3PU7A

Cu-zn tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical Properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3pu7A00
3PU7A 1E9QA 2R27A 1TO4A 2ZOWA 3GTVA 1F18A 1BZOA 5KBMA 2Z7ZA 2AQQA 1L3NA 1MFMA 1PZSA 1SXBA 2WWOA 2GBUA 2JLPA 3T5WA 1Z9NA 2E47A 1OEZW 1B4LA 1Z9PA 1COBA 1PU0A 1E9PB 2ZKYA 3GZPA 2K4WA 4BCYA 1CBJA 1HL4A 1OALA 1UXLA 2AF2A 1EJ8A 3L9EA 3LTVA 1E9QB 4A7VA 3KBFA 3KH3A 1E9OB 4MCMA 1JCVA 1F1DA 3CE1A 3HFFA 4N3TA 3QQDB 1P1VA 2C9UA 2APSA 1SRDA 1XTLA 1SXZA 2ZKWA 4A7UA 1OZUA 4FF9A 1SXSA 2C9VA 1SDAB 2SODB 2AQRA 3K91A 1EQWA 3MNDA 1SXCA 4MCNA 2AQSA 2AQNA 1Q0EA 1F1AA 2WYTA 3GZQA 4A7TA 1E9OA 1FUNA 2WKOA 1SXNA 4A7QA 2LU5A 1TO5A 1OZTG 1IBDA 2NNXA 3HOGA 2WYZA 1YAIA 1E9PA 1S4IA 2XJLA 3KM2A 2WZ0A 1IBFA 1YSOA 1YAZA 4U4IA 5KBLA 2Z7YA 3RE0A 1DSWA 1UXMA 3GZOA 4A7GF 1SXAA 3GTTA 1N18A 1OAJA 2E46A 2Q2LA 3GQFA 3KH4A 1IBHA 4BCZA 2WZ5A 4A7SA 1U3NA 2VR8A 2WKOF 3SODB 1XSOA 1F1GA 1N19A 2XJKA 2VR6A 5KBKA 1BA9A 1HL5A 3HW7A 1ESOA 2Z7WA 3S0PA 1PTZA 3ECUA 4A7GA 1RK7A 3MKGA 3QQDA 3CQQA 2ZKXA 2JCWA 4OH2A 2AQPA 4N3UA 4BD4A 2Z7UA 3H2PA 3F7KA 1SOSA 2WWNA 2WZ6A 2V0AA 2C9SA 4B3EA 3ECVA 5CU9A 1CB4A 4OJAA 1B4TA 1IB5A 1XTMA 2GBVA 2GBTA 1JK9A 1SPDA 4L05A 3KM1A 3L9YA 2AEOA 1IBBA 1SDYA 3F7LA 3ECWA 2VR7A 1KMGA 1DO5A 1AZVA 1QUPA 3H2QA 3CQPA 3KBEA 2AQTA 1JK9B
chains in the Genus database with same CATH superfamily
2DJMA 4Y19A 5EBGA 5EIQA 4UUJB 3VXOB 3ZKSD 1U8OB 1DTUA 4DP5X 1K4CA 3WEOA 1NC2B 2DQGH 1EUTA 3LKPB 2I5YL 2DOCA 1IJ9A 5KG9B 4QHUB 3DVIA 1RI8A 4FTVB 4JUSA 5I6PA 3QXUA 1J8RA 4BCYA 1U8PA 1RZFH 2F5AL 5LN8A 1R5VB 2OSLA 5GGTH 3CLEH 3WN5C 3HMXH 3P0GB 1JCVA 4P5RA 5SWSA 2GSIA 3HLAB 3L3JA 4XXDB 5DMIH 2ZP9A 1DJXA 2XBZA 3VGAB 4P3DB 5IW1A 4N5UA 5HI3C 3TN0B 7PCYA 4B53A 5KBPA 5C3TA 2BNQA 3BEVA 1TETH 5C70A 4OZIA 4MCYB 1CR9L 1I9EA 2ESVD 1ZHKA 4K8RC 4P4RB 3V52L 5A7EA 2WXOA 4I85A 2Q1EA 4RMUA 2CQVA 4XX1E 4R4BA 4UMSA 3BP6B 4K73A 4U6VL 1LK3H 4Y1SA 3FN0H 3PL6C 1U91A 4PJAF 5E0FA 4ZXBC 4HCRH 4MB3A 3CXHK 1HDMB 2QMKA 3KVPA 3V55A 4ANUA 5IIEA 4JM2F 3HOGA 2GY5A 2XWEA 1Y7VA 3FBKA 4KO6A 2YPKB 3TEXA 2VIRA 4XMLH 4A38A 1WFTA 1DVFC 4OD1H 3TO4B 2FHFA 4PJXE 3UJTH 3VI3B 3ZYOA 4N2IA 3V4PH 4F3FB 5J3HD 2H3NB 1AS8A 4MAYB 1CGSL 4W6XB 4R5XA 3KJ6L 1J5DA 4PG9B 4UU9B 4F37K 2YPLB 4E42A 3QC5X 4GSDH 4P4KA 1Q72L 4RQQA 1LO4H 3H3PL 1BJ8A 3MLWH 4PRIA 5HYQA 2V7HB 1AHWC 1ZT1A 4G6JL 3O4LA 3SE3C 2V5RA 3MC0A 3S0PA 4KX7A 2HKHL 4PJHA 1H5BA 4NRXA 3L5XL 4XPAH 4I8DA 5KVEE 4OCYL 2ZXAA 1EGJH 4GAJL 1F58H 3NPSB 3C9NB 1AIZA 1MCIA 5ITFB 1I85A 5I24A 5KYYB 5EULV 4LEBA 1LDSA 3VFMA 4WDIB 5D2LE 1KXQA 2HFTA 2MNJB 3T0EB 4NDMA 2EUZA 1EANA 2QGCA 4R90L 2C7UA 4D9RE 3ESOA 3PRZA 3NJHA 3RWHA 4OVUA 4Z7UA 3DX3A 3CQPA 1T83C 3SPGA 4EN3D 3TA4D 1IAKB 3SDYH 3DVGA 3NSDA 4KAQH 2EDOA 4Y16C 3WXWH 2HRLA 1W15A 4FL4C 3QK0A 5CD5D 1ET8A 2OK0L 4RGNB 5IFJA 1LK3L 1YN7B 1GXEA 1G7HB 1MVUA 2XACC 4QY8B 4GMSL 5CKAA 2QJDA 4AYMC 1AXTL 4FQLH 4F15C 2BVYA 1ZKAA 2EYSA 4IGBB 4PJ9C 4Y5XC 4PJ7F 3NRPA 2ZWZA 3ESVF 4JHBA 4OZFH 5DMGC 1YQ2A 2PYFB 2NY1B 5AG8A 1ETZA 4NNPL 2VN6A 4G5AA 1IEAA 3B1TA 4C4KT 2DRUA 2C5DC 4X6CF 3RJOA 1HL8A 1I7UB 4NO3A 1INDL 4AT6B 2YA1A 2BOCB 1UT9A 4I9XA 4HAGA 4YHZL 2J6EL 2R23B 2ZG3A 4HD5A 3UTOA 1G6RB 3HI5H 3OMIB 4IBZA 4G80B 2BX5A 5TQ0L 5CR8A 4A2FA 3TEYA 1NC4A 5FWRA 1USZA 4KNTA 5HGHA 1UEYA 3NSFA 3PNWB 2VJ8A 4BELD 1S9WA 5DJ0A 4ZYKB 3C6LB 3FDWA 4RSVA 2B1AH 4PFEA 2EINB 2XNAB 3L48A 2R2HA 1BWWA 2Z31A 5DQDL 4EZKA 1RPQA 1XX9C 3H0TB 3HHSA 3V4VA 4X8XA 4ZUVA 2VSKB 3QBTB 2I26N 4G9FE 4XAWH 4XB7A 5D1ZI 4BWWA 3GSXA 2Y7QB 4JL2A 5HHXL 4U7MA 3Q44A 4F2ME 3P4OB 5T1KA 1Y6MR 3FOLA 3ARED 4I2XE 3VD7A 4Q74A 3VQLA 4ZMWA 5EZLB 1GGIL 4K3JH 4X80L 5BO1L 2VAAA 1K6QH 1KV3A 1WZAA 3BJLA 3HG1E 4Y1AE 1OF2B 3ESPA 1U8NB 4LCWB 1INEH 1KTDA 4I0PD 4Z7NB 3AJ7A 3EH3B 5MEQA 3F7RA 4N2OA 5D72H 3HE7C 3RFRA 1BMZA 3ZHKA 4X4YB 2WXMA 4OZIF 1AZCA 1T2JA 4NWTL 1TMQA 1TETL 3L7EA 1HQRB 2AEOA 1BF2A 3RRQA 3T3MB 2HJFB 2P52A 1P7BA 4OLWH 2B2XH 5T3ZE 4JBSA 4HJ1A 3QZWG 1EFXA 3UOAB 3BO8B 2AEIT 1MJUL 5I9QC 3KG5A 3VXNA 1PAZA 4XN1A 4MQTB 4Y1AA 1T0NA 4GAYA 4JRXB 1OSZB 1BVLB 3ZRFC 1IGMH 4WEUD 5GGTL 4OIIH 3OVUB 5BS0A 2NW2A 2OSYA 2QZ5A 3DX6A 3GSQA 1NCCL 1HOCB 3D9AH 3ETBF 4O2FB 4XB8A 4LARL 1OEZW 3ARDA 2A0LC 2X28A 4O2EA 3VFTB 4DK6A 2XWZA 1N64L 3L9RA 2I27N 5T3XD 4OV5B 5BZZA 5DMJB 1CDCA 5DWPA 1FBIL 5E1GA 2HTLC 3BWUC 4G8EB 4F24A 5A2JH 4FG4A 3RVXD 2N1KA 1E4KA 1QRNE 4MWFA 3VXSA 2NYKA 4HJSA 4Y4KC 4RISH 2E7CA 2RALA 4FZEL 4XGZA 3QUMB 1CYXA 4W9DC 3ZKNC 5ICYB 2IH3A 4P5TD 5DJXA 3S37L 1I9JL 4EDWL 1AZNA 2GSGA 1IC5L 2X9WA 4GBXC 5DO2C 3ARFB 4FYTA 5CZVH 1UXSB 1WPCA 3DX8B 1AGDB 1AIFB 2P24B 2GJ6E 1G43A 3NCJH 3KLQA 1FVDB 3RIAK 3DV6B 3TPUB 4HWBL 2UZYA 4ZFGH 1WYJA 4WKZB 4DZBB 5F9JB 2X7LB 5L2JA 3S3JA 15C8H 3INOA 3LRHA 1BYNA 2RJMA 1MCFA 4GSXA 4OJEH 4EF3A 5F89B 4CSSA 4LE8A 1HNFA 1ETA1 2BVTA 3IN0A 25C8L 2FSDA 3OX8A 4BGLA 2Y0SA 4UM8A 2NUTB 1PX4A 3NUKA 1UWGL 2A6DA 5I1JL 5D6CB 2E7BA 1UWYA 2NY4B 1G9HA 1QLRB 1XSKA 2OTUB 4GQPH 4QO1A 5F7KC 1BVLA 4DO4A 3FJTA 2DBLL 2NW2B 2FLRT 4J12A 1JXJA 5DQ9B 3SCMD 