4FEMA

Structure of suse with alpha-cyclodextrin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
SLTPPKTMFIVGSMLDTDWKVWKPMAGVYGMDGQFYSMIYFDANSEFKFGTKENEYIGINDNRVTVTDKAGAGVSGSDNFVVENAGWYLFYVKAAVKGDDYQFTITFYPAEVYLFGNTTGGSWAFNDEWKFTVPATKDGNFVSPAMTASGEVRMCFKTDLDWWRTEFTLHDGEIFYRDFNLIDSWTEKGDGYSIQGSAGNVIHLNFTAGTGEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding protein
molecule keywords Outer membrane protein SusE
publication title Multidomain Carbohydrate-binding Proteins Involved in Bacteroides thetaiotaomicron Starch Metabolism.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16411 SusF_SusE Outer membrane protein SusF_SusE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3610 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA02
2.60.40.3620 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4femA01
4FEMA 4FE9A 4FCHA
chains in the Genus database with same CATH superfamily
2XZCH 2LTQB 1NEUA 3HHMA 1GJWA 4H2AA 3PAUA 3KPMA 1DBKL 3RWIA 4GAGH 3PPSA 1S7VB 5A16A 3UJTL 5MEQB 1QWHA 3QI9D 2C9SA 4MWFA 2Y06H 1HSAB 3RGVA 3EJTA 4B97A 5EDSA 4YX2H 5D6DA 2MHAB 1I8MA 1KBWA 2ZONA 2FBJH 4NSKA 4PY8J 5TDNA 1A3ZA 2BVOB 3CZEA 1SBSL 1OW0A 5C0AB 4ANUA 1PJWA 2Y5TB 3QXDA 4XPTL 5I1HH 1TKWB 4RMUA 4O9HH 2X05A 4Z76B 3MTRA 4Y16D 3D1MC 3FCUB 3GRBA 5I17B 1FYTA 3FUNA 2G9HB 3UTPD 1UXWA 1IGCL 2I32A 5L4MA 2CSPA 5JXEA 2O6DA 2HRGA 3ME0A 3ILQD 3ZQ9A 5LBSL 5MP6H 5HGBA 1MWAH 2KZ1B 3DX7B 1JCVA 2B1OA 2JTDA 2QVKA 3TZVB 4JCLA 1T6BX 3GXTA 1NQBA 5IEHB 3EFDH 2NTSP 3ULAB 4CU8A 3UJIH 4PWJA 5TDOB 4OQTL 2K78A 3FBQA 3VRIA 1GPOH 2NDFA 3ORJA 3QJZA 1JGLH 3HNTH 4RMBA 4M02A 5DJ0B 1WFNA 1A2YB 4NZRL 1RQ5A 4FQQB 4F8PA 1DJSA 1DEEB 3GHPA 2EC8A 1SDDA 3C09B 1UA3A 5D1QD 5ID0B 3O6KL 4WY7H 4ODXA 4PCTA 4CMMB 3HLAB 1IC0A 3INOA 2D4DA 3CZNA 3HE6D 4IHOB 1OVZA 3MRNA 3ECBB 3K4DA 2R56L 5HY9B 1QBLH 3ECQA 2FSEB 2FL5A 1WIUA 4LQFH 2ZYSA 1LO5B 3SDAA 4JFTA 5C09B 4ZNEA 4W68A 1IAIL 4F37K 1ZK5A 2X4TB 1OCWL 2GPZA 3HBPA 3U0TA 4TPRL 5DJDA 1K4DB 4K7FA 1Z7JA 1YECH 2CKBH 1KIQA 3IU4L 5AENA 3QC6X 2FX8L 1CYXA 4Z7OE 3OSVA 5EU6B 3HG1A 4MJID 5EG6C 2Z31A 3LQZA 4DP0X 3LIUA 1BZ7A 1FV1A 2B1HL 2I5YH 5CEXA 1ASOA 3ZIMA 1TJGH 1D6EB 2B0SH 2CBMA 2ZUUA 2BVYA 3QIBD 1WTGT 1JOIA 1DUYB 4MXVF 4R7LA 3TU6A 3DGCR 5DK3A 5C86A 5EOCJ 3NZ8B 3NP3A 4N3UA 5J9PB 3T8XA 3GS7A 1B2YA 4LGRB 2GJZB 4K5NA 4TUJA 1GYWA 1ED3A 1WFOA 2IXQB 5DSCA 3GIZH 1IC5L 3Q44A 4HC1H 1KPRA 1OAUH 1U8MA 3T6ZA 2ESVD 3MJGX 2APTA 2NXYD 1I9JH 1TYJA 4GIOA 5EOQL 2ADGA 2WO4A 4Y9BA 3CHOA 5C7XL 2X7LB 1OP4A 4IBSA 4FLRA 4U1HA 4ZYKB 2PYFA 3SKOB 1EGJH 4WWKB 3CHPA 5K9OB 3NMEA 1AZVA 1QA9A 4HIQA 4WFED 2JCCA 4Y9GA 3RWGB 2BNUA 4KRPC 5CGYD 3AS0A 3QUZC 3O6FA 1P7KA 1J88A 3I02B 3VI3E 4XI5C 2EDJA 3FB5B 1MCBA 1RP9A 4F7MB 5IHWA 5TH2B 3MXVH 4KAQL 1KG0A 3T9WA 3DX3A 4X8XA 2XQYK 3CQFA 4LBAA 5ECGA 5C0CA 3KH3A 1PX4A 4MB4A 1RL1A 3A6CH 2VDKL 2VH5H 3CSYA 4P3WA 2A9ML 3ETBF 2CPCA 3BQVA 2V37A 4PWHA 4JM4L 5FGCB 2Z35A 4M7JH 4FMFA 4KUZL 4JO2L 1F8TH 3KBHE 4IOIA 4X99A 1IBZA 2W0KA 2VR7A 3MRKB 5IEKA 4UQ3A 2XVGA 4Y2OB 2V7HB 5CIPA 3GMRB 1D5XA 4OM1L 4CNIA 2CRZA 2N01B 3CVIH 5DTFB 1YCSA 1ZD6A 2OJZH 3N40F 2EDFA 3GD1C 3ROOA 2H3NB 3FOMB 4BYHA 4ZUTA 2CNZA 1T03H 1RH8A 2AXFB 2DQEH 1Z9SB 3ET9F 3M07A 3U0WH 5I6PA 5CEYB 3UP1A 1XTMA 1BGXH 1TTBA 1NDGB 1I3VA 5KYUA 5BRZE 3RTQB 4M93C 5ITBH 4Q0XL 2VR6A 1N2RB 1MJ7L 4N2FA 2GJ6A 3IAPA 3GWJA 4JG0L 2VABA 5F72S 2J1ZA 2VUYA 4UNIA 2WINB 4LVOC 5ACZA 3MRBA 2H9GA 1JV5B 1YY9D 2YA0A 3K3QA 1BX2B 4X6DB 1DL7H 4KROC 3WE6A 5FHBL 4N8UA 4C54A 3JWOH 4PREB 3H7BB 2E76C 3CZFA 1T2QL 1EK3A 1I1AB 3TTSA 1F6AA 3E3QC 4P06A 4PY8I 2CLVB 3U25A 3TOPA 4OZIE 4P3DB 5B4MC 5KSBF 4KKAC 1HILB 1O7VA 4LCIL 4U6HA 4I18A 1PYWB 1HKLH 3C2SA 5HGAA 3SE9H 3VA2C 4AVKA 4I2XB 2YLHA 5IP4A 3N5AA 1S78C 3DETC 4DAGH 4A7VA 4D3CH 1N5YH 3H3PL 1QRNA 2NY4B 4GW4A 3H42L 3QIWA 4YE4L 3WNNA 2NPLX 3HB3C 4DN4H 2PWGA 2GIMA 3HC3H 2CLRA 4KTEH 1S7TB 5LN8A 2UXVA 1LE9B 1BXAA 2VRKA 3ZTDC 4YE0A 2WQUA 2KLSA 3DUSA 3UADA 2Z64C 5GZOD 2WLLA 3NN8B 4JPIB 3HS9A 2JB5H 1TNNA 2YUXA 2PWDA 4LK4A 2IWKA 4O2FA 3SYAA 4YK4C 4G5ZL 5ESQB 1CE6B 5CCJA 3KM2A 3ASOB 4G8EA 5CILL 4XNXL 3FONB 1V8HA 3QQ4B 4DGVL 3AQDA 4NP4L 2C1OB 2K9FB 4F7KA 2TAAA 3QUMB 4JUSA 4RZCA 