4FEMA

Structure of suse with alpha-cyclodextrin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
SLTPPKTMFIVGSMLDTDWKVWKPMAGVYGMDGQFYSMIYFDANSEFKFGTKENEYIGINDNRVTVTDKAGAGVSGSDNFVVENAGWYLFYVKAAVKGDDYQFTITFYPAEVYLFGNTTGGSWAFNDEWKFTVPATKDGNFVSPAMTASGEVRMCFKTDLDWWRTEFTLHDGEIFYRDFNLIDSWTEKGDGYSIQGSAGNVIHLNFTAGTGEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein SusE
publication title Multidomain Carbohydrate-binding Proteins Involved in Bacteroides thetaiotaomicron Starch Metabolism.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Carbohydrate-binding protein
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16411 SusF_SusE Outer membrane protein SusF_SusE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3610 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA02
2.60.40.3620 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA01
4FEMA 4FE9A 4FCHA
chains in the Genus database with same CATH superfamily
4E9TA 2VDNB 1G7IA 5IMKA 3VI4E 2QVKA 1F6FB 2ZG3A 2XZAH 3PJLA 3GTVA 3GXFA 4OUUA 4X8CA 2AAAA 2D7PA 4XMTA 1AO7A 3OHXB 3QDGD 3ESUF 5TQ2L 4FQCL 5TTRA 3G04A 4QRQB 3RWIA 3Q9QA 1ZHKA 2XY2A 1MW1A 3HC2A 5CLXA 3HR5A 3VXNA 5AW8B 3STLA 2DQGL 3SCMC 1WE5A 4L05A 1OF0A 2WXHA 4DUVA 3V6FA 2X4QA 4PJ5D 4ANWA 5HTSA 2R9HC 3WFBL 3HHMA 2MNUA 3HE6D 1TEYA 1ZT7B 3BRGC 3D48R 3EH2A 2J5WA 5T3ZL 2OMBA 5DJ8A 3O3EB 3WNNA 3MXWH 3WTUA 1UYWH 4PV8B 5DCCA 3OR6B 3V0FA 4AGOA 3S8FB 4O2FB 5F1OB 5C0RL 4IRSC 5GGVY 3FF7A 4UT9H 3WKYA 2RCSL 5F1IA 3J27A 1JV2A 1DVTA 2NYKA 4PJAE 1NKGA 2IDQA 2VW6A 4HUVA 1GY2A 2HAZA 2Y22A 2X6AA 4ZNEE 3TXAA 3VFSA 3KWWA 1IGTB 1Q0EA 1HU8A 2QQLL 1OE2A 1LDPL 3MLTB 2VQUA 2Y2YA 4GSXA 4P2RA 5KAQF 5HDBE 3QHZH 4LLQB 4JUTA 3E6FA 4IMLA 3QO1B 5IQLA 1FE8H 1F58H 1QTPA 3UAJC 2JKJA 1S7RA 3MRGB 3NZ8B 1UFUA 1OQXA 3QCVL 3AW5A 2VR9A 4YSPA 3V0WL 4ALAC 5JXED 2WVUA 1XSOA 4CVZA 3LVEA 3IU4H 1OQOA 3HHRB 3O4LA 1Z9OA 4PJDA 1CE6A 3FRPB 3OM3B 1KTRL 3KPSA 4NRXA 5FGCE 1EQWA 2ITDA 4PRAB 4U6YA 2WLJA 1WS7A 3AB0B 4MA1C 4YDKH 4R2GD 1ZLVH 3PS6A 1O9ZA 5DTFB 4BFRA 3D2UD 3DMMB 2H1XA 4PG9B 5IB2B 2VERA 3UP6A 2VM4A 4I1RA 1ZOXA 3H3BC 4BE6A 4HK0B 4IKLA 4GEIA 4WNJA 4YHLL 3FHEA 3V5DA 5HI4D 5C09B 2F1AA 2J6WA 3D52A 5K1JA 5TK2A 5GGUB 4J8RB 3MGOB 1RUML 4XO8A 5E0QA 1FHGA 1OARH 4ZAKC 5BW7C 1KTCA 4GI9A 5AD0A 2PWFA 5HI3C 3FHAA 3DGCR 3D9AL 4FQ1L 5EOCH 3HE7C 1J8HB 4P8QA 1JWUA 5T3ZE 1BQUA 1G6RH 4XB3A 3DHMA 3EOBA 3S36X 2MMXA 2NY4D 4AX3A 1A25A 2VLKB 1HNFA 4YFEA 5ITBL 1G7QB 2LQRA 4X6CE 1D5MB 2HJLA 5F7AA 1HXYB 4MNQD 1IBHA 1HYSD 3KPPA 1UOWA 1WBXB 2IPKA 3K74B 4A1RA 5D4IA 5FC9A 4N0UA 2AEOA 5IBUG 1T22A 2AGJL 4UYQA 4WUUD 1FV1A 1Z9LA 3MV7D 3QDGA 3TURA 5SWZA 5AZEH 1ZY9A 2LFEA 5E1AB 1IX2A 4S1SL 4EDXA 5DMIH 4JGMA 3L4WA 1YPZF 1J5IA 4AVKA 1K2DA 3D0AA 2G3ZA 2GT9A 1T1YB 3ASNB 2NX5E 2MKWA 4HXAL 3X11B 3KXFE 1Q0YH 1X9RA 1EFXA 1OGSA 3LVTA 4K94H 1AP2A 5DWUH 3QDME 2IFFH 5IMLA 5EEYA 1WWCA 3ET9F 1OM3H 3I9PA 1XH0A 2ZXQA 1T7ZA 1KC5L 3HAEA 4OIIL 3T6ZA 1U6AH 2EE2A 1T3FA 1QTSA 2D7TH 4QXWA 5EBMA 1UB5B 4LPVA 2DYPB 4NO3B 3WAJA 4D2NA 3FYIB 2J7LA 4PJ7F 3ZYIA 2PO6C 4PCYA 4WGWB 3VSVA 1LEKA 1YMMB 1NAKL 2NY7H 4LRIA 2DBLL 4ICWA 1ONQB 2JNZA 2YOCA 2X10A 2XG4B 3RPIB 4XP6L 1G4RA 1KN2L 5KSUA 1XTMA 1SN5A 3VG9B 2F9BT 2BOCB 2D0GA 4Z7WF 4MMZA 3ILQD 4F93B 3WI9A 2O6CA 4HC1A 1DQKA 5D7LB 5HHOA 1QBML 2KDGA 4NZRH 3TTYA 2AQQA 3U4AA 5I76A 1S3RA 5EA0L 4RH4A 1HEZA 3KPRB 4KBPA 2G3NA 2Z0UA 5JXEA 2W07B 5AG8A 4N4YB 4RAVB 1MWAA 3J07A 4LGSB 1CL7H 1FLTX 2OMWB 4MD0B 4QWWD 4NS0A 3WUWB 2OK0L 1BM3H 1OT2A 3M8OH 3N43F 5AVTB 2XWBB 2AXGB 1EIBA 3BIBX 4A04A 4AV4A 4NFDA 1JK9B 1QA9B 5D71L 4XZUA 2VDKB 5L4FA 3UDWA 1DJHA 3C8KB 4L4TD 5HP5A 3P69A 5CEZL 5ERWA 3RDJA 1T7VA 1NCCL 2VERN 3CVIL 4JFFD 4C56E 5B7EA 5B38A 5F0PB 4U1HA 1RJZA 3RAJH 1IZJA 4QO1B 4FZ8L 3OX8B 2J1XA 3AM8A 3X3GL 3WTVA 1WJ3A 3REWA 3ESVF 3M86A 2EDHA 4GSUA 4UTAL 4HCIA 1TSHA 1WBZB 2BVQA 4W9IC 3T77B 5IB4B 5CMAB 3U9UB 4H26A 2YZ8A 1RZKH 3DX3A 1JZ3A 1QUNA 4B3VA 5L2KD 1DHKA 4QCIB 5IGXH 4PRBA 2HKAA 1ZHNA 3ULAB 3E38A 3OKLB 3GK8H 1EMTH 1PLGL 2HRPL 3MV9B 2V2WB 5AOKA 3AG1B 3MAWA 3Q05A 2DJSA 3BZ5A 5LQBL 3NIGE 1XD0A 2M2DA 1G84A 4WFGE 3NN8B 3OZ9L 4PJFA 2OX5B 3O3BB 3QNYA 1BREA 2IQAB 3GLEA 2OJEB 2B16A 3CE1A 4RGNC 3TBSB 4CU6A 4HHAB 3KLHC 5FM8A 4JO2H 3BYTA 3QUML 2QTVA 5E5MA 2PF6A 3MV7A 1I1AB 3MLZH 2XQBL 4KGLA 2BSEA 4M4PA 5DDHB 2NY0D 3LHPL 3NFNA 1H8NA 4GP8B 4PJ9D 4PY8J 4IKNA 4QD2E 2PTUA 2WP3T 5FK9A 3BUPA 5FPIA 1ZLEA 1FYHB 5DMKA 2P44B 2NXZC 1JUFA 4YHYB 3HTLX 5ECJE 3H3PL 4LAJH 4B0MB 4F2MB 5ISZD 5LBVA 3DX8A 3PWUB 3CZLA 2AQTA 4J4PC 4HKXA 4MXWH 1IC5L 4N8CL 1QSFB 3WSQL 5KVEH 1X5LA 2WYIA 1UB6B 1SJHA 1MFDH 4OJYA 2B14A 4I2XE 2J3SA 5D7JB 1E27A 2DW5A 2ITCB 3L9RB 3MXVH 4LIQE 5JYMA 3CBRA 1V7ML 5CEZE 2P45B 5BMFH 1MH5B 1HHJB 4NPYB 4BIKA 4CC4A 1MCNA 3QEGH 3T6VA 3SPIA 2Z7WA 1Y6KR 2FYYB 3SE3C 5GRWA 2PCXA 3FRUB 2AK4D 4G72B 2WXIA 2E6PA 3MPCA 3VFMB 4J28A 1I3RB 5IVXF 3BAWA 2PWDA 2X4SA 4K07A 3HB3D 4C83B 2ZOKA 1GCYA 3K0WA 4NZFA 4WO4B 2R2HA 2IG2L 4FKKA 4P23A 7PAZA 3GBEA 2OXHB 3E9UA 5EU7E 2CDGB 3MNVA 1UT1A 2NXYB 3ECBA 3SJVD 4HBQA 2VN7A 2UZIH 5DS8A 3ZE0E 1BV8A 2Q7YA 4EI6A 3GZQA 3N3EA 3MKKA 