 1GGUA 3OX8B 4EI6A 4R4FL 2O1AA 5BNXD 2W8CA 3G6AB 1N3NA 2XWDA 4NB7A 1BZEA 3N9GL 3TP4A 2EUVA 2BRRH 1TNNA 1QWHA 4OLWH 1QA9B 1NQBA 2IH3A 4OCLC 4I2XB 1QNZL 5TF1L 1QUNB 4WWKC 1KTLA 3OGCB 5IEKA 2WNKA 4Q6KA 3C2AH 4WY7H 2V5TA 3KYNA 2IAMC 4N2AA 4YDIL 1CLZL 1RZIA 2Y7QB 3ORJA 1FL6A 4HZAA 3UOAB 5EWIL 4H1LB 5DMYA 1KTRL 4OZFB 2MCG1 4AEHL 2J56A 5IUCA 3FNKA 1Y18A 3HPLA 4I87A 4MHHI 2ADIB 3VXOB 2JTDA 2YKLH 2BIQA 5EF0A 1JGVH 5HVWA 2VW6A 1MF2H 3D33A 3B2DC 3LQZA 2XFGB 2B1OA 3GJEA 4MQSB 4YHPA 4PBXA 4YE4H 3TT3H 4J2QA 3U0WL 2JB6B 2UXFA 4JFHE 4A6YB 1FFNA 1U8JB 3E3QC 1N2RB 4OFPA 2B08A 3EYOB 4GAFB 1XF2A 1S3RA 2NDFA 1HXMA 1IC4L 5E00A 3HFMH 3BZEB 4B6ZA 1OCCB 4BK5A 3G5ZA 1YY8B 4Y1TA 3GMQB 4WW2F 1E4XI 4EDXA 1ZE3H 4GFTB 5H37H 4JGNA 3H8NA 3HMWH 5AB1A 5AYTA 3DO4A 4PJBA 3C5SA 1OW0C 6CGTA 3U46A 4AJ0A 1VDGA 1CXIA 3FSWA 4NQCB 3FO0H 3SE3C 3WUWG 4BQ9A 5K5YA 1XX9C 4PP1C 3CFJA 4R83A 1Q72H 4ELKA 2G5BA 3AG1B 4W9DC 1KT2A 1MFVA 3MXVL 1SXZA 3PWLB 4QHUA 5BOJA 1QWUA 4TLKA 1IJNA 3G6JF 1T66D 2ENPA 3MBEC 3R4RA 4GXUN 5MEPB 3T8MA 3EJPA 3KPRE 1H15A 1V3MA 2WLLB 1MRDH 4B9IA 5ESQB 5I82A 1QI4A 3DTDA 1QSZA 5FCUH 5LBGA 5B3SB 2P9RA 3ZVVA 1UWEH 1K4CB 1N18A 3RJOA 4AQ8A 2Y1AA 1ZV9A 4RQQA 2VXVL 4JFZH 4JMXA 3ROOB 4BKSC 2Z64C 2WINA 1OCWL 4UQ2B 4X9BA 1GGBH 3PWUB 5FWQA 4P5TA 1HKFA 2Q8BL 2VXQH 1OIOA 1UADC 1HEZB 2IADB 1X6LA 3BT2L 1QSEB 3OQRA 5JHDD 1GGIH 5FYKE 5I8CA 2W60B 4CW1B 5JHLL 2IFGA 3DUSA 1TTAA 3V5HA 2VCOA 3BFOA 4NP9A 4PY8I 3TPUA 1XH3B 3Q9QA 4HSAC 4DP1X 1XCQA 1K2DB 3Q8BA 1BD2D 2H0PA 4N2OA 3QO0A 3D5OF 4NC0B 1ETZA 2PUQT 3OSVA 5GSRB 3NFSL 3LKNA 4JRYE 1CICB 1UXWA 4WSKA 1IL1B 3D12B 4MAYA 5I71B 1U8KA 3LN9A 4APQD 3QGVA 4BCYA 4B9ZA 1EXGA 2KS0A 5KANI 5D93B 4HMCA 2XPYA 1J0KA 2CJUL 2IH8A 5H4ZA 3ZHFA 3N42F 1XSKA 2ZOTA 5TPWH 2X5PA 1JZFA 4UZSA 1A6VH 1A0QL 1UD3A 3EDEA 2AVGA 4X4YA 3N06B 1DEEA 4AQZA 1R5VA 2YD6A 4MDIB 1DQQB 4U1LA 4R4NC 5AOZA 5J4MA 1AD9A 1RZ7L 1SYVA 2LLNA 2OX5A 4HCRH 4QHLA 3RTQA 1P1ZB 4A37A 5ADPH 1J11A 1N4XH 1S9YB 2F54D 2VITA 4ISVB 3GYRA 4Z7VF 2I27N 2WXIA 2Y2YA 5AVQB 1B0RB 4G5ZH 1I9IL 3TESA 5EBWB 3CH1A 1OAYH 2WB1A 4CBZA 1FGVH 4MS8D 4OM1L 3EJQA 3FCSB 3UZVB 2EEXA 2V17H 5DWPA 3GJFH 2EKSA 3CBRA 5EULV 3QZWB 3FQYA 2FX7H 3TN0B 2O6FA 4QTFA 5EIIG 1RULL 4NI6A 1HH6B 4PGEA 3TIDB 2OP4L 3NJGA 1QMUA 1NFIA 2ZSWB 3BJLA 4J6IA 1G9NC 3NCJL 1YPZB 4FQHA 3QO1B 5AL8A 4ZTPH 3PHOA 4L48A 4OJFL 3WEXA 1HL9A 4TMPA 3L9RB 4YGVB 4A2FA 4I0PA 4KK8C 2GK0A 5DTFB 3WIIL 3MGOB 2DQCL 2C9RA 4FYTA 5JA8B 4UTBA 3MV01 1S7TA 1J9CT 3HIZA 3HZMB 1ES0B 4DKFH 5DJ0B 4C56E 2FJSA 2FQGA 1YHPA 4PGCA 1PY4A 3NESA 3D87B 3QNZB 4XNYL 3P30L 1CU4L 3RFZC 2CO6A 4GSDH 3T3MF 4A7GF 4JFDB 5EZJA 4K71B 1M1XB 1T5WB 1P1VA 1UC6A 2WTPA 1NIEA 5CJOL 4BJLA 5I75C 1AXIB 2DH3A 4HK3N 4L4TE 5MEOA 3WNPA 2NX5B 2Q1EA 2IQAA 4G9DB 5I6NA 1G7PB 4KUCF 5DYFA 3QUYA 5DJ8B 5CFAA 2ZX5A 1AZRA 3GSNB 5H35B 3QNXA 5HPOA 5LLIC 5J89A 3PG2A 3PCYA 4MLIA 4HH8A 3FRUA 5BZDA 4L4VD 2DLFL 2YPVH 4IGBC 4F2ME 1R5IB 2AXGB 4QOKA 1QAWA 2PPFA 2W92A 4ZX4A 2XG4A 2J5WA 1FH5H 3KBPA 4HUWA 2CZNA 1NOLA 1KTKE 5D4IA 4NC2B 1AGDA 2VR3A 4CGUB 5BS0B 4NKMA 5DRWB 1IBZA 4LCWB 1JYNA 1EEYA 1N3NB 3L4TA 4CSSA 2WSDA 3AQDA 4LCUB 5LJYH 1DVSA 5JW4Q 