2EC8A 1F3DJ 3L4XA 4AVKA 3EZ8A 4WTZA 3U6XA 2V6HA 2EIJB 1HINL 1MCEA 4BHUA 1XR9A 1UM4H 2D31A 5E9AA 5D2LB 4N0CC 4H8WC 4FQXA 4F80A 4UINH 3P4MB 4BWTA 4TNFA 2X12A 2GYSA 1KACB 1CCZA 4YQXH 1CVSC 3FQ4A 4LOUD 5T3XE 2DYPD 1QHPA 3GRWH 2XWJA 2Y36L 4KQ3H 3G5YB 5CLWA 3SDXB 1FG2A 4FQHA 4FQCH 1I1AB 5JDSA 1YEJL 2FL5B 4EIBA 3KEHA 3QARA 4RZCA 2V2XA 1ZTMA 3BGMB 3MPCA 1BDYA 4OLYL 3W2DH 1N59A 3VSVA 4CADA 1ADWA 5F9JA 5D96B 3L7FB 1U33A 1L3NA 4UYPA 3HG4A 4QRRD 3EO9H 1E42A 1I1AD 3L1GA 4ISVB 1HYRC 1MVFA 4JHUA 4PBWD 4R7VA 1S7QA 2UY6A 3OX8B 2OI9B 3MV8B 2Z35A 4IRJC 1ZLVH 1C08A 3S5LB 3MGTA 2BXZA 3N1QC 4IHBA 3KVQA 4WV1C 5I5RA 3WY2A 1NGYA 3I3EA 4Z7VF 1Q94B 3R1GH 3RL2B 3SE4C 3QUYB 5EPMA 4FXTA 3EG9A 5I1HH 3P3TA 1JNLL 1I3RB 2FLMA 3HNSL 1XH1A 5GRYA 5HVHC 2YD2A 1T6WA 5I17B 4PRAA 5KJ7E 2K78A 2CKBL 4GBXD 4TQIA 3VFUA 5CKGA 1JGVH 2DQFA 3KPTA 3K8LA 1MG3C 3G5ZB 3WJMB 4MVBD 4PJDA 4NQEB 4WQOA 1JPTL 1JGDB 1F1AA 1F4YH 1UFGA 3OJMB 3GSUA 1MFBH 1TSHA 3W9DB 2AXGA 2YRZA 2WUCL 3QO1A 4FD0A 4HXBH 4P5SA 1NGXA 2P7TB 2OMZA 3S34H 2YMXL 2XWJB 2AJ3A 4KMLB 3WIFA 1NCOA 3MV8E 1NWPA 4HUKB 4GXUN 4XNXL 2KH2B 1BG1A 2D3NA 2WP3O 4X6FB 5KBLA 3Q8BA 2ENSA 4J1UB 3T3PE 1L7IL 1YVLA 1KOAA 1OAJA 5I1DA 4NZFA 4AENA 2A1WH 2FDBP 2WBXA 1EJ6A 2H0FA 1UWFA 4QHNB 4QXWA 5IMKA 3V7AE 3AU1A 4Y16A 4RRPG 4NUJB 5JHLL 4RFOL 2XTSA 3LN9A 3B9KC 3MKGA 4TXVB 5J6GA 1BPLB 3G5XA 5F9OL 4W93A 3VACA 3GMMA 3Q8FA 3SB3A 3U9WA 1IAOB 1RK0A 1HZHL 1Q1JH 2W8CA 3P11H 3GMRA 1PGRB 3GJFA 3GMPB 3O2DL 5E5UB 1A5FL 5KYWA 4Z0XA 4I3RL 1ORQB 1HQ4B 4Y2DC 1A4KA 1M6OB 2EDLA 4P46B 5DFAA 1VAHA 4TLKA 4YR6B 1RKRA 2NW3B 3OKDB 3FTWA 4YGAB 1FGVL 4DP0X 5FGRA 1WWBX 1TJGH 5I28A 2WOYA 3P1VA 1R47A 4L3AA 1YEFH 5BJTB 2UYLA 2K9FB 3FO9A 4P99A 4DP7X 3VXUA 4JKKA 2CDGB 4F7CA 4ZOEA 3QXDB 1V7NL 2E59A 3MNVA 4FI7A 3BT2L 2ZXQA 1I8AA 3OZ9L 3S35X 5C0RL 3WIFB 5GJTL 1DYZA 4P2OC 4YDVA 4AW4A 3RY4A 1MCBA 4DHLA 2DD8H 1DJHA 3LKOB 5KVMC 3S88L 2OMWA 4Z23A 4HUNB 1HCZA 1I75A 5EU6B 5DJCA 1YA5A 1UM6H 3OC8A 4UCFA 4GI8A 1QR4A 5LBGA 3L13A 4AUYA 2AQ2A 4X8GA 1ASPA 1AKJD 3WUWG 2JB6B 4U3CA 2CHDA 5D4JA 4NFBA 4PB0H 3HC0B 3UTZB 2VDLH 4OJFH 5BCAA 4QTHB 3ZRSA 3KWWA 3THML 5SWZA 4GY4A 4HCIA 3FB6A 1WRFA 4K5MA 2SEBB 1AO7E 1OPGH 1F8TL 1WZ1L 1KPVA 3EJZD 5JW5B 5C8JB 5CIPB 3S4SB 3ZN6A 1SVBA 5I0VA 2DQHH 1BQHG 3U83A 1X3DA 2OZNA 4BFFA 2IDCA 4RLDA 2CRZA 5C0CA 1ZA3A 2K0RA 5E6IB 5SV4A 2NY7H 4YR6A 1MCHA 5KSUB 4KVNH 2JJTA 3ZR6A 2VIRB 4YS4A 1RU9L 5CEZD 3ZYZA 3APFA 2I24N 4FHJA 1PKQA 2ZD0A 4NQVA 3U9UA 1CXEA 1YHPA 4JS7A 4W1TA 4KZCA 3RB7A 1UJ3B 1WV7T 5JOEA 3FFDA 4PJEE 5TGBB 3NK3A 4TQHA 3LHPL 3KPMA 2XN9B 4M62H 4GYBA 3IBEA 4WNQB 4QRQA 5F7FA 1TVHA 2JTDA 3FOMA 4Y2DB 4WY7L 5T5NG 3O4LB 2NYZA 4AY0A 2XOTA 2ILLA 3LIZA 1ZA6B 4HHGA 1X9LA 3LKOA 4MA8L 1CLVA 1WGVA 3FB7B 3RNQB 1CGWA 2C7FA 1NAMH 2V5TA 3G7TA 1YDPA 4FGMA 5JIQA 1A4BA 4ODVL 4Y4HA 2H6PA 3T4YB 3N9GH 4NN5B 3T6WA 3V0WL 2IBBA 3KCWA 3QO0B 2VXSL 3NJJA 2CCWA 1FJ1B 1FFOA 2HB0A 4F9PC 4FC3E 1FN4B 1EHAA 5TE6L 4U6YB 3FTGB 3P30L 3QFDB 1IUZA 4OFQA 4H88H 3PFQA 1EBAA 1HHKA 2Y06L 1EZLA 3AQXA 4JCWA 2Z0BA 5MEOB 3VYOA 4CN6A 4WTQA 4LAQH 5ABDE 3FHAA 4PJ8C 1NFIB 4ZO8A 4N0FB 4Y4FB 1R34A 4N2LA 4WW2F 4KRLB 5KW9H 4HIXL 4MJ5A 3FB5A 3CN1A 4W9FC 1GRWA 1UZ6E 5JIIA 1F56A 3LVEA 1FO0H 1QI5A 1R33A 1QOKA 4NZDA 3O8XD 5MI0B 4KPHH 2YD0A 1INEL 4OFDA 2HT4D 4OI8A 2VKWA 1AD0B 5GISL 1CXLA 3WFEL 2APFA 2ZCHH 4HLZH 5IQOA 4PJ8A 4WSGA 2RAMA 3WS6C 2X44D 1C5BL 1UOWA 2X10A 1FH5H 5JOPD 3FFDB 5TGBA 1KLUA 2F53B 2YBRA 3OKKB 4MMZA 5ACMA 2G9HA 1UZGA 3HCVA 4IKNA 4FNPA 4LEXH 1F11B 2C9VA 2GAZB 4PJHE 1CLOL 4QHUA 4IM8A 3TVMB 4NUQA 1PD0A 3IDNB 1AQ8A 4M93C 1A3ZA 1T0OA 2OZ4H 3FPXA 3UGXA 2H2PD 1ODAA 3CIAA 4P23C 3BH8B 4Q52A 4B50A 3NBNA 4J8RA 4BWUA 3MXWL 2YIHA 1NLDH 1YQVH 3IE9A 2XNAA 2LU5A 3BE1L 3ARBA 3FUHA 1TCRB 3MRQA 3RHWK 1D9KB 2BVOA 4S1SH 4E0RB 1ETB1 1T1XB 2BVQB 2VLRD 2EDWA 4F92B 5BW7C 1TEFA 2X4SA 3FF8A 4ZS7L 4XP1L 5LGJB 1SLUA 2VM3A 1OK8A 2BNQB 3BEVB 3GSVA 2DKUA 5ESQB 4N2CA 4ZFOB 4AEFA 3C08H 4XCFH 3LKNB 3W0WB 4MA1C 2XIIA 4GW5A 3EYFA 1T21B 1F6AB 4XN8A 3U0TA 1UWXK 3ZTEA 4AITA 3R8BB 2Q6WA 1XF4A 2ZX9A 2JJTC 4YHOL 3IU4L 3QG7H 4ZBJA 2XXCB 4ODTH 1SVCP 4RAUA 2IDSA 1FE8H 1QEWA 3I6KB 5E8OA 1PY0A 1H8LA 2ZKXA 3B9EA 2KT6A 3Q43A 4AYFA 5K1VA 5MHSE 1G0XA 4HFWB 2LTQB 3MA7A 3VI3A 4F3FA 2CIIA 3PIQA 1CFQA 5B1JA 1NIAA 4QD2E 1EJOH 4QGTA 5IZ7A 2FIKA 4JGUA 3CHRA 1M05B 5HDQH 4UUJA 3VXOA 3HVDA 2VC2B 3BESR 3MV9A 1T0PB 4H8WL 2WZPA 1NOFA 5IGXH 2VABA 4KRNA 3BUIA 1K4CB 1DQMH 1HHIA 2E9JA 1XFPA 1UCBH 2MCG1 5EF3A 3L4YA 1MFDH 5FGBC 1B6UA 2JJSA 3US0A 3FH8A 2Z92A 3AG3B 1ZK9A 4M7KH 3ZZQA 3RVWD 3WNNA 4MHHG 5BZWA 4HT1H 2Q7AA 3ZIMA 2O30A 4WDIA 1BFVL 5DUBB 1YPZE 2OSLB 1ZVHA 3L4CA 1SHMA 2QPUA 1EAJA 4L48A 4Y9CA 1U41A 5C0IB 1E50A 1NMBL 4JDTH 4ZUUB 4E9RA 5GGSA 1MCKA 4N90D 5IW1B 3CH1B 4HS8H 4G6KH 3A4AA 4NUGL 5DWUL 3WTSA 4KQ4L 1SBSL 3IKKA 2TSAA 1AC0A 1CICC 2BRRH 3GO1H 4H8UA 1PX3A 3U7WH 5A6LA 4MA7L 4W4NA 3PE9A 2YOCA 4R6UA 2PWDA 4XVSH 2EVIA 2J7LA 1DVFB 1CGSH 3CPUA 1ED3B 3V6OA 2G5UA 3VI4E 5C0AA 4J6IA 2D9CA 4H8PA 2XFGB 3WS3B 3P2DA 2ZXBA 5IUCA 2F54D 