2Z7UA 5IB3A 4OM0L 2DD8H 1E5YA 3EGXB 1P5UA 2Z7YA 3BZ4B 3RGVC 3HC3L 6TAAA 1RMFH 2NY3C 2I7OA 3OPUA 1PSKH 5I71B 3KCWA 3AFLA 2Z8VC 4IS6A 4KUCF 4A39A 2X12A 3LH8A 3ARDD 1OCWH 3FC8A 2I27N 1FSKC 1AC6A 4JFWA 2HFEA 1G0YR 4P5TA 2I24N 1SM3H 5F7FA 1GGBH 1FFRA 1DVQA 4F7EA 3VSQA 4HWUA 3WIIH 3QIWD 2H8PA 1JTTA 3Q9PA 1FYTB 5J1AA 2AEIT 4MJHA 4WEBH 5DJDB 3IKKA 4NZTL 1AQMA 4JFDD 4AQZA 2DL2A 2YPLE 1EVTC 4RGOL 1FPTH 4Q4EA 3PHSA 4XPHH 5TPWL 3NAAH 1LMKA 25C8L 3IT8D 3QYCA 2F6AA 4OCMC 1HYRC 4HS8L 4M43H 1I8IB 5DRNA 1NC2D 1AHMA 4E36A 1S7WB 4JPWH 2C1PA 4FHKA 2ZSVB 2K78A 3RKDC 2VH5L 4ZQKA 2ICEB 4H88H 3S3CB 1UXLA 4C4KO 4NJAH 1T20B 1I9IH 3M07A 5BCAA 3H9HA 3ZE1E 1N0XH 2ZX5A 2DLFH 1G5AA 4BELD 1YECL 5EUOB 1EBAA 3BI9X 4FFWC 3VB8A 4ZYKB 1CC3A 1NEPA 3MREA 4LPUA 1EAQA 4Z77A 2YRPA 2ESVE 1TQWA 3NSXA 2NW3A 3KYOA 1HC1A 5DJYA 4OCLC 2VLJE 3HPLA 4K3DL 4PUBL 3WMQA 3AU1A 3O3DB 3QFJD 5DVKA 4FXKA 2ZYSA 3BLBA 2XBDA 1JRHI 4U6VH 1ORSB 1IGJA 4LLVB 4PJ9A 2Y36H 4L8BB 1NBVL 2J88H 1RJYA 2WBWB 4F9LA 2P80D 1XR8B 4XNXL 2EDXA 2OL3B 2R4RL 5IROD 3O4OC 3ULVF 3E6HB 1U3HC 4WEEA 1KPUB 4JVUA 4PJBE 1WHPA 3I6KA 4M03A 2FT7A 1X9UA 1AHKA 1KCUH 3FO2A 1MFEH 5H35A 5EU4B 2ZF8A 1E2ZA 4I0KA 4JFYA 1EXGA 4Q7DA 3PWPB 4HZAA 1KBGH 4BZ2A 5JQIB 4MJ5B 4N5UA 4XBPB 1HZHL 4YDVB 4NAMA 3MGAA 2XHNA 4AMKH 1HKLH 1SJEA 2J25A 3M7FB 2FZ3A 1OPGL 5I6LA 3GXNA 3A4DA 2AITA 5IW6B 3DVFA 4MKMA 3TPUB 1F1GA 2P9RA 1DEEA 1UCBL 2AI0L 5F6IB 3RWJA 5ADPH 1TKWB 1I9JH 2ARWA 4P59H 2DQ6A 4L1DA 4A2DA 1YQ2A 3ATDA 3E1ZA 4JFXB 4L1HA 4FL4B 2DMBA 5E94B 1AIFB 2FX7H 4P46B 3U7WH 3X14A 1ZE3H 2F15A 5IF0A 1S7UB 3VD7A 2BC4B 3CDYA 3OKYA 1FAIL 1YQVL 4DGYL 3V8OA 2IDFA 3ETSA 3G5YA 1TVHB 3L4CA 5FA4B 1WAAE 2IH1B 1TIUA 4AUYA 3BRDA 1U2CA 2OA9A 3MRQA 4L1BA 2AQNA 4F33B 1DBBH 1NANH 3FDWA 3KYMB 5D4HA 3MR9A 3P54A 2PPAA 4FNSA 5HGHA 1LK2B 4NQCE 3MRCA 2VXTL 3GSNA 4PBXA 3V2AR 4ZW3A 4PR5A 4OU3A 3OXRB 3L5XH 5EWIH 4UAOB 1CFVH 4E41B 1HXMA 1DVFB 3VQ2C 1IAII 1UWYA 1IQDA 1NLDH 1NOAA 2GUYA 2EIZB 2YARA 1S9XA 3EJCA 5D96C 1TQBB 2DJMA 2Z91A 3LN4A 5EC2B 5F70A 2BSRB 5IW1A 1VZGA 1JMZA 1AY1L 3BQUC 1UJTA 4ZUVB 3BIAX 4WI7A 1O7SA 5ABZA 5CCHE 1FVCA 2WV3A 3FTGA 4KK8D 3NFPB 1U8CA 4JFDA 5CZVH 5KBMA 43CAA 1A9VA 4WF7A 1CDHA 5HY9A 2C1OB 2HUEA 3V0AC 3WNKA 4M3KB 5FFGA 5J6HA 3MRBA 1NC2A 1P4LA 3ISWA 4NQXA 4TVUA 4EZMA 4JPSA 4NKOA 1KUMA 5JOPE 1WIOA 4S1DD 4MB1A 1AZZC 3SD2A 5HJ3B 3EJYC 3UO1H 4G6JL 2ZWYA 2AJ3A 3MTRA 2ALWA 2FD6H 1GAFL 5BVPL 2Q3AA 4Y4FC 2JJSC 4HMDA 4N1HB 1NCNA 4U4IA 1XF5B 3QQ3A 1BOGB 2WN3A 3QG6B 1HSAB 2HH0L 5D7IA 4BZYA 4G9DB 4PGZA 4Y88A 4BFGA 1GZQA 1E8WA 2OMVB 5KJ7E 4I0PC 1N2RA 1JGLL 4NQVB 4BCYA 3P1VA 2G2RB 4JAMB 5DQ9B 3U1SH 1WAEA 3G9AB 1JZHA 5JYLA 5IM7B 2HT2D 3IN0A 2MHAA 1P69B 2UWEF 1PW3A 3WIFB 5I75C 4OGXL 3MJ9L 2CZNA 1JL8A 4K8RL 3CFJA 3CZKA 5AYTA 2RA1A 3KYAA 1AD9B 3MRNA 1G9HA 2QKIA 2VUOA 2ADIB 2XN1A 3L1EA 1GGTA 3RWCB 4AJYV 3HBQA 1QHOA 3P77A 2H9GA 4IU2A 1NBYB 3CFBB 5FA3A 4B50A 5CLYA 4OUUB 2H6PA 1KJMA 3MOBH 3QR1A 4X9FA 3TCLA 3HKZA 5I0YA 4G7VH 2K7PA 1S9KC 5FF6B 2BSCA 1BFOA 2WXNA 2XQYK 1DJZA 3P0GB 5EBWB 4HG4J 4ORGA 4TQHA 5E08H 4HUWA 2Z7ZA 3QSKB 2A74C 4IRJA 5IFHH 3RIFK 3O6LL 3DGGA 3MBEC 4LCWB 3HHSB 3PQYA 4FQQB 1A3ZA 4I5BA 2BCKA 3HUJF 2F18A 4F9PA 3GBNL 1R3KB 4I85A 3ZLQC 2QLVB 4U1JB 5E03A 5AQ0A 1JD7A 5D1XA 2JCCF 5A2IH 1WA0X 1OSPH 2VAAA 4UQ3B 4PRPA 5C09D 3RURA 1OGTB 1TQUA 3GI9L 3LS5H 4G11A 4PV9B 2WLKA 4FNRA 5M95B 4DO6A 1OGAE 4G6ML 4HGWA 3FCSA 2WO2B 3L6FA 2VLME 3L2LA 3T6QC 3OWRA 1URIA 3ESPA 4YAQB 5E6YA 4ZUWA 1O75A 3CNKA 5EEWA 3HG5A 3S35X 5DHVA 2PWEA 1MHHA 1YNKH 3T8VA 4JFUA 4NZDA 3QIBB 4MFHA 5ENWB 4YPGB 2GSIA 1D5BA 3VFUB 2FJGA 3HG1A 2VLKD 4P5RA 5I16B 4JDZB 4DTGL 4J6IA 3KMDA 1E5AA 2HTLC 3TGXA 4Y2DB 3Q44A 3VI3A 5I24A 1I7TB 4YN3A 5IQOA 5EUKB 3BN9D 2D31A 2GI7A 3QJRB 2VMFA 4UIKL 5D6CA 3A4FA 3IMTA 3RIAF 1EZVX 5FUZL 4WU5A 3QH3A 2G75B 2RD0A 4R0LC 2CRYA 4IGBB 4Q9QL 3TBVB 1LEGB 2BS9A 4FZEH 3BWZA 2WP3O 2YO3A 4FF9A 5CSZB 4H0LC 1TZGH 3EOAB 3F12A 3QUYC 1KSRA 4JJ5A 1KTDA 1B3JA 2I69A 5BQDA 4L2LA 1WZKA 1YA5A 2XJKA 3NCJL 4WI5A 5GZND 2B2XL 4WO0A 5DJXB 1NUDA 4NUJB 3WJMA 3FTYA 3BEWB 4PJHE 2XQYG 4QGYA 1BMWA 4UANA 2N1TE 1QNIA 5D2LB 1PD6A 3WFDH 1U3ZA 2DDQL 4Y8DC 4J3BA 5GRYA 5JIDA 2KPWA 4P2OA 1NCHA 2V5MA 2DYPD 3MRKA 4Y16D 2NLJA 4APQB 3TS8A 1CO1A 4IM8A 4NBXB 3VXUD 1G6RB 3DKHA 1YMMD 4RDQF 5IK3A 4ZX5A 3V0JA 3PABA 5EEVA 4KAQH 1MJJB 4DW2L 2G3XA 4PRNB 3DXAA 4WFED 5MERB 3D0LA 3VFVB 4KVPA 2NZ9D 1CK0H 2YMOA 3UMTA 5E8DH 5A6MA 5DMGC 3ZYZA 3X1FA 3AC0A 1L9SA 4ODUB 4DEUA 1ZEAH 1JP5A 3LEXB 2B0SL 2FQGA 4O2EA 3T4AA 1DQML 1FZOA 3IAGC 4M93C 4MA7L 5SWZB 4LOUD 3RWGA 3Q3GB 4HLJA 3KPRD 1I3GH 1LDSA 4IDJL 4NKDB 4AE1A 3MLSH 4L1SA 5KVFL 4OH2A 4PRHB 5JO5B 2JKLA 2YKLH 3QQ4B 4OQ1A 5F9AC 2CK2A 1ICTA 1W0WA 2EH8H 4GNKB 3UYPA 1KG0A 2DKMA 1SJXA 1EEUA 5L7XL 2IWFA 1ZLSH 4C8XA 1TJGL 2HLFC 3VQ1C 4GEJA 1IJ9A 1PY4A 4YWGL 2VAJA 4QHUB 4QRTB 1S7SB 2UY7B 3S5LG 5SX5K 3SKMA 4RISL 4Q14A 1H0DA 4E5XB 3VD4A 1RPQA 4X6FB 4YSOA 4M7KH 2XTJB 5E00A 4XCYB 4Y2OA 2AABL 1M1XA 3S3SA 4Q8BA 4PJGA 3FL7A 3ZDYE 1ZXQA 1CLYL 1WTLA 2BNRD 5J6GB 2NR6A 3FMGH 3PGDB 3GSOB 5CD3A 3HRZA 4UB0L 3T4YA 3CFNA 5CUSL 2FLBT 4JRYA 4KK5D 1PNCA 1ZPUA 3I3EA 