4FEMA

Structure of suse with alpha-cyclodextrin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
SLTPPKTMFIVGSMLDTDWKVWKPMAGVYGMDGQFYSMIYFDANSEFKFGTKENEYIGINDNRVTVTDKAGAGVSGSDNFVVENAGWYLFYVKAAVKGDDYQFTITFYPAEVYLFGNTTGGSWAFNDEWKFTVPATKDGNFVSPAMTASGEVRMCFKTDLDWWRTEFTLHDGEIFYRDFNLIDSWTEKGDGYSIQGSAGNVIHLNFTAGTGEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein SusE
publication title Multidomain Carbohydrate-binding Proteins Involved in Bacteroides thetaiotaomicron Starch Metabolism.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Carbohydrate-binding protein
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16411 SusF_SusE Outer membrane protein SusF_SusE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3610 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA02
2.60.40.3620 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA01
4FCHA 4FEMA 4FE9A
chains in the Genus database with same CATH superfamily
5F88A 2KDYA 3Q13A 1NPUA 1II4E 5FKPA 4PD4J 5EZJA 3CE1A 2CBQA 4CVZA 4LOUC 2K4AA 3KGSA 3I3DA 4FJYA 2OZNA 3OKOA 3WTUA 4F7KA 5FUCE 4AUUA 4Q9QL 3VQLA 3NVQA 1AD9A 3BIKA 2ROYA 1X4YA 4ABVA 4E9WA 4LDOB 5LNEA 3BW9A 1BMZA 4H88L 5JYMA 1XX9C 1YECL 4Y1AD 2AABH 4TULH 1DQLL 1HHKA 1AI1H 2ZUQC 5TQ0L 4D0BB 3TN0C 2IANA 4ONFL 2HLFD 4G6JL 3NRFA 5L2KD 2NY4B 4H8WC 4YSPA 2ZONA 2ATPB 2HRLA 2HFGL 3EYFB 3NFNA 3AUVA 4HGWA 4RFOH 3TNMA 4GXVL 4P23A 5DMGD 1AO7E 4RFEB 5BRZB 2HT2C 3ZL4H 1A3LH 3BAEL 1CDHA 5DUML 3JWOC 4HAKA 2BS9A 3WS6C 5KSAA 4H0LC 5FC9A 1SDAB 2BMKB 3RL1A 5IMKA 2X4OB 4AQ8C 5FXCH 3QCTH 5C70A 4JRYD 4Y2OB 5DZJA 3OB8A 3UBXG 3WNLA 3KXFB 1XTMA 4UT9L 1EGJA 2A3TA 1U8PB 3HG3A 3N1FC 4UINH 1U58B 4G3YL 1X5LA 2AMGA 2YD8A 3PNWB 5DQ9B 2HH0L 5HDOA 1OO2A 3O41B 2NNAA 2JELL 3UL4A 5I1AA 5IVZB 1CFQA 1GSMA 5GJTH 3ATAA 1BZ9B 4IHOB 1GR7A 3RGHA 1QATA 1H9DA 4DGWC 4PJ9D 3KS0J 1QYGL 3NCFB 1XXDC 5GS2D 4A6YB 3A6BL 4NPKA 4Z7QB 4U33A 4HKJA 1E4XI 3GIZL 1B6UA 4N26A 4KKQA 3S48A 3DV4A 4PCTA 4APQC 3K6OA 5EO9A 4EQ3A 35C8H 1KB5A 3BH9B 5AVSB 2M83A 3ZTDC 4C56A 1EQWA 5BZWB 2WVTA 2YEQA 4MAUL 3AAZA 3RX9A 3D85D 1N64L 3RILA 4NLAA 1DJSA 1DQLH 3N40P 4ICXA 5AB1A 1E40A 3ESMA 1MJJA 5JPMB 4PV8A 2HTLC 1A7QL 4ONFH 1FV1B 2VDNH 5D2LA 5KBLA 2J21A 4DVBB 2HFGH 3V6BR 5CF3A 3QJVB 1DDHB 2MKLC 4OJYA 2HLAA 4GXVH 1I1AB 2LTQB 3W0WA 5HHMB 2IVFC 2HRGA 4PJCB 3WKML 5ADOL 1FF5A 5HTSA 1I7TB 4IEFA 5C0AB 5F7AA 3BAEH 4PRHE 1NCDL 5DUMH 4ZXBA 1HCFX 5JPNC 1R5VB 2IAAC 2AQ1A 3DGDA 5T1LA 3V4VH 2JI3A 4GIOA 2X28A 4QRFA 1I8LC 5EZPA 3SPVB 3DJSA 3PHQA 5D9SB 3MR9B 5B1BB 5A3ID 5IVXE 3WXVL 1MCOL 1DSYA 2WLKA 1JZJA 4TVPL 5JDSA 4M93B 3NJIA 5IW1B 2V4LA 3LHAA 1NICA 5FUZL 1ACCA 4U6VL 2ENQA 1DQTA 4LOFA 1HI6B 5AG9A 4IBUA 4QOKE 3FHAA 3SBRA 1YUKB 4Y5XC 4KO6A 2OV0A 2WZ5A 5LNDA 1NPNA 2CMRL 3TNNB 2NDFA 3RIFK 5JO5B 4GAYB 3NJHA 4UQDA 1QYGH 1YNLH 1Z9PA 3A6BH 3DETC 4ETYA 2ZWKA 4NO0A 3WL9A 4EQ2A 1VEMA 3VRIA 4WFGD 1IE5A 4WV1B 5AW1B 4QDGA 2XKNB 1AG6A 2BOBB 5I30H 5DZAA 4ZO6A 3KGRA 4O4YL 2GIXA 4JX0A 5A6LA 4XN8A 4MAUH 1A6PA 5KSAC 4P2OD 2IBZX 3VWKD 4HD9A 1CF8H 3ROLB 1TQWA 4WNQA 2XNAA 4EIGB 3CN0A 3AWEA 4HIHB 5IK3A 4HZLA 2ALAA 5DS8B 2WN3A 2G3ZA 2AJXL 4EI5C 4QTHB 3EH4B 4O02L 3EOTL 4GFTB 1G9NH 4OGYH 4N2KA 1U8KA 3AITA 4K7PL 5ADOH 1J1XL 5DYFA 1AKJA 2YMXL 2WGXA 2EADA 1NCDH 1ADQL 1CXIA 4OF3A 4WIQA 2HYMA 3GMNB 5TPWL 1MVFA 3H56A 4XN7A 3ZQXA 4JFVA 2AEWA 3QIWB 2E7DA 3ARBB 3GTTA 3VQMA 1U8CB 3S5LG 4UILL 1A6UH 3UC0L 1IBFA 1MCOH 2HFFB 4G9FB 5CD3B 3SJVD 4TVPH 5I1HL 1B4LA 3HC4H 3KH4A 4EI6A 2CDFB 5B38G 2GUOA 1QRNA 3IU4L 4UB0L 4Z3JA 3BZ4A 2HVBA 4WFFE 4AJWA 3E6FB 4ZX6A 4U6VH 4RESB 4PI0A 2VXUL 3AS3A 3HI5L 2IMMA 4S2SB 3UYPA 3O11B 3DROB 4XI5C 5DYOA 1NCUA 1NC2A 2CMRH 2BNRA 3TCLA 4YMPA 2X4RA 2J6EH 5EFIB 3QXAA 4OV6F 1KIRA 1JZFA 2QSQA 3P9MA 5C0EA 4TNVK 5ICYB 1NSNL 1E4KA 2J20A 4F8LA 2H0EA 4P2QA 2ZZUT 4XNQB 3UAJD 3ARWA 3Q43A 1CB4A 3DV6A 3D2TA 3FN0H 3GUTB 2R9HC 1UKSA 2G9HB 2JIXA 4XOEA 4PJFF 2XWTB 4Y5YC 5E70A 1QI5A 4JG1L 4ZXBC 3U2JA 3MV8E 4HV8B 4P5TA 4WGKA 3FT4A 3HZMB 1WD8A 3D8MA 4I18A 2OSWA 1Q38A 1CDGA 4GSDL 4DSYA 3K0WA 2UZXA 4LCVA 2WQAA 4HBQA 3VFPA 3IMVA 4G6FD 4AV5A 3I2CH 2FX7H 3G5XA 1IEAA 1P4IH 5SWZB 4I1NB 1JGIA 1TU2A 3EOTH 2L7JA 2YZ1A 5MEQB 4PREA 2PTVA 3RPIB 1F1GA 4FXGC 3QORD 4PJ5D 3QNXA 4WTZG 5E9DA 1NCCL 2YMXH 4HPYL 4KKBD 2MOVA 2EO9A 3FFCE 3HN8A 2P8LA 4XAWL 1HSBB 3TXAA 1QFPA 1FDLL 1RLBA 1J0JA 2EACA 3L9RA 4LLWA 3O2WL 5A2CA 2FX9L 3X1BA 2BSSA 2F54D 4CADA 4UILH 4FABL 2AERT 4FNQA 4P9HC 2DF3A 4YPGA 5I1HH 3BHBB 1DUZB 1I85A 3R19A 3BLKA 3MROB 4FG6D 4UB0H 1U3HD 5JIKA 3US1A 5EEYA 2AK1L 1IAKA 3ARGD 3O6MH 5I8KL 2VXUH 2X70A 3HI5H 4YNYA 1C5BL 2N3JA 4A2FA 2AJZB 2JJTA 4ZNCD 3MLSL 4WJ5A 5J7CC 2AGJH 2I85A 3STBA 3MRQA 3OXSB 3LZQA 3V0IA 2WWKO 4IHBA 1NEZB 1NSNH 1A0QH 3MLUL 3EBAA 1CGWA 4FQIH 2E7BA 4Z7UF 3X1NA 4POZD 1EAJA 1T5WB 2MOGA 1R9FA 1WZLA 2VR5A 4M5TA 2XQYK 4PJ8D 3QJXA 4JG1H 5H37A 5L2JA 3FQTB 4B5EA 4MDIA 5DC9B 3GJFB 4H25B 3EF7A 4HAGA 4GSDH 1L9MA 3VWJD 3HZYB 1LLAA 1ZA3B 3SQBB 4OIFA 3A4FA 3MMEB 1T21A 3G04B 3FJTA 5EO1A 1N10A 2FNBA 4LNRA 5KTEH 3Q8BA 4MNHA 5EUKA 4K5NA 3U1SH 1GMEA 3WS3A 3K4ZA 4WHDA 3FW6A 3KHOA 3MRPA 4E68A 1NCCH 