2DWTA 4MVBC 2A4CA 4XMWA 2X6UA 1A4JB 3PG2A 3E1ZA 3FQWA 1GSKA 1DDHA 3TPKA 1PEWA 4KI5E 4BCYA 1FGNH 1RK1B 3WFDH 1N12A 5BJTA 4KK6D 4L1DA 3L2LA 1IQDA 4KK8C 4Q9CA 4HJTA 4UNTA 1TCMA 1D7BA 2LU7A 4KJQC 5BMFH 2CR3A 1KTLB 1E43A 5IY5B 1JGVH 4X7CC 4ZJ9A 2HT4D 1NFIA 2QPEB 1T5XB 3QUYB 2FH8A 4I4WB 3KXFA 1I9EA 4N90D 3Q9PA 1UADC 3O2VL 3UYRH 1RXLA 2R0LH 4MKTA 1MJUH 3SBRA 4YO0B 5E8EB 3HKFA 3PNWB 4KX8A 3NSDA 4LMQI 3UTSA 4YWGH 4GI9A 3WNLA 3F7LA 1NCUA 5E2UL 2HCZX 2EVFA 4OJFL 4XMZA 1T04A 3B9AA 1A6WH 2Z7ZA 4G6AD 4DK3A 5I5MA 4LGPB 3QZMA 4EPSA 3D2UD 1NANI 5E0FA 4ZMNA 4GLRH 1XF4B 4JGUA 4Y7OC 4LFHD 2D7TH 2F53E 1FL6A 2IFGA 4DP9X 5L0QC 2CBQA 1LP9A 3KHQA 4GG6F 3SOTA 1TJMA 3KVDD 1SMOA 1JCKA 2EO9A 2HMIC 3HVNA 1P7QB 1RZPA 3OXSB 2R0KH 4QHNB 4X6CF 4HZLA 2AK1H 4KVNH 4FC3E 3NAAL 3RPKA 1P69B 3LVTA 4U7SA 5BZDA 4FZ8H 2DKMA 2N56A 4NO0D 2ED9A 3LCYA 3WFHB 1AMXA 4O58L 5FM8A 5K1JA 3IDGA 3ARSA 1GJUA 5FCSH 3PHQB 4QYOB 5GRVK 4K2UL 5GGQH 4R0LA 2R2HA 1HT6A 3CZUB 2RFXA 3CLEH 4PLKC 3HN5A 1IGTB 1X5XA 4LLYA 4U3SB 4YHMH 5B8CC 3WKNA 3FC8A 2HLFD 3VE0A 1ZTMA 2HTKC 5D1XD 1KB3A 2KHAA 5JQHC 2NOYA 5DYFA 3OKLA 1EEZB 2D0GA 2E9BA 4YDVA 4AI7A 5IJVB 3LNEA 1I8UA 3IGUA 3IE4A 1BM7A 3WL9A 4PVNA 2PUQT 5E99L 4JY4B 3MODH 5FC9A 3G6DH 1QLFB 2PXYA 2C9RA 4HIHA 2DLGA 4FQLL 4K5MA 1E4KA 3KBEA 2A74B 4PYHA 1EV2E 2A73B 4MXWL 4CDGC 1PY9A 1AGCB 1UWYA 3MNWA 3SYOA 3A47A 4P23D 1ZA6B 2WYTA 3F62A 5IOPA 3CFKB 5FFOA 1GGBH 3QCUL 1NL0H 3GJEB 4C56D 3UGEA 3K81A 1UGNA 2X70A 3ECUA 3SN6N 3SDCC 1CB4A 3QARA 2UWEB 4V2CB 1FNGA 4LLQA 3V2AR 3VFVA 2BVQB 2EINB 1QATA 5E8PB 2FTAA 4FL4B 5JDJA 4BE5A 4K5LA 4AZUA 2JFCA 1QX1A 2A9AA 4EDWH 3IDNB 2EVJA 1I8LA 2FWOA 4ZS6C 3S7GA 3U48A 3ABMB 2XG5A 3MRQA 1RP8A 3TBTA 2GHWB 4KY2A 3ZT5A 2ZG2A 3ZRSA 5EO0B 5DRNA 3FUMA 4JFZL 4BH8A 1OAZH 4YHNB 5F9DC 3DRTB 2PW1B 4JFFB 4KJYA 4AIXA 1KNOB 2D9QB 3EYUL 4LSUL 5HHOB 1I85A 3LIZL 5CUSH 2J20A 2YFOA 1MJ8H 3KPQB 4FNUA 3JQOB 5CP7B 4R4NC 3DHPA 4Y1TA 5I8CA 4DGIL 2EUVA 1XZ0A 3ZDYE 4JB9L 3H3BC 1KBGL 4CL7A 2VLLA 3CVHA 3H55A 4H8WC 3TO4C 1O9WA 1E27B 2BNRB 2EVHA 2F8IA 1LQBC 3L3KB 4YXLL 4JDEB 2JJWA 3CN0A 1JPFA 3QA3B 3Q3GB 4UM8B 5H37H 4L1BA 5HSFA 3QFJA 4HP5A 1QSVA 4ZT1A 4KI5D 4Y4HA 4OJCA 5KS9A 4KY1L 1YPZB 3OQRA 3CU1A 2ATPB 5FCUH 2KYIA 3NEOA 5JDSA 2ZCHL 1FYTE 1JV2B 3LN4B 3MLXH 3OHXB 4CADA 3KGUA 3VXUE 1H6EA 3K71A 3TN0A 4B7LA 1QNZH 1GS7A 3CSTA 3LKQA 3WXWL 5A1AA 1JNLH 3CFBB 5SWZE 3KWUA 2YRZA 4QCIB 1UT1A 4IEFA 1ET8A 2GTZB 1MRCL 4K23H 4BXVA 3RWCB 4XP4H 1X5IA 3D08A 3FQUB 3BH9A 4J27A 2IOIA 4Y9CA 5DUBB 3BKMH 3L7EB 2XWTA 3TASA 1Y0LA 2Z3FA 5IFJA 1JI2A 2VJ8A 5T3ZH 4M7LL 3L4YA 3CN1A 3V0VA 1ZHNB 1BECA 4I85A 4NT6B 5I66B 1BWMA 3PNRB 3WD5L 3GXDA 3Q8BA 2APFA 2BS71 2JI3A 5IVZA 5BCAA 4J4PA 4OUUA 2IAMD 2BIQA 4ZXBD 1RJCA 1O7DE 2GIYA 5LGYA 5G55A 2RMNA 5FECB 3WTTA 1ZLEA 1AY1L 3RHWF 3HE7D 3L7FB 1DN0B 4JDVB 1BF5A 1OV8A 2ZTBA 3MGTA 5FF6B 1F90H 3TCLB 3UH8A 1INEH 1BZQK 4OGQC 2APWA 4XCYA 2P8MA 1N59A 3EJRA 1T83A 3G6AB 4XXDB 3MREB 4Y19D 2BS8A 2QZ5A 5E9DA 2ZCZA 4KQ3L 3EYOB 2IANB 4B5ZA 1WWAX 3MLUL 4FFYL 4HOZA 4OCYL 2XN9D 2JELL 2WBJB 2BERA 2YSSA 3W38A 5GGRB 4LZKA 1YEEH 2R51A 2Y69B 4TV3A 3IN0A 1M3IA 3WLWC 5CZVL 5CZRA 1TTGA 2WNKA 1N9PA 4NRZA 1ECZA 2Z34A 1WFMA 2OMNA 2DIJA 2SODB 2CDFA 3IPEA 4UT6A 4LLVA 3I2CH 2H0JA 3W9EB 1PZ3A 1JHTA 3FT3A 3PWVB 1Y07A 4WLCA 5KN5A 1UXSB 2DMBA 3NSJA 5J8OA 3BE1H 4PJDF 1PD0A 3ZKMC 4C4BA 1Z32X 2ZF8A 5BV7H 1MLCB 2VDKB 4ACTA 3X1FA 1RUQL 1A02N 4GO9A 2WGXA 2XV3A 3FHQA 4RNRA 4WJKB 5ILTL 1OGSA 1T5WB 1PJ9A 4W9KC 4PRDB 3QWOA 1MFMA 1JGDB 3KPNB 5AVVB 3OMNB 4FA8A 2BHYA 2FIKB 2C4FU 1CDUA 1E67A 1NBZA 2ITDB 3JTSB 4GAJH 4Z7QF 4AEIL 5HHQB 5IJKA 1IX2A 4K3DH 5C0DA 1VPOL 2AK4B 4TN9A 5FKPA 1JFHA 4DP4X 1R3KB 4EN3D 4FFWC 2X9ZA 3D3VA 3ZK0A 1K72A 3MMEA 2BSED 2YA2A 2ILLA 4U1JB 5LXGH 3FAWA 3MRFB 3BAWA 1ND0A 4HWEL 1QVOA 1TLMA 1JERA 4HXBL 1AHWB 1NIBA 3MV8A 2FYVA 4NI3A 3VI3F 3ZSTA 5IMKA 3ARQA 3DI3B 1E4HA 3BUBA 3DK2A 3FU7A 4KDVA 5DA0B 1ZS8A 2C1PB 1BD2D 3REVB 4UI2A 1FFOB 2Y23A 1C8PA 2G2NA 1UC6A 3R0NA 4NHUA 1XIWA 4TOYH 1J9TA 1IFRA 2EDDA 3QNFA 1U3HA 5EIVA 3FU6A 3L9BA 5DZOA 2YAFA 4WF7A 3GMNB 2BY1A 3V5DA 4ES8A 1VFMA 3WN5C 3MBXH 4HSAC 5GS0C 3EIFA 3KGRA 2WW8A 3BDYL 3QORA 4NJ9L 3VXMB 2CIKA 2UUDH 4XNMA 4CSPA 1CD1A 4X6EB 