3PU7A

Cu-zn tomato chloroplast superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
ATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical Properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3pu7A00
1BZOA 1SXZA 1SXNA 2C9UA 3CQQA 2WKOA 3ECUA 4A7SA 1F1AA 3K91A 4FF9A 3QQDA 2V0AA 1B4LA 1TO5A 2XJKA 3CQPA 1E9PB 3CE1A 1MFMA 2Q2LA 3F7KA 3ECVA 3GQFA 5KBLA 1YAIA 4A7TA 3GZOA 1TO4A 2C9VA 2AQSA 1JK9B 1ESOA 2AEOA 4OJAA 1PU0A 3S0PA 1SPDA 1E9OB 3GZQA 2R27A 1PTZA 1B4TA 1F1DA 1FUNA 1SXCA 3HOGA 5CU9A 2AQRA 4MCNA 2VR6A 1OAJA 4N3TA 1HL5A 3GZPA 4B3EA 2AQNA 1Q0EA 1E9QB 1IBFA 3L9YA 1DO5A 4BCYA 3GTTA 4OH2A 3RE0A 1BA9A 3KBFA 1N19A 1P1VA 1N18A 3KM2A 4A7GA 1CB4A 3LTVA 2AQPA 2Z7ZA 1F18A 1COBA 1JK9A 3H2QA 2AQQA 1AZVA 4U4IA 1SXBA 3KBEA 1SDYA 3H2PA 3HFFA 3T5WA 4BD4A 2APSA 1EJ8A 1E9OA 1UXMA 2GBTA 1Z9PA 2Z7YA 3ECWA 1SDAB 1IB5A 1U3NA 2Z7WA 3KH3A 1OALA 1SRDA 2WKOF 3PU7A 2SODB 1RK7A 2WZ6A 4BCZA 4A7UA 1JCVA 3GTVA 1XTLA 2VR7A 1E9PA 1E9QA 1KMGA 1Z9NA 2ZKWA 2WZ0A 2Z7UA 2C9SA 2ZOWA 3HW7A 1OEZW 3KM1A 3MNDA 1HL4A 1DSWA 1S4IA 2WWNA 5KBKA 1IBBA 2JCWA 3L9EA 2WYTA 1XSOA 1SOSA 2K4WA 2VR8A 3QQDB 1SXSA 2E47A 1PZSA 2NNXA 1OZTG 1IBDA 1YSOA 1YAZA 2WYZA 5KBMA 2ZKXA 4N3UA 1CBJA 4A7QA 2WZ5A 2ZKYA 1QUPA 3SODB 1IBHA 1XTMA 1F1GA 3F7LA 1SXAA 2AF2A 2LU5A 2AQTA 4A7VA 3MKGA 2GBVA 3KH4A 1L3NA 2GBUA 2XJLA 2E46A 4L05A 1EQWA 4MCMA 2WWOA 1OZUA 2JLPA 1UXLA 4A7GF
chains in the Genus database with same CATH superfamily
5AOLA 4BWWA 3N91A 3RTQA 3D87B 4RBPH 4OFPA 5A2IH 4IS6A 4MNGB 2FNWA 3L7EB 2H1PL 1FYTA 2NX5B 1BVLA 4OIBA 1P4IH 4UOZA 2CPCA 1VKXA 4TTDC 1L9PA 1CTNA 2WQWA 2QGCA 5E6IB 3EH4B 3TBSA 1M7XA 1W15A 3NQIA 1I8MB 1SPDA 4MX7B 3ULUC 3J07A 4PJEE 3AG3B 1PTZA 1MHCA 4HWEL 1RERA 1NPUA 1ILSA 1K9TA 2GUOB 5CD3A 1E8YA 3HBQA 2D03H 1WQVT 5DC2A 5AAMA 1QQDA 5I74C 4HHAB 3ME0A 2NUPB 2O6FA 3FFOA 4IRJB 1H15B 1AG6A 3L3IA 2EC8A 1MVUA 1LD9B 3A0OA 5BZDA 5I17A 3EO9L 4ENEC 2PR4L 4AL8L 1HTYA 1RXLA 3LTVA 3RWGA 4Z1PA 2VKXA 4LOUD 3S36H 4EUPA 1TVHA 1ONQB 4Y19D 3H8NA 4HJIA 1AY1L 4HOMA 3CHQA 3D3VE 4LSRH 4X6BB 4P2QA 1T20B 4ZMTA 5AG9A 1VADA 4TQ8A 4DEPB 5AVRB 4AH2A 4ZODA 2BMKA 2C9RA 1CD1A 3MODH 3RILA 4OD2B 1RI8A 5KVGH 2JELH 1C16A 4YGVB 5DLMH 1U8HA 4IRSB 3L3OA 1L9MA 1KC5L 1K3IA 2A0LC 3L2LA 2H9GB 1WVZA 4M7ZB 1CDGA 2ARWA 4MHHI 3ULUH 4S2SA 4DGVH 5SWZB 1TPXC 2A3TA 3QORC 4WEBL 2P5ED 3PWVA 3H6JA 2OL3L 3TGXA 3ZE0E 3OHXA 3CFEB 1EAPB 1KACB 3F6LA 3ESUF 1LP9E 1E50A 3BZFB 1JHLH 4FQ2L 2EIDA 3QQ3B 2RGSA 1L9TA 5IB3B 3SQOL 4ZFFA 3CZFB 5KYXA 1OM3H 3MLUL 3WTSA 1N4XH 4MASA 1C9SA 4DGYH 3QGVA 2Q87A 5ICZA 3P4OB 4QO1B 1U95B 4OZFG 5C7XL 3TN0C 1UADC 3WIFB 2IWFA 1DVUA 4HK0B 4M9PA 4WHYH 5DWUL 3UTTE 3MMEB 4X6FB 5C09D 4HV8A 2CK0L 5TE6H 3QRLA 4HS6A 1LE5B 2OW7A 2KS0A 3P2BA 3MV11 3QS2A 4RZCB 5E9AA 3S48A 1KIRB 5L4MA 2WVVA 5F7KC 2R2BB 3RUGF 4Q6IC 3W11D 3DSFH 2M1KA 4M1GL 4P4KC 1XO8A 5F21B 4W9CC 4KO6A 4L1BA 3F12A 4K8RC 3H9SE 1D5XB 1HQRA 3IN0A 1Q1JL 3DLQR 2P8MB 1VZHA 2X2YA 3FUDA 3SYCA 4A2EA 4N4YB 5G5DA 2YKKA 3MRFB 4FOMA 2CKNA 2R56L 2NX5D 1F6LL 5DJ6B 2QDWA 1K6QL 5EOQL 5H35A 2RH0A 2WLNA 1LYQA 1W8OA 2WWKO 1RURH 4F7CA 1MVFA 4PLNC 1AS7A 1RZKL 3APNA 2FDBP 3I6KA 3D18B 5EF1A 2AAVA 1HHIA 2P28B 1G0XA 3AREA 4BHUI 4PWJA 4RLDA 4NO2A 1EHNA 4WZ9A 5IJDC 4X7FC 4P5TB 4JFSA 4I4WA 4OIIL 3WHE1 2B3RA 3PJLA 2ZG2A 3SBWA 1PAZA 5IV2A 3BC9A 2G2PA 4JFQA 4BHUA 3O9WB 4X6DA 2ZD0A 2XG5B 1ZK9A 2VITA 5A2FA 1UFUA 3TNMA 2CHDA 1C12B 2FR4A 5FGCE 4Z7VB 1N3NA 3D6GA 1A4KA 2RIKA 3P30L 2FBOJ 3GLEA 5EUOF 1XSJA 2Y9RT 2AJYL 1OSZA 1S7RB 2CUAA 4IIQB 1QACA 1EAJA 3GEFA 2V7HA 4GXFA 4NFCA 1J5OH 1TSRA 1L6PA 1XZ0A 1PMYA 2VNCA 3FHQA 1I1RA 1YY9D 3O6KL 1GYCA 1OT2A 3CIQA 3F58L 3NA9H 4RGMB 4I85A 3TYFB 4AKOA 4DGUA 3UJTL 1P7QD 1RCYA 1CURA 4XBPA 3NCJH 1BBDH 4N0UB 4PW9A 1DL7L 2EDYA 1XH2A 2IMNA 1EXHA 2UY6A 3IE9A 5IQ9B 3T2NH 3CMOL 4PG9B 1I8IB 5ERWA 2IPUK 1NLBL 4AYMC 3W0WA 4N2KA 4TQEL 1EAOA 1OF2A 2UVFA 2ZKYA 4MJ6B 3FONB 5SWZD 1UOLA 2VDQB 3BWSA 2NY4D 1YNKL 1GOGA 3MRKB 3IGLA 1LLAA 3LZFL 3U1QA 3EYSH 4LQFL 3MHZA 4FYSA 5F89A 5A2LH 1ZHKB 3V95A 1A8JH 5BZWA 2MPAL 3IFLH 1NWOA 4FQHA 2XKNB 3HKFA 1IGJB 2Z9TA 2BZ7A 4PBXA 4JL1A 2DQUL 4AIXA 4UDUB 4X7CC 4LHUB 1CLVA 4KQ4L 5E2TH 1FHNA 3ZT6A 4X4YA 2MCPH 4JFEA 4P23B 4Z7WA 3WNLA 4FEIA 1M7UA 4LHUG 4KH9A 3RZWA 4OF7A 3BP7A 3DX4A 4ETQB 5CZRA 5T5NF 3ULAB 2W38A 2XWCA 2PW1A 3UP6A 4CN6A 3S88H 4L3EB 3LV3B 1JIBA 3SDCC 3HRZA 4RISL 1RUMH 1NGQH 2WTRB 3U4EA 5FIEA 4MCNA 4WW2F 4BINA 5GIRA 2HFTA 2CXGA 1NKOA 5L2KE 1HWGB 1MAML 5JW4Q 3ARDB 4CGUB 5HI5D 2XV6B 3DECA 3L9YA 1I1YB 3W56A 2CBMA 3SGKA 2BP8B 1VPOH 1QMUA 3K2UL 1N6QH 3LH2H 5EBGA 1GY1A 2ZWKA 3KBFA 3VXRD 1HT6A 3DUSA 3EGDB 3EH2A 3MI6A 4NM4L 4LLVA 5FO9B 5J13B 1DQKA 1AXIB 3V7AG 3PUUA 1MCOL 2ADJB 2EUZA 1NCAH 4JZNB 2O5ZL 4F9PA 4KRPC 5IJVB 3F85A 5E56A 5DMKA 3GMOB 1OW0A 2WD0A 4F3FB 1JPFA 3OKNB 3O41A 3CSGA 3C5XA 3VSUA 1T6VN 5AZEL 1TTUA 2B1AH 4QKTA 3WTTA 1HILA 3E80A 2KZWA 4NAMA 5E2VL 1SYSB 3ABMB 2A9NH 5AVYB 2VH5L 4RGNB 3NN8B 2ZE0A 4OGQC 1G7HA 3LN5A 4JFDA 1SHWA 5T3ZH 1G1KA 4MRBA 1NGWA 4MVBC 3NIFF 1FRGH 3N0AA 1G7QA 3M46A 3CDGA 