3PU7A

Cu-zn tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical Properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3pu7A00
3KM2A 1MFMA 1OALA 1IB5A 1XTMA 2AEOA 1N19A 1OZTG 3ECUA 1S4IA 1SDYA 4N3TA 1SDAB 2VR8A 3MNDA 5KBLA 2GBTA 4MCMA 3CE1A 3GTVA 1JCVA 3KH4A 4OH2A 1CB4A 1E9OA 1E9OB 5KBMA 3ECWA 1COBA 2NNXA 4A7TA 3GZQA 2E47A 2WKOA 2VR7A 1DO5A 2WWOA 1JK9A 1SPDA 1IBHA 3K91A 1AZVA 1F1AA 3F7LA 2ZKXA 4BCZA 1XSOA 3ECVA 3KM1A 2ZKYA 3GZOA 1EJ8A 1N18A 3S0PA 3H2PA 4OJAA 1BA9A 1F18A 2GBVA 1E9QB 3HOGA 3CQQA 5KBKA 4L05A 2AQPA 1U3NA 2AF2A 2Z7UA 1SXNA 2WKOF 3SODB 2SODB 3HFFA 1B4LA 2Z7YA 1KMGA 1HL4A 1SOSA 1Z9PA 2AQNA 1QUPA 4MCNA 2AQQA 1IBFA 2GBUA 4BD4A 1FUNA 1SXAA 2C9VA 2AQTA 1E9PB 2ZKWA 3GTTA 1Q0EA 2LU5A 2JLPA 1SXCA 2ZOWA 1YAZA 3GZPA 1L3NA 4A7GA 3LTVA 1B4TA 2AQRA 1OEZW 1IBBA 1ESOA 3H2QA 1RK7A 1PTZA 2C9UA 4A7SA 2Q2LA 2WWNA 3L9YA 5CU9A 1SXSA 1UXLA 3QQDA 3QQDB 2AQSA 4U4IA 3T5WA 1F1GA 4BCYA 2APSA 4FF9A 4B3EA 1XTLA 1UXMA 2JCWA 2WZ6A 4A7QA 1SXBA 1SXZA 4A7GF 1SRDA 1YSOA 3L9EA 4A7VA 1E9PA 1IBDA 1OZUA 2Z7WA 1YAIA 3KBEA 1Z9NA 3F7KA 2C9SA 2WZ0A 1TO4A 1PU0A 3HW7A 1CBJA 1PZSA 1EQWA 2VR6A 1TO5A 2WYTA 1F1DA 3KH3A 2R27A 1HL5A 3KBFA 3RE0A 4N3UA 4A7UA 1DSWA 2WYZA 2XJKA 2WZ5A 3PU7A 3CQPA 2Z7ZA 3GQFA 2E46A 2XJLA 3MKGA 2K4WA 1BZOA 1JK9B 1OAJA 1P1VA 1E9QA 2V0AA
chains in the Genus database with same CATH superfamily
4UQ3A 4J3OC 4NUMA 3B9AA 2OXHA 2ZCZA 3H3PL 4Y4HC 4XGZA 3AW5A 5I0YA 5DURD 1N8ZA 3V4PL 1YVLA 3VI3A 3B9KD 2OMTA 2O5XL 2YRZA 4AIEA 4FXKB 2LTQB 3PWJB 2WHVA 4MAYC 5F72S 5FYKE 2ZCHL 1N70A 4A68A 4DVRL 3RZCC 2W9EH 2VB5A 4G80A 4GIOA 4HUNB 1HEJC 5DMKA 3IMRA 1A6WL 4P3WA 3NRPA 4TVPD 5DDHB 3EYSL 3CZLA 1UB5A 1WZAA 3L6FB 4UDTA 5DJXB 3P77A 1CXIA 1SVCP 1KGCD 3ARDB 1FNGA 2GIMA 2ZJSH 4I18A 5A1AA 1BM3L 3W39A 5IMOB 4N0CD 2QFPA 1A3LH 4Z7QF 4LCWD 2C26A 1QOKA 2NYYD 4QHNB 4ZW3A 4L8BA 4EI0A 5DVKA 5ELIA 2CBQA 2XZAH 4KJPD 4AQAB 3VXRD 3IXTA 4HIPA 4ENEC 2D7TH 3QEQA 3T08A 1FZOB 4HK0A 5C6TH 4OCXH 4PAZA 2F5BH 2F7IA 5CMAA 2R0ZH 3SGJA 3VX1A 4W4NA 2L4OA 2WWKO 4MLIA 5CD3B 4KK9D 5K1NA 3OWRA 2QQKL 4JVWA 2X6CA 3WTUA 1HI6B 1PEZA 4P2QB 2FT7A 1TEGA 1UM5H 4R8WL 1C5CL 3GMPB 4HHGA 4KXBA 4HA1A 5ADPH 1J0HA 3UYRH 5HSFA 3WFDL 2GY7B 2VAJA 3IGAB 3SQOL 4GBXB 4KJYA 1YYML 5D93B 4PP2A 3LRKA 1HKLH 3DX6A 3OAYH 4QRPB 4LASL 4ZOEA 3NZUA 4MDJB 1KZYA 5LGHL 3N04A 4Q8BA 1RUKH 4I3SH 4X6BA 1NGXA 5FYJL 3J2PA 2BZCA 4NO0A 5JPMA 1H0DB 4NQEA 2BNQB 3V0VB 2OA9A 3C5ZB 1KCSH 3HAEH 4HS3B 4QRQA 1C08B 4XAWL 1O6TA 4HBQA 1BFVH 3Q9PA 4NXKA 3ZIYA 3NSYA 3PQYE 4LKCA 3I02B 3KNBA 1WYJA 4S1RH 1RFDH 3CFMA 3UC0L 5ENWA 3UIYA 2IH3B 4A6YB 1I82A 5TE7L 2EQDA 1BFTA 2F54B 4AIOA 1HHJA 1LK2B 4S1DD 3ZDYF 1JZJA 2LVCA 3WN6A 3RVTD 3RNKB 3WTWA 4P9HL 3VE0B 4R2GC 4QRRE 1UFUA 4JFDE 4WJG3 5DK3A 5AUMA 4OCLC 4NENA 2O61A 4BM7A 3QUKA 3LQAH 1YUHB 4E5XB 1FJ1B 1A4JA 4MA8H 2KZ1B 3RWGB 3TV8A 2GI0A 3KGRA 3ALXA 2RQEA 4MCZA 3RURA 1G9NC 2AJVH 4Y1AA 4I8DA 4OIIL 2ZX6A 3N0AA 2XVLA 4XOEA 1KTDB 1EEUA 2IDTA 3HMWH 3QIWA 3UTTE 1BZ8A 4AEFA 1EVUA 2Q20A 2YPLE 1CFNA 4R0LA 2HCZX 4X99B 4QOKB 2DL9A 2GK2A 3CDGA 3LMJH 4PRAB 3VWKA 5AZEL 1H6EA 1BA9A 5T1LB 1UWXK 1AZCA 1W9XA 4JQIA 5FC9A 3NSCA 3DBXA 4FMFA 3REVB 4P57A 3GSVB 1UYWH 4IRSB 1CE1H 3UOAB 1R6VA 4OJDH 3EFFB 2AEQL 1ILSA 4FNUA 2ZYIA 4JHWL 1UWEH 1TJIH 1R24A 2NY1C 3OSVA 4XO8A 3KLAA 4PEEA 4UYQA 5L4IA 3EXJA 2ARJQ 3VG9C 1A7RH 4K7FB 3STBA 3GJFA 3KPSD 2HRLA 3ZUCA 2R2EA 3V5HA 2VE6B 3D3VA 4HQQL 5HI3D 4JO2H 4RFOH 4YL4A 1JPTH 1GIGL 3C5JB 1F4WL 3BKCH 1TQBB 3QQDA 5IB5B 1XR9A 3SHSA 1F1GA 4HH9A 1AGEA 4XMZA 3CBRA 4NKDB 4ATTA 2CPUA 2P7TA 4NZFA 4J28A 2BS71 5F9AC 2XN0A 3ZZSA 1WA0X 1FH5L 5ESQB 5E5LA 3BW9B 2QKIA 3VI3B 1DE4B 2J2ZB 2OMTB 1HINL 4YR6A 3TPUB 3NCYS 3LZNA 2G4GA 3O6ML 2JKLA 1X7SA 4P5MA 5E00B 3SPHA 1V3KA 4JDZB 4YFDB 1KLGB 2X89A 5INDB 1PF3A 3KLSA 4Y4FB 1MJUH 3TZVD 3RP1A 1YEHH 2CCLA 4ODHH 2Z8VC 4LHJB 3QDME 4OZHE 1RZQA 3V7MA 3EDEA 1F0LA 1AI1H 1UM6H 4FKHA 3W2DH 4N8VA 2JJWA 3DYPA 4AZUA 1GRWA 4UBDD 1FNGB 2IADB 4CSTA 4I18B 3IDXH 3V0FA 3FO9B 3S96B 3HE6B 1M71A 2PYED 4X4ME 1TVBB 1MCBA 3S5ZA 1AD0B 4OM0L 3WMSA 5JQIB 3VI4F 5B1JC 2TSBA 2AAAA 5D4IA 5FW7A 4RGOL 3RA7L 3SDAC 1QBAA 1RJYA 1IJNA 1JI2A 3ZE1B 5JZ7C 2CIKA 5HYQB 2JB6A 1P69B 2YPVA 2AK4D 4U1LB 3QH3B 2CHWA 4PY8J 3IJYA 5LQBH 2DM3A 4EUPB 4NRXB 5K9QG 3UAEA 1QNZH 2CR0A 3M6DA 2XNAB 3ATEA 1G5GA 1DBMH 2IGLA 3L3OC 4ZMNA 1CS6A 4DQAA 2IWFA 3D30A 1REIA 4WFGD 1IAII 5T5FL 1TU2B 3QEUB 3TCLA 2KH2B 3PPSA 5K69A 3DO7A 4MS8C 1OB1B 2WWKT 3GKWL 5IV2A 3QRBA 3B3IA 3OF6D 3BGFB 1WIPA 4Y2DB 1LEKB 4MKTA 2K3TA 4DUXA 5LNDA 4XMUA 2DLHA 3QG7L 5I30H 2VQTA 5D5MB 4FA7B 4OLYH 5I1JH 1HT6A 3BEWA 4BSWB 1AS8A 2Y1YA 3QUXD 1MRFH 3X3FL 4KZEH 1VPOH 5SX5K 1MUJB 1VEOA 3C6SB 4L8SB 1SYSB 4PRDA 3SE4A 3T4AA 3W11C 5CU9A 5I71B 5D71H 2X6VA 3VW3L 2NUPA 1WAAF 4AE0A 4G2AA 5E5UB 3VFOA 3LNHA 4QMEA 2JI2A 2WLJA 4Y5YC 5AD0A 2ZWLT 3ZDXB 4I9WE 1AACA 2AQ3A 5BV7B 2IOIA 4P4KC 5IMMA 2J6EA 1E5UI 4HIIB 5GGRA 2AFNA 1EGJH 4MZIA 1I9JL 2E5EA 3KLDA 1UJ3B 3MX0B 4LEOA 3H9SB 2NY7H 4DEWA 1OP5H 4XP4H 2HT4D 4HZ1A 1UZ8A 3HW7A 3VRLE 