4HPYH 5HDQL 3N55A 3BP7A 4Z7NB 1UURA 4YVUA 4XAWH 5FYJH 1NLBH 4YL4A 1D5RA 5EBGA 1A64A 2IMNA 2L04A 2YSTA 2Z34A 5DQJA 5F3HB 2WBJA 3TT3H 3O2WH 3WCYA 2FX9H 5L8KB 2IPKB 2RA1A 4D2NA 2FEJA 2O5NA 5AUMA 2IANE 3LH2H 3UTPE 4AGOA 1G4MA 3KWWA 4U3XA 2J8UF 3ETBF 3QEUB 3VACA 3QEHB 5DUPH 5IY5B 3HE6B 2AK1H 2VQ1A 3R7RA 2WVVB 4FQ2L 2J1ZA 3DIFA 3ATDA 2EEBA 3EUUA 4DO5A 1ZHNA 3L4TA 3QIBC 4AC4A 2HWZH 1SDDB 3CHOA 2B7DT 3NJFA 2UYLB 4Z8FH 3HNTH 3MLSH 4QAWA 1HWGB 4W9IC 2VDQH 2DOCA 3BVVA 5J6GB 4TQIA 2CAKA 1ZLUK 5CLWA 1AHKA 3U6XS 1OM9A 5IBUB 3IB4A 1D5IL 3PY9A 4XBGA 4X83A 4PJFA 1YCSA 2H26A 3IMRA 1OTTC 5CP7B 3ZRSA 2AQPA 2WUBL 7PCYA 1KIUA 3NIDE 2GTWB 1JGDA 2NYYC 5BZDA 3JZYA 4HJSA 2A83B 5HJGA 2OAAA 2IH1A 3T5WA 2Y72A 1Z9NA 2IH3B 1VFBA 3LN5A 3NTCH 3MCG1 5HJBA 3MNVB 2JQZA 4MZ3A 4CC0A 2FAUA 1QWUA 1RJZA 1B4JH 3O6FD 3DX9B 1QAWA 3D3VA 3DVGA 3PWVA 4HSAC 4OBRA 3HI6L 5A43C 3QUZD 1WE5A 1QBBA 3TYFB 3LEVL 4KKNA 3VXTB 1IV8A 5C0BD 4KPHL 4HWZA 2O5ZL 5IMMA 1FJ1A 4YDIL 1WZMA 3VXQB 5C0FA 1KC5L 4M48L 5GGRB 3BN9D 3HHMA 3DO7A 2PABA 4M6AA 1B0IA 2CK0L 3JV4A 7PAZA 4MA3A 1AR1D 2R0ZH 1G4RA 1OF2A 3AACA 3MV01 5D7JC 5E5MB 5HDQH 4C56E 1NGPL 1MPAL 3ELAT 4W9GC 2ZP9A 3QHFL 2X10A 4WWKB 1E6JH 4ZUVA 1UT2A 3JT2A 1V8HA 3H6JA 5C2BL 1JV5B 3FB8A 3EYVA 1GZHC 2ICWB 4PJ9B 4QKXB 2FO8A 2VJXA 5HY9A 1N70A 2EILB 4GH7B 2ZXAA 5D2LE 3QA3B 2WZ6A 3IDNA 1FH2A 4HPOL 3SDDD 2H8PA 3LDBC 2H1LM 3GGWA 2EVFA 1WD9A 4P4RA 2OCCB 3EOAB 4FQ2H 3W0WE 4F58H 2CBPA 5B1AB 2MIZA 4QNPE 4MYWB 5JHLL 1IBGL 3IPFA 1CQYA 1NBVL 4LZKA 3WFBL 1VFAB 2NR6A 5KJRH 4JPKL 4S1SH 3QZWB 4Z7UA 1G6RL 3U46B 4LOUD 4GS7C 4WFFD 4QHNA 3RDTD 3CMGA 4W9LC 5AALA 3ULAB 5BS0A 4IU3A 1OGTB 4DKEL 4WSGA 5EEWA 1NFKA 2DICA 4A7VA 5CEYA 4KAQL 2R15A 4LKXA 2Y6SD 1DCEA 1MCPL 3SOTA 3K71B 3OZ9L 2CHNA 1KTBA 3H1ZA 1J0KA 4MCMA 4FQXC 4CC4C 5KSVB 5LAXA 5PAZA 2OXGB 3HI6H 3VFVA 1QA9B 5LGJB 4E5XB 1DE4B 1NAKH 1JTPA 5I6KA 3NG5A 1OP4A 3BUTA 5F6IB 4X4KA 1B90A 2JKXA 2O5ZH 5IQOA 2TAAA 2HT2D 1RFDL 4QUOA 5HJ3B 3J2PA 1B0RB 3MNWB 4Y16C 1EZSA 4PBDA 5KG9B 1AD0A 4LSRH 1XB8A 2EDEA 2FYYB 4GI8A 4LCCA 3RUGF 1SVZA 3V0WL 3SO3C 4MXVF 2H1XA 4ZTOL 1N4XH 3FU8A 5D5MF 2PETA 5D1QC 2AKRA 5HHPA 1EMTL 1KJ3L 3FAWA 3QHFH 3K4DA 3MOAL 3C9NB 2J8UA 1IGYA 1AIFA 2XV0A 1PY4A 2ZAGA 4PG2C 1Z9SB 4AC2A 3UBXA 1AS8A 4X6DF 3EDKA 1CDJA 3ULUD 3ZIMA 4I13B 3NIGB 4JPSA 5DFAA 3FFCD 3IMUA 3X1FA 1T89C 1VEOA 1Z5HA 2CJUL 3OC5A 4P0DA 4AKPA 2QSVA 4AEHL 3FO1B 5GIRA 2IADB 4AK2A 3OXRB 3C60C 1Z5LA 5JHLH 1XF4B 2GAZA 1BFOB 3ZQWA 3GLDA 1NBVH 3T08A 3WFBH 4N0CD 2NY3B 3GSRB 2Z35A 4JO3L 4APQD 4X4XB 4TM9A 4HUWB 3CH1B 4P2OB 4PB9L 1G6RH 5FFOA 1XH2A 2E46A 2VGLM 5GS1A 2C4FT 2EDMA 1GYWA 1HILB 4UM8A 5A16B 1PZUB 2VMJA 3VG9C 4H2AA 2OMNA 1J9TA 3OKEB 1J8HB 5CLZA 3M17B 1QRNE 3TJEH 3OKMA 4OI7A 4NQVB 4N9GB 4TLUA 2X3AA 1JRHL 3TBVB 1JPGB 3GSQB 1OT4A 4E41A 2CQVA 1XMEB 2HTLD 4LNVA 1CLYH 1MCPH 3UDWC 2BNRE 1CL7H 4XWOC 1PQZA 5AENA 4JKPL 3WTSA 4AGMA 2D8KA 2P28B 3BUIA 4O2FA 3Q1SL 3QR1A 4PSRA 1PG7H 2E4TA 3U82B 3BD5A 3GSVA 5EC1A 5M7QA 1EFQA 2F7IA 4P2QE 1PJWA 4IMKA 1DQVA 4CSZA 2ESVD 2KS0A 5IHZA 3VW3L 3S7GA 3SJVB 3D51A 4LCWD 1DJGA 4N8CL 3HHSB 4S11A 5DVKA 5SX5H 5ES4B 3P1VA 5E5RB 1BQUA 3C8KB 1H6TA 4N6RB 1NLDH 3FQWA 3V0WH 3FCBA 2XWBA 4ZTOH 3MQIA 1J1PH 2X6CA 2V2XA 3ZTEA 3CSPA 5DS2A 4HIEA 1EMTH 1KJ3H 2DI7A 2X1OA 2YD6A 3MOAH 3OKKA 4UTBH 4X0KA 5DK2A 4OFVA 3QDAA 2VC2L 2YFOA 3BWAA 4TOYL 3U6RB 4HIIB 4F24A 5LN4A 2CJUH 2NY5C 3CVHL 2X88A 5HGHB 4TQHA 2QPSA 5HI3C 5E9DE 1MVYA 3ZN6A 3DETD 5TK4A 2Y7MA 3INUL 2IAND 3UTPD 4KNTA 5HPMB 3V95A 2FATH 4U3HA 3RWJA 3NJVA 1DQIA 1RZKC 5F9WC 1R34A 1L7TL 2WBXA 3EGDB 4KRPB 2XQYG 1OOWA 3EF4A 4LHUG 2KZWA 4UQCA 3CZFA 3VI3F 3QUYA 2VISA 5C3IA 4J3BA 4TSBH 4XH2A 3T3PB 3H55A 4OZFB 5KSAD 4KZ0A 3T3MF 3WDHA 2X9WA 3VA2C 1JRHH 1ZA6A 3DGGB 5K9OB 2E59A 4PJ5B 2Y7QA 2L8AA 5JMOC 3FB6A 1X5GA 2CR6A 1DZ0A 3L5IA 4F8TA 3GMRA 1VGEH 1A4KB 1FO0L 1PX4A 2YKLL 3UJJH 4JKPH 1DSFL 3OF6A 5FOBB 1CF1A 5KYYB 2HLEB 1NIDA 2JKNA 2AMUA 4R97C 3MV11 2H7WA 2YD0A 2F54B 4KJYB 3RUGA 1UJTA 1E9QB 1MCJA 1KJVB 3VW3H 4PJ6A 2YA0A 5D5MA 1NGYA 1YY8A 1NBCA 4N8CH 3EDDA 3HW7A 4I77L 1U3HB 5CUSH 1I9RH 4JFYA 3LKSA 1P4LB 4N22A 2VSCA 4HU8A 4QXVA 4X6DA 1NAMH 3SPJA 1NCAH 1LD9B 4FQCH 1GS8A 1N6QL 4PS8A 3JV6A 1CDYA 1LILA 4D8PA 3BCDA 3LEYL 3K74B 1S7RB 3S5LA 3FRPB 5C9KA 2VC2H 3U4BH 4GINA 5J0BA 1Z5YD 5HHOD 1X4XA 4XI5D 3KYOB 3TFBA 4C56D 4TOYH 4Z77A 1SHMA 1BQHB 3O3DB 1HFUA 5E95B 2BSBA 3QULA 3ZE0F 3GHEH 1CZ8L 2OPCA 2WXLA 3P77B 2OCJA 1JPEA 4JG9A 1GGUA 1KNOA 3GPSA 5HGBB 3U7YH 3KL3A 1MHPH 2JB6B 2OA9A 3BAWA 2J1YA 1IKNA 3GZOA 3UZVA 2XACC 4NN6B 3SE4A 1KY6A 4JKNA 3C5SA 3QEQE 2R9HD 4Q7DA 4GMSL 1CFVL 4QKTA 1EZLA 1Q9WA 2P80D 5DEJA 3V2AR 1JZ4A 3BZDA 1GYVA 4H4NA 3PIQA 4ZXBD 2ITEA 3HS8A 5ID0B 2DWTA 4EZJA 5T1LD 1BF2A 1TSHA 4M4PA 2ZPKL 5T1DH 3BOVA 5C0JA 4DQOL 5IOPA 3N1QC 3V0DA 1FL6A 4JR9L 1E27A 3KWXA 2EIMB 1T6BX 3LZNA 3OAWA 4DP5X 2CKBL 2PXYA 3O81A 5I1DA 3MRFB 3OG4B 1RY7B 2YEVB 3KHQA 4KMLB 2FBRA 2B77A 1U4EA 3AU1B 4FP8H 1OV8A 1FPTL 2G5BB 5B39A 12E8L 4PJFE 3RWEA 5ENWB 1YEGH 4U1JB 5GGTA 5HHXL 4OD1L 4QJ3B 4I77H 1I9IH 2GITA 2OBGA 4WTZA 1R3JA 3CVCA 1J0ZA 1SXBA 3ZO9A 4JDTL 2NT1A 2QQLL 3NEXA 3O0LA 3CQFA 