1DQMH 1ZRUA 2WNGA 4XHJD 2XN0A 4I0PA 1FQ9C 3GMPB 1A6TA 3PIQB 4BSWA 1Q9LB 4IJTA 4KZCA 3SIKA 1CUOA 4IBTA 5EZLB 5SX5H 2VDPL 1URIA 3LSOA 2AP2A 5DWUH 3UIYA 4J5VA 3MZTA 5DURB 4HGWB 3QCVL 3ZTEA 3QXAA 4LF3B 1A3LH 3LB6C 3O45A 2DI8A 1A6AB 2CA3A 3RIAF 5I1AB 4L9LB 2GSMB 2DM2A 1QG3A 2WLZA 3L5XH 3MTXA 4HK0B 3Q06A 4LEBA 1SLXA 4OT1H 5AB1A 1ORSA 1ORQA 5SWZD 4PPTA 1PSKL 1NFDB 1CD9B 2WXNA 2UYLA 2MCMA 2YEZB 5AOZA 5BRQA 1Z3GL 5E70A 3BESR 2J6EA 3BZEB 2DJUA 3RWEB 4ZPTA 2HFFA 2WQXA 3N9GH 4OZIF 3LN9A 1MCIA 1NUDA 4EI5C 5TFSL 5C70A 3S37L 5CKGA 2CUHA 5FO8A 3ATFA 3IDUA 5ISZB 3QI9A 5I19H 2VO5A 4OJAA 2ZX9A 1C5CL 2P24B 1H8OA 2ICWA 1KBKA 4JPQA 2CMRL 2QKIA 3UYOD 5C08A 2EEBA 5EOCL 3DTUB 2I9TB 3AUWB 3HNSH 1HXKA 4OCXL 3B2DC 2D2CC 3QJSB 3VMPA 2X4UB 5AAMA 3RDTC 5IHUL 3M1BA 2DTML 4Y16A 4IRJC 5DLML 4CJ0A 4QIRA 3OHXC 4JPVL 2NY2C 3AT9A 4J3BA 1ITCA 3VFPB 4F3FA 2ZJSH 2UZPA 1F58H 1CFQB 1D5MA 3AC0A 4HCGA 1UCBH 4IM8A 4F9PA 4ZMZA 1QLEL 1XL4A 4OGAC 2VLKE 2NZ9D 5F7KC 3TYGH 5T1KB 3K2MC 3LOWA 5TGBB 2WZAA 2ZOWA 3CHRA 5I9QC 1PY4A 1N5AA 2HN7B 5EV7A 3OJMB 4LHUG 1BREA 2Q8BH 2J72A 2NYKA 1F0LA 2ZOTA 2ICEB 4X9FA 5I1EH 1CFTB 1B0GB 3CG8A 4KI5F 4RDBA 4X0KA 2W65A 4GSDH 5FKAA 3RL2B 1ZLVH 1BQUA 1YN6B 3SGEI 1AGEB 4F9LC 2WYHA 3T0DA 1RIUH 2AJYH 3HE6A 2IH1B 4MAUL 4X6CA 4P2AA 4BZ2A 1TQTA 4U33A 5FLUA 3UCQA 1AANA 1D5BA 1WD9A 4P5SA 1F11A 2F74A 5G2NA 4JL1A 3S96B 2Y2TA 4BSVA 4GKOA 1TYEB 4ZW8A 3H2WA 4I3SH 1HE7A 1NDMB 4GBXC 1PG7L 5IVXF 1RIVH 1INDL 5A2LH 1O6SA 3SPGA 3O4LE 5DI8B 5DJ8B 4MJIA 1I8IA 2RCSH 3V0FA 1RVFH 3R06B 4RMSA 5D7IF 4UAOC 1R3JB 2C9XA 4YZWA 1U8KB 1B6UA 1HAUA 3QIBA 4OLXL 3EYFA 4U6XA 2E7LA 3W39A 5LHDA 3GI8H 4UBDC 1CR9L 4PTTB 4Q52A 1HH9A 3PWNB 3IF1A 5F7AA 1MI5B 3AB0C 1WZAA 4PBXA 5ICYB 2NYYD 4WK2B 2X1OA 3QULB 3WFBL 4WSGA 3R4RA 4L37B 5ALBH 2ESVA 5D1ZD 1WP6A 5GS1B 1WAPA 2VDNL 2P8LB 2VC2L 2OMVB 3L3IB 5PAZA 1A7RH 5AYTA 1MELA 5E5RB 4QRAA 1MHCB 2ZKHH 3CPLA 1BZOA 4K8RD 4U0RB 2BCKA 5DZVA 3RNQA 5AG8A 5B38B 5KVGH 1H5BC 5F7NC 2ZOKB 5EWIH 3D85B 2VXSH 4E36A 5D7LD 1SJEA 4DQOL 5JNYA 5I74B 3DDFA 4LL1A 3FTZA 4OGXH 5IBTL 4XZUA 1FO0L 3A21A 4EZJA 4K9JA 2FRGP 1D6VL 1FZJB 1KTCA 1JZ2A 1QFOA 3V5KB 1RZJC 4F20A 2MTPA 5I8EB 3U36A 3WLBA 5L7XH 4MMYB 4XP6H 4L48A 5DQJA 2OYMA 1KCSL 2LU4A 4NPYB 5ANMA 5CD3A 3SQBB 2DD8H 2TSAA 1QBBA 2E4TA 1JHKH 2WN3A 1F2XK 3L3DB 5FGBC 1D7DA 1ZCRA 3T6WA 4HS3B 3U83A 3UBGA 2X1WL 5JHBA 4X4KA 1V3KA 1UD4A 3S34H 4U1SA 4G7YH 1TMCB 2DKUA 4OIIL 2GABA 3TURA 5D2NB 5F0MB 1ZT4A 4ELMA 2Y07L 4FP8H 1KFAL 1LVEA 2AQNA 3L8QA 1SJXA 3GLAA 4Z0XA 2A9NH 3T04D 1TVHB 3H85A 4HAKA 1VHPA 3CFNA 4ZMYA 2DOCA 4QNPE 1JNNH 3TBYB 4ZFGH 1MRFH 4W4OC 2E7CA 5DYOA 1IM9B 1JUFB 3VXQB 5FOBB 1WT5A 1LWRA 4L9LC 3WTXA 1IFHL 2YQ3A 3H6AA 4FCHA 1N6QL 1RJZA 1A66A 1URZA 1MWAA 5EZJA 3K6IA 4P5KB 4DVRL 4XPBL 3U1SH 1HHIA 2VXVL 2O72A 3A5VA 4OB5H 2H0FA 4RGOH 1JZ4A 1WUZA 2JKXA 3BXNB 4WFHE 4Y1AD 2DMGA 4HFWB 3QNZA 1ONQA 3JV0A 2PO6B 2OI9B 3L9RA 3I9AA 3TO2B 2DQDH 4PRPD 1SHSA 2AEPH 2XKSA 4IU3A 1OY3B 3SPIA 2NT1A 2WVTA 3WJMA 3CFTA 4DJMA 4F7EB 4ELKB 1TOXA 5I1JH 5DZAA 3BKYH 5DHVH 3VH8A 4ODWA 3L48A 3TPUB 3Q43A 3J8F7 4DPRA 4NZJA 3PV7A 1E9QB 4RGND 4YFEA 3FFDB 3KPOA 4PGJA 4P46C 3C5ZD 3MU3A 1KIUB 1IC4H 1QLRB 4GRWE 3JV4A 4UCFA 3NACH 5HYQB 3I6SA 3L3GB 4TQEL 3UAJD 2B3RA 5A7BA 3BQUD 1XB6A 1HL5A 1OGAA 1SXBA 2CKBA 3SPVA 4DOHE 2ZP9A 2WSPA 3BZDA 4OI8A 3D5OF 1PAMA 1ZWIB 3KLDA 3SYQA 4E41E 2WOBA 5T3XL 2KKQA 2GG1A 5JHAA 1S3RA 2XKNA 4PJDA 5LG1A 4IKLA 4E42A 4LCCA 4QXGH 4ZFOA 2ICEC 4UQ2B 2NR6D 1VFOA 5KZCD 1HHKA 2B2XH 1MF2H 1P4BH 4OLWH 3BFWA 2GJRA 2QQKH 3DJ9A 3GXNA 4MMZA 5LLIC 2HTLD 2BX5A 1OTTC 2XOTA 3FQ4A 1YUHB 4JHWH 4KXZH 1OAQL 4GSQA 5I8OH 3FRUB 4L0ZA 1IGIL 1TZOA 3RL1B 4HX1A 4HC1A 4AGOA 5GRUH 4Y5VA 3P73B 5C2UB 3BAEH 3NSYA 1HDMA 2F19H 3VCLB 4HWBH 1S8DB 4HGKC 4KU1A 1TCRB 3MLRL 3IAQA 2NNCA 1LO3H 3MROB 2VMCA 3DI2B 4P9HC 4U1MB 4WGKA 1EGJA 4OD1L 4B6ZA 3BI9X 1F56A 3D2UA 1KYDA 4HIEA 5EBGA 1FL5B 1MFBH 3B2UD 4PRNA 4AYFB 4PRIB 5F21B 5HYJE 1IBGL 2IBGA 4Y88A 4LCUB 4P2OB 1UOKA 4FQXA 1XGUB 1X4ZA 2EKSA 4N26A 3D25B 3T0WA 4YR6B 2C7UA 1NBQA 1MCCA 3GT6A 3F5WA 3CN2A 3FH8A 2PCFA 1WF5A 3AXLB 3HG2A 3X11B 4LCWD 4XVOA 1QQDB 4N2IA 3GGWB 5J1SC 3BOVA 4TULL 4L3CA 5J12C 4XT1C 3IJ8A 5FYLH 4KKZA 5B39A 