1TZ8A 4GPVA 2DWTA 2B1HH 1WZKA 1H5BA 5IVXA 3P0YH 1QSFA 1CYGA 3I50L 5EUOE 3Q8CA 5DJZB 1J5HA 4YHOL 1HCZA 5J3HC 4GMTH 5GSRB 3LNHA 5C0BE 5IJCC 3WXWH 1J11A 1UH4A 3P4NA 4HEPA 1IGCH 5ISZB 3VFTB 3KH4A 3U9PL 5IQMA 1BD2B 1IGFH 1NCDH 1M56B 3GXPA 1PNCA 2KKQA 3WU1A 5ITBL 3RY5A 3D52A 3F00A 3TJPA 3KYMB 1AI1H 1T7WA 1XR8A 2JJSC 2RFXA 1FZJA 5IB5A 3B3IB 2PW2A 4ETYA 1DFBL 4KX7A 2A2QT 3CFJB 1E9PB 1DQIA 1A6UL 1MFMA 5IBLC 1MLCB 4D9QD 1AO7D 3VYNA 3CVHH 4GFXA 3UZVB 5INDA 4LESA 5T1DL 2IH8A 4LP4A 2CXKA 3LKNA 2UYLB 2UZXB 1REIA 3WEBA 3V4UL 2Z1KA 3L17A 4AWJC 2V37A 5AW5B 1MLBB 4P23D 2Y7QB 3RTLA 2PCPA 3GSUB 3IDUA 3RY4A 4GW4B 1KYFA 1VFAB 2GSGB 3MCLH 4ADJA 5B7MA 4U3XA 5EH1A 2NTFA 5IZ7A 3X14A 3DETC 4NOFA 2XRAL 4Y2OB 1H3TA 4HWEH 3CSYA 5E7BA 4L3ED 4H5SA 3E9TA 3LJ3A 3CHOA 4XNQB 2PPEA 3RWFA 3NGBB 4J3OF 2XPGA 4V1DD 4XXDB 5HHXH 5DJCB 3K4AA 1MCCA 4FN0A 4NENB 4M1CC 3V52L 3IDGA 5IVNA 3EO9H 3LEXB 5E5MB 2PR4H 3MNZB 2DBLL 4HUUB 5K1JA 3RWCB 1URZA 4LSVL 1XF3A 4UOQA 3O2DL 2XWBB 2VL5A 2WTOA 2HG0A 5IBUB 3IETA 2X9YA 3KH3A 5E8NA 1AY1H 4GO8A 2X4NB 5CJXA 1I8LC 5IBUG 3A4DA 2B2XH 3CVDA 1JXGA 2VDMB 5ESVB 5HTSA 4U6YB 1FPTL 2EIJB 4DP4X 4OZIB 3VQMA 1I3RB 3FSWA 5K9QG 4F33B 3D50A 5F93C 2E3VA 1RZ8A 4P9HL 4WFGE 4EI5B 4JRYD 5GRXG 1R3JB 1KC5H 5D4HA 4ZOAA 4Z8FL 3DOIA 3MA9L 2VDLL 4JQVA 4F2MB 4RGND 2Q0ZX 4WEBH 4MS8C 4OI8A 2OL3H 5C70A 1XIWC 4ZQKA 5BV7B 1QI5A 4WFFD 3ZU8A 3FCSA 3B5GA 5PAZA 5I1KL 3NIFE 4N0CC 3VXNA 4FQ2H 2IWKA 5GPRA 2G3NA 2FWOA 5EZLB 3EXJA 3MLUH 2MCAA 5MENE 1QABA 2QR0B 5DHEA 3M8OL 1S9WA 4CVZA 4LKXA 3FUIA 3MV8A 3QIUB 3VWJD 4ZUVA 3QWOA 4PJ5A 1HX0A 3JZ7A 1MXDA 4P5SA 3G5WA 5DWUH 3X1FA 2QKIB 4N2NA 5HHQA 5FCSH 4ODUA 2CK0H 4F8TA 4PWFA 1WFTA 2W0PA 3GC3A 4HU8A 1JGDB 5IHZA 2E59A 1I8UA 5E03A 4RRPG 5BRPA 1HHJB 1ID5I 2X3AA 2IO5A 3LIUA 4FYRA 1A1NB 4Q9QH 3IDXL 1AZZC 3RBSA 1AD0B 5L4JA 1KXQE 5ACZB 4M1GH 1R5WB 3MLYL 3HHSB 4JFVA 1X6NA 5I75B 3T0XA 4U3SB 3MRIB 1O9WA 5DC9B 1TOXA 5BCAA 2GYSA 2F08A 3TWYA 5BQ7A 3TO4D 1SVZA 3PQYA 1WA0X 1CMOA 4LPVA 4G2AA 2E7BA 2HVJB 5EO1B 3U46B 4ZNCD 2R56H 4WUUA 5C9JA 4BK5A 5EOQH 1K6QH 4PJAF 4HULB 4V2CB 5FA4A 1K5NB 4JZOB 2J1YA 2NYYC 3LXBA 1OT4A 2X2UA 1W0YT 5EBMB 1YUHB 3PWJB 1P1VA 4M9OA 4XVUD 1XR9A 2VAJA 3VJ6B 2OL3A 2BNQA 4DP9X 1EEYA 2DYSB 7FABL 2GAZA 4JDTL 2A4EA 2G30A 3DX9B 1OGAE 4N9GB 2WANA 5ENWB 3P40A 2Z0UA 4LSQL 1OT1A 1FYTB 4YL9A 4OIIH 4JG0L 4TUJB 2D73A 5DD0L 3OV6A 1U3JA 2VXUL 2BOCA 4OVVA 5DRXB 3VYOA 4A2LA 3EH5B 3E1ZA 3QARA 2PPAA 3GTVA 3NOIA 5CILL 3MRLA 3LQAL 5F9JA 3TBSB 3GMMA 3KL0A 4ZMYA 5FO8B 1OEZW 3DO4A 3OAYH 1B0GA 3P30H 5IW1A 3R7RA 2CALA 3VXMA 4F7PB 3FQRB 2AJYH 3BN3B 2A9BA 4NXKA 3RY6A 3A21A 4UINH 1IAKA 4HMDA 4JB9L 3T0EC 4HVBA 3O6KH 2HT3D 4X4KA 3F65A 2QADB 5TH2B 2JK5B 3P0GB 1P1ZA 2VLJB 3ROOB 4XPGL 1NAKL 3BWAB 4Y2DB 5FB8B 4KKLD 1U3HD 2OMVB 4JRXA 3PWPE 2OP4L 4EIBA 3LD8B 3BT2L 2MTPA 1NLBH 4EI5D 2R51A 3MUY1 4JMNA 4TQEH 4WVRA 5HHOE 4YHIB 5D70L 5CIPH 5E4EB 3SJVA 1E3FA 1W0VB 3IDJB 4P2QB 2XXFA 2Z34A 3D2UA 4RA3A 4X4XB 5SWQA 2F9BT 4EUPG 4NJAL 1CFQB 4I48B 1MQKL 5B1JC 4JQXA 1XGRA 1NCGA 3FQNB 1JDCA 3OGOE 1J48A 1G9NC 1DJSA 2BNRD 4R4ND 2MPAH 1A7PL 3K8MA 3BSGA 4OGXH 3WI9A 4MMYA 5H94A 2YSSB 4PJIA 5J9PB 3GQFA 3EO1B 2DQUH 3QIUD 4XH2A 4ZW6A 5AB9A 3EHBB 4KQ4H 2QQQA 1EHXA 3PWVB 3D0LB 5E8PA 2ZOTA 4R9HA 3M17B 3NQKA 4RVBA 3NT0A 3OX8A 2DJUA 1EXUB 2FBJL 3JT2A 4UNTA 1QR1A 4U31A 1U42A 2GVYA 2P8PB 1CG9B 4ZAKB 1CXFA 4PV9A 5C0AB 1OK0A 3PDOA 4QAMB 4YEEA 4ZW8A 4I3SL 2P5PA 3AWGA 5E1AA 5FFGA 1XF2B 3HPJA 3QO1B 4WDIA 4MHHG 5FM8A 1E30A 4JM2A 2PYEE 4BH7B 3CFMA 3DO7A 1MAMH 4FXTA 1BGXL 3KM2A 2FUQA 3UYPB 4B9FA 3O2WL 4LFHG 1QNZL 2X3CA 3NYKA 4M29A 4YQXL 5A2BA 1P5UA 2E7DA 1EFXA 3OKKA 2K0RA 3NMEA 4R97B 1PDKB 1PD6A 4E5XB 4NM4H 2FJSA 2I24N 2WVVB 4UDTB 4WENB 3J2PA 4ZS7H 1BJMA 1MCOH 4PJAE 5CIPA 1SDAB 2O5ZH 1KXVC 4UQCA 4G9FB 3L4VA 1QI3A 5JPNC 4PJBB 2FL5B 3Q2VA 4K5OA 3ROLB 2X4RA 5KN5B 1B3JA 4F8LA 1WLHA 2NTSP 3ATDA 4WO4A 3WFBL 5F7HA 3MRDB 3C6SA 5F7LB 2C4FU 4A2HA 2E7LA 4NQXA 5E2VH 4I88A 1HNFA 3EOAB 1IBBA 4X5RA 2VH5H 5SX5K 1BX2A 1NC2B 3DXAA 2X70A 1YEKH 4OJCA 2NZ9D 3I6KB 4MKTA 1S9KC 1BHGA 2DYPB 4WV1C 1HIML 3VGAC 4HK3N 4N3UA 2QPEB 1L9SA 3EFFA 4OKDA 1FZOB 4PJHF 2VRAA 3C8KA 2NW2A 1TQCC 3I50H 2O26U 3U48A 1AHWA 1L3NA 2CBPA 2QADD 2XJLA 4YFLI 4YHOH 3VG0L 2VLJD 2GBAA 4APQD 4GG6B 4HGMA 3LN4A 1EJOL 1IBGH 5A7BA 2WO4A 1U8JB 2ESVB 2EYTA 2C3GA 3TNMB 1AGEB 3U9PH 1LEGA 1A4KB 3PABA 3B7RL 4P5MB 4CVWA 5LAPA 4X7EC 5MI0C 1R6VA 5LNEA 2ZCHL 5EF0A 1FNSH 2Q2LA 3P3RA 5DEFA 1QBBA 3PHQB 4OJYA 4WEEA 3SE9L 3ZE2E 4RAUA 4GUOA 4A6YL 3LEYL 1IZJA 4Z7QF 2B5IC 2GTWB 3SGJA 4NRZA 1BAFL 1A6UH 3FT2A 3N85L 4KH2A 1FN4A 1FAKT 4MNQA 3FH8A 1KG0A 2QVIA 5ERWB 2QBWA 4HUVA 4QRFA 2Z91A 4GH7B 1JD7A 4Y5VC 2CBQA 5F8RC 3RVVC 5HYQB 4TLUA 2CNYA 4N24A 3RYMA 3ARFA 1OCZB 4DGWC 3V4UH 3CVCA 5D7JA 1FFQA 3BQVA 1WH0A 3HUJA 3LX9A 4OAWA 3KXFB 1GZQA 4JJ5A 4WI0A 4Q8BA 2JCCA 4KK9D 5GSVA 4CL7A 3QI9C 3O3EB 1GJUA 1T7YA 3DHMA 5IJBC 1TZHB 1SF3A 1KPUB 1DBML 2XRAH 4M4RB 3T71A 4HPYL 4ZAKD 5C0AD 3DYMA 1RJYB 1JAEA 1USQA 3F84A 2DI9A 2CIIA 3CZGA 1AOZA 1NUNB 3B2MA 1DQML 