2CR0A 4Y5VC 3VFTA 2MNWA 3BIBX 3FBQA 4JY5H 1RL1A 3RGHA 4V2BA 3G9AB 4HWZB 1DBAL 3DUHA 5IEKB 4ODXA 4YO0A 4FLQA 3MVSA 5I1CH 4PV9A 1LTXA 5D7SL 4YGAB 4IIQB 1UB6A 2BNRA 4EBQH 2BSBA 4JEGB 4E9RA 5FW8A 1UACH 1QR1A 3O6LH 4WI3A 3NTCL 2Y06L 3QEUA 5HGDA 3U6XA 2KQMA 1Y18B 2CRYA 1GY1A 1QZNA 4XNDA 5IB4B 2ICES 2V2XA 3HNVL 3DX1A 4JKPH 1H3GA 3MA7A 4ZXBC 4U1HB 2IALA 1IU1A 3LQZB 4HJ1A 4L8BA 2G0KA 2WCSA 4XZUA 3IGKA 1CVRA 3N85L 1U36A 2EDFA 3GXIA 3J7HA 4KKCC 4IMKC 4NN5B 2NNAA 5F21B 4AH2A 4CSTA 4H88H 3I50L 5FOBB 2VDKH 1FFNB 3L3OA 4ODVL 1RERA 5F6HI 1OSZA 3ARFB 4G8GD 1NBZA 2EVIA 3NH7H 2VZOA 1IT9H 1HXMB 1RIVH 4GW5B 5E00B 2VN6A 1FORL 3EDKA 2O6PA 3ATBA 1N6VA 2AXWA 5MP6H 2VIRA 1GTFA 3U9PL 3PGFH 2FCBA 1G1KA 1RZ8B 5C0GA 1BHGA 3TYFB 1ZXKA 1BBDL 4PJGE 3QS2A 1WP6A 4NLAA 5D2LF 5C08A 3CFMA 1R3IH 3QR2A 4PJXA 3EO0A 3FU0A 3ZHNA 3C5SB 4ETYA 2IDFA 2UXTA 4MKMA 3BAEL 3DMMA 4CDGC 3V5DA 1LEKA 4Y8AA 5JIIA 4JM2F 5TGBB 4RGOL 4ELKB 4ZYKA 3TV3L 1DVTA 4LOVA 4QHUB 3WAKA 4PRPE 3D48R 4X4XA 2HN7B 1QATA 3MLTA 4BFIA 5BV7H 3I02A 1RJZA 1P4LA 2FD6H 3WKML 1XAUA 2OKMA 1MUJA 3N2JA 3P2TA 1HDMB 4HGKC 1F8TL 5C7ZA 2WBJD 5F0JB 4UYQA 3IAQA 2IQ9L 4XN5A 4HF5L 3LS4H 4GKLA 5J6HA 4E0RA 3BISA 3HRZC 3HUJB 4ZFGL 3OAUH 2A0LC 1IE5A 1NCAH 2B1HL 1U95A 5LGYA 5DQ9A 2ISDA 1AXTL 5D1QA 2PCFA 3S2CA 2C9QA 1W6LA 1OGSA 4Z7QF 2FT6A 1MHPL 3QQXA 3TPUB 1JDCA 1YDPA 3WIHA 2D9CA 2P46B 5LAXA 5IF0A 3DGDA 4QRRA 1WFMA 4GRLA 1NFDF 3L3HA 2QDVA 2LHAA 2ROYA 4B9KC 4LE8A 4FNLH 1SMOA 2VDLL 3QDHA 2GBVA 1U91A 4LCIH 1D6EA 3KPQA 4Z7WB 2OMUB 2EABA 3QJTB 4NWUL 2R39A 4OQTA 2Y7NA 3BWZA 5EU3B 3TLRA 5C0BE 4EIGB 3ABGA 3ULVC 2OR8A 3RPBA 3PE9A 4YHLL 5D7KD 4AGQA 4LZKA 1JNJA 3OMAB 1U58B 3NA9H 2EILB 5ESAA 1OP5K 2LAGB 3P73B 5EO1A 2OMTB 2A4EA 2VITB 5F72S 3AROA 2EH8L 2XV0A 3F5WB 4QMEA 5EU7E 4JPIB 4N68A 4EVNB 3EH3B 5F7MC 1V3JA 2AJSL 4LL9A 4FGMA 1E5AA 3S36H 2GJZA 5EZOH 4HKJB 5BMFL 2CO4A 2XQ0A 4HIJB 5GSVA 1SVZA 1UWYA 1YNKH 2GCYA 2LAAA 3ASWA 3BZ4A 3HZVB 1KIUB 5CR8A 1BF2A 1NCIA 1UZ6E 1N7MH 2ZCKL 4H5SA 1O9VA 2ZOOA 5D8JH 1UWGH 1CG9B 3WG7B 1WQVT 1L0QA 4QYOB 5IESH 4AV4A 1X5FA 5A2LH 4XP5L 2NDGA 5FM4A 2VE6B 3QT2A 1ML0A 3MA9L 4IS6A 5CZXD 4L37B 5E4EC 1EO7A 1QBLH 1RZKC 3BPLB 1S7TB 2Q7YA 1FIGL 4PJAB 4MLSA 4FL4C 3S3SA 1MLCB 4KJYA 4OJAA 3TCLB 3OXSB 4AYDC 3NSJA 2KC0A 5KSBE 3KPNA 1EFXA 5JA9A 2P5WA 4A2LA 3OJDB 2CO6B 4TUKH 4C4UA 5EZJB 1E6OL 2H41A 3K71A 4RDBA 2XXGA 5EZLA 5MEOB 1RPUA 4AQAA 1P6FA 2IQAB 2HT4C 1GS6X 1L7TH 3SQOH 1O6TA 2HCZX 3X3GH 3VWJB 4AEFA 1FJ1B 4Z7UE 1SNRA 2MCAA 5JW4M 2JLPA 5F1NB 4HWEH 1VFAB 3QNXB 2EO1A 4PGZA 2YMXL 2D7TH 2X2IA 5BZDB 5IVOA 3VFRB 5BUPA 4PLJD 1MCHA 4PTTA 2CO3A 4KTYA 2VL4A 2WIMA 1DVUA 2HVJA 1D5MA 1A4BA 2XG4B 1WFNA 3M8OH 2OYPA 4HOWA 4Q9RL 5DHEA 1X5ZA 2WD0A 5EHFA 4TULL 1ZVSA 4FA8A 3TV8A 1JTOA 4G70B 3L4VA 4NKMB 1A7PH 1GGYA 4O2EA 3IGAA 2VM9A 1J8RA 3LDBC 3V55A 5LDSA 1X4ZA 4R2GC 2OR9L 3WOVA 1Z1WA 1KYFA 4J4PC 1INDL 4BWTA 1IBBA 3AT0A 1F1DA 2EE6A 3GSRB 3KCWA 4H8QA 4UM9A 5AW8B 1ORQA 3MRDB 1DJZA 3EDFA 2E0PA 4G42A 4A68A 1F1GA 3L2LA 1KENH 3ZMNA 4AYFB 3IETA 3QEUB 2MHAA 4UQ9A 2WBKA 3C5JA 4LGSB 5EBGA 2WP3T 4K9JA 2J8OA 2V2XB 4N0UE 1IAII 2ZZUT 3WHE1 1P9MA 5CD5D 1XGQB 2AI0H 2IALB 