2UVFA 3U7AA 1KCVL 2YMTA 4Y2DB 2FUQA 1NH6A 1U3NA 3MV8E 5GS1C 2B59B 3MV9E 1N19A 3P3RA 5JR1H 3NH7H 4CN4A 3SQOH 4AT6A 3GXUB 2AJSL 2QSVA 2N7AA 2VDPB 4GKSA 1Z3RA 1XGQB 3L81A 1KGIA 3BT2H 2LW3A 3EBHA 5D1XA 1ILUA 5GGUA 2ICWJ 3DVGB 3NA4A 3MUY1 3U7YL 4TSAL 3X3GL 3LV3A 4ONFH 1NC4B 4F8OA 3BWAA 1R24B 3MFFB 1U8CA 3AWEA 1DR9A 2W59A 1U8LA 3IJSB 1CDYA 2H2SC 5E4OA 1LD9A 2VISB 3MLYL 1YNLL 5DK0B 5C3LD 1Z9LA 3CMOL 4KQ0A 2CHNA 1BXVA 2JJUA 3V0EA 2BSTB 5EU4A 2FEEL 4TQ8A 4BEIA 1OSEA 4KZEH 1EEQA 4H5SB 1JK9A 5EZPA 1B4JL 1AZNA 2O30A 5AD0B 4PS4L 4U4IA 3TBWB 1GOHA 1UD2A 2VDRL 4IBZA 5E6SB 4FXKA 1ZLSL 5IWLC 2NW3B 2H1LM 5C9JA 3E3QE 4C56A 4YXKL 5GXBB 1I3RB 5IKCB 1OAYL 4Q4EA 4E68A 4WFHD 1SYVB 5FO9A 2WXMA 3UZEA 1X5YA 2VAJA 4P48A 4PHZA 2ZCLH 3WKMH 4D2NA 3MVSA 4M8QA 2YPLA 5KOMC 2Q2EB 3C60B 4FMVA 1RZKC 4HPYH 3IMTA 2J44A 3FT0A 2XWCA 4R6UA 2HLEB 1KCUH 3V9FA 2ZX8A 3K91A 4PLOB 2H3XC 1NLBL 1CGSH 2EE3A 4WTZG 5A2IH 1RUAL 3ARUA 1Z5LB 3AXHA 1AQ8A 5GHWL 1ID5I 1Q9OB 2DDQL 1XGZA 5D2LF 3X3FL 4DTGH 1XGPA 3QYCA 1FFNB 2IFFH 2CDEA 1CDHA 3FCSB 4MCNA 4QKXB 5EIIB 5KSUA 1PZ5B 1QLEB 4A2EA 1QFWL 2PLTA 3BZ4A 3MO1A 5CBEA 4XBPB 4ABQA 1YJDH 2MOVA 1OB1A 2Z65C 4TM9A 3T8VA 2L7QA 1JFQL 1OSYA 5EBLA 1Z9PA 1P5UB 1AI1H 2FAUA 1VIWA 4E41D 1MVUA 4QRRD 4RRPG 5JOEA 1JG9A 2ZX5A 3GMLB 1A0QH 3GHBH 1X7QB 5D96B 2F7RA 1IZKA 3HS0A 3ES6B 2PO6C 2OI9C 5I5IA 3CC5A 4UOW1 2ZP0T 4TNWK 5CNHA 3CLFH 1CLCA 4BCXA 2R7EA 1E40A 5C8JB 4HXAH 4FXGB 1SF5A 1YMME 3WY2A 4OLVL 3I3DA 3UG3A 3UTTB 3TJEH 3BKCH 2ZIDA 1TZAA 3FT4A 2R2CA 3IDIA 4P3CL 3VGBA 3WNKA 4JRYE 1SZNA 2VXTL 2A99A 3WJLC 5IVXA 1MEXH 4H0LC 2DQTL 4CC0A 2ETWA 4PJBB 1UWXK 1KJ3L 2IMMA 5JPMC 4Y5YA 1SOXA 5D7IA 4WW2F 2V5TA 3LKNA 2V2XB 3IXAA 3MV7B 3HCVA 2Q1EA 1KIPB 1W0VB 3NFPA 4KRPD 5E6UB 1QFHA 3QUZD 3BKJH 1DVFC 1Y6KR 4XI5D 4NLAA 4YDMA 4G71B 2WTPA 4G9FB 2QL1A 5IGXL 5FYKU 4Y19A 4GKNB 4MYPA 5IIEB 1I3GH 1BAGA 3Q6GL 4LOFA 1IQWH 2I7OA 1FH2A 1IBBA 4JUTA 1LHZA 3DURB 5HDLA 4I88A 3NA9H 4TVUA 1EUTA 2RB8A 4JR9L 1G7JA 3TIDA 2GC4C 2XN9A 5D70H 1X5MA 1O6TA 1HHHA 4LIQH 1SLUA 1TSHA 3D48R 3QH3A 5CEZE 2VDNB 2YC1B 4N0FA 4ZX3A 5K5YA 4JFQB 2I9LB 2YPKA 2ADIA 1TT6A 3P9MB 3Q8EA 3IMUA 2Y5EA 5FYKD 3MUUA 3ESMA 4X7TB 1NCAL 4XPHL 4N2MA 1Q0EA 4OUOA 3MV9D 3NIGB 4IIQA 4F37F 1FFPB 1OD7A 2EC9U 2WSKA 1DZBA 1NPUA 3T3PF 4LHQB 1BHGA 2OQJB 1EMTL 3CDFA 1DLFL 2VERN 4JM0A 4DZ8B 4LVHB 3HI1A 4HHAA 4X98B 2VQTA 1N6VA 2GTWA 1IILE 5BXFA 4WAFA 3FRPG 4RFEA 4APQC 1FO0B 3BN9C 4F57L 5E2VL 4EEEA 4G6JL 1QAWA 2OMYB 3KJ6L 4ZZKA 3HPJA 3SY0A 1HXYA 1LO0L 1G9NL 3D9AH 4UILH 5KVFH 2B5IB 3UBHA 2KC0A 2ALWA 3S5ZA 3ZPDA 1K85A 1U4EA 2YZ1A 4Z7NF 2DQFA 5IB4B 1N8OE 5DVOA 4U0QB 43C9A 3ZVVA 1MCQA 4N24A 2W60B 1KOAA 2D7MA 1UJ3A 3HHSB 3E2HB 3LKRB 3S3CB 4O2CA 4KROD 4WWOA 2J8UB 3DC0A 5AEAA 1JZFA 3HNVL 5L6YL 2H47C 2BSEA 1UASA 2ED6A 3Q9QA 3A4DA 4HT1L 5B4MD 3RB7A 1RZGA 4KKAD 2DICA 3JVFC 5ID1A 3P4NB 4HIXH 3P4OA 4ODVH 2A83B 2VSMB 2XY2A 2F7PA 2JTYA 2W0LA 4JAMA 1S78D 3DETD 1DDTA 1YUKB 3A67H 1T7VA 5HGDA 4G7RB 1PGRB 3IDXL 3FB6B 2LFEA 4IHBA 4EIZC 1BJ1H 1BD2A 3CQQA 1N0LA 3HB3D 3VU1A 2SEBB 2O6CA 2V2WB 3DPDA 3Q6FB 3OKEB 5F6IC 4P2RB 1PD1A 1K4CA 4F15C 4JDZA 4MZ3A 1U8HB 2RTTA 2EDHA 4NKOA 3B37A 2IF7A 4BA0A 3J27A 4KTGA 2FGZA 3DRQB 3Q5TA 1AYOA 1TENA 3GMMA 1EWHA 4AG4L 5IMLB 3ZT6A 2DAVA 1OGTA 3ARFC 2GUOA 2XN1A 2JV6A 1PF3A 3ZDZB 1A14L 1ET5A 3FFOA 3PDGA 1XX9C 4LXFA 4P4KB 5J11B 3GB7A 1Z9MA 4XB7A 2PTTB 4D0CB 3ARBA 4Y4FC 3T3ME 1RZ8B 3ZKXC 1FORH 4KVPA 5H37A 4MVBD 4HWNA 2CLZB 3SD2A 3QJUB 5F1KC 1DBAH 4NQDD 2ADJB 1SDYA 4IRZH 5A2FA 2ARWA 2XZAL 1ZGLM 2H8PA 3CX5K 3ZE0B 5J1AB 4KK8D 2EO7A 3IJYA 2ADYA 1VADB 2XZQL 4KJQD 1J5DA 1GGCL 3R0MA 2E8ZA 4TLTA 5IV2A 1IBHA 1RD6A 3FSOA 5SX4H 2X38A 4QHMA 4F7PB 5KYWA 1HZLA 4WI8A 3KPMB 3ZL1A 4LSSL 3TWYA 1S3KL 1LL1A 2EXWC 2F2HA 4JRYD 4XAWL 4XO9A 1ETZB 1XCXA 2DEYX 4G6FD 1QR4A 3NABH 4AQ1A 4JO4L 2YGVA 4DWHA 1FRGH 1OCZB 2VN4A 3RGVB 3C6SA 3S0PA 2HJKA 3LHAA 4LQ1A 4WKXA 1PVHA 1VSCA 1BVKA 2HJFA 3IDJA 4PTUB 1XT5A 4TVPE 2ZNWA 2OA9A 4UV4L 3WUWB 4HW6A 4JANA 1TITA 5KW9L 3QXDB 3QUMH 4FYQA 4XVSH 5AW4B 3K6DA 5E24E 3OV6A 4UT7L 4WEEA 4ZFQA 4B0MB 2JJVA 2WK2A 3BIBX 4DQAA 5D96C 3GMQA 2HJLB 3TBBA 3SZKC 1IAKA 2HMID 3HMWH 3FCTB 5HGBB 1A5FH 2XXMB 2VZUA 4GP8B 1A3RL 3NCEB 4M7KL 