3L17A 1K8IB 3DV4B 3MV9D 3FO1A 4G6FB 2C9QA 2OYLA 1OAJA 1FNHA 4CMMA 2IPTL 1ITBB 4XNUH 4N0YL 1M6UA 2WQ8A 1T7YA 3TJPA 3F64A 1Q9OB 4YJZL 5J3HD 2H6UA 4WZ9A 3CLWA 4YDNA 1RHHA 4WHTA 3DVGB 5T1DL 1IE5A 5B7MA 2RIKA 1MHCA 4YR6B 1C08A 4Z7NB 5IJVB 3RL2A 2EDEA 3OPZL 3H42H 1L6PA 4ZX4A 5JHLH 4YSEA 1RIVL 3QPKA 5JIIA 1I1AD 1OP5K 2A9CA 3FQXB 4JZNA 4MAYA 4MDRA 2D7NA 3ZPDA 4NZUH 5B3NA 4BH7A 1X4YA 2BFVL 4MS8C 1AHWB 5EBLB 3WY3A 1XVSA 1BOYA 5GGVL 5E9DA 1GZPB 5GZNA 1EJ6A 1RJZB 5F96L 1ASQA 1JOIA 3GUFA 1FVDB 5KSBB 1ZGLM 2BZCA 2I32A 1XIWC 2WLMA 3TNNB 1QSFD 1XTLA 5KVFE 3N6YA 4M62H 2YHGA 3TBYB 4ANUA 3EDFA 4LRNH 2FX9L 2FGZA 3BW9B 4F8PA 1ND0A 2VW7A 3B9DA 2B08A 2VOTA 1IC7H 2F2HA 4WY7H 1KIPB 1HI6A 3MRPB 4KKPA 4Y16A 3H4HA 1E28A 4R4BB 1CR9L 3ATEA 3MBXL 4XVJH 5C07D 3SOBH 2NUPA 4A2HA 1E65A 1UXSA 1J0KA 3FSAA 1U91A 4HGMA 3T04D 2E46A 1KEGH 5C0JB 1F4WL 5JNYA 2P26A 1PY0A 4KKCC 2CO2A 4AM0B 3OLIA 2FNWA 3JBG7 4OSUH 5DYOA 4YBQC 2ZP9A 4HG4K 3EF7A 2P46B 3FSVA 1KOAA 4B53A 4WO4D 5E2TH 1JHLL 2EXWC 3OKDA 3TTSA 2IQ9H 1QRNA 4U3SB 3HMWH 2VSMB 4PY7A 5HDWA 1RZ7H 2AJXL 4JPIA 4MZIA 1N59B 3PL6B 4XCFH 3VVWA 3MJ6A 4RNRA 2EVGA 3IMRA 3KW7A 3DJSA 4QHMA 5D93C 4MDJA 2RHEA 3SDXA 4UOZA 1F00I 4QHPA 1NCAH 1QLRA 1U41A 1FJ1B 1X3DA 3OKMA 3T3MB 3DX8B 2YD9A 3MYJA 4OLWH 3CZEA 1XF3B 3L1FA 2G5RA 5B3SB 1FL5B 2YC1A 3D09A 3LNDA 1TMQA 5IIEA 3PAYA 4PVMA 3BH4A 4MAUL 3DYPA 4BE5A 4PRIB 2WK2A 4J3TA 5DZNA 3HFML 4K7FB 2AJYH 3IDUA 1UZ6F 1P1ZB 1U8HA 3VXTB 1FYTD 3WN5C 1MCLA 3K8LA 3STBA 4EN2A 4MJIE 3SCMB 5ICXA 2BNRA 3DHJA 4NUGH 4HMCA 4Q58C 2HVJA 5JPNC 3BP4B 3EGDA 3NT0A 3V8CA 5DVMA 1I7ZA 3SOTA 1OTUC 4ZBJA 4KKAC 4OD1L 4R8WL 4XPAH 1QZNA 1L7IL 3EFFB 4MD5B 2MIZA 5FB8B 4QHNB 4HIXH 1RZJH 3BKML 1C1EH 4WUKL 4PLJD 3QEQE 1XX9C 3IFPA 2B7DT 1PNDA 1DLFL 1PCXA 2MEJB 3O11B 1M71A 2OMXB 2WKOF 1P9MC 2YPVH 3B9KB 3GRWH 3QIUA 4I87A 4GIPD 5C0IB 3KLSA 2VR3A 2YPVA 5EOQH 4D9RE 4IRSB 5FO8A 1S78C 5A16B 3VSUA 2A1WL 3NSCA 3G08B 1BPVA 1NPNA 1P5UB 3O6KH 1JNHB 2OP4L 5E95B 4G8IA 4FP8L 5D1QE 3KM2A 1QHQA 2P8LA 4EKJA 1AQHA 2J1YA 3CDFA 3PWJB 2IAMD 5K9OB 3IE9A 1CXHA 2XY1A 1YNLL 4DP9X 1RUPH 4Y9CA 1R5WA 5ADOL 4XH2B 3V4PL 4GAYB 1C8PA 3VTAA 1RIUH 2WWKO 2Q20A 1IQWL 1A02N 5AVZB 1O9WA 5DUML 5IREA 5EIIB 4YH6A 3P11H 4POUB 5C0BA 3GSWA 4LSTL 2LAAA 4KO7A 3GXDA 1CMOA 1FH5L 2DQTL 1QBLL 4PP1C 1ZXKA 3D18A 3T0VA 5JORA 3NP3A 2DRUA 3PWPD 1B0RB 5MEND 3LZQA 2X1XR 3AZUA 1A8JH 4PJEE 4JHZA 3T0EE 1H3WM 5BZDB 4H8WC 5KG9B 1GA2A 3L4TA 4NCC1 2VL5B 4QAWA 4K23H 5C07A 4G42A 2DEYX 2ICWI 2JXMA 1FFPA 4J27A 4Y19D 2Z31A 1JF6A 2R4SL 4R97C 1V10A 4JQVC 5BZWA 2NSQA 4LEOA 3PRZA 3MLWL 3MLXL 4EUPH 2HT4C 4EUPA 4PJCF 4P46D 4APXB 2PP7A 5IV2B 4ZAKB 4X50A 4A67A 2GJ6A 2I9TB 3R0MA 1CE1H 1IILE 1TF4A 1UURA 1IGCL 3IPEA 3WLBA 3HLAB 3BGAA 1CICB 1GGUA 1KJ3L 2FVNA 1ES0A 2V5RA 3FBQA 3LEYL 3JWDL 3BGMA 3GPEA 3PDOB 3LS4L 2WQRA 4HD9A 3EOTH 4WTWA 2VZUA 3K4ZA 1E6JH 4JO3L 5DUPH 4JO4L 1YN6B 4HJSA 4XE0A 1JFHA 1LEIB 2YJQA 1NGWA 1AGBB 3QZOA 5B22A 2RACA 4H0GA 4PGEA 3LIZA 1X5GA 1MCOL 3SDAC 3GJFH 4NKMB 4GS7C 4E41D 1YZZA 3BSGA 1DVFD 2IGTA 4XZ4A 3IGAA 3X1NA 5EO9A 4IKKA 4DEWA 1KCBA 4S0SD 3EADA 5AVSB 4I1PA 1J8RA 1U9KA 4FFYA 5F21B 2J4WL 3DROA 4P4KA 5I1HL 4YDLB 3QJVB 3DVIA 3VNZA 1EZSA 1INQB 2CMRL 4AMWA 1YYCA 4PCSA 2YJLA 3KGTA 4WU7B 1O0VA 2JKNA 1BQ5A 1VFAB 2Y24A 1GYCA 4O5LH 3TEYA 4WNSA 4CADB 1L7TL 2MQGA 2O61A 3K72B 1JYXA 3WD5L 3KH3A 1OAKH 1EH9A 3DBXA 4ZMLA 4OLYL 1W72L 5AW6B 5HDQL 2D7MA 3ARSA 4YGAB 2X4RA 1J0YA 4HP5A 4IHOA 3WHXB 3C60C 2PO6B 3QRBA 4YBLC 3S37X 2JTYA 3JV4B 3TT3L 1JN6A 2BP0A 2B5IC 3BDYH 3MRFB 4KVNL 4OTXH 5AAWA 1MSPA 2F1BA 4BUGA 3ZZQA 2IAMA 2OKMA 4BHUA 3FCUB 3M88A 4AYFB 3SIKA 4JY6B 5E2VH 3QEUA 2EEBA 3HMXL 3FFCE 5BJTA 3RDTA 1CFNA 3U82B 4ZX6A 1YNTA 2AVGA 3V0VA 4LCIL 3K2UL 5AW7B 1Q38A 4U33A 1CFMA 3DRTA 3QNXA 4ZTPL 5C2UB 2EVJA 3MRMA 1ZLUK 2GITA 3LZNA 5IHUH 1OSZB 3P9WB 4A55A 4KMQA 3BUDA 4YBHA 2ZOWA 1E5CA 3L3OA 4L8DA 4OFPA 4ZG1A 1MRFL 2B9AA 1IIKA 2F1EA 2K45A 2XFXA 4P05A 5DSCA 1KPVB 4AQ1A 3CN1A 1HQRB 1NGXB 3H55A 3ARBC 5I15H 1CLOL 3M1BA 2FH8A 4YQXL 3VRJA 4Y1AD 1MVFA 3IPFA 4QRPA 3V4VL 4PM1A 1NAMB 2P1YA 4XPTL 3WEOA 4WEMB 2PTVA 1I1FB 4F57L 2WNKA 2KHAA 3DTDA 3WU1A 2DQMA 3IWUA 3PGCB 3FTZA 3WFCH 4F58H 2WVTA 3QJSB 2NSMA 3QR0A 1SJMA 4PJAB 4GQ9H 4ZTOH 1NKRA 4OKVB 5D1QC 2CHXA 3SSGA 3NCMA 4XNZC 1JHTB 2OPCA 3B2UC 5DS2A 4LCCA 1GYAA 2BWIA 1Z32X 3B4NA 4LCWD 1IKFH 4JFED 1JPSH 3HNSH 3TYFB 1KCLA 3V6OE 5I8OL 2V2XA 3LRGA 3FQTA 4RAUB 2XN9A 5EU6A 3GLDA 1QVOB 5GGSB 1EZLA 1G9NL 4PJXF 4JM4H 2CHNA 2XQYA 2PP8A 2O5YL 1BDYA 3D1MC 3EHBC 4NP9A 1RUKH 3WY2A 4ZD3H 3LX9A 5EIIG 2XICA 5FGCB 4RGNB 3IVKB 1UD8A 3T0EC 2IEPA 2B4CH 1NGQH 4G43A 3EFDL 3W5MA 4JFHE 4IRZA 4WI6A 3D25B 3TF7C 4NKQB 3TN0B 1EDYA 3TIEA 5JHDA 1KZQA 1Z5LA 3CCHA 3HS0C 3Q1SH 5D5ME 3WJJA 1HILA 1PD0A 3QIBD 1SHWA 2F8XC 2Y1AA 3UAFA 1IVLA 4JFZL 1C8QA 1QI5A 3FSWA 2NXZB 4U1LA 3S3BB 1MJ7H 3MX0A 1JZ4A 4BDVB 1FBIH 2YN5A 1VPOH 4KI1A 4M3HA 5EEXA 4LLWB 5DD5L 4L3EA 5DD6A 4QF1B 1SYVA 1PKOA 3KS0J 1WITA 1A7RL 3RGBA 3SYAA 1W80A 3GMMB 4J3OH 5DZAA 4WKZB 2D0HA 5BV7C 5HDRA 3DOHA 3PREA 3FT9A 4X98B 1HHIB 5CJXA 3MACH 2APSA 3QS3A 3D3VA 4ZUUB 1PG7W 3S98A 2J8UF 4GI8A 4CNIB 3RPBA 