4DCQB 4AGOA 2V9UA 3RY6A 4XZUB 2B16A 4QRFA 1ZPLA 1TETL 4D0DA 5JIPA 1AHKA 1QACA 2ZTBA 5A2AA 3GZOA 5DFVD 2NNAB 1CJYA 4K8RH 3QQ9C 1KCKA 2EIKB 1DVFD 5E6YA 3V6BR 1OSZB 3VI4A 3NIFB 5I9QC 4WUUA 1W6WA 5DJAA 1Y07A 2IPTH 3DIFB 2O61A 1BZ9A 1PYWA 2WWMC 4X7TA 5IVXE 5A6IA 3STZB 1JYVA 4PRDA 3MRKB 1UOLA 1FV1B 3RY4A 3ZYOA 1OY3B 1CFNA 3O6FB 5EBLB 4LVNC 3H1ZA 3RBGA 4TKWA 5C08B 3SCMB 2EUZA 1VB9A 3ME0A 4PJXB 2W38A 1NCOA 3EO0B 3VXPA 4HULB 5D1XA 5BUGA 2ZKMX 3NEXA 4MQ7A 1FVEB 1MXGA 3V5DB 4YOKA 1PKQE 4F37K 5JO5A 5EEXA 2WLNA 3GB7A 1EO5A 2VABB 5JQHC 4JM2A 3O0RH 4LKXB 4BFIB 1RJZB 4KI5F 4LRIA 3R1GH 2VC2H 3V0EA 4HCIA 4CMMA 4PWHA 2A9BA 1ZHNB 2SEBB 1JHLL 4HJJL 1DJSA 5DVOA 1MSPA 5E1AA 1GZHA 5FUZH 3SE8L 4FXTA 3UJJH 4X5LA 5J6HB 4UTCA 4E0RB 4IBVA 1BBJA 2NY2D 3O8XD 4L0PB 4MVBD 5DFWH 1Z3GL 3F7VA 4M1CD 4UM8A 1U95B 3UZEC 2DD8H 5D6CA 1BG1A 2CBOA 2UYLA 2PCFB 2PCPB 3LZOA 5DC9B 2VMFA 4CC4C 5AVWB 2ZKYA 1AVAA 3CZKA 1RIHL 1QFHA 5LAXB 4QRRB 2P5EA 3VDAA 1AMYA 4GRLB 2EEAA 1E9QA 2B39A 3CUPB 3L3HB 4MXVE 5D7LA 3RB7A 5AZ2L 3SOTA 1NFDA 3E6FA 5LNDA 2ZWYA 3W1ZA 4LPUA 5ICZB 5DRXB 3OHXB 4Q52A 1CBJA 5E6IB 4K5OA 3W9DA 4HPOL 4A6YL 5DMJB 5F70A 2WQXA 2AK4B 3QHFL 4ZI8A 1FA4A 5BXFA 4BSWA 4UTAL 3MODH 4AYGA 3WE6A 5K1NA 2AEWA 5T3XD 4MB1A 5D6DA 2QT6A 4LSPL 1MCPH 2JELH 2XQBH 4GLRH 1IVTA 5EO1B 3HFFA 4KGLA 3B5TA 2WXPA 2JKWA 3CPUA 3DX9B 2OR7A 2WN3A 5CIPA 3MLYL 5IHHA 3AWGA 1I3UA 4OD1H 1CIUA 2ZG3A 5D1ZB 4TQPA 4GAYA 3ZHDA 3KL3A 5GSVB 2E7CA 5CEYB 4WEMB 4LQFL 5GRWA 4AV0A 2V2WA 4OT1H 3BZ4B 1L6ZA 3MLRL 4H5SB 1JGUH 3A47A 1P5UB 4KKZA 1E6JH 2C4XA 3DRTA 3F6JA 2PXYA 1ZGLA 4F7KA 1W9XA 1RAMA 3UL4A 3HE6A 1MW0A 1SXSA 4LCYB 5DFTA 1C08B 1Y6MR 3S36X 1QFPA 2E7HA 1EGJL 4PJHF 2HZHA 3VUAA 4ZZKA 5KJRL 2IXQA 2CQVA 2FT7A 4G8FA 1EZUA 4O51B 1KYAA 2Q7YB 1JF1B 5IJVB 5LG6A 3KPNB 2IAMD 5HDWA 2P5WB 4U1JB 1EERB 3VFMB 4UV4L 1T1XA 4HSCX 3EBIA 1I1YA 5AOIA 4CC0A 4AYMC 3K71B 3AVEA 2ALAA 4M29A 4OZHE 5EZLB 2ZJSL 4K94H 5C09E 2AS5M 3T4YA 4DETA 4XNUL 2AANA 4Z7NE 1XL4A 3VD2A 3ECUA 4FQLH 3ZR6A 2AGJH 1UXLA 2E7LA 1RU9H 1ZEAL 3PP3H 4WFEE 1AE6H 4C4KO 4M93C 4U6TA 1I9RH 1D5XA 3AY2A 3FH8A 3W0WE 2B3RA 4F92B 4ZFFB 5EU6E 2BOCA 4ADIA 4PTTB 2BXZA 5IQ7H 3FB5B 2DM2A 4LASH 4X6DB 2J25A 1D5MB 3IB4A 2F19L 4N0RA 2WGNB 4AC2A 4RGNE 2XTJE 2YRZA 1K8IB 1ZVSB 3GHEH 3TFKC 1NMBL 3SDCC 3WHE0 2IGFH 2A74A 3WY3A 1CBVH 4O2EB 3MYZA 1FVDA 2XNAB 1LEGB 4IRZL 4A04A 4UMGA 1A7RL 2BIMA 1AANA 3SOBL 2KMWA 1UJ3A 4NUQA 5I8EB 1I1FA 4NWTH 4CVZA 2XN9E 1B2WL 4PP1D 3NABH 2NY0C 1DYZA 4JDZA 1E5ZA 3HE7B 3IETB 4FEIA 4IBTA 4RISH 2OULB 2MHAB 2FEEI 3BUYA 3D39E 3FT2B 1E67A 2ESVE 1JVKA 2XLLA 2ZUVA 4N8CH 3MBED 3PU7A 1ETB1 1BXVA 4FP8H 3RUGB 2F7OA 4BZYA 3PAZA 1PNCA 3LD8B 2I60H 4Q9BA 4IJ3B 3L9EA 1QFOA 1W0YT 2ZOKB 3FFDA 1M6UA 5B1CA 3JWOC 3BLBA 3BW9A 2OSWA 1KUMA 3MNZB 4YBLB 2CD0A 3QEHB 3FUKA 4NQEB 4ZFOB 4X7CC 4XPHL 3B34A 1E27A 2A5UA 3VI4B 4HQQL 3VTAA 3JWDC 3MLSL 3ULSA 1FCCA 1WC7A 5DJAB 4AYBA 5DK2A 5J6GA 5ADOL 5DEZA 4JFWA 5DGRA 3NQIA 1BZ9B 1PYWB 5CZRA 1DN0A 1HK6A 2QKIA 4B9CA 1UTDA 4AZ8B 1XF4B 1N8ZA 1CFNB 2BZ7A 1OAQL 1YZZA 2J57A 4A7VA 1HFUA 3V79C 3FUIA 3VXPB 4F9LA 3BVNB 3GSNL 3L13A 4MQ7B 1WZMA 5HYSA 2A77L 3FFOA 5B4MC 