5A16A 3DHUA 3FSZA 4GSXA 1I3UA 2NY0C 1J05A 2XG4A 3TN0D 4G8AC 4MJ5A 1O7SA 4DOHB 1ZANL 3ARYA 2QR0A 4FFWD 5C97A 2R56L 1U3YA 2IWKA 4Y9FA 3IPBA 5EO1A 4Q14A 5T1KD 4P2OA 1XGQB 1UFGA 4KNSA 3VNZA 1CFNB 3MRIB 2ZOOA 3AS3A 1A9BB 3LYRA 4R0LB 1AQHA 5J11B 1BQHG 4AIZB 1YMHA 1MWAH 1ROCA 4F2MB 4E36A 5GISH 4ZXBC 4R7VA 5FO9A 5KYNA 1UXSA 4AT6A 4X7TB 3FO2A 1C5DA 5DEGB 4PV9A 4FLQA 3PWLA 1KENH 1YN6A 3OJDA 4P57B 4KVPA 3HBGA 4LK4A 2NT0A 3RIAK 4XE5B 4Z76A 2BSTB 4HD5A 1WTLA 1KCUH 4FQXB 2H0EA 1I1AD 1KBWA 5G4MA 4I13B 1E3XA 1RP8A 2DQHL 5MENE 1KCWA 1F1AA 4KHXH 1N5YL 4ZODA 2PWHA 3C5SA 4KV5E 3S98A 2VLKD 1XGTB 1ZGLB 3OZ9H 4BZ1L 4PJGF 3CZJA 4APQA 2QMJA 4MHHI 5GS2D 4F58L 4JZOB 3W37A 3CQQA 4HCIA 1JHKH 2EXSA 4FXTA 2ZYRA 3NN8B 1GKOA 3MFGB 4DSYA 1X5IA 4LRIA 4KRNA 5EEUA 1Q1PA 3CVDA 3JV4A 2F8XC 1SLVA 2V17L 5ANME 3TT3H 4LPYA 3WY4A 3GIZH 4N0CC 2D3VA 5DWPA 1A5FH 1BJ1H 1Q0YL 2WSKA 3VXME 4DP5X 3K6IA 1QUPA 2NYYC 3FQ4A 1YC7A 4JHAL 4N6RB 1CFSA 4MA1B 4JQIH 1UENA 3DX7A 2G0KA 3K46A 4PCYA 4YR6B 3T3MF 2CQVA 5D7JD 5HDBE 3MXWH 2QHRL 3QO0A 2VDNL 5DC9B 1HQRB 3ULVL 1L9QA 4CGTA 4M4PA 3HMXA 1ESOA 4JO3H 5DHVH 4RZKA 1QWHA 1CLYL 2OCFD 2DYSB 4P5MB 1JPSH 3VFNB 2YJQA 4HGWB 1MLCB 1QEXA 5F1NA 3RVXD 2FBJL 1YEJL 3F8UB 2EDFA 3RX8A 4Z7OE 4TN9A 2UUDH 5DQJB 5E03A 4ZFZB 5EF0A 5CJQH 3SCMA 1JNHA 4PJDA 3EGDA 4HWEL 1KULA 5DHMC 1NFIB 2HUEA 2AV1B 1QFUH 2A38A 5EU5B 3SGDH 2D03H 1WLHA 3N50A 2OZNA 1K72A 1MZYA 1XBRA 3KBEA 5EZLB 3NIGF 4GH7B 3Q6GL 3QS3A 1N68A 2HMIC 1NCIA 2VDLH 4IGBD 4XPFH 1M57B 5F0JB 2XDHA 1OD7A 2YUXA 1I4FB 4NERA 4JY6B 4X6DF 4W4OA 4LGPB 3KPPA 5L8JB 5JR1L 2N59A 1OB0A 1OY3B 4R84A 1KV3A 1UCTA 2Y7MA 1XHHA 3CFBA 5ACZB 1WS7A 3HI6L 5EOTB 1VACA 5TDOB 1RZJC 3DV4B 4Z7NE 1T4KA 2A3TA 3OV6A 4FABH 1X7TA 4MXWL 2X1PA 3QUYD 4QKTA 3CXFA 4YO0A 1SDAB 3MNDA 5DHDA 1IGFH 1P4IL 3GI8L 2DQFA 1LMKA 4DN3H 4Y19D 2J57A 2LU3A 2CRIA 1IQWL 1RPQA 2E9JA 5KZCD 3TCLB 2R8SL 1UCBH 4BV1A 1OHZA 4A55A 3PQYB 5IW3A 3VXUA 1FIGH 5IV2B 4ODWA 3U0PB 4U1JA 4AQ8A 1BF8A 2JKJA 3KWWA 1U58A 3B3IB 5EUKA 4NC1E 3C6LD 3I50H 1VZIA 3DGGA 3TBWA 3F84A 3NFPB 2Q9OA 1SVZA 4NHCL 3D0LB 3ECQA 3KL3A 4RQQA 3L4CA 3KEHA 1VCBC 5AQ0A 4M8QB 2GIYA 4PRDB 4KKCD 1Z3RA 4YSOA 4L29A 4QRRB 4GXVL 1SY6L 3NJMA 3DSFH 2W0FA 4JFDB 4EI5D 3VFOB 2Z4TA 4JO5A 5BQ7A 3HC0B 4MD0B 3X13B 2EE9A 3IPFA 4GAYB 5DO2D 5AD0B 3QC5X 3ATBA 2YFNA 5GRZA 3WGUB 1A7BA 4L3EE 4PWJA 3UAJD 2CU9A 1YNTB 4CDGC 3QXDA 1OTTC 4C47A 4HWBL 3A67L 3GIVA 4KX7A 4ODVH 2H26B 4LCCA 4HPHA 1Q1JH 1K2DA 3IT8D 3UTTB 5KBDA 1UWYA 4KFMA 2YPLB 1X6LA 2AXHA 1JPGA 2XG4B 2QDWA 2AQ2A 5AALA 2JWYA 2FJHA 5FCSH 4DKDC 4PJHA 5LBSL 5HI3C 4F8TA 5EO1B 3MA9H 4I4WA 4QAWA 1CDIA 3BC9A 2O5ZL 1J11A 4HBCH 4J3OF 4AH2A 4ZQKA 2YEVB 3IMBA 1OWRM 1USZA 5CEZE 3F85A 4PBWD 2XETA 4AI7A 1HOCA 1Q9KA 1DJSA 1JGUL 4S1QL 4YHKL 1MN4A 3OHMB 2X28A 5FO9B 3RJOA 2D7QA 3BAXA 1CXKA 3GBNL 2WTRB 4U2ZA 1CICC 3MC0A 4L23A 4QWWD 1UA7A 1IAOA 3PWLB 4TPRL 1RP9A 2MJWA 4Z3IA 1M42A 1DSWA 2OW6A 2J6EH 4XMKL 1MLBB 4GKLA 1X9RA 2IXQA 1I9IH 4W1TA 1N6VA 1P5UC 2G9HA 1QEWA 3UJTH 4XCCH 1NFAA 3NIFF 4AUJA 1E67A 3TH4T 1KGWA 3QJZA 3TVMA 3II1A 4FE9A 4UANA 4U31A 3CVHH 3D18A 4RMSA 2DLEA 4APQB 4PJ9A 4QXVA 2ICWI 5I0DA 4KKLD 4ABQA 5ESVB 3GHBL 5I1HH 3QAZC 2WXMA 3BD3A 1BJ1J 4TTDD 3D9AL 2CLZA 3HJEA 3I6SA 2WQAA 3RY4A 3OG4B 3FUEA 1E28B 4D0CB 2BVQA 2DIEA 2K78A 2X9WA 4MQ7A 4UI2A 1F41A 2P5ED 4FZ8L 5FOBB 3LIZH 3DX7B 4ANKA 2Y5QA 2WVTA 3QDMB 2IFFH 5C0JA 2XN9E 3W9DA 2B9AA 3QO0B 4OZHB 4UF7C 3SE3C 1JL8A 4XBEH 4L1SA 3FS9A 5DJ6A 2WC7A 4RWYL 4DGWC 3MLZH 5F1NB 4XH2B 4OVUA 4G6JH 4BXVA 2E6JA 4FEMA 3V0IA 4O2FB 4PJDB 4KXCA 3ECBB 1QSZA 1BBJB 1OTSD 3ELQA 4PGEB 3WTVA 5JXED 1Y07A 3M07A 1HS6A 1JVOA 1ZAGA 1QLEB 2AK1H 4B0MM 3SY0B 3U4AA 4L4JA 1CU4H 1Z3GL 1G7IB 4YHIA 5F7MC 5FGSA 3RYMA 4HT1L 1PY4A 2ILLA 35C8L 3GZPA 4ZMXA 1J10A 5LGJB 1HWWA 2AQRA 3NPSC 4X4YB 4OF0A 1DR9A 1DQIA 2H1LM 2PN5A 5TE6L 3UO8B 2TRHA 2C3WA 4NN6B 3BP5B 4GAGL 1CI5A 3Q5OA 1AR2A 2X2UA 4LSQH 3K81A 2B2XH 3M1CA 4P23D 2FIKB 5E6ZA 3P4NA 2JCWA 5EG6C 4ZFOL 1T4KB 1BZ7B 1J86A 1I85A 2Y36H 1YECL 3QHZH 4LHUA 3KYMA 4YO0B 4TF4A 1IJ9A 5K9OB 1EK3A 4EJ1C 3VB8A 2E76C 3HZVA 1WFMA 3I85A 2UVFA 2OULB 2EIMB 4CU6A 4K5NA 1J1XL 1XGPB 4M3KB 2XJKA 3VXUB 3E6FA 4ODWB 2CALA 4G7RB 2IDFA 3KWWB 1U58B 1IM9B 4XCEA 1FHGA 3R4DA 1EUUA 3ZRSA 4AEEA 3V4PA 3FO1A 3U1SL 1E9QA 2BDNL 3AY2A 2QBWA 1HEZB 1UACH 3DGGB 2ZOLA 4FFWC 2EIZA 2XWTB 3DOSB 4GXUM 1XH1A 4RQQB 4GUOA 1E3ZA 4XO3A 1RY7B 3UDWA 3TYGL 2XV0A 2BPBA 4O2CA 1N2RB 3HNTH 4JO1L 4IDJL 2E6QA 3V0JA 4UQIM 5AKVA 2A9BA 2YK1H 4PJ6A 1JXDA 5F9DC 5JOFB 2KQMA 3RUGE 1GJWA 3PWNB 4FMVA 5SWZD 1JF6A 4LARL 1LM8V 2VR7A 4FMKA 4KQ3H 1SOQA 5BRZE 1I1AC 1QAWA 5IW1B 1UH4A 3OC8A 4AMWA 5IQ7H 2KZKA 4LCCB 4X8CA 4FHJA 3EOAA 1BVNT 2QVFB 4AEHH 1KN2H 1GGYA 5J6GA 5H37H 1NZRA 3M7FB 4L05A 1U95B 4FJYA 3V52H 1R5IA 1UADC 5MERA 4O00A 1MVUB 3QK0A 4RNRB 4QXGH 2R2HA 3ARDD 4XCFH 1JV5A 5ABAA 5FPIA 2EC8A 4JFWA 1I3RB 2ZICA 3BI9X 3N3EA 2YQGA 3CD4A 3MLYL 2E7LC 1OGAA 1T7XA 5F93C 5CXPA 3G7TA 1ML0A 2IANE 4OKVB 2R2CA 5KSBE 4ESKA 1CLVA 2X42A 2XKSA 4I77H 3U7YL 1SBBA 3GJFK 2Q86B 1RK7A 