3PDDA 1GR7A 4Z3GA 2R69H 4FXGC 3TNMA 1A1NA 5JW4R 5DHYB 3CUPB 1OGAE 4G3YL 1WGOA 4GRWF 2N1TE 1A6VL 4S11A 4JJHA 2P80A 5EZOH 2JJTC 4L8DB 3B2PA 1BFOA 2X4SB 3QZWG 4UNVA 2EKJA 2ZWKA 4K7PH 2XTJE 3LJ3A 1SDDB 1CCZA 3A3YB 1EH9A 1DO5A 1T3FA 4HU2A 5IK3B 4PLKD 2FBRA 3MXWH 2KBGA 4ZUUB 3RJQB 3T65B 2IPUK 1E5YA 1JZJA 2CO4A 2HTKD 3O81A 4NQEB 1JZ6A 1F4YL 4L5FH 3MRNB 5FYJH 2V5SA 5IF0A 4YL4A 4ZBJA 1RFDL 5C0FA 3AQYA 3MJ8B 1XH3B 3QNYB 1KGCE 4LLDA 4XMLH 4YHYB 1U93A 4QXTA 1I8KA 1N3NB 3C6LC 3N0AA 3T0EC 3U2IA 1CQYA 4NEHB 3MYZA 2VLJE 2AJ3B 5C0NC 4G1EA 2EXSA 3V0WL 3AVEA 3W81A 4M7ZB 3S98A 2DMCA 2Z91A 4FQCH 4K7FB 4DO6A 4MYWB 1JRHH 2YRBA 4NZTL 1CU4L 3PL6B 5ABAA 2PPCA 5TPWH 2Z31B 3S3DB 5JHLL 3DX8B 5HHNA 1B3JA 1BZ7B 1FV1B 4FCAA 5CEXB 3C08H 3FT2A 2R0WH 3SDCD 4LDOB 2ARJA 2B14A 2P5WE 1L7IH 25C8L 5DJZA 5HVWA 1DLHA 2XSKA 4JKLA 1X4YA 1ML0A 4CJ1A 3QEQB 2DPKA 4M29A 2WAHA 4LVHC 4ZS6D 2YD1A 3IFOA 4XMKL 5EIQA 3BEWA 5DSCB 4BZ1H 3PP4H 5AW9B 1KPRB 3FQNA 1NGQH 3SKNB 2VOTA 1BCIA 5CSZA 1N4XL 2IPKA 4FI7A 2E8YA 1ODAA 2AGJL 1QO3B 3AS2A 2B5IC 5D1ZA 1PL3A 2BMKA 4N0UA 2QBWA 5EUOE 3GKWL 4PRHA 1DANU 4R4ND 4G43B 4TLKA 2JCCB 3IEAA 3E2HC 3NP4A 4TRPL 5F44A 4IBWA 1NEZA 1IEBA 1P7KB 1DQIA 4P5MA 4C58B 3TO4D 3EO9L 4G7VL 3UYPA 3NIFB 1AGFB 2P7TA 4LCYA 5KVEL 5DXWA 1TZGL 1WVZA 1DBKH 5J56B 4M7LT 4MNQA 3CSPA 5FPIA 3UJTH 2XYBA 3GQFA 4JY6A 5D7LA 3W9DB 2JF1A 2ENJA 2CR0A 2APVA 5HHXL 3DO4A 5J6SA 3MOQA 3KG5A 4I1PA 5JO5A 5GZNC 2WZPD 3WGVB 3BMVA 5GSRB 3QGVA 3NCBB 4XPTH 3VX1A 2XWXA 1YNKL 1D5XB 3VWJB 1NIEA 1CL7L 2CCWA 3FFCE 3F7VB 1IGCH 5F96L 5G4NA 3RPIA 3U82B 1UZ8A 2WXOA 3OJVC 4DP6X 3UAEA 3GSXB 5C6TL 5DRWA 3HZKB 5LBSH 3RX9A 4P57A 4PLJC 3MFGB 3AROA 5HD8C 2J43A 3GIVB 3W5NA 2V33A 4QOKB 1KXVC 2BOCA 3APCA 2ICES 1XF5A 2D2OA 3TONA 3DMMC 4KHTL 4OQTH 4F1ZA 1KBPA 4P4KC 3TFBA 1RAMA 3F64A 5BOZG 4JZNA 4NZRH 4G83A 4QHKJ 4OLYL 4G8GB 3V9EA 2HLAB 4URTB 1F6AB 3O6KH 5D71L 1WISA 3TNNA 3ZO0A 1PLCA 3IS1X 5F7HA 2L4OA 4DUXA 1A7PH 1NAMA 1TQWA 3KEHA 3BUDA 4U6HB 2R56H 2MKWA 5HGAB 4MTMA 4W9HC 4ZFFA 4TUOA 1T21B 4GRMB 1IKOP 4UOJA 3MJ9L 3OGCB 3RVTC 2W9DL 5JPNC 4JY5L 5EFIA 1QRNB 3WE1A 1IAIH 4PBDA 3WLWD 1OCWH 3ZHNA 4PRBA 3FTWA 3QIWB 4TPRH 4WNQA 2Y5QA 3CSBA 3PWLB 4WW2A 3RY4A 1VAHA 3IU4H 2CLRB 5KSVA 4PRPA 2FX8H 4UTAL 3DUSB 2XVBA 3QWQB 2HAZA 4LEOB 4G80A 5I26A 3O8XC 3DPBB 1G7MA 3VTAA 1YDPA 2NUPB 4HH9B 3ZKMD 4ODUA 2B1HH 2WB1A 1YMHA 5LKNA 4UNUA 1A9BB 2ZG3A 2E7BA 3QAZC 5KVDL 1BOGA 3UTZA 1HK6A 3ZKSD 1YN7A 2Q8AH 5CHNB 3B9KB 5J13B 4XO3A 4G8EB 2V9QA 3C5ZA 1UG9A 2J6EL 4FJZA 2AQ3A 3BP7B 4MJJA 5FFLA 3SEPA 2RQ8A 1NBYA 1P7QD 4QRTA 1ICTA 4AYGA 3IMWA 3NFNA 5IR1A 3UAJA 1S9VA 4PSPA 4IBUA 2R1XB 1WSST 4E5XA 5CJQL 1PQZA 3BQUA 2H6PA 4NDMB 2BY3A 4FFWD 4HKBA 1J9SA 1J5IA 3BLBA 3KLKA 1DDHB 3O3UN 5EOQH 5DJXA 5C7XH 1ZA3A 5T5NF 2E9JA 2E86A 3RURA 2UVEA 3Q2NA 5GPRA 3UMNA 1L9MA 3DV6A 4X5XA 1E8ZA 4LSTH 3P40A 1FVCB 1RKRA 2NR6A 2CK0L 2HB0A 3KMDA 1R5IB 3LZLA 5I6NA 4UM9A 3ULUC 4O00A 3KBFA 4N22A 4KAQH 1JGUH 1AO7D 2NXZC 5DUJA 2HUEA 4XN8A 5KWYC 3MJWA 4AH2A 2VDKH 4WHTA 2J88L 2A9MH 4LLMA 2WXQA 1XEUA 5ESAB 2IALB 3DXAB 1AG0A 2NY1B 2N0KA 2YD0A 4NO5A 4JM4H 2P28B 1WLHA 4XB3A 4KUZH 4JO2H 4JFVA 3KYMA 2WXKA 2OS7A 1TLKA 3LZRA 5DJYB 1J8SA 3NQKA 1H6UA 5I0WA 4M7ZC 3RX8A 5GS0D 4ODSL 3DROB 3FTXA 1MOEA 1HI6A 4YBLB 3RBSA 4YJZL 1IGFL 4PBWD 5I1LB 1HWGB 3PL6C 1GYVA 1IGML 1LP9B 4XAKD 5F1SA 5B1BB 3VM5A 1XB8A 2A6KB 3IRCA 1W9XA 3MNVB 3O3DA 3NBNA 1IC1A 4MDJB 5BUAA 1TQSA 4HZLB 2Z8SA 2AQ1A 4Y2LA 2RAMA 2O6PA 1MAML 3LB6D 3K2KA 2G3XA 2C7FA 4Q0XH 5K1VA 1FF5A 1MJ7H 4X80L 3VXSB 3QBTB 3NCMA 2HFGL 3BRFA 1AIFA 4JG0H 1TR7A 5D5ME 5E2TL 2EZ0C 4H8HA 4FKHA 4HHGA 1T7XA 2FX9L 5FHBH 1WAAE 5HHOD 3GC3A 3QEUA 1T2QH 4ZMTA 4MD5A 1W80A 3WHE1 5SWQA 1XD1A 1SJHA 4LCIH 2G2PA 4GB9A 4EI5D 1QPKA 2OXGA 1ES0A 3FSZA 4P5TA 3BW9B 3BSGA 3FTYA 3IJ9A 5AW8B 4JFEB 2V3FA 2F5AL 3KL0A 5JW3H 4Y5XB 3H3PH 3E9TA 4NENA 5E23A 3O9WB 4G72B 3QAQA 4PG9A 3H42H 2I69A 4YE4H 1MCSA 1H3WM 1T22A 2VUOA 4QXUL 4TSCL 4WU7A 4ZUSA 3MNWB 4BHUI 3STLA 3RDTD 1XF3B 1THCA 1IGYA 4KH2A 4HV8A 4IRJD 1ZSDB 2BHUA 5FO7B 5DRZA 2NY2D 4NQQA 2VZTA 4MQXC 2X70B 4XH2A 4G2AA 3EOBB 3O3AB 3P9LA 4P2QD 2WM0A 1JWMB 1J7VR 4GLRI 1FNGB 3A24A 4G5ZH 1G1KA 2K6WA 4CN1A 4Z3TA 4OGAD 1NWPA 5A2JH 4OF3A 