3QSKB 3WU1A 2Y1AA 3D3VE 3D7PA 5IVXB 3MX0A 2VE6A 5EOCL 2Y36L 3LEYH 1SHSA 2IPTH 1HNGA 1T0MB 3UP6A 3VU1A 2VXQA 4BQCA 2R1WB 1GS6X 2C9AA 1JE6A 2FSEB 1FZOA 1UD3A 4YLQT 3PUUA 2ZSVB 4QOKB 1XH1A 2Q6WA 4JO2H 4X6BA 1AS6A 2PP9A 2LGNA 2DQHH 2GHWB 1TEYA 1QWHA 2ODIA 4AQ1C 4M6MH 3VI3A 4GKZA 3O6FB 1NL0L 2B4CL 2FWUA 3TCXA 2A77L 1SEQL 3FTGA 1KIQA 4U1IB 1LK3L 1CFVH 5BVJA 5JXAL 3WLBA 5C0BB 3HMXA 2Q76A 4KUZL 3N04A 3VD0A 2VAAA 5IKCA 2HPOA 1BQ5A 2EYRB 3E2HB 3LPWA 1AR1B 4DQOH 2A5UA 2QKIB 2AXFB 3WEOA 1X3DA 2ZF8A 3GSNB 43C9B 3OMAB 2C3VB 4FXLA 4XP6L 4Z7UE 1QRND 3WHXA 3ZBMA 3NK3A 3GLZA 5TK2A 5LBVA 1QW9A 3SE9L 1FPTH 1S5HB 2CNZA 12E8H 1DVSA 5BS0E 2BY1A 3JT0A 3L5XL 2QGBA 3O3AA 5T3XD 3WO4B 5K1NA 1R33A 1NC2D 1OY3B 5F1SA 3SDDB 1KCRL 2BNRD 5D1XC 4HOXA 2QBWA 5IFJA 2O61B 5GGRY 4BH8A 4MX7A 2VH5H 3PQYA 4JY5L 3EGSA 3J7HA 2PCPB 5AAWC 3OB0K 4XPGL 4WU5B 2CO7A 5EOCH 4I87A 4BUHA 5J06A 2BINA 2Y36H 1C7TA 4L2LA 3V5KA 5FA3B 1JPTL 4QHUA 2C3XA 2FHBA 5EA0H 2B16A 2H47C 1EDYA 3TT1L 5IMLA 2F8OA 3QIBD 2JB5L 3KGTA 1CUOA 3RDTB 2CLRA 4UOJA 5INCA 2AJSL 3HPJA 1GL4B 2ATAA 2E9WA 5EOQL 3P4LA 1W16A 4WZ9A 4RAVA 3V52L 3WGUB 4PGEB 2BVEA 3T0EC 2R51A 3ZE2F 1ETZA 1EHKB 2ZUQB 3FUFA 3NFPB 4TNVF 1AQKL 2MHAA 1T04B 4S0TD 1OTTD 4AMWA 1G7JA 2J8UE 1LEKB 2X1QA 3FAXA 1SZNA 2NNFA 4JZNB 3EXLA 2B4CH 3GRWL 3S36L 1R5WB 1DVFC 2A77H 5AAMA 1DO5A 1XR8A 4E9LA 3T0WA 2FWLB 4QLWA 5HYSB 1KCLA 3CZJA 3MJ8B 3WI9A 3H3PL 4KUZH 4W6WB 1JYXA 3IXAA 1AGEB 1E67A 1UH2A 3DYMA 4OQTL 4NBXB 1BAWA 4XGZB 3WAJA 3VGGA 1UXMA 3F7YA 2Y06H 2WXQA 1F6FB 3FFDA 1DANT 5MERA 1M1XB 1X5JA 1JOIA 5DC4B 4HHAA 2Y22A 5LGHL 5TE7L 5CJXC 2QGDA 2J43A 2OTUB 2VDKL 3OGCB 1L3NA 1S2EA 2XHNA 2OX5A 4XMWA 5D7JD 1U91B 1DBAH 1SJEB 1WHOA 3DMMB 4NXKA 4NQQA 1ZT1A 3FFCB 2X6VA 4AXWA 4JMXA 4BGLA 3BEVB 4HFWB 1IQDB 5KSUA 3GMQB 2VZ3A 1BGXL 4P5SA 4GEJA 2FH6A 4E41E 2CLVA 5DZOA 2EXYC 2XETA 3UJTH 4RMVA 4XPGH 5CSZA 2A74A 5AW3B 3MJ7A 5DJ0B 4APQB 2YJQA 5F1OB 4HIQA 2X1WL 3HI1B 3J8F7 4J8RB 2JB5H 1MHCA 4BCXA 3K81A 4LLYB 4ZBJA 4NKDB 2R69L 1CFNB 3V6FA 5C0DB 3T09A 3GD1C 4UQAA 1I1CA 3QJUB 3ZHKA 3L4XA 1XGYH 1ZHLA 5C0IB 4DCQB 5ALBH 1Q1JH 3NACH 4N6QA 3L7EA 3D30A 1WEJH 2OMBA 2WTOA 5KN5A 1HYRC 1ZSHA 3M86A 1WCBB 1H15A 5FGCB 3MBXH 4GLRH 1C08B 2PPDA 3OKDB 1JI1A 2KH2B 3QZNA 5I26A 4JK0D 2RACA 2RFXA 1MW2A 3CUPB 4L29B 5TF1L 3BEWB 4UYPA 3H3PH 3R1GL 3QBTB 2QV4A 2DD8H 2ESVB 4DIXA 4FQXD 4GRWH 4LCWB 3AM8C 2QMJA 3EUDA 3VH8G 1GJWA 4F3FB 4GP8B 2LE9A 3GKWH 3SDAC 1JYVA 2XWEA 3PJSB 5BO1L 3KYMA 1XGPB 1XH3B 5GZNC 3LEXA 4HA1A 5JQ6H 5F88B 3ZDYF 4NZUH 3K6DA 5FKPB 4BH7A 1CI5A 2JKTM 4Y16D 5EZJB 3VRJA 4CVZB 1BF5A 3NFSL 2DTML 4Z76A 4W9DC 3OKOB 1HX0A 4OD3L 5AVZB 5GSVA 3JVGA 3NK4A 4LEOB 1KXTA 5C07D 1U21A 1AD9B 4LVEA 4XT1C 5D1QD 3TP4A 5I5MA 4JN1L 3DIVA 1DSWA 2IBBA 3SYCA 3VTTA 4JCMA 3W5MA 1HHKB 3SY0A 4D7PA 3BKJH 5K9JL 1QEWB 4K94L 4OIIH 4ZUUB 2IANB 3KPOB 2BP0A 1CVRA 4HUKB 3QQDA 1GXEA 1HHIA 3B83A 1WC7A 3SPCA 3DURA 3NFNB 3FTXA 4BHUI 3TNMB 1CD1B 4P23B 3RUGE 2YK1H 3C60D 2YGOA 2C3GA 4XB8A 3MLYL 4MXVE 5D5ME 2EIEA 4U6TA 5JIIA 2OTWA 4UYQA 1PS3A 1I8AA 5D8JL 5EWIL 5MP6L 1E2ZA 4JQVC 5KSAB 3QWOA 1QBML 4LIQE 3RL1B 1OHQA 5IMKB 4HF5H 1P84K 1O9ZA 1RU9L 4I48A 4QRQA 4X6DE 3SCMC 4QO1A 1UKTA 5D7LA 4BZ1H 4W6YB 4CBZA 2ZOOA 2YAEA 4JFZL 1H3PL 4NO2A 5ID1A 3TPUA 3UP1A 3ML9A 4Y19A 3RBSA 1OQXA 4BDVA 1IBDA 4QCIB 4HC1L 2IBGA 3EO1A 1I9JL 1A6VL 1VSCA 2NNAB 1OD7A 4YFLI 3CC1A 4MXQD 5EZLA 1QP1A 1CFQB 3WUZA 4O58L 4XNBA 4OLWL 1IGCH 4XC3L 5DWPA 4JCLA 4OCNC 4FXTA 5BO1H 2J4WL 3UROR 2NZ9D 1UCTA 1SJHA 3O9WA 4IGBA 5JDJA 1NA8A 1NDTA 3U79A 3DV4B 3DHUA 1OSPH 4FYSA 4PWKA 2APBA 4AUJA 2I60L 3EZ8A 4E9QA 2P44B 2ICWJ 2WLNA 5BMFH 1GIGL 1KCVL 2OL3A 4ZNEA 3UMTA 4C56B 3DSNA 2NR6D 4JN1H 5CAYB 5IW6A 3AAZB 3E3QC 2BDNH 3RI5K 2PWGA 3E1ZA 2AJVL 4GRLA 4K94H 1MJJB 1IC0A 4PV8B 1ZTXL 1FZKA 3GDCA 3OMZA 4HUCA 2YKKA 4ONOA 1U8OB 5BS0D 2MNUA 1U8NA 4U2ZA 5D2LB 2QTVA 4DPCX 3CSGA 4QHKJ 2HLAB 5HI3D 4IBWA 1E8WA 5CEZE 3MLYH 4M1CC 5DT1L 5I1GL 2NY0D 4N8VG 4XBMA 1ASQA 5D8JH 4PCSA 1DVZA 3Q44A 5EWIH 5GPRA 5MP6H 4ZXBB 4GQZA 4F1SA 4Y88A 4KKRA 2A6JA 1JFQL 3H53A 4X7SL 5T1LB 3ZZLA 1CXKA 4KRNA 5KVEE 4JPIA 1HCZA 3PHQB 3VDCA 1ETA1 1K8IA 2BSTA 4P5RA 5AW0B 3DX6A 5KVDH 2CWRA 1AIZA 4BQBA 1H3PH 5JDSB 4LDLB 3CLWA 3K2KA 2XQYA 3UEQA 1MIEL 4HC1H 4HGKC 5DD0L 5KVFL 3L8QA 1A3RL 3BSZL 3L95B 1NFDF 1I9JH 2O6DA 1A6VH 2VN7A 1SOQA 3JVGC 1SPDA 3QGVA 3TIEB 4EN2A 4WTXA 2JJSC 1XSKA 1C8PA 2DL2A 4M7JL 5DHVA 3AXLA 4UV4H 2VR4A 3M7FB 2VW7A 2N7AA 1P2CA 4A6YL 2R0KL 4M7LH 4NO0B 3TZVC 3VI3E 3WL9B 2WD0A 2A9NL 3VRIB 5IP4A 3NRQA 2F7PA 2VDOH 3DX3A 3WDIA 5J3HD 1DQKA 4W68A 3CFMA 1S3RA 3X3GL 4GG6F 1FLRL 4FTVD 3P0VL 1HL4A 1QSEA 5CCKH 5ITBL 1KCSL 1KCVH 5KSBF 4NQXB 4Q9BA 3VD1A 1H0DA 4TQPA 1R1CA 5IEHA 3QPXL 3MRJA 5IGXH 2VRKA 4ZOEA 4L18A 2YRPA 4WNQB 2XNAB 5FYLE 2FGWH 5IK3B 1HK6A 3BP5A 2EDWA 1ZTXH 4YC2C 5FWRA 5KYUB 5E4OA 2APSA 1X6LA 3QVAA 3BP6A 2VDLB 5KJ4A 1E5BA 2P8MB 1E28A 2H9GA 4ZOAA 1TVHB 5J6HA 3GI8H 3EYOA 2BCMA 4G8AC 4ENZA 1U8KB 5DT1H 4E41D 4ZO9A 2W80C 1MQKL 2QHLA 1NWPA 1JFQH 1Z0MA 3T9WA 2QT6A 3DVFA 3BPNC 3HEIB 1KCWA 1R6VA 1A3ZA 1FFNA 3PQYE 4H0IA 4WW2F 1HAWA 5D4QA 2H0PA 3ASNB 5E2TH 3UO1L 1M56B 4JQIL 