4FEMA

Structure of suse with alpha-cyclodextrin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
SLTPPKTMFIVGSMLDTDWKVWKPMAGVYGMDGQFYSMIYFDANSEFKFGTKENEYIGINDNRVTVTDKAGAGVSGSDNFVVENAGWYLFYVKAAVKGDDYQFTITFYPAEVYLFGNTTGGSWAFNDEWKFTVPATKDGNFVSPAMTASGEVRMCFKTDLDWWRTEFTLHDGEIFYRDFNLIDSWTEKGDGYSIQGSAGNVIHLNFTAGTGEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidomain Carbohydrate-binding Proteins Involved in Bacteroides thetaiotaomicron Starch Metabolism.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Carbohydrate-binding protein
molecule keywords Outer membrane protein SusE
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16411 SusF_SusE Outer membrane protein SusF_SusE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3610 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA02
2.60.40.3620 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA01
4FEMA 4FE9A 4FCHA
chains in the Genus database with same CATH superfamily
1NBCA 4UDTB 1WGVA 1B9ZA 1WWCA 5EO1A 1CK0H 1LK2A 3BPOC 4JY5H 4H8WH 2H3XC 5E2VL 1AGFA 4QCIB 2R1XA 5E5MB 2DI8A 1GS6X 2ITCB 2GJ6A 1MHEB 3IJHA 4F2MA 1WC7B 5EBLA 3MN8A 3PDGA 4IS6A 4Z95H 3SY0A 1F56A 4DGYH 3GXIA 4D0BA 5JTWA 5DJ8A 2WCPA 2AGJL 4Y16D 4MBOA 1Q38A 4M5YL 4QTIL 1QVOA 3LNIA 1UH4A 3ARGA 3V5HA 4AVJA 4Q9QL 4XNBA 3ZT7A 3CC5A 4OD2B 4YL4A 3GRGA 1Q9KA 1CDJA 4YHKL 1N64H 4PP2B 3CXDH 1A3QA 4JUSA 3MNZB 1FF5A 5DVOA 4XXWC 3L16A 4PJGB 2H8PB 1KTKE 3MBEC 4U1HB 1TDQA 4HZLA 3VU2A 3UTSD 4OCWL 1LEIA 1P2CA 1DE4B 4IBZA 1NIEA 4JFED 1AR1B 2H2SD 1NCUA 4WO4A 3T65A 1PZ5A 2I60H 4U1LB 5DQDH 2IFFH 4EAEA 1BOYA 1PD1A 5LVEA 1P7QA 5F21B 5HGAA 4UF7C 3HUJB 3LZRA 4WUKL 1I7TB 1XXFC 1G7PB 3M1BB 4HUMB 1MCOL 1LDSA 1ED3B 1HQ4B 3QI9B 3ECBA 2PPEA 2YWZA 1KTLB 1OSPL 4LPCA 4MD5A 4P9ML 1A4BA 1U8IB 1L0PA 4NZTL 1IVTA 2WUCH 1PMYA 4ORGA 4WIQA 3HE6D 1R5WB 4XB3A 3X14A 4JRXE 5D5ME 2D7MA 4R2GB 4M6OH 2VNCA 4AYMC 1CFTB 5KBLA 4EN3C 1P7HL 4M6ML 2E5EA 1U8LA 2R0ZL 3QUZA 4LEBA 4B9PA 4YHZH 5AD0A 4FA8A 2QMJA 3EG9B 4OTXL 2P5WA 3TBYA 2MCAA 4NCC1 5TPWL 2JK5B 3E6HB 2R51A 1A1OB 1SMDA 2AJZB 3D12B 4PTTA 4ONFL 2AQ2A 1KPUB 3I9AA 4M61B 1Z9OA 3IJ7A 1ONQB 5MI0B 3X11B 4CSSA 3FHEA 4FQ1H 4DERA 1FYTB 2WTRA 1KPUA 1ZEAL 2C9PA 3FULA 4JRXD 1AGEA 2CLRA 4DP7X 1HKLH 1MCBA 3WTYA 1R5WA 3V4PA 2IALA 5TDNA 2EE9A 3B2UD 4AKQA 3BD5A 3MV7A 2AXHA 1GYCA 4YK4C 4QJ5B 2CIKA 1EWHA 3MQIA 4Z0BH 5D93B 1AXTH 3SBRA 1DJIA 2ADJB 4NZUH 5IG7A 2Z4QB 4PAZA 1JL8A 2RFXB 2FBOJ 2EYTB 4X6BA 4ELDA 4Y5VB 3X14B 4M6AA 3I9GH 2DDQH 4J6RH 3X1BA 1GCYA 4PLKD 2NQDA 1ID5I 4WK0B 1DQDH 5IBLD 1RJZB 1IAIH 3HA0A 3LHPL 5DRWB 2DTML 1CF1A 4GUCA 2ITDB 3LZFL 4GRWE 3QPQC 4QOKA 1JF1B 1FNFA 4BSVB 5BNXD 2CBTA 3QAQA 3NJLA 4L9LA 2DJSA 3KHQA 3QDJB 2JK5A 3E6HA 1GS7A 4N0UA 3UYOD 1AJ7H 4NKQB 1VCBC 1VFMA 1EQWA 4WI2A 3Q8FA 5HJBA 1HL9A 2Y5TA 4UQ3B 3HPLB 3LB6C 3PL6A 3S7GA 4ZUWB 5T1KB 3WJMB 1AE6H 4DP1X 3M17A 3PP4L 3RNKA 4Z7NE 1AQKH 2APBA 1SOKA 5F7YC 2BVYA 5TE7L 3LX9A 3CH1A 2NRDA 4HS8H 3TVMB 1EHKB 1MFVA 3FH8A 3IN2A 2HPOA 4JMXA 5FKPA 5I1DA 3MBEB 1JZ6A 3DIDA 2PR9A 2MHAA 5ECJE 4QWWC 1K9TA 1KJMA 1PTZA 3BWUC 5CINH 1AZBA 3T2NL 2PYFA 2F8VA 4CU8A 5JPNA 4MHHI 4U1MA 3T4AA 5JIIA 4QRUA 4XTRC 1UD4A 2JLLA 1TJGL 4HX1A 1TENA 3SPJA 1WA2X 4YSRA 4KKCD 5FKAA 4HOMA 3FQWB 5F96H 1DBMH 3UG3A 1IBHA 3LD8C 1Z3GL 2V2TA 3CUPB 1FVEA 3QEQE 4JO4H 5F1KC 4JS7A 1OT2A 1CI5A 3QFJE 1PG7H 4LLDB 5C1MB 3O3DB 3V6OC 1L6PA 1M57B 4UTAH 1TU2A 4IOIB 4WK2B 3T3PE 4O5LH 3QGVA 3QFDB 2BW4A 4JHVA 4D8PA 4V2BA 1P5VA 4JQVA 4X9IA 4U33A 1BQHG 3MLSH 5FKPB 4YIQB 3X1FA 4ACTA 2JB6A 4X98A 4B0MB 5FC9A 3N2JA 3D07A 4QPEA 4P04A 4NQUA 2P3YA 4I0CC 1RULH 5T1KA 3RBSA 5LBSA 2AITA 4LLVB 4G83A 4NLAA 2IIJA 3I9PA 4BXVA 4WW2F 4WI4A 3LIZA 3QP3A 5G5DA 3QCUL 1RVFH 5ESVB 2E86A 4EDWH 2Q76B 3FTGB 2RQ8A 1TCRA 2J8UF 3GIVA 1ZA6A 3CV5A 4MNQE 3LPPA 1R1CA 2COVD 2X4RB 4QHLA 4AOFA 2H8PA 5E6UB 3GI8L 5D1QA 1V5JA 1M7IB 3UAJC 2GABA 5CEZH 5IUSA 2XTJD 5EG6C 2QR0B 1E4KC 3EHBB 5E4EC 3ZKSD 1HZHL 4FQ2H 5BW7C 3CVBA 4OZFB 5IB4B 1VZIA 4G80A 2DQUH 3GJFB 3MLVL 5C6TH 3OGCB 4NJAL 3NK3A 4JO2L 2PXYC 3TU6A 4YSEA 3H9SA 3FCBA 4GRMA 4NQQA 4PRNA 1JV2A 3ROLA 2D7NA 5IHUH 2GY5A 2J20A 4JO3L 3VG9B 4GAYB 3RWDA 4BK5A 4Y1SA 3S0PA 3BVWA 3KPRB 4UV4H 1AI1H 4J8RA 4IRZA 3BT2H 2QV4A 1RI8A 4Y5VC 3V0WL 4Y5YB 4KKZA 4OUOA 4Z7QB 3CQQA 3B3IB 1W72L 2MJWA 3L4ZA 1FRGH 5K39B 4JM2C 2BCKA 1BLNB 1ASQA 1TQVA 4PBXA 5HI5D 1IBDA 1WPCA 4WEBL 1FCCA 4OLXH 5LBVA 1UKQA 5E8DH 5F3HB 2FUQA 5IK3A 2NY4D 3GGWB 2FO1A 2C1PB 2OCCB 3GSRA 5EZLA 4DGUA 5C9JB 2HWZH 5HXMA 3C2AH 3VI4A 2VLRB 1SZNA 3FOLA 2JTDA 3HVDA 4NO0A 4RWHA 3GSRB 5EZLB 1A21A 4KKCC 2B4CH 3HN5A 1I3GH 2XV3A 4YDVA 1XO8A 1OTSC 5DYOA 4RX4A 3ZIYA 1A3RH 3WBDA 2YUWA 3TVMC 3I3DA 3NJKA 1EHLL 3VU1A 4JPSA 1UJ3B 4GAJL 3MLRH 4AL8H 1O9WA 1E2WA 2ZCKH 4Z3IA 4BQ6A 4OR1A 1YEHL 4G82A 1NCHA 2CR3A 1WAAE 5BOZG 4M1GL 3JTTB 4PGEB 1CD1B 2CCLA 1VPOL 5DUPL 1X5KA 3KYKH 2X9XA 1JV2B 2EIDA 3ROLB 1M05B 4XO3A 2F15A 3A6CL 4NPKA 5IBLC 1FO0B 2NY1D 4FLOA 4XN8A 4CL7A 4JLRA 2XT1B 4Z78B 2GBAA 5FYKL 4IGBA 3MV01 1CL7L 2DLGA 4XP4L 3GBEA 4Y4FB 1IGIH 3BQUB 1F3JA 3TJEH 2FD6H 3T0EB 4NJAH 3OR6A 4HOZA 3GBML 1G7MB 4U6HA 5AW1B 1JIBA 