3MLTB 2AQNA 1BQKA 1Z2KA 4KH9A 4MZRA 1GGBH 3RA7L 4NO3B 5EA0L 3PIQB 1M7UA 2IAAC 5GJSL 1NBZA 3FN0L 3D4ZA 4KV5E 2EZ0C 2CGYA 2R69A 3MRBB 4Z78B 1A1OB 2ARJB 2OJ1A 3K3QA 3O9WA 3CSTA 4H0IA 4LDEB 4U31A 5BO0D 4M8UA 2X4UA 5AZ2L 1JK8A 2ZWYA 4FP8L 5D1ZA 3VFNB 1HYSC 3UX9B 4GKSB 4X98B 4KKCC 3SBPA 3DMMA 5CU5A 5DJ0B 3HIZA 4IRZA 3W39B 2A74C 1MUJB 1RHFA 4PWIA 4J3OC 4W70A 2B5IC 5DEJA 2FB4H 5KANG 2IIJA 5CM1A 3W9EB 4JKPL 5FGCB 1XCTA 1GPOL 3JTTB 3M8OL 4S11A 3CLEL 4FI8A 5C0IA 1GCYA 3GS4A 2J57A 3QIUA 1CPUA 3F84A 2J5LC 5JQ6H 1OARL 5CWSA 5KVFL 3QYMA 3QHZL 4G71B 4NRZB 2VO8A 4OTXH 2VLLA 4JDZA 1OTTD 4Y9BA 2OX5A 4I18C 3MRHA 5LGHL 4AQ1C 5BNXD 2DQGL 4G1MB 3UP6A 2WTOA 1KPRB 2O6FA 2BHZA 5HHMD 3N44F 4XGZB 1DVFA 1G9NH 2A74B 3ABZA 3H8NA 4QXTA 5B7FA 4HS6A 5L7XL 2ZZUT 3JWNE 5JTWA 1I9IH 4L1SA 5F3HB 5E1HB 4G43B 1BFSA 1DUZA 4U3SA 4ZXBA 5CN2A 4W6YB 1AGCB 1QZ1A 2X70A 5J12C 2FZ3A 1AHMA 4A68A 1SEQL 3UAJA 2ICWA 2GPZA 3P02A 2YC1B 2RTTA 2VLME 1W6LA 3AUVA 1NGZA 4NJ9L 2VITB 5E8EB 4ZX3A 1JL8A 2WY3B 2BNRA 1KCVH 3S3DB 3ECQA 3T4AB 3ZKND 1S3KH 3T1FB 1JK8B 2R23A 1CLZL 1KBGH 1XCXA 4PJFF 5HHOE 4HUUB 5DFWH 1D6VL 5KJRH 4Q0XL 1OGAA 3UEQA 1N6QH 4F2MA 3Q05A 1U2CA 3ARRA 1VHPA 3D4CA 3WN6A 3GMLB 3DGGB 5DJZA 5SWSE 3D3VA 2IWEA 2YSSA 2O5ZL 4M6ML 5A2LH 2QGEA 3FQWB 3N42B 5GRJH 1BYOA 4E5XG 2X9ZA 5DUJA 4EBQL 1BP3B 2VE6A 3BQUB 5BVPH 4PGDA 1AQDB 3DK0A 4AL8C 2A6KB 1BOYA 1R3LA 1H0DA 3ASWA 4BK5C 1H3GA 4OBSA 2NZIA 1GC1L 4W9CC 4P06A 3OKOA 4Y4KB 3WO3B 3SYAA 5I1KH 1CK0L 1IFHH 2QQKL 3CPLA 3LNHA 3KCPA 3SDCC 4ANKA 4FLHA 4BFEA 3MJ9A 4HIXH 2Y7QA 4KJQD 2XQYG 1DLFL 1KB5H 4IRSD 5GZNA 2IJ0C 2OMYB 3QDJE 1FFNA 4JFVA 4DUXA 3UXFA 2KZKA 5IHZB 2GSGB 2OMXA 4C47A 2FBOJ 1OPOA 1KDJA 5JYLA 4AYID 3FFCB 3VXMA 5DJYA 3V9CA 3D39B 5EBWA 5AB0A 3SDDC 4S10A 2F5BL 4CMHB 3VFVB 5ANME 4HVBA 1YRKA 4G6ML 4N86A 4JM0A 3ZE2B 4MDJB 2DD8L 3NCEB 3P9MB 5I75B 12E8H 1QTPA 1JV2A 3BVTA 4O51A 5J1AB 3RKDD 3BT2H 3OZ9H 3GJEB 5DURD 3IB4A 5E51A 4APQC 2EH8H 4X0NA 3SJVB 4WIQA 3ULVE 4MAZA 2NY6C 4RFNC 4ATTA 4GG8A 5FO9A 3ULVF 3HC3L 4OI9A 1O6VA 1R3KB 5FUOL 2NY0D 1IC1A 2WOBA 5HHPB 1U36A 3CN2A 1FNEB 1LP9A 2V8LA 5IB3B 4NT6B 5GZNC 1TU2B 3D0AA 4GG6A 2W9EH 4OIBA 4K07A 2C1OB 2VXTL 2QHRH 3BDXA 1WBXB 1BZQK 3WS6A 1DO5A 2EUVA 4GRMA 4ZSOE 4PLKD 5C71A 3LIZH 3KYKL 4RGOL 1VGKA 1C16B 4EUPB 4PWGA 2F7IA 5DQJA 1ERNA 3IDMA 1UKQA 2VDKB 4NZRL 1G7JA 2YD7A 2R9HC 4H1LB 3G6JF 3RP1A 4LCCA 5A2KH 1QQDB 3BN3B 3UAEA 3S5YA 3FKUS 3MUY1 4PJFE 2VR4A 4GBXB 1BLIA 1KJ2A 3INUH 2IH1B 4LEOB 4ZMQA 3O4LE 5J89A 5D1QE 1J0YA 4YDVB 1K4DB 2FL5A 1WZ1H 1LO0L 2E0PA 2NYYC 3TEZA 5L9DH 2DQMA 2L04A 1L7TL 4L5FE 1MW1A 3QRGH 1KIRA 4H7VA 4PJEB 1L7TH 4J3UA 3VWKA 1A1NB 2WQ8A 2E7HA 1L5GA 1B0WA 1UXSA 1R5IB 2WIIA 1DJZA 2UZXA 4HWNA 4WI9A 4YFLF 4DZBA 1DBBH 5FECB 4ZO9A 5C09B 4EKJA 3UTZA 3S34L 1YY8B 2ZICA 4UI2A 4OGAD 5T3ZL 3U9PL 3IMBA 4XH2B 5G2NA 3Q2NA 5GGTA 3DHUA 2CHXA 4Q9RH 2I9LA 4JFHE 2KUTA 3ATFA 1YN7A 1SLXA 5C8JA 5LBSA 4HIEB 5EPMB 3LNEA 3I74A 4JRWA 1JXDA 1CFTA 2B0SH 1BAWA 3Q3GA 2GG1A 1AZBA 2A1WL 1L9NA 4QO1B 3SD5A 3O45B 2TRHA 2J21A 5BRZA 4F58L 4TQPA 5IBTH 3SHSA 2NX5B 1UB6A 2ICES 1ET7A 2C34A 2MHAA 2UXFA 1ZLSH 1SDDA 2WLJA 3MREB 3FQ2A 1S7WA 4EUPA 3SDDD 1Z0MA 4NQVB 4MD0B 4OUOA 1TZHB 4N5ED 4U49A 4XXWC 3IDMB 4CSPA 1EMTL 4HHWA 4WWPA 5KS9A 1M9SA 3QJQB 5EU6D 3LKRA 1SHSA 1F5WA 3NCCB 2A6IA 2NQDA 4GUPA 2R39A 2P1YA 5BRPA 4IU2B 5DMYA 3CQFA 3VSTA 1FYTD 5AB9A 1HFUA 5D96C 4I5BB 3D69A 2AABH 3R0MA 3VE0B 2GIMA 3DPBB 4ODBD 4GKZB 4JM2A 1J9RA 2W9EL 2Q9OA 2ESVA 1IFGA 3GHEL 4AENB 5H4ZA 4JHAH 3OR7A 1FVCB 4AGLA 2OMVA 2K70A 4GO6B 4M29A 5DEFA 3S8FB 2F0CA 3L9YA 2P45B 5B21A 3CX5K 2I9TA 1RPKA 4OF0A 2NMSA 5FUOH 4JGNA 4FABL 2E5EA 4OLUL 3TH2T 3A4EA 1NCBL 3F7LA 3RGVB 3GI8L 3PAVA 1R75A 1XL6A 4F8QA 4AV5A 4LB8A 5K5YA 4YGVA 4DK3A 5I1KL 5JIPA 2ROXA 3ZE2E 4IHOA 3DJ9A 4IDJH 3QHFL 1S5IL 1KGUA 2R9HD 3CC5A 4HIEA 2R1XA 4UDTB 2AZUA 1ANUA 3U7YL 1VFBB 2OMUB 1BECA 1P5VA 2MCAA 3ZYJA 1VKXA 5AVUB 3V6ZA 3BUBA 1A7PL 2GK2A 2ZUSA 3SKJL 3UG4A 3HHRB 3RWFA 5JHBA 4N0RA 3CFKA 3WNLA 5IHWA 2OQJA 1BGXH 1EH9A 1NEPA 3O4LD 3B2VH 4UQCA 3RJDA 1G94A 2H3NA 2ZUWA 4MAYA 5AEAA 4OQTL 3H1ZA 3HAEB 4M9PA 2VR9A 3GMNA 3SGKC 4QCIA 2J1WA 1NAMB 2W65B 5A40E 3CXHJ 4A7UA 5AVSB 3RI5K 4D9LL 3IJEB 4BUQA 1CL7I 3GUTB 4OGAC 1CU4H 2R0ZH 2VW7A 3FRUB 2XFXB 3OLGA 5AW6B 1NGXB 2ERJC 1KCUL 2OMZB 4FFWC 4ZW5A 2ICCA 2MEJB 3MNDA 4BZ1H 4HWBH 5GRJL 1RZ8B 4Y5YC 5C08A 1UACH 3BPLC 1EEZB 3BZFA 2ESVB 1P7QD 3VFMB 4ZRGA 5T1MB 1OAKL 1EFXD 4UT6H 4KVPA 4WO4C 1OKEA 3S37H 4JK0D 1MQKL 2HVJB 3MUZ1 1JBJA 1T3FA 1TZ8A 4Y1AD 4BQ6A 1MCJA 4QHNA 4YAQB 3FUJA 1JDDA 3GIZL 2R2BA 2HKFL 4D0CA 4HEME 4OLYH 3TJPA 2HRGA 2WANA 3JV5A 1ZTXL 4L4TD 4OLVH 4Z3TA 1GS7A 5KSAA 4BCZA 3Q06A 1HIMH 4OKVB 5M94B 4GW5B 3GLDA 3QXVA 4M6OH 1G5AA 1KCRL 5CJQH 1KLFA 4NQCE 4F8TA 2KZBA 3U2SA 2F8XC 1HEJC 1DFXA 3IXAB 4LDLB 3TEUA 4Z18A 4TN9A 1WFUA 3ATDA 2QHLA 4RAUB 3H4HA 4P46A 3AMKA 4HC1H 4W68A 5F1OB 3MBEB 1DSFH 1I3GL 5E00B 2W9LA 2VNCA 2CIIB 2GHZA 4FZEH 2BW5A 2C8NA 3V0VB 1PCSA 2ADIB 2HYMA 3T08A 3BD3A 2NUPA 5DHVA 5BOJA 4UDUA 2R7EB 1GGYA 5AZ2H 