2JH2A 4X4YA 3FOMA 5DVLA 5TDNA 2O5YL 2VM4A 5J8OA 1I8KB 4HGMA 4EI6B 2XPGA 5I0VA 5I1KL 2GUOB 1QRNB 3ZE0E 3BZ4B 4YXLH 4M5SA 4AEIL 1A3RH 3BSZH 5KVFH 3E7JA 1EHNA 5KOMC 1U3NA 3NPZB 5DYOB 3QCVH 1L9RA 4CUCA 1NC2B 2BNRB 5K39B 3TCLB 4M7JH 2X4RB 3V5HB 3QXAB 1KIRB 3GS0A 2WANA 5KS9F 3P9MB 4A6YH 4PWJA 3ETTA 3S3JA 5J1TC 2A9NH 4P2QB 1BVKA 1TETH 2YOAA 3F5WA 2GC4C 8CGTA 3KPRA 1BBJA 3V0VA 3DV6B 4HXAH 4JFPA 5KJ7E 5EF2A 1XSOA 1KTRL 1MFDL 1HL8A 5E56A 3X3GH 4DEPC 3SOBL 3GS7A 3VNYA 1JN6A 2JIXB 3B1TA 2IIJA 4FE9A 4M1DL 1TIUA 1EAOA 1HS6A 3QPXH 4P5TB 5C3LD 1Z32X 3FT4B 4WLCA 2DY2A 1NINA 4I18B 4W9CC 3CFTA 2UZXB 3VFPB 4B9KC 5D96C 3KGUA 5L88L 4GO8A 4YHPA 3G5XB 3KCWA 4U0RC 4LFHD 1IEAB 3ARYA 1KBKA 1TU2B 5DVNA 5T5FH 1LO2L 4NAQA 4GUQA 4EKXA 4IK6A 2H0JA 1MQKH 2P8LB 4HIJB 4ODVL 2VUOA 2ZWLT 4ZW5A 5IJCC 3JTBA 1J05A 1YEDA 3OF6D 2SODB 2PO6A 3QDJA 3L9RB 4LLWB 1CI3M 4FMFA 2BSSB 1CXHA 4JQIH 1NFDA 4WO4A 4ALAL 1ITBB 4ZPVA 4YPGB 5DS1A 3CN2A 4M43L 2QVTA 4JZOB 1NH6A 1Q72H 4P4KA 1IAKB 2ALWA 3QJTB 4IRJC 4AEIH 1LP9E 4NRZB 5D7JB 5FM5O 2X70B 4MZIA 2K3HA 3K5RA 4LHQB 3LNHA 1HQRA 5DHYB 3PLYA 4WJ5B 3AG4B 4BGDA 4A63A 3EYQD 3KNBA 3MRQB 5IWLA 4Y4FC 4GG6A 1L6PA 1J9CT 4OD2A 3X2QB 3S35L 3IDXL 4HS8L 5KSBA 1MLCA 3GBLA 1FN4B 2K70A 1TCRA 1D7CA 2BXZA 3LDBB 4OF7A 5G5DA 1IIKA 3DXAA 1MFDH 3BT2H 1Z0NA 1ZEAL 5I8EA 3RY6C 1KV7A 2WKLA 4CN6A 4XPHL 3T1WA 3QQ9C 1UB6A 4EE2A 3ALXA 5CINH 4YVNA 1XL6A 4JFHE 5L2JB 3B4NA 1WRFA 4MDIB 3MUZ1 2APFA 5L4JA 1XCWA 3VG0H 1PG7X 4OUUA 5DD1L 3CVIH 3PF2A 3O3UN 2PWEA 4ZT1A 1ACYL 1H3WM 4YDJB 1EHAA 1AXTL 5DZLA 4FNRA 3OKYA 5EO1B 5FWQA 4LNRB 2A7BA 3UMNA 1G9NC 5B3JE 5EUKB 3SBWC 1N67A 3WS3B 3T0ED 3R06A 4X7FC 3MRPB 4WW2A 3R4RA 3BP7B 4KBPA 4ODVH 4BSJA 4AQZA 3ARXA 4FQXB 4PIRF 3B2PA 4JDVA 4KKCC 1KYAA 2WBJB 3C8HA 1DVFD 1TZGL 3DBXA 3S3SA 3MBEA 5CEZD 4BSVB 4P49A 3HUJF 5KVGL 1K72A 4IKJA 2DH3A 3BPCA 4M43H 2BSCA 1R4XA 2EUWA 4Y16B 5CIPA 4WEEA 4KI5F 2VQ1B 4Q0XL 3DIFB 5J1SC 4PJEF 2UXTA 5KS9A 2ZX5A 3A22A 4BE6A 2BWDA 2QADB 5C07B 2EUVA 4HKXB 4L5FH 2NXYD 1A6ZA 3OQRA 4FQPA 4XO5A 3MYZA 4AYMC 5EUOF 4DKDC 3HR6A 3B1UA 2HAZA 5D7LE 2AXGA 3LKPA 4NI3A 4RGNE 4MJ5A 1OM3L 3IDXH 4HS8H 3S35H 4TNEA 3LZRA 4XBGB 1JZ5A 4PJFB 2CPCA 1IILE 1E4WL 2H26B 3ECBA 3GNMH 4FFYA 1HINL 3CHSA 1KIUB 1QBAA 3KJ4C 5EU6A 1JGDB 3QUKA 3QWRD 3T65B 3W39A 5BZDB 1S9WA 5JOPE 3AY4C 4HXBH 2Q7AA 1VFBB 2EXYD 3C60B 3E6HB 3LN5B 2ZG3A 4XPHH 3RG1C 1G1YA 3V6ZA 2ZX6A 1MIMH 1YEKL 1RJZB 2LU4A 4XXWA 3PWVB 4BFFA 4G8IA 4H0HB 4O2CA 4HG4K 2DM3A 3NJGA 5HPOA 1AXTH 1OHZA 5CR8A 1OIOA 4HWZB 4XODA 2WM0A 5IMMB 2NZIA 2Z8RA 2OP4L 4N2EA 3DO7B 2WXPA 3JV4B 4ODHL 2YBGA 4MA3B 1EEYA 3GF8A 3GJEA 1P7BA 4ZNEE 3W38A 2R2HA 4HWBH 4A1RA 5JIPA 4FQJH 4FFWC 1JV2A 4YHOL 2MPAH 3LZLA 4KROC 5I6LA 2CHDA 1TZGH 2CIKA 3ZMRA 1NCNA 3FB8B 1OSZB 3EYVB 5F96H 1LE9A 5HY9B 5KVGH 3HG1D 5HYJA 2LQRA 2Z91B 3IDNB 2H8PB 5T1MA 5FHBL 4FMKA 3GGWB 1JGVL 1F8TL 5T33L 4ANUA 3MC0A 2XWZA 4PMEA 4S0HA 2V0AA 3DX4A 1UASA 3KM2A 5GZND 4KNSA 2Z64C 4JPVL 4UOW0 2CJ3A 4XN1A 4AYEC 4J3XA 1SYSB 5LDUA 1RIVL 3KLSA 1J12A 3HCVA 2PCFB 3FN9A 4Z7UB 1WVZA 5IUSA 2I5YH 4IBSA 1RP8A 4QHNB 4DGVH 1RZPA 4PY8J 5BS0B 1WT5A 4IU3B 4I1PA 4H8HA 3AREC 4QY8A 2VTFA 5CEYB 1PNCA 1BZOA 1YYML 3GMLB 3RX8A 2YUWA 2BS8A 1UJ3C 4OLZH 1Q0XL 3THML 3WDJA 2VABA 4LKXB 4CRPA 3P2DA 4IJTA 5GRJL 4F37K 3FB7A 2NY0B 1YEKH 4RRPA 3ZIYA 3ZDYE 4JFDA 1T20A 4NX0A 4TXVB 1IAIH 4ZTPL 2XVLA 5LAXB 4JDEA 5HGDA 3VFVB 4DP2X 3GJFH 3D18A 4OI8A 1YJDH 3F12A 2FQGA 2LLNA 4Q6IC 4XAKE 5CBEA 3MJ9L 1XGZA 3LRGA 4Y4KA 1HH6A 1N26A 4MJID 3P9LA 1HEZB 5CJQH 1XWVA 4RGMC 2YPVH 4ZOCA 3NJLA 4LLQA 4WKXA 1DN0A 1QSEE 3SCMD 3FCGA 3JV0A 4EDXA 3B6SA 3MAWA 2QLYA 1MVUA 3HUJA 5A40E 1WZ1L 4GJTB 5HHPB 1XZ0A 1WG3A 4NERA 4C47A 1IGYB 5T3ZH 1IM9A 3B56A 1DYZA 5ISZA 3TF4A 3FUKA 5EORL 1L9PA 4X4ZA 2KMWA 4PJEA 3LN9A 2WQSA 3EH3B 4EIUA 2IQAA 1IO4C 3MYJA 5K1VA 2GJPA 1JGVH 1F8TH 4XNXL 2BJML 2RB8A 1E5AA 5GIRB 3P0YL 1QTPA 5EUOA 1Z5LB 3CN1A 4M6OL 5BPPA 4YEEA 4JPVH 3CXHK 1O7VA 4OLVH 2XA3A 1RIVH 1MJ8L 2Z35B 1WCQA 5KYXA 5GS1B 3MFFB 1FNAA 3EJJX 5LG1A 4BFRA 4N2LA 2D3LA 1R3KB 4EN3A 4W9KC 3T4YA 2DQMA 2VQUA 3WN6A 1VACA 1DQML 1F4WL 1PJ9A 3SEPA 4JHWL 1CGYA 4M61A 2AEIT 1Q0XH 3ZYOA 4YHML 4E41B 5GRJH 3KYKL 2HG0A 4R2GC 2DLIA 1J1OL 3GLAA 3PJLA 4ZTPH 3RVVD 1PQZB 3ESVF 4NC0B 3R18A 4XVOA 3D06A 1M7DB 4Z3IA 3A0OA 3WD5H 3U7WL 1J87A 2IDQA 3GSVB 2E9IA 3HZKB 4LO9A 3RBGA 4EEEA 1T3FA 5IHZB 5TGBA 2VIRA 4KKLC 5IV2A 5I19L 3ME0A 1J0YA 3KPRE 4IBQA 3KPNA 4KJQC 2WNGA 3VYPA 2COVD 1QABA 3LMJL 3DJRA 3FQWB 3WN5A 4N8VA 2XWBB 3TA3C 2V2XB 1CYGA 3NJJA 1WZ1H 1KCUH 1NJ9A 4JAMA 1TQBC 5DMIL 5DFTA 1CL7I 2GHZA 4X0KB 5DK2B 3SYPA 3PHSA 1TKWA 3D69A 3IDMA 2F7OA 4NJAL 3BGFC 4YDLB 3CC5A 3MA9L 1KB9J 2O1AA 1I3RA 3TESA 4FZ8L 1F58L 4W4OC 1X9QA 3IJEA 5IQ7L 3P0YH 5EDSA 1CFTA 4M7KH 1AH1A 1KDIA 2YZ8A 4KOBA 4M6OH 4N5EC 2O6PA 4QT5A 1H3TA 1S7UA 3Q8CA 1MJ8H 2XWRA 3RWJB 3SYAA 3QDJE 4WHTA 1ZJBA 4ZX4A 1MAJA 2DRUA 3ILEA 5JA9A 3CSTA 4FAAB 3D4GA 2DQCL 4OFYA 2WCGA 4O51A 2VISB 5J12C 5A2KH 5HI4C 4LP5A 4MAYC 1DQMH 5AEAA 5DC0A 4NN5C 1G0YR 2YRZA 1ZA6B 3S34L 1W0VA 4YDZA 4YHMH 1XL4A 4KH9A 5D7LD 3VFRA 2Y7QB 3DK2A 4LL9A 2OMVA 4MS6A 3FB6B 4XPAL 1J1OH 