4LEXL 1IAOB 2DLFH 2VSMB 4QYOA 3LH2H 3CZFA 4WO0A 3IFNL 5DQ9B 3O3AB 5IB3A 2EUVA 2E27H 5D7LE 1WISA 2PCFB 5GSRB 1RFDH 4MAZA 1IGCL 4G8EA 1ETZB 2DKMA 1EX0A 4QYOB 3EH1A 3HKFA 4OZHA 4UTBL 3MRJB 2YEVB 1E42A 1IILE 3WSQH 4AM0Q 1IBGL 1O6VA 5SX5K 4W9DC 3WKPA 1BJ8A 3CFEA 3PHOA 1KNOB 5MEQA 4XPGH 4ZYKB 2APFA 4QRPA 43CAB 2DW5A 2B5IB 4JKMA 3FSOA 4XN4A 5HHXL 1WAAA 3GSXB 5DLML 1NEZB 2LU7A 3EDKA 3LTVA 2CRIA 1GYUA 1OGAD 5HYJB 3LOWA 3JWOC 3VXSD 4IS6B 1MWAH 1NIAA 2YRLA 4LLQB 3TBBA 3SGDI 4DKTA 5IJVB 5I82A 4YSPA 4HOXA 1ACYH 2YMOA 4L1BA 1MY5A 3LQZA 4JZOB 3TOPA 4ALAH 2JELL 4P5TB 3U83A 1E9PB 4DP8X 3AU0A 1QNZL 3SPVA 4PJFB 3CLFH 3CX5K 5C07D 4XO9A 5F88A 3QNXB 4MASA 1U8JA 1RP8A 2EE3A 1JMXA 4MAYB 3OF6A 4L5FL 4I18C 3RTQC 5A3IC 3C5JA 3VFNA 2XY1A 5LCVL 2XZQH 1BG9A 1UZGA 2YRZA 4UT6L 1E3FA 4RGOH 3OHXC 5DLMH 2YAMA 4RMUA 3AWFA 1MCDA 4K3DL 5F1SA 3GHEH 2PPFA 4LARL 3WIHH 4PRHA 2WLKA 2BCKB 3O2DA 5EOTA 3WIIH 5EOCJ 4JPVH 5CEXA 1QFWH 4LP4A 5AAMC 2FT7A 4I7ZC 2C34A 1XF4B 3KH4A 3NCJH 2A6KB 3LDBB 3ZTDC 2HT4C 4NP4L 1ZLWK 1ECZA 3HBZA 1BD2B 4NEHB 1A7QH 3US1A 3RNQA 1RZQA 5B22A 3QO0B 4F7MA 3TA3C 2G9HA 3OXSB 5C0RH 1E40A 1Q9LA 3VXUE 3DSFL 3EYUL 4WFFD 1RZPA 3MRLA 4IDJH 5AB9A 4WK4B 4MB5A 4XNYL 5KYNA 1QRNE 2NX5D 4WHDA 4XO5A 4G8IA 3GMQA 4BSWB 1MW2A 4CVUA 3VD0A 4Z5RA 4PG2C 4L8CA 1CF8L 1MCLA 3EH2A 4RQQA 3WXVL 4UAOB 5BOJA 2IF7A 3N1MC 3WIIL 4ENEC 3PXHA 3D2UD 4PP2A 4KOBA 4EN3D 3S4SG 1NGPH 3P4MA 2CDEB 3BCFA 3U6RA 1SF5A 4P06A 1BAWA 1UHVA 4ONOA 4ELKA 1JVOA 4PVBA 1JZJA 2DQJH 1KTRL 1S9YA 3G6JB 3GJEB 1S78C 1G94A 1JGLH 4F27A 1BYOA 3LRLA 2BRRL 2GCYB 3SODB 1ZLVH 1F18A 3ZDYE 1ADQL 2Y2WA 1NMAL 3IS0X 5EO9A 5GRXG 3H42H 4LSTH 4RGNE 1BIHA 3GF8A 2DYRB 1BLNA 4KPHL 1XGTA 1E4XL 3UBXG 4MDIB 4PLOB 3NCFB 2F8IA 5DRZA 1SLUA 4MTMA 1LEKA 5KYXA 3E6FA 2EDRA 3V9FA 1SGKA 1CDGA 5G4NA 4TUOA 5I8CA 3S88L 3UADA 2ENSA 2VXSL 4JCMA 3JQOB 3Q5OA 1PG7X 4A2DA 4P2RD 5J6GB 1NAML 4YL9A 4FC3E 3DUUB 4CGUB 4ZXBA 1EBPA 5HJ3B 5I1CL 3RU8H 2BCMA 4OQ1A 1PIFA 3D0VA 4M3HA 1CE6A 4LIQE 4U05A 5DZJA 1KB5B 3CVHA 5I75C 1J8SA 4HV8B 2GC4C 3PHAA 3VB9A 1RLWA 2BSED 4QAMB 4LQFH 4H0GA 3N1PC 2FT6A 3TPKA 3CFDA 4DP9X 1SDYA 5IGXL 3HW7A 3QHTC 5EIVA 1NCCL 5BRQA 2UX6A 4OLVL 1A6UH 4DKEL 2DMGA 1CF8H 2WO2B 1FORL 5DJAA 2MNUA 1ZVSA 2XTLA 1URZA 1Q90A 1HCFX 2JJTA 3HMXL 1K5NA 3BWSA 3QNFA 1LLAA 2UX7A 4KTDL 3N0AA 4NQDB 2Z8VC 3KMDA 2NTFB 4L29B 2RHEA 1K85A 5I6PA 5AKSA 2GEQA 3IXAB 3QUYC 3QO1B 3BZFB 1JFHA 2DLEA 1HINH 2RMNA 3B3BA 4GO6B 2OL3A 3DOSA 3F5WB 3LEVL 3A23A 3V6BR 4XP6L 4QJ3B 3MRDB 4TL4A 2DM4A 1OCZB 4BCZA 4DTGL 4YXKH 1SYVB 4LOFA 1L9RA 2J8UE 3ESUF 5FM8A 4AEEA 4GS7B 4R26H 3MLTA 4TYUA 2VC2H 2M1KA 5I8KL 3VQ1C 4GEIA 5EPMA 2KUTA 3ZR5A 3SJVE 1IGTB 4P46C 3ASWA 1V7NH 4A55A 4Z7QF 2D7TL 4KJPC 2W60B 4Q6IB 2JI3A 4DEUA 2CK0H 5E5RB 4PJ7B 2JMRA 2ADGB 5JR1H 2P5WB 3P40A 3VGEA 2B0SL 3GC3A 4JFVA 3B4NA 4N90E 3PIQB 4AUYA 3BIBX 4PJ9A 3KLHC 1FRGL 2VR8A 2BNRB 1CFTA 1WT5A 3M1OA 1FLRH 3MUUA 1IT9H 4QAWA 4KRMB 2RQEA 2F18A 1R5IB 1XH0A 3B9KD 3MRPB 2QFRA 2D4DA 2PWDA 4YZFE 2WKLA 3TLRA 3L1OL 3GSVB 4NBYB 5LGHL 5EU6B 4LCCA 2HRPL 1BXAA 4MMZB 2EDHA 4NUQA 4V1DE 1I8IA 4D9RE 4FQIL 4FZEH 2VZTA 4LPUA 3RL1A 5KVDL 5IVXF 4QHPA 2ZNWA 1YEKH 4IRJD 1RURH 4F5CE 4A1RA 5I30L 1O0VA 1YNLL 1UJ3A 2DWEB 3L4YA 4XP5L 3WYRA 4F37K 2WB1A 3KWWA 4NFDA 15C8L 1E6OL 3VD1A 1AC6A 2W9EH 5SWZD 3KYKL 5HVHB 4NQDE 1CFNA 1ZE3H 5BMFH 4FLQA 3V4LA 4ZTEA 1X5LA 4HK0B 4ZZKA 3NBNA 3D05A 1OARH 4X4MA 5I15L 4JAMA 3QNZA 3FCUB 4YJZL 3NACL 1T89C 1D9KD 2JSFA 4O2EA 3ALWA 4DZBB 5HPMA 2M8XA 2KZKA 4FFYL 5CJXA 1TTBA 5SX4I 1SFDA 2GJRA 1F11B 5EOQH 4LHUB 1KF9B 3IKKA 4JG1H 2FH8A 1ECYA 1INQA 2V6HA 1UYWH 3GFUA 3L4UA 5EOCL 4TSCL 4LL1A 1I3RB 3BKJH 4R84A 2IBZY 1E27B 2VIRA 3WNMA 3JWOL 1D5ZB 3F12B 3MRMB 5C0NC 4S1QH 5I17A 1FO0A 4P5TD 3IAQA 3T2QA 3ZJAA 2NLJB 4C4UA 4R7VA 4OT1L 2VO5A 4ABWA 1WK0A 5C08A 3HI5L 3QHZH 4P4KC 2XN2A 3VXSB 4OU3A 2R56L 5HYJD 4ORGB 3QBTB 5F93C 3T8MA 2H0EA 2VN6A 1JZ4A 2EIZB 3IXTA 3N91A 1L9MA 1KY6A 3QORD 4NRZA 1M3JA 4UDUA 3IVKB 3VGHA 2X4TB 2W0KA 3VD4A 4LFHD 5KAQG 2JFCA 3FB5B 4JKKA 3SOTA 2JIXD 1OPGH 4XNQA 1NMCC 1S7VA 3DUUA 4ZXBB 2P46B 2P8PB 2XWJA 1XR8B 5IB2B 1BXUA 4YIQA 2O5NA 1MFAL 3ARBC 2JE8A 5T8IA 1UM4H 2H9GB 1X5ZA 3IRZA 1FG2A 4BYHA 2IXQA 4IOFD 1J10A 4KAQL 2YQ2A 1GCFA 4GRLB 4LLYB 2AEOA 4NBZB 4AGPA 1D7FA 5C6TL 1VZGA 4PJ5E 3MV8D 1INQB 2BMKA 2ZUQC 4UM8B 4FN0A 1JJUA 5CEZL 2J8OA 1ZA6B 4QHLB 5HDBF 3P30L 5JHBA 3N3EA 1ODUA 3MRMA 2DQGL 3LEYL 3II3A 4MGXA 2N01B 1VESA 4AQEB 4KI5E 3DXAB 2GQHA 4F7TB 1T1WB 4HG4J 2CHNA 3T4AB 2YKLL 3LN4B 1ORQA 1D5BB 3AS1A 5ERWB 3N1GC 3QXWA 1NDTA 3F5WA 4FNQA 4P3CL 4JFDA 4YBLC 3RY5A 4NZRH 3OBAA 5EO1B 3QCVH 5C2UB 1AG0A 3QEQD 3K2KA 3KBFA 3NG5A 3O6ML 4YO0B 4GRLA 2DIBA 4APXA 1T1ZB 5D2NC 3DX8B 3D50A 2W07A 4K8RL 1P6AB 1XR8A 3KYMB 3CHPA 2R29L 3SDXA 1XCWA 4NN6B 1SUHA 3V4VH 3VD3A 2DQ6A 1OLLA 4A04A 4E41E 2JWYA 4PCKA 3GSQA 2AERT 1KYDA 5DK2A 2I07A 4QXWA 1RKRA 5E4IA 1SXCA 1NC4A 3L3IB 3HS9A 7PAZA 4OLZL 1VADA 1VFAB 2OMWB 5E00A 4E42A 2DMCA 3Q3GB 5IQNA 1G7JA 3KPRD 4FLHA 4EOWH 4PRDA 1QEWB 4ZFFA 1WSST 1EEQA 3L7FA 4C8XA 1CBVH 4FABL 4DPCX 2IG2L 5E2JA 1U3HC 4HHAB 3OX8B 5KSAD 1TQBB 2QHRL 4MZRA 3H9YA 4O00A 2AQ1A 