3IXTA 3NIDE 2P8MA 3O3AA 2LE9A 5JPMA 3GMNB 4KWUA 1ADWA 2NTFB 1VFUA 3DSNA 4QIRA 4X6CB 2IXQA 3RVWD 3UABA 2A77L 4WI8A 2H26B 1B9KA 2NQCA 4NIYE 1AGFB 3GMQA 1OAXL 3L6FB 2NTSP 1OAYH 1W15A 1XGPA 3ARGC 3HNVH 3FU0A 4MCZB 3AGVA 1GGIH 4LEXH 3MRRB 5KS9F 1JZ5A 5E2UH 3BKYH 12E8H 5HGAB 4CSZA 2APWA 1L9RA 2OMTA 4APQD 3SYCA 4ZMPA 1CD8A 2WCPA 5IT2H 1CFSA 3GHPA 2BDNH 4UCFA 5B8CC 2VDOL 2XQ0A 3I6LD 3LD8C 2KZKA 3JVFC 3KLAB 2B1AL 4QI3A 3RGVB 3QUXC 4LXFA 1D6VL 5I1IL 1I3UA 4G8GA 3VWKA 4Z7VA 4J6RL 5E1HB 3WKQA 1REIA 1SBSH 3V95A 4S11A 4Y1AA 2E4FA 1AZNA 2CCWA 4MD4A 2V33A 3MROB 4UBDC 4BFIA 2W94A 1JJUA 2R0ZL 5I6OA 1YEGL 4DPCX 1P5VA 1I53A 2BH0A 3VFNB 2F7QA 1CGSH 1FN4B 4TSAH 1KTDB 2CR0A 1OCRB 4CDGC 3BP6A 4PRHD 5EORH 3ABLB 1L0XA 2AXHA 1BZ7A 1UADC 3KZ8A 1PX3A 2BSSB 4LGPB 4NN5C 3S48A 1I8LC 3IDXL 2WBXA 1KTBA 1HTYA 3VDAA 1NTDA 5I9QB 1KJVA 3OXSA 4WDIA 4RMBA 3SDYH 5TDNB 4GKSB 2XTJD 1A6ZA 3PP4L 4XMKH 3L3GB 3VXMA 1EEYA 2VWEC 1EANA 3ML9A 3WTXA 4GG6B 4HJEA 5KEZA 3BP5B 3RIAK 1Z0NA 4YHMH 1E67A 4RA0C 1IIIA 3CC5B 1EEZA 1N4XH 3US9A 3D0LB 3DHPA 2AK1L 2Z64C 4PS7A 3OKNA 5SX5H 4H8VA 3ZZLA 4ZO6A 2DWTA 4KKZA 3RB5A 1MCFA 4OBSA 1T1WB 1JFQH 1OAQH 2C9AA 1FFOB 1T0NB 2HUHA 4YHNB 1EGJL 1FZOB 3JQOB 4N2EA 3MRJB 3AAZA 4G6FD 3NYKA 4R7XA 1Q72L 3T5WA 5DT1L 3UJJL 1G87A 3O4OB 2X4OA 1U3HB 2JI2A 3OKEB 4FQ2L 4G82A 4OGAD 1VB9A 1MIEL 1S7QA 4M8UA 4OLZL 1HHGA 2VABB 2P5WE 3TOPA 1DQQB 3UYPB 4LSRL 4OJFH 4GUPA 1PQZA 1BGXH 2I07B 4GW1A 3KWVA 4DF9A 3TJEH 2JLPA 3KW8A 1SVBA 2QDVA 1URZA 3LH2L 4XN1A 5FCUL 2ZX9A 1X7SA 3SYPA 2V17H 5K39A 3TO4C 3MJ7B 1MELA 4S1QL 2UX7A 3SKNA 1ZTMA 2H47C 1YEFL 2GSGB 3ILEA 1BAWA 1I1CA 9PCYA 5AFAA 5DHXB 3ZTNL 2PYEE 1JF1B 2NZ1A 3MFFA 4DUWA 1OP5H 3QFGA 4PJ7A 3SDDD 3WDJA 2CLZB 5DU7A 5IHLB 4O02H 4X7DC 3ZUCA 5GS1A 5HYSB 2Y4SA 3O2DA 4P0DA 4NQSB 4UDTA 1JZDC 2HKHL 2QDWA 1ZHLB 5CJOH 1GSMA 5AKVA 5I1JL 1MZYA 1CZ8L 2JKTM 4I4WA 4K9EC 3HLKA 1UGKA 4GAJH 4Z7WA 5D2NA 4U1NA 1K9TA 1Q9KB 2ZCLH 3QJXA 4UUJB 2F7PA 1BW8A 4HS3A 5I17B 1B6UA 4AIZB 2FJFA 1RHHB 3FAXA 1AE6L 1T2XA 2BVOA 3A6BH 4XP4H 4TVPH 5BW7A 3EH1A 1OE3A 4NRYA 1MHPL 2L7EA 2Z1KA 4I2XB 1T1XB 1G9MC 3BVDB 5I6MA 4ELMB 2DTMH 5HD8D 1UKQA 3BAEL 4K3EL 3ULSB 1KGUA 4ERSL 3IDNA 3BQUB 5F89B 3AS1A 4BSWB 2Q8BL 4F8LA 3FT1A 5E9DB 5IOPA 3D08A 4M5YH 1R1CA 1JGDA 2E7DA 4KZEL 3L13A 4NO5B 4PP2B 3OG6B 4CW1B 1DSWA 3JWOL 4XCCH 1ZDSA 1D6EA 3MTXA 5D7KE 3GSVB 1F3DJ 5FUCE 1HIMH 2ITFA 3WDHA 5CM1A 4PWIA 1W6WA 1ZA6B 5CEYA 2V3EA 1YEKH 3U2SA 1BX2A 2Q0ZX 2EKSB 1J0IA 2YSSA 5TF1H 1ZV9A 4O9HH 4YNYB 3AXLB 4WJ5A 4AEIH 1CD9B 4U1KA 2Z4QA 1A0QH 3NABH 4HJJL 2NUPB 4XN5A 4YO0B 1LO4L 2ZWLT 4MJ6B 2CO6A 4Y4FB 3SCMD 3QDJE 1G9NC 2QGCA 5TH2B 1VEPA 3CFDB 3GUTA 1QPKA 4NB7A 3MI6A 4AC4A 2R9HD 5MHSD 2CPUA 5LDUA 4AL8H 2RJMA 2K0RA 3ARRA 1R3HB 1B4JL 5T33L 4XWGL 2CSPA 3NZHH 4I0PB 1WS8A 5CXPA 4H40A 5GS2H 4G5ZL 4N2LA 2OLDA 3HZKA 2EEDA 1SY6H 4M1CC 2EDLA 1HX0A 4QHMB 1ZGLP 4IRSD 1SY6A 2ROXA 3HNTH 5I75B 1MRCH 4D3CL 3IS0X 3SBRA 2BIMA 4N6RA 2EDJA 5HVHC 4XAWH 4ZFOA 3PJNA 1USQA 2FWSA 2ZJSH 3NMEA 3IGFA 1DVYA 1FRGH 4AOFA 1I75A 5DJ6A 2A38A 3PWNA 2JJUA 4PRDA 2NNAA 4KXBA 1G7PB 1A7QL 2GC7C 1BLIA 4AENB 2CDEA 4GB9A 5IP4A 5CEXB 2DLGA 1XCXA 2XVLA 3UAJD 4NN7B 1HCYA 3P02A 3V6ZA 2Q7NA 4K3JL 5E70A 1LP9B 3SKOB 4L37A 4TKWA 5DUBB 1W8OA 1Q1JL 1EHLH 1BA9A 2VDLH 3SDDA 3UCRA 4OD3L 1MI5B 1YLBB 5BV7H 2A74B 4X7TB 2FDBP 4KJYB 3ISRA 2W65B 2VE6B 3MQIA 3WN6A 2XG5B 4DN3L 1NDMA 4ZTEA 3F2LA 4HWBH 3MUGA 3DUUB 4DAGH 3NGBC 2Q86A 3PYCA 1HT6A 3E2HC 4MKTA 3U4EB 3TVMA 2HFFA 4JRWA 3JWNE 4D9QE 2VXVL 5E4EB 3LKPB 1UD4A 4N85A 4KZDL 4W9EC 4ZAKD 1HH9A 3NRFA 1DJYA 1DDTA 2JVUA 1G1OA 3QDAA 1VCBC 3CPUA 5HI3D 1RIHH 1TUPA 2YQ3A 5E6ZA 4LVHB 1BBJB 1JRHH 1N5AA 1N64H 1R5WB 3HE7D 3L48A 4QRBA 3TH4T 5LCVH 4G3YH 1A3QA 2HJFB 1NFIA 1KLUA 1OY3B 4NQEE 1TJMA 2GIMA 4PGCA 2GEQA 3B2VH 3C75A 3EO9H 4H2CA 3ECWA 2ISDA 1CU4L 3WIHH 4LPYA 2XIIA 4ZMOA 4FXLA 4MVBC 3T08A 2XXGA 1A6VH 3BT0A 1ZS8A 3WIHA 3ZL4H 5AYUH 3MCKB 4LDEB 1AQKH 1NWPA 5I8KL 3P3TA 4XO9A 1HWHB 3OV6A 5C9KA 3PP3K 3VRLF 2WSKA 4BQCA 3LQMA 1PJWA 1F5WA 1X5AA 3H9SD 3RZCC 4AIOA 1UZ8A 4X6DA 2COVD 4FNUA 4R0LB 2QQNH 4AZ8B 1S3KH 4DGVH 1MDAA 43C9A 1W0VA 3RYMA 1TNMA 3UIYA 3UTZB 4ZZKA 3QUYB 3WIAA 1AOZA 3CFKA 3UBGA 2P43B 3QUZA 2AV7A 3BHBB 1NCDH 1DCLA 3RUGA 4JZOB 5IBTL 4UIMA 4Z3HA 4YX2H 4FNQA 4PJ5E 2OR8A 4HUCA 3BUBA 2Q76A 5F9OL 1CQKA 4PGDA 5LBSA 3GHBH 1DLHB 1MCEA 3BP7B 2K3HA 3ABMB 4I88A 3UJTH 1QYGL 4OT1L 5B3JE 3VFOA 4X4YB 1GS8A 3T2PA 2HRLA 2ZG2A 1MFCH 2Z93A 3WKML 1BVKB 5DK0B 3N06B 2IANA 4JKKA 2WXJA 5DEZA 2DQDH 2PO6D 2PYFB 2LAGB 5AUMB 1NJ9B 3F84A 2NRDA 2F8OA 2UUDK 3HZVB 5I18H 1XO8A 2YEVB 3V52L 3ULVH 3TP4A 5FUCC 5I66A 2G2PA 2XLLA 4XVTH 1CIDA 4LSQL 4NLAA 1DBAH 3GJFB 2YD1A 4N2FA 1MJ8L 3FU7A 1H5BA 5F7BA 4JVPA 1IAIH 1E43A 1F42A 1YEDB 4L29B 4M93B 5A2CA 1FUNA 4DUXA 2VUYA 2X05A 3C87A 3VGBA 2ZXEB 3TV3L 1B2WH 1A14L 3JV5A 4UT7H 4X4KA 1KWGA 2XZZA 3DO4A 1VADB 4MB3A 3C5ZA 3MLUH 2DIJA 5FO7A 1H15A 3LKSB 4K71B 2VZTA 5FYJH 3TWYA 3FZUC 1DJXA 4JHWL 1TYJA 1ZLUH 4WKXA 1T03H 2F74A 1I8KA 4IEFA 3FKUS 1WZAA 3CQQA 3H2QA 3CDGB 4W9KC 3PY9A 4GAAA 4FG2A 2CK0L 2X1OA 3VE0A 1IEBA 3A24A 1J11A 3QHFH 1EO8H 2H41A 3SE4C 1LK3L 