5I1DB 1SQMA 4XP4L 1HHGA 5JO5B 1NBYA 4ZD3L 2J4WH 2WLZA 3I6SA 2HUHA 1WFOA 4AIEA 3TYGL 5GZOA 4YEFA 1KCRL 4G8EB 4HYTB 1I8UA 1GL4B 5K39A 1I7ZA 5G4OA 4UMSA 4MZRA 1ZT7A 1B3JA 4CMMB 4EIUA 1PVHA 5K33A 3W39A 4OD2A 3BIAX 3MRQA 4EN3C 4KFZC 1S9XB 1QRNB 4R4ND 5JZ7C 2CIKA 1WS8A 4CN4A 3MV7A 3HC0A 1CLOL 3IE4A 4FE9A 3IFLL 5SX4I 3K5SA 4GQ9L 3VI3E 3F04A 1KCVL 1KBGH 1T4WA 2ZXGA 4UM8B 4PG2A 4XBEL 5AALA 5I8OH 3OWEA 4FNSA 4Q6YA 3RWJB 1UA7A 1N67A 1HT6A 1MCOL 2A9AA 2FJGB 2E56A 2AAAA 1U8OB 1OANA 3X13B 5IW3A 1FYTD 2HTKC 4MNQA 3PQYE 1SRDA 4PJCF 1IFHL 1AP2A 4HXAL 1KYOJ 5EU4B 2DQGL 1ZE3C 3KM2A 3QH3A 4GQPH 3BVDB 4L23A 1F3RB 3HZKB 4G8IA 3WCYA 4ADGA 4JHUA 4S2SB 4HC1H 3SJVB 5ICXB 4K15A 5AAWA 4AYSA 1TVHA 3BPCA 1EXUA 3V5KA 1PIGA 1LQBC 3D85D 4RMQA 1IC7L 1TPXC 4NERA 3ZW3A 3K6IA 1C16A 4YWGL 2ADGB 2JJSA 4NXKA 5K9JH 5DZOA 5I30L 2QHRH 4HLJA 5CIPB 1C5CL 1OM9A 1A2YA 1PG7W 4F2EA 1OL0A 2NZIA 1LO4H 5EU7C 3H9SD 4GAYB 4WSGA 4N9GB 2EDRA 4BH8B 1KB5B 4IGBD 5TE4L 3GIZL 4Z0XA 1KLUB 1KC5H 2V2WB 3CHRA 3FULA 2HG0A 2FUTA 3DK2A 1E4JA 1NGPL 4OIBA 5T1KB 3WTXA 4X80L 2X6VA 2GJJA 3B2VH 4OLVL 4V1DE 3ZE0E 4A55A 1ZGLB 3DURA 4U1SA 1UUSA 4LSSL 3GUTB 2IFFH 1S7UA 1WBXB 4F3FA 3QORA 3VXMA 1XAKA 5I0WA 3BDXA 1J5OH 3ARDC 4G8FB 1JNNH 3GTNA 1IAOA 2R23A 2QPFA 3QDAA 3U4BH 3P3SA 3MOBH 1KBVA 1QLEB 1OQXA 2C8NA 2Q6WA 2AV7B 3LZNA 1CLVA 3QDJD 4KZCA 1I1YB 5KYUA 3REWB 1JRHH 4IRJA 4YLQT 4V2CB 3LN4A 3U4EB 4HS8L 1MDTA 3ZDYB 4D9LH 3T4YB 5GISL 3BAIA 4NI3A 3QXAB 1Q0YH 5HHME 5IVZA 3PGDA 3VRIB 4ZXBD 4B27A 5HDQL 1LEIA 5MENA 1DFBH 3KAAA 3PAVA 8PAZA 1KIQB 5I66A 1EDYA 2VLRE 3MLWL 1INQB 4XN1A 5F9OL 1JZ4A 1KFAH 1ROWA 4NPJA 1NKRA 3GF8A 1A4CA 2BOCB 4KHXH 1N5AA 5I6XC 2EDNA 1JXFA 1ITBB 1UYWL 1XGUA 5IHLB 2QV4A 2HFGL 4FTVA 4MD4B 4N0CC 4X50A 5C2BL 3MCG1 1I7TB 2A74B 3AT8A 1TJIL 4Y1AE 5FPIA 1TCRA 3IMTA 2XOTA 4PP2B 2HSIA 3CLFH 4IKJA 4XO8A 5HYSG 2J6EA 3L16A 3L1GA 4G9FA 1NFKA 4AITA 1T7ZA 4DK6A 5LBVA 5IW1B 4NNYB 3NJKA 3DUUB 3TFBA 5HY9B 4CVZB 3VWKD 1TFHA 3H2QA 5JIDA 3C6LA 2A1WL 5GGUB 3WFHA 5ETUB 4JGUA 3L48A 5INCA 1NGZB 3NCWA 2VL5B 4X7SH 2QQLH 4N1CA 1DSFH 1JFHA 2LU3A 1T20B 2WY3B 3DGGA 3SDXB 3WIAA 3SPVA 2ICEC 1DQJA 4NQCE 2ERJB 2ED6A 3UC0H 1A6WL 3VQLA 1YEHH 3FQ2A 2K7PA 1ADQA 3FFDB 4JDTL 4GSXA 4TTDC 3WLBA 3JV0A 2UUDK 4A66A 1Z3RA 5ALCL 3TA4D 2FVNA 1E27B 1LJMA 4JAMB 5F7HA 3ULSB 2A0LD 1TQBC 4UT9A 3NEOA 4KNTA 3GD1C 5J6GB 2WLKA 5JOPD 1DN0B 2QKIB 5SWSD 4K7FB 4F8QA 1BMZA 3D2UD 4UT7H 5AWNH 2YUXA 5L0QB 4N8UA 3F3HA 5HYJB 4GMTH 3MJ8B 2F5BL 1QSEE 2R1WA 2UY7B 5IR1B 3AM8A 2NCMA 1NDGA 2IVFC 3AB0B 3IXAA 4KJQC 2XKUA 3US0A 3BZDA 4F7CA 4HPHA 1QD0A 1YC8A 1NBYB 4KRPC 1NAMA 4GBXB 4N6QA 5AW4B 2DQHL 1TZOA 4H0GA 3V0AC 3KPSB 3FB8B 4RWYH 3ULVD 4IJTA 1ZT7B 4UTBH 1N64L 3W39B 3QHZL 1F4WH 3WNMA 1IO4C 4PV8A 3Q8EA 2BNQE 1GC1L 3MR9B 2CIKB 2FHCA 3VDCA 2DWEA 3QJUB 4KY2A 2PPEA 5EPMB 2YD8A 2JI1A 3HC0B 3WBDA 3WKNA 3ZHKA 1Z0MA 2GJ6A 3ULUF 4GKZB 2X6MA 5GJSH 4QO1B 4N2HA 1J0YA 5DO8A 1EH9A 4MD5A 3NAAL 1IGYA 1S5IL 3HC2A 5FFGA 1NC2A 5KVEL 4XPTH 1HNGA 1RIUL 4KDTA 3QRGL 4EZKA 3SGDI 2HKFL 1I1CA 1KFGA 4KRLB 2X38A 3HB3D 1QRKA 4OCMC 1YNTA 2VO5A 2BW4A 2CDGA 4EKJA 4HGWA 2WTRB 3GK8H 3HUJF 2VXSL 3A3YB 2AKRA 4LL1A 