3MRCA 4JHAL 2HVJB 5JW4N 1MJUH 1WTGT 4Z7VA 2UZIL 5J89A 4X8XA 2HLEB 4E0RA 3I9GL 2OV0A 4U1NA 5ILTH 3LMJL 1FCGA 2VLLA 2Y6SD 4DEWA 2EE0A 3RL2B 3V4UH 3IMUA 2IO5A 5E5LA 1Q94A 2QKIA 2P48B 4FNSA 5KOVC 2WJ7A 4PCSA 5D7EA 2YUXA 2XACC 4LCIL 3U0TB 2MQ0A 4L4VA 2J6EL 1KJ3H 1MHPL 4WI7A 4GKZB 5DJ6B 3MNVA 3VQMA 3IMWA 3X17A 4WWKD 4MDIA 4O5LL 3VI4F 3C75A 4ZW3A 2XZAH 4RGMB 2IDUA 4WDIB 4M5YH 3O4LA 3RUGB 4K73A 4ZXBC 1OPOA 3RBGA 2Z6FA 3RILA 4LLMB 2E3VA 4HCRA 1ZVYA 2UZYB 5BZDB 4WI0B 4F92B 4KZDH 4I8DA 5HBBA 4HLEA 4PV9B 2VSDA 3CIAA 4FQCH 1BZ8A 4QRPB 1MZYA 4LSRH 4TNVF 3FH7A 3K46A 2B4CC 4TNWK 2FLBT 1B3JA 2VJXA 1G9MC 4KUZH 5D7IA 2Y7QA 3ZDXF 1QA9A 2Y7LA 2J88L 1K4CB 4I9WD 3IFLH 3CZSA 1UENA 1ANUA 3H7BA 1XB3A 4AJVA 5H37G 4L3AA 2X09A 1YSOA 1XH1A 3PUUA 1D5XA 3O11A 1N12A 2WKOF 5JXED 3DJSA 1E4WL 1ETA1 3SE8L 3GMOB 3HI6L 3MV7B 5BMFL 2W94A 2XIBA 1ZTMA 3DBXB 3LMJH 3P2DA 2WQUA 4LCYA 5DCCA 3ZE2B 3VX0A 3KPMB 5JYLA 5IG7B 4LGPB 2F5AH 4YDJA 3ZYIA 1YPZF 3FK3A 2EDYA 3L81A 3KDMA 5EUKA 1FNGB 4F57H 3REWA 4NKOA 5GRYA 2IG2H 3IGAA 4KK6C 1HL8A 1BV8A 3PABA 4HKJB 3S98A 4XPHH 2WVUA 5GIRA 4ODWB 2W0FB 4MX7B 4ZOBA 5E0QA 1V55B 2HXAA 4K7PL 4JDEA 3CSBA 1UD8A 4MMXC 1JP5A 1B0RA 1UA3A 4BH7B 1RSYA 3CG8A 3MLYL 2Z8RA 3FYEB 4LEOB 2G9KA 4FQXD 3AWEA 1IFHH 4OLZH 3VAEA 1CFVH 4BHUI 2CNYA 3ARDD 3M88A 3DGCR 4JPQA 1S7XB 3FUIA 2H0JA 3UJIH 2R7EA 4NZDA 4OW6A 5EZIL 4YZFF 4HWEL 3X1EA 3VDAA 2AHIA 4WV1B 2A38A 4ZAKD 4NT6A 3L7FB 4L8BA 4MB1A 4X4XA 5JNYB 3ZKND 1TCMA 2YPLB 4S2SB 4A2GA 3N85L 3IGKA 1QYGH 5I1AB 4P0DA 5HJGA 5C0GB 1A3LL 3V0IA 3ECBB 3NGBB 2CO7A 2EUXA 5IVXE 1JMZA 4DKAA 4RFNB 2V3FA 1QI4A 2PPDA 5CIPA 2K1MA 3ZQ9A 1T1WA 2R15A 4GAYA 1UATA 1Z9PA 4OQTH 5TPWH 1O9VA 3CLEL 1EGJL 4NZFA 1IQDB 4CVWA 4WUUD 2H3NA 1J0ZA 3TZVC 3ETSA 1EAPA 1KGXA 1U9KA 1NCNA 2OQJA 3G04B 4L9DA 3S35H 1ZA3B 4QHNA 3RPIA 5IMKA 1OANA 3FUJA 3PQYE 1V54B 4MRBA 1KSRA 3G04A 3HG0A 4A7GA 2OSLB 5F44A 1KFGA 1XT5A 2EYRB 1DBJL 4GFXA 1AD0A 1A14H 3VI3F 4ZOEA 2VRAA 4J3VA 2DTSA 1T0OA 4M5ZH 1JDDA 4LLVA 3S6CA 4MQXD 3QSKB 4HBCL 3H85A 4KK5D 1WYJA 3D9AH 3CCHB 3WE1A 3FTVA 5CJOH 5F9WC 3UEQA 4Z77B 4RMVA 1PZAA 3TS8A 1RIUH 2WC7A 4F2FA 1TFPA 2IEPA 2VDLB 4U1GB 2KLRA 4TV3A 5D1ZD 1R17A 2ESVE 2ERJB 3EOAB 4IMKA 5IQ9A 4AGNA 4FNTA 1XQ4A 1AFVL 3O6MH 4X7CC 4HCIA 4F20A 5I18L 1R4XA 5HYSG 4L3CB 3NJHA 3P9WB 4B5ZA 3QR0A 3SIKA 5J12C 2R29H 3UTSB 4X7SH 4X5WB 4M6NL 4PHXA 1I8LC 5H8DA 4XVJL 5SWSD 4Q9QH 3H1ZA 3VFGH 2VC2L 4DAGL 4FG2A 4BIKA 3BXNB 5KVGL 2BY3A 1QSFB 1L6XA 1CG9B 4BFIA 1TMCB 1Q1JH 1W72A 1CGSL 1ES0B 4U2ZA 3ULVL 2XTJC 5JQHC 1J48A 1XF3B 1OCCB 4QF1A 3MGAA 4OGQC 3TYGH 4NNPL 1DFBH 1S9WA 3O3EB 4GKSA 3BZEB 4OKDA 3C08H 3VNZA 1EPFA 2DIAA 1DJXA 2M26A 2QKIC 5F3HA 4WFHD 2XVLA 4I18A 5JZ7D 3NRQA 4N0YL 1NEZG 3RPBA 4HCRL 3TESA 3MLWL 1X5FA 3V0EA 3I3BA 3IVKA 1CLCA 1Q9LB 3OHXA 1JGLL 4L4TB 4HS6B 3BKYH 3FUFA 2ADYA 3EGDA 3BH8A 3N55A 1ZHBB 1IKOP 5HDBE 5DD6B 5I1GL 3IEAA 2E9WA 3W9EA 4JFXB 2DI9A 2XZZA 3JZYA 4G8AC 4S0TD 1G6VK 3MLZH 3U46A 1EDYA 2Z8WC 3B9KC 1FE8H 3FT0A 5FHBL 3FQ1A 3TBWA 4DP4X 3HUJE 2HFEA 4HEPG 4YUEH 3ARUA 4X6DA 4KXZH 3GMNB 3RGVD 1IIKA 2BSRA 4QRRB 5F6IB 4DFHA 3NFNA 1GW6A 3L5IA 2VLKA 5IF0A 4P3DA 2IQ9H 1HX0A 2CUIA 3CU7A 4YR6A 4KY1L 3ZRSA 2F19H 1IAII 2EUWA 3PP3K 4FZEL 4Z78A 2OMVA 3ATEA 1Q72H 3T3PF 1IQDA 2QPFA 1D5IL 4LLUA 4LMQI 4CADB 2BS71 2XETA 5I1JH 3V4PB 1VZHA 2DS4A 2WKGA 2WVVB 1GZPB 4HEMA 1QLEL 3DGGA 3MRGB 2OX5A 5EUOE 4UM9D 1WCBB 3GRWL 5EEYA 5IV2B 5FECB 1GHFH 3OMZA 3QO1A 4O58H 3ARGC 3DJRA 3G5ZA 3QA3B 4DQOL 1EFQA 4ONHB 1AXSB 1A6WH 4IRJC 1JK9B 1FZMB 2DQTL 2MCG1 3ET9F 3D48R 3JWOH 3GLEA 4HJJH 3S88H 1PPIA 3C08L 1PZDA 2D4FA 1HILA 2AW2A 1E5BA 4HSQA 2GEEA 4TSCH 5E0FA 1CR9H 4FG0A 4XPTH 3TPUA 1R0AL 3UCQA 2K3HA 2B77A 4MNHA 1E8WA 2J5LC 3HJEA 5ADPL 4KZ0A 5FIEA 3MNMA 2HFFA 4HUUA 3VWJB 2F2HA 3GMNA 4AGLA 4LLUB 2ICEC 4HV8A 2Q7AA 4UM9B 4ISVB 5B21A 4L0ZA 4YSOA 2CLVB 3ARFB 5B8CC 1UWGL 5MP6H 5E08L 4QR7A 4Y5YA 4YR6B 4GNKB 1E7VA 1NGWB 4RIRA 5AYUH 3FQTA 2OSYA 5KN5A 3MBXL 1F0LA 3SJVD 3F7LA 4PJDB 5I1DB 1K8DA 3JV6A 5GRVL 3BUBA 5HDBB 4GS7C 4GMSL 3PP3H 5CZVL 3GIZH 1RZKH 1N6QL 3IT8D 2P5EB 3S9DB 2ZP8A 3BMVA 4TVPH 1OP9A 15C8H 3SKOB 1QBAA 3HMXH 2X87A 3ZTJH 3FFCB 4KXCA 4OF6A 1XGTB 3HNSL 2YD0A 2WOBA 2Y0SA 25C8H 5E6ZA 3HTLX 4BK4A 2BWQA 4PJGA 4KUCF 5FDWB 4IIQA 1RZKC 1DBBL 4G5ZL 2YQGA 3H2QA 3ZK0A 4A7QA 1BSIA 5KUKA 3ARZA 5TE6H 3TJEL 4JGMA 2FL5B 1WGOA 3LRSA 5TDNB 3ZZQA 4AGOA 4UU9A 3MR9A 3IPFA 1HXYB 2JCCE 2X4NB 2YMXH 3CZKA 3DMMB 2BNQB 3L1OH 3R0MA 4HG4K 4AJYV 1SY6H 4J4PA 4Z7OF 4G42A 4ZFZA 1A66A 1KWGA 3NMEA 5LNDA 1T66D 2BVOB 4GRWF 2E59A 3F7VA 4G8GD 5J5EA 2VJ0A 3RWJA 1DP0A 3CDZB 4AEFA 4U1JB 5D6CA 2LLNA 2XFXB 3MRBB 1RPUA 3LAFA 2A1WL 3OKNB 4XNXH 4PREB 4BK5C 1HNYA 2DICA 2N0MA 3MCLL 2FSEB 4G8GE 4LVNC 3APFA 2DYPB 5JR1L 4NDMA 4C58B 4K5MA 1YN7A 5F1IB 3AJ7A 1SJVA 4EXKA 2ZOKA 3CFJA 4P46A 2WZPD 3KLAA 3ARRA 5L88H 5I1HH 1YEJH 1QLRA 7FABL 3V95A 3EW3B 4LOUC 2HJFA 1DVUA 1S7TA 1ZWIA 3KLAB 4L1TA 5D1QC 4ZUWA 3MR9B 1VEOA 5JPNB 5C92A 3L5WB 2CLZB 3QJRB 4FNPA 1D7BA 3M45A 2FTAA 3GMLA 5HHVH 4WEBH 1WS8A 4IIQB 1CFVL 3TV8A 1FHNA 1KEML 4YDJB 1ZSDA 1KLGB 5AAWA 1FBIL 1FNEB 1MUJB 3GBLA 5T1LD 1RERA 3WNKA 4EQ2A 3D2TA 