5BV7H 5F0PB 2NUTA 1JHTB 4YHNA 3FRUA 4L9LC 1BM7A 2DLEA 3F00A 1KUMA 2EH7L 2HWZL 4XXWA 3OJVC 3FQXA 5HP5A 3U48A 4YEEA 2X40A 4NB7A 2CA4A 5DVMA 2GFBB 5DJDA 1A47A 2XA3A 3C6LA 3I6LD 3V5HB 3ROLB 3IDGB 1U8MB 3CZLA 4JKNA 4JO3H 2LLNA 3WFHA 5JHLA 5K59F 1RLWA 4ZT1A 1IGML 4OY9A 4ZSOB 3HAEH 4JRYA 4L8SA 5G55A 2R83A 3QUHA 1HC1A 2OBGA 4O58L 3C2SA 3VXRD 1A3RH 4OZ4A 4ZPTA 4AM0B 4F57L 3U4AA 4HWZA 5ILTL 2F7PA 3KYOA 2DBJA 1OAUH 2YXVA 4J6RH 4MD5A 2A77H 1A0QL 1AHWB 1W72B 5DJ2B 3ZDZE 4YVUA 3ISWA 4U1IB 3SDXA 3ZGHA 3FB5B 2WXQA 3MRGB 1IBYA 2GY7B 1O9VA 3HFMH 4ZQKA 1TENA 3UTSD 4Y9EA 3NH7H 3GXUB 3K91A 43CAB 5SWZD 5I30L 4YXHL 1H5BC 3CFUA 4CW1B 4X80H 3VAEA 1OTTC 2EADA 3HNVH 4RAVA 4H26B 1RZGB 5CBEA 3J07A 2UUDH 1JF6A 2WSDA 3CDZA 3EAKA 3LV3B 4Z8FL 3GNMH 3O4OC 4QIRA 5DHYA 1R9FA 5T3ZD 3QIWB 1JOIA 1KXVA 2GABA 5CSZA 3ZYIA 2QMJA 2Z35B 2X4UB 4UQAA 7PAZA 2OP4H 2ZG1A 3U30C 3Q1SL 3NFNA 4HS8L 3TVMA 1UOKA 3MX0A 4HWBA 1NC2A 4WNQA 2L8AA 1E6OH 6PCYA 1WJ3A 2VZVA 3ILPA 3PABA 1RVFL 3TO4C 3QIWD 4AE0A 4NNPH 1TUPA 3P0VH 5AW1B 2VDKL 4O2CA 5I19H 4IGBC 1FZJA 3PG2A 4PRAB 4AJVA 2ED9A 5HDWA 1IEBB 3TU6A 3WCYA 2DQFB 1NGPL 1HKFA 3QJZA 3UTPE 1CTNA 2HUHA 5I66A 2E7MA 2XWTB 2EXTA 5IKCB 4PJGA 5AB2A 2X89D 3RVWC 2ATKA 3TT1L 4JPIA 1OT1A 1QUNB 1S5HB 2UWEE 3AADB 1WUNT 3IGUA 4A2MA 3ZHDA 1JDCA 3CUPA 3MAWA 1IBBA 1KT2A 1E4KC 2JB5L 2PTVA 2WSKA 3CK0L 4NBXB 1QI4A 4R26H 4IBQA 4KXDA 2XN0A 4GP8B 2VLJB 4ZQKB 3VH8G 1CE1L 3A6CH 1WICA 1L0YA 2X2HA 3VGGA 5IFHH 3KDPB 4RMBA 1X6LA 3O2VL 4H26A 1OAYL 4KWUA 3L5XH 4YN3A 3Q1SH 2DQTH 5E2VH 4ZQTA 1JZEA 1QLFB 3PWPE 3MV9B 3L45A 4HKXA 3G5XB 2LQRA 5DD1L 2VABB 2F54B 1XWVA 2OYPA 4EI5D 1W0VA 4WRLA 5HYQB 1C5BH 1MI5E 2I7OA 3GMRB 2VAJA 2FBRA 5DHEA 3KBFA 2EYTB 3V0IA 5DR5H 3MN8A 4AMKH 3VW3H 5D7KE 1MXGA 1D6EA 4WI0B 2Y2TA 1NLDL 2ZP0T 4TVPE 3BH8A 4N2MA 2N7SA 2PYEA 4MSWB 3D18A 5IB2B 3OKDA 4NKMB 1UJTA 2EDYA 3HUJE 5HGBB 2YFOA 2DYPA 3JZYA 1LHZA 5FO7A 5BQ7B 4HK3N 4NDMB 2VSMB 3NCYP 4R4FL 3S48A 4AC4A 2E6PA 1V55B 3HZMB 1CXIA 5D7LB 4HX1A 3GWJA 4JFYA 4LCUA 4HU2A 4U2YA 2VUYA 4W9ZA 2BSSB 3WAKA 1AACA 5EC2A 5BV7B 6CGTA 5IW6A 3AZUA 4R26L 1AH1A 3NZ8B 2Q10A 3TTYA 3S3CB 5BS0E 1TO5A 3HI1A 2J5WA 4XP6H 3ZQXA 4HKJB 3K6FA 1FG2B 4JM2C 1I1AA 2UZIH 4TSCL 1RPUA 4U1LA 5F93C 3RWEB 4PJCA 5FOJA 3DUSB 1DHKA 4ODVH 2J6WA 1Z32X 3JWNH 5H37H 5G4MA 4G7QB 1RZFL 4LNRB 1A25A 2OCJA 1CZ8L 1ETZB 4EXPX 5A2AA 4XNUL 3PL6A 4YK4B 1IGCH 3ZT7A 3RY6A 3O9WB 1G1KA 3P0VL 2A3TA 2ZP8A 2ZCZA 1A9EB 5FYJL 1TJMA 1I1FA 4I18A 4CSZA 2QL1A 4Y2OA 2WZ6A 4C4KO 1LEIA 2P5EE 3T77A 2NY6B 3P73B 2YRPA 4RFNB 4TOYH 4HC1L 3U0PB 3DURA 3MLWL 1EBPA 4B9GA 1SPDA 3RVXC 4MNGA 1AS6A 3FT9A 4NCDA 4OF5A 5EV7A 5JZ7C 4XO8A 3K2UH 4QTIH 5AOIA 2FD6L 3KJ6H 1JUFB 5CSGA 5BVJB 4N2NA 5DMGD 3LRLA 5E5LA 1IM9A 1FFTB 4KO9A 3U9UB 2FQGA 1JGLL 3S5LG 5L2KA 4Z7WB 2YGNA 4PSPA 5E99H 2FEDD 2V5SA 5DSCB 4LCUB 3V4VB 3HR5A 5F96H 3WIHL 1SN2A 2V17L 2Y23A 5HDBB 2CO6A 5KG9A 1VADA 2EDJA 3WD5L 1MQKH 1WITA 3WHE1 5DD3H 4U6VH 5K1NA 2D8KA 4DP9X 3H6AA 4XXCC 3VFGL 3CFJA 1A9VA 3V7AG 4L37A 3STZA 1RU9H 2D4DA 3COOA 2HA1A 5HVGB 2X4OB 3JVGA 2J25A 2VDML 3FMGH 3VWKB 4CDGC 5CJXA 4LCWA 5SX5K 5MENB 2W81C 4ZFFB 3H2WA 1XIWD 1MCWM 2AJZB 5EBLA 1PZCA 4QGYA 4HQQH 3DETD 4K23H 3FTVA 1U92B 4OSUL 1A6PA 4G8AC 1TNMA 2ROYA 1GGCL 5I2IB 2IADA 1KBWA 2WQUA 5F7EH 3IDYC 4N0FA 3GSNA 4QRRB 3T77B 1LGVA 2DMGA 1U6AH 4OLXH 3U4EB 1RQ5A 3H9ZA 3VXNB 3MKKA 3IDXH 4OGYH 1A1MB 3HZKB 1NUNB 5IJCC 3BQUC 4OFPA 4W81A 4XNZC 4KDWA 1T03H 3ZDZF 5KZCB 3MRDB 5TK4A 4HGWA 2BP0B 1MFEL 2BSDA 2NXZB 1QFWL 4JE4B 5JYMA 3CFEB 5AYUL 4DUWA 2OR7A 1ET5A 1N18A 3UDWC 3BPOC 3FS9A 3T71A 5DSCA 4LQFH 3UO1L 1F1GA 4WU7B 4WI7A 1WF5A 3GXNA 2VXQH 2CO1A 3OF6A 3NDZE 4YHLL 4BRJA 3L3HB 3LXBA 4ZMOA 1U58B 1G9NC 1X5LA 3WENA 3TBYA 4FN0A 4TULL 1D5XA 1IMHC 4IJ3C 1FRGH 2NX5E 2H47C 3CXDH 2CALA 4PSRA 4YZFF 5AUMA 2NY2B 2CBOA 3KHOA 4H5SB 1NKGA 5FDWA 3VSUA 4PIRF 1F4WH 2BSBA 4AJ0A 5ITBL 2QGBA 3C75A 2DQEL 5C0BD 2DZEA 3MODL 4LRNH 1MDAA 1J88A 5KUMA 3TO2B 2H6OA 4YSOA 3UMNA 1T2XA 4G9DA 1AO7D 4TNVF 4GB9A 3H85A 5EDSA 1E4WL 3W56A 1XH3A 1JZ2A 1WTLA 1UTDA 5AVRB 2FJGA 2H1PH 3U25A 3VU1A 4ALAH 3EYFB 5T5FH 1JPTH 1IC7H 3GSNB 8PAZA 3Q2VA 5JW5A 5CIPA 4CBZA 1H19A 4NC1E 1JPST 5HGDA 3VX1A 2CXGA 1EHXA 3ZTDC 1BX2B 2PTTA 3I6SA 3PP3H 5E56A 3FT3B 1A1MA 5EZJB 1G87A 3KPRD 1VFBA 4WO4D 2J73A 5HYEA 1G9EA 3VGFA 1IQWL 4HH9A 5E95B 4EZLA 1M7XA 1URZA 4L3EE 2O26U 5DQ9A 3TYFA 4DPRA 4QYOB 2HN7A 2IALA 5J56B 1MFAL 3TCLB 1JTTA 3IMTA 4TUKL 1KXVC 4AT6A 4ONFL 1UATA 1H3WM 2FSEA 2GTZA 3L2LA 5EUOA 2BPBA 4Q9RL 3DK2A 4OGXH 3T8XB 4D0BA 1UURA 4XAKE 3T65A 4JFSA 5EF0A 1OVZA 1C5CH 1F13A 1RIHL 3QXTA 2CBQA 2C9RA 2E9GA 4LFHD 4QRQB 5C0EB 1S5IH 3AS2A 1SJMA 2LT9A 4JFQB 2X6UA 3B9KD 1Q9LA 4NBYB 3SE8H 1F3JB 1TQCB 4MXVF 1AMYA 1WAAA 3IKCB 5JORA 5DO8A 5BZWB 4LBEA 4AVIA 5ICZB 1KIRB 3IPFA 4J7RA 4KX9A 3BPOB 4OLUH 2DWXA 3D6GA 3MNWB 2A9NL 4UQIM 1L5GB 5DK0A 1SJXA 1FRGL 3T2NL 4KVCL 2OMBA 4DGVH 1ZSDB 1DFBH 2HVJA 1JZ4A 2V7NA 4JLRB 1XAUA 3EJJX 4F2FA 4YAQA 3RL1B 3TM6A 1JV2B 3RZCD 4O51B 3L3GA 5J1AA 2D7TL 3FC8A 3IF1B 1T2QH 2YAHA 4MXWL 3SDCD 