1LMIA 5GSVB 1XQ4A 1XH3B 3MV7E 5D7JC 4BELD 4XXCC 2DM2A 4M9PA 4NO5B 5EPMA 5F7EH 1SJMA 3RVXC 2HB0A 3RTLA 2DICA 3IN2A 1OAUH 3O81A 3QEGH 4I48A 4P2QD 4YK4B 1S7WB 5HTSA 2E27L 4H88L 2EDNA 4PJFE 3QO1A 4AYGA 3N43B 3DPBB 4GBXD 2WINA 3VJ6A 3VXMB 3QORA 5FO8B 2C9RA 3FTVA 4P59L 4PJ9B 5C0GA 5IEHA 4QRPD 2M8XA 1JYWA 1O6VA 5L9DH 5D6DA 4GSRA 3BSGA 5CHNA 2XN9A 5HDBB 3Q7JA 2BNQD 3RVWD 1AH1A 5IM7A 4P3DB 4FTVE 1N59A 2XT1B 3ASWA 4BK5A 2ZX7A 3OKOA 4H1LH 5A2JH 1PIFA 1GGBH 4ZS7L 2CO7B 4NBXB 5T3XL 3W56A 4Z7OB 4AIXA 2EUZA 5IQLA 3E3QE 5ES4B 1Y18B 2G2NA 3BLKA 2DQUH 2IOOA 4AG4L 5IROA 3UYOD 3H0TA 5JQHC 3EO0A 1WQVT 4OY9A 2F54D 2WAQA 1L0YA 1NPNA 2XWCA 1S9WA 3FUDA 3TM6A 4DAGH 3KPOB 5ICZB 2DOCA 4ZTPH 1C1EL 3SQRA 1HVXA 2QVTA 1AKPA 3QUYC 4R7NA 1CB4A 1ZDQA 1AE6L 4P04A 5A2CA 4NCDA 4TLKA 5KVDL 1W72L 2ZOTA 1QABA 1R5VB 1UH2A 1QP1A 4ZFFA 3BUPA 1X9LA 2ZKHL 3TIEB 1NGYB 1RZ7L 2OW7A 3LRSB 2QVMA 5LXGH 3CVIH 4H8VA 4YSRA 3S88H 5GGTL 2VO8A 3H8NA 3V6OC 5HGHA 5PCYA 3C9NB 3O45A 3GSXA 1PCXA 3IJHA 3APMA 4PJEA 4Z7NB 1MFBL 5DUML 3HOGA 1ECZA 1FBIH 1XBDA 5FYLH 4OZFG 5IB1B 2WO3B 4Y7MA 3FF8A 4QOKD 4DP1X 2XWEA 1L9NA 3T77A 4KKCC 4HJGB 4R7LA 4YGAB 1AQMA 1F4AA 2H7WA 5T1LD 2FX9L 3TIDA 5D7EA 4EI5C 1ODUA 4QYAA 3MUJA 1G1CA 4IRZA 4JG0L 5DO2C 2HG0A 4YLCA 5SX4I 1LGVA 2ADFL 3AREB 3ATDA 4IRSD 5DD5H 4Z7IA 1BXVA 2AJSH 1JGVH 3FCUB 2NT1A 1JXJA 3I6KB 4HXBH 1ZV5A 4MHHG 2CA3A 4N0FB 4OCNC 5JYLA 4EBQL 3FU5A 1I7RB 1JZGA 2H1XA 3ARRA 4J1UA 4YDIL 2NYZA 1N0XL 2ZNXA 3OPZL 3L95B 4LVHB 3CPLA 3C75A 1VA9A 1MFEH 4NT6B 4EZJA 4XMTA 1KCRL 1RJZB 1NAML 5EBMA 5FFLA 2Q3AA 1OQXA 5LGYA 4ETQB 4XPGL 3O2VL 4M93C 5IVOA 2QT6A 1MQKL 2L0DA 4HV8A 4NKIL 4U1MB 4L3EB 5KJ4A 5L2KE 1F2QA 1T0MB 4EE2A 2FWOB 2HT3D 5BRZA 4LOEA 1NIDA 1OK0A 3Q43A 3BP4B 3LNGA 4IIQA 2H2SC 3N40P 4LLAA 3NTCH 4HOXA 3O6FA 2E46A 3WNOA 3ZKND 3ZZ1A 1MI5A 3QJQB 1MRDH 4PJXA 1S7UA 2CUIA 1QO3A 2ZUSA 2AXJA 3WFEL 3ZTJH 4M1GH 4Y4FD 1FYTE 3HVNA 2FL5B 4K9EL 1D5RA 5DJYA 2VR8A 3MGTA 1KYDA 3BUYA 3BQUB 4P5KA 5J6GB 2JVUA 2M26A 1X5LA 3H3PH 4AYDC 1T0PB 4A39A 2N4IA 3F7YA 1WEJH 4JM2D 5ECJE 3U7AA 1R5IB 2UZIL 3LEYH 5KSBA 2O5XH 3B6SB 2X4TB 1JWMA 3EJPA 5HYSB 1JV5B 1T66D 1ZHBA 4ECNA 1IZJA 4TTDC 3TBVB 3HE6D 3MV7A 1RUQH 3KWXA 3BP6B 3BE1H 3U0TA 1HQ4B 3OKNB 4DVRH 5JW4N 5TF1H 1K8DA 3HE7D 4I3RH 3RDJA 3MLSL 4JQXA 5T5FA 2GK0A 3L1EA 5F1IA 3V4LA 3WJLA 1KGIA 2BOBA 2E4TA 3EYSH 4Q6IC 2BSDA 4XZ4A 4ZUVA 3MLUL 1KXQA 4N2NA 1GS8A 1JXFA 4BKSC 4GAJL 1MCLA 5EPMB 1BM3H 1JHTB 1WG3A 3T2QA 1PG7W 5IKCB 2V2WA 4B60A 5T3ZH 4K8RD 5F21B 4HUXA 5C09E 1GYUA 3WNNA 4HMEA 2XIBA 3FT3A 2WINB 1OTSC 4YBLB 2IC2A 1U21A 2DYPB 2PYFB 4KK8C 4JL2A 4WVRA 1DP0A 5JXEC 5C0GB 2FD6L 2IQAB 1HJBC 2P5WA 3KXFE 3PAUA 1ZLWK 3N9GL 2OI9C 4Y2DD 4Y88A 4YLBA 2X0VA 4HPOL 2XN9B 4KZ0A 4FHBD 5I66B 2QQKH 3FTGA 3L54A 2E75C 2FCBA 4M29A 4DKEL 3U7WL 4EKXA 1KTRL 4R8WH 1C5CH 3SDXF 4XWGL 4OZGF 5FA4A 3SQOH 4OW6A 5JXAH 1YYMH 5D7KD 4X4ZA 5GGSB 3D08A 4WW2B 1IGMH 2F5AL 2B0SL 2YJLA 4F15C 4LASH 3CC5B 4ONGL 4O02H 1QFWM 3S34H 4E41A 2B08A 1T5WB 5FYJH 1PCSA 3Q06A 2H41A 1UOWA 2O6FA 3D25B 2G75A 1EEYB 3WTXA 2DN7A 1USQA 4XAWH 4TSCL 4QJ4B 1CFTA 3H9SD 4M9OA 4FLHA 5CGYD 1LDSA 1FGNH 3VD1A 1BMWA 4Y9GA 3MKGA 1SFHA 4OAWB 4NNPL 1TF4A 5E51A 4ADJA 3T3PE 3UC0H 3WUZA 4XNXL 1UB6A 3ATAA 1MFMA 3ZT5A 3K71A 5TE7H 4RMBA 4ZAKC 4BQCA 4R4FL 3GSQB 5HGHB 1CGWA 3B5TA 1Y7VA 3IJHB 4Y5VC 5GIRB 1NC2A 1TJHH 3JZ7A 4KI5E 4TQEH 1NQBA 2FLBT 4ZUSA 2P8PB 4L1TA 1U4EA 3LN5A 4B6ZA 2GTZA 2APTA 3X14A 4HWUA 1PZCA 1AD9B 2BWIA 1E7UA 3IETA 4IOFD 3PABB 4PTTB 4A7TA 1BM7A 1IX2A 1U91B 4NFBA 4WEBH 4CSPA 4PMEA 3WV0A 1I1YB 3BT0A 2JSFA 2OMYB 3TASA 1TCRB 2LTQC 4FQHB 4OIIH 5C9KA 1LHZA 4FQXD 2Z31A 3DHPA 4P2YA 3T0EE 4E42B 4FNPA 4KZDH 3ZMRA 3WHXB 3LVEA 1GSKA 4PY8I 2YSSB 4J1UB 2W07B 2YXFA 4D9QE 2HJLA 2W92A 2ZXEB 4GS7C 5CIPB 3O0RH 5AZEH 4WI2A 1JPFA 2EDWA 3VYOA 1ICTA 3MBEB 5BZWA 3O41B 1H8LA 3OR7B 5EBMB 5F89A 4UZUA 1GY1A 3KYOB 5EU3A 1AY1L 3WJMB 1W80A 1WFJA 4ZUWB 3RUGB 3ARDC 1Q9WB 4F33A 2NR6A 4HV8B 1U8MB 1DUYA 1QWNA 3AUVA 2AEQH 1X5GA 5FF6B 2CLVB 2X6UA 5BXFA 4PJ8B 5BRZB 2O72A 5FYKD 1A2YA 4WSKA 1X5FA 4TSBH 4HOZA 3BMWA 3GBML 2EUWA 3HG0A 4HKBB 4KRPB 2EYRB 5INCB 1XVSA 1F4WH 2EDMA 1S7UB 1QLFA 4A7GF 4KO5A 3UPAA 3FT4A 2W91A 3RL1A 2Q8BL 5T1DL 4M7JL 1JHLL 1JRHH 3OKKA 4O58L 4D3CL 1A1OA 1RZIA 5C7ZA 5E7BA 2NCMA 1IMHC 2VJ8A 1Z5YD 2PXYA 3KGUA 4P5KB 4MSWB 3RHWK 4AZ8B 4ZOBA 4RMUA 1R75A 4TMPA 3F7YB 3KPLB 5D93C 2PF6A 2IANB 2W8CA 2X3AA 4NLHA 1T3FB 4Z7QE 5KSBB 1HINH 1TIUA 4UT7H 2BIPA 2BSED 4KPHL 4IRJA 4RAVA 5C3LD 1JWMB 2J56A 1B9ZA 5F7AA 4LSRH 2AMGA 3EZJB 4CL7A 3NCWA 1EXUA 3MUUA 3MV7B 2BZ7A 2K3HA 4ZD3L 3MRDA 3FYEB 2XRAL 1H9VA 1OAQL 3KDPB 4PGBB 1HL9A 1RCYA 1K8DB 1YEDA 2Q7AA 1KT2A 1RK0A 2MTAA 1I7UA 4K5MA 1VADB 3ECUA 1H9DA 1GXEA 2RJMA 1DQDL 3IFOB 4RSVA 4PJFB 3ZKQD 1O7DE 1OT1A 3EGXB 3O8XC 3V0DA 3T2NL 4ZUVB 1A66A 3V9FA 5DYFA 4WUUA 3BZFB 2K70A 3UJIH 4ZO9A 4R97C 3WHE0 5I8CA 3KDMA 1DBAL 1XB6A 3KXFA 3LY6A 5BJTA 3ARFB 4U1HA 3ZE0F 1DDHA 3LPFA 1HL8A 2EDXA 5E9DE 4OLUL 4HK3N 4GUCA 3MRMB 3IFNL 4OM0H 3K91A 3FT3B 1U36A 1NKRA 2WBJA 4RGOH 