1OW0A 3GMRB 1LO4L 3I75B 5AB9A 4QWWC 2BY3A 4X4MA 2DDQH 4Y19D 1V7ML 1BXUA 2V33A 4JPWH 4GG6E 2X4SA 2BC4B 1BZQK 4NBZB 5KSBE 3RUGB 2D9QB 1A02N 3MUGB 3RVUC 1LDPL 1NGYB 1YY8B 2J73A 2W9EL 5D5MB 5EPMB 5I19H 2CDEA 4XP4H 4H20H 1FA4A 2BIOA 3DXAE 4PWGA 1G9MH 5F6HJ 1WAEA 3LMJH 4JFYB 3T0XA 5FDWA 3HPLB 4RAUA 1JRHI 2WP3T 1H6FA 4X6DB 2RIKA 2MRYA 2VXSL 2XKUA 1D5ZA 3MNDA 2R29A 4AG4L 4IGBD 3FO9A 3JV6B 3K2UL 4D8PB 2ZX9A 3OAUL 1CLOH 3R4DA 5DMIH 2K78A 3I6LE 2EDNA 2L7QA 4MQTB 4NJAH 5LWYL 1SLWA 1Z3GL 3MA9H 3T6QC 1DCLA 3QG7L 4KFMA 3QQXA 4MMXA 3MLVL 4DP4X 4M7ZC 4Z77B 3T0DA 3MV7A 5D7HA 5AVVB 4X9IA 4L8SA 4WI7A 3QULB 1ODAA 5IQ7H 1IC1A 1U8QB 1ED3A 6PCYA 3NCYS 1CGUA 3OWRA 4MB3A 2P47B 1KNOB 5E08L 5HHVL 3US0A 5F1IA 3FUDA 4M3HA 1BD2D 3WBDA 4K07A 4L05A 4HISA 3UZVB 3C5SB 2DQCH 4JM2C 2R1YA 3ERXA 4FQQA 3L3JB 1BAFL 3PIQB 1PVHA 3MJGX 4JRLA 3QZOA 3U6XA 4PEEA 3LKRB 1WWWX 3RI5F 3KPSA 5E5LA 4AH2A 4LCIL 3T0EB 4AX3A 2X41A 5C0JB 5KS9E 1BIHA 4XPAH 1E27B 5FLVA 1U92A 4B0MB 5DZNA 4PWFA 3NIFE 5I1DB 2K0RA 3ULVF 4RGOL 2CLZA 5EZOL 5IG7B 3IRCA 1DVFB 4EUPH 2FJFA 5FO8A 5B39B 5C0CD 1EEZA 5ESVA 3RWEB 1KN2H 1LDPH 3IT8D 1DUYA 5EU6E 4RWHA 3PXLA 1CD0A 4YBQD 1NMBL 1GRWA 1ZGLA 2X1PA 1JGEA 3N0PB 3AFLA 3ZL1A 2GITB 2BWQA 5DI8A 1YA5A 2EDJA 1PU0A 3RNQA 1V3KA 4XAKD 5DHMC 1JHTA 2A6IB 2QSCL 3BVNA 1ZHKB 5DK3A 4TL5A 3MX0B 3OAUH 2NXYB 1CG9B 5FYJU 1BFSA 3ZR6A 5LWYH 3HRZA 4IRJD 4WFHE 1MG3C 1WH0A 1Z3GH 3QG7H 1QUNA 1QSED 1N9PA 1CGTA 2GTZA 1UA7A 3AUWB 3MLVH 3ZK0A 3DGCR 4AIEA 4UIMB 1ESOA 5F7KC 5GRUL 2NNXA 1DBBL 3EYSH 1I1FA 1UQSA 3O0RH 2N01B 2R2EB 3NZUA 1FC2D 3UGUA 1GCFA 4PP1C 4N3UA 3D2UA 3UFIA 5E08H 4PVNA 2VERN 1WBYA 3TU6A 1PDKA 1MCNA 3VI3B 1NGXA 4WEBL 5MENA 1WV7T 1MDTA 1BQSA 2EP6A 5KAQG 4I3SH 5JLZA 4KVNL 3T3MB 3TX4A 5L6YL 4YLCA 1XSJA 1KIQB 4AQOA 3L3GA 5HYJE 1WUZA 3QQ9D 3IBOA 3WLBB 1BAFH 4NZDA 2HT3D 2Q76B 3VU2A 5IJDC 3KLLA 2VAAB 4Y2DA 5IKCB 2ICEA 3ZT6A 2A99A 4LCIH 2YQGA 4MD5A 5E5UB 1NOAA 4ODBD 2O5XH 5D6CA 1KBVA 3BAIA 5EHFA 5AOKA 3L81A 1UM6H 4RGOH 5EZOH 3WHXB 4B9PA 1QKZL 2X0UA 1EEUA 1HT6A 1PZ5B 4YSSA 1KEML 3EGXA 1DFBL 3G7TA 4XBPA 3L5WB 4OM0L 1PSKH 3HG1B 3O3AB 4CVXA 3B9VA 5IFJB 1D6EA 1NMBH 1F1AA 1KZQA 4YHIA 3AMKA 4BH8B 2ERJC 4MX7B 1XB6A 4FJZA 3PQYB 5T1KA 3LYRA 5ESAA 3EGSB 3L3OC 1ZK5A 5DVMA 2E5EA 4JFDE 1H8OA 2CO7B 1FNFA 2H2SC 1WZKA 2CK2A 5I71B 3KPRD 5IOKA 4QHUB 2Q7NA 3WKNA 5JW4R 3ZE0B 2GIYA 5IMLB 5AZ2L 4Y9CA 3EJQA 2WBWB 3GHBL 4MS8C 2KHAA 3HPJB 4LP8A 4XHJC 3KCPA 4WWPA 4ZS7L 2WMPB 5GRUH 2VDRB 1MCWW 3H8NA 2BIQA 4PRIA 4RAVB 3BYTA 1BVLA 3C5ZA 3TS8A 3TIDB 2OSYA 5E1QA 5T1JA 1A4CA 5JW3H 4U1LA 3ESPA 3QUMA 1ETZB 3HUJE 1GYUA 3HB3D 3WIHA 2MHAB 1PIFA 5I74B 3KBHE 4WEBH 1G7JB 1NFAA 4JFOA 1XGQA 3EOBA 3HJ0A 3S4SA 5ISZE 5AW7B 4KI5E 1NDGB 5L6YH 2K1MA 2UY7A 4IBLT 2VYRE 1I9EA 1XR8B 2Z92A 1QBLL 1BJ1J 3H9ZA 4GT0A 4PJEE 3WMQA 2KL6A 3O2VL 1BZ7A 4AIXA 4MJIB 2A4CA 4ODSL 3B7SA 3BAKA 3LZFL 4C4KO 2PO6D 1YEHL 5D7IF 4RNRA 1W8OA 5EUOE 3PWPE 1VLXA 3F7YB 1HJCA 3DIDA 4UNIA 2CBMA 4NC1E 1KUMA 4WO4D 1NCBH 1MFMA 1ZWIA 4HHAB 2HJLA 5TE4H 2IH9A 1OAKH 1HIML 3FS9A 3H9HB 2GPZA 3F7LA 5JYLA 1XZWA 4P4KD 3CHXA 1QKZH 3QI9C 1YY9C 2F7RA 2CBOA 2OX5B 3CH8A 4JQXA 5AYTA 3H2PA 5CN3A 4OM0H 3U0PB 1J8SA 3UAAA 3JUYA 3CHPA 3LKQA 1ZT1B 4FFWD 4AXWB 1RUPH 4KROD 5KSUB 1EJOL 1GY1A 2YUXA 3T6XA 3WFEL 2WTPA 4WNJA 1CU4L 2CLVB 3Q7JA 5D72L 5FW6A 2Z9TA 1BPVA 5IFAH 3BP4A 3QDGA 1RCYA 1U93A 2Z31C 3F62A 5CSZB 3MJ7B 5A2AA 5LXGL 1P5VA 4I9XA 3C09C 1IEHA 1U8LA 2ZXGA 5IB2A 5I5JA 3M1OA 5HGGS 5SWSA 5I0XA 5AZ2H 1MHCB 4M1GL 5CZRA 3WJMA 4OLYL 2ZKYA 3S96B 4ZS7H 3B2VH 5C08A 3V6FB 5F21B 4PLNC 3ISRA 1A4JA 3UOAB 2WNWA 5FFGA 2ZYIA 4MD0A 1JK8A 2IFFH 1ZHLB 3I6LD 4YHNA 3L7EB 2VMFA 5IHWA 1RIHL 5LBSA 1CFSA 4NPJA 5KN5B 4JFEA 2DM7A 1WPCA 2J7LA 1H15B 3P0GB 4H8WL 4B9GA 5CD5D 4N2MA 1N0LA 4FI6A 2ZCHL 1V27A 1QBLH 3DHJA 2F6AA 3QJOA 2P4AB 3O2VH 2D2CC 4IOFD 1I75A 3RDJA 1A8JH 3JWOL 1AGCA 3LZFH 1YEHH 2OQJA 4JMNA 5DURD 3K8KA 2DEWX 3VFGL 1L0QA 4N0YH 1GYAA 1SOXA 2IF7A 4PVBA 3PYCA 3MBED 3GSNH 1WYJA 3I9GL 3LEXB 3HNVL 1BOGA 1I31A 1CFBA 1HIMH 5CP3H 2E3VA 3DX1A 1C16A 5EIIG 1VADA 3QPQC 4BH7B 5GGSA 3LPOA 3E1F1 2WOBA 2DQGH 3VRJB 4GLRI 4EXPX 2FZ3A 4PY7A 1XFPA 2EC9U 3DRQA 4LGPB 3W81A 5J57B 5GSVB 3ULUL 2IDFA 3VQ1C 1KXTB 2W0PA 4CMHC 2UXGA 5FR3A 4L0YA 2WO4A 1S7XB 1SM3L 4A38A 4Y8DC 1XCXA 1EVUA 2W95A 2XYCA 3SY0B 5DWUH 4MJJA 5D72H 3D0LA 3TC9A 1S7SB 4QRSB 2KZBA 5LXGH 2BP0B 4HCRL 4X4ME 1HHIB 4GSXA 5EU6D 3DURB 2W91A 3L16A 5CS7A 1A6WL 1FL5A 3VGHA 3VFTB 1EBAA 2Y5QA 3NSCA 3ZE2B 2ADGA 1AGBB 2MFNA 2OTWB 1B0GA 2A4ZA 3O8XC 2J5WA 3QWOB 1B2WL 4BCYA 1IGIL 5FHAH 4L4VA 3E8UL 2AVGA 4I48B 4QRQB 4F80A 5JHAA 4QO1B 1RIHH 2XZQH 5D7LB 4NNPL 4RGNB 4ADIA 4DH2A 4AL8C 2I07A 4BFOA 2EYSA 4GT7A 5D6DA 2DYPA 3S88H 5FECA 4I0PA 4L23A 1SVCP 4NO2B 5ID1B 3TPUB 4Y19B 1CDUA 3FU6A 1A65A 1K6QL 4MMYA 3IKCA 4IKNA 5D7IA 4BDVB 2ZCHH 3MLZH 1WBXA 3DK0A 4X6CF 1LE5A 1H3XA 2VW6A 3EO1B 1W0WA 4DVRL 4H8QA 2W59A 5IJKA 4Y9EA 3MV7E 2B5IB 4R2GD 4N8UA 1IVLA 1UT9A 2C1OA 1MCDA 2YJLA 3SGEH 1DLHA 5E6IA 1CXLA 2BFVH 2BVQA 4L8CA 4TNWK 3MLRH 1JNLL 4FJ6A 3TV8A 1RJYB 3FCUB 3I9GH 4C4UA 1SJHB 5EU7C 3K91A 3O9WB 4IGBB 5SX5K 4OCRL 4XO3A 3WFZA 4ZAKC 1BLNA 