4RWYL 5MERA 1S78D 1IEAB 5EBGA 4PB9L 3ZHKA 1JRHI 1TZIB 4AQAB 2A9MH 3ZLQC 1R24B 3N43F 4XNYH 3AS0A 3B5HA 2XA8L 3K72A 2K4AA 3BP5B 3OM3B 3UBFA 4PI2A 4UTBH 5HHQA 1VDGA 3FFCE 3GQFA 3GUTA 4JG5A 2BC4B 2VXTL 5AOLA 1B0GA 5IFHL 3J2PA 4MVBD 1JS4A 1BECA 3FTXA 3U4BL 2WV3A 3CVHL 4ERSH 5CKAA 1A9EB 1HHGA 1T5XA 4H4NA 4GUPB 5B8CB 1GTFA 3AMKA 3QRFM 2XX1A 4ZFOL 4LHUA 3LVEA 1AZRA 5ALCL 5LAPA 2X53A 1ZDQA 3JYBA 4UT9L 1UD6A 4GUPA 4R7LA 4TUKL 2E0PA 5EOTB 1E0OB 2DQIL 3OMIB 1G87A 3SDXF 3C60D 3MLWH 5C0GA 1NGZB 3WIHL 3T0BA 2E56A 1A5FH 2R27A 5BVPH 3FT4A 4NC2B 5I1HL 3CHRA 4E41D 1SEBB 3V6OE 2AZAA 4MQTB 4R0LB 3L1EA 1BD2A 3FFCA 1S4IA 2CO1A 3DRQA 3VWKB 2WLIB 4LK4A 4Z7VB 1MHCB 1RK0A 4ORZC 4X99A 2BLFA 4QNPF 2W38A 1BZOA 4HXAL 1NGPL 3AQXA 5IZ7A 2WN2A 2AJSL 3TT1L 2AEQL 4GB9A 5I74B 1BBDH 1QUPA 1S5IL 1BJMA 4V1DA 3T1WA 4H26A 4B9ZA 1ND0A 5GGRA 2Z0BA 3G5XA 4I2XA 3DMMC 5DGRA 1MRCH 1ZTXE 2GY7B 3WHE1 1WBXA 3ZKXB 4HWZB 4MCYB 2WXRA 4NYLA 3RI5F 2YA0A 4JHUA 2R2CA 2CQVA 5BW7A 1OIOA 3PDOB 1KB9J 4P4RB 3WDJA 1N0LB 4LIQL 4ZD3L 3ZW3A 1U41A 5B38B 4MDJB 1BQRA 1OALA 3VD9A 4MZ3A 4KVNL 3G6DL 4HDIB 3KWUA 3ZTNL 5C0BA 1MF2H 4N2HA 2A73A 3JWNE 2DIEA 4G7YH 5F1IA 3VGBA 3N9GH 1LO5A 4L4VE 2ESVA 4QKTA 4KJYA 2DV6A 4NOFA 3V6ZB 4QJ4B 1Y6NR 2C4XA 3L3JA 4FYSA 3U2JA 4YLBA 4R83A 1RZIA 5IQ7H 1RZ8A 1AIFA 3MYZA 4P5TC 1N8OE 4KKQA 2X6BA 5GHWH 5G55A 5FPIA 3KZ8A 5DZOA 1ORQB 3T6WA 1OTSD 2MFNA 1I1AB 4J23A 5DRNB 1CICB 1YNTA 2VJ8A 5FW8A 3IETB 3RFZB 3PWPB 1RVFL 3QXAA 3ELQA 4Z7UF 4B41A 5I1LB 3ZTNH 4CVXA 1E5ZA 3HS0C 4LARH 1ZLSH 1S5IH 2EEDA 4RZCB 2CKNA 1S9VB 2RJMA 4XC3H 1S5HA 3GMPB 3QG7H 5EF1A 4AL8L 5DT1H 1PSKH 1UXSA 4RRPM 1TQBC 5FO9A 3ROOB 2G3MA 1N7MH 3GXMA 4GKZA 4L0YA 4GRMB 4IGBB 8FABB 1UA6L 1U30A 4XXDA 4G43B 2ZX5A 2ODHA 1JI1A 4YHLH 5CD3B 4X0KA 3QNZB 4F2ME 1MFEH 1QFUL 2ESVD 3CPUA 2EDLA 1KV7A 2JNZA 2PN5A 3PV7A 5DJYA 4AYDC 5IEHA 1AR2A 3PWVA 3H55A 3BH8B 4MJ2A 3NAAL 1E43A 1OAUL 2R1YB 3JZ7A 2OXGA 1QLEH 3LB6D 4HUVB 1MFDH 1P69B 3TF7C 5F96L 3DRTB 3EJPA 4C47A 1JE6A 3QH3B 1MH5B 4ZW8A 3QQDB 2XWRA 5CLYA 1UWFA 2G3NA 4G6AD 5HYSB 5ISZA 4X5XA 2PW1A 3HNVL 4M8QB 2GSGA 4ZMXA 5CGTA 1LXMA 1U3YA 3IKCB 1WH0A 4WY7L 2LU5A 1Q4NX 1MJ7H 4GSDH 4JHZA 3UTTE 4H13C 2LFEA 5DU7A 1MFCL 2DLIA 2G75A 2HLAB 5I26A 4AQZA 1NFDB 5SWZE 8FABA 4MAYA 4XB8A 4WEMB 4WO4C 1NCBL 4IK6A 2A74B 1JK8B 4CAGA 4B9YA 1AS6A 2ZD0A 3GMPA 2EINB 5KW9L 3BQUA 3UZEC 3GSNA 1DEEA 3MRGA 5KZCB 1Z5HA 4QTFA 1EAPB 1T1ZA 4ZSOE 5ICYA 1NJ9A 3P0GB 2C1PA 2ZPKH 5EIQA 5HHNA 3G08A 2PWEA 2ENPA 3OMNB 4RNRB 4Z6AT 2EE6A 4NCDA 4AENB 3Q1EA 4U2YA 1J0JA 4ZFOB 3MV8A 2EYSB 1VKXA 1KYFA 1I53A 4IK7A 4LB8A 4HIXH 2XTJE 2YGPA 5FUCE 2QZ5A 1HHGB 1IGJB 4I1RA 4KV5F 3KPSB 2WCGA 3QDAA 5DJ0A 4C83A 5MEND 2CNZA 2LV4A 4LP8A 3TYGL 4ZODA 1CU4L 2ED8A 3FONA 4RISH 2X4RA 1T2JA 1M6OB 1P5UC 5E8NB 1RZIB 1U8MA 2K6ZA 3NEEA 3HJ0A 5CM1A 4TNVK 3GMQB 2C1OB 2ED7A 1HHIB 2DJ4A 4HPYL 3HZKB 5E8PA 4PJHE 5F72S 5J9PB 1GOHA 4FQHA 3LQAH 4O2FA 3W9DB 2XI9A 4HT1H 5CP7B 1E9QA 3W57A 2XWXA 1OQOA 5FCUL 5JXAL 3JT0A 3R7QA 4ZOAA 1EUTA 4LGRB 4E5XG 4HVBA 4YHNA 3VFMA 4WW2B 1CD0A 2OAAA 5D1XC 5FFLA 1YMME 4HIIB 1S9XA 3H9ZA 4YDNA 5INDB 3TBTB 4LMQE 4P9HL 3A67L 4WUUE 2VMDA 3MREB 4NZTH 5CINL 3E3QE 3FL7A 4CNIB 1LE9A 4XCCL 4KQ3L 2GTWB 3MJ9A 4HWBA 1KN4H 3SQBB 1NCBH 3Q2VA 2EVFA 1RZJL 2YPVL 3H53A 3S8WA 4NYLB 4N24A 3C5ZD 3SDDD 4Z8FH 4RFNC 2YGVA 1I9IL 4X5RA 5IUCA 2QGCA 4EIUA 1JYNA 1F1AA 3B8SA 1JWUA 3NESA 4MQSB 5CCHE 5IJBC 2WYIA 4OLYH 5TE6L 1ZLUK 2FDBP 2AQSA 3ALXA 3WEMA 5IEHB 2F08A 5HY9B 4MXWL 1R34A 2OMTB 1BWMA 3WUWG 1GYAA 3PPSA 3APMA 4J8QA 4N0UE 4NQCD 2ZX9A 3UX9B 3F7VB 3G7TA 4JRYE 2XA3A 3LHPH 4G8GA 4PRIA 2X70B 4PYHA 3CPLA 3HMWL 2ZOOA 2YPKA 4M8RA 4GXVL 2A4EA 5GGVY 5ID0B 2EEFA 2ZUTA 4P5MB 5AYQA 5SWQA 4JGUA 4BWUA 1UVQA 4PGCA 1UM5H 1S7WB 2PP8A 3HE7D 5LBSL 4ABQA 4XPAL 2P49B 1HDMA 3GXTA 4NNXB 3KHOA 3K8MA 5AKRA 1HWHB 3KWXA 2YN3A 4KJWD 2HKAA 3T1FB 4JFOB 3VFWA 2LHAA 3CSTA 4OJAA 3SDDA 2R9HD 5F9WB 3MBWB 2J57A 3ML9A 1YEDB 2YZ1A 2JLPA 3BKML 3MNDA 4OCXL 3E38A 2EC9T 1NANH 2Z1KA 4FQ1L 2VR6A 2FECL 3LKQA 4R3SB 5K1NA 5AW2B 3KR3H 5IOKA 4W93A 4AI7A 5EC1B 4XPTL 1B0RB 4BH7A 1S7UA 3EGXA 3QAZC 3LNEA 2EZ0D 3IAGC 1Q0EA 3F85A 4JFFE 5KVEL 1Z5YD 1N5AA 3MFFA 2J55A 3HB3B 5DK0B 3MGTB 5F6HI 3UP6A 3HCVB 3FOMA 3F04A 4G1EB 2R2HA 4YHZL 3U9WA 1VRSA 4UB0L 1NICA 3CPLB 1HDMB 4FNUA 4NNXA 4KY1H 4WFED 3US9A 1FFQA 2HFGL 3NJXA 4FULA 4Z7QE 4HS8L 1P4LA 2Z93A 1PDKB 4UI2A 3TL5A 5BUAA 3TFBA 2X2JA 5ANHA 1C1EL 3I75A 4NBXB 1CGVA 1D5XB 3O9WC 5D7SL 1EMTH 1MKFA 5BRZB 2X6AA 4XZUA 4UQ2A 4F9PA 1ZK5A 4PJ9B 1M7DB 5ANMB 4MNHB 3HOGA 2YA1A 5F7EH 3JT2A 1R3HB 2VQ1B 2DBLL 4XZUB 3VFNB 1C16A 1CXLA 3WENA 3MBWA 4PJ7A 4Y16C 4ZRGA 2R0WL 3TBTA 3OLGA 1URLA 4S1RH 4DUVA 3DYOA 3D39E 2D03L 4XVSL 1NZRA 4KJQD 4NUGH 3NK4A 4KKRA 1ZCRA 2BJML 3TN0A 3K71B 3REWB 2BOBB 2FO4A 4PGZA 4E42B 2IWGA 5C2BL 5G2NA 3IXAA 5FUOL 4HXAH 5B1JA 2P26A 3BISA 3VGFA 1HHKA 2IWFA 1PYWB 3MLRL 3CFEB 3PHOB 5DK0A 5ENWA 1NOFA 3S96B 1W0WB 2FQDA 2VUKA 1HCVA 5DD5L 4AQAA 2VISB 4XHQA 1YEFH 3HG3A 5F9OH 4Z7WF 1WHPA 3CFCL 3VFOA 5F7KC 2GVYA 1MZZA 2EDFA 1HS6A 5DUBA 2XNAB 4UT6A 4FMKA 2F7OA 2GBUA 1MDAA 4C4KT 3VFUA 2X88A 2FR4A 1L0XA 2NXZB 3NSCA 4PCTA 