4EUPA 1WHOA 3GSXB 4KKRA 4DGVH 4XVTL 3F58L 3V0GA 1U9KA 2JKXA 3VD7A 3U7AA 1NCGA 1X5LA 3MRNA 5F96L 4RFOL 2DBJA 4KNQA 3DJ9A 1EXUB 5CWSA 3QJFA 1YPZE 3V5KB 4MA3A 1ZSDA 3PWPD 3FBKA 1W91A 2QTVA 5AOLA 5E6SB 1VACA 3CDZA 5DZAA 1A9EA 3V0HA 2HLEB 1GR7A 3HAEA 2NR6D 1JK8B 5DCCA 2N4IA 5AB9A 5BVPH 2HT4D 1YEIH 1JF5A 3JV5A 3QQNA 5CJXC 2XTSA 3IE9A 3U1PA 3D4ZA 4HOMA 3OAZK 4P2OC 4Z7WF 3QUZB 2R56H 1BEXA 4YHOH 5F7EH 1AQDA 1PZ5B 5K59E 3LKRA 2XACC 2R2EA 2X09A 2ZAIA 3SYCA 4O02H 1JSYA 4P46A 2BVOA 1DL7L 2NXZC 3QUHA 3D07A 3UZQA 1IM9D 2XZAL 5L7XH 4FHBD 4LMQE 4P23A 2RB8A 3NQKA 2F1BA 4OCYL 3AS3A 5IKCB 4NT6B 2ZCHH 2TSBA 2WQVA 3ILQC 1J48A 3QORB 5IHZA 5JR1H 3FO1B 2QELA 2Z9TA 3DI3B 3FT1A 4YK4B 2PTTA 3RPIA 5EOCJ 1I85C 5CSZB 3L81A 5BRZA 5LQBL 2YUWA 2A9DA 3PS6A 3NPZB 5A2BA 1IAOB 1BM3L 2R23B 3FRPB 3LVEA 2W91A 5DZJA 2UXGA 4JZNA 5HHPA 4UB0L 1IILE 3TF4A 2Q6WB 2GC7C 5JIQA 4MRCA 2H3XC 2I9LA 5KYUB 4UOJA 4IRJB 5KTEL 5IQMA 3HPJA 1TZHA 1ZLWH 3CGTA 3K6NA 3OC8A 3S3DB 3WIHL 1U8PA 4WK2B 2LLGA 4O58H 5IVZB 3PGDB 1LEIB 4RFEB 1EWHA 3I2CH 4MBRA 4Y4KB 5MENB 1DLHB 1R5WA 3LMJH 3MOAL 5GRUL 2WK2A 5I66B 2Y24A 2UY6B 1MAML 3TF7C 3I75A 2C7UB 4HIXL 4HIIB 3FO9A 1I3RB 1MJUH 1WCQA 3PPSA 4OVUA 3U6XS 4N90D 2XKNA 3QQ9D 2GPZA 4FYQA 1CXFA 4OQTL 2HKAA 5ID0B 4MXWH 3SY6A 1OB1B 2ZG1A 2ZXCA 4QRAA 2W88A 2FO8A 5CEZL 5CUSL 3HLKA 3MYJB 1WHPA 2WWMD 1KY6A 1KGJA 3MUGA 4RGNC 2PP9A 2XTJC 3HVDA 4GFXA 4IRSC 5EBMA 1CZ8H 4IU2A 5IREA 4XVJL 4Z0BH 1QABA 3MLZH 5J12C 2DZEA 3PL6C 4PWGA 5FF6B 3RVXC 1B0GA 3U2SA 1G6RA 3DROB 4MB3A 1B3IA 1LNUB 2DEYX 3BVTA 3O6KH 2WQUA 2GFBA 4HIEA 1BCIA 2NQ3A 4N26A 3C6LB 5K9QI 3WFHB 2GEEA 2IOOA 3DO3A 4MMZC 5JW4N 5HDBF 1BJ8A 4PJBE 4JFFB 2F8IA 4TUUA 1ZLVH 1X5YA 2EDMA 1IGML 4BE6A 1WE5A 3DGGB 2DKSA 3AAZB 3ML8A 1TMQA 1NWPA 4MA1C 1MRFL 4WGKA 4PJ5B 4DZ8B 4M7LT 3ESNA 1PAZA 1QOKA 3M1CA 1KV7A 1NIBA 1COBA 1T4KA 5F7FA 3VVVA 3VGAC 4X6FA 1TZIA 1GS8A 3Q6FA 5BRPA 2IGLA 4KJWC 5DR5L 3V0WL 4GT7A 5GZNA 5T5NF 1FE8L 4JQIA 1X9QA 1YEDA 2W80C 4M6ML 4A7TA 3T3PB 2CH8A 4MJHA 2E9WA 3RI5K 4AVKA 2ZNXA 2WGXA 4WO4C 4JW3A 3T0BA 4JM4L 2EDHA 5CFHA 3CXHJ 2ODIA 5H94B 2PCYA 2R1WB 4EUPG 5F9JA 2PO6C 1J8KA 1Q9KB 5HTSA 4ODWB 5HJ3B 3GNMH 3IXAB 1YEJL 4RMBA 5JW3H 4HX1B 1IARB 3GFUA 4M7KH 3MJ9A 1II4E 1WZLA 5I74C 3RWGB 3SO3B 4S1DC 3QFJD 3S35L 1BQKA 1RFDL 3NIFF 5HHOE 4B53A 5FAAA 4JFVA 4XN9A 3QEQB 2BNUB 4F7EA 3QDMD 1WGOA 5DDHA 4OF6A 2HFEA 5A7EA 4R0LC 4X2UA 2VDRB 5KYNA 3HAEG 4AGMA 1QNZH 4PRHA 4L9LA 2PP8A 1JF6A 4M1GH 2RAMA 4YDIH 1MWOA 3TH2T 3SBRA 1K4DA 1KSRA 4X98B 3MNWB 5IMLA 5EWIH 2G3ZA 2EC9T 2IANA 4HHWA 4JDEB 2ATKA 3TBBA 4YSAA 2GJ6B 1UM4H 2Z93A 1M7IA 4JO4L 1ACZA 2J88H 4XE5B 1K6QL 4JGMA 2WC7A 4NC1C 1WIPA 1YECH 1SDYA 4GYBA 4ZW8A 2WLHA 4MD5B 2WYZA 1A9BA 1BFVL 2QFRA 2XTLA 3STLA 1BREA 4KNUA 2HPTA 4BH7B 1TEGA 2H3KA 2QR0A 2OXHA 5E2UL 1ACCA 1ZPUA 2WVUA 4P5KB 3BEWB 3DTXA 3WXVL 5DRZB 4WVRA 4JRXB 4GSQA 3P4LA 3NJJA 4P2RA 1OAXH 4KKPA 2WZPA 1A4JA 2ZCLL 4KPHL 2V0AA 3NCEB 2B0SL 2DQUL 1SY6L 5L6YL 4NPKA 1J8HA 4FKKA 4R7LA 2CNYA 1FNEA 4ZFOL 1RLWA 4F9PA 3SDAC 5CWSB 1MFEH 3L3GB 3WY1A 1BAGA 3N50A 5IWLC 2X0VA 1JK9A 1EQWA 3A5VA 1UEYA 3OKMA 4TQEL 5AVXB 1YJDC 3RNKB 5DZVA 3OXRA 3ZE1E 3TH3T 