1PG7W 2FECL 1NBVH 4RGMC 3L3OA 4UTBH 4PW4A 1QBLH 3BKCH 3FO0H 1RIHH 2ENYA 3UPAA 4H8QA 3KYAA 3OLEA 2Z34A 4GRWH 4PS4H 4ODHH 5CXPA 1WFOA 1I3RA 2XN9D 2YQGA 2DYRB 2HRHA 2P3YA 4L18A 3D2UD 2W94A 1KY6A 1G0DA 5HGGS 3NSYA 3OC5A 4UM9B 5JPMA 2J2ZB 2OYMA 1TPXC 5IVXB 3EYVA 4KUCF 1VGKB 1C7TA 4NQCD 1TKWB 1A7RL 3ALXA 4FFZA 1UB5A 3A0OA 2XVBA 3JWNG 1KYDA 3GKWH 5GGUA 5C07D 1OP5K 3VFNA 2CDFA 4GUPB 12E8L 5C0EA 3W9DA 2PXYB 3GRGA 1EFXB 4KXZH 3HB3D 1NBYB 1JI2A 3R1GL 4GFXA 4L1BA 2P7TA 4PGBA 4PJDE 4PRPB 5EIVA 2VLRA 3PU7A 4IDLA 3L5IA 3SE9L 1SEBB 4NRYA 2F5BH 4P9HC 4XCCL 3ZKMC 2AK4B 3IDJB 4JMNA 4FQXC 4Z9KB 5BOPA 1JFQH 2EVGA 3QEQB 1JN6A 2H1PL 4HGMA 1HWWA 4PJ5D 4O00A 4X6EA 3HBQA 3R0NA 2TRYA 3NRFA 3R4DA 1DLFH 1KB5L 4LMQI 3T9WA 2V7NB 3UYOD 1OQOA 4Y4FD 5C2UB 4TLTA 4NPYB 1OK0A 5IOPA 4YDLC 2R4RL 4XNDA 5LGJA 4FADA 1GZPB 4P2QE 3T0AA 5E6YA 5C7XL 4RMRA 8CGTA 4IBWA 1JDAA 2H2PC 4H25A 4HUCA 1CE6B 3MOBH 1FO0B 2IQ9L 1HSAB 2VXQL 5SWZE 2IH3B 5DJXB 4ZAKC 3T4AC 3VMNA 1VKXB 2G2NA 2R8SH 3L81A 4WO0A 2F53D 1LJMA 4E9XA 3TA3B 4LHJB 1M6OA 4PTTA 2O5NA 2X5PA 1CGTA 3QR2A 4AEIL 1UM4L 3SBWC 4X4XB 5DRZA 3UTQA 3X1BA 1S7UA 1NCUA 2PCFB 4PCKA 4PRHA 1ZY9A 4OI7A 1FA4A 1SDDB 1MJUH 4E2OA 3RIFK 1KBGL 2ICWJ 1DQDH 2BFGA 4MD0A 3O8XB 1S3KL 4ZUTB 4ZAKD 1I8IB 2R29A 3QIBA 2CDFB 2FR4A 2NTSP 2CRYA 2P44B 2XFXA 2CDGA 3BHBA 4FXKB 4A7GF 1F2XK 1F4HA 5I1JH 3GQFA 2DS4A 4S0TD 1CYGA 2NDGA 2W38A 1U3NA 4N0UA 3NACH 3O2WL 4OLZH 3OKNA 3EHBB 4HMEA 2HJLA 4U1GC 2NQCA 3B56A 4XX5A 2XSKA 3EOBB 1REIA 2WWMC 4P9ML 3H9SD 1NOAA 4LCIL 4LSRH 4XP6L 2WVUA 3NJFA 1AR1D 4A6YH 2YHGA 5DUML 35C8L 4ZTPL 3MBWB 1B0RA 1T7XA 2X38A 5IW3A 4HETA 4HOWA 5C0AD 1RZKH 2ATKB 5AVTB 3C5ZA 1CE6A 2AITA 2F54E 2V9TA 5F8RC 3DI3B 3VRIB 5C9KA 3BVVA 4JO2L 4IHOB 1NCNA 4RISL 2H0JA 1G84A 1UT2A 4FQHB 2QQLH 5JDSB 2OMYA 4MRCA 3VCLA 5CJBA 1N5YH 3K2IA 1PEZA 3WUZA 3CCHA 1KGWA 1AFVH 1E8ZA 1TCMA 5D1ZD 3NQIA 1RCYA 1S7UB 3T0BA 5F7MC 5EFIB 1MFMA 4ZMAT 3G6DH 4ZZKA 3PGCB 1BZ8A 4FULA 1FL5B 5EZIL 1NCCH 1P6WA 3SPVA 2QTVA 2RQEA 4BDVA 4YHML 1XF5B 3MV8A 3P0YH 4Z7AA 2VH5H 3AS3A 2VKXA 2J6EH 3EUDA 4DCQB 4KUZH 3EFOA 3R19A 1II4E 2G75A 3EF4A 4ZS6C 4KY2A 3KR3H 3VB9A 4W9HC 4JW3A 1JV5B 2DKMA 4UOW1 3HFFA 2GFBA 4KRMB 4Z76A 1CGUA 1L0XA 4OKDA 2UV3A 4U1JA 4GJTB 2J1ZA 1UC6A 1HU8A 1XCTB 4HDIB 2JI3A 5HYJB 4HJ0C 4R4NC 1O6TA 4E41A 5J1SC 4UV7L 4UQ2A 5LDUA 3SQBA 1HOEA 1IVLA 1UHVA 1OAZL 1DVFD 1J12A 4HKBB 3GBEA 4HWZB 5DS2A 4O4YH 1G7JB 3MRNB 5D7LA 4LVOB 3GBML 2AXGB 5T1DL 1BVNT 3QWQB 3LZLA 1LEGA 1ND0A 2K45A 2W9DH 2VDNH 3IFPB 4R8WH 4UIMA 1LNUB 4ZTOH 5HDOA 2ZCLH 2XJLA 5K1JA 2Z64C 3KDMA 1QBML 2ZSVA 5JUEL 4BFGA 3L54A 1UUNA 3PWLB 4GIAA 4H1LG 3OGOE 4L4TA 5KSAD 3V5KA 1U21A 1XD1A 2FE0A 5L4FA 4I9WE 4XVUC 3FU0A 3CU7A 5CBEB 3BVWA 5EFIA 5EB9A 3MLPA 1YEHL 1RUML 3CSBA 3NCMA 3KGSA 4ADIA 2IGFL 3S3BB 4UILH 5I76B 5F0JB 1XB8A 4O02B 5FYLL 5B22A 1HK6A 5D5MA 5ISZD 2OP4L 1NBCA 1TTRA 4OCWL 5DFVD 3F7KA 3GXPA 5GS2D 3PGFH 4ZOCA 3V0FA 5KYWB 5FPIA 4PVNA 4Z8FH 3DHMA 3T0EC 1NTDA 4S0HA 1AYRA 1DSYA 2FX7L 5IMLB 3HI5L 5IB4B 2XA8H 3CVHA 3MUHL 4B6ZA 5ITFA 5EEXA 4Q6IB 1GAFH 5D2NE 4G1EB 3WFHB 3O0LA 4L8SC 3FCUB 3IDIA 4PJ9D 4QTFA 3N3EA 3N41F 1FAKT 1T04B 2XBTA 4L3FA 1T0MA 5EMYA 4F7TB 1N10A 1H9DA 3MRNA 4PUBH 5DVOA 5CLZA 4F9PA 5T33L 5BRZD 3HR5B 4KROD 4J3BA 5F7AA 5GPRA 5ESQA 2DIBA 3CK0H 2I07A 2W0FB 1T1YB 1LO5B 1LEGB 2NOYA 1QBMH 4WW1B 1CE1H 2ADJA 2CK2A 4PRDB 3FAWA 4JG5A 4X5XA 2E76C 4JRYD 1S9VA 4DN4L 3B5GA 4OD1L 1A6UL 4V2BA 5EU6A 4JM4L 4XP4L 4JM2B 2YPVL 4WK4B 2VDRL 2FEEI 4MLSA 3KH3A 2A38A 4B9PA 2QDVA 1YUHA 5DZAA 2W91A 5DVNA 1I8MA 5CJ8A 1IEAB 1L3WA 1OAZH 4LOUC 3D87B 2YD3A 4ABUA 3V52H 2H45A 3UBXG 3UC2A 1SXCA 3QIUC 3F3HA 4HGKC 3JWDL 4NNXB 3CC5B 2YZ1A 1CFNB 2BCMA 5HI5C 2VT0A 1QRND 2WLMA 4L2YA 1OIOA 5ISZE 1EA9C 1KJ2H 3U7AA 3S98A 4K71B 4DEPC 4TMPA 3S8GB 4S1QH 2VM9A 2PYEB 4MSWA 1GA2A 1CUOA 3JBG7 4HGWB 4HXAH 5C6PB 2DDQL 1FZJB 2N7BA 2R8SL 1EV2E 2NY6D 4QAWA 2IH9A 3J2PA 1UH3A 4UB0L 3M6DA 1UJ3A 1EIBA 1E6JH 2VLMD 3VD2A 3PCYA 5EC2B 1U8OA 3FH5A 1BEYH 3QNYB 5FS5A 3ETSA 4JQXC 4PLJC 1X5XA 5EDXA 1X7QB 4NNYA 4AH2B 1QVOA 4NBZB 3HFML 3TBYB 3QJFA 2RR3A 3MV01 4JHWL 3SPIA 4H0GA 1J8HB 2FH8A 2P5ED 1RJCA 4OJYA 1A0QH 3QB7C 5GS3A 1B2YA 3IVKA 5AL0A 1NAML 3FRPA 2X89A 1KNOA 2Y1VA 3N43B 4ZS7H 1RY7B 4UTCA 5E2UL 1JZIA 3LN4B 1KGCE 3D0VA 3OLDA 3PL6B 2BMKA 2MCMA 3D1MC 3CJJA 5IROC 4DGIL 5C2BH 4NM4L 3CVBA 2YN3A 4FI6A 3MRBA 4WUKL 3ZTJH 1A1OA 3EGDA 3KAAA 3L7EB 5D7IE 1F18A 3TF7C 2JXMA 4PW9A 5PAZA 3WSQH 4ELME 3KLHD 1N8ZB 1SXBA 2PR4L 3DTXB 5E6RB 4ESKA 4OQTA 4F9LA 3MJ8B 1I8LA 5TTRA 1OE3A 4M4PA 5EZJA 3TPKA 2EDNA 2K8QA 4P9HL 4QDGA 4URKA 3WU1A 5BVJA 1OALA 3ENEA 4M7LH 3FQUA 4JFZH 3DRQA 1NEZG 2P8PA 4FLSA 1FYTE 4P2RB 3ARQA 4LU5H 4Q9QL 3AT9A 1EVTC 3DJSA 4GEJA 5ICUA 4F7EA 1NBVL 1DDTA 1IC4H 1GIGH 1KCBA 2D4FA 2UY7A 4CAGA 3HVNA 2GIYA 2X4QB 3VDCA 2GI0A 4JFYB 1DEEB 2VDLL 1XEUA 2R4SH 4WENB 1X7QA 4YZFE 2NXZD 2V7HA 2A6IB 4FF9A 3QDMD 3D0LA 2D7TH 4M6OL 1LP9F 1MW0A 2A4CA 4K3HA 1MDTA 1S7VB 1YEEH 2HFEA 1RJLA 4YXLL 1QA9A 4FABH 5I1EH 1PSKL 3MUJA 2OS7A 1E43A 4M7ZC 3NIDE 2PCPA 1A9BB 