4XO5A 3JV4A 5FUZL 2H32H 3ZHLA 4BSVB 4WCYL 3GINA 4M1DL 3VXTB 3GSRA 4OM0L 3V52H 3M1BA 2ATKA 4Y9BA 2GG1A 3VUAA 3K8LA 4LSVH 2MHAA 3O2DH 1V55B 1YY8B 2IC2A 4FLHA 1RUKL 4DVRL 4WSKA 2IADB 2EDJA 5D4IA 4ZI8A 3RWDA 3UAEA 3PV6A 1SHXA 3L4UA 4FJZA 1LL1A 2CR6A 3FL7A 4AG4L 5KBKA 3MJ6A 1XB8A 4G9FD 1NMCC 3QQDB 3D0VB 3G6AB 3WSQH 3MLZL 1I7RB 3HTLX 4NN6C 4QR7A 2HJKB 2VDNB 4H88H 2QQKL 3HE7D 1TZAA 5HI4D 3T8MA 4P9HH 1LO3L 4Z8FH 4PRAB 4JG1L 4DFIA 3GDCA 3T4YA 4L9LB 6FABL 3EYVA 1BZ9A 3ZE1B 5BMFL 4HUKB 3QEQD 5CGMA 2DYPD 1OK8A 4MCMA 2NR6D 5D6DA 1AGDA 4BRJA 2ATPA 1NINA 4AEFA 1BXXA 2ITCB 2XPZA 4N5UA 5TJWK 5C0IA 5I1KH 3DJTA 4LASH 2CO7B 3SQBA 4OZ4B 1UM6L 3U2SB 3TFKD 5MEPA 4PJHE 2YLKA 3LRSA 4G11A 1YG9A 3V4PL 2YMXL 4AVJA 1SJEA 3QFGA 1BZDA 4HIXL 3VI3F 4YDJA 3WKNA 2W5PA 4GXUM 3ZO9A 1MCHA 5IWLC 4N26A 5HBBA 4UOW0 1FNEA 2A38A 1NGWB 2H32A 3CZLA 4HMCA 5IQOA 2ZOUA 1HSAA 3M88A 1H9DA 5T1KB 5EB9A 3PHOA 3T65B 3PUCA 1A6WL 3D30A 3QCTL 5EU7C 4U1SA 1GTNA 1RMFL 3APCA 3WNIA 3IDNA 1AGCB 3O2DA 5C2BL 2ADIA 3IDXH 3C6LA 3QO0A 3SPGA 1H6FA 3UZEA 5HDQL 5D6CA 1K4DB 4HQQL 4R3SB 5D1XC 43CAB 5IFAL 3GMLA 1DBJL 5DRNA 4K9EL 1ND0B 2YA2A 3AROA 5AOZA 3MLYH 1OHQA 1WUZA 3FQ1A 2P45B 3FW6A 2VQ1A 1T1YA 1UD3A 2IPTH 4AENB 3JVFC 1UOWA 5FYLD 1G1YA 1OQOA 2G2RB 4Z7QE 3DIDA 2QTVA 5IJKA 3HZKA 5AB2A 4NP4L 4NNYB 3AS3A 1AE6L 4DKFL 3UG5A 4Z7OB 1F4WL 4S1DD 1NQBA 4OFYD 1IRAY 2AQPA 3FTVA 5KYYA 4M5ZL 3DPBB 2DEYX 1UH2A 3KXFD 4PJEA 1T7VA 2F54B 3OMNB 4J1UA 5AOIA 3QPXL 2V4LA 4K3EL 1G7MB 4N2MA 5MEOB 2O6CA 2VXTL 3B9KB 7FABH 2V2TB 4C4KT 5CCJA 3KPSD 3KYKL 2IALB 5INDB 4WIQA 4N6RB 3ARUA 4PVLA 3SCMA 5GZND 1DYZA 5CINL 4LARH 2FLBT 2E6PA 3C8HA 1I3UA 5DD0H 4W68A 5ICUA 1DTUA 1WFUA 2VXUH 3CVIL 1T89A 4FFWD 4NO3B 4MQTB 3BE1L 2AZUA 1MW2A 4E36A 1XF4B 2EKSA 4ICWA 4LK4A 5CILH 4APXB 1LTXA 3LQAH 3AAZA 1SEQL 3AACA 3D3VA 1QLRB 2I32A 2QLVB 4UV4L 4M3HA 4XN1A 1GGYA 3PL6D 4JHBA 3DMMC 3FO9B 4PJ6A 2X0UA 1CGWA 4JB9H 4H5SB 4YXLL 5ECGA 5I8KL 4LPYA 4N22A 1I4FA 3ZDYF 2XPGB 4XPGH 1NAKH 3RWIA 4I1PA 4U33A 1U2HA 5AW3B 3W9DA 3BISA 2WXIA 4XN4A 3E8UH 4DZ8B 5I2IB 2OP4H 4XO8A 4MA3A 3BT2H 2FSDA 1QFOA 2BC4A 3QUXA 2I07A 1UXLA 4ANUA 2AMUA 2FH8A 3WKPA 2AANA 1MFNA 1DVXA 5FKPB 2EIBA 4R5VA 2VL5B 3IBOA 1R3LB 3QNXA 5E8NB 1UM4L 2PP9A 1SBBA 4DUWA 4RMTA 4M6OL 3WJJA 5AAPA 3ZTDC 4NJAH 3G08A 4WFHE 1MQKH 5DJXB 3HS0A 4JANB 3KPOA 4KGJA 5I0XA 1NCBH 3V5DA 1A7PH 4KKBD 1EUTA 4PJGF 2F8IA 5EWIL 5GRZA 1MIML 3JWNE 4IRZL 5FDWA 3GSQA 3EBAA 3M45A 4PMEA 2JE8A 2WSKA 4OUUB 3VI3E 4BXSV 1JZ8A 3FTGB 4NP9A 2KPWA 3EYFB 4EZLA 5T1KD 1CQKA 1UJ3A 4OCSL 2P7TA 3RNKB 3T1FA 2FBJH 4CU7A 2OZ4L 1N8ZA 4QHKJ 5DT1L 5DQJA 1O6VA 3V9EA 1G9HA 3LPPA 5DJYA 3L1GA 4YFEA 3MVSA 3PGFL 1ROCA 3D69B 3H9SA 1WWBX 3UPRB 3GYRA 2DEWX 1S9WB 1XAUA 2FECL 2WQUA 4DSYA 1NBYA 3NSXA 3NJHA 4ANVA 3QWOB 1AZNA 4YDMA 2NOYA 4Y9EA 3UAJD 1YJDL 4N87A 3H2PA 4EZKA 5CKGA 5J12B 1BGXH 1WICA 3QIWC 1PG7W 3O2WH 4U1HB 2CZNA 4FKKA 5JOPD 1QNZH 1PCSA 5HYJE 5EEZA 3EG9B 4NQDD 4AK1A 5G4OA 5F44A 1E4HA 2ZUQB 3KLAB 5CM1A 4UM8A 5TK4A 4FQQB 4HBQA 4BFGA 5EBWB 1FZMB 3ESNA 2F54D 4QTHA 1ES0A 3KPLA 3RFRA 1AGFA 5BVJB 5D7LA 1HAUA 1OWWA 1YN7B 1TJIH 4B7LA 1CLZH 3B9KD 4P5KA 5E9DA 1JNNH 1YDPA 4P5RA 3S3JA 3UH8A 4B9YA 4QTFA 2H1LM 3UPCA 4NUPA 5D1QE 3WUWA 3QDJD 1SXSA 4S1RL 3VX1A 2QMJA 3WFBH 5GGSA 5C9JB 1YAZA 2HLEB 1TLMA 3IVKB 5CNHA 2G0LA 1I9RH 2FO4B 5SX4H 2CGRL 5EORL 5CR1A 1FG2B 4FTDA 4XWGH 1QZ1A 5J6GB 4OGYL 1WUNT 1IGTA 2JI1A 5JW5A 4JPSA 2IANE 3MCG1 3L4CA 4ZMOA 4M8RA 3ARBA 1HIMH 3MRQA 3NZ8B 4DW2L 1EGJH 2WCGA 4UQ2A 3UTQB 3D34A 4JM4L 4YDNA 3EBGA 5IIEA 1YPZB 4A2DA 1RP8A 1IGYB 4KVNL 5IMOA 1XH1A 4Y1AA 1RJLB 3VG0H 3WUZA 3DURA 3NPSB 4JPQA 5CBEB 3SE8L 2RQ8A 1I8AA 1TVBA 2Q8BL 1P6WA 3ZDYE 5KJ7E 4Y16A 4BE6A 3QHZH 2O4EA 4TNWK 1BSIA 1YC8A 4BK8A 1F5WA 3C60A 3NSYA 4DP0X 3UEZA 2OR7A 1Y6NR 2IAMB 4LMQI 1BFOB 4JG9A 3UXFA 3QEHA 2G4EA 4QRAA 3RWJA 4LF3A 1I1AC 2PTTA 2AXFB 4G6MH 3MREB 3VGEA 3RIAF 4RFNC 3LEYH 4A6YH 4LNRB 2HZHA 4ACPA 2J88L 4PJ8D 5SX4I 4N0YL 4CVXB 5I0ZA 4NERA 2LU3A 4QT5A 1ZY9A 5I0WA 4H8WC 3MX0A 2EDDA 2XN1A 2YS4A 4J27A 4PRPB 4Q56A 1N10A 1TDQA 4WTXA 5HHMD 5EUKA 5T33H 2JB6A 1JPSL 1RIHL 4AOFA 2VTFA 4PJGE 1HNYA 2JKXA 3H9HA 3T77B 1JF1B 4ISVA 4PGBA 3GPEA 3W3BA 3FT3B 4U1GB 5AYUL 1NFDF 2H3NA 5J8OA 3LS4L 4AM0B 2C7UA 5E6ZA 4IU2A 2AHIA 1XGRB 5HGHB 1NUDA 1FNHA 3P0VL 3RUGA 4RX4D 2P43B 4HPYH 2MQCA 4PRIE 4D8OA 3SPJA 5BW7C 5L2KA 2CO3A 2HLFC 3U30C 2VCOA 4NZRL 1T1XA 1X5KA 3G5ZB 4U1MB 3A67H 1DQMH 3GFUA 4IK7A 4NHUA 4UB0H 2ZTBA 3OMAB 4WCYH 3QJFA 4M1DH 1ZPLA 4GRMA 4OM0H 3ZYIA 4U1JA 4U1KB 4TOYL 2O5NA 3E8VA 4GKZB 4K3DL 3JSSA 1E2ZA 2ZUUA 4P04A 3MUGA 4H8WH 4DVRH 5C0CD 1IBYA 2NNXA 2I27N 2BSRA 5D2NA 4CUCA 1QHPA 4QXTB 1I8KA 1NGXB 3AY4C 3TPUB 2E75C 3U2JA 3NSDA 3ARRA 4A6YA 4MAYA 4Z3TA 4Q52A 3AXIA 3MLZH 1ZS8A 5T1LA 3R19A 2CIKA 2QQKH 4Z7UF 2Q9OA 1QAWA 1ZDQA 1P7BA 2J71A 1LO3H 1XL6A 2XN0A 1LM8V 5DS1A 1X7TA 4JG1H 4YXKL 1HJBC 3MU3A 4J3TA 3X13A 2CDFA 1AKJA 4K7PY 3BP6A 5K93A 5BMFH 2V8LA 4M7LT 4NKOB 2UUDH 3AMLA 5EUOA 2XX0A 4AQAA 3VO0A 2XYCA 3WJLA 2CLVA 2Y5TB 5BPPA 1JNHA 1UM6H 4PGCB 4TSBH 5E94A 