4KJQD 3OJVC 3AS0A 3VXUD 4XPTL 1ZIBA 2LABA 3TA3D 25C8L 2VITB 2WUCH 5B1JC 3ULUH 2OL3B 2V5SA 4X98A 3DSNB 3RWDA 1SY6A 4DTGH 1D9KA 1K8DA 3HBZA 2NXZB 1SM3H 4BXVA 3KPSE 4YO0A 4GRLB 3HHRB 2H5UA 2P8PB 5D1ZC 4Z7AA 1TZHB 1SN5A 2BH0A 2B1HH 1A8ZA 3O4LA 4DJMA 3W2DL 4PCKA 1LNUB 2FIRT 3WUWB 2IXQB 5CILH 1WA0X 4OF0A 1RIUL 2MOQA 4N5ED 2DQIL 2Z7WA 4DERA 4JFDD 2FLRT 3C75A 1GCYA 4BK4A 1LYQA 1ZS8B 5F7EH 1B2WH 1L6XA 1RMFL 2A6JB 2XTJC 2ZQKA 1E0OB 1IGIH 3BAYA 5JIQA 5DQDL 4HX1A 2E76C 3IS0X 4JPIB 4F15C 3VRLF 1VJSA 4RMSA 3DUSA 2JSFA 2ZP8A 3DX6B 2OR9L 3K2MC 5HI4D 2HRPH 4U0RB 1EGJL 4YDMA 4J3SA 2ZG2A 1A21A 2ED7A 5J1AA 4DVRH 1CVSC 4B96A 5L0QB 2MKWA 2DBLH 2CR0A 1NCWL 3BKMH 5KAQF 3II2A 3ZDYB 3HC0B 1IM9D 4XMKH 5DHVB 3TJHC 3QDMD 4KI5D 3RGVC 2HMIC 2NY1C 3S35X 4JANA 2YD7A 4L8DA 2E27L 2MQGA 2UUDH 4DT2A 1SGKA 5BOPA 2MQ0A 4CBPA 5KANI 3ZHFA 2VOTA 3FU5A 2CSPA 1I7ZA 2XVKA 3BMWA 3ATEA 1CDIA 1HN1A 1S9XA 3AY2A 2D7PA 2ENSA 5JQHC 1QSEB 25C8H 3NZHL 4OZGF 2N4IA 2VZSA 2AXHA 4RFNC 1H0DB 3LB6C 5IEHB 3BKCH 3MRJB 5JZ7C 1NDMB 2WLJA 1WFOA 3BP5B 4MMZA 2V8MA 1F2XK 3MU3A 3BVDB 4KTYA 2Y07L 3LX9A 4PPTA 1G7MA 4QRPD 5A2JH 1YEJH 2F0CA 1E28B 2FEEI 2H9GB 3HBGA 1KLUB 5J6HB 5D4HA 5G4NA 1LWHA 2LU5A 2NZ1A 1MNUL 1PL3A 1ZLVH 5TDPA 3WNNA 5AL8A 1RP9A 2FVNA 1B9KA 5BJTA 1J8KA 1U3JA 2NOYA 4DP0X 5DD3L 5I24A 4BQ8A 4PLKC 4KK8D 1RMFH 3FT9A 4JO8A 2AEQH 5HVFB 3PV7A 2Y7LA 1FFNB 1UD5A 2QZ5A 1QI3A 3DDFA 3TO4A 3MRMA 4X6CA 2OCFD 5HVGB 5MI0C 4X4YB 3FOMB 1M7XA 2OR9H 5TDNB 5KBKA 3I02A 1EGJH 2HTKC 2CNYA 2XPGB 3ZE1F 1FNLA 4X9HA 2VXVH 3AADB 4U6HB 3KWVA 5IBLC 3P3RA 4JKMA 1EX0A 1KBBA 4KHXL 1ND0B 4BK8A 4DFHA 3D4CA 4HKZA 4TKWA 4YBLB 2WSKA 3UBFA 3A4EA 4OGQC 4PRIE 4HPHA 1PBYA 1S7QA 1ZMYA 5CEXB 3IJSA 3SD2A 4DGYL 5FOJA 1LO5A 2X5PA 4FDWA 4P9HL 5INDA 3WY2A 4MDJA 1BVKB 3F5WB 5EEVA 3KPRB 1BBJB 1T80A 2AZAA 1FGVL 3V0VB 4JFPB 4JO1L 3MGAA 2E6QA 1KB5H 2EDOA 3NZHH 1JN6B 1KGIA 2E8YA 4RWYL 1A7NL 3QUXA 5B3NA 1PGRB 1BLIA 5CMAA 1PNDA 4UV7H 5ETUB 4B97A 4GW1A 3ULVE 2D2OA 4F7EA 4OGZA 1YC7A 5IT2H 2PTUA 4AVKA 3KPMA 4OFYD 4JRXD 3HB3B 1Q9OA 3VGDA 2EE2A 4J39A 4YHPB 1KT2A 1Q0YH 3FONA 4XMZA 1DJXA 3D34A 3OLDA 5F44A 2XXMB 3KJ4B 2I9TA 1NGZA 1QPPA 2WIIA 2OS7A 2DWEA 3QCUL 2MTPA 2FL5A 4PP1D 5ICXA 1RPQA 2CXGA 4H5SB 1J05B 1YEDB 3T2NH 4FLSA 2PO6B 3QDJB 2YC1A 5HVHB 1CR9L 2PYFA 3QDGE 3S97C 3MV9D 1NFDB 4WO4B 4OM1L 4ZPVB 1KELH 4PYHA 1CICA 3POHA 5AB0A 4ETQA 4BSWA 3D39A 1U41A 3FU7B 4P4KB 4KY2A 5SWSE 2FE0A 4GQ9L 4AK1A 3Q48A 1IJ9A 3F64A 1G84A 2PW2A 1NBQA 3PCYA 4OIAA 1F42A 1ZCRA 1UD4A 5T3XL 2X3CA 5C08E 3QYNA 4JKKA 1HQRB 2BNUB 1KGCE 4NO5B 4OJDH 1BM3L 5JW4N 2VLRA 4OR1A 4FZEH 3N85L 2HX9A 3KNBB 3U2SA 1J5DA 1I3GL 4U4BA 1RJCA 4PLOB 4JFEE 4OD2B 5F9OH 1JI2A 1KG0A 2DQEL 4OZGA 1MLCB 5KSBB 3HKZA 1TCRB 2B1AL 1CQKA 4L1TA 5G5DB 3T0BA 4M9PA 1CWVA 1FGVH 1NUFA 2IQ9L 4UT6A 4H2CA 4JO1H 1C5DA 2BLFA 4JRWA 5I8EB 1NKOA 3VXNA 5JR1L 3ARZA 1JPSL 4Q9RL 4WFEE 1UB6B 3OZLA 1OP5H 3RFZA 1QNZL 3STZA 4QF1A 1JF5A 2G0LA 2OZ4A 3E0GA 1KTJA 3JWNG 1HZLA 3EBHA 2WPGA 1AYOA 2NY4C 3P3TA 4JLRA 1PZSA 4N0FA 3QJZA 4MS8D 5CR1A 4XHJD 2VDLH 4F7MA 3II3A 4X7CC 5FYKE 3QCUH 1OGAA 3KPSD 4N0UA 1UJ3B 3STLA 4WW2B 4YDNA 4MQXC 1K4CA 3LTVA 3MODH 3HIZA 4ZMQA 4GKSA 3OQ3B 3ZUNC 4JDVB 5DURB 2CGZA 4X8CA 3DBXB 1MZZA 2ZYSA 2F53D 3MBEB 5I9QC 1J86A 2GSGA 2XIBA 1X7TA 4ZJ9A 5GS0H 5HYQA 1OPOA 3QIUA 1ZLSL 1FL3B 1MCIA 3BPCB 3QQNA 2CM5A 5ERWB 4B5ZA 1JTOA 5CIPB 5EU4A 1ASPA 1IC7L 2OYKA 4GQ9H 1RURL 3SHSA 2ADFL 1TTRA 5KS9B 1FSKB 2E6PA 5FO9A 2ZE0A 3QUXC 7FABL 1KPRA 3HKFA 3A4DA 2F68X 3B9KC 3IAQA 2CGRL 1A6ZB 1PEWA 2XVGA 1BM3H 2V5RA 1IU1A 1LL1A 4L4VE 3FUNA 1XF5A 1YY9D 3O45A 3FTZA 4XB3A 2AXGB 3LKPB 1GPOL 1A9VA 2DQEH 1A6TA 1J10A 5I82A 4N2IA 1CGSL 2B1AH 3ECBB 1LO3L 4FFVC 4UT9A 2AW2A 4AQEA 1UVQA 2IQ9H 3OSKA 5EU6B 2EECA 3QUKB 5D7IE 3GYRA 1S9WB 1DVUA 1FNEA 1EAPA 2VW4A 4OF8A 5JR1H 1JPSH 1P0SE 3D2UD 5TDOA 1Z7JA 2VDQB 2Z31D 3V6ZB 1KCKA 1UG9A 4QEGA 4R4BA 3FMGH 2FSDA 1MHEA 3NA9H 2WSDA 5DD6A 5MEND 3GBML 3POCA 2FJSA 1BXXA 2R7EB 1K9TA 4O2CB 1OALA 3IXTA 3FFOA 4A67A 4YGVB 1AP2A 5CGTA 4KDTA 4ODWA 5TJWK 3W3BA 1MRDH 1I1AC 2LTQC 4LCUB 2WXJA 3P73B 4Y2DD 4JO4L 5IQLA 4Q56A 1EEYB 3GJEB 4FLHA 4ZW6A 2XYBA 2R2HB 3NGBB 3RHWK 4R2GB 3GIVB 3FQUA 4HZ1A 5B4MD 1JV2B 3ZDWA 1RULL 3KDPB 2FECI 2CIKB 3FB5A 2E7CA 1UA6H 3D6GA 1TJHL 4HJJL 4LVNC 5AAPA 5F7HA 4M93C 1LE9B 1RZ8A 2Z3FA 1KXVA 1DQJB 1V5JA 5MHSD 1ZLSH 3WLWC 1UXWB 3O4LE 4LLVB 2OSLA 1TPXC 4J4PA 4K71C 3QW9A 5IB3A 1AMYA 5T1MB 4ANXA 3ZSTA 3FCTA 3OAYH 2YAPA 3QC5X 1S7VA 3MLWL 4HIXL 3VXUB 3RX7A 1PEZA 4AE0A 3K6SB 2G5RA 4DN3L 4FERA 2B9BA 3TA3B 3B5HA 1NANI 4KDVA 1YMHA 2CGRH 5MEOB 4TSAL 2EICA 3QPQD 4M29A 5KBDA 4YZFF 5JW5A 3T6ZA 3KPLB 3NUKA 4ONGH 4N85A 1RSFA 5BNXD 3BGFB 4AZ8A 4Z7VF 4LLDA 4WV1C 3N1MC 5EIIA 1CGSH 1LO3H 4G7QB 5I73B 1QSFA 3D4ZA 4PRID 3VAEA 3BCFA 3C5ZD 4GAFB 4KKAC 3AMLA 2CCLA 2CRYA 2VABB 3H9SD 4GIPD 4BV1A 3CLEL 3FB7B 1F90L 5H37H 4DPBX 4JFDB 1T20B 1DEEA 4HJ0C 5IBTL 2J55A 2OMUB 2V17H 3GBMH 4JDEB 1QOKA 4PP2B 1OE3A 3F12B 2AEPL 1C9SA 1B88A 1YMMA 3U48A 3M8OH 1PD6A 3MN8A 4PN6A 3TPKA 2XPZA 3P9LB 4BK5A 3CGTA 2AV7B 1M6OB 1V7NH 3QJHB 4OJEH 1IQWL 3AC0A 1BEXA 3TF7C 3ULVD 1PZCA 2IOMA 4OJFL 1W80A 