4GW1A 4HG4K 1FLRH 1SMDA 3O41A 3GIZH 5GZND 3RTQD 4V33A 1H6FA 5EBLB 1I7TB 3IXTA 1KB3A 2LU7A 1DSWA 1MCPL 1K8DB 4WK2B 3T4AA 1K9TA 1YEFL 4FFTA 2NZ9D 4V2CB 2FVNA 4X6DA 1MFVA 2JXMB 3WJLA 1U8JB 1TT6A 5DD6A 3W11D 5KN5B 1G7HA 3H53A 2BY0A 4Y2OB 3FCTA 4Y5VC 2X4RA 1V5JA 2XJKA 3WE6B 5A2BA 4M62L 3DX9B 2BM3A 3LEXA 2E6JA 5D1XC 1QNZH 5HJDA 4PHXA 1QEWB 1P5VB 2J56A 1TQUA 4AGQA 1NCIA 3VM7A 2ZWLT 5C08E 2DLTA 1G7QA 3TYGL 2XX0A 3K5RA 4QOKE 3T6QC 3S96A 4AQ1A 2DKSA 2GJJA 2AQ3A 3A23A 3MR9A 2OJEB 4B95C 3TL5A 2G5RA 2B1OA 4KVNL 4WK0B 2B0SL 4AGNA 1PJ9A 4PD4K 2EDDA 1URLA 2Z4QB 3ATBA 5DC0A 2QQNH 3G04A 4F2EA 5GGUB 3QZPA 3IS0X 4ALAL 1YNTF 2CCVA 3AG4B 3D0LB 3CHQA 3IJEA 43C9B 5AUMB 4ZDHB 4XWGL 5GS0D 2WAHA 3ZO0A 4DGYH 4ZPVA 1MCWW 1YN6B 4Q89A 2ZXDA 4HSQA 4MNHB 5FFOA 5KBMA 3RUGE 3ZSSA 3AY4C 4DK5A 2OA9A 4L37B 3RZCB 4GAGH 4JL1A 4PJFA 1FDLL 3TBSB 1RJZB 5FO8A 1NC2D 2W95A 2E8ZA 3CHSA 3SQOL 1KPUA 2FNBA 3B4NA 1R4XA 3BZDA 4MTMA 3INUL 3H0TA 4PV8A 1XSIA 3WMPA 5IHUL 4JO4H 1JS4A 5DS8B 2JJVA 3MYZA 4ZUVB 5GRVK 3T1WA 3WO4C 3FSOA 4FKEA 1IKFL 4F5CE 2F68X 1DVYA 4C54A 2G3XA 3I3BA 3S88H 2K1MA 3OG4B 5AB1A 4GQRA 5J13B 2VZ3A 2VDOB 3PQYD 5C0RH 2WQSA 3UO1H 4F7PB 2CKBB 4QRBA 1FNSL 2V2WA 2XZCL 3X1FA 1XIWA 2NXZC 2IOIA 1MWAB 3C6SB 3MJ7B 3RGVD 1HZKA 2J43A 1BF5A 2VLJA 2WBKA 3QI9A 2PN5A 1PAMA 1YG9A 2VDPB 4KO5A 4WFHE 3BMWA 1OF2A 3QQ9C 3O3BA 1R19A 4PJCE 1UA7A 5IQ7L 3MR9B 3MLVH 1FYHB 5KOMC 1V54B 4X4XA 4OM0H 1F3RB 4QWWD 1YNLH 1J10A 1KIUA 4G82A 1ZHBA 5GSVA 1U6AL 3G5ZA 1G1CA 1M71B 4YLQT 1G7PA 2EH8L 3Q2WA 5I26A 3O6MH 5T3XL 2A4EA 1KFAH 2CZNA 4HWEH 4B96A 3KLAA 3AS1A 3QJTB 3WGVB 2BC4B 1NICA 4UM9D 5LAXA 4A6YA 2OAAA 4KGLA 1HXMA 5MEPB 4QRPE 4QF1A 5KYXA 4KMTH 4KK6C 5DA0B 2WQRA 3MLXL 1WH0A 3QDHA 3V5HA 2JKSA 1NPNA 2JMRA 4NC0B 1ICTA 1SUHA 4PJEA 4K7PX 4OQ1A 2VISB 4Y2DD 1CDHA 3HB3B 1YEIH 4PRPD 5F6HI 3HR6A 2Y72A 4G59C 1IU1A 2DI7A 2QSCH 2PPDA 2HAZA 4NN6C 4DP8X 3PY9A 4HCGA 5LAPA 3RWIB 2AK4D 5K39A 5C0JB 5DXWA 5L9DL 4L8DB 1CIUA 2J55A 3F5WA 2DQEH 4E9LA 4YZWA 2GBVA 2ZOKB 4EI6A 3GMMB 1WC7A 2YMXH 3PXLA 4HPYL 4XWGH 3KPOA 4GQ9H 1MFBL 3KPSD 1OGAE 4N8CH 4AEHH 2BW4A 1AO7A 2FO4A 2YPLD 3KJ4B 3HB3C 4J4PC 3BEWA 1NQBA 4XE5B 4FFWD 5E9DE 4PCTA 5GIRA 1AGCA 2X70B 2P26A 4LSQL 1Y6NR 1D6VH 3WFBL 5IVXA 4LCYA 1P4LA 1CLZH 5IK3B 1M71A 4FQPA 1TZHA 1Q1PA 4KI5F 1WWAX 4MD4B 4X0KB 4CKVX 1QSFB 3KLAB 3KPNA 2OJZL 4DFHA 1N8OE 4HJJH 3TH3T 3LKRB 5DHXB 4C57C 2WXHA 4MMYB 4GP4B 1D5RA 4KXAA 1TOXA 4KXBA 2VGLM 3IDJA 5FYLE 5KSAC 1F41A 5E4EB 1GOGA 2H2SC 2WXKA 2Z93A 1CZ8H 2VL5B 3QNFA 4K4KA 5D7EA 1IC5H 4NO0B 1KXQE 1S46A 1YY9C 1KENL 5AVVB 3DPBA 2NT0A 4IIZA 3EO9L 2VISA 3VGHA 1IM9B 4HDIA 2Y22A 1PG7L 3TLRA 4NO2B 3TT3H 4YSAA 3S8WA 3IJ7A 4FAAB 1ACZA 1MCQA 1D5BA 4DP4X 5DEGB 1HH9A 1I7RA 3WMQA 4D8PA 1JXFA 3B9KA 1ML0A 2J8UB 3OKOB 4Y4KA 1P7QA 3WIAA 3F5WB 4H25B 5CZXC 1G5GA 4Z7OE 4HZLA 1FO0A 1IM9D 3T0ED 3TFBA 2FEJA 4L9LB 5DRNA 1NEUA 4ODSL 3JWDC 3C60D 4R4FH 3M86A 4NERA 4BQCA 3N85L 1FNAA 4HXAL 4OIIL 2NCMA 2N7AA 2X0UA 1YJDH 2L0DA 2ZKHL 5EBWB 1GJWA 3SDAC 1Q0YH 4OCSH 3AXHA 4GKLA 4WV1B 4Z1PA 4XP5H 4Q9QH 1FCCA 1E28A 1RJYB 2WKOF 4AMKL 3VW3L 4G6AD 1NKRA 5GGVH 1DQQB 1TJHH 5E7FA 3X2QB 1JGLH 1XGYH 2VZSA 5B38A 6FABL 1J9SA 2XQYA 5AQ0A 3EO1A 4XVTL 2FLBT 5BPPA 2MPVA 2K7PA 3EYVB 4EBQH 2IPUK 1NDGB 1QRKA 4NENA 3IMWA 1WP6A 4QCIB 5JW4N 1QFOA 2XYBA 3DWTA 4LCWD 1PD6A 2NLJB 3K4AA 4ICXA 5C0AE 5HYJD 4W9EC 5KJRL 4B7LA 5TDPB 3NGBC 1KCKA 1R3KA 5IB5B 2W07A 1YMMA 3ILEA 4LFHG 5I1IH 4NT6A 4X7SL 3V9FA 4LVHC 2G4EA 3E6FB 5FA3B 3SBQA 1QEXA 5FM5O 4ECNA 1YDPB 1U93B 3GRBA 5ADPL 4Q6IA 3X17A 2ZWKA 5FFGA 4NKMA 4IJ3B 5DUPH 2ZUQB 1KC5L 1BZ9A 3QO0A 1M1XB 5HHOA 2ZXWB 5DQJB 4JPVL 3WIIH 4MS6A 3L3OC 4X6BB 2F8OA 3QJOA 1F45A 3HA0A 2QBWA 2XG4A 5DDHA 2LW3A 2ZF9A 1FL6A 1KTKE 1RV6X 3T5WA 1ZHKB 3AABA 1D5XB 1PMYA 4DAGL 2WXPA 3U1PA 5GS0L 4HJ0D 4JHVA 4R4ND 5ADOH 4PB9L 3VA2C 4UNIA 4Y4FA 3U2SB 4JB9H 2DAVA 3EFDL 1IGTA 2CO7A 3RAJH 1E4XI 2CR6A 2JIXA 3UO8B 3P4NA 3VFSB 1OAQH 1A1NA 1N64H 2H1XA 2Y69B 4GRWB 1E6JL 3CDYA 3UC0H 2XWRA 4G5ZH 4FA8A 2HH0L 1EK3A 1S7XA 1TQTA 2MSPA 2IANA 4XP9L 3HG5A 1AD0A 3TO4A 5LBSH 1JPEA 1E5ZA 2MQ3A 1UOLA 2JKTM 3TV8A 1YY8A 1YYLL 2NUPB 1NDGA 1ZE3C 3RQ3A 4NQTA 2YXFA 4E42B 4UDUB 1DN2A 3ARVA 5FOBA 2A73B 2WXJA 4EN3C 4XNBA 1BJ1H 1FHNA 3E9UA 1PKOA 4AIZB 3GJFB 4IQHA 3TBTB 1LEIB 4MNQB 1H5BB 4NRXB 5IQLA 3BUYB 5B39B 2YOAA 3ZKXB 1JYVA 2GSMB 4R2GB 2QDWA 1WFJA 1BEXA 1ZHNB 3DSFH 4NGHL 2V2TB 4N1HB 2HJLB 5TPWL 3BP4A 1HHJB 4IMLB 2AHIA 3I84A 4JRYB 4L8SB 2FSEB 4L8BA 1XGRA 4JKWA 4R83A 1WBYA 4M61B 2WUBL 4TYUA 3GBMH 2BOLA 4C58B 4CVXB 3IFPA 3VXRE 1GHFH 1KELL 3MZTA 4NX0A 2VQ4A 4FNRA 4KKPA 2XETA 3WEXB 3T3ME 2Q6WB 3TJEL 5DJCB 4YLCA 1XGUA 3DXAD 3FRPB 1N26A 2CXKA 1A4CA 3U2IA 3VFOA 1YEHH 4TVPD 5LB1A 3VFPA 3QG6A 3WOVA 1ZSDA 2HPOA 1MREL 3RWJB 4Z7NF 2V5MA 3L17A 4YE0A 2HJKB 2VR7A 5FV2A 1AZVA 2VDOH 1CXKA 3K74B 2QPEB 1QBBA 1BFVH 2R56H 5KTEH 1DVZA 3EJUA 3ZE2F 4AIZA 4JFFD 2OMNA 2YK1L 3QI9C 1RZIA 1LLAA 3EFOB 1E5AA 2G75B 1DQJA 5CUSH 2HLFC 4YXKH 4JPWL 1I3GH 1OP9A 1LTXA 1Z9PA 2L7UA 2B77A 3QUZA 4UILL 2ZX7A 3WNKA 