3RA7H 4WTZG 4FTVB 2BNRD 5EOQL 3BPNB 3RL2A 1ODAA 3PQYD 5KTEH 3QWOB 1SY6A 2EINB 3POHA 1AHKA 1JDDA 3CH1B 3ROLB 4FA8A 4NRYA 1K8IB 2KBGA 5TPWH 3FTGB 3FTZA 1VEPA 4F8LA 3QR2A 2BNUA 3BUQA 2H32A 5BZZA 5F3BA 3QIBD 4FULA 2CCWA 5D2NE 1JTPA 4D0BA 1LP9F 4HWBA 4IOSA 1A47A 3IDGA 4ZSOA 2FSEA 3LSOA 1R33A 1E2VA 5FO7A 1YA5A 4J39A 4QRRD 3HHRB 1DTUA 4JFDD 5DD1L 2WUCL 5HHVL 1DEDA 2UV3A 3IU3A 4JFYB 5DT1L 2J88L 2Z0BA 3P2TA 5KS9F 5E8PB 1B88A 1ZVHA 1FZMA 2BFVH 2CD0A 2ED6A 1SJEA 3L3DA 3QG7H 4DP9X 4JY4B 1ZS2A 3V4VL 5FGRA 3EYQD 2HRGA 2EDYA 4AL8L 2K6ZA 1SLXA 1ZS8B 4DHLA 1GYAA 2WIIA 2ROXA 2UVEA 3CFNA 3LDBC 3Q2WA 5I0ZA 3QYCA 3X3FH 4HCFA 3UTTD 1DJYA 3ES6A 2YFOA 2YPLD 3ZQXA 4LSUL 2NX5E 4OF3A 5D1XA 1F3RB 5D2LA 1A0QL 1ZJAA 4Z95H 1CDUA 5HYJD 5DHEA 4GFXA 3L48A 3VFTA 1GCYA 3ZQWA 2IJ0C 5LLIC 4NP9A 1GH7A 1WBXB 5IWLA 1N5AA 1PU0A 2FBRA 4JRLA 1S7RA 1PDKB 1TQBC 2VISA 3LN5B 2K7PA 1I9JH 2GTZB 4HLZG 3UAFA 4KDTC 3GMNB 4HUMB 1SBSH 4J7RA 2Z65C 1G1KA 3W0WA 2RB8A 3IETB 2HT3C 5DQDL 1SNRA 3PGDA 3CHSA 1KB5L 2FYYA 3NCMA 5JHDA 5GJSL 1G7MB 2FATL 4JFZH 1HHIA 2XICA 5B8CC 1WT5C 2I9LB 1TKWA 3CFKB 3KM2A 1ZANH 4C58B 4GG8A 1K6QL 3DURA 4DPCX 2R56H 3TEUA 4NIKB 4PI2A 3ZKNC 2OPCA 1F56A 3BP7A 2X3BA 4Y16B 3WN5C 4TNWK 4ERSL 1MNNA 4NKOB 5HYSG 3E2HB 5AOLA 2DEYX 1B6UA 4KQ4L 4Y4FC 2HJLB 2B3RA 3VH8A 1KELL 1QKZL 5L2KB 1E9OA 3DMMC 2YD0A 3FQTB 2IGFL 4H5SB 4CW1B 1EAJA 1SJVA 5AYTA 3D87B 4K0OA 4L4VA 4WWKC 5BZWB 1CQYA 3SKUD 4B95C 4YHYC 4JM2C 1SHWA 3APNA 3EJYC 1MJ7L 4X5WB 3MTRA 4FZEL 2BJMH 2FUTA 1T66C 1CDBA 4IK7A 2CK0L 3TFKD 2DDQL 5F9JA 5DJCA 4CVXA 1IGCL 2DQHH 3O3EA 5I1EL 1NH6A 3HE7C 1AG6A 4WEMB 1N5YH 2FO8A 3Q5TA 3MGAA 4N0YH 1FYTB 4TNVK 3MXVL 2H6OA 3QJRB 2KPNA 3WLBA 3MRBB 4BZ1H 5B3JF 1J0IA 3QDMD 1QRNA 1TOXA 4F58H 1GZPA 2YKLL 4JLRB 4QY8B 3U9UB 1CD1B 4YDVB 4X7SH 1Z9LA 3ZBMA 4G43B 5JIQA 4JFOB 5E1HB 1YEIL 1A1OB 4L18A 3O3BB 3S3SA 5BVJB 1Q0YH 2PXYB 2W1NA 4YSUA 2A0LC 4HEPG 3FB8B 3V6FA 2ICEA 5DR5L 2BVYA 4RBPK 4MBRA 5L4FA 1RVFH 5GS0C 2QPDB 2VW7A 1OGPA 4XMPL 4DP2X 2QHRH 2VDNH 1G7JB 2H3NA 1X9UA 3ULVH 3ENEA 4ZFOA 3I9PA 1EXUB 4Z3FA 2WXJA 4G7VL 4MMYA 3IRCA 2FBJH 4CDHA 3RFZC 5JW4R 1YEDB 1HU8A 2NQ3A 5KOVC 4RFEB 4AITA 4HWEH 3FRPA 1CDJA 3PAYA 8PAZA 2E8ZA 4L8SC 4PJ7E 5C09B 2P28B 1UURA 5A7EA 1DVFB 3ILDA 2J1ZA 1KUMA 1I8LA 1KYUA 2AJXH 2EILB 3I74A 5DJ8B 3KXFB 3MACH 4U1HB 2VZSA 3MRHB 1DDHB 2FQGA 2PTUA 4A2FA 2EDLA 3VVWA 4JJOA 5FDYA 4J3BA 4AC4A 5HHQB 4FFVC 5JR1H 2WBJB 5CGYC 3ZHFA 4TL5A 4LQ1A 3RL2B 4AENA 1GC1C 1RHHB 3HI6H 1HTYA 4IBUA 2AC0A 3WEBA 3T4YB 1IM9D 4YQXL 1MHCB 1H6FA 1TNMA 3QI9A 4G3YL 3FAWA 4HKZA 1FL6A 1QI4A 3PWVA 3HFMH 4MXWH 1AP2A 4YSEA 1URZA 5F3BB 4O51B 1QSFD 3AROA 4EN3D 4U6HB 2W81C 2X4NA 2NNXA 2EADA 4TKWA 4H8WL 2X53A 1LDPL 3MDJA 4JRYE 4PP1D 5FO7B 4CVUA 4J3WA 3K2UH 3T1FB 2EDHA 3HLAA 3IU3B 1CCZA 2CGRH 3AT9A 4S11A 2F9BT 3TNNA 2ADIA 3RWIA 4QRTB 2JCCF 4UINL 5L88L 3T3PB 2GJ6D 2GSIB 3BSZL 3B8SA 3GPSA 4DP7X 4E9SA 1BQKA 1A7QH 4M43H 1IM3B 1SJEB 3OB8A 4PG2C 4YPJA 4HG4K 5I16B 3NT0A 4GQZA 4HEME 1UC6A 2JIXD 4N2IA 3CSYA 1CYWA 2WIIB 3QCUH 3V5DA 5GGVH 4P5TB 4ZK8A 1O9VA 3I3BA 4HH8A 1WAEA 2J1YA 4IKNA 4R7XA 4JFEE 3ZHLA 1AXSA 1BYPA 2VW6A 4YFLI 3AU1B 4GXVH 1A9EA 5IF0B 2I7SA 5GRUL 3IDUA 1F2XK 3SGDI 5D2LB 1O0VA 4LVNC 1ZCRA 1ZD6A 4L37B 4MJ2A 5FB8B 2WV3A 4R5TA 5F7HA 1ZLSL 1U8NB 1FAKT 1O5PA 1QX1A 2OJZH 3GRWL 4PJIF 5DZNA 1LTXA 1CG9A 3GMQA 5I9QB 4HWBH 4EI6B 3T0EB 4GW1B 1AR1D 3VFWA 2LR4A 1OP9A 4WO4D 2FX8L 3QJHB 5MEND 2EIDA 3BH4A 2FT8A 5C0FA 1HHIB 4UDUB 1WSST 3G5YB 1GGIH 5LDUA 1TKWB 3FHAA 4WI3A 4G8FB 1GAFL 5LBSH 1TQTA 2C7UA 1D7DA 1TQWA 3E7JA 1ZSDA 3KBHE 3UTZB 1CIDA 3BP7B 4PJGE 1LO2L 2O5ZH 4JMNA 4NP4H 3IJSA 5DLML 2IH9A 4S10A 2YUVA 4BA8A 3MRKB 5FR3A 3VH8B 2XIIA 4YHKH 1CGYA 3KPMB 4OQTL 4G6AD 3VXMD 3GBNH 1ETZA 3IDYB 5C0AA 5FDWA 1AS6A 2ADGB 4RA0C 3WIAA 2LFEA 5B38A 3QZPA 2AABH 4W6XB 2G9KA 5CNHA 3S2AA 1MCFA 4XXWC 3SPVB 1J9TA 1FHNA 2BW5A 1R4XA 3T3ME 3WEXA 3NJXA 5F9JB 4OSUL 3MBWB 2J5LC 3O3EB 3T09A 1FF5A 2P46B 3P73A 4MJIA 2FE0A 5EC1B 3L4VA 5D4HA 1W72A 4P46B 3IWUA 2V8MA 3J27A 3WLBB 4YHOL 5KBNC 3X11A 1YMMD 4XWOC 1MWAB 4K5LA 3BPLB 3GHBH 4WU7A 3TA3B 4Z7QB 4Q9QL 1I7TB 4TVPL 3D9AH 5HHNA 3VI4A 2X1QA 1R3JA 1OCCB 5JW5B 4BK4A 2GTQA 1WDAA 4M6AA 3TGXA 6CGTA 2JNZA 1KBPA 1U6AH 3IXAB 2EP6A 3SJVE 2Z35B 3V6FB 2NXYB 4GO8A 2BSBA 2MPVA 1HWHB 4BKTC 1S9XA 2IDCA 1ZTXE 3K1KC 5DWUH 4YC2C 4NQXB 3LH2L 2F1BA 4ZO6A 3VX0A 3QFDB 1JFQL 1PZBA 2QGDA 3GMOB 3K3QA 4XN5A 1KTJA 3O0LA 5KEZA 4RWYH 3S35L 3OJMB 5GGVY 1TTBA 4D8PA 3QUZD 4FLRA 4A2HA 1ZVYA 5HGBB 5IMKA 2D7NA 3QIBC 1QBBA 1KGJA 4DCQA 5GXBB 5JW3L 3WUWA 2UWEF 3FRPB 2CKBL 5JA8B 5E9DB 1A6VL 3FT2B 4ONOA 2F19L 2RALA 1UOLA 3T0VA 5CCGE 2HRPL 5HHXH 4WI9A 3SEPA 4NN7B 3TX4A 3QQ3B 2B1AL 1Z3GH 2WWNA 1OAXL 1F4XL 1GA2A 4HT1H 35C8H 5GGQH 3HB3B 1NAMA 3ARED 3WTSA 4PIRF 1KIRA 4DN4H 2ENJA 3EYQC 5DHVB 2ODHA 2ZZUT 4EVNB 5I82A 4GIPD 3S36X 4QGTA 3A23A 3QPXL 1WAAA 4G8EA 1K85A 1NGPL 3PJLA 5SWSE 1DJZA 2X4QB 5D2NB 4P5SA 4OZIE 3VG0L 3FU9A 5EO0B 2ZWZA 4FNLL 3O11A 2M83A 4JRYA 1FQ9C 4LDLB 3FFCE 3GBDA 3HAEG 3O2DH 4IEFA 4XNZC 1OP3H 1XL6A 