5C0BA 5LQBH 4WO4B 1U8QB 5DRWB 4IBLT 3V4PH 2YMXH 4CILA 1U92B 5LBVA 5F70A 2OR8A 3QJVB 2BIHA 5CJ5A 2HUEA 2E4TA 4J8RA 3D06A 4QCIB 1GW6A 5JHDE 1L9NA 4XP9L 4U3HA 2XPYA 2OXHA 4FFTA 1QATA 4MMXA 2X87A 1M6OB 3WELA 1A6WH 4A37A 1F3JA 3QCTH 2GSIA 1RMFH 1A7NH 3CH1B 2OMUB 4NB7A 2NW2B 1MKFA 2IAMD 5DHXB 5DZVA 1KCUH 5EN2A 4NYLB 3IXAB 5EU6D 4JY5H 2FE0A 2KMWA 2OA9A 3EO0A 1IC5L 1AHWB 4HQQH 5HDQH 1E2WA 7PAZA 5IFAH 1DVFC 1DBJH 1B0RA 3BP5A 1EDQA 4K9EH 2E27L 2BY3A 2LQRA 4H0GA 4EN3B 2FB4L 2IH1B 3ES6B 3KPMA 4ZO8A 2ZG1A 3ILQD 5D7KD 5D7IF 4WWKD 2OCJA 2NY2C 2KQNA 4KFMA 3NCXA 3UMTA 4PRPD 1X9RA 5CP7A 5T3XE 1A4CA 5FOJA 3ZHDA 4BWUA 3CXFA 4NP4H 4NAJA 2DLFL 2GJJA 1WYJA 1XEDA 5HDRA 5KYWA 5ILTL 1F4WH 4YXHH 4AZUA 2ZWZA 5IMMA 3LZOA 5BXFB 4M5ZH 5IFJB 3OF6D 2WWMD 3M7FB 1LO2H 3JXAA 3FH5A 4H25A 3QPXH 3NIDF 4QY8B 1RZJL 2F8VA 1FL5A 1XTLA 4O51A 2ERJB 3QJQB 1NFDE 4D0DA 1ZT4A 4LOFA 4ZYKA 2DWEB 1CD9B 3QNYA 1I7UA 2Q3XA 1BVNP 2XQYA 3FFCE 5CINH 1ZXQA 5KOVC 1R34A 3KYAA 4C4KO 1T5WA 4WW2A 2OPCA 3V4PA 3JZYA 1XGPB 1YUKB 1KBVA 1W72L 2R29L 5AW6B 3SEPA 5ID1A 2AABL 2N7AA 3CVIH 5HGGS 2BWIA 2DJSA 1CE6A 1YSOA 4UIMA 4WGWB 5JLZA 4R0LC 1FFTB 3WFZA 2YEQA 4AT6A 4ZZFA 1SEQH 4UV4H 4HJ1A 4EEEA 1MNUL 1IKOP 5DMIL 4GIOA 4KHTH 2ZCKL 5EOTA 3CN1A 1GGCL 4XCEA 5C0ND 3VFPA 1UB5B 4RFOL 3ULVD 3ARTA 4YXLH 2XWJA 3OKOA 5I8KH 4FXGA 3FBQA 1R3IL 4PSPA 4KXDA 4EDWH 1U91A 3RVTC 3STLB 3KZ8A 1VCAA 4GUPA 3GF8A 1D7CA 1RZIA 3BDBA 4Z3FA 4QRRE 1PY4A 3HC3L 1W0WA 3NABL 2XTJE 4POYA 3A6CH 5CGTA 4GIPD 3K6SB 4QTIL 2ZUSA 1N64L 4Z7UE 15C8H 3UBXI 2D8KA 5HDOA 1UM4H 2NY6D 2BINA 2XWTA 4M6OH 4NKDA 3VD2A 1G4RA 1X7SA 1XH0A 4R26L 4RNRA 3V0VB 3NBNA 2XWDA 4XXCA 4M61A 4TM9A 4YPGA 1QSEB 3MXVH 4DERA 2MKLC 3EAKA 1YY9C 4MJ5A 3MGAA 3UBXA 4KK6D 4K5NA 2XX1A 4J3OH 3DTXA 5JO5A 1HH6A 2XQBL 4YDIL 4HALA 4GQRA 1MIMH 2KQMA 4IRZH 2YUVA 3C5ZA 2VXQL 3LPWA 4HMEA 5F7DA 4E9XA 1CBVH 3T4YB 4RQQA 1EEZA 4HIEA 2EE6A 3GGWB 3LZQA 4FXKC 3SB3A 2BO0A 1KLUA 1UD4A 4HJGB 4GOSA 1Z5LA 4FA6A 2WCPA 4OCSH 5I1EL 3Q13A 2NY4C 3AXLB 4JPIB 5DD6B 5DQ9B 2MH4A 4KROD 1DJWA 1M7DA 4K07A 2OZ4H 5DT1H 4LPCA 5AD0A 3RFZA 1PYWA 3WTWA 4S1QL 1VIWA 4XMXA 4HJSA 2K8QA 2WIIB 4RH4A 1R3KB 1XGUB 3PGFH 4G6AC 3MLTA 4YIQA 3HNTL 4XXWC 4ZO6A 1G4MA 4O02B 4LCCC 1GRWA 1EHAA 3D4ZA 3Q8FA 4H2CA 1XQ4A 2X10A 3FSZA 2J56A 3LQMA 3WOVA 1T04A 5ALBH 2WKOF 1DLHA 1SRDA 1YJDH 3FQTB 1I7TA 4PN6A 2NY1B 3QDAA 5D7IE 2J8OA 1F4AA 4J6RH 4XB7A 3TOPA 4AGPA 3CFCL 3MCYA 5I71C 1ORSB 2DV6A 1IJ9A 3IDNB 4WU5A 3I3BA 4BK4A 4JO4L 4JPKL 4Z9KB 4RMQA 1JZ6A 3HPLB 1T0MB 1OGAA 5KSAD 5D96C 2VQ1B 3CXHJ 3KDMA 1WCBA 4KUCF 1M1SA 1O0VA 5C3TA 3QEGL 1GOHA 3W38A 3DIFB 2EXYC 3NIDE 4GBXC 4ELMB 3UO1L 4P49A 2G9HA 4CMHC 1ZJAA 3VMOA 3TURA 1CGXA 1ZA6B 1ZV5A 4G8GB 3MKGA 3NESA 2Q6WB 5EORH 5HI5C 2VDLB 4IRZA 2DQFB 2L04A 5KVFE 3V4VB 1ZHBA 1WZLA 3MYJA 5B3SB 1WC7A 4HWNA 1KBKA 2EVGA 4ZMNA 3JV5A 4N2DA 1DVZA 4GRWF 1DLFL 3JVGC 4Y4KB 5A6MA 4HBCL 4DW2H 1VGKB 3KPPA 1D9KA 2BRQA 2OMYA 1AZUA 1XCTB 3S3DB 2J5LB 2YK1H 1KXTB 1Z9MA 1DEEA 4F20A 2FYVA 2WNKA 3BZ5A 4JM4H 4QRPE 3KLDA 2OZ4A 4EZJA 1KIQA 3V6FA 2A73B 3G5XB 2BSSA 4MYPA 2HPOA 1L7TL 5GGRB 1EVUA 3BLBA 4KVNH 3DDFA 2YQ2A 4EKJA 5J1SC 2WUBH 2WBJD 2WXHA 1S3KL 5G55A 4PLKC 5IQ7L 5HHOA 4EVNA 3VM7A 2PWGA 4NQSB 5HSFA 1ZPUA 3QRBA 3ZBMA 4GO9A 4ZX4A 3CCHA 1M71A 2CGYA 1FE8L 2IV9A 3II3A 3OZKA 3GIVB 2BSDA 4KQ3L 3I3EA 3BAYA 5EIIA 3VFVB 3V0JA 2WLLB 3FU5A 4IM8A 3Q8BA 4L4TD 2VUYA 1QSED 3F64A 3F7QA 4P3WA 2J88H 4N0YH 1Q0EA 3ETBJ 3W9DB 3K6OA 3LB6D 4YFDB 8FABB 3QUMB 2AXJA 4LVOB 2EUXA 4G1EB 5TDOB 5DZNA 3U6RA 1A64A 1DQTA 1N19A 2F6AA 4YHNB 1UCBH 1ORQB 3HC0A 4DK5A 1JPSH 1RIHH 4LEOB 3STZB 5CKAA 3ML9A 4YSPA 3MRRA 4OBSA 1BMZA 3L9RA 3SKOB 3ESPA 4F58L 5GZOA 3LKSB 3C9NB 2PO6A 1L7IL 2YAPA 4HWBL 4YC2C 3G08B 1H8OA 3IDYB 5AYUH 4JG5A 1UA3A 3TH3T 4FLOA 5I1AB 4NO0B 3LS4H 3IKCA 4MA1B 4U1LA 1MCSA 3PGCB 4POZD 1ZVSA 2AKRB 1O7DE 1ASPA 1NCUA 3P0VH 5HI3C 2OJEB 2PYEA 3U25A 3WKQA 1TZGH 1B6UA 3L4YA 4NZRH 1KPVA 4ERSL 1UG9A 2BVQA 5I24A 5FKAB 5HGBB 1I9IH 3RA7L 3E2HC 3WDJA 2C9XA 2HRPL 1WBYA 2NY1D 3X12B 5DD1H 4G6FB 2P7TB 4PRBB 2GJ6E 3LZRA 1JV2B 4PJAA 2VW7A 5JXED 3ALWA 3G9AB 2CNZA 4OZHA 5C0JA 1INQB 5KSUA 4M5TA 4OZGF 3ZDXF 3ZIYA 4K3DH 2BVOA 2CDEB 4L8CB 3F3HA 5D7SL 3VFNA 1R5IA 3ZKNC 2DL9A 5SWSE 2UY7B 1KIUB 2MOVA 2B0SL 3ZRCC 1PS3A 1T66C 3CN0A 3EADA 5DC0A 4JFFE 2W07A 3ELQA 3KR3L 1MUJA 1M05A 4MAUL 1J8HE 4XN7A 1MI5D 1F1AA 3V0EA 1J5CA 1M3IA 5EFIB 3D33A 1JYVA 1KJ2H 1Y6MR 4F2FA 5KEZA 3BJLA 2ADGA 2HG5B 4Y4KD 3I6GB 2XBTA 4U0QB 4AK2A 5DO2D 4XMWA 5BZZA 1G7PA 1YDPB 2WNWA 3O3UN 2NNAB 3L3GA 4GRWE 1QLFB 4PIRF 4R7DB 5DRZA 2E56A 1SMOA 4AI7A 5H4ZA 3GS4A 3VWKD 3DV4B 4X8JB 1T21B 4UQ9A 2AEQL 4L8SA 1WFNA 3WS6A 5KS9F 2JI2A 3QXDA 2F5AL 3MRHB 1N0XL 1HWWA 3WUWG 3OXRB 1G7JB 3IMTA 5EPMA 2YFNA 1JG9A 2LLNA 4I2XE 2QMKA 2ZYRA 1LE9A 2YO3A 4Z18A 2R0LL 3L13A 4B6ZA 3IGAB 3N44F 3H9ZA 1WS8A 3NRPA 3PWUA 4CKVX 3HZ3A 3QWRA 3TJHC 2ZSVA 3D8MA 3QDGB 5IIEB 4JAMA 3PJSA 4WFEE 3QE5A 1TENA 2GKIA 2P5WA 2XKSA 3FMGL 1IC5H 3GIZL 2IOIA 1COBA 1TG8A 3RIFK 3OZ9L 4B97A 3QA3B 1S9XB 2FB4H 4JGJA 3Q3GB 1J9SA 4CSSA 1SLVA 