2PXYC 4O2CB 5F70A 1C9SA 1YECL 3N85H 2RB8A 4W4OA 2GJ6D 3QDAA 2P8PB 4EJ1C 4Y19B 1NLBH 4ODSH 5ES4B 3TASA 1Z3GL 2CSPA 3MJ9H 4OD2B 2NZ9C 3V6BR 5I66B 2YD5A 1DZBA 2GB2A 4AK2A 3B1UA 1IILE 1QBAA 1T1YA 3QPQD 4YDJA 5I30H 2PXYA 4MFHA 2VQ1B 4RWYH 2WZAA 4V1DD 2P5PA 2SODB 3BQUD 3M07A 3FYEB 3QUYC 2Y06H 3WGUB 4ZNEA 4P2OA 2XVGA 1AYOA 5T1KB 2VDNB 4LVNC 3QUMH 3N9GL 1C8PA 1ZCRA 3FU7B 3UABA 3F62A 4GAAA 3T8VA 2DEXX 1HT6A 2CLVB 2WP3T 3S2AA 1BIIA 2PCPB 1AGBB 1TEYA 3V0WH 3HLAA 3L3JB 4D3CL 4N9GA 1ES0A 1LEKB 3NJMA 3ESMA 3QUYD 1JRHL 5JZ7D 3MRIB 1CQKA 3H9HA 2FHBA 4X4YA 4H1LH 4AZUA 2R0ZL 3JUYA 1N2RA 5HYSB 3ZL4H 3BFOA 2EO7A 2PO6D 4NNXA 4Y8DC 5JNYB 3B3BA 3Q5YA 4RGNE 1B4RA 2RH0A 2K6ZA 5K9QI 4H40A 5H35A 3AC0A 1L9RA 3PXJA 4XCYA 3B3IB 3JV4A 4QHMA 5IIEB 5K9JH 3G5VB 4YE4L 2EDMA 3DTDA 3JT2A 5BV7L 4P5TC 3W9EA 3DX6B 5LDSA 1CD9B 3MBEA 4XMVA 3JVFC 3QDMB 5D7JB 4P48A 1WVZA 4FYQA 3LZRA 3BZEB 3QAQA 2FJHA 5C0NC 2GTZB 1MSPA 1A6ZB 1HEHC 2WXGA 4OCSL 2ZUTA 5EORL 4YL4A 1T0MB 1S9KC 1MJJA 3KYMB 1J9CT 3LY6A 3RPIA 1OPGL 4IIQC 3T0DA 3EO0B 2GAZA 1S7RB 1VFMA 2NX5D 4YIQA 4HCFA 3S3PA 3LEYL 4QOKA 4K7PH 2ADJB 3O11B 4GO8A 3PWUB 4BSVB 5JR1L 2CLZB 4X50A 4ZPVB 3SO3B 2DQJH 2D7OA 3BAWA 3UPCA 4Z6AT 1CD8A 4NI3A 4LBEB 3QIBD 3TBSA 3RZCA 3TOPA 1R0AL 4PJCB 4MXQD 5ALCH 3DJRA 4B9FA 1BIHA 2QV2A 4KKLD 4LSRL 3SDCA 1I8LC 1I8MB 4LLVA 5IT2H 1G7MA 5HY9A 4EVNA 4Z7UB 2CIKA 4U1SB 1NGZB 3EJSA 1AMXA 3GKWL 3QNXB 4GIOA 4KJPD 3DC0A 2EACA 3MA9H 4MS8D 5CCKL 4U3HA 1HE8A 1MLCB 4URTB 4AJYV 1SOQA 2CMRH 4HPYH 5DZOA 1PW3A 1SRDA 5KAQF 1L9SA 4UTBA 1S8DA 3X1NA 4BFKA 4I3SH 3G5VA 4FEMA 4PJAE 3R8QA 4I0KA 1F97A 2D7NA 2EYSB 2CHZA 1TQCC 3REWB 3MXVL 5B1KA 1N6UA 4GLRI 5C07A 3OKEA 3EZJB 4MASA 1JYWA 4WGVB 3PWPD 3NEOA 3Q1EA 1Q9OA 4P2RA 4XPTL 3BZEA 1QABA 1JD7A 4F5CA 1HILA 3ZPDA 1AQDA 3K8KA 3LHAA 3NZUA 4C4BA 4POZC 4WSKA 3SPVB 4MHHI 1BGXL 4NN7C 5A2FA 5D1XD 1HZHH 1Q1JL 1D9KC 1JHLH 1Q9WA 3ORJA 5IEKA 2IAMB 3G6JB 1IKFH 4CC0A 5I8OL 3SDDB 2LGNA 2WBJA 1L6XA 1LE9A 2E46A 4N8VA 2DMCA 3RPKA 2WZ5A 4I13B 2J4WL 1YYML 3QHFH 2ZIDA 3PHAA 5TFSH 1TTUA 4FTDA 1MELA 2CGRH 3O6ML 5T3XH 3LVTA 1FAIH 1WFIA 4N8UA 1U8HA 3DRTB 5EU3A 4JR9L 3VB8A 3B8YA 3OR6A 1TTFA 3PQYB 2DM2A 2CRIA 5F9WC 3D0VB 4G42B 4N0YH 5FUCC 3K7UA 4RA3A 4R0LC 1K8DA 2P5EA 2YGOA 5M95B 5HHME 4MBRA 4JPIB 4L8DA 1I4FA 4WI8A 4Z77A 4BKLB 3OB0H 2AJUL 1E30A 1LNUA 2Q5BA 4NZRH 3NA9L 7CGTA 3UMTA 5E5MB 3EGSA 3PJSA 3CFNA 2VZOA 3KPOB 3P3SA 4FNSA 3HZVB 1ED3A 3RX8A 4BA0A 4KTYA 3JWNC 3VD9A 1JGVL 3HZKA 2WINA 3MHZA 3NVQA 2E7LC 4HUWA 2Q3ZA 2EYRA 4XBMA 5B1JC 4CA4A 5I1HL 4U1HA 4P4KC 5DRZB 1NFDE 3ZGIA 1AAJA 1NAKH 4GRMB 2JLPA 3SE6A 2ZAHA 4LOFA 4AJWA 3WJMA 2KYIA 5IQ7H 1M56B 3B9VA 2ZPKH 3I02B 5CINL 1FDLH 1KN4L 4ZX6A 2YJLA 4F7EB 1QSFA 1I8IA 2ZUXA 1W8OA 5LVEA 4F58H 1V7MH 4WU7A 1U9KA 1G9MH 3P3RA 5EO9A 3D50A 4U2ZA 1H3UA 2WAQA 4JFDE 3K72B 1EAOA 1HH6B 1A5FH 3H9SA 4X5LA 4NQDA 5FKAB 4H20L 1BJMA 5JHLH 5GZOC 3P9LB 3I3DA 3FUNA 4QRUB 5F9OH 1HSBA 1NIBA 1YEJH 1AOHA 4KH2A 4M43H 5I9QB 2YAQA 1AANA 2BH0A 2BIHA 1DBBL 2UZXB 1KIQB 4MKMA 5I1GL 4PJIB 2DLFL 3PFUA 2HG0A 4HX1B 2G0KA 4NO5A 2GCYB 1IQWH 5GZOD 1IAIH 1QW8A 3BJ91 1GSKA 1CK0H 1IFHL 3I6LE 3OJ2C 4WW1A 3EJRA 3A47A 4PJ9A 4LGPB 4S1RH 1T83A 5DRNB 1TEGA 2QR0A 2QTEA 1BYPA 1MWAA 1KTLB 3MJ7A 3FOLB 4CJ1A 2EDBA 5HI3D 3SN6N 1DBKH 1RSFA 5EZLA 2DBLH 1AR1C 3RFZA 2WXNA 3D85A 4OJCA 2QQNL 4RBPH 1BVZA 1OCCB 3KL5A 1FVDA 2XICA 4PJCF 2CU9A 3CFDB 4R0LB 1QTSA 1WBZA 1IJNA 1FNGA 2DWYA 2ARWA 1AGFA 5DFTA 5AAMA 2BY1A 3HW7A 2HG5B 3NIGF 3IAGC 1O7DE 4E9TA 4OUUB 2P28B 2MKWA 1WISA 4FKHA 4U6HB 5HDBE 4JEGB 5B1AB 3N91A 3U2JA 1OTSD 5EOTA 3GI9H 3HNSH 1G7IB 2HJFA 4I0PA 4N25A 5ETUA 1A7NL 1JWSA 2DIAA 2W07B 4NJ9H 4NXKA 4UT6A 4R7LA 5T5FL 5CEZH 2BNQD 4M6AA 2VQTA 1Q9KA 4MNHA 2B1HL 4JANB 3GT6A 3QAZC 4CU8A 1DQKA 2Z1PA 1RUKH 4Q2ZA 1E67A 4QLWA 1XXDC 4FQ1H 3ARDC 1FVCA 2J8OA 3H4FA 2VXVL 3IMUA 3IYLW 1QNIA 4PJIA 4I4WB 1VB9A 3N1GC 1KGYE 2ZUQC 1AQKL 5B8CA 3KPRE 4OJDH 4X99A 4BE6A 3QJSB 4PGEA 5C9JB 1T22A 1GOFA 4QKTA 3KHQA 4QHPA 1NKOA 3UPRB 4GUOA 1VADB 1FCGA 1U42A 3SQRA 2QR0B 1KZQA 3EIFA 4LARH 4MWFB 3ARDD 1THCA 3GBDA 5L4IA 4FHBD 3RIAF 4F33A 5I23A 2CM5A 3FSVA 3SE4A 4M00A 3CX2A 1P7KB 4MMXB 1TZGL 2YR3A 3GPEA 4N24A 4PN6A 2PPAA 4M8RA 3DSNA 1I3UA 5FYKD 5I0DA 3CE1A 3QFJE 3L7FA 4NFDA 1MEXH 2CUMA 2R1WB 1AY1L 4XMKH 3L3IB 4OT1L 2IO5A 3OKMA 2WGNB 4UNUA 1FGNL 2GBAA 5G4OA 4KV5F 4FA7B 3C60C 4X0KA 5D7SL 3RVUC 4BH7B 5DJ6B 4PHZA 5LLIC 2GC4C 4C55A 4DKFH 4EDXB 5LXGH 1EDHA 2AQSA 3ARUA 3N50A 4I0PB 2EEXA 3HS0B 4GLRH 5A6IA 3L9BA 1E27A 3GZQA 2VRKA 3BYTA 3QUXA 4JPKL 4A6YB 1KB5B 4XNYH 4E36A 1CDBA 4MYPA 3X11A 3FSWA 4ZAKA 3OXRB 4OFYD 5B3JF 4HIIB 4X9YA 3WIHH 1WBXA 2HP4A 2G0LA 5DI8B 1OP3H 3BCDA 3EJCA 3O8XC 1UADC 3QJHA 5HI4D 5KVDL 1BPVA 4AQEA 1BCIA 2EICA 3SDAD 4JVWA 3N6YA 3FMGL 4M6NH 1NM4A 3BMVA 3LZPA 4QRPD 5ERWA 1UYWL 4A7SA 4OF6A 4F7TA 2CUAA 5F7LB 3CVHH 1B88A 2GC7C 4K2UH 3U1SL 3GSRA 2FT6A 1BZ7B 3L3HA 4KJWD 1SBSH 5D7KD 4UT7H 5D7HA 3WXVH 1YYCA 4LASL 1KIPB 1X4YA 2D73A 2IH1A 1I9JH 1VEMA 4H0LC 4LEOA 4PY7A 4XAWL 4EDWH 1KZYA 5KVGL 3SDAB 1S9VB 1VERA 