3VRJB 4X80L 3VFRA 3ILEA 4OF6A 1PY0A 2DZEA 4LXFA 3SDDB 4BSVA 3GWJA 1IARB 4N3UA 1NUDA 4ZFQA 5DMYA 1BD2E 2AI0L 4HIJA 3U30B 5ACLA 3SGEH 4L3ED 4I5BA 5EU6D 3U2SA 2PWEA 1MY7A 2CDGB 2D31B 4AMXA 2VDLB 2ZUQB 3GB7A 1CO1A 5C0BA 4NIYE 3BKYH 4I2XA 5L0QB 4NPJA 1QW9A 3S4SA 3NCFB 4Z78A 2KC0A 4NC2B 3ULUC 2ZPKL 2ZP0T 3R4RA 5GGUA 3NCYP 3LN4B 5DTFA 1M1XA 2NX5B 2BDNH 3BFQG 4N6QA 1B2WH 4N2EA 1XGZA 4M1CD 2EH7H 3MSPA 3TJPA 1XD1A 2FYVA 1GW6A 2QPFA 1QMUA 3D12B 3TYGH 3HG1A 2RHEA 1J88A 4IDJH 4PRHE 3PV7A 1Y6KR 1SHSA 5H2BA 2J73A 4QKXB 5CEZD 5CM1A 3MLRL 4FERA 3PWPE 4OJEH 4BQ9A 2V2TB 4KVCL 1AGBA 4YHLH 1SPDA 2J25A 3TTYA 4NKMA 4QT5B 3UYPB 3N40F 1DHKA 4ZNCD 4WWPA 4P2RD 4XPAL 4LARH 4L3CA 2PTTB 1S78D 5BMFL 2EDDA 4C59B 4M61A 2K8MA 4HKXA 5J56B 3L4YA 2I07B 3A4EA 3PFUA 4M6NH 7PAZA 3UZEA 1FGVH 2VN3A 1FRGL 1JOIA 1G7LA 3T71A 3UP1A 1RUML 5AYUH 2NNCA 4NQVB 1Z5HA 4HC1A 1UJTA 1AKJA 5C0FB 1LE5A 3Q8BA 1TSRA 1YQVL 1R3HA 3OKYA 2YD8A 4XXDB 3SGKA 4FYRA 3TO2A 5EU7C 1FUNA 4WI8A 1ZSDB 4HS6A 5C0EB 5IHBA 2WM0A 3QXWA 4ES8A 4AM0A 1FVEB 2QTEA 3FFOA 1BW8A 1HAUA 3BAIA 3MLYH 3MJ8A 5I2IA 2DPKA 4KXDA 4Y9EA 3GSRA 1VESA 4OT1L 3L9YA 5HYIA 2DY2A 5ERWA 1SXSA 1A7PL 1GW0A 2DYPD 4UQBA 2ATAA 1WZ1L 3BYYA 3QNYB 3QJFA 4PHXA 1HZHH 3I9AA 1PZUB 1GCFA 3UZQA 2NTSP 5EORL 4LQFL 3GXIA 4XHJD 5EIIA 1R3KA 4W9JC 2RTTA 4ZYKB 3SZKC 1AFVL 3WEXB 3K2MC 3NQIA 1BLNB 3QRGL 3CLFL 4JFTA 4JPSA 3FOLB 4H88H 1VRSA 4NN6C 4QCIA 4ZTEA 3P73B 1BZ9B 2P49B 3GGWA 4UWQB 5EA0L 3MNVA 4K2UL 2F8OA 1MF2L 1TO5A 1Q9LB 4JREB 2EVHA 3BWZA 2IAMC 1PJWA 1WC7A 2VDKH 4JFFD 3MGOB 4X6DA 3PUUA 5DEJA 1A14L 4ODXB 5KSUA 3CDYA 4AY0A 3Q48A 1TTCA 5DVPA 3FQ2A 3FOMB 3FU0A 3EDKA 5AAWC 1RMFL 2EEAA 3LKNA 3CZUB 3OXSB 4AG4H 2CBOA 4PJ7B 3I3DA 1JCVA 1FNEA 1ETA1 5KBMA 1WA2X 3CVHB 3EADA 2H4EA 2AXWA 2AV7B 3CZFA 4PCTA 3EFDL 1RHFA 1WBYA 3MRFA 5TH2B 4FFZH 5I19L 2P8LA 1CZ8L 3IE9A 3OMZA 4EN3C 3RKPA 1LO4L 5T3ZE 5KVDH 3TNMB 1XB3A 2BVOB 4PP1C 3GXMA 3NSXA 1I7ZA 4LGRB 4QJ5B 2VCOA 1BJ8A 3RTQA 2ZKHH 1P6FA 1F18A 4Z7WA 3PYCA 5ALCL 3PGFH 4Q4IA 1MFDL 1T89A 5KYYB 5GGTH 2VH5L 1P9MC 1X5ZA 1M9WA 2HG5A 3FFCA 1IGIH 4JL1A 2XWZA 1MFBH 5DUMH 1X7QA 3ESNA 4N90E 1HYSC 3WIHL 4XCYA 3TO4B 1E50A 4MLSA 2AEPL 4X7EC 1CGSL 2WLLB 2BINA 1BAWA 4R4NC 5AVRB 4JRYB 1JYXA 2FLRT 4X98A 3WS3A 1L3NA 3MBED 4ICXA 3CHQA 1HZKA 2VJ0A 1QTSA 2ED7A 4JG0H 2KL6A 5CZXD 2FTAA 2ADFH 5FV2A 5AVYB 2QSCL 3FUIA 3PNWB 1BMGA 4XMWA 3U2SB 4HFWB 4KOCA 4BCYA 5DZVA 4PJ8D 3QHTC 1PSKH 3GB7B 4JZNB 1AR1C 4EBQH 1UXWB 2YBRA 4WO4C 4YDIH 1M6OB 4RFNC 4FP8L 3RI5F 1N0XH 4Z78B 7FABL 1T7WA 2DJSA 4JFEB 5GGUB 3AQXA 3VTTA 4AEIL 1PZ5B 2XIDA 3GS7A 5B4MC 1MEXH 5CN2A 1IAMA 1MCNA 3N1PC 3WIFB 2DB8A 4YBQD 5LUMA 4FKEA 1A1MA 4B9JA 3EJTA 3O2VH 1HNYA 3K8LA 1KYOK 5MP6L 4ZMOA 4NKIH 1XZ0A 5ICYA 4ZMWA 4NZRL 2KERA 4MAYA 4JM2F 1I53A 3P9MB 4X4XB 1NBYB 3I6GB 1FO0L 4NB7A 3UZVA 3PV6B 4G6AC 4KQ0A 2IPKB 3MCYA 3LRLA 2IAND 4JPQA 4JZJA 4PJ5A 2WXOA 4N2OA 5DRXB 4YZFE 2BSSB 4RAUA 2D2OA 5JIIA 2DBLL 2EE2A 2DTML 3BWAB 2VL4A 4JX0A 5ITBL 3B8YA 4B9GA 5GRJL 4L8CB 1S7SA 1PL3A 3L4TA 3MV8E 2V3DA 3G5XB 4LF3A 4K9EH 4PJGB 4WUKL 4CBPA 5ID0B 4F7TA 1N26A 4BFOA 1HDMA 2BZDA 2IEPA 1UKTA 3I75A 3MLTA 1JMXA 3RPKA 3TO2B 1DSFH 1PAZA 2UZIH 2B1HL 1OSZB 1ZPUA 2VERA 3BKJH 15C8L 3F7LA 4PJAA 4L0YA 4L1BA 3IVKA 2CJUL 4YDMA 3ARFD 2VL5A 4L5FL 3TOPA 3BUDA 5I2IB 1PYWA 1KIUA 1QPKA 3GSRB 4JPVH 3EYOA 3CXHK 3T3MB 3GMRB 5KSAB 4FTVD 4LOFA 5CUSL 3X12B 5F1KC 4GJTB 1IFGA 3UZQB 2J4WL 4Y4KD 2H0JA 3EJUA 4JRXE 4TLSA 3MLUH 4OLVL 1MREL 5D5MF 5EIIB 1R3KB 3VFUB 4PCKA 2AQNA 1U8IB 4Z6AT 4GAJH 1AZNA 1WHPA 1P4BL 5HHPB 2AW2A 1TTRA 3KJ4B 3QUZC 3L4XA 2QL1A 3V4VA 5HDQL 4QCIB 1T20A 1H3WM 3QUMA 4NN5B 4I87A 2WXNA 3GGWB 5IW6A 3D8MA 1RD6A 2YAQA 3L2MA 5HGAA 3SJVB 2DQ6A 2MFNA 3ZDXF 1B3JA 2FD6H 2RIKA 1P7KA 1WC7B 1ZKAA 2N3JA 4IBZA 3VSQA 3N9GH 4X42A 3QFJE 2QPSA 4M62L 4YX2L 2DIBA 1AGDA 4Z0XA 1LO0L 2WZPD 2ZXQA 5JW4Q 2NY5C 2O26U 4WU5A 5DYOB 1NLBL 3LRHA 1IEBB 1FE8L 3ARGD 4M6OH 4UMGA 4XWGH 3V6BR 1S3KL 4UNTA 4Q2ZA 1TENA 1RSYA 5CBEA 3MRRA 3ZR6A 2CHXA 3GS4A 4LVHC 1KB5A 1ITCA 5AG8A 3OC5A 2VMEA 1G43A 2F5AH 2B0SH 2NNAA 1J8SA 1AQKL 4ONGH 3A4FA 5F7YC 5E1QA 3B2DC 3D69A 4L4TA 4WI0A 1YG9A 4KXZI 4UAOC 2EO7A 3CZFB 3GSNH 5DZ9A 3FMGH 2H0FA 1OE3A 3NCEB 3P3TA 1BQLL 3P4MB 5E2VH 2P48B 4CC4C 1BHGA 4L0ZA 5EIQA 3WMPA 5IP4A 4URKA 1WS8A 2FQDA 5H4ZA 3EBIA 1FI8C 1BPLB 5IESH 5J1AB 5T1MB 2YEZB 1EUTA 3BAWA 4H1LB 3FCTB 4XNXH 5BW7C 3ZTCC 3MMEA 1IBYA 5SWSB 5IR1A 4OZIB 4PH8A 5HBBA 5J9PB 4DQOH 2XPGB 1AGCA 4R4FH 3A0OA 3L5JA 3ILPB 4GRMA 1T0NA 2HG5B 1THCA 2J8UF 4WKXA 3RIFF 3FFCB 1KCVH 4JFHE 5AVXB 3FRUB 3LH8A 3TEWA 4PBXA 1PG7X 1RZKC 4JR9L 1M4KA 4Y16D 4HOMA 4CMHB 1VF5C 4M1CC 4N8VG 1G7HA 1GGUA 1CDHA 2ZIDA 2H47C 3LCYA 1BD2B 3SE8L 3G04B 1CLZL 5L2KD 3KGTA 3IFPB 4RGMC 4RCAA 4YDNA 3KM1A 4TVUA 1WWCA 1UA3A 3DARA 4X98B 3IF1B 2FH8A 4QIRA 1HESA 4K94C 4R3SA 4IU3B 1IV8A 5F88B 3HZ3A 1XF4A 1CLCA 3E0GA 2R39A 1QLRA 4HDIA 5FW6A 1T1YA 4CADA 1S78C 2AXFA 2JJUA 4LCUA 3WKNA 2WWMD 3CLWA 3SODB 1RZGB 3O4OB 5ICUA 4BINA 4C8XA 1RULL 1AHWA 2VWEE 4QRUA 5IBLD 4B3VA 1FYTD 4PRHB 3WY3A 4PY7A 