3NA4A 4YE0A 5E5UB 4Y16B 1WFMA 4W9KC 5EO9A 3VWJC 3IJ7A 1ZJBA 1WIPA 3FS9A 5AUMA 1UOVA 4C56D 2DLFH 3IMBA 4U6VH 4LCWE 3PU7A 2YPVH 5ILTH 2EDTA 5I9QB 4LLMA 2XV2A 1HSBA 1PF3A 3RWJB 1FVEA 5DFTA 5I1CH 4NO0D 5C0FA 3MBEA 4GSDL 4U3CA 1RZJH 2EXWC 4GSRA 5CN2A 1MWOA 2LLLA 2WXFA 4AV4A 3DUUB 4OD1H 4OLZH 4JN1L 2ARJA 3BVNA 3U0PB 5DK0A 1AR1C 4G43A 4FEMA 3ZL1A 4ZXBA 3BPLC 3HNSL 4P2OC 2NXZB 1YEEH 2I9TA 3X2QB 3I9IA 4AEHH 4M02A 5T1JA 4OB5L 3TO4C 2R29H 3F5WA 1W72H 4DAGL 3LPOA 2JJTC 1OHZA 2AABH 3AUVA 1L0XA 3FQXB 3NK4A 4XHJD 5GRYA 1BEXA 3ML8A 3B1UA 1H6EA 4G6FD 5IFHL 5B7EA 1DVTA 1ADWA 1S7QA 3K6FA 1USZA 2G75B 5DMIH 5FM4A 1Q9WA 2F53E 1EZLA 3QWQB 4K55A 2NY5L 2R1WA 2ZCKH 4XVUC 1GGCH 2R1YA 3DC0A 2A6KB 4EDXA 4RFOH 4MMZA 4OZGE 3ZDXE 4NZTH 1DN2A 3LAFA 1DDTA 1R3IH 1H8NA 3GJFB 3BW9B 3UTSB 1AXTH 5CCKL 1O6TA 3BGFC 4BFJA 4XX1G 4Q4IA 3DROA 1S7UA 3HC3H 4OLYL 3OJDB 4XBGA 1INEL 3NABH 3DO3A 5FK9B 3STBA 2QGBA 3NJVA 4C47A 4GRLA 5DVPA 4P46B 1N64H 1XWVA 3O8XD 3PXLA 3O0RL 3RZCB 3T0VA 4FAAB 4Z6AT 1VZGA 3P73B 3SDAC 4PJ7B 1I8KB 5DEZA 4JFXA 2R8SL 4M4PA 2XXCB 3L4XA 5KBDA 3L45A 2Q8AL 4ONGL 1NFAA 5JORA 3QJTB 4P57B 1IE4A 5T1LB 3H56A 2FEJA 2AQNA 3ATAA 3BHBB 2Z31B 2VABB 3FQUA 3IJSA 4WRLA 3ZTJG 1K8DA 1Z2KA 3CGTA 3FB8A 4ZUSA 4KKLC 1U3HC 1BPVA 2JWYA 2XQBH 4N2EA 1O7SA 3JWNC 4FFVD 5EZOH 2IXQB 5IR1A 1S6NA 1E8WA 2R29A 3GRBA 1W72A 3HZVB 4Y4HA 3F7YB 4LU5H 4J3SA 2HVBA 4OKVB 2JF1A 3B83A 2X12A 3VDCA 1X7QB 1Z7JA 5I1EH 2APSA 3QUZA 5CD5C 4U6XA 2HN7A 4YR6A 4XC1L 2WOBA 3QDGD 2YAOA 4NFDA 1EEQA 1U3NA 2CPUA 1MHHB 4NKQB 5FW8A 4KKPA 2WLYA 4GXVL 4ZFOL 4Z5RA 4XPBL 2BW4A 1BECA 1ILUA 4K7PX 2P5EE 3HFMH 3W57A 1D6VL 3LKQB 4GKSA 4PVMA 1N2RB 1CFVL 3CQFA 3CHXA 5AW4B 2P3YA 1ADQL 1CU4L 4BV1A 3U4BL 3N42F 3CFCH 2CGZA 1PEWA 2ORBL 4HUWA 4HEMA 2X38A 4G83A 5IHUL 1JSYA 3VRIA 5CSZA 3NAAH 1ACCA 4JPKH 4JO4H 4D0CA 2QLYA 1DE4A 4Z78A 3DBXA 2NRDA 2XTLA 1BZQK 1GC1C 1IBHA 1U8CB 3GLDA 3KWWA 3B2DC 2PCFA 3JWNH 4H0IA 3BH9B 2VAAA 3UOAB 1IC7L 1PG7X 1EBAA 3QEGH 5DI8A 4MDIB 3UO1H 4GKNB 1QWNA 5BOJA 4L05A 1S7TB 3MRPB 4RGOL 5ESAA 4QOKB 3LVEA 1FFPA 2NMSA 3X3FH 5IKCB 1CFNB 1YC7A 3B9VA 1QVOA 4LRIA 4NUJB 2BFVL 2E9WA 3RWEB 4HKZB 1IO4C 2JKRM 5I1JL 2BCKA 2VXQA 5DZOA 5CEZE 2C9AA 1WBZB 4PRHD 1UACH 3TZVA 3MGTB 2CG9X 6PCYA 3AU1B 1S2EA 1DLFH 3L8QA 4XP4L 4JN2B 5CEXB 4MNGE 1WPCA 5DD5L 1WBXB 5D9SA 1QYGL 3BKCL 3KPRA 4J39A 1KIPA 5T5NG 4ADIA 1L7TH 2AQ3A 4G5AA 3WN5A 3IXTA 4U1NB 4OJAA 3UTSD 2XQYG 1PU0A 3KGRA 1S3KH 3HZYB 4YUEL 2GTZA 1K2DA 1B4TA 1S5HA 4EE2A 3RX5A 4N86A 4PRNB 5TGBB 3WD5L 2O93L 1RHHB 3X1EA 1FE8H 3EZJB 1BZ7B 5M7QA 2A6DA 3Q1SL 2NZ9C 2R69L 5J1AA 2A83B 4KQ3H 4K5PA 4L8BA 2OYPA 4ODWA 4PRDB 3QQ4B 1HH9A 4ZBJA 3RKDD 2XWJB 1M2VA 4KKNA 4MQ7A 4PGJA 2C3VA 3CPLA 1HI6B 2EH8L 4IKKA 4Z7VF 5IMLB 3GO1H 4NN5C 1KV3A 1N0LB 3WMQA 4FA7B 5I73B 5MHSD 4XO3A 3NJNA 1OPOA 4FQXA 5H8DA 2Z31D 3DWTA 4XNUL 1W0WB 2IOOA 1OARL 3GBNL 3Q6GL 5EU4A 5IBTL 3VI3A 2V5YA 2J8UB 4APQC 2DYRB 3EGSB 1CDIA 5B39A 2OBGA 2ZX6A 1DQVA 3BFOA 4W9FC 4XMPL 2NNFA 2PWEA 4QF1A 5JW4N 3FB6A 2Z8SA 4AXWB 4F58H 4OTXL 1KYAA 3T6VA 1XBDA 3HI1A 3GMRA 4C4BA 2KH2B 2OK0H 4BZ1L 5JNYB 2Z7UA 2FJFB 3FU7B 4PAZA 4ZNEE 3U0TA 4F8NA 3G6JE 1JWUB 3MYZA 5GS1A 2F74B 3N2JA 5C07A 2C3WA 1GYWA 2R2EA 3U6XS 1LVEA 3T2OA 1X9UA 3K80A 4D8PA 3TIEB 1R5VA 1LQSR 3UBXG 1OTTD 4ERSH 3ZHKA 4QWWD 3UBHA 1KTJA 5KBMA 4Q89A 3WV0A 4WI2A 3RA7H 1YNTA 1XGQA 1IQDA 3TO2B 1JF6A 4MB4A 3N3EA 4XBMA 5TF0A 1NJ9B 2MIZA 1QLEB 4PP2A 4X5WA 1PYWB 4ALAC 2X4QB 4KK9C 1CC3A 5LAXA 1UVQA 1X4ZA 3QPQD 4PJXB 4KTEL 2K78A 3R06B 4KVPA 5J11C 1KGCE 1FV1B 1G0YR 1NGYA 2C9PA 3AJ7A 3GRWL 4JFOA 5D1QA 4AEEA 4K2UL 2R59A 2B0SH 2GUYA 3DYPA 1MCDA 2WLJA 1JPTL 4ZPVB 4NQEA 1I7TB 4HCIA 3KVQA 5KVDE 4XP1L 3PDGA 4F15C 5GS0D 2BVYA 3KR3H 1NFIA 1FYHB 4G5ZH 4LOEA 2H6PB 2HP4A 4MAUH 4QOKD 4TUUA 2I5YL 2YUWA 4QRUA 2ZJSL 3H3BC 2IANA 3LDBC 3SY0A 4I89A 1XSKA 4F8PA 1XF5A 3V5HA 1YAIA 4YX2L 3V5KA 4G8EA 1WFOA 2OX5A 3T0AA 3O6FA 2VN6A 2GIYA 2YGPA 5FR3A 2BOLA 4HWBA 5L2JA 4U7SA 4W9IC 5IB2A 3VDBA 3CHPA 1WZMA 2L7QA 4B3VA 5ETUA 3MLXH 4ZSOE 4M3KB 2VLRB 1JGIA 1P5VA 3FUKA 4LVNC 5BZXA 4DFHA 3Q05A 1XB3A 5JZ7C 1GJIA 3ECBB 3FN0L 4XCNB 5I74B 1BAWA 2F5AH 1B9KA 1N0XH 2XHNA 4HH9A 1ZHBB 3HE7C 5HI4C 3V9FA 4B96A 2KPNA 2KLSA 2P1YA 4JY4B 4ZUWA 4W9ZA 4AJYV 3SZKC 5HPOA 3TBYA 5DHVB 2R0LH 4CSZA 2W65A 2ZP8A 3DJSA 1QRNB 3FSAA 4LXFA 3AT8A 1JS4A 1MF2L 2GFBA 4JM0A 4Y5YC 2IQAA 4UZUA 2V2WB 3A47A 1Q0YL 4K5MA 2X4TA 4M48L 4TNVK 3FMGH 4CADB 5EC2B 1MDAA 4PJ9C 4PWGA 2V5RA 5B4MC 3OZ9H 1CDCA 1M9WA 1WIOA 7CGTA 3WFHA 4DGIL 4AMKL 4Z7VE 2ODIA 3QXAA 4PJGA 1D5MB 3GM0A 4U49A 1IC0A 3EIFA 1XZWA 3EYQD 1ZTXE 2ZSWA 4GIAA 1B2WL 4ODXA 3INUL 2OSXA 3WIAA 3TXAA 4K7PL 1JYXA 2EECA 2BRRL 2OULB 1IFHL 1TPXB 3QORB 3HMXL 4UM9A 5AEAA 3MROB 4XTRD 5FECB 4N0UE 4PRIA 2C9QA 2HTLD 1T0OA 4GSDH 4LLYB 1V10A 4JPVL 1PVHA 1OAYH 5F97E 4JN1H 5HDBB 3EBIA 5E8OA 1ZLWH 3W1ZA 4IJ3C 1ZANL 4G6KL 2R23B 3CFQA 3HNSH 5HVGB 2X1XR 2ZWSA 5AW1B 1MFEL 4BWTA 4WEUD 4BKLB 4YDLB 1EANA 4OB5H 4OQTL 3LKRB 4DAGH 5I66A 1C08B 3QK0A 4WKZA 4GAJL 1PG7L 3TN0B 3OKEB 2EDQA 4W9LC 3UC0L 1MQ8A 3DRQA 