1DN0B 2R4SL 3LPPA 3HG0A 3RWFA 5C6PB 1OCCB 5E99L 4GG8A 1FHGA 1SJXA 4EDXB 5FF6A 3B6SB 5BOZG 1MVUB 2M2DA 3DHPA 1AY1H 3ARBC 3HUJB 4HS3B 3REWA 1XZ0B 3KL0A 1QTYT 2Y4SA 1IM9B 1IAII 1JXDA 3RA7L 1TJHH 4C8XA 3RIAK 4UF7C 5IIEA 4LSUL 2XZAH 3ZT7A 2P42B 4H0GA 4PJEB 4A7SA 2D03L 2DIAA 4LEXL 2IQAB 4NDMA 4PVLA 3MYJB 3RE0A 2X9ZA 5CBAB 4W1TA 4LAQL 3NAAH 3SDYH 3MLWH 4O02A 4OKVA 1P5UA 2PWHA 5EUOB 4DN3H 3M1BA 3K46A 2HVKA 1S4IA 2J1WA 2Q7YA 4P5MA 1YUHA 4MA8H 4RIRB 1ADQA 4JREC 4TSAH 2XWCA 4HP5A 4J3OG 3FQNB 3P11H 5ACMA 5I1EL 5K59F 1L5GA 5KYXB 3TONA 1XDTT 1QACA 2V8LA 1H8LA 5KYNA 43CAA 4EN3B 1O0VA 5E6YA 3T4YB 4ZO8A 2ADJA 4LOEA 1KGWA 4HLEA 2XDHA 2XX0A 4M5ZL 3ILQD 1VACB 2NY5L 3FF7A 1GOGA 1GOHA 2ODHA 2BRQA 5LGYA 2C9PA 4W9HC 4M61B 4NUPA 2KZ1B 4OFQA 4X6FA 4OCWH 4WHYH 5DD5H 1WS7A 2H4EA 1KACB 4DK6A 4JFED 1F90H 2J5LB 5LLIC 4J3UA 4I1RA 3VD7A 5IBTH 3NT0A 4OCXH 3WJJA 1RZKL 4KK9C 2FB4L 3OSVA 1L0YA 2V2TB 3BH4A 4D9RE 3F84A 5A2LH 1T3FB 4LMQI 5TGBB 3CMOL 2VIRB 3ARFC 5IV2B 4FADA 1FFOB 1JZ7A 2XTJD 1BPLB 3KPNB 4JFXA 1N3NA 3F6JA 4OJFH 4DETA 2A6DA 3WN5B 4G5ZL 4N8VB 3T71A 1V54B 1OAUH 3MCLH 2BW5A 4WU7B 4JAMB 3W9DA 3BLPX 4YGAB 2CALA 2OK0L 3P4NB 4MRCA 3KWUA 4YXKL 4C4BA 1TKWB 3D69B 4HUMB 4MWFA 4IOIA 4LSUH 1CJYA 1WIPA 3CC5B 2RHEA 2D03H 2W9DL 2DQUL 1I3RB 4LEXH 3DYPA 3APCA 2QLVB 1IVTA 2XG5B 3DSFL 3L7FA 3IJEB 4LAQH 3TJHD 2HFEA 3RGVD 2ZOKA 1CFTB 1H3GA 1CURA 5K9QG 2NY1D 3QXTA 1MREH 4RZCA 3B7TA 4OJCA 3BPLB 4QT5B 4Z7VA 1S7UB 4PLJD 2TRHA 4YR6A 5F7BA 3WV0A 4MAZA 4MNGA 3NQIA 1EO8L 4PJIF 2XN9D 2E7MA 3FTSA 4WHTB 4K3JL 5TF0A 5I1EH 4YE4L 5SV4A 4RBPH 1UATA 1KJMA 4GAJL 2ICWI 3K1DA 1UC6A 4JRXB 4NRXA 4O51B 4TQ8A 4IU2B 3D39E 4WW1A 1EFXA 2NY5H 3LB6D 3LPFA 5DO2C 3EJRA 5JZ7D 1AZVA 2ZXEB 2Y2YA 4NFCA 4WK0B 2X4QB 3S8WA 1DJZA 2EO7A 3LIZL 4ZPTA 3ZZ1A 2OMVB 4RX4D 3UBGA 5E24E 1YJDC 2YR3A 3EH1A 3HG4A 5T5NF 3ZKSD 2XWJA 2FB4H 5TE6L 4KTEL 2VLRE 3PDGA 4QPEA 3ZKMC 4QHKI 2X4SB 1RPUA 4AYFA 3KLDA 4A68A 1M53A 4OZGE 3TLRA 3NJKA 1GGBH 1OZTG 3R8BB 2IALB 1VKXA 4NM4H 2CDEB 1WBZB 3K6FA 5E6ID 1S9YB 3AG2B 5A1AA 5L4MA 4G5ZH 2CO3A 5FDWB 4RAUB 4J27A 5DRWA 4A2MA 5F8QC 3ESOA 1D5ZB 3V6OA 3ZXAC 2DQJH 2QELA 1PCXA 2N1TE 2OK0H 1G6VK 3QHTC 4NT6A 4FNSA 3ZDZB 4PCYA 3L48A 4RVBA 2HKFH 4WK4B 4MMXB 3HE6C 1U8IB 1MDAA 3AABA 4YFDB 2HUEA 3MV7B 4N90D 3V9FA 5EZIH 1IGTA 3DSFH 4N0UE 3GDBA 1ED3B 2ERJB 3LQAH 2H1PL 3CCHA 1JZ2A 3T2OA 3GM0A 5F1IB 3O4LD 4LRNL 1EO8H 5CJ5A 1N5YL 1KDJA 3ZE1E 4K3JH 4YE4H 5DHEA 3LN4A 3WTXA 3MXWL 3UZEC 3EFOA 2R1YB 5EU5B 1JPST 4FQQB 5FK9A 4ELDA 5BW7C 3IDUA 4PJDB 3U0WH 4LE8A 3EFDH 5DMGC 5TQ2L 2BHZA 1TQTA 4FQ1H 3KPSB 2F08A 3REVB 4AH2B 4G6ML 4JFUA 2AJUH 1DVYA 5K33A 5TTRA 3OTTA 1AGDA 2J57A 1U92B 2MCPL 3CX2A 1BDYA 1A2YA 4PGCA 4FA8A 2CLZB 4I2XA 1KFAH 2J44A 3BQUA 1GAFL 1ZVYA 5FO8B 2P43B 2WKGA 3M88A 3GWJA 3IFNL 3MA7A 4RQQA 4WGVB 5HDBF 3B7YA 1S5IH 1ADWA 2EE9A 4BWTA 3KYAA 3L3DA 3EJUA 1DUYB 5F0JB 3LH9A 3G9VA 4DFIA 1ZGLB 1JGEB 2XRAL 2EDYA 2R1XB 3CVDA 3HMWL 3RNQB 3NZ8A 4WWKC 4LSQH 3BVNB 2KQNA 1X5FA 4YSOA 1QFUH 5I16A 1FCGA 2KQMA 2AQQA 2YAFA 2YXFA 4P3WA 4PJ9C 4UZGA 2NSXA 3OHXA 3L3IB 1KIPA 1A14L 4RMRA 4KH2A 4Q6YA 2GTZB 3PWNA 3O4OB 3I6SA 4WJKB 1I1FB 1UQSB 2L7UA 4HKBB 4PJIA 3RWIB 1N8OE 2Z65C 2BVOA 4UDTA 2VLKA 4UTCA 4LL4A 3BZFB 1S46A 3PUCA 1FC1A 3D2UB 1WBYB 5H35A 1AZCA 5IROA 1PDKB 4LRNH 1NGXB 4JE4B 1YDPA 5MENB 2IAMA 1P7KA 3V5DB 4NO3A 1B3JA 1O7DC 1WTLA 3MXWH 4L1DA 4JGJA 3L3GB 3CWGA 1DFXA 1TXKA 4MHHI 5DRNA 1PFCA 1KTCA 2K7QA 3A24A 5J4MA 5CXPA 1X5YA 1TYJA 5IM7A 5TQ2H 2FR4A 4PRPA 3UTTD 3GXTA 4NWTH 4Y2DB 5E1GA 2ICEB 4F9LA 2G3NA 2VB5A 4R26H 1MAKA 2NY4D 4MD5B 3PL6A 4TNGA 1IUZA 2NQDA 2G0KA 2X44D 4X5PA 5E2WH 5D6CB 1D7BA 2VWEC 3DRTA 4M8RA 1N12A 4KVPA 5AVYB 5BRZD 3U83A 1GAFH 4CKQA 4XVSL 2Z7YA 3GMOA 4MQXD 4XBPB 4PGBA 4CVXB 4TTGA 1G9MC 4LVHB 4NZRL 1QSFE 4TVPE 3K8LA 1YEFH 1D6EB 4GY4A 4S1RL 2EUXA 1RKRA 2H32A 4QAMB 3RJOA 3V0AC 1PMYA 2XOTA 1XF1A 3GPEA 3VXPA 2WO3B 4B9YA 1SBBA 5T1KB 4D9RD 1UWYA 5HHQA 1P4UA 1Q9LB 4IRZL 1OCZB 3QO0A 3SE3A 1YMME 2VM3A 2WLHA 1IKFL 1A14H 4GXUN 4FHBD 4DGIH 4GIAA 3DX2A 4YHLH 4JFFA 5IMOA 3QUXD 3KCPB 3B9KD 3EDEA 3V79C 1BQLH 2GCYA 4PRIB 1Z66A 1BVLB 2WVUA 3C5ZB 2NY3C 4FXKA 4U1LB 4B9CA 4N1CA 3QUMB 1G5AA 2L7EA 4NP4L 1XGQB 3EOBB 4XCYA 1CXFA 3S4SB 5C8JB 1EZUA 2VDMB 4JDZA 4NCC2 1XGRA 4Z95L 3UIZA 2EIKB 1GGCL 2Z92B 3VXSA 1UKQA 5SV3A 1PZ2A 4AYBA 3HMXL 1TZ8A 3NSDA 1F3DJ 2AQRA 2XV6B 4J3OF 4D0CA 1J5OL 5CGYD 2P52A 4HOMA 2FJUB 2E7LA 5F7WC 1K4DB 1OVZA 1ZIAA 4RNRB 1KPVA 4DKFL 2X4NA 2CRZA 3PDDA 1N68A 3VGAB 2YOCA 1ZWIB 3BLBA 3BRFA 5MEPA 1CICD 1MXDA 1UACL 2GYSA 1S9VB 5F7UA 5KANG 2D4FA 3W82A 3MRCA 1AHWA 4WUKL 1VGKA 5G2NA 2GJZA 1PZDA 4FEIA 3UPCA 1GKOA 4Z0BL 1CBJA 2Q0ZX 4H7VA 1VHPA 5CEZH 3BUYA 5BV7B 3CXFA 2WZPD 5GGTH 1PTZA 1B2YA 3LKQB 4J2XA 1N6UA 5CLTA 2VLRD 1LO0H 4ZS6C 3ZY7A 5I6OA 4P04A 4PJXF 2DLEA 2DQDH 1E9OA 3AQDA 4PTTA 3BP4B 4IKLA 1U93B 2CD0A 5FGRA 3WLWD 4J6RL 4H8UA 4KO7A 1P5VB 4U1GB 3CV5A 2FQDA 2WB1A 1U8LB 4K3EH 1IKFH 2NX5A 2VXQH 4HEPG 4X80H 5IB2B 2ITCA 4PRHA 3BX7C 4PGZA 4NQCA 2HA1A 4F9PA 3WJMB 2C1PA 2BZDA 5C08B 4V1DA 5IFHL 3Q6GL 2VDRL 5HDRA 3H42L 1JNNH 1JK8B 4MD0B 5EOTA 4F9LC 4YHNB 1MFCL 1TFPA 2EIZA 