1ZOXA 2V6HA 2ATKA 4FI8A 3PWPB 4WCYL 1HIML 1P5VB 4ZMVA 3FB7B 4Y4HB 1AY1H 1A7OL 3LS4H 3FCSB 2K6WA 5LO7A 4LU5H 2W0KA 1MCPL 4A7SA 3WFBH 5KYUB 1XZ0B 4NGHL 4HJEA 4N0RA 4MAYB 5E5RB 2XZQL 1T5KA 3UZVB 4HAKA 9PCYA 4LCWE 2YLKA 1UKSA 3MV8A 3ZTDC 3RZCB 5L8KB 1IVLA 1QVOB 1BAFL 3UGXA 2TRYA 5I6XB 4LSPH 1ZSHA 4RAUB 3I9GL 1M7DB 2ZE0A 4U3SA 2PP8A 2V7HA 3II2A 3OWEA 4XHJC 2ZX5A 3FU8A 4XPHL 5JHMA 1VDGA 1LEGA 3ZPDA 4S2SA 1UWGH 1S8DA 1S7SB 3FAXA 4O58H 3TBBA 4D3CH 2P1YA 2WXPA 2YQBA 4C4KO 4F7TB 3KAAA 1HDMB 2Y7NA 1Y6MR 5C09D 2R2BB 4KGLA 2W38A 1LNUB 1DVFD 2QFRA 1IC4L 3MYJA 3QARA 3UJJH 2A6KB 4FNTA 5B1JA 4OV6F 5EUOA 2A74B 2X6MA 4HJJL 3B7UX 4PRIA 5BUGA 2HXAA 5I17A 5ID1A 3IVKB 1NBZB 2VL5B 4ZD3H 3BZ4B 1JWUB 1OAQH 4L3AA 2GHWB 3LEVH 4F7PB 4LL4A 4Z8FL 2KT6A 1XCTB 2OMXA 2DLTA 2LU7A 1DQDH 3LQZA 3HS0C 2BIOA 2BWDA 3L3OA 4MRCA 1TPXC 1GJIA 1AC0A 3OL2A 3T2NH 4G5ZL 3FCBA 3FSAA 3HNSL 4HJTA 2X1XR 4YNYB 2X41A 3GZQA 4OZGE 5IIEB 5DRZB 2EDJA 3BSZA 2W9LA 3RWDA 5ADOL 3MRQB 4YEFA 3ZL4L 3U0WH 2O6CA 1S7XA 4LL9A 1EX0A 3KWTA 1N3NB 4KJQD 4E9RA 1BVNP 3D39A 1IO4C 3DK0A 3QUMB 2IMMA 3IFNH 4PVLA 1E7VA 1HHHA 2ZX8A 3AY4C 2Y69B 4BZ2L 1YC8A 4U1GC 2Y7SA 2PPFA 4HLEA 3IDIA 4LIQL 4JJHA 2R83A 2WXRA 1INDL 1UZ6F 4Q0XH 3EJCA 1CVSC 3DIFA 3MLVH 5I73B 3ULVE 4AXWB 1OOAA 3T6WA 2V8LA 5ITFB 3AC0A 2BHYA 1OPGL 5C08E 3VXTA 2V7NA 4QRFA 2APXA 4NQSA 1MCSA 3T0WA 1QUNA 3BZEA 1ZT4B 3GRWA 2ZCLL 4LT7A 1JRHI 1XIWA 4MJHA 4KI5D 5DJAA 4P5TD 1G9EA 3CDZB 1JK8A 5E99L 4Q2ZB 3CLEL 4TULL 4W6WB 3MROA 3MRRB 1AANA 2YR3A 2WUCH 3BPCA 5HHVH 1A9VA 2JKNA 4YXHL 2PCPB 2XKNA 5FEBA 2X4OA 1E30A 4LLDA 4M4RB 2BHZA 3QDAA 3D69B 4WI0B 4XB8A 5CZXC 2EUXA 3BH9A 3D05A 4G11A 5FHBH 3V4VH 3UERA 4AL8H 3GF8A 3T6QC 4GFTB 3VXSE 1EH9A 4YSAA 2HSIA 1NL0L 3T0ED 4E9YA 2KZBA 3DRTB 2MQCA 1ASPA 3HUJE 1ONQA 1BP3B 2XX1A 3CX5K 4BH8B 5CZKA 4OQTA 4IKJA 4LSUH 3WJJC 3RWJA 2DQIL 3MV9D 4MDRA 3X1FA 4YSDA 4F92B 5DI8A 3L4WA 4ZXBA 4YBQC 3SKJL 3SYPA 4DIXA 1G7QA 5HYFA 3QIUD 1XCQA 4O02B 4W81A 3RILA 1CYGA 4QTHA 1G7HB 3B9KA 3QCTL 2GT9A 5IB4A 1YZZA 2QSQA 2VDMH 3BIKA 2P3YA 5E8EA 2WCPA 2R1XA 3OMIB 3QCVL 2JI3A 1EDHA 3O4LE 1AIFA 5GJSH 2FATH 1SOKA 2ARJB 2YIHA 1BEXA 2JTDA 3POCA 4ZPTB 4ZMLA 1G6VK 5GS0H 4NQDE 3NYKA 3VG9B 1JWSA 1QLRB 2EACA 2YSTA 2BM3A 2WGXA 2QQQA 4ELKB 2GBTA 1E4KC 3IB4A 5CN1A 3ZYJA 4ENZA 2GQHA 1CF1A 4CADB 2W88A 5IQ9B 1ZLUK 4LCUB 5EN2A 2JTYA 4AMKL 5HPOA 3RZWA 3SKMA 4PB0H 4ERSH 3IDMA 3DUUB 1KFGA 2ICES 2YOCA 4NO3B 1UM4L 2X10A 2CUHA 4H26A 4QRUB 2Q10A 1KELH 1QKZH 3LEXA 4OZHF 4P46D 3FU7B 4PFEA 4W9FC 5HGDB 4PY7B 1UT1A 1RH8A 3V0WH 3BKMH 2PO6D 12E8H 3BWUC 3LKOB 4JHVA 2DWEA 5AZUA 3TESA 1U8CB 4NQCD 4LCWA 3QZNA 1GTFA 4FZEH 3NRQA 1DBKH 4WTWA 3TA3D 1U2HA 4N20A 5JIHA 3VGFA 3WE6A 3VXRA 1JG9A 2GBVA 3JBG7 2JQAA 3V4UH 3ARFC 1MELA 2DDQH 3VD9A 1JGLL 3T8MA 5C70A 1IGCH 3Q1SL 4A66A 3U25A 2D0GA 3BWSA 5I1EH 3IWVA 4FCHA 1I9RL 1K4DA 2HTKD 3JYCA 3MRGA 4OUUA 3MV8B 5I1DB 4MB4A 1DQMH 1GC1H 2WNKA 3BPNC 2VT0A 1TQVA 3OB0K 3LIUA 4JDEA 4UU9A 4GW4B 5LDSA 2YKLH 1XD0A 4Y4KC 3KLQA 3SQBA 3DXAE 1G9HA 2DIJA 2ZKWA 1E4XH 1XF2B 4U3SB 1BVZA 1NANH 3MLXH 4AYSA 1ASQA 2AK4E 4WV1A 4JFPB 4S2SB 3MO1A 4IYKA 4YSPA 1YEIH 2XPZA 4TS6A 3STZB 2OMNA 5AL8A 3L8QA 4PWEA 2M1KA 3EHBC 5BZDB 4F5CA 4UB0L 5E9DD 2AJ3B 2OBGA 3LV3A 3ZE0E 4IBWA 1A7NL 2OLDA 4BBWA 4UUJB 4F8OA 3MYJB 3JTTB 1KPUB 4X0KA 1IBGL 5MEPB 5LVEA 3VWJB 3BLPX 3D48R 1JN6B 3EUDA 1QTYT 1C16B 2D0FA 3OPUA 5EU4A 5ID1B 1QQDA 3SDAB 5BS0E 5TQ0L 1BPVA 3SDXA 3HB3D 4G7VH 4JRXB 1JGEB 3QHFL 1ILUA 4OZGA 4C4KT 5LB1A 4HJIA 5EFIA 4TUOB 2G2RA 2APBA 4OTXH 1FP5A 5E4OA 1E27B 1PZSA 1EQWA 3ARGC 2NZ9C 4NI3A 2Y1VA 3CFQA 2JB5L 5B21A 5ABDE 4OV5B 3V2AR 5ACMA 4D8OA 3R06B 4UTBL 1LP9E 2R1YB 2YMTA 2MPAL 2Y07H 4OGYL 3RPBA 1A4KA 1IBZA 4H1LG 3L81A 4L8DA 4A6YL 5T1JA 3QFJB 3EFOA 4A1RA 1XH2A 1MW0A 4KAQL 3RWCA 3INUH 4KY1L 2FIRT 3VRLF 1TQUA 2GITB 2WLNA 5CSZA 4W9LC 2EKSA 2CO6B 3RGVD 4G1MA 4M7LL 5J6HA 3EDDA 1PZ3A 2BOCA 1HILA 3CHXA 3UAAA 3HZMB 1RKRA 1BQRA 4G3YH 1NJ9B 3DIFB 3T6VA 2NX5D 4YSTA 3Q2NA 2ZXDA 2PCFB 2YPKB 4DKFH 1K4CA 5CEYA 4RZCB 1QUNB 2K0RA 4XNUH 5BOPA 2OXGB 5C7XL 2I5YL 4XBPA 4Y5YB 5DJAB 2H2PD 4H8WH 3ARTA 1LDPH 3ZRFC 1EJ8A 1C5BL 2AANA 4P4KB 4YXKL 5JLZA 3MROB 7CGTA 2VDRB 2VITB 2VAAB 2G3MA 4UQ2A 2XKNB 2OR9H 3KPNA 4UINH 5L88H 3GMMA 3UPCA 2NY0B 4I1PA 2FHBA 3LQAC 4AQEA 2Z93A 1T5XB 3APCA 3B4NA 3KPSA 4J27A 2OX5A 4AJWA 1EAPB 1WWBX 2CBPA 1TZIB 3DVGB 5JMRA 5EEYA 2P8MA 1WITA 3O3AA 5DUBB 1KJ2H 3CXDL 4BD4A 1KBKA 1Q72L 3TBTB 4L0PB 1KCKA 5TJWK 3CN2A 2GSMB 2VQ1A 5IBLC 1CGUA 3NH7H 4N0UA 3GLEA 3SDYL 5GRUH 5IFHL 3RWJB 1OT4A 4JM4L 4JNXA 2VLKE 2XN1A 5AENA 1JGIA 3FPXA 3U4EB 2C9UA 3OHXC 2VN5A 1PLCA 5D4JA 4ZXBB 1U8HA 3VVVA 4WWID 1G7QB 1ZLSH 3ALPA 3JV6B 3VU1A 1I1CA 5DURB 4M7ZC 1EBAA 4KK6C 4HIQA 4NRZA 3N43F 1F3JB 2ERJC 1CFQA 1OF2A 2G60L 4G1EA 2GT9B 1XWVA 4YOKA 3GDBA 5IVNA 3V95A 1IGTB 3LKRA 2GW5A 4PSPA 1VEMA 2Q3XA 3DBSA 4MA3B 4N8UA 4UT6L 2NDGA 3M1BA 5DCCA 4OCYL 3FQRB 3FC8A 3TZVA 3PJNA 5CD5C 1GAFH 1Z5LA 4F7CB 3PLYA 3MOQA 3WFHA 4PJCF 4MS6A 3SBQA 4BFEA 4LLMB 1ZHLB 1KC5L 5B3JE 3SKMB 3HRZC 4Z7OF 