1ZJAA 1V3MA 3G08A 2CUHA 3ARGA 3BIKA 3RBSA 2V17H 4HJGA 4KKBD 4FQXD 1MJ8H 1HKLL 3JT0A 4FNUA 4ANWA 3DDGA 4EI5B 3B5HA 5FECA 4M5ZH 1QRNA 2IFFL 5AAMC 3AREC 4MJJA 3MRMA 1LYQA 3BI9X 1TQWA 1UG9A 4NUJA 3I6GB 3SKMB 3H42L 4ISVA 5LGKA 3JQOB 3FH7A 5DHVB 4F1ZA 5J6GB 1DJIA 4DN4H 4NKIL 2VZ1A 5TDPA 1E27B 5IB5A 4ICWA 3E80A 5HGDB 1CFNA 3FCTB 1E40A 4YMPA 2IG2L 1XH0A 1NMCC 2GKIA 3C2AL 4O5LH 5LKNA 1DR9A 4LKCB 3H3KA 1IE5A 4XCNA 5EF1A 3SPJA 4IBSA 5CEZE 5BRZB 4JX0A 4LOEA 3WHXB 2KI6A 2ZKYA 3HE6C 4GMSH 4FX5A 4NQSA 2NW3A 2P5WB 2YZ8A 5FHAL 1EJ8A 5AFAA 2EQDA 1SJHB 2JB5H 2NY4D 1T1XA 2BVQA 2Q3AA 3QA3B 1XZWA 3QG7L 5EUOB 3V8OA 4MB5A 5HI5D 5C0DB 4RWHA 3SDYL 3ULSA 1FWXA 4L4VA 4XE0A 4NS0A 1QWUA 3ESNA 4Z7QE 1B0RB 1ZGLM 4LLAA 4UOW0 2GUOB 3IETA 5ECGA 2AJXH 4K3DL 2XY1A 1K6QL 3WFZA 3C08L 5EOCH 2AC0A 1WWCA 4MDRA 3U0TB 3JYBA 1U8IA 4GW4A 2XU9A 1YN6A 3LNDA 1TVDA 1ZVSB 4OCWH 3VI4F 2VOTA 4J3TA 3Q2LA 4HD9A 1R46A 1VGEL 5CP3H 4LVNB 4EN3A 3VWKC 3QIWC 5AW7B 4CKQA 3UBFA 1FC2D 3WJJC 4WUUD 4FXGB 3TP4A 3ZTNL 2JCCB 4DOHB 5KEZA 4MYWB 4DUVA 4HG4J 2OXGB 1O7SA 3KW7A 2AVFA 4YSRA 4YDIH 4PJ7A 4UQEA 2N3JA 1SXAA 3MRRA 2CM6A 4R7NB 2HFGH 3IDYB 1TTAA 4GSDL 1GHFL 1EEUA 2YO3A 4ZTOL 1IAOA 3IJHB 3W57A 3K6SB 5JMRA 1DQML 1S78C 4F27A 5KVDE 4IBUA 1D7DA 4PV9A 4LP4A 4KC3B 1KXHA 2YWZA 3M17A 2FTAA 4IKJA 1Z5LB 3DO7A 4IOIB 1N5YL 2ESVE 2PTUA 5EIIG 1QR1B 1HHJA 1FO0L 2YMOA 5D1ZC 1KIUB 4KKAC 1ZSHA 3R4RA 4L8BB 4NKOA 2NY0B 1Q38A 4HZAA 4Q97A 4MS8C 2CJUL 3D3VE 3RY5A 2EDRA 2XWTA 1L0QA 2UYLB 1WZKA 2VDKH 2HPTA 4KHXL 4BV1A 2HLEB 5ABAA 1T20A 4Y5XB 1W8EA 1TVHB 3RPIB 4LF3B 5ILTH 3BYYA 4NKDA 4Y19D 3GIVA 1ND0B 2IWKA 4UIMB 4Y7OC 4ZS6D 2XT1B 5D70H 3F8UB 2UVEA 1E4XH 5PCYA 1IT9L 3MROB 5E9DB 2VDQB 4L8CB 5C6TH 5IMMB 3EJTA 5TDNB 4NQUA 2HH0H 4U33A 4XP9H 1FN4A 2ARJQ 2ZUYA 1N3NB 3D09A 2JCCA 4WWKB 1WD8A 1M7IB 2FO1A 1J8HD 1JMZA 4JCLA 2Y07L 4YOKA 2DI8A 5IMOB 4HC1A 4P23A 3SCMA 4WY7H 3QFJA 1ORSA 2WXIA 2JIXD 4GPVA 4RX4D 5JW4M 5DGRA 1QFWI 1WT5A 1HKLH 2BZ7A 4OKVA 3MOAH 4WGKA 1QWHA 1RVFH 3APMA 5LO7A 1MHCA 3MO1B 4ZMTA 1A6AB 4PJBB 4OB5H 3WFCL 2GEQA 2J8UF 3HBZA 3QQXA 4H4NA 2W5PA 1AKJA 4LSUH 1DQJB 4PGCA 3U1SH 4HMDA 3QQNA 4PBXA 4TLUA 3FBQA 5JPMC 1SYSB 4JJ5B 4AGMA 4JFXB 3E2HB 4WJ5A 4M03A 4APQD 5IMLA 2ERJB 3MRKA 3PWJB 1ZIAA 35C8H 2VRQA 1A3RL 3FT1A 4NHUA 4F57H 1GJIA 1DVQA 3ULAB 1WFNA 2J88L 3FQRB 4EIZC 3WDHA 3QIUB 3VA6A 5EUOF 4M8VA 5FO7B 3BOVA 3O6FB 2YBGA 4JFEB 5GSRA 4KZ0A 3MOBL 4NZTL 3PAUA 2CK0L 2Z4QA 3KPNB 4ZMXA 5HYSG 2VB5A 3F58L 1VA9A 4LF3A 4P5KA 5IROD 2IAMA 3MMEA 3SOBH 1JTPA 3FQXB 3FQYA 4L3EA 3QZNA 2B14A 4PRDA 4QPEA 3MCLL 3UZEC 3LZFL 4X7CC 1CIDA 5EU7E 3T2OA 4P4KD 4N2KA 1XF3A 4W9GC 4X5WA 4G43A 2VR6A 4OLEA 4IIQA 4ZTPH 3APDA 5FK9B 1LEKA 4DH2A 4OIFA 1EXGA 4ZZFA 2H6PB 2P9RA 4UWQB 1KPUB 3T4YA 3PQYA 2X4SB 4QHLB 3SE9H 1B9ZA 4LNRA 3TIEB 2IG2H 2OPCA 3P30H 5AVZB 1OLLA 3OXSA 3L8QA 1VF5C 3OB8A 4OFIA 4OM1H 4YDNA 2N0KA 2X88A 2ZKMX 1IARB 1V7NH 2FEDC 4OZIB 2R69H 4D94A 1J05B 2WNWA 2IPKB 1Z5YD 2IQ9H 2X1XR 4YDKH 4XCYB 2ZSWA 1AKJB 3BWAA 3F04A 4GINA 5L88L 1QMUA 5FGBA 1DUYB 3QQ4A 4DZ8A 4Y9FA 5IBLD 4PBDA 4XNAA 1OT4A 4XTRC 1JPGB 1A7PH 1U8CA 3VJ6A 2VXVH 1E3FA 3CHPA 5AVWB 2CGZA 1A7QH 4RAVB 1AHKA 3ULVC 1PG7H 3TT3L 2KZ1B 1D2PA 5I0YA 3C60A 2YEZA 3BKCL 1CFQB 3MGOA 3QIBC 3ILDA 1FPTH 5HDRA 1BD2E 2A6KA 4B9CA 1YPZA 2IVFC 1WHOA 4RMVA 2YN5A 4M4RA 3RTQC 4PWEA 5F6HJ 1QSEE 2VN3A 1Y0LB 3OZKA 1HWGB 2V8MA 4OVVA 2BC4A 2G9HB 3V4VH 1AS7A 3PDOA 3GI8H 2L7QA 1WA2X 4NPJA 2HFFB 3CMOL 3MDJA 5F0LB 5DJ8A 4NQDB 1U8QA 1MHEB 1E5UI 1M3JA 3WY1A 4M7JL 1QD0A 1U93A 1BBDH 5FK9A 2KPWA 5HYJA 1R3IL 1RULL 4PJBF 3THMH 5I1LA 3K5SA 3WNOA 3SDCB 4EN2A 3ABGA 4GSRA 2RMNA 2ZXCA 2UX6A 3N42F 2IWGA 2ZNXA 4YFEA 5CBAB 1OAKH 3V95A 4NO5B 1JFQL 3WNPA 1JNNH 2WKOA 1C5CL 4ZFQA 2PW2A 5D6DA 4HOZA 2R1YA 2I32A 4XNZB 4CDHA 5EN2B 4CC1A 4CMHC 4RA0C 2DQ6A 4X5RA 1S8DB 3GYRA 4Y5YB 3UJJL 1RXLA 3DROB 1IBZA 3U4EA 1CYWA 3DTXA 1KGXA 1IGIH 3GSOA 3L6FB 5EBMB 2NR6D 5GS0C 3CFBB 5D6DC 4BFBD 4N2HA 4OQTH 2PO6A 2FJUB 1DVXA 1L9PA 1DFBL 2YEZB 3B2VL 4D9QD 3I9AA 4KK9C 1XR8B 2YWYA 5IVNA 2G60L 2C1PB 3MSPA 1QSVA 3AACA 1MRDL 1XQ4A 2QVKA 5FF6A 3AQYA 3OHXB 1TTCA 4F7KA 4Z3HA 5EOTB 1WGOA 2V0AA 2WPGA 4E9WA 4CVUA 4GBXA 5J13C 4BSJA 4M9OA 3LD8B 1NMAH 5ETUB 1JWSB 4OJAA 1IKOP 3H7BA 4LCVA 2E56A 2J72A 2X1QA 4P57B 1XDTT 4QRAA 2IQAA 3ZTJG 1HI6A 3DRTA 5EU3B 5DUBA 2WZPD 2ZPKL 3STLA 3FO2A 3DPDA 3QEHA 3QQ9D 3OAYH 3DO4A 4ZW3A 1XGRB 1ZLEA 2X53A 4I4WA 2Q8BL 5FEBA 2CBPA 2ADYA 4KFMA 4WF7A 3UCRA 1P7QB 3DX2A 3V4UH 3M1OA 1K3IA 5FYJD 4KXCA 2BVEA 4ZUSA 1X5GA 5B7EA 3HI1B 4ONOA 1NL0H 3JV0A 5ID1B 4YK4C 3V4PA 1BAGA 3MU3A 2WB7A 3BZ4B 4I48B 2KMWA 1OP5H 4DN3H 4LRIC 2QQQA 1IRAY 2E27H 2YS4A 5D1XE 2BXYA 4FNLH 3VWJC 2JV6A 3DARA 2JTYA 3CFBA 1L6PA 3CNKA 5DRWB 1YUHB 5C0AB 1MCOL 3HRZA 1F1DA 4HH9B 1G7QB 2AEPL 2Z91B 5CZXD 3MRLB 4FG2A 5DHDA 1MFAH 4J28A 1MN4A 2ZKWA 4HPHA 3LZQA 4P5TA 2VITA 3EFFB 5CZRA 5E8EA 3ZY7A 1ZLSL 4BA8A 1SQ2N 4R84A 1SXSA 3SKOB 4S1RL 5JOFA 1VENA 3T1FA 4QUOA 1PZ3A 3DXAA 3BIBX 4G9FA 4KHTL 1MHHB 3FHQA 4F37F 3QJXA 5T1LB 5EO9B 2OMTB 3TS8A 2NLJA 4G8GB