4JDZA 5AW6B 4HS3B 2XVKA 3NQKA 4JFFB 4R5XA 3OB0K 2MTPA 2A4CA 1IC7H 2K8MA 4TOYL 4DGIL 1ZLEA 2A77H 5F71A 4CMHC 2GJ6B 3IJHB 4G6JH 5FWRA 3RDTB 3FQTB 3CFJB 3WFHB 1U42A 3KXFB 4XE5B 1BG1A 3B7TA 4ZX6A 2R4RH 5DHMC 3HZ3A 5IMMB 3R7RA 4Q9BA 1SN0A 3RX7A 4DP5X 4EE2A 4E2OA 3AQDA 5BVJB 4PRHB 4YDVB 2R1YA 1ZKAA 1FL5A 1TEYA 5T3ZE 2XXCB 3BDBA 5I1GH 4TUOB 1H3PH 2WCSA 1T7ZA 1G9MH 4X9FA 2XCMC 2WKOA 3F12A 4J4PC 2VQUA 5T33H 3UJTL 3O2WH 3WFDL 5C0DA 2WN3A 3WUWA 3VCLB 2DH2A 2FZ3B 4AMWA 4QLRA 3B9VA 4HZAA 5E9DE 1R0AH 2V2XA 2VGLM 4NKMA 5CS7A 2YQ3A 3C09B 4L8CB 5FYLD 4MJIE 1A7BA 1AGDA 4GRWH 3MRQA 4HCGA 4Z7NF 1CYWA 1P4BL 1M2VA 5LGJA 2DD8L 3ULUL 1DZ0A 2J3SA 4GI8A 2QADB 1BD2E 3QUMA 4N8VA 1J8KA 4HK0A 1IB5A 2IPKB 1SFHA 5AL8A 2X3BA 4QRSA 2QR0A 4G71B 4EN3B 3HG1E 1F2QA 4U6VL 3A6OA 5EU3B 3C6EA 3KGSA 2PPAA 5E2VH 3QDMA 1N2RB 3UROR 3MLYH 4U0QB 3MJ9H 4EZLA 2H45A 3G5YB 3ESVF 4QXTB 4CJ0A 2WWMC 4BCXA 5KBNC 4O58L 3QDMB 4U4IA 4V1DD 3BPOB 3IMRA 2NX5B 4LVNB 5DZLA 5IROC 3D09A 4ZMQA 2XG5B 1LP9B 4NKMB 1DUZB 3LZOA 3KLQA 3QQXA 3KW8A 3UZQB 4GSUA 3S3SA 5JZ7C 4DGIH 2VZ3A 5DD3H 2H6PA 4TOYH 3KWVA 1DQJA 2EAEA 3KXFE 3LKPB 1DR9A 1GY2A 1OGTB 4PMFA 3QYCA 1BD2D 1YY9D 2Q8AL 4KGJA 1KCRL 5F70A 1WC7A 5EBLB 4MJHA 3MYJA 3CDFA 4J3UA 3MLXH 1E28A 1P5UA 4KKAC 1ZHKA 4BBWA 2BSBA 1MW3A 3RLSA 3VRLF 3UBXA 3EJYC 3EFOB 5MENA 3TCTA 2NZ1A 3QJTB 3CH8A 4WFGE 4KI5C 2FIKB 3DOIA 3VE0A 4HU8A 1SXZA 4ZFGL 2DWDA 2HSIA 2IOOA 3FFDB 4Z7AA 2YJQA 5LKNA 1C5BH 4CMHB 1PKQB 4M1GH 3CN1A 2LE9A 4NN5C 3SZKC 3KXFA 4EI5C 1DDTA 5T1DH 1WEJH 5KTEL 4M8QA 4TSAL 3O9WA 4FQPA 3ULVE 3QWOA 4YHYB 4PJBE 2XPZA 3FMGL 4YHPA 2MKWA 35C8H 3GO1L 3SKMB 5I5RA 4IBSA 1L6ZA 2FX7H 1I8LA 4J28A 1DSYA 5T1LA 3BO8B 3W38A 3NFSL 1A6PA 1R33A 3MKGA 5E1IA 1M42A 1H6EA 3KDMB 1ITBB 2WPGA 3CE1A 1UCTA 3NCYS 1MEXL 1MAMH 1WS7A 4KK6D 5HHQB 3FU5A 1PLCA 4YDIL 5I1KH 3MLTB 3D3VE 1HOCA 3FTWA 4NWUH 1JWMA 4I77L 1U95A 1FFPB 3VI4E 3OAZH 5IW1B 3WFEL 5FO9B 3T6XA 4KMTL 5ICZB 4FP8H 4NWTL 1JYVA 1G9NH 1JGUL 4ICWA 5FA3A 1XF5A 2I69A 2Z9TA 2ENYA 4MZ2A 4Q6IA 4YNYB 4GW5A 2V5SA 3V5DB 2VR5A 3WJJC 4KBPA 3WL9A 3BD3A 3B7UX 1JD9A 4GLRI 4KMQA 1MJJA 5EMYA 1DVYA 3NPZB 4YZWA 1PZCA 3VA6A 2VDNL 4PR5A 3GSNL 4P2RE 4UNVA 1IM3A 3PWNA 1R5IA 4Y8AA 4PS4L 4PJCA 1H3WM 4FKKA 4R90H 1ULVA 2GUYA 3DHUA 1KLUA 3RIKA 5HVGB 1L9PA 5CIPH 3LV3B 4LSQL 4UAHA 5FUCC 4GQRA 4J4PD 5BZZA 2L7EA 2XRAH 3HPJB 1XAUA 3KM1A 3NCWA 1RL1A 5TF1H 1JPSL 2V8LA 2ZUXA 5CR8A 2F7IA 5CJXC 4GO9A 4XOEA 4K2UL 5BV7H 1IZJA 4WSJA 3L9EA 1BYPA 2VN4A 3H3BC 4G7SB 4ODVH 4UTAA 1DFXA 2AJUL 3QXTA 5AQ0A 2Y1AA 5A1AA 2FATL 5MERB 4MD4A 3S37X 1CQYA 2I26N 4TRPL 3SDAC 1GYVA 4OD3L 3JUYA 3CXDL 3E80A 2QKSA 2YPLE 4MMYB 1AKJD 1F6AB 4HPYH 5KSUA 3VSUA 4OQTL 5LDUA 3MRFB 1BFVL 4MA7L 4KZCA 1GJWA 2YPVA 4XCEB 2DZEA 3Q6GL 3ZSTA 5C6WH 2WMPA 4GI6A 2HT3D 3NFPA 2VUYA 3KPRA 3LEYH 2PO6B 3OKKB 4PG9A 5J0BA 4PREA 1HT6A 3THMH 3FUNA 4UMSA 4H40A 2FSDA 1JG9A 5BJTB 1DJYA 4M5TA 3S36H 1NKGA 4PVLA 1A1MB 4FXKB 3V4VB 3QUML 4BFEA 2PCPB 4EI5B 5FUZH 5KVMC 3OMAB 5GRZA 3HZVA 5K59F 2D7OA 1PFOA 4LSQH 4QI3A 5F1NB 3ILDA 3MKKA 4BUQA 3SO3B 3T3ME 2PETA 4LOEA 4W9CC 4PLNC 2BOLA 4A2HA 1O6SB 4E9TA 1G5AA 5D7IB 4X4XB 4M48L 4RAUB 1FL3B 1RUQL 4Y4HA 3FW6A 4LHJB 2JKTM 1Y18A 2ZQKA 4KVPA 4NZJA 1KLGA 1T03L 1YQ2A 5DJ8B 4N5EC 1MQKL 2Y24A 5C09E 2FYYA 5EH1A 4OKVA 3O9WD 5CSGA 5T3XD 3RY6C 3CDGB 5C7XL 2CDGB 2EDEA 4AYGA 1KBGH 3GSNB 3RGBA 4I3RL 3BP5A 4QTHA 1E7UA 4A38A 3QUGA 1G5GA 2W65B 3QDHA 4KK9C 4OFIA 1C8QA 4R6UA 4UZGA 1K3IA 4KWUA 4ODWA 3EJTA 1BAGA 5CLWA 4BE6A 1JV5B 2IBZX 4RFEA 4NUMA 1DN0B 4PJEF 1ZXQA 1FN4B 2CSPA 4OGAD 4BFOA 3OAYH 5EOCH 2IXQB 2P8MB 1ZE3C 5JHLH 5EUKB 2AV7A 4RAVA 1DQKA 2JVUA 3F3HA 3V10A 2OMTA 1F3RB 5I76A 3MUGA 3OB8A 3GEFA 2BWDA 1JPFB 2O4EA 2XZAL 3U0PA 4PJGF 5JA9A 1U8CA 1XFPA 2PW1B 2BRRH 5K9KB 3QXVA 4TULH 2WXMA 5IM7A 5FO7B 1I1FB 3WS6C 4MD5B 3RVTD 2WLJA 1MRFH 1MHPH 1NCOA 1J0YA 4NQEA 2KZ1B 2HZHA 4XXWA 2NSMA 4PWHA 2Q3XA 2Z7UA 1Z2KA 5C86A 3O8XA 4J3OD 4HIJB 4TVSa 2B5IC 1U8KB 2NY5C 1FUNA 2VCOA 3TZVA 2K45A 5CHNB 3BRGC 5GGRY 2ETWA 1TSRA 4OGYL 1DBAH 1NCWH 4JFOA 3K91A 1PZBA 3ZDYF 4KFZC 5CP3A 3KBHE 2XFXA 3MRBA 4N2NA 4PJ5B 4DQAA 4NQVA 1H0DB 4LFHG 2GJZA 4KTEH 5F88B 4NERA 3HR5B 4JL2A 3KAAA 4JKNA 1Q9WA 2HRLA 5IV2A 4HJGB 3AABA 2W07B 4PPTA 3T3MB 1YEIL 4FXGC 5GGTL 1TF4A 2B59A 4X0KB 4DNLA 3WKMH 1IE4A 3IPEA 2XIIA 3OKDB 1DVTA 2VLJB 3G5WA 2CLRB 2R8SL 2NPLX 4MA8L 1NDGA 3LY6A 1QLFB 2BSCA 2BS9A 5E2WH 1MFDL 3HI1B 4YGAB 3OKDA 4ELMA 4UB0H 3R8BB 3TPUB 2O6FA 1DQTA 4GP4B 5I6XB 3BUIA 3VWJC 4TTGA 4HA1A 3QUZD 4YDZA 2O6DA 3FRUB 1HE7A 2CE6A 1RZ8B 2N1TE 3IJYA 2HRHA 4OZGF 4PRIB 1JXDA 4PJAF 4O4YL 4B96A 3UPRB 3P77B 4NZRL 2H0FA 1G0YR 1G1KA 1PZSA 1XZ0B 2NUPB 1F13A 2OXHA 4GAAA 5JIKA 3UJJL 5DYFA 2WNWA 4CC1A 3FC8A 1PL3A 1HFUA 3QQ3A 4UBDC 3I2CH 2VLLB 1BOGA 1G6RH 4QRSB 2RCSH 1F3JB 1ZY9A 4FFVD 4KO6A 4TN9A 2GIMA 3QS3A 3MZTA 2F1BA 3O6LL 1TQSA 3RZCB 4ZMYA 3K6FA 3NPSB 5AD0B 4JQIA 1IBYA 3LIZL 3KDPB 5A2LH 4H8VA 3CFQA 4ZS7L 3ZQWA 2YMTA 4Z7WB 5AOIA 4M7KL 4JM4L 3BE1H 2IOIA 1V7NL 3MJ6A 1CI3M 3FN9A 1L7TH 1X5JA 3EYQC 1FZOB 4UAOC 4OQTA 2XWBA 1A2YB 4G6KH 2ZX8A 3RVXD 1P4IL 2UWEE 3ILQD 3OLDA 4GW1B 3CFTA 2GHWB 3EJQA 3ARPA 1KN2H 4MJIA 