3C87A 5DLMH 4ZBJA 2YD5A 4Z3TA 3CHPA 1FDLL 1CXEA 1NICA 4KHTH 2EAEA 2ZAGA 4TSAH 1D7BA 3LEXB 3UTQB 4BGLA 1T03H 3CSPA 2VC2B 3G9AB 4LHUG 4PTUB 5JPNB 1U3HC 2PYEA 2GAZB 2QTVA 3I3EA 3FSWA 4OFYD 2MQ0A 3ZKSD 1DVFC 4AGQA 5LNEA 4LCWB 2FEJA 4MWFB 2MCG1 5LN8A 3ZTJG 4AK2A 2FZ3A 1ES0A 2ROYA 2I9TA 2DJ4A 1I1FA 1CD0A 4WWOA 3KS0H 3C6EA 4OZFH 1BVLB 5IVZB 3ETSA 3QZWB 4TRPL 5K59F 4QXTA 4WW1A 4OSUH 5ECGA 1IE5A 2DEXX 4X8JA 5DJ2A 1PS3A 3P30H 1BSIA 5LJYH 4BDVB 3P4OB 1DVQA 2KQNA 4MMZB 1WPCA 3WIIL 2J44A 3NAAL 4YHOH 4B7LA 1OCWL 2J21A 5JHAA 4UU9B 1VGKB 4Z7NF 4AYID 3QJUB 5E8NB 1FFNA 3DVNA 3ISRA 3JUYA 4OGQC 1NINA 1VFOA 1GS7A 1YCSA 4Q9QH 2UXTA 3UIZA 4OLWL 5IFJA 3C12A 1CMOA 2YN5A 4E0RA 3F5WA 1QA9A 4Q9RL 2F53E 4KJQC 2GPZA 3KR3L 4MFHA 3OF6A 4MB3A 2XQYA 3L3GA 3T04D 4B5EA 4POYA 1F11A 1MH5B 4I0CC 3WIHA 3ARPA 1FORH 4JFXA 4L2LA 2GTWB 4K8RL 1RPKA 1SN2A 2C4FT 4JKPL 3T0DA 2CH8A 4FOMA 2XQBL 3LH2H 3JXAA 1S5IL 3ULUH 3QUXA 3TYFA 5JQ6L 4FA6A 2FR4B 4MD4B 2MCAA 2WUBL 1TJMA 1MWOA 1BF2A 2I69A 2XXFA 4OZGB 4XTRD 3S35H 4ISVA 3EOBA 4JUSA 5F9OL 4ZNEA 1A6ZB 4ODUA 3WKYA 4PGDA 3TO4D 1OGTA 1W16A 2CKBH 3DDFA 2F68X 3KJ6H 1A6VH 1DO6A 3HG4A 5KS9A 1T1XA 2F19H 2FX7L 4JKLA 2HRPH 5DEFB 5B39A 3RY6C 1OAXH 4CSZA 5K9KA 2JQMA 1DQTA 4HSCX 1KYAA 3FUJA 1M7IA 1HX0A 2ZSWA 1GL4B 4JFQB 1Q9OA 2D3JA 4OI7A 3RWCB 2JCCE 4WFFE 5HJDA 3TN0A 1C7TA 2X4PA 5C08B 2ZYHA 3VXQB 3T0EC 3QXTA 5BV7L 2AJZA 1VFAA 3CG8A 3HKFA 2A7BA 5T8IA 5T1KA 3VG0H 3CN1A 4QHPA 4NBYB 4ZRGA 1ID2A 3QPKA 2ADJB 5CJBA 2OMWA 4NWTL 3P02A 4V1DD 4XVOA 5CEYB 2FJGB 5AB1A 3SGJC 4HU8A 1OAJA 5K5YA 4BH7B 3QIUC 1W0VA 4XBPB 4NEHB 5K9JL 2HT2D 2XQ0A 5JLZB 3ZMNA 3V6ZB 5DFVC 3VXSB 2CNYA 3MQIA 2YD2A 5CFAA 3QRLA 3FUNA 4J2XA 4K71C 1OD9A 3MREA 5K39A 4ZW5A 4L2YA 1I1AA 4UQ2B 1HNGA 3CSGA 5ILTL 1NSNL 4OGXL 4YHNA 2J55A 1BIIB 3CV5A 4J3VA 1K3ZA 3RG1C 1FVCB 1J1PH 4FQLH 2VLKA 3ECWA 1D6EA 3KPSB 4PHZA 3MJGX 2J12B 3B5GA 5JOPE 1FCGA 5JPMC 2OR8A 4J2QA 4PGCB 2AEIT 4NJAL 2L7UA 4RH4A 3MJ7A 2OSLB 4ZUUB 3CFTA 1GJUA 4IQHA 1QACA 1MCWW 2A2QT 3EYFA 3KBPA 4J5VA 4ICWA 2A73B 2PO6C 5FWQA 5KVFL 3P11L 1W8NA 1QBLL 4XPAH 4NQDB 1JZFA 1HSBA 1KJ3L 4K5OA 3TA3C 1CICB 2XA8L 1Y1UA 3GLDA 1PKQA 5D7JA 3NP4A 4G1EB 4XXCA 5AZ2L 5CLWA 2Z7YA 4QHUA 4X6CA 1FRGH 2M2DA 3HN3A 2BVTA 4D94A 5KSAD 3LKRB 2R7EB 1RUMH 2GBUA 2XVGA 1P5UB 4WTQA 5HJ3B 1HH9B 2P5EE 1DQVA 4AGOA 3F83A 5FYKL 3J07A 2MMXA 2NZIA 5TE4H 1FNHA 1O7DC 4HP5A 1KY6A 4MZ3A 2OZ4H 3S37L 4Y9CA 3LKQB 1R0AL 1MHPH 2E6PA 4L48A 3QULA 2MCPL 4PR5A 1PPIA 2W5PA 4NDMA 3SGEI 4E9TA 1BZDA 3QAZB 3HZKA 3ZDWA 3VXPA 3QIWC 5J57B 3THML 1GOHA 2FEDD 4APXA 5DHXB 2HFEA 1G9ML 4IGBA 1LE9A 1SRDA 3SJVD 2CRYA 1EEZB 1AZZC 2ATPA 3KS0J 1GPOH 4Y1SA 3FONA 4HS8L 4U6YA 4LQFH 5DHYA 2IG2H 1OW0C 3QRFM 4HSQA 1IAIL 3DXAB 1AFVH 1Z9OA 2FGWL 4GMSH 5FKPA 5IB3B 4G6FD 2AK4B 4DP8X 3CLFH 5D72L 3ZGIA 3NJNA 3K4DA 4N9GB 5A2KH 4W6YB 5KVMC 3GM8A 3U2IA 3LHPH 2WKLA 5HHME 1U8LB 1VJSA 3QUYA 3CK0L 5D2NC 5E6IB 1UKQA 4DO6A 1NEZB 4LPTA 4EIBA 3PRZA 5HJGA 4IU2B 4WI5A 3ZE0B 2A1WL 4Y19A 2L04A 3MRNB 5AW4B 1SOXA 2NRDA 2WQUA 4FG6D 4N26A 2DMGA 3LXBA 1VHPA 4YHZL 1AXTH 5BS0B 1FWXA 1TVHB 3U30C 5KVEE 2NQCA 1ZLEA 1XL4A 2CJSA 2DS4A 3V6OA 1H8OA 3NPSB 5FFOA 4JFXB 5D6CB 3C6LA 4P4RB 2BP0A 1S7VB 3BUIA 5CJ5A 2GJZB 4YIQB 3RGVC 1Y0LB 2XV6B 3MCKB 5CGTA 5SWSD 3V0AC 3G5WA 1E4JA 1EDQA 1E8XA 3WAKA 5HPMA 3VRIB 4G83A 4GUQA 2VDPB 2QKIC 4JDTL 2HJKA 3EUUA 4FYTA 1LP9B 3L3IB 3HBPA 4NZ8A 1GZHC 4EI5A 1ET7A 5FHAH 3EFDH 4G6MH 1LO4H 1OGTB 2H2PC 1BD2D 4AQ1C 3H6JA 1DCLA 3V79C 4U7MA 2CLRA 2JCCA 3UAJA 3V0EA 2JELL 3FTWA 3O3DA 4GSDL 3A6BL 1KDJA 5B39B 3US0A 5IEKA 2OSXA 2A77L 5ALCH 3US9A 2LFGA 5IBTL 3TFBA 2ODIA 5EWIL 1BIHA 2VH5H 3TCXA 1IKNC 5SWZE 3ML8A 1J5OL 2FWUA 3NCCB 2A4CA 5FK9A 2X4PB 3GTTA 3GO1H 1O9WA 4PJBA 5CJOL 3WIHH 5HHOE 1TUPA 4FLSA 2AEPH 2Z8SA 3WXVL 1CGSH 3H85A 5CO1A 5FYLD 3WBDA 3GHEL 4K3GA 4PRHD 2IBBA 3BISA 3T2PA 1YJDL 4MAUH 2DWDA 2K7QA 4NAQA 4UILL 3JWNH 3PWPD 5J6SA 4PJIA 4PRNA 2EE6A 4Y4HD 3PP4L 4NNYA 5HI5D 4QHMB 3P2DA 2W59A 2HZHA 3UBFA 3MLWL 1E3FA 3I84A 3ZSTA 1FLRL 2YAOA 3GI9L 1J9SA 5TDPA 4FYQA 3HZYB 3JWDL 3BVNA 3ZTNL 1F90H 1I1AB 3D5OF 7FABH 4CU8A 2Y5TA 5AVVB 1U8PA 3BFWA 2CJ3A 1KPVB 4FNRA 3GHPA 4P0DA 3RZCD 3AUWB 4AEIH 1N0LB 5ANHA 1IC5H 3V5KA 1XAUA 3TF4A 1NGQL 1X44A 5B7MA 2VLKB 3U6XS 1D6EB 3RWHA 2HJFA 3FYIB 3FDWA 4PWIA 5JNYA 4OKDA 1RZ8B 1R5WA 3OAZK 2UZXB 3QUGA 4KKQA 4U1SB 3BWUF 1KJVA 1H15B 4C56E 1HCFX 2Y4SA 1FO0H 1NCDL 3IMTA 3P1VA 3AAZA 1RK1A 2ZUUA 3ABLB 4KMQA 4N87A 1UASA 2N0KA 1L7TL 4YHPB 4QHKI 1IEAA 2P45B 3B56A 4OLZH 3QFGA 4YL9A 3MUHL 4HCRH 4OIAA 1HSBB 2P5EA 4NPYA 5EOCL 1T7VA 3G08A 5IMLA 1NLDH 4Q6IA 1RV6X 3RIKA 4Z7VA 5D7IF 2ZCKH 5I1AB 4G82A 5GRJH 8FABA 4PREA 1ACYH 1MJJA 5AW6B 1TETL 1U93B 2P5PA 4P2AA 2YXWA 4NHUA 5A6IA 3FH8A 1MW1A 3CWGA 1B3IA 2XG5A 5IVXF 1M2OA 1NCUA 1E8YA 4ODSL 2VXVH 1ND0B 1ZWIB 4FKKA 4I9XA 4U1IB 15C8H 4Y8AA 4FQJL 2H9GB 2IQ9H 2VUYA 5JXEA 2CJUH 3QULB 4PR5B 2Z8WC 3HZKB 3HMXL 4ZUTA 2WO4A 3DUSB 4OQ1A 1KY7A 5E95B 4JUTA 3KEDA 4P2OC 3BN3B 1FAIL 1FH2A 1P2CA 1PEWA 4N8CL 3JSSA 1WTGT 2GEEA 1LE9B 3VMPA 4P3CL 3HI5L 