3BPOC 4KXDA 1FORH 1OSEA 2PPFA 3HI6L 3UZVA 4BWTA 5FO9B 4M1DH 4Q0XL 3BSZA 3DJTA 1XZWA 3NOIA 4FQXC 3ZRSA 1A1MB 3HE7A 4GLRI 5FYJU 1BJ1H 4AK2A 4F7TB 1M7DB 4FEIA 3WEBA 1XCQA 3VG0L 5DA4A 3FU6A 4PHZA 5FKPA 2OSLA 5I30L 3ESMA 3G5WA 1CT8B 4MQ7B 4JLRB 3FFDB 4ACTA 3QXTA 1R5VA 2X41A 4ATWA 1TU2B 2QTEA 5PAZA 5EIVA 3ZDZF 3TWCL 2P8PB 2YAEA 3NCXA 4K7PY 2Z9TA 4RGND 3P0YL 5JLZB 1UXWB 3JVGC 1X5YA 3KLHD 1C12B 2YFNA 1EDQA 5CCKH 3H9SA 2ZAHA 1OIOA 1AI1H 5G5DA 4DKFL 5K9QI 2FX8H 3JZ7A 3QCUH 3BISA 3CZUB 4NC0B 3TN0D 4OLXL 5I1GH 4H8UA 5HGGS 4KQ4L 5FGBC 4WUUE 1NL0H 1NFDB 1XGUA 3OL2A 1RP9A 4N9GA 3UJIL 4OZHF 3H85A 4YC2B 1XZ0B 1GRWA 1HINL 3GLZA 3JWNC 1DVSA 3NSFA 4M7LH 5TE4H 1P84J 4JM2A 2NXZD 1A7BA 3UXFA 1N0LB 1XR9A 4H1LB 5I8CA 3E1F1 3ATFA 4J4PD 2FBRA 2NMSA 4K2UH 1JXKA 4ODHH 1MVYA 1ETA1 2WWMC 1CVRA 1SHXA 2F53A 4RX4D 4B41A 4FA6A 7CGTA 3CVHA 4QXTA 2EE0A 4EAEA 1KDJA 5HHVL 3V5HA 3BGFC 2Y06L 3UTTA 5I0VA 1PZUB 5T3ZD 1A3RH 4EIGB 1THAA 2J8OA 4A6YH 1F13A 4KMLB 1FNLA 1QLFB 2OXGB 4A6YA 5GRVL 4X8XA 2EECA 2VMCA 4EDWH 2ENSA 1OF2A 3M17A 3X1BA 1BYNA 1LWJA 4PFEA 4H5SA 1P4BL 1V7NL 3CX5K 3QEHA 5C6TL 1YG9A 4BFNA 3MOAH 4M5ZH 4U1SB 3D39E 5GISH 2SEBB 4OZIF 3BPLC 1EJOL 3OKOA 2XWTA 4YVUA 1QEWB 3VI4A 3ULUE 4FQJH 2UWEA 4HIPA 2WZ6A 4Y4HC 1N8ZB 4H44C 1LVEA 4I3SL 2W8CA 3CH1A 1XQ4A 3GWJA 4Y0GA 1K4CB 2A83A 3AREA 2DQEL 1J1PL 4U3CA 4QTIH 2APFA 3N5AA 2R2EB 2ZUUA 1SFDA 3AG2B 1RK1A 2OW6A 2NX5D 3LKRB 5D93B 5CJQL 2R23B 1D5IL 3LRKA 3BIKA 2V7NB 4ZRGA 1J7VR 3QDMD 3WEMA 3RGVD 4PJHB 1CLZL 4UM9D 1C16B 4HSAC 4HPHA 4EBQL 5DRZB 3US0A 2IC2A 5DD3L 4N86A 1KPRA 1KB9J 2V5SA 2FATH 4L4TE 4XNDA 4BH8A 3Q6FB 1Q90A 3ZE2E 3WFEL 3IDJA 4OCRH 1GPOL 4JFFE 2KQMA 3LXCA 1BZEA 1U2HA 1KYAA 4ODTH 3WN5B 3ZKMC 3KPMA 3S4SG 4FLSA 1KGYE 1JXJA 1OEZW 4A37A 1BD2A 3C5JB 4ZFFA 3ETBJ 1KFGA 4NSKA 4ZNEA 2EYTB 4B9KC 1KCRH 4JFQB 1Q94B 3OMNB 2JCCA 2BHZA 2FQDA 3B8YA 3U30C 3I85A 3ZKXC 4EF3A 5L2KE 3RKDD 1U8OA 3QK0A 4RGMC 1M6OB 1XH2A 1T4KA 1CFQB 2GJPA 5JIQA 2OYMA 2YSTA 3VFPB 4KHTH 5BNXD 4FFWD 3R7QA 5CN2A 1J05B 1KV3A 3AT9A 1LE9B 1U8LB 4MMXA 4L5FE 4Y5YC 5I5MA 4HAFA 3TA3C 1WWAX 3A6CH 5B4MC 2PPDA 2HZHA 3I84A 3IJ7A 1JPTL 3U83A 3W9EB 4F2FA 3CHRA 3K71A 3AT0A 2G2NA 4C56D 5TQ2H 3C5SB 2EDKA 2YA0A 2ZCKL 2BS8A 4OW6A 4PG2C 5HGDA 1YC7A 2ICCA 2DQGH 2QV2A 4FMVA 1F41A 1U3HD 1M7IB 1HH6B 3Q8FA 4DKAA 3I2CL 3ZK0A 2MCPH 4JFOA 5CLTA 3ROOB 4NP4H 3PIQA 3TU6A 3NACL 1TT6A 1IGML 3D0VB 3Q8BA 3ZQXA 1DQJA 3R0NA 3SE6A 3S5LA 4RMRA 4OZGF 5SV3A 5B1AB 4RDBA 1HWWA 2ZOTA 3GS7A 1TG8A 4GUQA 4ADJA 2QHLA 2D2OA 5C0RH 5C7XL 5K5YA 4WFGD 2RCSH 5KBDA 2EABA 5C08A 5AWNH 4KY2A 1DUYB 5LGJB 2V8MA 2BOLA 1IL1A 2J8UE 2R0LH 3FB6B 3UYRL 5ESAB 5BS0E 2QQLH 5MEPA 1LDPH 4IIQB 2QKSA 1HQ4B 3VXRA 3IDGA 4D9LH 2GJZA 3COOA 1KGWA 4LPWA 2IBZX 5K1VA 1C5DB 4NC1C 5GGRA 3FH7A 3SJVE 2NX5A 4A7QA 3KXFA 3FFOA 3QCVH 1FFNB 3QDMA 1IC0A 2MQ3A 3VUAA 4Z7AA 2WVVA 4UM9A 1G5GA 5HYEA 4ZO8A 1CFTA 4H1LG 3VJ6A 3SDAB 1YPZB 3CFCL 2FEJA 2F5BH 4W4NA 3SQRA 3PJSA 4HWEL 2X3CA 3O8XC 3QXAB 1P4IL 4DVBB 2KT6A 4HCGA 3DBSA 3GEWB 2H45A 4GMSH 5ANHA 1B88A 3DTUB 3OSVA 4NENB 5CBAA 3BQUD 5ICYA 4HETA 5EDXA 2V3FA 3SY0B 3UAEA 2G4GA 4Y1SA 3IJHA 3GT6A 2CO7B 3MMEB 3INOA 2PCFB 2IDCA 4F3FB 1FHNA 3O41B 5DA0B 1RSFA 2XFGB 1QTYT 4CKVX 4Y5VA 4YE4L 1WFNA 2E7LC 2NY6C 5E6IC 3ULUC 2FWLB 1T04B 4PJ7B 1ETJA 4L9LA 3EJZC 3BDBA 3JYBA 4FQ1H 5CWSA 1QFUH 2Q8AL 2CCLA 3D05A 4LEBA 1KYFA 2J6EL 2X28A 3UADA 4JX0A 4O02B 4LP5A 3W0WB 3BH9A 3JUZA 1W9XA 1JGEA 2EIEA 3EJYD 4P06A 4YUEL 1LO5A 2Q10A 4BKTC 1A22B 3UBXI 3WNJA 5LGHL 3VVVA 2HJKB 5F72S 1EPFA 4Y4FD 4YBLB 4GPVA 5IQ9B 1P84K 2VISB 5EO1B 1OAZL 1IKOP 1A6UH 3F58L 3D12B 4Z7UF 4KDTC 5GRXG 4JDEB 5LN4A 2X9WA 2YAOA 4NNXB 3P30L 4D8PB 2VO8A 1ZTXL 3QFJE 2NY5C 2D4FA 4C56A 3E9TA 4I0PD 3N43B 3RTQC 2A9ML 3ZO9A 1WUZA 2CGRH 4N20A 2Q7AA 3QA3B 4NRZB 2LR4A 3IKCB 4W68A 3W9DB 3MRLB 1KYUA 1ODAA 1TPXB 1G1CA 1BQHG 4IU3A 1FLRH 3LQZB 5TE6H 5EC1A 4A7SA 2VDNL 5FM4A 2BIQA 2BSBA 1ZA3B 3ARBB 3EBHA 1ZK9A 1JPST 3U2JA 2ENJA 2HXAA 4QRAA 4I0CC 1Z5YD 4ZW8A 4KRLB 4UTCA 3SQOL 3TO2A 2SODB 2DBLH 3ZDXF 1VEMA 4G7YL 4XP6H 4NYLA 1FC1A 2ESVD 3EZ8A 1KN2H 1MI5D 3CQFA 3SGKC 3QC5X 4O2CB 4FNLL 3BAKA 4UQ2A 2YBGA 5KYUB 1K4DA 4DJMA 1VACB 1PG7H 1TYEB 1AG0A 3MBED 1MVUA 1NICA 4LKCB 4KNSA 1QBMH 5DHDA 5KSAC 2JK5A 3HW7A 5EA0H 4FJZA 5DC9B 3LKQB 2QR0B 2RFXA 3IMUA 5CN1A 5F7DA 1NBZA 2ETWA 5IQMA 2XN2A 5FCSH 1AGCA 1C5BH 2W9EL 2QZ5A 2YPKA 4XMPH 4ETQB 1DBML 3ZTEA 1RJCA 1T6VN 1WIPA 5E5RB 3GNMH 3OAUL 1RURH 5DEFB 1L4IA 3CSTA 3WGVB 4UDUB 2HFTA 1EO7A 2X3BA 1UH3A 4PJ8A 4EO5A 1BLNB 2N56A 3QARA 4XHJC 3QJFA 4O4YL 3KJ4C 1PFCA 2QPDB 1F02I 3JTSB 3KPQA 4OZFH 3HS0B 3ES6B 2IH8A 1PDKA 4HCRL 4OZFA 2R56L 1KXQE 4PJDF 4HLZH 5FDWA 1WK0A 2EDQA 1UM5L 2RQEA 2YAMA 4FZ8H 4JHVA 4CDHA 1A2YB 2APXA 2W0KA 5K9KA 5J8OA 5FFOA 4XE5B 1U8PB 4AUJA 2HTLD 5GGQH 1V05A 1I1RA 4UTAA 5MP6L 1BF5A 2VDLB 3U46B 3N42F 1CDUA 2E9BA 1E3FA 1TZHB 2RB8A 3OLDA 4HA1A 5BV7B 4ODVL 5CGBA 4YFDB 2HRPH 4MASA 3B56A 2CCVA 2IMMA 1AKJB 4YFLF 1BQLH 3BESR 3P3SA 3QUYD 4NQDE 5IVXB 1JSYA 1BG1A 3TVMB 2R29L 4NQCD 3HEIB 5LAXA 4RBPH 4BYHA 4YXLL 2WKOA 1NGYB 2ARJA 3MA7B 4DKEL 3V79C 2XT1B 1A1OB 2RTTA 5C9JB 3EJUA 3ARGB 5KVGL 3I50H 