1UM5H 1KJ3H 2KI6A 3C60C 2X4UA 1BV8A 3LKRB 4BFKA 1CFMA 5I6LA 1GW0A 1I75A 3TH4T 1FNSL 4XCCL 5I1KL 1M1SA 2BVOB 2DWXA 5GHWL 4P4KB 4JFXB 2H9GA 5EORL 5L4MA 1OZUA 1WBYA 3JT0A 4KTDH 4P23B 1EMTL 4EZJA 1JUFA 3ARGC 3RGVB 5KSAA 2WLJA 3AJ7A 3WJJC 3TFKD 1KB9J 1EAPA 3WO3B 5F7BA 3QDGD 4G7RB 1F02I 4QOKE 1IM3D 3NFNA 2CDEA 3B56A 3T65A 1CURA 3RPIB 1XIWA 2IPKA 2PR4H 3UTTA 5BRZB 3VSUA 3LNIA 4HISA 3VGDA 2DW5A 4XCEA 1YY9D 4L29B 3TU6A 4M1DL 4TF4A 4D9QE 2R0WL 4J3VA 1XZ0B 4UQEA 1D5IH 2NY0D 3BDBA 1F45A 3ARBA 2W9DL 4YH6A 4B50A 5J1AB 4AEIH 4CBPA 2BVQA 2VKWA 3UERA 2OZ4A 4CJ0A 5KVDH 4KVNH 3CFBA 4UDTB 1L5GB 4E9TA 1L9RA 2AZAA 1R5WB 2BNRE 1M42A 2YAEA 4Y2DD 3OBAA 3ZDZE 3W2DL 3FO9B 3FQNA 1H8SA 1OSEA 1LK3L 2YWYA 2AJYH 4CADA 1OZTG 4XHJC 3NG5A 3T0EA 4G59C 1KNOA 3HHMA 2DBLH 1U8NB 3IMWA 3FFCD 4YX2H 3FTYA 3FTSA 1WZ1L 4QY8B 5BW7A 2VAAA 4K9EH 1LK2A 2AJZB 5EBMB 5DQJB 1TO5A 3QSKB 4IU2B 4QRBA 4HD5A 3FCBA 4K4KA 4LRNL 4W9JC 4HHAA 4Y4FA 2EE2A 5G4MA 1KPUA 1B0GB 2BMKB 1BVOA 3T2PA 5E4OA 1J0JA 3ETBF 1C8QA 4PW4A 4ZUVA 3ZSTA 1IRAY 2IDTA 4DZBB 3BWUC 4U6XB 1KPVA 2OMXA 1YMMD 3M17A 4W93A 5C3TA 1YYLL 5H4YA 5B4MD 4I9XA 1EVUA 3CK0L 1KB5L 1PG7H 5C08E 5CILH 1U4EA 1MWAB 4TVUA 4UNUA 3UBXI 2APWA 4NQDB 5SWZA 4G6FD 5AD0A 1P7QA 4IK7A 3GXFA 3WIIH 4FFWD 2VR6A 4DVRH 3LZPA 1O7DE 1IAIH 3VMPA 4YUEH 4RGMC 1KGCD 1WFTA 4K94C 3VRJB 1QFUH 5JPMA 4IM8A 1CU4H 5JZ7D 2HJFB 4UAHA 3AXLA 2Z8WC 2FIKB 5FYJD 5L2KD 4X6FB 2GKIA 4GW4B 2J3SA 1J1XL 2J5LB 3Q6FB 3R19A 3C8KA 4TNGA 2NYKA 3BQUD 4XOBA 3QC5X 1S7QA 5KVFH 4KMQA 3UEQA 3IDJB 2JV6A 3D4CA 5EN2B 5CZKA 4M5TA 3P77A 2K8QA 2DI7A 3EXLA 1MREH 3GBMH 1DO6A 1CDGA 2AABL 4ZSOB 5K9QG 2QVMA 3VFNA 3WTYA 3E7JA 5D1QE 2VDNH 4W9HC 3ZT6A 1RZGB 1A1MB 2VJXA 2FEJA 3FUDA 5JPNA 3HG3A 1BZOA 5DLML 1T0PB 3DVGB 4XX1G 4DJMA 4QRRE 2NLJB 4WI0B 3ZZLA 4LEOA 4IBWA 3QZPA 1U3NA 4Z7AA 2HH0H 1M05A 3BMVA 5DDHB 4XPGL 5HJDA 5HVFB 2HFEB 1BPLB 2DQIL 2ADYA 4JPKL 1OOWA 2ZUQC 4LNRA 4XCYB 2PWHA 1KY7A 1PS3A 4N22A 5D1ZI 2V9TA 5GQBA 1CICC 4G80B 1K4DB 2FGWL 1UT2A 5I71C 4HDIA 5D7SH 5IMLB 3G3LA 2ZP8A 1EHKB 2IANB 4HW6A 4OJEH 1M2VB 2ATKB 3U9UA 3KHQA 4Y89A 2YPLB 5AVTB 4AIXA 2Z93B 2LW3A 2Y06H 3PGCB 2CLVA 3HNTL 4OGYH 3I3BA 4X9YA 3S34H 3L9BA 1IIKA 5CBEA 1AGBB 1KEMH 4KDWA 3D30A 4ZAKA 2YGVA 5C0AA 3VFSB 1A9BB 2WN2A 2CU9A 3IWVA 4LF3B 3STLB 3VXSD 5TQ0L 2I7OA 4GKNA 3VXUA 1CPUA 2QR0B 3VW3L 1PD1A 3RZCA 1ASPA 3G7TA 3KPMA 3KPPA 3D8MA 1A8ZA 4DIXA 2H2SC 4XC1H 2MH4A 3VFGH 4HIQA 1I1AA 2Y72A 3B3IA 3OF6D 4Y9FA 1USQA 5DZLA 2YD0A 3GRBA 3GLDA 2YEZB 5I17A 5E5LA 3TN0C 2VDOB 5FCSH 3TNMA 1D2PA 2NUPA 3OMZA 5DRNA 3E9UA 1B9ZA 4ODHL 2AP2A 1LP9B 2YXVA 4LFHD 1N5YH 4CKQA 1JK9B 4PLKC 3IDXL 1EZVY 3PDGA 1D9KB 4JLRA 5AAMC 1X5IA 3OKMB 1BF8A 3ABZA 2HVKA 5SV4A 2P5WE 2MTPA 4DTGH 4JO3H 3AUVA 4FKHA 4X99B 4CVWA 4AWJC 4PJFF 2V7NA 3NK3A 2W81C 3T3ME 4IDJH 2X4UB 1YLBB 3QA3A 5K93A 4HFUH 2NY5L 2GUOA 2OL3A 1ZLUH 2GTWA 1OTUD 1L3WA 1JPTH 2AV1A 3IFNH 2AEPH 4J6RL 3KYKL 3FCTB 3AQYA 2ALWA 3DSFL 1JUFB 1BZQK 2G0LA 4KNSA 5KSAB 1AH1A 1Z9PA 5GGVL 5CNHA 1OCZB 5I6OA 5I0XA 4LBAA 3MV9A 1JZEA 2VW4A 3IJEA 3CX5J 1UD5A 2LFEA 2RCSH 5JIHA 1RPQA 5G5DB 3W57A 5DA0B 5BO1H 5I19L 4WDIB 2RTTA 5GPRA 1U6AL 5EOCH 4H0HB 