1WUZA 2A5UA 3BUTA 2H6PB 4NHCH 4XNMA 2W9DL 3UTZB 1S7SB 1BGXL 1WF5A 3O6FC 4WI9A 2R8SH 3ZZLA 1NGYA 3GT6A 4OVUA 1MLBA 1I3RA 1SQ2N 4B3VA 2WWMD 3GZKA 1WICA 1HSBB 2F53D 2AKRA 4TQ8A 4O2CB 4Y16A 1XCXA 2RIKA 1D7DA 4PP1D 2OK0H 4ZUUB 1L4IA 5TQ2H 5B3SB 2UY6B 2FBJL 4GUOA 4RMRA 2OMXB 5B1CA 4JN2B 5A7BA 5M95B 1KLFB 5C0JA 4K7PX 3IJSB 3VFVA 3TT3L 1E9OA 1OGAA 1N70A 3PWLB 3ZYJA 1JHKH 2OMXA 2W8CA 1VGEH 1XIWC 4HETA 1QAWA 3C8KA 4G7YL 3RWGA 3FN0L 4FQXA 4KVNH 3COOA 3T4YB 2X41A 4P2QE 1WIPA 1YEHH 5DJXA 1QQDB 5LDSA 1B0IA 3NJIA 4OUUA 2OQJB 3SDYL 1TR7A 1EJ6A 1SHWA 2MNWA 2PPCA 4GKNB 4PJ5A 4R4NC 4CUCA 4F80A 4NS0A 2VH5H 3QCVL 5DQ9A 2H9GA 1Z6JT 4LCWE 2UYLB 1QTPA 3A6BL 3CHSA 3O41B 3GJFK 3LCYA 3MTXA 3RKDD 5FGSA 3M86A 5D4HA 1C5CH 1PZ3A 3Q44A 1N68A 1FL5B 2P44B 4ZO6A 2IMNA 4M7LH 4OZIF 1Y07A 4LSTL 3FQRA 5EBWA 2B1HH 3HS0A 4L4TA 4W4OC 1QI3A 3MV7E 1KIQA 4DGVH 5JHDE 2XTSA 4OLWL 5EFIA 2QDWA 3QIUA 4OVVA 3BH9B 5AVZB 4AVHA 4F8TA 1WFJA 4RDQG 4YBQD 5DHVA 43C9A 3DIFB 3FQNB 1P4LB 4KPHH 4UOQA 3LEVH 3TEWA 3SQRA 4YQXL 2NY7H 2ZONA 3PFQA 2P8LB 3CVHH 4A7GF 4ERSL 1R3IH 4UQAA 1QHOA 3KCPA 4I2XE 4FZ8H 1MI5B 2CPCA 4QT5B 1MXGA 3GMMA 4RH4A 4ZQKB 1BREA 1J0HA 1ZK9A 3S5LA 5DRXA 5IVZB 1G1OA 3U7WH 1UGNA 3TT3H 2VDKB 4MCZB 3B5GA 5FAAA 1FG9C 3BEVB 4YHML 5B7MA 4OGZA 5I30H 3R1GH 2GPZA 3QVAA 3UMNA 1UCBH 2PYEA 4WWOA 2XXFA 5HD8D 3RVWC 2E8YA 3RVTC 4MMYA 1CS6A 4XVTL 4G7QB 1D9KC 3BGMB 1S9KC 1IC4H 4A2EA 2P24A 2X4QB 3UZEA 1E27A 5E5UB 5AUMB 2FJFB 2CUMA 2PP7A 1IFGA 2WP3O 3BKCH 4RMTA 2CPUA 5AOKA 4PJ8D 3X1NA 3PQYD 5TF0A 5K33A 1IM9B 3F00A 5GSVB 1G7QB 3VGAC 3WXWH 4AL8C 5L2KB 3VTAA 3HE7A 1I9RL 4ZSOA 1DQLH 2VE6A 4DH2A 4OIIH 1NFDF 5D7JC 5DVNA 3ZZ1A 2PP9A 2AANA 1FAKT 1J05A 2OFQA 1OHZA 5HGDB 2FL5A 3LRSB 1YYML 4XOCA 3LKRB 3Q1SL 4R4BA 1OAJA 4YXHH 1TUPA 1LJMA 2XXMB 5IW1A 5K59E 4ADGA 1CT8B 1K4DB 1X7SA 2AGJH 2V9TA 2YBRB 3EF4A 1IM3D 4FMFA 2BHYA 1MUJA 2Q7NA 3H6JA 3QCTH 1A4CA 1A8JH 4HULB 4MLIA 4QGTA 4PJXE 2B0SH 2FEDD 4F24A 1CFBA 4YSQA 1FO0L 2NXYD 3GK8H 4JFZL 4Q6YA 3WGUB 3FB6B 3FO9A 2YMXL 1GGBL 3IGAB 5LB1A 3ZE0F 3IDXH 5E8EA 4AQ1A 4IU2A 2JB5L 4XN1A 1B6DA 3VVVA 5T3XE 3QWNA 3V0VB 2EADA 1ZS2A 1GHFL 4YAQA 3NJNA 1XGRA 4YE0A 5IEKA 3EJUA 1RU9L 2NY0C 4HF5L 1JYXA 5CXPA 1DN0A 1CICC 1LO2H 1N4XH 2IALB 4UUJA 3SPGA 2CA4A 4A67A 1P84K 2XBDA 1TSHA 3CFBA 4ANXA 1DVFD 3RL2A 3WI9A 1XMWA 5I16A 3MUGB 5EC1A 4AIOA 4AGQA 4BFNA 4FI8A 1AXSA 3SQOL 1CVSC 1V3LA 3HS0B 5CU5A 5KVGE 3WXWL 2F7PA 4L4VB 4NFBA 4OZ4B 1TO4A 4JY4A 2GJJA 4X5QA 4A6YL 5IOPB 4GP8B 3AAZA 4B7LA 4ZFZB 4NAQA 1HHIA 4WWKC 3JVFC 5AYUL 1AO7B 1V27A 5JW3H 1MCCA 4DVRH 1W0YT 1TZHA 2E8ZA 2J6EA 3DSNA 12E8L 2L7UA 5CF3A 3QPKA 1LGVA 4NFCA 1KN4L 4P23D 4CKVX 2VERA 5IHHA 4Q6KA 4Y1AB 1T7WA 4MA3A 3WFBL 1KIUB 3S3JA 4NQSA 4P2OD 4ZQKA 3QI9A 2K78A 4P4KB 4HJ1A 4NRXA 1NC4B 3DTDA 3L3IA 4MYWB 3OSKA 4XAKD 3FRPG 4TUJB 1MWOA 2E47A 2CUHA 1AOZA 3PL6B 5B1KA 2ZP0T 1BXXA 3KYMA 4NQXA 2VW6A 5KBMA 2FX7L 3PGFL 4N2KA 4UTCA 5I71B 3QEHB 4XNAA 2EVJA 1T7YA 2YSSB 1ETZA 3MU3A 3R19A 3TJPA 2R39A 4WJKB 1NPUA 1B0GB 2Y7MA 3Q2LA 5DS1A 3ZHDA 3GWJA 4I85A 4K15A 5F7BA 1NCAL 3MOQA 5EEWA 1NAMA 1ZT1B 1AMXA 1PX4A 1MPAL 3HEIB 4HHGA 1NCTA 4OFVA 4JM0A 3EFFB 5CEZE 3IDIB 4S1DD 5I6OA 4XMTA 1ACYL 2O5YL 5CHNA 3BAIA 2RAMA 4M4PA 4KRPC 5H2BA 1J1OL 3C5XA 3UH8A 8PAZA 2HT3C 3D08A 2B4CL 1KXVA 1WWWX 1JZFA 2NXYC 2ZCLL 2VE6B 1VACA 4ZT1A 3WXVH 5JXEA 3DLQR 4Y4KB 3P0YL 1FP5A 2IDTA 4KK8C 3MV8E 2AV1B 4P5KB 5LWYH 4PRPB 4OJCA 5E1GA 3LN4A 3EADA 4U1SA 5HHMD 2X42A 1E6JH 5KSUB 2WVSA 4JQXC 5FR3A 1J8HA 1NCCH 3QISA 4Y19B 3ILPA 2CO3A 5D70L 3VWJA 1CXEA 2C3XA 1KTBA 4JN1H 2WGNB 3FSWA 1Q72L 2J2ZA 1EMTL 5CWSA 1EEUA 3FO0H 2EIJB 2FEEL 1ZIAA 1GC1L 3VXRA 4YBLB 3BQVA 4M61A 5IHWA 1CIUA 3L3DB 1A47A 5EB9A 4IBWA 5G4OA 2B7DT 3NCJL 1QWUA 5E9AA 3QWRD 4OI7A 2LVEA 1XCTB 3D30A 4DEPB 1PVHA 1U8MB 1P2CB 3AFLA 1C7SA 2GTZB 4KDTC 3IDGA 4Q4EA 4K55A 5D2NB 1KCVH 3GM8A 5FW7A 3U4AA 5HVFB 4IM8A 3L48A 4I4WA 4FI7A 4WWID 3EYSH 4BZ2H 5J13B 5E8PB 1IAKB 5IMMA 4ILDA 4WU7A 3TEXA 5E6YA 3BAJA 3IKCA 2X3AA 1ZJBA 5AG8A 4YPGA 3CQFA 3B34A 1DJHA 3WTXA 2ED6A 3QWQB 4JFHE 4KX7A 4PJ7F 2KDGA 1YNTB 1T3FA 1MPAH 4A68A 4IRJA 1OAUH 4KRNA 3ZMRA 1JZGA 2HUEA 3CZJA 4N0YH 3UZQA 2XLLA 2ZXAA 1OB1B 3FTYA 1CXHA 3SE9H 1U3HB 3RJQB 5CAYB 1PNDA 1NMCB 1YC8A 5MHSE 2ITEA 5F89A 3JVGA 3MNWB 1NUDA 3RIAK 1T0MB 2E7HA 3AADB 1V3JA 3B8YA 5ICZA 2E9IA 5DWPA 1NLDH 1U3HA 4L3EB 2K70A 1TEFA 2BZ7A 4RNRA 2AXGB 1TJGH 4WO4D 3WLBA 4WHTA 3AS3A 3R06B 5A6LA 5JA8B 3IBEA 4XHJD 3O2WL 5KYYB 4JJ5A 3QZWA 5C07E 1AZCA 1KEGH 3QJOA 1PAMA 4NO5B 4W6YB 4PB0L 4HWEH 3RTQD 4UOW1 2ZOTA 4NHUA 4K8RC 4PBWD 3DX2A 4KXZI 3CSFA 5T5FL 2ZYIA 3FHQA 2NCEA 2G30A 4UV4L 3ZTJG 4YX2L 5HSFA 1XF3A 1PKQA 1BPVA 4PY7A 1F6FB 2YSSA 1DZBA 1N9PA 4D7PA 3NT0A 3LH9A 1U93A 3ZKMC 3ULVC 3SGEH 4NO3A 3IJSA 3VFVB 1LP9F 4DN3L 5AB2A 5K9KA 4B9JA 2DQUL 1SMOA 5IJCC 2H26A 2LOEA 4K5OA 25C8L 1CYXA 5DDHA 1A7QL 1KTCA 3CWGA 4C4KO 1OAZH 1CLYH 2YD1A 2C5DC 4M1DL 1DEDA 2JKXA 2YD8A 4JFDD 4K7FA 4MA8H 4U4BA 2H26B 5EIIA 2PUQT 1MFBL 4OCRH 1MY7A 1G0XA 3BXNA 3ZPDA 2FCBA 4OUUB 5LJYH 2V37A 1NWPA 2CO4A 3A4AA 3QHFH 4KKNA 4A6YA 2NNAB 4XMVA 4YQXH 5HI5C 4Y4KC 1SN2A 3CFMA 4E41A 4NN6C 4Y7MA 3AAZB 3D87B 