4P8QA 2CRYA 5CILH 1WIOA 4XNXH 2BNQE 5TK4A 2HH0L 1BXUA 5FUCC 3MRRA 4DGVH 2XIBA 4NP4H 3WIAA 2YRPA 4L4VE 3MRQB 1S7WB 2GI7A 5E5UB 1G1OA 5E4IA 4H8QA 3WEXA 2EYRA 4OZHE 2FD6L 3NJXA 5KBPA 3BYTA 4L3FA 1FYHB 4D0BA 3X2QB 4KJYB 5GRXG 4IRSC 3RWHA 1MIML 4DGUA 1RCYA 2FECL 2FO8A 1U8PB 1FNSH 2OMWB 2OP4H 5DMKB 1GTFA 4HYTB 2R1YB 5DMIL 4E2OA 2YHGA 1HNGA 5K39B 5I1DA 4Z23A 1P4LA 3TVMB 4OZ4B 3O2VH 4WVRA 1LEGB 4GBXD 1TVBA 2XWBB 2YARA 4BH7A 1HXMA 4L8BA 2FQGA 1BM3L 5CU5A 2Q7NA 5E2UH 1D3CA 4QRRA 4OJFH 5JDSB 1HKFA 1MZYA 2XVKA 3CFEA 5BS0E 2BP8A 1M6OA 3D05A 4MHHG 3OBAA 4X5WB 1R3IL 3PHAA 4MDRA 4N8VA 5H8DA 3LRSB 3WCYA 5DGQA 2Q3XA 4PJCE 4B3EA 4BINA 1E4XL 1T0OA 4UBDD 1AZCA 2OW6A 3WY1A 5FWRA 2XC8A 1RERA 3IFPA 1I9RH 3ZYIA 4PJFA 1WS8A 3A22A 3V0VB 5IMOA 3NAAH 2ZWZA 3V4PL 4YHIB 3B9KC 1T7YA 1JYWA 4HJJL 2IAAC 1FN4B 1LK2A 1THAA 3CCHA 3MJ7A 3PWUB 4EOWL 3UJIL 3L5WB 4HWBA 1XF2B 4O58H 1CE1L 3W2DL 1MFNA 5J6HB 1E8YA 4MA8L 4AENA 3C8HA 2AK4D 1GZPB 1LM8V 4P9HH 4WO4B 4CVXA 1FNLA 4K2UH 5JW5A 4BWWA 1N59B 3B4NA 4NXSA 5E9DB 1BYOA 2HRLA 3R19A 1MHEB 3SGKC 3IK2A 2ZQKA 3RNKA 6PAZA 4PJ8B 3JVGA 3BIAX 4R4BA 3FB7A 5I82A 3U9UB 5E99H 1P2CB 4PWFA 4RGMC 1JZ7A 4FQLH 3BVNB 5GSVA 1OP5H 4WHYH 4Z7UE 1K2DA 2Q7YA 2R27A 2CHZA 4HEME 4MJ5B 4GQPH 4MXWH 1UGKA 4PFEA 5JYMA 3C5SB 4LLVB 2NY1C 1JHTB 3MGOB 5LNDA 4OZGF 3PYCA 2NQDA 3I6KA 3AAZA 3II3A 3QCUH 5GGTL 4YBLC 2DEXX 4ZFOL 3T0AA 3UTQA 3VXNB 3V55A 1J8RA 2C9VA 4NQCB 4R2GB 3E6FB 3M88A 1MFDL 4I77L 2J2ZA 1TTCA 3L4TA 2F5BL 4V2BA 3H9YA 1AD0A 1JI1A 2YXWA 4FQJL 2EDYA 1EZVY 4YGVB 5D7HA 2G3NA 1AGBA 1TYRA 2KUTA 4X6FA 1NBZB 2AXGA 3KLHC 1QP1A 5TQ0L 1JXJA 5L4IA 4HC1L 4JFZH 3MR9B 2HXAA 1I9JL 1LWHA 4JPWL 3N1MC 3EYUH 4LSUH 2CGYA 2X0VA 5F97E 3LIZH 1RJLB 3H4FA 3AMLA 3PWPB 1TEYA 3G5YA 2CXGA 2FX7L 4J2QA 1AHKA 4I3GA 1H8NA 5J0BA 3N1QC 4DGIH 4UQ9A 4JB9H 3Q5YA 5IMKB 2BNQD 4PJGA 4HJUA 1GC1L 3SJVB 4BQBA 1HIML 1T6WA 1ZSHA 4JGMA 3V0HA 3ZUCA 4YXLH 3WNIA 1H6FA 1UCTA 5HBBA 2J5LB 1CXKA 1IKFL 4JFYB 3FULA 4NHUB 1BAWA 1KFGA 1XIWB 3GPSA 3A6CL 1F41A 3QDJE 3VD4A 2G0KA 1JZ8A 4UQDA 3TESA 4EF3A 2CU9A 1BDYA 2D7OA 4CBZA 5MEQA 3SB3A 4HFUL 3M6DA 1HSAA 3KPTA 4Y5XC 3BFOA 4NHCH 2MHAA 3O9WC 1TNMA 2ZCHH 1K9TA 5C0AA 3CVBA 5I71B 3FB8A 3ZHFA 4IJ3B 5KSBB 2JKTM 3IFLL 3FKUS 2VDLL 2Y5TA 3ARGB 5H35B 3WXWH 4P46D 1TKWA 4Z76A 4I0PB 3L2NA 3SPHA 1MRCH 2QJDA 3CVIL 3BPNB 4AYID 2Z9TA 3JUZA 2NSMA 3X1EA 1BPVA 4LPXA 2Z1KA 1BEYL 1H3PL 1NCCL 5CGTA 3DX7A 4U2ZA 2G60H 4JVUA 4WFGE 3I9IA 4KITB 1K8DB 5BS0D 3WD5H 2WLJA 4QTHA 5IEHA 3PGCA 1Q9WB 3FHEA 4NQDA 5DJ0A 4PS3A 1XSKA 5BW7C 1W72B 1ORSB 1U8NB 4KTYA 4MLIA 4FHKA 4FJ6A 4ZTEA 1A2YA 1AY1H 2QADC 2G3MA 5AW3B 4B96A 4E9WA 4KNSA 1GMEA 3RUGE 1DEEA 2LU5A 1DL7L 2WKLA 1T7WA 5KUMA 1MNUL 2ZYHA 1MFEL 4KQ3H 1MAKA 1OTTD 4ZPTB 2FZ3B 2HFFB 5CINH 1IAIM 2P1YA 1YQ2A 3HLAA 3WDHA 1BQ5A 3MLUH 1SMAA 3ECBA 3OXRA 4FFYH 4TVSa 4OCYH 3T5WA 2JELH 5HY9A 1VZHA 4H8PA 4B95C 5C9KA 1U95A 1RJYB 1M7DB 2D0FA 2FSEA 4N28A 4NB7A 1LO5A 4AJ0A 5C09A 3PCYA 1F1AA 2H26A 4ZW7A 1A22B 1X5KA 2B77A 4X5RA 4AZ8A 2X4TA 4NQUA 2Q76B 3TVMC 3QRGL 4K5PA 3VXOA 4DCQA 2X6CA 2DWXA 1K4DA 3WMQA 3H9SE 3HC3L 4PGBB 3M1BB 1L0PA 2FEDC 3ESPA 2QGEA 5EU6A 2WV3A 3HZMA 4H13C 1M1SA 2J55A 4KXCA 4LSQL 4XBEL 4Z8FL 1RUQH 2J8HA 3O41A 4LOEA 1D6EA 5ILTH 3DIFB 4XN1A 1DUYA 3G04B 1QBAA 3NZ8A 2Y3AA 3S5LG 5J9PA 1NLDL 4C8XA 1IU1A 3V0DA 3AM8C 2QPFA 4AEIH 2GJZA 4DKEL 4FA6A 3L9YA 3EH5B 3NZUA 2IXQA 1VPOH 4UQCA 1VZIA 3VI4E 5HDOA 4NBXB 1Q9KB 2YGQA 3TEYA 1G0YR 4GG6B 5LVEA 2X7LA 5B8CA 1NKRA 3UJJL 1S7RB 5D1QB 1S7XB 3FN0L 4ZYKA 4HWEH 2AKRA 3SKOA 4AQZA 3HE6B 4WO4C 3ZZ1A 4WWKA 1R34A 4HXBH 4X6CB 4AMKL 4EXKA 5K9OA 4Q9BA 4YSAA 1MCJA 5D6CB 1F11B 4PJEF 3CHSA 3GSOB 3I02A 4QUOA 2H2SD 1F5WA 4J3OH 3FB5A 3OHMB 4F7MA 3QZLA 5TH2A 4PJHF 3B56A 3PAZA 4PJ5E 4WKZB 2NX5E 3V9CA 1XWVA 3UYRL 4FNTA 1J0IA 1UA7A 4PJ8C 3H1ZA 3PPEA 2DIEA 3D6GA 3ALPA 4NBZB 3DDGA 4Z0BL 3RX5A 3DTDA 4CSSA 2W91A 1QUNB 3MX0B 1I8IB 4MJIB 4ZSOE 2FCBA 4DK6A 3KPRD 3NJIA 5KVGE 4OGYL 3BDYH 4NJ9H 2P5EE 3MRKA 4Y2OA 4LL4A 2EACA 3SDCA 3GMRA 1MCPL 3EBIA 3JT2A 3EYFB 5CP3H 2Z4TA 1OEZW 3NCYP 4PJAE 1I82A 2H3NA 2VDPH 3UGUA 3FUJA 3QCVH 4AY0A 2AXFA 4U31A 4HAGA 1Z9SA 1AQDB 3VQMA 1FFQA 3JXAA 5CEYA 1QHQA 5IREA 5B3NA 2VSDA 1NDGA 4NAMA 3WGUB 