3A67H 4X0NA 3I6GA 4C54A 3TTYA 2D4DA 4JFEB 1PPIA 4NUQA 2YD9A 4KRPC 3T8XA 5ALCL 3BPOB 4CJ0A 3MRNA 4YSDA 2Y0SA 5FUCC 2H6UA 4XZUA 1N0LB 1OGAD 4KKAD 5F7DA 2YN3A 5GGVY 4FG2A 4MJHA 2VN5A 3HMXH 2WXOA 1J5OH 1YRKA 1FGNL 3OLEA 3GJFK 4R8WH 1AGCB 1XCTA 1AACA 3CVHA 2OQJB 4YZFE 3W57A 1JFHA 4KKBC 2VLME 4DKFH 4ODXA 4OZ4A 3EJYD 1X6NA 1HOCB 1JP5A 4FKKA 4Z7VE 2FO4A 4GUPA 2JF1A 1JHKL 3ALWA 1TVDA 4ONHA 2NW2A 1YNTF 4MNGE 3SGJA 1C16B 2V5TA 2XY1A 3HFMH 3OM3B 4WUKH 4F2FA 2H6PB 1ORSB 1UM4L 1J0HA 2MCMA 2DIEA 5SWQA 4CW1A 4UQEA 4PY7B 3IMSA 3LZOA 5EF0A 4ABUA 5L4FA 1U3HC 3N1GC 5INCB 1F11A 1Q4NX 2DPKA 2EDHA 3ARBD 4IRSA 1JWUA 4NUJB 1NFIA 1TQSA 3CHQA 4P07A 3JYCA 1WA1X 3WY3A 3ZZSA 3GFUA 3RGVB 1GY2A 2NY1B 3D0LB 2VERA 1QLFA 4J6RH 1I8IA 1NWOA 3T4AA 4Z3TA 1HDMA 4GPVA 2ZUYA 1BMWA 1SOKA 2ZUXA 1FO0A 3C6SA 1N59A 1SF5A 2XN9B 4UUJA 1TVBA 3JYBA 1FL5B 5C7ZA 4UQ2A 3IFPA 4AOFA 2ADGB 2ZTBA 2VDRH 3H42H 2VKXA 3BT0A 1XF2A 2E7LC 4RISL 3SGKC 4L4VB 4RDQG 3VDAA 3CFKA 3GLEA 1RUQL 1OARL 5I1LA 3ARDA 2VZUA 3V6OE 4PUBL 4PY8I 5DR5L 2EYSB 4JNXA 4NN6C 5FECB 2OM5A 4I0PB 5ALCH 3ZKNC 4MMYB 5D7IB 5CGMA 1WBXB 4IW4C 4XP1L 1IAIM 4X99A 2JKIS 3IU3A 1W0WB 4F33A 5ECJE 2QEJA 2FT8A 2YQBA 1YYLH 4WI2A 1A3QA 2QQKL 3LKOA 1FGNH 2Z8SA 2FQFA 3C12A 4CAGA 2I26N 3BIBX 2NY7H 4Z5RA 5E6IB 3MLTB 5K59E 4K9EH 5LCVA 1NBZA 2BVQB 1IKOP 4BRVA 4CA4A 4L8CB 2TSAA 1H19A 3P9WB 4XP9L 1HYSC 1JHKH 2J88L 4TS6A 5MI0B 1KFGA 3ARFD 3T2QA 1C7SA 1VCAA 2CCVA 3QXWA 4HJIA 1BLNB 1H8NA 1T1YA 3PNRB 1PIGA 4U6YB 4XVJL 4WKZA 5DRXA 4L9LA 3FH7A 1D3CA 4LSPH 4PJXA 1MH5B 1OP9A 1FAIL 4MGXA 2ZUUA 2NY6D 4P2YA 3L54A 4X98B 3RWDB 1TNNA 4ZFFA 1D9KB 1T0OA 5FPIA 1RI8A 1K8DB 3CD4A 4OAWA 1DN2A 3SGEI 1WUNT 2F58L 1THAA 2I27N 5JHDE 1IC4L 3AQZA 5I1IL 3H2QA 1CCZA 1WF5A 3RWCA 3O4LB 1WAPA 2CKBA 1MCSA 1KTDA 4I2XE 1YN7A 2BNQD 2V37A 3QJQB 5BXFA 3CFCH 4HH9A 2BVYA 2BZCA 1PKQA 1MQ8A 3NDYE 3X13A 2VR7A 2AABL 2AQTA 4TULL 2IWGA 3ATBA 1AI1L 2Y69B 2P5EA 4RISH 3D9AL 5JQIB 5D4JA 3B9EA 1J8RA 1T2JA 1YMMD 2W0FA 4HX1B 3UPRB 3O6FC 1RUQH 1OARH 5ILTH 5I76A 2NMSA 4LBAA 2N56A 5DDHA 5DR5H 2ZKHH 4BINA 4CU7A 2P5WA 2PYEA 4ZQKA 3PGCA 5DLLA 4XCEA 5DO2D 4J8QA 1MRCH 3BO8A 3TBSA 4Y9GA 1JXKA 2ZIDA 3ZL4L 5J1AB 3W9EA 1U2CA 2X4UA 1A6AA 1YEIH 2ZCZA 3E2HC 2X2JA 1YNTA 3QCTL 4PJIE 2O93L 4QNPF 2VLKE 1Y6NR 3U9WA 1HZHH 4DKTA 3C5JA 4JANB 4XP9H 1KLGA 2IGFH 4UINL 2DN7A 4EJ1C 4XMXA 5AKRA 2F19H 4GFXA 4PRNA 5B8CA 4P8QA 2EVGA 1MI5A 3RZCA 3WO4C 2DZEA 4XVJH 1UCBL 1R46A 4IS6B 1S9XB 4NOFA 4ODTH 5DEGA 1QUPA 3VTMA 4IMLA 5GJTL 5JORA 5T3ZD 3RGBA 3MJ6A 4Q89A 4PRPE 1XSIA 6PAZA 1YN6A 2F58H 3DI3B 4EOWL 3VYOA 4JHZA 1IC4H 1FYTA 2A6KB 2R23A 5I1IH 1DVXA 1IFHH 3HRPA 5D93B 2VDOB 3F00A 3HE6D 1BYOA 3EJSA 3JWNE 5GISL 1PYWA 1D5MA 35C8L 1HWHB 4JL2A 3RDTC 3WFCH 1ZHBA 2N0KA 4P3CH 3MRHA 2CE6A 5TDPB 2OULB 5BJTB 1U42A 3GEWB 4LRIC 2N7BA 1I3VA 3LKNA 3V9EA 3RJQB 1ILUA 5LGKA 2ID5A 4B7IA 1VZIA 1WDAA 2Y6SC 3D9AH 3UTTB 3IDGA 3KLHD 4XX5A 3FU0A 1VERA 2VDNL 2AK4A 5FGBA 3MRMB 4X6CB 4EPSA 1PLGL 4HOZA 4W6XB 1MFVA 3GBNH 1BVNP 2APWA 4BXSV 1BBDL 3H4HA 1D7DA 1C1EL 1SN2A 1IGJA 1SJVA 2DM4A 4OLEA 3V0FA 4JFFE 5E1AA 1C12A 2BVTA 2PR4L 4RLDA 6FABL 3V4VL 1GYCA 4HKZB 1TTCA 5E6SB 2BM3A 2WVSA 1E5CA 1GJUA 5FX3A 3BGMB 1T7YA 4PI2A 2EEDA 2WYHA 5AVRB 1DVTA 5GGQL 3IJSB 3QC6X 3PGDA 4OFPA 1LO5B 5I9QB 5INDB 4ZMTA 1PAZA 1TQCB 1UFGA 2VO5A 7CGTA 1TJXA 1UCBH 3CFNA 1CGXA 3DMMC 3GRWA 5F6HI 3ULUC 1R3LA 2WOYA 1UADC 3D09A 3SPIA 3VXSE 2EUZA 2QVIA 4WWKD 2OL3H 3QUXB 1OCWH 3PXJA 1JF6A 4Q8BA 5CMAB 3B9KB 4AMKL 3LNFA 4A2GA 1YNLL 1TJIH 4OQTA 4EOWH 4F7EB 4YUEH 3BSGA 3NSYA 4N0CC 3V7AG 3LD8B 5HDBE 3KPMB 3QO1B 1O6VA 1JS4A 1Q9OB 2NUPA 2Z93B 3G6AA 4ZUSA 1KT2B 1NEZG 3FONB 5GISH 5I30L 2VCOA 4BFIA 3QJSB 2I9TB 2DWDA 1NGZB 2EXWC 2WIIB 2VZOA 3VXRD 2DWEB 5I17A 3S5ZA 2FL5B 5ICXB 1ES0B 3TO2A 2AP2A 1U36A 4HJGB 1FH5L 3VNZA 4A55A 4LHJB 1CF8L 5CHNA 3P02A 3EO9H 3FSWA 2YC1B 3PAZA 3U1QA 2A9MH 1PLGH 2X3BA 1E2VA 1FIGH 4LCYB 2ADIA 3W11C 1CICB 1FLTX 5CLXA 4BSWB 2Y9RT 3D39B 4FA7B 1G9NL 4OGYL 1BBDH 2NX5E 3GTVA 2L0DA 1QFWH 1C1EH 1F4AA 3HC3H 3L9BA 4NQCE 2XFGB 4NZTL 2PW2B 4KU1A 2PR4H 2H2PC 5C0GA 6FABH 4NHUA 3FSVA 4V1DE 1HXYB 2VSKB 2ARWA 3UJIL 2R69A 5L7XL 4LAJH 1FIEA 5DHVH 2VLRB 1A6UL 3IMTA 5GGQH 3LRSA 3U2SB 4LVNB 1QD0A 2PW1B 1BZDA 1ID5I 3HC4L 1S78D 1KG0B 4OZGB 4DZ8A 1H3UA 1O75A 3M1CA 4K71B 1TPXB 4OFKA 3L3HA 1M05B 4LF3A 5F0MB 3QG6A 2JXMA 4ADGA 1C5DB 3VXNB 4ZYKA 5JIMA 2J6EL 1AQ8A 2CRMA 3RFZB 4AMKH 3PHOA 1R3HA 3KLQA 4QF1B 1DDTA 2PF6A 3TVMA 1FFPA 5GHWH 3T77A 1QI4A 3BYYA 3DOHA 4JLRB 4ZW7A 1HHJA 4HJUA 3Q2VA 4N0FB 2K8QA 2Q2EB 4PU2A 2JKJA 5IBUG 4P23C 3FN0L 4KNQA 2VDPB 2ZWSA 3MBWA 4M62H 4CMMA 1OGAB 1U33A 3ZGHA 2NY3D 4FHJA 3NABL 5I0YA 3QPKA 3STLB 1F6LL 3P30H 4UQBA 1K4CB 4YWGL 1FH5H 3IK2A 1AOZA 3IGLA 2UY6A 2J1XA 32C2A 3A21A 1ZSDB 2QMKA 1BFVH 4GKSB 5BOJA 1E3XA 5CFHA 3P4OA 5IZ7A 3PDOA 3I2CL 1J8HD 3L2LA 4BE5A 2FX7L 5IREA 4AJ0A 1W2KT 4PR5A 3ARTA 1P4IL 3S3CB 2GSGB 5KZCD 3QIUB 3NJNA 2GFBA 3L1OL 4J28A 4KY1L 1DVQA 4RDQF 4XVTL 4GBXA 2JMRA 3L17A 3UCRA 5EU4B 2HFTA 4NZTH 2MMXA 4G6AC 1MUJA 1CIDA 1I3UA 2AQSA 1U2HA 2XWXA 5FO9B 3UJIH 4NHCL 5FUOL 4LLMA 1HXKA 3WY4A 1HESA 5L7XH 3DVIA 4UBDC 4AJVA 2PTTA