3HVNA 3ZKNC 3B7SA 4G43A 2OMUA 3UL4A 4NQEE 1RP9A 2PXYD 2VLKB 4JREC 3U7WL 1NUFA 5KS9F 4KZEH 1Z9SA 3QAZB 1J8HB 4ELME 3QI9C 1GL4B 4TULL 2JKWA 2B1HL 5D1ZI 2TSBA 1AD0B 5DTFB 1JNLH 5TH2A 1L9SA 3GPSA 5JMRA 1X6LA 4HWBH 4UMGA 3CD4A 3P4OB 3QUXD 5DZPA 2VB5A 1QTYT 4OCSH 4XE0A 2FEEI 1QACA 4ZMPA 2JKLA 3BZ4B 3QDGE 1I75A 2DEWX 2QQLL 3Q48A 4PTUA 5DHYB 5D4QA 4LPTA 3IM1A 5DD0H 3LRKA 3NIGE 3WS6A 4HPHA 1W2KT 3B2VL 1QD0A 3MUZ1 3S3PA 5KWYC 1F4WL 2KMWA 3VXNA 1UUSA 4FQJL 3TBWB 4ZX3A 3O3BB 3O0RH 2YQBA 3EO1B 3QJUB 1IC5H 4MMXB 1MCPL 2Y4SA 4N6RB 1NBVH 1ZT4A 4OJEH 5ICUA 4PJ9C 1C12B 1F5WA 1N19A 4RA0C 1VGKB 2GYSA 4PWEA 3RVXC 4G9FE 2JJUA 3MO1A 1ZLVK 3WUWB 5C08D 1MNUL 1T3FB 3BGAA 4ONFH 5EO0A 4M48H 1AE6L 1QFWM 1TXKA 1C1EH 2EECA 3AGVA 5AVTB 2CMRH 2EE2A 4O2EB 3UEZA 2OMYA 3U4BH 3QRGH 4JFHD 1JTTA 1SDAB 1VGEL 4PGBB 4QY8A 3QQ3B 3IDJB 2QFPA 4JM2F 3VQLA 3INUH 3ATFA 2HKHL 2WZPA 1KXVC 1HZKA 4N8CL 3WTWA 3IGUA 1A02N 3C5ZB 4YDLB 1A0QL 4I87A 4PJFE 4Y19A 4YH6A 2IV9A 4G6MH 1RUML 5IESL 4AW7A 4X9BA 5JW5A 3EF7A 4KHTH 3GXFA 3P3TA 5J7CC 3N42B 2VMCA 4HXBH 5BS0B 4H25B 3MJ8A 3HI1A 5TFSH 1JTPA 1UFGA 1CGSH 1R19A 1U93B 1ACXA 2OA9A 1DQML 3L3GA 5I16B 1QPKA 3TO4D 5BQ7B 2J4WH 4H0HB 4FMVA 1SVZA 3CSGA 3MFFB 3MHZA 5FCSH 3FB6A 3FO9B 3R4DA 1OAYL 3BYYA 3BE1L 2F8XC 2A9DA 4V2CB 4AQOA 3WEAA 3QDGB 5IY5B 4N5UA 3SDYH 2QVKA 3EUUA 4Z5RB 1WZLA 4J3WA 5D6DC 5LAXA 5JW4M 2P45B 2ZSVA 2BP0A 3VGDA 5IQLA 5L6YH 1NIBA 3FT2A 1JZ3A 2CIIA 3KPSD 3UJIL 1KBGL 1HQRB 5HPOA 5C8JB 1Z3RA 3BT2L 1AD9A 3ETBJ 4XPFL 2J6WA 1F58L 1FPTL 2WBJB 4WI5A 4AIXA 2UZYA 5BZDA 3P02A 3NFPB 4QKXB 4B9IA 4NM4H 4G9FB 3F7RA 4ODXB 2GCYA 4XC1L 4O51B 5E6ID 2IQAA 1EXHA 3DMMA 3IS1X 4MS6A 2G5BA 3B6SA 4UT7H 4L18A 1E8YA 5H35B 2HJFB 1OKEA 4HU2A 4XN7A 3AREA 3UBGA 1FV1A 1RZJH 2YPVH 3N06B 3EBGA 3B7RL 4GT0A 4GT7A 3AW5A 5I5JA 4HHWA 4PY8J 1IARB 4M5ZL 4JVWA 4AMKH 2CBPA 4A37A 3C09C 5AFAA 3T77A 2SODB 4R9HA 3D0VB 4YFLF 4G8FB 1AGFB 2OR8A 1X7TA 2EQDA 4NWUL 3O3DA 3QUMH 1F97A 1I85C 3NJFA 1KCUL 1P4IH 3ARDA 4NCC2 1IEAA 4F2MB 3WY3A 4ENZA 3IF1A 2YO3A 4W4OA 4JG0L 1J1XL 4GMTH 1HZLA 4Z7UA 2PTTB 4M5SA 4P2OC 4ZMNA 5C97A 5E4EB 2YUZA 2XKSA 1N26A 2ROXA 5CJQL 1T66C 2OMYB 5DD5H 2OULB 2ODIA 4ZUVA 3I02A 2P47B 4MCZA 3GO1H 1T7XA 1EO5A 2X4UA 1NCIA 2EXSA 3KGUA 5IMOA 4ZTOL 1JVKA 4OBRA 4MJIB 5PAZA 3TO2B 4Y2DC 1BIIA 3M1BA 4LU5L 3UO8B 3WO3B 1QBMH 1XGYH 2EH8H 3BDXA 2HG5A 4IHOB 2WXQA 3HBQA 4NN7C 5DMKA 5H4ZA 3C5ZC 2Q86B 1UACL 3PWNB 4IGBD 3LSOB 1S9YB 4G9DA 1PS3A 2AJUH 3G6AA 2VLKD 4EPSA 5JIHA 4LPWA 2D03H 4XVSH 5SX5H 1E5CA 1RIHL 3F8UB 4JFEE 5B3NA 3NIFF 5D72H 5HHOA 3MRLB 1G7LA 4NO2B 4U1GC 4XPHL 4J3SA 4APQB 4RRPA 3G6JF 4NC1E 3F6JA 2XOTA 3ZL2A 2D0GA 5E8NA 5KVEE 4H88H 1KCKA 2NY2B 2ZPKL 1IFHL 1MAJA 2CIKB 3GPEA 5ALCH 2VDPB 2C3VB 3L7EA 3QDME 3AS2A 4HALA 3EO1A 1NSNH 2RFXA 2AEPH 2XWEA 2VDNH 1BJ1J 3TJHD 4CC0A 1T20B 4JHAH 4ELKB 3VI3A 1RUAL 3IU4L 3MNZA 5JHDD 2V9UA 3DK0A 5CZXC 1UM6H 2DQFA 2VDNB 3MO1B 3GS0A 3WN6A 4X4YB 3ZO9A 5HYIA 3TN0B 3EUDA 2J5LB 3SYPA 5TDOB 3H3KA 5F3BB 2DQFB 2OBGA 4FNLL 1A65A 2AF2A 2ICEB 3ZRCC 1I85A 3U7YL 5FHBH 3ARFC 3E9TA 1NFKA 3MGOA 2QPEB 2X38A 2NUTB 1IRAY 5BZWB 3OXRB 2J43A 4HH9A 4LU5H 4LF3B 1IQWH 4WTZA 2B59B 2QTEA 1CTOA 5I73B 5T5FH 2BINA 1BMGA 1UXMA 3T0EC 1MCHA 3NCXA 1KXTA 3ZDZB 4OM0H 1I1YB 2DQHH 2KPNA 1MLBB 2BNRE 3FQNA 3PAVA 4ZNCD 1RUKH 4EUPB 3RVVD 1O7DC 5EU4A 1CDHA 1UB5B 2CGRH 4R8WL 2W0LA 3AWGA 3GD1C 2OW7A 1M9SA 2NY5H 1FDLL 2J6EH 1K6QH 1YJDC 3KL0A 5EU4B 4E9XA 3IMBA 5D1QD 5T1DL 4XVUD 1Y0LB 4ZPVB 1IO4C 5IF0B 2YKLH 2IAMC 1NBYA 4UYQA 5IROA 1FNLA 2GT9B 5CCKH 4A63A 5KG9B 4PY7B 2DMBA 5GSRA 4YXKL 4WKZB 3PS6A 5MHSD 2ZKXA 1J5OH 1TJHH 1NLBL 4QIRA 4UIMB 3VSQA 2O61A 2JKJA 4QRQB 5E8OB 2A6IB 2ZKHL 2W60A 5D8JH 2X4OA 5CSZA 4BCYA 3GSNH 3VI4B 5JIDA 3ULVF 5BV7L 3ARGB 1Q9OA 4OLYL 1IJ9A 5A2IH 2VR9A 3O8XC 2CHWA 2VC2B 3VXPB 1KCRH 1D5ZA 4R5VA 1M2VB 2LQRA 3SKMA 2V4LA 3I6GB 3PWPA 4FFZL 4GAFB 3KLHD 4I18B 5E24E 3VACA 4WI8A 2E6JA 1BQLL 3ZGHA 2P80D 4KVCL 4GIPD 3UYRH 1FJ1A 5L0QC 3EYQD 1BFOB 3P73B 1RK1B 4WNQB 1SY6A 5HHMB 3OHXB 3CBRA 4I48A 4PJGE 4PRPD 5KVDH 1YEWA 4XH2A 2N7AA 4LQFL 4MJJA 3ARBD 5FO2A 3N04A 4OF7A 3VJ6B 1N6QH 4ZD3H 4D8PB 1EZUA 1MNUH 2WNXA 2ZP9A 1WFIA 5JPNC 3BAYA 4JL1A 4M62L 1I9EA 1T80A 2I5YH 2B2XH 2KH2B 4GH7B 4XN5A 4HD9A 1RPKA 4K71C 1NEUA 1WITA 4LLDA 4PBDA 4RBPK 4CU7A 2WAHA 1CQKA 3GDBA 1NBYB 3D39A 4YHKH 2XWJB 1RPQA 5J3HC 3H2PA 1VFBA 2BOCA 1PLBA 2ALWA 1BQSA 1LMKA 1UASA 4PJ8C 1QW9A 2A3TA 2X0UA 4PW3A 2XN9D 2Q5BA 1ORSA 2Z0UA 2AJSH 3EJSA 2AP2A 4PM1A 5B38G 1KENL 3K72B 4JZJC 4WEEA 2D31A 1YN6B 3CVIH 3GBNL 2CU9A 1BF2A 3ZTCC 1UYWL 5GIRB 3EJZC 4TRPH 1FFOB 1OZUA 4WU5A 3N44F 1IGMH 1QP1A 3KPTA 1KGUA 1SJEB 2CGRL 1LD9A 3MI6A 4R8WH 3AU1B 5A2AA 2DYPD 3ABMB 4LASH 3LN9A 1LO3L 4N1HB 4U1KB 1P1ZA 2EKJA 1XBDA 1DQMH 2R29A 2XQYK 1U2YA 2E4FA 1W80A 5EULV 5I73C 4J8RB 2IAMD 4NT6B 3AG3B 2F58H 3SGEI 1PLGL 1DANT 2BVQB 1VFBB 1ZT7A 4U1MB 3L3GB 3L1FA 3DX4A 1SEBA 1V3MA 3RKDC 3QRGL 4XB7A 1M2OA 3HRPA 4N0CD 4X5PA 1OB1A 1AO7D 3H9SB 4PRNB 1QBBA 4X7TB 3MROB 4A2FA 3GXDA 1U8QA 2BVOA 2VR7A 3N1FC 4R0LC 1BA9A 5DURD 1MFBH 4OCRL 2MCMA 1PY4A 2J12B 2F19L 2MRYA 4PN6A 2FJHB 1JBJA 4X8CA 4P5RA 1KWKA 4RZCA 5MI0C 