5KN5A 1PGRB 2JQAA 1JVLA 3QUMA 5DJZB 4AH2A 4XNQA 2VDPB 4YGVA 4X99B 5E8OB 1OLLA 5DFTA 2XZQL 1TJIL 2AJSL 1KTLA 2VDRH 4J2QA 1ZDQA 1FGNH 2IADA 1BXVA 5KYWB 5MEQB 3QQNA 3R06A 3H3PH 1M3JA 4PH8A 2YPLA 1MY7A 7FABH 3FOLA 1CGWA 3ZHDA 3WSQH 4ONHA 3QUXB 2X2IA 1EA9C 5I1CL 5DMGD 4BQBA 4QYOA 4AEEA 1EHNA 2H32H 5C0EA 4Y4KA 2OJ1A 2R0KH 5ECGA 3BOVA 2YK1L 5JOPD 2H32A 3BEVA 2JB6B 3ZGIA 4LCUA 4ZUTA 1R46A 1V7MH 4WW2A 1DQVA 3ILPA 4MNGB 3ZX1A 1K6QH 4MHHG 3GB7B 3RY6A 3T6XA 4HGKC 2Y7SA 3TM6A 1U58B 2GAZB 3T1FA 3ARPA 4MMYB 2BMKB 2Y5TB 1SXBA 4YFLI 2ESVA 4W93A 1HNYA 3RTLA 1YDPA 4K15A 1R0AH 2MRYA 5F1KC 4F2EA 1TDQA 3ABZA 2OBGA 2VLJA 4WSKA 4NN5B 4QRUA 1BWWA 5DK2B 2Q76B 2HLFD 1FCGA 1MY5A 3MBEA 4LAQL 5IHHA 4TUJB 1NDTA 5F9JB 3WAKA 1F90L 3AGWA 5HDOA 5INCA 1EEQA 4JG0L 1AOHA 3JSSA 1D5XB 5FR3A 1SMDA 4Z0XB 2Z93B 4PJBA 2B59A 2QGBA 3ESOA 4OM0H 4TTGA 2EQDA 4NNYA 4HYTB 3CK0L 1DSFL 3VSTA 8FABB 1KLFB 3HC3H 3RNQA 2OTWA 5C09E 3VGAC 1GHFH 1YSOA 2G0LA 4MDIB 3SO5A 3UP1A 5FYKH 1BVNT 1D5ZA 1RK7A 5HGBA 1G6VK 3M7OA 3BZEA 5BQ7A 5I74C 2GVYA 2R0WH 1SBBA 2UVEA 1CG9A 4CSPA 4ZDHA 1G43A 5KVGE 2WBJB 5A7BA 2ICES 4Q9RL 1BYOA 4P9MH 1DFBH 1J8HE 1F11B 4FI6A 4Z3GA 3H3KA 2H2PC 1BJMA 3L3IA 1MJUL 5J13C 4W6YB 4RGOH 2TAAA 3HZMA 4XXCC 3N0AA 2BZ7A 4JFVA 25C8H 2VDKL 2BSTA 3FUKA 4HS8H 2FUQA 3S8GB 1VESA 5KOVC 4BUHA 3TLRA 1NKOA 4CUCA 2O6DA 3PU7A 3FONA 4JHBA 2VH5H 1VLXA 5BVJB 1X5FA 5I6PA 1IRAY 1YN7A 2BERA 4MS8D 1A9BA 2IIJA 5GS0L 4EI5B 1A7PL 4U6XB 4NQCA 3RFRA 2A9DA 2MJWA 4B9IA 4IOIB 1JXGA 4URKA 1FL6A 5H94B 4KK9C 2EH7L 3NJJA 3O6FA 1XIWD 1ZK5A 4R7DB 1DN2A 1KT2B 2VLMD 1P7KA 4PGBA 2QPEB 3FB7A 4LPCA 4K3DH 4CU8A 4F7CA 4EZLA 3SDCB 1CLCA 2CLVB 4ODBD 5CCJA 1KWKA 4WV1C 5ANMB 2OMZA 3MU3A 1E4HA 3S4SA 1KEML 4AI7A 3SGEI 1NQBA 2KC0A 2FEDD 3UFIA 4P2QE 4LSVH 4HFWB 2CBPA 3BUYA 4POZC 3PPSA 4RFOH 2C9XA 4KKCD 1UT9A 2R83A 3D6GA 4XMLL 4LQ1A 4YBQD 1HZHH 4W9HC 4OVVA 2NY5H 4KMTH 5D1ZB 2EXWD 2KH2B 5F7EL 1OPGH 1LHZA 1MCKA 2VT0A 2BJML 1VZHA 5D7LE 1BIIB 4LP8A 2WBKA 3KCPA 4HUKB 2AI0H 2XCMC 4PQXA 3EDEA 5GIRB 1SQMA 5IHZB 5L2JA 1OTSC 3GMRA 4MJJA 3KPRE 4WRLA 2XX0A 4R9HA 5IKCA 4Z95L 3GBML 1P7QB 3QI9C 5D8JH 4LMQE 5CZKA 3SD5A 4FNTA 4WCYH 1IEAA 2DQIH 3OF6A 1F8TL 3GMPB 4L8SA 1NOFA 1JHKL 1ET8A 1T6WA 3I6GA 2DEXX 3GINA 2KYIA 1GCFA 1KCVH 1QFHA 5HI5C 3H0TA 4OM1H 5JIMA 2F7RA 5ESVB 3WEXA 1E5UI 2X4TA 4JN1H 3FU9A 1KULA 1TITA 4L4VB 4ONGL 5DZPA 2CRMA 1U8MA 1P7HL 4GRLA 1KJ2B 3NA9L 4YHPA 4XNYL 1HL8A 5I26A 2MCG1 2W9LA 3LV3B 3JTTB 2ZSWA 1A4JB 3VWJC 1OTUD 4JO1L 4KKAD 4PJXA 3V4LA 3GKWL 4V1DA 4E0RB 2YKKA 5I6NA 1OZTG 5DEGA 3IFNH 1QW9A 1I9RL 1ORQB 3QQDB 5C0FB 4XBGA 2AJUL 3OJDB 1LO2H 4AG4H 3MV9E 2RGSA 3HJ0A 2LT9A 1AR1C 1OP3K 3MRHA 4LB8A 4LSUL 2P49B 4PW4A 1SPDA 2BY1A 5HVHB 2V9TA 3WENA 1NMBH 3AB0C 4X2UA 3BMWA 2WQVA 2JI1A 2WTPA 2IOOA 3D69A 3CMOL 1KPRB 3DMMC 4JEGB 4M7ZC 4QOKE 1G1YA 1WEJL 1D9KA 4G6JH 5GGSY 4XNMB 2Y7MA 3FPYA 4MRBA 4ZXBC 4L18A 5IJKC 5T3XE 1GAFH 2FJSA 1FZMA 3WDIA 4R7VA 3KPMB 4C57C 1OPOA 3MLYL 1OGAA 3HUJB 5IEHA 2O30A 4LZKA 1XCWA 3B7YA 2VJ8A 1XIWA 4RWHA 2AV1A 1XXDC 4PP1D 1HOEA 1QPXA 2F54B 4AM0Q 1QSFE 1D5RA 3C9NB 1LYQA 3G5XB 5F0LB 5J9PA 3DX2A 2A2QT 2PW1A 2BNQE 2HWZH 3CFEA 3T65B 1MCIA 5JOEA 1Z9SB 4XN2A 1KLGA 3PGFL 4IBQA 1FZJB 4FXGC 4E42B 1FGVL 3B5HA 4KXZI 5K59E 3F7VB 5B21A 4LKXA 4QXUL 5B7FA 3L3JB 5AENA 3GI8H 2BVEA 3RNKA 5BUPA 3QRGH 4K8RH 5D7SL 4GP4B 2YQBA 3E8VA 2HTKC 2HT4D 2CA4A 3MJ9A 5F3BA 3MDJA 5A6IA 1TTRA 1FH2A 1T2QL 4MMXB 3EDJA 1KV7A 2PXYB 1FO0H 5CKGA 1BZDA 3GPSA 4HS6B 3U0PB 1KACB 4KK6C 4QRFA 5I5RA 1EVUA 4KRPB 1ET7A 4AYEC 1F6AB 1MCJA 3CZJA 3T0XA 3WO3B 4FAAB 3B3BA 1INEL 2XU9A 3D5OF 2D2CC 4HIEB 4OFYA 1JZ8A 2OL3L 4FQHB 3PV7A 2X1QA 1LD9A 4LLUB 4LHUB 4NUPA 5DWPA 5E99L 4AEFA 4N8VB 2WSDA 3DC0A 3LQAH 4ILDA 1WFUA 1JPFB 3BFQG 3EYSL 2X89A 2UZPA 4HZLA 3Q13A 4G6KH 4LLDB 3SDAD 1OM9A 1BCIA 3NQKA 3DX7B 3JXAA 4QNPF 2J20A 3IN2A 5DHYA 1MREL 4HUUA 2D3VA 3FT3A 3BYYA 4K55A 3CDZB 4C59B 1F4XL 5J6SA 4TSBH 4TLKA 4ZS6C 1BQHA 1BZQK 5JPNA 3MLRL 4M6NL 1IO4C 5E5LA 5GJTL 2W0FB 1MUJA 5C08B 2IAAC 3UX9B 3ALPA 3TIDA 3BAXA 1MPAH 4K7PL 4Q52A 4TV3A 3VMOA 4YSAA 1ZWIA 1NCBH 1FQ9C 4BD4A 4ZUSA 1YEJL 2A6JB 4I7ZC 4JCMA 2FO1A 1KELL 4G9FB 4NO0B 4LLAA 1P9MA 1IE4A 4HH9B 4EVNA 2O5NA 5I6XC 5L9DL 5A2LH 3FK3A 3LNEA 1Q0XL 3CUPB 3HR6A 4PW9A 5GJSL 4X7SL 1DJSA 3C60D 4DTGH 4OFDA 5H37G 4GSDL 3S96B 4TQIA 2HKFL 2YXWA 3CH8A 2XWJA 4NQQA 2R1YA 5G4NA 2M83A 1WFMA 4X4MA 3D85A 4GJTB 3Q5YA 4R3SB 4XN4A 3U9PH 4P5MA 1KB5H 3PHQB 1OB0A 1CYGA 1QOKA 2Y5EA 4PTUB 2L4OA 3CPLB 4NBZB 4G8EA 3VGFA 1ZT4B 3V5KB 2FWOB 2AXJA 5JXAL 5LXGL 1CN4A 3S9DB 4M61A 2JIXB 2DQJL 1HDMA 2AXFA 2IH3A 4WHYH 3NCJH 5GS0C 3C2AH 4WAFA 5CSGA 3U36B 2VZVA 1BWMA 3KLLA 3P4MB 2E9JA 4XRCB 1M2VB 4AGMA 4HKZB 1JBJA 3KL3A 2EXTA 3I02B 2OW7A 2VLRA 4L9LB 4MXQC 2Y25A 3ARBD 5F8RC 4NUQA 1S6NA 3VXSB 4AKQA 3QEQD 1AJ7H 3F7RA 4N2CA 3JT2A 2BCMA 2WXPA 1HSBA 4RIRB 3SKJL 5BRZB 5D7IF 4DN4H 3FCTB 2A6DA 1AQDA 4MBRA 5KUMA 4DW2H 4U0RB 1YYLL 3EIFA 4ISVA 4YHOL 3MOQA 3K2MC 4TNFA 4X5LA 5D1QD 2G9KA 2WLZA 3B8SA 3A23A 5AVRB 3B2UD 3BVNA 4YK4C 1CXLA 4PGJA 4FQXB 1EXUA 4A63A 1BMZA 1KIUA 2ATPA 4X5XB 3SHSA 1KN4L 4B97A 2V7HB 5ID0A 4P57B 5GS2D 4Z76B 2W91A 