4HISA 2DOCA 5C0DA 4ZTOL 4NM8L 3MRGA 1ZA3A 3H54A 3N06B 3WHXB 5HYFA 1U33A 3FRUA 2ROYA 4QRSB 1V3JA 2NY5H 1BFVL 5F7NC 1RH8A 3EJYD 5TPWL 2FX8L 1C5CL 3FT1A 4P4KB 4UIKL 2Q1EA 2YAQA 5GZNC 3EFOB 1Z1WA 1C7SA 1JK9B 2WQRA 3G04B 5CCKH 3QFJA 4H7VA 3ZYZA 2HVKB 1VEPA 3CFKB 1J1XL 5AKRA 3QG6B 5HHPA 1INEH 5IEHA 2XTJC 4OZHB 4DETA 3DV6A 3S8FB 3HHMA 1YEIL 4KU1A 3FUEA 4J5VA 4ZUUB 3TBWB 3PL6C 4E2OA 1UD2A 1ZT1A 1ASQA 5C71A 1KCVL 4PY7A 2A9CA 2R8SH 5TD4A 5HHVL 2Q8AH 4ONGH 3UCRA 3D4GA 3IK2A 1SLWA 4TNFA 5CN3A 3I75A 3ULUD 2PP7A 2JI3A 5IG7B 3V7AE 5B8CC 3APDA 4G7YH 1FH2A 3EOBA 5F71A 1NCTA 1ZKAA 3LNDA 4H8HA 5LJYH 4Z76B 2OI9C 1K8IB 3DX2A 4N90E 4HCGA 4OZIF 4TNWF 5FUCE 2A77L 4DT2A 5BOZG 3NEOA 1K4CA 3BDYL 1WZ1L 1QRND 3CU7A 4ENED 5F3HB 3RDTA 3P3TA 1SOKA 3UTZA 3U0WL 2BERA 4LAQL 1UXWB 3KLLA 2LFEA 1PX4A 2Y7SA 5DRZB 4G72B 4XC1H 2X4SA 1SVBA 1U8KA 2VZ1A 3OR7A 1GXEA 4BCXA 4EI6B 3WTUA 4RGNE 2EE0A 3HAEB 4GXVH 4Y1SA 2NSXA 5E8EA 4IK6A 4XPBH 4Y9GA 3TIDB 2XETA 1AJ7L 4KKBC 4PU2A 2Q5BA 3MRCA 5I19L 1D6VH 1E3XA 2ZX5A 5F0JB 2J21A 4F7EA 1CFVH 4PMFA 4WFFE 3D39A 3IMUA 5GJSH 1WAAE 4P9ML 4XCYA 1CU4H 1ML0A 2XXGA 3IDIB 3CDZA 4LCYA 2A0LD 2XN9A 3L6FA 3OPZL 1KDIA 2ORBH 3WE6A 4XNZC 4FG6D 1LO0L 1NMBH 1SXAA 3KJ6L 3SE3C 3T8VA 2J73A 1NFDA 1TJGL 1OOWA 3DX8A 1HFUA 3W0WD 2CLRA 3FFCA 1A47A 4LPUA 3TWCL 1SYVB 4HPHA 5ISZE 4CC4C 1BD2E 3FCGA 1KT2B 5EO9B 4J4PC 5K9KB 3A4FA 3ARGC 3FCBA 4JHWL 2VJXA 3IF1B 3T4AC 2MCMA 3QXTA 4FQCL 3K0WA 1KENL 2V33A 4A38A 3QHFH 2EVFA 1OPGH 4YAQB 1SHSA 2UZYA 3QXWA 4H0LC 4JQIL 1FQ9C 3TN0D 4Z7AA 5JPMC 5I76A 2DWXA 2B59B 2ZUTA 3V6ZA 3TH2T 3LHPH 3QQ9C 2VDOL 4X0NA 4I18C 1N6UA 4X98A 4YSTA 3WMPA 5F3BA 2ARJB 1MELA 1WHPA 2VDPB 5DD5H 3PAVA 4JDEA 3L81A 1QYGH 2SEBA 3BKCH 2KLRA 4KAQL 2R15A 2Y6SC 3U83A 5AVVB 3OAUL 3IJHA 4Q14A 3SDCB 4ZFOA 1KBBA 2Y06L 2VQTA 4F2EA 1J86A 2DQTH 3BAKA 1KTCA 5I15L 2L7JA 4YUEH 4JBSA 4B3EA 4KJQD 3VGGA 5TDPA 3WD5H 3S3CB 2VLLA 1S7QB 1ADQA 3P1VA 1UZ8B 2BOBA 2CAKA 3HR5B 2R69H 2IGFL 1KJMA 2Z7ZA 2LV4A 1CS6A 4UTCA 5FX3A 1OCWL 3QQNA 4AVKA 3APMA 3L48A 2VN3A 4P05A 4RWHA 5EO0B 1KTLB 4ANXA 2EH8H 4TN9A 4KRPB 3R4RA 2D7TH 4NRXA 3OAZK 1E9OA 1EJ8A 3KHOA 3O3BB 3EDDA 2P4AB 4NQQA 4XNMA 2Z7YA 4ENZA 5KVFH 2NLJB 1AAJA 3GMQA 5CEZL 4ZFZA 3ZMEA 3TV3L 1S7UB 3QUYA 1HL9A 2UWEE 4HK3J 1OARH 4Q4EA 4K7FB 2WW8A 1BQRA 1VCBC 3RGVA 3R4DA 5FF6A 1U58B 4GI6A 2LGNA 4DTGH 1BIHA 3FTXA 4XMPH 4G7VL 3HE6C 8CGTA 1IARB 2FIKA 2HSIA 3CVHB 1BVZA 3EGXB 4OZIE 4BZ1H 1UEYA 5FYJD 5JORB 4G1MA 5DS8A 3O6MH 2JXMA 2VN4A 4P06A 1H3XA 2DQMA 2H6UA 2VSCA 3PHAA 1AD9A 1Z5YD 1A7OL 3FQWA 1D5RA 3Q2NA 5IMKB 4DKDC 3VFOB 4HJ0D 2VT0A 3IMSA 2GQHA 5E95B 4F2ME 5F3FA 1KNOB 5EC1B 2Y5EA 4MD0A 1BIIA 5D7IA 3QUHA 3UP1A 2ENJA 2EIZB 3O4OC 1H6TA 1HU8A 2D4FA 2BNUA 1UASA 2KDYA 4KO7A 5DS2A 5GRJL 5J6SA 3BCFA 2MFNA 1SM3H 4X0KA 1ZDSA 4PJFE 4I5BB 2R69A 4KTEH 4UV7L 1R3HB 2CO6B 5DVOA 4LSPL 4HGWA 3MV01 3GRWH 2V3DA 1CICC 4Y4FC 2W9DL 1GW0A 2A74A 1A4AA 2KC0A 3L3HB 4K2UH 3SKJH 3N1QC 1JPTH 1RVFL 3MV9B 4CSPA 2CRYA 1L4IA 1QNIA 4XP1H 3SO3C 1TLKA 3VFUA 1DQJA 4I9WD 3S9DB 4GI8A 4CMMA 1QASA 3NJJA 2I5YH 1E5YA 4AJ0A 1N59B 1MAJA 1A1MA 3CFBB 2VLKE 3FSVA 1PZ5B 4HIJB 5KYNA 4YX2H 1HEZA 1SDDB 1JN6A 3DX1A 1IT9L 2RBLA 4Z78B 3RVUD 2DM7A 2UXGA 4Q2ZA 4QRPA 1JZ3A 5T8IA 4MDJA 4GW1A 1MZYA 2A5UA 4BZ1A 1NM9A 4NNXB 5HGAA 1G6RH 2G0KA 5T3ZD 5KJRL 1FL6A 1TFHA 1EPFA 1QEWB 2Z8RA 2I26N 2K7PA 1P9MA 4PGDB 1UD6A 4XNXH 2XICA 4PJBF 2R1XA 1XL4A 4XAKD 2R83A 1DJHA 1UTDA 4JHAL 3QDMB 1DJZA 4AQ1A 1TQBC 3BUYA 4F9LA 3OLEA 3WIIL 2PLTA 5CLXA 3GK8L 4ZDHB 4DPRA 2IDCA 1T1WA 1FYTE 4M48H 1IEAB 3AM8C 3TEZA 5C08A 2NY0C 5F8QC 1AC0A 3L3KA 4X99B 3W82A 3AQDA 2VDRB 2NY3D 1U8OB 3U9UA 4DGIH 3GRWA 4QLWA 4AMKH 2KBGA 4JJHA 3BUDA 4PJDB 1A6ZB 4FMKA 4C83B 5DVMA 4NQCB 4F1ZA 5AAWC 3JTTA 4MBOA 1SOSA 2PPDA 3IJEB 2NW3B 3S98A 3B43A 2Y36H 3SKNB 1B2WH 5EMYA 5I8OL 2KZ1B 3INUH 4TVSa 5B1BB 5J1AB 1IV8A 1PQZB 4KITB 4GG6F 4LIQE 4GRWH 3NZHL 4K7PH 2LABA 4AYID 3ULSA 1S9YB 2BRRH 4G42A 4ZTPL 4MNHB 4MQ7B 1ZLSH 3O4LB 3HMXH 4MVBD 4PGEA 3F62A 5IF0A 1XIWB 1T6WA 1TYEB 1SY6L 2EXTA 4ZX6A 3RI5F 2HFFA 4JPVH 1UXSA 4JS7A 1FGVL 1RK1B 1AZCA 4FJYA 1IAIM 2YC1B 1ZANH 1GYVA 4G6KH 3WNJA 1AZBA 1Z9SB 2DAVA 4I0PC 4CAGA 3B6SB 4WWKC 1MFEH 3BZEB 4P2QE 4OQTH 2WKOA 5GGUA 1D6EA 5TDNA 4GAJH 1PG7H 2WQXA 3X11B 2WB7A 1LDPL 5I6XC 5K59F 3UC0H 4D2NA 4XOBA 5C2UB 5KWYC 4NM8H 4YO0A 4AQEA 2NSMA 2WWMC 1GS8A 1LO5A 3DVGA 3HG1A 5SWSA 1EZUA 3F7VB 4PHZA 4I1NB 4MXVF 4JFFA 4NKMA 5H37G 4ZFGL 2WZPA 1G43A 2X7LB 3FN9A 5HYSA 1ZTXL 4UIKH 5I82A 2GC4C 1J8HA 2XA8L 2OM5A 3MV9D 4EI0A 3K71A 3KYNB 5IBLD 1XDTT 5F7YC 4F7TB 1NLDH 4GAGL 5IROC 2PETA 1YMMA 1BPLB 1J1XH 2LU7A 5B38B 4F7MA 3VXSB 1UQSA 1T83A 4X5PA 5B38G 1QW8A 5HJ3A 2JIXB 1UWEL 3ENEA 1QSZA 3H6AA 4WUUD 1KCVH 2VDQL 4FMVA 4WU7A 3HMXA 4NUQA 1JGEB 2OYMA 4HUCA 5HHVH 3RL2B 3S37X 4J3BA 3MRBB 1HYRC 1Y6KR 2ZG3A 5ANMB 3ZJAA 4HUXA 3RQ3A 4I2XA 1YN6B 2Z92A 4GG8A 1VSCA 3PG2A 5EDXA 3SY0B 3DX6B 2DM2A 3CUPA 1XCQB 2CD0A 5FFLA 4OQTA 4FQIL 3JYCA 1E9QA 1J9TA 2A77H 1DHKA 4IKNA 4U1IA 3BDYH 3JWDC 3QDMD 3RG1C 3UEQA 4PJBE 1WZ1H 4M1CD 3UTOA 3MLPA 