1UZGA 2X9WA 5DJCB 3RTQA 4JPSA 3VXPB 4LPUA 4Z6AT 5TE4L 1YYMH 5D5MF 2B20A 2JH2A 1TETL 2PF6A 1LMKA 3CDCA 4KO9A 5HDBF 5LG6A 3HUJE 5KSAB 1G9MC 2WINA 1PSKH 5H2BB 5HJGA 1XQ4A 2R23B 3UO8B 1NCIA 1AQMA 5IMMB 3CPLB 5F9AC 1WAAF 2XBZA 2OYPA 4X6DA 2PCPB 5AVSB 1Z3GH 2RACA 3H2QA 3MRPB 4PREA 3H7BA 1UD5A 4YHML 4JHAH 4RSVA 1GW0A 1HSBB 1UM5L 2EYTB 2CLVA 4JKKA 1EZVX 4P3DA 5TFSH 3UPRB 3S37H 1HILA 1DVTA 1PYWA 2D8KA 4G1MB 4GKZB 3PUUA 3G6JE 4FADA 4NNYB 1C5CH 2QDVA 4JFSA 4Z7WB 4IRZA 3KJ4C 2PO6D 2CMRH 3RIKA 3PQYD 4E9QA 5EOCH 2OTUB 3CD4A 5DQJB 1RLWA 2YLKA 4OCXH 2WZPA 1E30A 1LEIB 2A9DA 5DU7A 5C0EA 5IHUH 1LE9A 2CRMA 1S7TA 2DTMH 1PAZA 2IADB 1HX0A 5DLMH 1MNNA 4JPVH 4EJ1C 4IS6B 3NN8A 2ZOLA 2FT6A 1UYWH 3HRPA 4GUPB 4IJ3C 4BFNA 2M26A 4ZQTA 2DWEB 3H53A 5I18L 3BAJA 4GSRA 4J23A 3IXTA 1MHHB 1QLEH 5T1MB 1CE6A 4R97B 1PNDA 2EDXA 3U9PL 4NQSB 2WQVA 2MNJB 1MJJB 1ZT4B 5L4JA 2B15A 3FONA 4EMZA 3QQ4A 5F8RC 3K6SB 2AABL 1WZKA 4FDWA 5LGHL 2WP3O 4Z0XB 3BHBB 1MH5B 3GM8A 4OZHF 1F1GA 2C3WA 3QUMA 4UIKL 1EAOA 4DN3L 2OBGA 2XV6B 1DVFD 4AEFA 5DYOB 3AMKA 3K6OA 3SZ6A 4GKLA 3AADB 1GJIA 4UQAA 2VLRE 4WUUD 1CYWA 5EEZA 5EU3B 2MCPL 4MAUH 3GSWB 4UMGA 1K5NB 3V4PB 2R69A 3GRGA 3EH4B 2O61B 1YLBB 5DS2A 1T5XA 3QUYA 4I4WA 3QNZB 2DQUL 2WLIB 1JHLL 4G82A 3EJYC 1PG7H 5HVHC 5HVGB 3GI9L 4YO0A 5E8EA 2D3VA 4LCVA 3PNWA 1INDH 3WYRA 2WB7A 5DK2B 2HFEA 5I1IL 1EHLL 1JNHB 4M8VA 3SE3C 1X6LA 2EUZA 4JQXC 1KT2B 1M9SA 5CLZA 4PJIF 4POUB 4AQEA 3KPOB 1BBDL 2G9KA 2X6BA 4MCYB 3BN9D 4PHXA 4APQD 1P53A 2DY2A 4XO4A 4PJCF 4OLXH 3GZQA 4RAVA 2BHFA 2FHCA 3JV4B 4ODBD 2W0FB 1CLYL 4CC4C 1E90A 2NX5D 1CR9H 4U3XA 1OM3L 1P7QA 1LDSA 2F8OA 2PYEE 5GRZA 4QHNA 4LDCA 5C6WH 2A3TA 4GS7B 3WFBH 1G7LA 4Z7OB 1XTLA 3WJJA 1ZLWH 3VGFA 2Y9RT 2VDNH 3ATDA 4OZGA 5F93C 2P5ED 4JGNA 2VC2H 3WFHA 4LCCB 1JZIA 3BSZA 4ZFOB 4A2MA 4ORGB 4AEEA 2PABA 1HHKB 2V4LA 5A3IC 3M7FB 4GNKB 3PHQA 1XSIA 4ZUWB 1OARL 4MMZB 1VEOA 1IGTA 2X12A 4JE0A 5D4IA 5F7BA 4NUMA 4PD4J 4YFLI 4FJYA 1VDGA 1JXKA 3C6EA 4DQOH 4Z7QB 5IBTH 4HX1B 4BZ1A 1FO0H 5IJVA 2B3IA 4WZ9A 4X50A 4UB0H 3DX9B 1JDDA 1KTDB 3PAYA 4W9IC 1D6VH 3OLIA 1HDMB 1YO4A 4JY4A 3VD5A 3D4CA 1QLFA 2IH3A 3CWGA 4Z7UF 3SGDH 5IQMA 3EUDA 3QNXB 2A74A 1SM3L 1KCSH 4HIEB 2A73A 3OTTA 3VI3B 1RUPL 3BT0A 3N43F 1AGCA 3ARFD 1ZA6A 4EUPB 1X5JA 4GMSL 4G5AA 3SDXE 2Z4QA 2EKSB 1YAIA 3GJEA 4JO1L 1A6ZB 4Y4FD 5CAYB 1KJMB 1H3TA 4WENB 3NCXA 2ITEA 4X4XB 2D3NA 5D93C 3D07A 1YQVL 5E8PA 4OIIH 3WY3A 3Q0HA 4LRIC 2Y07H 4NO0B 3I6LE 1KFAH 4HUVA 5FDWB 3V52L 5CR8A 2K45A 2DLIA 1V3LA 1X5ZA 2CQVA 4GAJL 1P1ZB 4L8CA 2VDLB 4K3DL 1WCBB 4TS6A 4JFDE 5BVJB 3F01A 1KDIA 1XO8A 2PW1A 3TV3L 5DRXA 3UBXA 3ABLB 1KNOA 3V6ZB 4ZMAT 3LH8A 4JREB 5HHOA 2Y1YA 4PJGE 5J5EA 1AJ7L 1IFHH 1OB0A 1N6QH 2EXWD 4W9DC 3PAVA 1AC0A 5KSAC 4G8AC 5D1XB 4AQ1B 3HR5B 4S0SD 4DVRH 1K3ZA 4XPBH 2J5WA 2VXVH 1GSMA 5BRZB 5LGJA 4URKA 2XPYA 1U8LB 5HYSB 4PJ9C 5HHMD 1ZANL 5HDQL 5CJBA 1E27A 1LD9B 4KXZI 3L3KA 3WNJA 1U36A 4OQTA 4JDEA 3M17A 1L9SA 3QA3A 1HINL 3Q3GA 4UM8A 4TOYL 4RIRB 3QJFB 2K6YA 1GS8A 1JK9B 4QT5A 3NGBB 4IIZA 3CMGA 1I3UA 1G0DA 2WIMA 4ONHB 4P23B 3KGSA 2FEJA 1JV2A 3LN4A 3OHXA 1S9WB 4FXKB 4IKKA 4XNYL 1BJ8A 4OZIB 3ESOA 3LPOA 4P4RA 3E8UL 1NKOA 2JKNA 1WFTA 4FHBD 4J6RL 5D7KD 4F5CE 3D4GA 2XV2A 4P2QA 4W4NA 5FO9B 4U49A 4OU3A 4R4FL 3CFBA 4RX4D 3D39E 4K8RL 2GTZA 2QV2A 3NRFA 2JB6B 3RWCA 4M8QB 4IKNA 1TEGA 1T0NB 4FG6C 4TQEH 5DUBA 1WZMA 1RUKL 2XQ0A 3L7EA 3L3OC 3VFTB 1H8LA 3I6GB 4TLSA 3TYFA 4B9CA 1XAKA 3O6LL 4R97C 1ZHNA 4NT6A 3ZSSA 5T3XH 3FO2B 4PGDB 2WZ6A 5DA4A 1X3DA 2XQYG 3MV7D 5FECA 4PJXE 2HWZL 2O26U 4GQQA 3NSFA 3L7FA 5IBUG 1DN0A 3QUGA 4JDVA 3TCLA 3D0LB 5FF6A 3CZJA 5H94B 4HZ1A 2F61A 2QFRA 4G9FD 2ZOUA 1T4KB 3C6LD 3T0ED 1UFGA 1PKOA 4XXDA 3G6AA 3MREA 2OSYA 5EBLB 1OAQH 5C0ND 3CDYA 4OV5A 3EYOA 2X1QA 3POCA 1IGIH 2BY0A 4GBXA 2VLME 5TQ2L 1MVUB 1GH7A 2DQJL 4FFVC 1YSOA 5GGRA 1AR1C 3P4MB 3HS0B 3CC5B 3MLRH 5F88B 2DIBA 3B7UX 5JIMA 2D3LA 3KPSE 3HIZA 2ZXBA 4OD1H 2GAZB 3S36X 5J4MA 1EJ8A 1FZOA 3LZFH 1LQSR 4X9YA 1IBGH 3W9EA 4PJEA 1KPVB 3MNDA 1BJ1J 2D9CA 2BIPA 1UXSA 1XMEB 2VZOA 5HI5C 3ULUH 3VGAB 2ZJSL 1NAML 3WSQL 3NK4A 4YBQC 1MLCA 3KDPB 1UCBL 1IEHA 1IBYA 4LOVA 1T5WA 1BVNP 3H6JA 3OVUB 2OR9H 1JGDA 3KPNA 1GRWA 2R1WB 3WS6C 3SCMC 2NDGA 3F7QA 2IAMB 2FIKA 