3VYNA 5I16A 3AMKA 3PWJB 3UP1A 3MX0B 5IOKA 1NCTA 4FMKA 1G1CA 4P2QD 3MLXH 1A7QL 4OD3H 2R4SH 2AJ3B 3FQ1A 5D71H 5TF0A 4G6KL 1AYRA 4OCSL 2FZ3B 3ARBB 4M7JH 4D0BB 3UP6A 4YDLB 1D6VH 3DO7A 1E9OA 3FKUS 4PJ9A 4FZ8H 3CFBB 3L3JA 3NIGF 4JHZA 1E28A 1ZVHA 2VXTH 2VWEC 2B14A 2HLAA 3NSDA 3ZUNC 43CAA 2BOBB 9PCYA 3C09C 3ZTNL 25C8L 2WYHA 5IW6B 1T22A 3IPEA 2XYBA 2FIRT 1HJCA 4PW9A 3EGSA 4KXAA 3QCVH 5T5NG 2K6WA 4CADB 2VQ1A 3DVNA 4N0YL 1IBFA 2DLGA 2EXTA 1KNOB 5TK4A 4PVBA 3UH8A 2VQTA 3UPCA 2EXWD 1EEQA 2Y07H 5CINH 2Z1PA 1XR8A 1MKFA 2VAAB 1UA6H 5FUCC 3S5YA 1JOIA 3BH9A 4GRMA 4JCWA 3ZZQA 1TLMA 2G60H 2ROXA 5CJ5A 1FNHA 3STBA 1F58L 1X4YA 3CTTA 4HHAB 4I48A 4Y4FB 3VI4E 5JHBA 2XWTB 1E8YA 4WUUE 1KPUB 3CFUA 3DV6A 3ESOA 3X12B 3B1UA 3FHQA 3NN8B 1CLYL 4DKEL 3UG3A 4ZUVB 2WWKO 3ARFC 3ZL4L 1KN4H 1KPVB 1OCOB 3N91A 3M17B 1Z9NA 3KLQA 4KJQD 4G6JL 4JG1H 4JFEA 1IE4A 3Q8CA 2OMYA 3TWCL 4BK5C 1FL5A 1IB5A 5HBBA 4RH4A 3A67H 2FATL 4XNXL 3WEAA 1E40A 3MA9H 4NM8H 3X14A 2CNZA 5D1XE 4OVVA 5AD0B 5DJ2A 5IHWA 1QBMH 2Y69B 3DX7A 1XFPA 4OZGB 4WEUD 4GMSH 2VUKA 4RX4A 2Z31D 4TOYH 5KVDE 3F6IA 2BVEA 2O5NA 3AY4A 2F2HA 4YIQA 4YSSA 4K23L 4QJ4B 2P4AB 1RKRA 3MLPA 2QHLA 1E6OH 2N0KA 4NQVA 4BEIA 2F0CA 4KVCH 1CXEA 4M6NL 2UWEA 3L1OH 2VMDA 4TVPL 4IBZA 5LHDA 1KG0A 4UINH 1CN4A 5IMKA 3AG2B 5IBUG 4L0ZA 1SLVA 1ZGLP 4X5XA 3P77B 5AENA 2YMXH 4P4RA 1S9VA 1E42A 4LOUC 4WWKB 5LB1A 4AQ8C 5IFHH 3SDXF 4OIFA 3AGVA 4KQ3H 2B1AL 5D4QA 3VFNB 4QXVA 3TC9A 2XQYK 2MNUA 5HGHA 4LKCA 4P5TC 2EDJA 4HKBB 3UBXG 2JQMA 5F3BA 3MUJA 2VDQH 5JPNB 5C8JA 4ACTA 1ZRUA 5EO9A 3AXIA 3OB0K 4L3CA 3OB8A 5ALBL 4J1UA 3VG0L 5E56A 4XE0A 2P5EE 2KZBA 1NC4D 2OTWB 1DQTA 5D7LE 1Z9MA 2VN3A 1M05B 1T2QL 3F05A 1NFDE 3C6SB 4S1RH 3CHXA 3T8XA 5GS0H 2G2RA 2O5XH 1UENA 2IDSA 1JGLL 1J1OL 1J9QA 4LNRB 3LNEA 3IJYB 1QSFD 1X7QA 1MJ7L 5JIMA 4OZIA 3BGMA 4MAYC 1NEZB 4ZJ9A 3P40A 4QRUA 3U9UB 4ZMVA 3LZFL 1R3HA 2YD4A 2ITDA 2XWEA 5FGBC 3OKOB 4PW3A 4C83A 2CWRA 3WL9A 5J11B 3QBTB 1VPOH 4R5TA 1FWXA 3ROLA 4BA0A 3RE0A 1CYWA 3HN8A 1RUML 4JJ5A 1QEXA 4JG9A 4YBQC 1VESA 4N2EA 5KVFE 5B39B 5DS2A 1JBJA 2J55A 1OD9A 3QIBA 4GKNB 2R51A 1RURL 4KROD 5GIRB 3RZCB 3PP4H 3UTSA 3JTBA 3KJ6L 2ZF9A 2ZXWB 4RNRA 4OBSA 3KPPB 4EPSA 2DJ4A 1FIEA 4JJOA 1N10A 3V8CA 2F68X 4OGAC 4POZD 2GI7A 4QTIH 3QJXA 1HN1A 3FK3A 2A2QT 4B0MM 5D9SB 1I1AB 1GAFL 4Q97A 5I1HH 2VN4A 3O4LD 4AMXA 4XAWH 4PUBL 3NZHL 3ASNB 5I5JA 5FHAH 1NCUA 2VB5A 1OARL 3FN9A 4WKZB 2H6PA 2HWZL 5HHNA 3WE1A 5DRNB 2OJEB 2AXJA 2GIYA 3GXPA 1AKJD 3CDFA 1OSPL 1PNDA 4FF9A 3L5XL 2VTFA 4IBUA 4JLRB 4I0PC 3WDHA 2VH5H 1U93A 3S8FB 5C86A 2BSTB 2O26U 3P69A 4UBDD 1EV2E 5C09D 1FZMA 2H6UA 2V7NB 3U6RA 1OLLA 3QIWA 4PRID 2H3NA 2ZSVA 4LSQL 2VSDA 4I85A 4GG6B 5HHVL 2GUOB 3ZDYE 3TO2A 4XMKL 3QPKA 2BJMH 2OS7A 1NMAL 2GTWB 3PF2A 4X6CF 2VJ0A 1ADQH 1MN4A 2AV1B 2GAZA 3WENA 4MA8L 1CFTA 2X4QB 4GRWB 1EVTC 2VDRL 4WNQA 1IGFH 1SXCA 4NM4L 5J3HC 2QSQA 4E9QA 5FW7A 1OB0A 3MV9B 2MRYA 1CE1L 3OKLB 4UT9H 4IKKA 4XPAL 5LKNA 4OZFH 3DPBB 3PL6D 4IKNA 3DETC 4XWOC 1IC5L 5HXMA 4LIQH 4FULA 2EDWA 3K80A 4RAVB 5CD3A 5I28A 3BP5A 2AC0A 1B90A 4OF5A 4FQIH 2BIHA 4L9DA 5FWRA 3SGKA 1NCDL 4LSUH 1MCQA 4KI5D 4XPBH 4J3OC 3A0OA 2K8MA 4FABL 1GC1C 3N44F 