1LNUA 3BHBB 4H44C 5KYUB 1WP6A 4KRPB 1OW0A 3EYFA 5BUPA 4FTVB 5T1MA 3CSPA 4ZMAT 3MLUL 1OP3H 3NH7L 4GBXA 4I77H 5EZOL 1GGCH 4C56D 1Z9MA 3LXCA 4YDIH 4ACPA 3RUGF 1HSAB 2J8UB 3O4OB 4TUUA 3SEPA 1LO2L 1N4XL 2DKUA 1JD7A 4XVOA 4R97C 3TCLA 3ZKXC 4IRSA 3DVNB 4X4ZA 5FA3B 2C9XA 1LO4H 2V7HA 3ARXA 2X4OB 3CK0L 4TNWF 5TK4A 1MIMH 2IC2A 2MPVA 5E7BA 3HI5H 1NCAH 2OL3H 4X7TA 5CZXD 3O8XB 2H32H 4K3EL 3QDJE 2ZT9C 2G4EA 1BHGA 4ZW5A 2UY7B 2X89D 5GS3A 3VW3H 1S7QB 2GUOB 1XCQA 2JJWA 3GHPA 3WG7B 4CA4A 4Z7NB 3TONA 3ZYOA 2AK4D 5HDQL 4OCSL 3L3KB 2Y5EA 2ZUYA 3MRCB 4DGWC 2A99A 4R26L 2GTWA 3CMOL 4R7DB 5F2FA 4FG4A 5J13C 2YC1B 1I3UA 4FXGB 2JELH 2W0FA 1UVQB 2N59A 4MX7A 1JNNL 4A7VA 4OZIA 4NRYA 4XBPA 1H15A 5EBMA 4EUPG 4WWNA 3B9KA 4K71B 1T22A 2JQMA 5H4YA 1SPDA 4PRHE 5A6MA 4HUWA 4OFYA 5CLXA 4PJEE 3KJ6H 2E7DA 1NM4A 2PW2A 4PJ8B 2ZOLB 4AE1A 2P4AB 1HKFA 2ZKWA 4N3UA 3WCYA 5I15H 3VE0B 5DJ6A 4KV5E 3VXMB 1S7XA 5F8RC 1GXEA 1A7NL 2Q8BL 2OR9L 2OMUB 1ONQA 3X11A 4WQOA 3H9SE 3QEHA 1MREH 1MCKA 2MPAL 2NTSP 4K23H 1I31A 1SRDA 2QZQA 3LV3A 4QXVA 4HUCA 4RDBA 3VXMA 4F93B 2NNRA 4J5VA 2WXIA 2YUVA 3ZDWA 1AZNA 2V3DA 3MRDA 1J9CT 4R0LA 3UTPD 1G7IA 5F7HA 4PJHF 1BVLB 2QHRH 4PV9A 1M9WA 4D0CB 4PB0H 1ADWA 5D4JA 2IH9A 4FQIH 3ZKQD 1PJ9A 2AK1L 4IOSA 4X4ME 2A9CA 3PXLA 3LQZB 1HIMH 4QRFA 3BWUF 5LWYL 3E9UA 1UWYA 2EYTA 3FNKA 4X6BB 2EDXA 3F64A 1I1RA 4ZUSA 1CMOA 4P3WA 1UWGH 2YR3A 2BP0B 2C3WA 5IOPA 5FYLH 1Z0MA 3MV9B 1KCWA 3MROA 5GZND 4NQVB 3CMOH 5DS8A 5DZAA 4ICXA 3X1GA 3Q6FA 1P4BH 1AMYA 1T6WA 5DC2A 3PPEA 4HUWB 2AXFB 5DJDA 1GSKA 2OLDA 2DQDL 4A7TA 1YAIA 3AB0C 1NC2B 2NW2A 5GGQL 2XKNA 5CZKA 3STLB 1S7SA 4FFWC 5BJTA 4D0DA 2GITA 2A74C 2BSEA 1I3GL 3L4XA 5FV2A 5EU5B 5HTSA 3P1VA 4F58L 3H42L 3FUHA 4RCAA 4EVNA 4JK0D 5HGHB 1SJHA 4W9IC 5LUMA 2Z31B 4Q89A 1RXLA 3RTLA 1ZVHA 4RSVA 4NUJB 3LEXB 4WDIA 3P2BA 3I6KB 1I1AC 1BQKA 1J9TA 2Y06H 4ELMB 5KYXB 3MCKB 1X5HA 1LK2B 2UWEB 2FT8A 3DXAA 4IHBA 2ATPA 1ZHLA 1QZNA 3SDDC 3T2OA 5EU7C 4YPGB 5HHXH 1QR4A 3IPBA 4O2FB 3W9DA 1TETL 4FI6A 5E5MA 1F4XL 4KOCA 4PWFA 3V6FA 3DO7A 3K0WA 1AP2A 1E50A 3U9PL 1DJZA 4YPJA 2FNBA 1IGIL 4X6FA 5IB1A 5AEAA 4P2QD 2ZTBA 3WHE0 3OKNA 1A6AB 2G3XA 2X6CA 5K1VA 4YUEL 3SDCB 3MRIB 3L54A 3ROOA 1J18A 1F8TL 2ICWJ 4U3CA 4UIKH 3L1GA 3LS4L 5JQ6L 1U0QA 3D5OF 1SNRA 3FZUC 4O9HH 2X7LA 1B9KA 1D6EA 2NY7L 2IPUK 1TT6A 4W9FC 1SOQA 2GAZA 1EO8H 2VDRL 3DROA 3W0WA 3HI6H 3A47A 3IDYC 5A2JH 4YNYA 1O7SA 4NSKB 3S97C 5DHXB 2L8AA 4EN2A 2FWOA 2R1WA 4PLJD 3VYOA 3FU7A 3BH9A 1JFQL 1KELL 1MJ7L 1VEMA 4P2QB 5T1MB 1UXWA 3KPLB 3BYTA 3KLDA 3VXNB 5IB3B 2G9HB 2I7SA 3QHZL 1C5CL 4NUJA 4UT6H 4X7DC 3DUSA 4LBEA 3MJ7B 3WS3B 1HXMA 1JZDC 1W15A 4EI5A 5AZEH 1JHLH 3VDBA 3ZOAA 2VITA 3F7PC 2QV2A 3LIZH 2OI9B 2VH5L 4OLWH 5J1AB 4KXBA 4JN2A 4UILH 5HHPB 1JGEA 1DL7L 1BAFL 3EOTL 2DQMA 5CBAB 5FM5O 3B43A 3D3VD 5FOBB 4OIBA 2EIBA 2Y7NA 2HG0A 5DFWH 3V52H 1OT1A 3LKNA 2A74A 4ODHL 1PW3A 2Z31D 4QLWA 1KZQA 3EO9L 4NXKA 1YDPB 3OKLA 1WZKA 1IAIM 3IDMB 3K2IA 3NJVA 5SV4A 2ZG2A 5AVUB 4KZEL 3FO2B 4M62H 3NIFB 3PWLA 5CZRA 3KYOB 2QGBA 1AGDB 1YVLA 2FIKA 1MI5E 3CBJB 1ORSB 4DO4A 3W0WB 3UTSA 2ADFH 5PCYA 2ATKA 1TLKA 5C0CB 3VH8A 3LRMA 4KVCH 4JMNA 1HXKA 4N3TA 5CUSL 3UAJA 3MLPA 3GTVA 2G3ZA 4MXQD 1SUJA 3U79A 1RZGA 3H2WA 2C26A 4GSQA 3CX5J 4EUPA 3FONB 3HHMA 1RY7B 4HX1B 3UTZA 4L8BB 4IBLT 2I24N 3FRUA 1MCEA 1EFXB 2XBTA 5KSBA 4P9HH 3EO0B 2FB4L 5DVLA 3LEXA 3QRBA 3GB7A 1QSFE 2EDKA 3BAEL 3QUYA 5CFHA 1A64A 2WWKT 4YSDA 5E2TH 1NUNB 5GPRA 1MWAB 3MLSL 5I66A 4IOSD 4YDMA 2WBJC 4X6DB 4NHCL 3CBKB 1BVNP 1THAA 2FX9H 2P43B 2VZSA 5CN1A 1EGJH 5GGSY 1OE3A 5J06A 3V4VL 2AV1A 5GRWA 4TLKA 4OZFG 2CBMA 2YAEA 3WAKA 2E7LA 2ADIA 2Q20A 4YHLL 2YD7A 3VXMD 1A6AA 1I8MA 5FW6A 4QXTA 3SDCC 3LDBC 5GRJH 3TIEB 1M1XB 3VD7A 3HPLA 2X1QA 1FFNA 4ODHH 4N68A 3UAJD 1QKZH 3JV6B 4L23A 3F2LA 3FTSA 2ENJA 4BINA 1M6UA 1TJIL 3C8DA 3S35X 4Z3JA 2DM7A 2QPDB 4U6TA 1LHZA 3RX9A 3GLDA 4P59L 2HWZL 5IFAL 1FGNL 3TNMA 2IV8A 1V7ML 1LO0L 4FXLA 1OSYA 4GW4A 3HZYA 4WWKB 3WSQL 3BPNB 4J3OH 1S3RA 4MNQD 2AK4B 1JGVL 2QSTA 3W11C 2Y1YA 5HGDA 2HAZA 5DRNA 1YQVH 4KNQA 1J9SA 1H5BC 1K3ZA 1XD0A 2Z31A 5I6LA 4LEXH 2CG9X 4JAMB 3HLKA 2IPUG 3P4NB 1JZEA 5DWUH 5IQ7L 2A83B 2OJZH 4JM2D 4F8QA 2XVGA 1PEZA 1KCSL 2F54E 5D2LB 1B6UA 3EBIA 5C0AE 5ACZA 1DO6A 2G2PA 1YN7B 1QFWI 4HIEA 2WUCL 4WI3A 3VXOB 3WGVB 3ATBA 2IANE 3QJHA 3ZE0E 4AZ8A 3TWCL 1F1DA 4EI5D 2NSQA 5IW6B 2H1PL 2R23A 2W1NA 1ETJA 2EDTA 4H88L 3RDTA 1BQUA 4GAJH 2XA8H 3H4HA 4N6QA 1MAKA 3PU7A 5AOJA 3ABGA 5F0MB 5DSCB 2O30A 4Y2OB 1GZHC 1UA7A 3GMLB 3V9CA 4Z1PA 5F3BA 5KJRH 1U36A 2E9GA 2I60L 4OF3A 5DUPH 3P3SA 5LHDA 1XEDA 3MRPA 4HJEA 4FEMA 1BVKA 4XCYB 1LP9A 3QZLA 5H94A 3BW9A 5INCA 1TTUA 4GUQA 3HNTH 1XGYL 2EH8L 1X9QA 3KEDA 3MC0A 3H9SD 2BY1A 3OX8A 3APNA 1ROCA 3ESNA 3HZVB 1MRFL 5H35A 1XBRA 4AZUA 2EVIA 5I5IA 4EIGB 2P28B 1SJXA 2WLLA 4G3YL 4TPRL 4D3CH 4PJDE 3OGCA 1IAMA 4MKMA 4AYID 4P59H 1BVOA 2I25N 2CA3A 2DLHA 1JWSB 2Y23A 4XVJH 5C0AA 4PCYA 1HXMB 3FN0H 2IAMA 5JYMA 3UG5A 1AZUA 1WLHA 2KLSA 2BERA 3WNLA 2NQ3A 3HC0B 1OSZB 3DXAD 4NX0A 1TYJA 3NIDE 4M8UA 1BQ5A 4XXCC 3U6XA 1JAEA 1EHNA 1TFHA 1OO2A 1ZGLA 1L9NA 1TVHB 2ICWA 1RIVL 2WXKA 1P1VA 2APSA 4X50A 4X8GA 4AKPA 1KYOK 3V0WH 2V2XB