3QULA 5KVGE 2NY6C 1UJTA 4WJ5A 3U0WH 4LAQH 1DDHB 3TBVA 3DVNB 3QUKA 5F1NB 1TF4A 3M07A 2OTWB 1KGXA 3ZE1F 1UUNA 2QV2A 3T0EB 1NCIA 3AWEA 5F88A 1CWVA 4KBPA 3EJPA 4BZ2H 1AJ7H 3VXMD 1TETL 3WNNA 3B7UX 5B1CA 4XNDA 5HP5A 4AUYA 4HETA 3T6WA 4YHML 2O61B 1T4KA 3FB7A 1F11A 1FVCB 3MRNA 4NQCD 3WEXA 1HESA 4AQ8A 1SFHA 4N2IA 4P9MH 3QJOA 4KY1H 1IQWL 2NNCA 3TA3A 5JHBA 3NFPA 5ESQA 2X4PB 5EEXA 1LO0H 5LGHL 2ITEA 3KJ6H 3ZQ9A 4MCZA 4AUUA 1U93A 1TJGH 1DBAH 1D7DA 3O4LD 5K33A 4KROC 1GGIL 2C1OA 5IOPB 1XIWD 1MCNA 2ESVE 4RMRA 1G7LA 4RBPK 3TWCH 4DVBA 4RDQG 4IGBD 3V0IA 3LXUX 4NI3A 3QXAB 2MSPA 4N0CD 3C12A 1B4LA 1ODUA 4QRTB 1TYJA 3T3MB 4JHWH 4XMVA 4MA7L 1AIFB 4XOAA 2D31A 3WHE0 4A2FA 3RVWD 4HUNB 4JFPA 1J18A 3L4WA 3L1EA 4LBAA 3QEUA 3FT9A 3CN3A 4HFWB 4JQIH 1U8NA 5L8LB 4PTUB 4BDVB 2E8YA 2X4UA 4NWTL 4WK2B 2VDOH 2OS7A 4MZ3A 2F7QA 4NCC2 4NQUA 3QZWA 2APVA 2X2HA 4OZGA 3DBSA 4EF3A 3D12B 4KI1A 4Z7OF 2EYRA 4UAOC 5K59E 5E8OB 4N0FB 5KSAC 3SN6N 2OTUB 4KAQH 3O2VL 3N04A 4FADA 3O45B 2Q86B 4MXVE 2Y06H 4QHNB 5KG9B 5E1QA 2BVUA 4KXCA 1FCCA 4X50A 2Z3FA 3EDFA 3OM3B 2ZF9A 3H2QA 2F0CA 4D3CL 3VFSB 4JM2D 3MBWB 3VXSD 3FRUB 1MY7A 4KDTA 1D5BB 2VW4A 3FH7A 1BFSA 3MRJB 4GUCA 2JIXD 3AABA 5J57B 4JFEE 1K85A 4Z3GA 1WISA 2E6JA 1IU1A 5DJAA 1KPRA 5HGDB 4KJPC 1E0OB 1JV5A 5IW6B 3BO8B 4P0DA 4NRYA 4E42A 2BIIA 5E6UB 2WZ0A 5CEZH 2WXPA 2O72A 3TV3H 1ZS2A 1I9EA 2WBJC 4FCHA 4L9DA 4Y5XC 5K9JL 5KS9A 3SGDH 1EIBA 4YN3A 2EICA 2WVUA 1GMIA 2VE6B 2XBZA 1MFAL 4UQIM 4G7VH 1RK0B 3BPNC 4YBQC 3SGEH 4F37K 3U36A 5AB0A 4JQIA 1BQSA 3D85B 4O5LL 1D5IL 3QIBA 2AV1B 4QRQA 5E2UL 4PBDA 4WV1B 1HHGB 1MHEA 4G80A 3VGAB 3VCLA 1R0AH 2W94A 5FPIA 3M7OA 4YNYB 4PWIA 2EDBA 5H4YA 2P5EA 2YQBA 2Q20A 3B2VL 4EXKA 1TTFA 1TQCB 3RIFF 4DP1X 1S7XA 3H42L 1TCRA 1IKFL 5GXBB 3VXUD 2CHZA 5FO7B 3D0AA 3LB6C 1ZSHA 3GJEB 2WKLA 2ICEA 3FUJA 1HKFA 2EDMA 1R19A 3AG2B 4FNTA 2WXOA 3ZDWA 1BMGA 5DYOB 1J05B 3BVUA 2WB1A 3SYOA 4AC2A 4D7BA 4KFZC 4Q97A 2J72A 1JDDA 5GRJH 1E65A 1UD8A 2FZ3A 4MSWA 4OGZA 4NQVA 1O7VA 1GJWA 5GRVK 5MI0B 2XDHA 3MOAH 3IPBA 5C09A 5JHLL 4ZJ9A 3IU4H 1QFWH 4QHLB 4UV7H 3IJ8A 4JFDE 4LSPH 3KG5A 4LSDA 2W9DH 2B5IB 4FJ6A 4C54A 3SGEI 1ZLDA 1RVFH 4XPFL 4NS0A 5K69A 2VDML 1K3ZA 4XCYB 2GY5A 5IVXE 4Y5VB 4ONOA 1EO8L 1FO0H 1QSFE 2OLDA 1AG0A 1SBSL 4HIHB 4E41D 2VLMD 3WKYA 4KXZH 1MRCL 3S5YA 3ZT7A 2LE9A 3MJ7B 4MNGA 3L2NA 4IMKA 1IT9H 2DQCL 3L7EA 1DO5A 4WNSA 2NX5A 3MJGX 3QI9B 3VD3A 4OLVL 1KYOK 1NA8A 4NGHL 5D7JD 3TPKA 4AV0A 1E7VA 5IK3B 5JOPE 1XBRA 4KZ0A 5BV7L 2GY7B 4OFDA 3IRCA 2BP0B 4Z7OE 1SJVA 3NTCL 4AY0A 2X41A 5KJRH 1I8MA 2B20A 4MX7A 2DBJA 5IB4B 4OZFH 1CGSL 2F54E 5DK3A 3S37L 2GUOA 1BV8A 2EEFA 2EO9A 1XD1A 4JHAH 4MQXD 4O9HL 4X98B 4HHAA 1E28B 4FABL 3WIIH 2NUPA 4IBWA 4QXWA 3GK8H 2SEBB 4IRJA 1H15A 4M8QB 5IW3A 2YKLL 1LD9A 5KVDH 5AW8B 5JDSB 5JQ6L 1GC1L 1BOGB 3WY2A 2APXA 4KX9A 3VNZA 1UT1A 1ONQA 2AC0A 1PZSA 3VWKC 4KXZI 1NMCB 1W2KT 2VN5A 4NBYB 1R75A 1X3DA 4X6BA 2DQJL 1T20A 2IH3B 4NN6B 3BH8B 3GXMA 4H0HB 1YPZF 2LT9A 1P7QA 1BDYA 3RJOA 1E40A 1MEXL 5I8OH 1FI8C 2NZ1A 4M7JL 4OD2A 4G9DB 3ETTA 5L8KB 4YGVA 3NZHH 4ZNEA 5L0QC 2R7EB 5GJTH 4RGMC 1AGBB 4IRSA 4OCRH 3D85D 2VZ3A 2H9GA 3U2IA 1BYOA 4I77L 2RCSL 1SY6H 3ETBF 2LHAA 4NRXB 4WFHD 4UQEA 5FOBA 3ZE0B 5SWZA 3I6LD 4OU3A 5KTEL 2AV7A 1JZ7A 1FGVH 4L4VB 3CFEA 1EAPA 5EA0L 1S7VB 4WWID 3BZFA 1NSNL 3UTPD 3V6OC 1Z6JT 2QJDA 5IB3A 5TQ0H 3CZFA 5JIMA 1S7SA 2IPUG 2N3JA 1F0LA 2HB0A 5E1HB 1GSKA 3P4OA 1GZPB 2VXVL 4QO1A 3J8F7 1QP1A 1A4JA 3WIFA 4HK0A 4QXVA 3TVMC 2ZYHA 4J6IA 4GMSH 4D7PA 3MMEA 1ZXKA 4X6FA 4OLEA 4PCYA 4ZFGH 3BQUC 5D1XB 2VC2B 1ZTXH 1LE5A 5D71L 3RPBA 2VDKH 2VUKA 2UX6A 4KKQA 2XA8H 4RZCA 4N5EC 2CO4A 4LIQL 1KIRA 4PV8B 2R2BA 4L37B 5HYEA 1JVLA 1QFUL 3V9CA 3BN9D 5INCB 2YN3A 3L1OL 3RVVD 3H3PL 3ECQA 4XHJC 1D5XA 3ZOAA 2N56A 4YVUA 3H53A 3NDZE 3HJ0A 2FJHB 4N8VB 3MV8E 2Z0BA 3MRFA 4PJCB 1UWEH 3BVWA 3OB0H 4PJ5E 5CLWA 3QI9D 3TT1L 4NNPH 2A74B 2VDQH 5DJ6A 4HAFA 4N8VG 2NT1A 3MSPA 3ARDC 1SY6A 1KEML 4Q6KA 1XVSA 1TUPA 2ID5A 4NO5B 2J2ZB 4XP6L 4PWKA 1DQJB 2EILB 5IHBA 3D18A 1OO2A 4L1SA 2DL2A 3ULVF 4K3GA 2PUQT 2B4CH 3QZLA 3SPHA 1A25A 3LOWA 4BEIA 1CFSB 3GXNA 1GKEA 2YRBA 3H9YA 3CSFA 3N1PC 4FQIH 4XB8A 2CUMA 2P24B 4RAVB 5FUCC 4P5TA 2EDWA 4XPAL 1IILE 3O8XC 1FG9C 2EDKA 4UQDA 4XX5A 1P0SE 1U8IB 3MJ8A 1NCHA 3ZSSA 2DH3A 5LLIC 3HA0A 3O9WA 3FUHA 2XG5A 1JWSB 4FL4C 3DMMB 3HN5A 2V8MA 3RBGA 3KCWA 3DIVA 1C12A 4E0RB 3AITA 1A6PA 4Z7VA 1X4YA 3GXTA 1OP3H 2AQTA 2UXFA 2XACC 4CKQA 5HXMA 2GBVA 4YWGL 1S7RA 4IIQA 1FWXA 2BNQE 2IGTA 4X42A 3GLZA 4WI8A 1C5BL 4FYQA 1VFBB 4C4UA 2VN7A 3CSTA 2EVHA 3BUYB 5DVKA 1B6DA 1BM3L 1J10A 1DVSA 3UJIL 1RIUL 4N0UA 3II1A 4L23A 2Y69B 1HHKB 1SHMA 1W8EA 5IQ9A 3CH8A 4HPOL 4PG9A 2XBDA 3OKLB 4UTBH 1RZFL 3QRGH 3WGUB 1GGIH 3PFQA 3RGBA 2DICA 3OVUB 3FONA 1TTGA 1A0QL 3KYOB 3S4SB 4FMFA 4A67A 3MRKA 4LRNL 4HUMB 3VYPA 3QG7H 3JTTB 1PFOA 1U3YA 1ZE3H 3CLEL 3F6JA 1TNNA 4XN9A 4ZFQA 4AIEA 1ZHKA 2AVGA 4UQ3B 4XBEL 1GPOL 2N0MA 5CU9A 2XKNA 5CN1A 1P84J 3QXUA 2M2DA 1IGJA 3SDDC 3UTTD 5IF0B 1U8MB 6PAZA 4JRXE 1JHKL 2Y07L 4UDUA 2NNRA 4S0TD 1AXSB 4QHMA 4YFLF 5AENA 1KN4L 4BGLA 5DO8A 