4ZMNA 4P9HH 5GS3A 4CNIA 1ZDQA 1E9OB 5KEZA 1NAMH 2R8SL 4HHGA 1WV7T 2YSTA 1HS6A 3L3JB 4W1TA 5GGTL 3D39D 5C9KA 2HLAB 1V10A 4LEXL 1MFAH 43CAB 1KLGA 4NNPL 4ZMZA 2FWOA 1O9ZA 2XY2A 3LXUX 2DTMH 4OB5L 3C75A 3WFEL 4E9SA 2BP0A 4TSBL 1NGYA 2AJXL 2IAAC 1MI5B 4LSPH 3KWUA 5GRZA 5CN3A 3DVNB 2JCCF 1OPOA 3L1EA 1J10A 1EUTA 1XGPA 5DHMC 5I1LA 4KJWD 3EOBA 4GUQA 4AVHA 1XR8B 4GT0A 2YBRA 1NM4A 3H3PL 4W9IC 5FLUA 1YN7A 4QYAA 4GRMB 3E9TA 4MCNA 4DP4X 5D7JA 4AG4H 1URIA 4RAHA 4WO4D 1WVZA 3S5LB 4AIOA 4I48B 3HZ3A 4WHYG 2OMVA 4BSJA 3L3OC 1PX3A 2F53B 4UU9A 4Y19D 1E4WL 4LXFA 3ZT7A 1XGRB 3HI6L 2J1YA 2P80D 4OJDH 4Z3IA 1YO4A 4KK6D 4L3AA 3K2MC 3LIZL 2FB4L 5I15L 1KZYA 4EAEA 3X14B 3EJZC 3MUUA 3SE9L 1NL0H 3O6MH 5DJ2B 3MU3A 1GHFL 2HG5A 4YL4A 4I18A 4FQXD 3GI9H 1K3IA 3X11B 2FDBP 4HVBA 3F7RA 4BBWA 2APXA 4JM0A 5HJBA 4QIRA 5C0NC 2JF1A 5ISZE 1UCTA 5DHYA 4QRPD 3LHPH 1MFCL 1YMHB 4G71B 1E65A 32C2A 4XNUH 2UWEB 3HAEH 4U6HA 4Y4HA 1NPNA 3ZBMA 2Z7ZA 1KG0B 4Y5VB 3B37A 5IMKB 3MV7E 5ERWA 4PB9L 3ZQXA 1NTDA 4HBQA 2BWIA 1MQ8A 1IKNA 4Y9BA 1UM6L 2O72A 2Q8AH 3WD5H 2OTUA 1OT4A 5DQDH 4BFOA 2GSIA 3N3EA 1MH5A 5HGHB 4LKCB 2A83A 2IPUG 3FTWA 3LPOA 1TTCA 3V6OA 2YSSA 1JGIA 1SPDA 4U1NA 5F3BB 3MCYA 4HS6A 5B1JA 4QLRA 1KCLA 2CO7A 5D1QC 3SPGA 3QR0A 1JHKH 3QUXD 4OLUH 4J1UB 4YPGB 4ABWA 1OAZL 2Q2LA 1HKLL 2Y5EA 1PY9A 4YSUA 3QEGL 2A9MH 4IRZH 4MNQE 4ELDA 2X6UA 2YXFA 2HJKA 3SDAD 2F8OA 4GRLC 4X8GA 2G2RB 4ACPA 4U1MB 5FGSA 2WWOA 3THML 5C0RH 4X9FA 2FHBA 4DW2H 4JY4A 3Q5YA 4I3RL 1BXXA 4RVBA 5LGKA 4ODBD 1A6PA 3PV7A 4PJDB 1O6SA 1BQUA 5E6IC 2DL9A 3UTPD 3BUTA 3M6DA 1O5DT 2O30A 2UZXB 2ITDB 1BFTA 4QJ3B 2K3HA 4C83B 5J7CC 3LNHA 4FFTA 3EAKA 4GI8A 4YSPA 2DICA 2J8UA 4HXBH 5I1IH 4L1HA 2F58L 1AOZA 3DLQR 3ROLB 5F88B 4QHNA 3KD4A 4JJ5B 1HWGB 1K85A 3ZIMA 1FRGH 2HRPL 1MWAL 1CFSA 3MV8B 5F3HA 4KKAD 1W0VA 3RBSA 4HJGA 3UTSB 5D55A 2J1XA 3SGDH 1PL3A 1ED3B 3F7YA 1RSFA 2NY1D 2CK2A 4GKSA 1ET5A 2D3VA 2FWSA 1YNLL 4PLOB 2VGLM 3CXDH 3NCFB 2JMRA 4UANA 4NCC1 2NYZA 1OAQH 3Q6GL 1WBZB 4XCFL 1PJ9A 4GAGL 5HHNB 1OOAA 1RH8A 1SXBA 3VXME 1G6RH 5DJZA 1UB5A 4ONFL 3K3QA 3LS5H 3ETBJ 4NDMA 1CS6A 1G9MH 2BHYA 1G7HB 5CMAA 3RAJH 2WVVA 1AR1C 1U93B 3KEHA 5J56B 4Q14A 4QRQA 4YN3A 5L4IA 5AW1B 4TVPE 2R4RH 5DUPH 4M62H 4TS6A 4XP9H 4DQAA 5ANMB 5I0ZA 1YEGH 4ONHB 1DSYA 1T1ZB 2F7IA 3U6RB 1MIMH 1D7CA 2LU5A 5DVLA 3SQBA 3QXDB 4NRZA 4Z5RA 1URLA 3TO2B 3TJPA 3VGFA 1SJMA 4YHML 2OSLA 3S2AA 4IOSD 2VLRD 5T3ZL 5JORA 3IJHA 4K0OA 4WW1B 3P9LA 4FFYA 4XHJD 1CFTB 2P8PA 2DYRB 3IFLH 2Y2WA 3O9WB 2N1TE 4CSPA 3ARTA 1SBBA 3ZDXB 3ZGIA 4G3YL 4JRYA 1U21A 3E6HA 12E8H 3B7UX 4UT6A 5IBLC 3D3VB 4XBEH 1CGTA 3RL2B 5GRYA 2ED8A 3SE6A 4JQIH 4URTB 3N40P 4GSRA 1ROCA 3FQ4A 4MMYB 5ABZA 3QJQB 4FNUA 4FTVE 5EU5B 5IROC 4JS7A 5IHBA 3L4XA 3D69B 2JKRM 3DJRA 3PLYA 4X8JA 5LXVA 1JCVA 3BP5B 4M5YL 3V95A 5F2FA 3NOIA 4PMFA 2BY2A 3SYAA 2GIXA 2I24N 5CJQH 2G5UA 1GKEA 3DYOA 3EJSA 4Y7OC 3M46A 4CNIB 3K6OA 1RJYA 3MJ9H 4G9FE 3ARVA 4N87A 3IU4H 4JZJB 1K8DB 3B9KB 4BCXA 3QUMB 2NZ9C 4D0CA 4DN3L 35C8L 2XDHA 3AGWA 1KLGB 3QE5A 1JWSA 4KK9C 1BJ1J 2WXRA 4NQCD 2BP0B 1DBKL 1NGYB 4BKTC 1HZHH 4Z7OB 1JNHA 1OP3K 3KXFB 2VDOL 2XN2A 1TLKA 1SQ2N 1P9MC 2JCCA 1BQHA 1S4IA 1C8PA