4IDJH 2V2TB 1Q9LB 1ZSHA 5DZVA 4YHYC 1PIFA 4AVIA 3T3PE 2DL9A 4EN3C 4HMEA 1TO4A 1Y1DA 2DLTA 2X88A 7PCYA 1TJGH 2WTRA 1WLHA 2ZXCA 3KJ6L 5FECB 3EXLA 4XXDB 4IJTA 2QHRL 1MFUA 3EYVB 4AKOA 2HLEB 3O0RL 4HEME 2KMWA 5D7JC 3REVB 4W9JC 4HKJA 5HYQA 2BVYA 1ZVSA 2F5AH 5ID1A 3JV6A 4HJUA 3OAYK 2AABH 3GIZH 4JUSA 4KTEH 2J2ZA 2MOGA 2M1KA 3TO2B 3X13B 2O6FA 5AOJA 1AYOA 4NYLB 4GRMB 3CLFL 5FW6A 5IB5A 5AOZA 4XAKE 4OUOA 5KBLA 4YDIH 4X80L 1SOSA 3I75B 1XF2A 3QUKB 5CGYC 4R7NB 2C9SA 1BVLA 3U6RA 1E30A 1L5GA 2WTOA 1UYWL 3FOMB 3FUHA 4HUNB 2NXYC 1G7HB 2YR3A 5EU5B 4UQBA 1AKJD 3CVDA 4N0YH 3C60A 2XRAL 4R84A 1GJWA 1PZCA 1K5WA 4UT9L 3BXNA 4JN2A 4DSYA 3MNWA 1PYWA 4N8VG 4OKDA 1TR7A 2CO1A 3OKKA 1Z9PA 3BPLB 3HC0A 4DQOL 4EQ2A 1E90A 3PXLA 3ARGD 2OCJA 3OPZH 3F5WA 5DJ0B 3RWFA 1FNGB 1JDAA 4Y4HB 1RIVH 2AQ3A 2FQFA 1MFVA 2GK0A 3MBWB 1ZKAA 2Z35B 2OTUA 3SGDI 2NY1C 3VI3F 3W81A 1XGTA 1FE8L 1TTUA 4KUCD 2O72A 1F58L 4WFFD 2CIKB 4MJIA 4DETA 2NUTB 2BIHA 3I9IA 4JRXA 1FL3A 4HFUL 2HLAA 1WQVT 3IU4L 3QUXD 2R27A 4HV8B 1WRFA 2FX9H 1GS7A 3GXIA 2BS71 3NP4A 3PNWB 3NSDA 1FNAA 4MQSB 5LG1A 3HI1B 3NZUA 3T0AA 2P24A 5KVMC 3GMLB 4KTYA 5CU5A 4UBDD 2CBMA 1E9PB 2R1WA 4I3RH 4QTHB 5CAYB 2WAQA 3SPGA 1DZBA 4M6AA 5CSBA 1ADQH 3BVTA 2Y69B 4Y5XC 4FC3E 2ICWB 2OV0A 2VXUH 1HNGA 4NHUA 5D1QA 1XGYL 3SO3B 3IDIA 1OARL 2J1KA 2QGEA 4X6EB 5EOCL 2BNUA 4LEEA 2WQWA 4NQTA 4LCWE 2OR9H 4HJGB 2PWHA 3N2JA 4YVNA 1JVOA 4X8JA 1HHHA 1UOVA 4F7PA 2JKIS 2GTWA 1W2KT 4I9XA 2OQJA 3SZKC 2XNAB 1G6RL 4RGMB 1H19A 2CDFA 3G6JA 2VDRB 3D50A 1SHMA 2A6KA 2X4UB 3VXPB 4AYGA 3FQWA 4XNBA 4J3VA 3B3IA 4FLRA 5DI8A 1HZLA 3ZT7A 4N0RA 2FIKB 1PVHA 3H2WA 4QJ5B 5I28A 4PJEA 4NWUH 3T0EA 1DBKH 3P4OA 1U92B 4Y5YB 4YHIB 1VDGA 2K6YA 1N10A 2WHVA 5EPMA 2FQEA 1ODUA 4MAUH 4QJ3B 4TS6A 1ID2A 1SDDA 4P2RE 3KVPA 4OIAA 3N50A 5AZEL 5B39B 2JKWA 4GBXC 1WZLA 3IAPA 3M6DA 5DMIL 5EOTB 2GUOB 4ZSOB 2EYRA 3T1FB 1LNUA 1LE5B 1WCBB 2EC8A 3L7FB 1Q0YL 1OB1A 2ADGB 4IMKC 1Q9WB 4K94L 4GRWH 3EJQA 2IFFL 2UZXA 2ZZUT 4R8WH 4AXWA 4JY4A 4LE8A 4BZ1L 1RL1A 3O4LE 2ZKMX 1UKTA 2FBJH 3KPSE 4OR1A 1LO0H 1VCAA 4BKSC 2A6IB 1IZKA 1RULH 5IEKA 2FGWH 3BKMH 3FJTA 4XOEA 1U6AL 4IKIA 2D7TL 2P5EB 3GSQA 5HDLA 1IM9B 4TPRH 3HN3A 2HN7B 3NJXA 4PJCB 2CJ3A 2WB1A 3GZPA 3RU8H 1I7UB 3VGGA 1EAPB 2CU9A 3TO4D 1QO3B 1FCCA 5F3HA 5F1NB 3FQUB 1JZ6A 3TNMB 1BBDL 3CAFA 2OP4H 2IH9A 5DFWH 4FP8H 1B6DA 1OK0A 2WGNB 5TK4A 4NJ9L 3QO0A 3T8MA 3Q5OA 4WGKA 5EFIB 2PN5A 2IWKA 5D2LE 4D0CA 1RVFL 3NQIA 4NKIL 2IDTA 1HE8A 5BO0D 3V4PH 4MB5A 4NZRL 4GLRH 4ODXB 1TQBC 2OMYB 3EYFB 3K8MA 3V4PA 1GIGH 1UACH 1HL4A 1IQWH 1XGQA 4HIHA 2VR7A 5ITFB 5D9SB 3FUJA 1ASPA 2DIEA 5B8CA 1UT2A 5IUSA 3QJQB 3NH7L 3WE6B 3FB5B 1U93A 3FT2A 1QBLH 2Y7QB 3JWNG 4P3DA 4WWKA 5IG7A 4G1EB 2FEEL 1L0PA 1BP3B 1MCRA 2ZYIA 3UZQB 3IFOA 2VZOA 4NZJA 1EDHA 3K6SA 1LLAA 1Z3GH 2BVPB 3IMBA 1YN7B 1UGNA 5SWZE 2KZWA 1WBYB 2Z92B 3P3UA 5JW5A 5HBBA 4OZ4A 4KO9A 3CV5A 3QWOA 3MRDA 1T0OA 2O93L 1P7QD 5E1QA 2CIIA 2YGNA 3V0EA 1NWOA 1CDGA 3TV8A 2ENQA 4PRHE 3RVUC 2EVFA 3L95A 4I89A 3FB8A 1J88A 2NY6B 2HVKB 3FFCA 4LF3A 2QGDA 2RH0A 2YEZA 4WQOA 1E4KC 5IFAL 1XXFC 3SZ6A 3EUDA 1J10A 5D7EA 1KJ3H 3IJEB 5DJCB 4WHDA 3LEYH 3JWDH 3PAUA 3LS4H 4ADIA 2YQGA 1EMTL 1J48A 1QG3A 3GK8L 5LAPA 2FSEB 4L4VD 1HOCA 4NGHL 4FQLH 4W81A 2AQ2A 2XTJE 3P9MA 4KPHL 5AAMC 2XKNB 3LJ3A 1NIFA 2XBTA 3NCFB 4LU5L 1KXVA 3MA9H 2BFGA 2BP8A 1V55B 1M05B 3WY4A 4ADGA 1X7TA 2JJTC 1MCOH 1WD8A 5KYXB 2D4DA 3X1EA 2QZQA 1TQSA 3QWNA 3MJWA 3TZVA 3WTSA 4BRVA 2FR4B 5KBPA 2NCEA 5E8NB 2KBGA 4JO2L 4HHWA 4LDLB 3CN3A 2HB0A 4OB5L 1LMIA 3SDXF 5I1AB 2R8SL 3DA0A 4U6HB 4UV7L 3RTQB 2IVFC 2WQAA 4YXHL 1PKQB 5GGTH 4M1CD 5I1HH 1ROCA 4KJQC 3BO8A 3G5ZA 1N6UA 5I2IA 1F3JB 2JKRM 4NHCL 5ETUA 1A9EB 4MXWL 4HIIB 4D94A 2N7AA 1I4FB 5KVEL 3I3DA 3EBGA 3W37A 4RMVA 3P0VH 3V0GA 1L7TH 2E7CA 3V6OA 4Z7NE 5BRQA 1UVQA 4M7JL 1MFDL 3WD5H 3BD5A 5IMOB 1SGKA 1TVBA 1U42A 3MXVL 3QJHA 1OP3H 5K69A 2DQFB 4YHKH 5IQ7H 2FT6A 3TO4A 5BXFB 1W72A 4XPBH 5T1LB 1MFMA 5LNDA 3KPNB 2YRZA 1THCA 4CN6A 4A7UA 3QEGL 3AQYA 1F97A 4KVNH 1VGKB 5KSBE 2X44D 2F54D 1VFBB 2C4XA 2ZSWB 3W39A 5DD1H 1S7TA 3GIVA 3HMXH 2DQHL 3IU3A 1A6AB 3HMXA 3IGLA 1BQRA 3K2UH 5D5MA 1E5ZA 2EO7A 3NJVA 2VN5A 4LMQI 5T1KA 5KSAB 1QABA 2UZIL 5MEOB 3DTXA 3DV6A 4X4YA 4ELKB 4D0BA 2Y1ZA 1HXKA 4IJ3B 2GY7B 1FZKB 1NMCB 2DD8L 2D3NA 5G2NA 3MRHB 4ONFL 1E7UA 1OCOB 4PJFE 4Y2DC 2VRAA 5F7KC 4C55A 4M00A 4OAWA 1PSKL 4WIQA 4JMNA 3ML8A 2DOCA 3DI2B 4JB9L 4QHLB 1G4MA 1V3MA 1OCWL 4KRPD 4QY8B 4YQXH 4KNQA 1PZBA 3A67L 4IGBC 1P7BA 3L7EB 1NUNB 2X09A 3DIFB 1PZAA 1SM3L 2EUWA 5H37A 3EYQC 1RY7B 3WIIL 1YY8B 3IDMB 3FUFA 1RZIB 1N6QH 3US1A 1S5HB 2F19H 4LHUD 3V4VA 4F57H 4PD4J 4UV4H 3PE9A 5I1DB 3EYOA 1Y0LA 4WEBL 4NXSA 1M7UA 4P4RA 5DHEA 3T3ME 4O51A 5E51A 4GSRA 4MVBD 2J8UB 5E2WL 1FPTL 2AV1B 2Z0BA 1RK0A 3K2IA 1S9YB 3C08H 4Z0BL 3PNRB 4DERA 4HOZA 1MHEB 1R17A 1KBWA 1WSST 1NZRA 4M43L 5E4AA 1H6UA 3MCLH 3RY4A 5KVEE 2ZICA 4JPWL 3RZCD 1QSVA 3DRQB 4L4JA 1HKFA 2DWEA 3D51A 4H88L 4G80A 4PRIE 4NJAL 4UF7C 3UTQA 3RWDA 3AADB 3SY6A 1BZ9B 2Q9OA 2L8AA 5KS9B 4F1SA 4BUQA 1AXIB 2UYLB 3B7UX 3BE1L 3DURA 2L7QA 3FNKA 1GW0A 2VIRA 4UU9A 4KH9A 5F88A 1WGVA 2NDFA 3IBOA 1PG7X 2DM4A 3VYOA 3TFKC 