3EG9A 2V9RA 3FONB 1M9SA 3F00A 1OCRB 4BWWA 4YDKL 2LU5A 5DO8A 3L7EA 3UBXI 1FNSL 4P23A 4DGVL 2XV3A 1QLEL 5G5DB 1E43A 2UWEA 1JJUA 1H3PH 1CDCA 2FB4H 4M1DL 5D1ZA 3TO4C 2F53B 3HA0A 4WK4B 2DJUA 4AE1A 5T3ZD 3UPRA 1DQQB 2FUQA 2F2HA 1WHOA 1XF5B 4QRAA 4DJMA 3BHBA 2ICWJ 1SEQL 3PHOA 4M62H 4QF1A 4ZDHA 2B3IA 4LCYB 4N1CA 4HUVA 2WSDA 1LO0H 2DAVA 3B43A 1NC4B 2C9SA 4JPIA 1TO4A 1TG8A 2WLHA 3M7OA 1NLBH 1XCWA 1FE8H 5KWYC 4Y5VA 4PG9A 3ULSA 4N90D 4ZFGL 1S3KH 4A2LA 3PP3K 1M05B 2A83B 4JO4L 1KBGL 4XT1C 1S7TB 1XSIA 2Z92B 1DEEA 3E8UL 4MNGE 2DW5A 5KVGH 3H56A 3G5VA 5AYQA 1NDGA 4KU1A 5AW9B 1R46A 1D2PA 4JDVB 1M3IA 3BIBX 5GJTH 3CMOL 6FABL 5I15L 3FUKA 2LAAA 5EC2B 1I3GL 2UX6A 2VDKB 2BXZA 3P3YA 1BQLH 3EH1A 2F18A 5FYJD 4O5LH 3OBAA 5SWZA 3I9IA 1T2JA 2DH2A 1ACZA 2NXZD 2HT2C 3PWJA 1GGCL 2JCCB 2DJMA 1BQHA 1L0XA 3O3DB 4KTDL 4JPKL 3LD8C 4H13C 1OAKL 2R0LL 1A8JH 3NMEA 4J4PD 2I32A 3NZSA 1N9PA 1UWXH 1MY5A 1UT9A 3OM3B 3WO4C 4CMMB 5CU5A 5LCVL 3IFLL 5DFWH 2NY6D 4AV4A 2X4SB 2Y7QB 3P2BA 4JR9H 1TQCB 2EH8H 5DDHA 5CILL 4IM8A 3EYUL 3L6FA 2IAAC 3FFDB 5DJXA 4UNUA 3IDNB 1E40A 3WHE1 4WNSA 4UAHA 3UG5A 5I8OL 2F1EA 3SE8H 1FL3A 3ARDA 4OM1L 3BVDB 3OTTA 4W4OC 1FFPA 5IMOA 4UZSA 5BO1L 3D0VB 4PLNC 5EHFA 3ARUA 2X2JA 3QC6X 4G8GE 3TV3H 4N2FA 4QHNA 2SODB 3D51A 1CR9L 4AQAA 3WXWL 4X5XB 1Z9PA 2YO3A 1FZOA 3U4BH 5F7UA 3DJTA 5AW2B 4N9OB 1N6QL 3EF7A 1ORSB 3M88A 4KUZL 2YLHA 5TDPB 1RULH 3LZFL 5CD3A 5J06A 5I6LA 2Y5TB 4NJ9L 1HI6A 4N68A 4FQ1L 2PUQT 4P2QA 5BZXA 2V37A 3ABMB 1PLGL 2BERA 3FTSA 3GMPA 4P9MH 1IU1A 5EMYA 1MFUA 3IGAA 2E7DA 2BIQA 4GBXA 3RWHB 4MNQE 3APFA 5J12C 2VABB 1BYOA 1CYXA 2NUTB 1EJOL 2VUOA 3BDBA 3CFJA 3D1MC 4WI6A 2ORBH 3KJ4C 5CJXA 4QRPA 4HIXL 1HXYB 4MDJA 3NABL 2Y6SD 2BP3A 3CX2A 5H35B 5AVSB 3TJEL 3MNZA 4N5UA 3H3BC 1H0DA 1CXFA 2BNQA 2FEDC 3JUZA 3V0VA 3FL7A 3F7KA 1C08A 3VWJD 3ARXA 4UM9D 4WHTB 5IHWA 3BGAA 2P5EB 2ZWNA 2ZKMX 3SDAD 2QQNL 1H3XA 1BQSA 5JZ7D 5IMLB 2X05A 1YUKB 5JOEA 5F2FA 2IH3A 1MJ8L 2V33A 3UBXB 2RGSA 3E6HB 8FABB 2F54A 2ENPA 1LK2A 1MJJB 1MNUL 1NCJA 4NHUB 3A47A 4TLUA 3RNKA 4Q4EA 1I8MB 1CE6B 3VE0A 4DEUA 5IGXH 5I75C 1NDMA 4Z77B 3C8DA 3NJKA 2YA1A 2XXMB 2O93L 3EO1A 4FG6C 4H25B 2L8AA 4LESA 4X8GA 2C9XA 3CVBA 3QFJD 4X0NA 4GG6E 4OH2A 1YUHA 3D4ZA 2XWDA 3ESOA 4TOYL 1FJ1A 4ZUTB 4E5XA 2OI9B 5KW9H 5G4NA 2IPUK 3A3YB 2AEWA 2VLRE 4HHWA 4DGYL 4Z8FH 3QQ4A 3BGMB 3O6LL 3R1GH 1A4CA 3EG9B 5CINL 4F20A 3MFFB 3E1ZA 5CZRA 5HHMB 2ENQA 2YAHA 1LK3L 1DQKA 1D7FA 4UOW0 3HVDA 4X99A 4QOKA 4PRAA 2OJ1A 2X40A 3W11D 1NOLA 1X5XA 3AABA 3ZL4H 4EO5A 5T1LA 3UTPE 3U1PA 4G70B 4IMKC 4JY5L 1T1ZB 4CMHC 3L5HA 5D8JL 4DTGL 1TZOA 2B4CH 5TFSH 4B97A 2Q76B 5EBGA 3GSVA 2XQYK 2LU4A 4P4KD 3LPGA 4IRSA 5MI0C 4BZ2H 1PX8A 4K7PL 3U48A 4NQUA 3EFFA 3HNVH 4ZPVB 5SX5H 3SPCA 4FCAA 2R59A 1JYVA 2E9BA 2WLKA 3WFCL 1BZQK 3QT2A 2Y5EA 3L1GA 4XC3L 1WUZA 2EDEA 3CUPB 1NPJA 1FA4A 1PY9A 4MNGA 4K7FA 1OWWA 4U1NA 1TTGA 3H53A 4ZAKB 2VE6A 2ZCLH 3CHRA 1X6NA 1LO3H 2R69H 4A2EA 3CIQA 2HP4A 2O5NA 4HKJB 5GS1C 2J8UE 1OSPH 1T83C 5E99H 3CLEH 5IB5A 2GIXA 2PWFA 2YWZA 2DTSA 1TZGH 4UT6A 4NKDA 5E6RB 1JSYA 4Z5RA 2D3NA 2O5YL 4FADA 5JUEL 1J1OH 5HI5C 4WEUD 2HH0H 5ESQA 3BW9A 1WT5A 1DE4A 1TVDA 2J2ZA 4OCRL 4UT9L 3DYMA 5SWZB 1NL0H 2WK2A 3OQRA 3TPUA 4Y2LA 5A2IH 3VD3A 3LPPA 1LLAA 5KJRL 3U6RA 1BQHB 1KLUB 1X5AA 5E00A 2WLIB 3L3HB 4KY2A 3WN5A 2R4SL 4JDZA 4DGUA 5HHOB 3SE6A 1KLGA 5INDA 4Y4FA 2NDFA 4FAAB 2NW2B 2FGZA 1S5HB 4GS7B 4KVNL 1GS6X 5I6XC 3SKJH 3VMNA 1BMZA 4JM2A 1JP5A 4XC1L 2Z1PA 3GSNB 3QCTH 4N3TA 1RZKL 1FL3B 2IADA 1FFPB 3FO9A 1MCOL 3Q01A 3S96A 3QCVH 3HE6A 4YN3A 3UEQA 1TVBA 2Q1EA 5D1QE 3T6ZA 1YPZE 3F6LA 4XP9L 4PVMA 5CEXB 3HE7A 4KK5C 1AD0A 4WJ5B 2LLLA 2KPWA 2A74C 3P0GB 2ZXWB 1E65A 3GPEA 4FD0A 4XMXA 4ZMQA 3JZYA 5HYQA 4AMKH 2ID5A 4MJ6B 4ZT1A 3EBGA 4U1LA 4GAAA 3QH3A 2OYLA 3P4LA 4QPEA 1JVKA 3NJFA 3S5YA 4KX9A 3U9PL 4EUPA 4NRXA 2VXUH 4PPTA 3GS0A 2HPTA 4U49A 2XNAA 5C6WH 4C56B 1JFHA 5AAMC 5AVUB 1TU2A 2R29L 3QEUA 4ES9A 1NCTA 4WY7L 1DVUA 2WB1A 2K8QA 4U6VL 1NIAA 5FWRA 1KJMB 3CFJB 1INEL 1OB1A 2VXQH 2MHAB 3DI2B 3X1BA 3Q1SH 4Y2DA 2C1OB 3MNZB 1LEKA 3UDWC 1FV1B 2HMID 5JIDA 1RUPL 1I9RH 3RFZA 2K4AA 3DTUB 2DQCH 5D5MA 2AP2A 2PW2B 2X4UA 1YAZA 4PS3A 1QYGL 2BNRE 5E94A 3DKHA 4BSWA 1DN0B 4OFKA 3EJZD 4JVUA 1VKXB 1J0ZA 1MUJA 3C6SA 4L8SA 1SYSA 5I73C 3O8XB 1DBJL 4Z3EA 3NA9H 4JB9L 4BUQA 3FN0L 1KN4L 4LKXB 4HD9A 5FX3A 1TDQA 2OS7A 4R97B 1NAKL 2V9UA 2ZX9A 2VIRB 2Y9RT 1DN2A 3BZ5A 1QFWH 2OM5A 4HIIA 5MEQA 1J5DA 1P7QD 1H6UA 2R0KL 3ZHNA 3MX0A 1UJ3A 1IBGH 3H9SA 1OZUA 1YEFL 2ZQKA 1NDMB 3IAGC 3FB6A 3EO1B 3A6OA 4LRNH 1XGRB 4IS6B 3QHFH 1CQKA 3G3LA 1TJGH 2PNDA 3ULVD 1R3IL 4DFIA 4RX4D 5C08D 1MIMH 1NWOA 1UZ6E 3CFDA 3MUZ1 3QQ4B 4I89A 2C3VA 3M8OL 2J1KA 1P6WA 2JB5H 2VR3A 5F96L 4DPBX 3W82A 1ACXA 1HWGB 1XGQA 1T21A 5LNGA 2LABA 1VB9A 4UTBH 2DQTL 3MRIA 5DJDA 1A9BA 3O2WL 1OZTG 4AIZA 2DWTA 3QW9A 1G0DA 2FT6A 4OGYH 2Q7YB 4F2MA 2B5IC 1CGTA 2VDOH 4C83B 5HYJE 5T33L 2ZUXA 1J12A 4A6YH 3HPJB 4X7TA 3TT1L 2QPUA 3FBKA 4KAQH 3GM0A 2I7OA 5DEGA 5B38G 1X3DA 5E8DH 3IMVA 4PG2A 1PGRB 1E4WL 1ZK5A 4PN6A 3VXSD 4F2FA 2NXZC 2BSTA 1OTTD