2WLZA 4LEEA 4P23A 3OR6B 4X5LA 4FI7A 1EEUA 5JW4R 2OMWB 3O2VH 1VDGA 4NC0B 3SJVE 4FNSA 2OXGB 3TASA 2MWCA 2CSPA 4NPYB 4ETQA 1ZLEA 2WN2A 1NGPL 1F42A 2G5BB 3IU3B 5CR8A 4PSRA 1UZGA 4L3EA 3LV3A 3IYLW 3WTXA 4H8VA 3QIWB 4NZFA 4IDLA 2WTRA 1SUHA 3D7PA 5TK2A 1E5BA 1LO5B 3THMH 5DZ9A 5I1IL 1HXYB 1OP5H 4OI9A 1Z5HA 2KT6A 4UI2A 1I1YA 2BP8A 4JZJC 2MCG1 1UOKA 2N01B 3S2CA 5BNXD 5KBPA 3DGGB 3EGDA 5FO9A 2FO8A 2ADJA 4HLEA 3TFBA 3DHUA 2ZP0T 4JZNA 4K23L 4TS6A 2KZBA 5K9JH 5IJVA 4UT9L 2ZWYA 1D5ZB 3GMOA 5FYLL 4F3FA 3OKNA 2HA1A 2DQEL 1MH5B 1GYUA 3UACA 1M9SA 3ZRSA 5HJ3B 3ATEA 4H8UA 2H0PA 4GYBA 1MRDL 4JFYB 3I9PA 5I6NA 1D5IH 1SYSA 1HXMA 2ZXQA 4UZGA 5E2UH 4M62L 3VW3H 3NN8A 1UFGA 3NUKA 4L5FE 3RKDC 1WAPA 1YEFL 4X80H 5BRZB 2OMXB 3VU2A 3B2VH 1I85C 3ISWA 3H42H 3GI9L 1IKFH 2PXYC 1LO4L 3EJZC 3WFCL 2GK0B 3IAGC 1TMQA 5D1ZC 2QGDA 1QUNB 1XMWA 3MOBL 1JZIA 1EZVX 2NZIA 3VFMA 4U1IB 4UUJB 2WKGA 5DJZA 5GGSY 3VXOB 1CLYL 3HNVL 4FE9A 4JNXA 1NOFA 5FGSA 5GSRA 3BEVB 3BPCA 4L2LA 2QVFB 1LWJA 4RMVA 4LO9A 5FM5M 5ISZA 5JXAL 4ESKA 3SE4C 3OLGA 1BD2A 1MVYA 5F88B 5JHLH 1I1AB 1IFGA 3FU8A 3GZQA 4WI4A 4TL4A 4RFNB 2QKIC 3KYMA 4XPFH 3VE0B 3NDYE 3MRNB 3IS1X 2VDMH 3B3IA 3X1NA 4QWWC 4HOZA 5MERB 5LDSA 4AGLA 1M7IB 1EO8H 3CFJA 5JR1L 4NZDA 3CZKA 2IVFC 1SBSH 1MLCA 2VDNL 4JDVB 1NBVL 1MOEA 1MRCH 3UZVA 3TO4A 1G9ML 2DQCH 4G8FB 1ZD6A 3K1KC 4BQ8A 2UYLA 2UZXA 4OLVH 2WCSA 1BVKB 3QPQC 4U2ZA 1X5IA 2XZAH 1MLBA 1IAOB 3CC5B 1AZRA 2Y7QA 4HSCX 4XVJL 5BJTB 4UCFA 4CW1B 4N1EA 5BV7H 3GSUA 3OL2A 2WHVA 4L0YA 4GW4A 1VFAA 2GSGA 3AS1A 4X2UA 2GB2A 3NTCH 3TLRA 2WQ8A 3ZGHA 4AIZB 1CXLA 2NDGA 3U30B 3MOQA 4Y2OA 1QHQA 4PS4L 1NIEA 4B0MM 4YHYC 5AG8A 3S37H 2LVEA 3OAYK 1JZ2A 4ELMF 5L2KD 3QB7C 3RTQC 3GMNB 3QIWD 4XNQA 4MNQE 1CYWA 4JFHD 4O9HH 2DH2A 4PVBA 4FABH 1MCBA 2CLZA 1PX3A 3GSOB 3GUFA 5DJCA 4U05A 4KTGA 4HJJL 1E4XH 1HS6A 2YKLH 3QZWG 4NENA 3AGVA 4PS3A 4XP5L 3P02A 3LEXA 5E5MA 5DFAA 3MNZA 4HUUA 5HD8D 3HUJE 3RWCA 3W5NA 3FT0A 3PLYA 5JHLA 4X7SL 2XWBA 1MJ8L 4NWUH 3VFWB 2V9QA 3VACA 4HIIB 2X4NA 3TTYA 3UCQA 2AGJL 2OYLA 3CFDB 1DUZB 2FJGB 2WYIA 5ESVA 2CO1A 4HXBH 4MQSB 3REWB 2PNDA 4U6YA 3NVQA 3IWUA 4M7JH 4OZIA 1P2CB 1IE5A 5C6TL 1I3RA 4HJUA 4F33A 3CMGA 1J7VR 3BESR 2I7SA 4EI5A 3QW9A 4G59C 1R3JA 3QP3A 1KPRB 2I60L 1JI1A 2V0AA 1WD8A 5D4QA 4F2MA 4Y19B 1BFTA 4ZMPA 1JVOA 4G71B 3CE1A 5KTEH 1DQDL 5A16A 3GD1C 1LDSA 3SOTA 1NEZB 3LEVL 3B4NA 4HJTA 2DWDB 2FJUB 3O11B 5EA0H 1CDBA 4LNVA 5MENB 5DZLA 4PY8J 4XC3H 3VRJA 2CWRA 2XG4B 2XY1A 1TEFA 4UU9A 3C2AL 3NSCA 4D9LL 5EZLA 3EFDL 1I1FB 2QR0A 2VWEE 1SXCA 1Q72H 2W9LA 3F04A 3QIUA 1WHOA 1WEJH 4NLHA 2J1WA 2VXVH 5JMRA 1JFHA 3JUYA 1GCFA 3L3OC 5J0BA 1TKWB 4AVIA 4POUB 4RRPA 4PWEA 5TTRA 1TTAA 4BFNA 4E9WA 1KBPA 2CBTA 35C8H 3EYUL 4HP5A 1RPKA 2CUIA 3BKJL 2HX9A 1JGDA 4J23A 1DVFB 3ZDZB 3FHAA 5D71H 1WA1X 1HHJA 1S9VB 5I5JA 1A1NA 3OHXC 1J0HA 1AD0A 1ZTMA 3HVNA 4LIQH 1HKLL 2WSPA 2NY2B 1TFPA 1XXDC 2DMHA 5ACZA 1R5WA 3L3JB 3K81A 3HFFA 3HHSA 25C8L 3B5TA 3L1OH 3H3PH 4U3SA 3MRIA 4OIFA 2QVMA 4DPBX 3FO1B 3TYGH 3VB8A 4JMXA 4AIOA 2M26A 2G3XA 2LR4A 4EUPH 2HVJA 1YEJL 5EO1A 3U46A 3GUTB 4IOSD 4KZEL 3TT1H 3L95B 2VL4A 3EOTH 1OB0A 1K5NA 4KK8C 4JZOA 5ID0B 4R6UA 1KEMH 1MCEA 5DVNA 5EBMA 4DK6A 1KTKE 1YUHA 3PWJA 3T9WA 3UDWA 2YGVA 3VH8A 3VJ6A 1SN2A 2HLFD 2MPVA 1XSOA 2ZQKA 3L5XL 5JIDA 4MWFB 4ZW3A 3DX9A 1KF9B 2E7HA 3OGCB 4N9GA 1QTSA 5ENWA 4YLQT 4GS7C 1KYUA 3MLRL 4R0LB 4TVPE 2YD0A 2BVPB 4XPAH 2D2OA 1ETB1 4TUJA 3M1CA 2L3BA 2Q76B 1X4XA 5DRXA 4A7VA 1RPQA 5E00B 1IC4L 4G8GE 4R5TA 4CDHA 5FO8A 3TEWA 3DKHA 3N9GL 1ZGLB 4CN1A 4WNJA 4YWGH 4F7PA 1CD8A 2X9ZA 3FQRA 5EEUA 3AREC 1C5BH 2OMTB 1OTUD 3DRTB 5CWSB 3RVXC 3PWPB 5TH2A 2JK5A 3ROOA 2E9GA 2VLJA 5DUBB 1HZHL 3BWAA 1BM3H 2NY7L 4Y2DA 4ZD3L 5FB8A 3UJIH 1RIUH 2OMVA 4FS0A 5IESL 3VD1A 4J8QA 2ZF8A 4HPOH 1RZFH 3SBWC 2RA1A 1JRHL 2C1PB 3CZEA 4HKJB 4P07A 1QOKA 1JTPA 2CJSA 4L48A 4YHIA 2XYBA 3WL9A 1RY7B 2AXHA 2XVGA 1W0VA 3IDJA 4LRNH 2MNWA 4QHKI 4X4XA 5F1SA 3LCYA 2WINB 5AOKA 5F0LB 5LWYH 3C5JB 1NEPA 2IF7A 1CFQA 1E5UI 1P7QB 4I48A 2WN3A 1JD9A 2FQDA 3WJMA 3CLEH 5MEND 2IEPA 3EYOB 4OF5A 1B9ZA 2X28A 3FQNA 1MW1A 2G3MA 3MLSL 4PG2A 1F45A 3HI5L 4FXKB 2D3NA 2YSSA 2G60L 4AMXA 5J9PA 1OSPL 5FOBB 3EO1A 1BREA 1JHKH 1SQMA 2W95A 2Y07H 3C5ZD 4FG6C 4LP5A 2JKLA 2KZKA 5AZ2L 2AV7B 1T22B 2NY4B 1KN4H 3D0LA 3NIGB 5CXPA 4YSAA 2K1MA 3Q6FB 3CSBA 3M17A 4XVTL 4HOWA 1KJVB 1EXUA 2JV6A 3MAWA 1DVFD 4LEBA 1KCLA 2VW6A 3Q7JA 4LCCB 3CFNA 1NCNA 1AFVH 3MRMB 1NGPH 2P8PA 1CG9A 4ZAKA 5C0AA 4BBWA 1S7SB 2WYHA 2W0FA 1A9BB 2NY2D 1FL3B 4X9FA 2YAHA 1XF2A 1A22B 1BQHB 3QO1A 4DF9A 2BSTB 1IGIL 1YEWA 2XOTA 5DHDA 1I3GH 1OAKH 4XWOD 4BH7A 5I71B 4LLUB 1A4JB 3MNDA 4KXAA 5I1IH 3AVEA 3S7GA 3LQZB 3UYPA 2HFGL 4XO4A 2FD6L 3LPGA 5B1KA 1KYDA 1PDKA 2K6ZA 4R96B 3VI4B 4E5XA 5D96B 4U7MA 1U30A 3TF4A 4UDTA 4OCNC 2GITB 4GBXB 4K23H 4D9RE 3FPXA 4CMHB 4UT9H 2AF2A 4E68A 4G9FA 3KLHD 4OSUL 4KJQC 4PJBA 2DQEH 2FL5A 3ROLA 3P3YA 3HRZC 3IEAA 2BJML 1MFBL 4J3XA 5KN5A 2PMZA 4CN4A 1FHGA 3MRDA 1MRDH 4TMPA 4J3OD 5FFOA 1CIDA 3UMNA 3VXRB 1JK8B 4OW6A 3VGFA 3EOAA 5F7UA 4M62H 1ZT7B 1NC2A 3C75A 1YEFH