1MZZA 3INUL 3TBWA 4GY4A 3UIZA 3SGJA 1FO0B 2W9DH 4U6VL 5JW3H 4NO0D 3U2IA 3NVQA 5E8PB 2Y36L 3LSOA 3CIAA 2J88L 3OG4B 3O45A 2XJLA 4OFIA 2GBUA 1E42A 4LL4A 5AB9A 4KI5E 2W60A 5CINH 4WWPA 5BO1H 5J5EA 1JGVL 3VFWB 5GRVK 4IOSA 5EU3A 3DSFH 1KCUL 4R4FH 5D7KD 5ACZB 2L7UA 3G6AB 1AXTH 4GMTL 3T8XA 1SQ2N 1A7RH 4W1TA 4H0HB 2GK2A 1KBGL 2APTA 3QZWG 4L9DA 4MWFA 2F7IA 4FYRA 4AMKL 1JV5A 4F80A 2NOYA 3RVVC 1Z5HA 5EG6C 3Q1EA 1SXCA 4PWGA 4W4OC 4UT6H 5IWLA 1X44A 3X3FH 4I13B 4QRSA 4NFCA 4XTRC 1R3JA 3UPRA 3SPVB 4BGDA 2JIXD 1A1NB 1F2QA 5J12C 5INDA 1HHKB 4DZ8A 5ADPL 2V5YA 4LLYA 3QDJD 4Z3FA 1I9JL 4P59L 4LRIC 1OT1A 4JGJA 4N2OA 4TVSa 2HPTA 1X7QA 3ZTCC 1S7VA 1KGJA 3L3DB 3TIDB 4E9QA 2FX7L 3U7WL 2ZCHL 4IQHA 1I7RB 3WJLA 4KKRA 1CXKA 3SBWA 3CIQA 3FZUD 1RJLA 3LN5B 5GZOA 3VXSD 2VYRE 5EUOF 4HXBH 3JT0A 5DC0A 2WUBH 1QZ1A 1H3PL 4C54A 5BRZD 3LZRA 2ZUSA 2WMPA 3U0TB 1P2CA 1PS3A 4OIBA 5SX4H 2X4NA 3EO1B 2ZOLB 4UNUA 2VDOH 2AEWA 5JMRA 4N0FA 3KDMA 4LNVA 2P5WA 3V4UH 2KZBA 2A73B 3G5VB 3QR2A 3UBXA 3AABA 1T5XB 5F9WC 4NAQA 3ROLA 3VGAB 1G7LA 2OAAA 2CQVA 1UWGH 4RFNB 1B0GB 1CXFA 4J6RH 1U8JA 1SEBB 5EZJA 2EDBA 5I74B 4OGYH 2IMNA 4FQXD 5A43C 1G7MA 1TMCB 3EFOB 5A6LA 1KB5B 2R0ZH 1XGRB 3QYNA 1NLDL 3OGCB 4XBEH 3VMNA 1AHWC 2EICA 3WNPA 2EYSB 1JD9A 3V9CA 2WNWA 3FUIA 3L4YA 4AGQA 2PYEA 4FERA 4XCNA 4GXUN 5CZVL 3DPBA 5J13B 3AM8C 2Y1YA 4YZFF 2A9NL 4KV5F 4X7EC 3ABKB 3LXUX 1IBFA 2DMCA 4YEFA 5IY5B 1TCRA 4G7RB 3ZHKA 3RZCA 3QAQA 2MNWA 4LCYB 1MLBA 1RZKC 1OZUA 3HCVB 1DDHA 1J9RA 3ARWA 1NAML 2ZOOA 3PP4H 3UO1L 4HISA 4WENB 5JUEL 1RLWA 2GB2A 1UG9A 3CG8A 4Q2ZB 4D9QD 4QNPE 5A7EA 3ZRCC 3DUHA 5TDOB 3JV0A 3BWUF 5J56B 2CKBH 1MCQA 4GXVH 4PS4H 3H54A 2WWMD 2WINB 3D87B 3ZOAA 4Z3IA 2VLLB 3OAYH 3OR7B 4K3HA 3BH8B 4PY8I 5HD8C 4ZPTA 3GSUA 3PL6C 1Q72H 1EGJA 4Z7UA 3KG5A 4DGIH 3U1SL 4MZRA 2QSVA 4NQED 2R39A 1JPGA 3STZA 4OLZH 4XI5C 5FOBA 5IMMA 1U8KA 2K9FB 3VFRB 5HHQA 4LSRH 5TDPA 2WUCH 4B5ZA 2BSDA 3EAKA 4OJDH 1O5DT 3P40A 1IV8A 1KIQA 3MRIA 3EG9A 4Y4HD 3QVAA 3TBCA 3LH2H 2FLMA 3WS6A 4DQAA 4ZPVB 5E56A 3THMH 3GYRA 4XMXA 2QPFA 4AV5A 1LWRA 3N9GH 1OD9A 3QNZB 1KIRA 1FFQA 4GAGH 4NQDB 2XYCA 3TT1H 3QDJA 2HG5B 4B60A 3C6LA 4G7VL 3VH8A 3DHUA 3DNKA 3QI9B 2O6EA 2BK8A 1AGEA 4N2HA 2CBQA 4J3OF 4BKLA 5T1MB 5E08L 5C0CB 3VRIA 1L6ZA 2D73A 4QT5B 5IFHL 3MJ8B 4EPSA 4L8CA 5IFJB 4Z78A 2YD8A 2QFRA 3WS3B 1RFDH 2VXSH 1XH3A 2H3NB 4P23C 1HCVA 1BVLB 5I1JH 1SLWA 4TQEL 3L8QA 2DMGA 2TRHA 3HOGA 3KEHA 5LLIC 3B9KC 4LLMB 3A21A 4KI5C 3VTMA 1J0ZA 1YEWA 2WXGA 1OSPL 1U8IB 4KXAA 3ZKMD 3LZPA 1DUZB 3R7RA 3K3QA 3LS5L 2JE8A 1P5UC 1JWSA 4PD4K 2EIJB 1UUSA 4FTVB 3OAZK 4W6XB 5HPMA 4UOW1 4ZNCD 3DO7B 1A4BA 1T0MA 3VWJB 3DI3B 3B5TA 4AT6B 2J43A 1MHPH 4OD2A 3TH3T 4G8FA 5I1LA 1WC7B 4NLHA 4XCEB 1RP8A 4K3EH 1UZGA 2PTTB 4Z7QF 4P5TC 1DVZA 1YNKL 2XZCL 4D0DB 2ZWNA 4FQIH 4J1UB 4MCYB 5AOMA 1AR1B 4Z7VF 3RWHA 3P73A 3VXQA 3QWQB 4N2KA 2GQHA 4H25B 1KGCD 2VCOA 4V33A 1CGVA 1TEGA 3JVGA 4MSWA 4RGNE 3TA3D 1UATA 1R5IB 2FO4A 1MLCB 5B4MD 5FEBA 2W38A 4LGRB 3S88H 2Y2WA 1DBJH 3UTPE 5LGYA 1DR9A 4M7ZB 1AD0A 1XF4A 5DJ2A 1QNZH 2GW5A 2QVFB 4FZEL 4ZXBB 4HJJH 1TZGL 3UC0H 5AVYB 1TTGA 4LBEA 4F37F 1S9WA 2E56A 1ZGLB 5I8EB 3U79A 3NRQA 2FJHB 4HT1H 1FG2A 2QT6A 3EO0B 1IUZA 1NGZA 1ED3B 3S37H 4X42A 3MZGB 1O7DE 1PX4A 5KJRL 8CGTA 1BVNP 5T33H 4XWGH 5HYJB 4WW1A 4AZUA 3CSPA 1UA3A 1IM9D 1CICC 4ZFQA 1ZT1B 1MAKA 2PR4H 1JDDA 4NQEA 4FXGB 1VEOA 4KX7A 3L4UA 5FUOH 1QACA 4AJVA 5IB1A 4OLUH 2CDFB 3ZKQD 3MGTB 5D1XE 1CD1B 4KAQL 4JKWA 3QE5A 3FQWB 1CK0L 2X6CA 2VL4A 4I8DA 5M7QA 5E8DL 3WL9A 4MQXC 3IRZA 4FFVC 1ZEAL 3ALWA 5FYKD 1A7QH 2DB8A 5IESL 2X4PB 3AXHA 4HDIB 4HX1B 4P5KA 5HHNB 3L1OH 1OCCB 2UY6B 5ALCH 3V0HA 4MX7B 4J7RA 1I3GL 5C71A 2O5XL 4YDLC 2BM3A 4X0KA 1IAOA 1Q1JH 3H4FA 1JS4A 3HG1E 3VD9A 1S8DA 4PJ5A 3FO9A 4X5WA 4ENZA 3ARFB 3HE6A 1ZLSL 5F44A 3HAEH 1QI4A 4ZMXA 3DVNB 2GHWB 4KH2A 5BOJA 4Y9FA 4GINA 2DI7A 2GCYA 1ZE3C 3HKFA 4DN3H 3O8XD 4WNQB 1U8NB 5CFAA 1VENA 3RZWA 3CVCA 4G2AA 4M7KL 4CVXA 4U3XA 2Z3FA 3O9WB 5D70L 4M8QA 1I8UA 4P2QB 2ADJA 4I1NB 2VXVH 3L3KA 4GO9A 1UH2A 1CCZA 3FCBA 3D39D 3FTVA 4TUOB 4U1MB 1NC4B 1ZCRA 2ZD0A 4LL1A 4LNRA 5DURB 4KZDH 4DP6X 2NY6D 1FVEB 5E6ID 2X87A 3ULUD 1AZVA 5CIPH 1CDBA 2LVEA 1K8DB 3EJZD 4HC1H 1JCKA 4KVCH 5CIPA 4WI4A 3KPLA 1IT9H 3LNHA 4RQQB 3EDKA 2EO9A 1MNNA 1N9PA 4KZCA 5MI0B 5HYIA 2OFQA 5SWQB 5H2BB 5I6XB 3VFTA 4G1MB 2VC2L 5LDSA 1MWAH 2VM3A 2JI3A 3H9ZA 4GW5A 2HFGH 5CBEA 4GKZB 4WI0A 4UZUA 1JIBA 1CU4H 2YWYA 2ZAGA 4GG6E 1DN0A 1QI3A 4GYBA 2YN3A 2QEJA 1FDLH 5IG7B 1UM6H 3IJYA 4B96A 3SQBB 4NDMA 3DXAE 5I8KH 4DCQA 5C8JB 3QXUA 4HWZB 1R19A 2QVTA 3B2MA 3WFHB 4AIXA 1GJIA 4LIQL 1ZSDA 3H42L 3KLQA 5GS3A 1AANA 3D2UA 5JHLL 3FH8A 4QR7A 3IFOB 1JYNA 4GUCA 1TOXA 4JZJB 5JZ7C 5C0NC 2N7SA 2WIIA 3RTQD 4NZUL 4PPTA 1KNOA 4OF5A 2AEPH 4V2BA 2OYPA 3FQNA 3FUEA 5IBTH 5LHDA 3NPZB 4Z5RA 1QBAA 4UM8B 3CZFA 1NDGB 4M62L 4QRRB 2I9LA 3MV8B 4LRNL 2YD5A 1OGPA 5E8EA 1RZGB 1QYGH 3VXOB 1G0XA 1A6TA 2ZKWA 4M4RA 2NW2A 3FO0H 5L4IA 4FX5A 4OF8A 5L6YL 2FBOJ 2EDMA 1I3VA 4R7LA 4XVJL 5LXVA 3GSRA 4ONOA 4I18B 4JW3A 5EF2A 3ZTJG 4X9BA 1KEGL 4JFPB 3V52H 3ASOB 2N59A 5J7CC 4PJGE 3OC8A 4MNQA 2OSWA 5HHPA 5ICZA 5I0DA 4OSUL 2QKIC 5FV1L 1IFHL 4WI3A