2YRLA 4OF8A 5D7IB 3GS4A 3LKNB 2YGOA 1X5HA 4K55A 4TULH 4ZXBB 1U2CA 3R7RA 3ZW3A 1WE5A 1CURA 1KCVH 2AK4A 3NFPB 3WN6A 4BQCA 4F58L 1YEHL 3HE7B 2GC7C 3N3EA 2X0WA 3UROR 5B3JE 2EO1A 2N4IA 1ZIBA 4ZD3L 2ENSA 3LKOA 4U1JA 3WFEL 1VFBB 4HVBA 3MRFA 1KIRB 4O2EB 4F7TA 3U7YH 1WG3A 4OVVA 4TSAH 3X3GH 4ZTPH 2EQDA 4LU5L 1PKQE 4H1LG 1PZCA 3I6LD 3QH3B 4PR5B 1F4XL 2MTAA 3HBZA 3MLYH 1YNLH 2C1PA 3Q2CA 1LK3L 4JMNA 3REVA 3CMOH 2YPKB 3UO1L 1FFOA 5GZND 1SXAA 1QD0A 3IWVA 4Y4KB 1BMZA 4L0YA 4L0PB 3JTBA 4FKEA 1IARB 2JSFA 1B4JH 3V6OE 2CWRA 4OCRL 1KXQA 4PS4H 3GMNA 5JOFB 5J6GB 2BRQA 1GGIL 2RCSL 2WJ7A 4XXCA 1YRKA 5FGBA 1ZLSH 4HOXA 1JPEA 2OFQA 4PLJD 3SPJA 3K80A 1RU9L 5HD8D 4YXKH 4NQXB 4FOMA 1OAYH 2HP4A 1U3YA 4FN0A 4MX7B 4RH4A 4UWQB 3ZT7A 2EIDA 3EH2A 4D9QE 1PX8A 2H32A 3HPJB 3GMPA 1HXYB 3NESA 4PIBA 5DEFB 1WICA 3LXBA 3AY4C 5DMGC 3PIQA 3DMMD 1Q9LA 3BZFB 1W91A 4P4KD 1MWOA 5EZLA 4AM0B 2ZXDA 4UTCA 2BIMA 2CALA 1FUNA 3GO1L 3VWKC 1J5HA 5GHWH 2X3CA 4EN3B 3FQYA 3ILPB 4KQ4L 1A6AA 2DDQH 2ORBL 4W4OA 3DWTA 4X6DE 5I1AA 1B0RB 1KGUA 4L9LA 1KACB 2XHNA 3HUJF 2XIIA 4NKMA 5FGSA 5ID1B 3F04A 3P4OB 4ALAC 4PV8A 2BVEA 2YEZA 3P3SA 3RVTD 1T0PB 3KAAA 1M57B 1GZHC 4I2XE 3BZEA 1JFQH 4DP1X 4JM2C 2Q2LA 1X9UA 2BSSB 3S5YA 2QDWA 4E0RB 3JWNH 5ISZA 4JN2B 3RWDB 2R4RL 5T3XD 1H0DB 2P24A 2X88A 3AWGA 2IH9A 3O8XD 1XMWA 1KYOK 4I0CC 2CHWA 2EDRA 4P2CG 5FUOL 3T77A 3EDJA 5ELIA 2EIZB 4IKJA 5AL0A 3RY5A 2K7QA 2YWYA 2AF2A 3NGBC 4UZGA 2YBGA 2JI1A 2GUOB 1TTAA 4LVNB 4OLVH 4AKOA 1ID2A 3Q1EA 2X40A 2W9LA 5IT2L 3VQ1C 3H9ZA 2FYYB 4NUPA 5MEOB 3GB7B 5I76B 3LX9A 1LE5B 1CICB 3PRZA 4P3CH 4RDQG 1PPIA 1V55B 3BRGC 2VXTH 3FH5A 1JMXA 5EIIG 3ASWA 4LKCA 5SWSD 5DQDL 4ZX6A 2DQTH 5L2KE 3O11B 1NTDA 3LZQA 4H8UA 4OF7A 5TGBA 3WNMA 2PPEA 3DO3A 1KJ3H 3KPSD 4XBGA 2OYLA 2HN7A 5J57B 1CK0L 3TBCA 2YXVA 1GY1A 3IJYB 1Y7VA 4PJIA 4CSTA 2ZXEB 1D5RA 3VD1A 5SWZB 1NFAA 2ICEA 3HAEB 5JA9A 1CFTA 3ESNA 3TEUA 1NCBL 5IV2B 1B0GA 1MRFL 3ULUD 1Y6NR 2YN3A 5ALCL 4AVIA 5IGXH 3BAXA 3RL2A 1ZV2A 2NXZD 4NQED 5EPMB 3Q6GH 3RFZC 5HI3C 1YN6A 1AGEA 5IJCC 2IH1A 2VRQA 1NPNA 3OKOA 5AZEL 1CFMA 4ABUA 4JR9H 3OSKA 2OZ4A 3C6SB 2HJFB 3IDJB 2YQBA 3NSCA 1F4WL 2DLHA 3RY6A 2VDML 4PI2A 3FN9A 3S96A 1E6JL 4EIBA 3GUFA 3DUHA 3UPAA 1NDMA 5EA0H 4ILDA 4KXDA 1BOYA 2MSPA 1NCAH 4XPHH 4MMXC 4FA7B 2OMUB 5C6PB 2WVSA 3PL6D 2X1PA 1BVLB 1PZBA 2IGTA 5FYJE 3GMQB 1U8IA 4FHJA 3ULVE 2G30A 1PCXA 5DI8A 1BQHB 1EMTH 1IAKB 5DJ8A 1FHNA 1DLFH 3QISA 1QWUA 1OAJA 3R06A 5B3SB 4LSDA 3M86A 1YNTB 1R3JA 3CK0L 5F9WC 4LP4A 2OK0H 1U8KA 2R59A 4F57H 1SXSA 1KWKA 5E2VH 2F58L 4G6JH 3KJ6H 5F7LB 1UT2A 4JEGB 1CLZL 1LO0H 3QEQD 3T0XA 1BQKA 3ZE1F 3FUFA 1A7QL 4NP9A 4PTTA 4WI9A 15C8L 3PWNA 4L29B 2EZ0D 4DW2L 1D5IL 2IQ9L 4JRXE 3IKCB 3HZYB 2YAQA 4EBQL 3QULA 1PLBA 3H2PA 4QF1B 2ZKWA 4U7KA 4L37A 1TZ8A 1PLGL 5GS1A 1ZJBA 3HNVH 3RGHA 3TBVB 4AGQA 5L6YH 3R18A 4AQ8C 4ABWA 2OMVA 3CZGA 3JV6B 1FPTL 4IK6A 2QLVB 3QPKA 2WUBL 4LLDB 1MHCA 1MF2L 1U93B 3ZY7A 5SX4I 5B38A 1AZUA 4XC3L 3EHBC 4RMWA 4U1NB 4LARH 3DV4B 3IDXH 3QQ3B 2W07B 4XN5A 3D85A 5I8OL 2ZX6A 5E4EC 2XFXB 5FHAL 2EXTA 1OWRM 2XICA 1REIA 4E9XA 5F0JB 4I7ZC 4B27A 5AQ0A 1FZJA 4MHHI 3L54A 5HHNB 3MUJA 1W0WA 4MQXD 3V5KA 2LAGB 4FI8A 2WZ5A 3KPRA 4Y4KC 4HMEA 4YC2B 3STZB 4YHKL 2HKHH 4AG4H 4WGWB 3ZO9A 2IDTA 1PLAA 3SQBA 2G4GA 1DLHB 2UWEE 1FHGA 1UEYA 5EEUA 4G59C 1TJHH 2YKKA 3A6BL 5ADOL 3S4SA 4DFHA 1UWGL 1A14H 5DJ2A 5KAQF 1BPLB 3N50A 4Q9RL 3EOTL 1CTMA 4L1HA 3BEVB 5DS8A 1ZLDA 3V10A 4IRSD 5D1ZB 2XZAH 4JFFE 4D0DB 4N20A 3F3HA 4B50A 1GHFH 2F6AA 5I1KL 1BQLL 4XXWC 2XZQH 3IM1A 2CR6A 4G8GD 1VCBC 2X4OB 2P46B 1GGCH 3FUHA 1IEBB 5FYKL 3BD3A 1BBJB 4P5MB 5E94A 2C3XA 1MCKA 4YDZA 2DQ6A 4Z7VE 1IM9A 1JUFA 2O5ZL 3UXFA 2EIBA 3W82A 2Y2WA 5FOBA 3VXQA 4AC2A 3OJDA 1PBYA 4LSSH 3DJSA 3O3BA 1S3KH 1TTUA 2BNRE 2Y1VA 3KCWA 4G11A 2OX5B 5GRVL 1KC5L 4XAWH 4JY6B 5D7LB 5M7QA 4JO4H 4P5KA 5L2KD 1RUML 1UJTA 5IBLC 1KZYA 3G5ZB 4I3RH 5D2LB 2Y6TE 1YPZE 2RA1A 4PWKA 3N1PC 5FAAA 4L4TE 3CFUA 3RLSA 3FPYA 2PO6A 3DKHA 3SGJC 1OCOB 4NN5B 5KW9H 3TO2A 2E6PA 4PEEA 1JRHI 3ML8A 4KZEL 4UT7H 2X2YA 3BSHA 2VMFA 3RPIB 4F7EA 3GJFK 1OP3H 4YMPA 3K46A 1ZT7B 4HCRL 4WWPA 1E7VA 3KW8A 4ELKA 5FYJU 4GYBA 3OF6D 5DRWB 1A3RH 5C0GA 1E9QA 1JPSL 3FUDA 4M7KH 4ESKA 2UZXB 2VRAA 3B9KD 2BOCB 3MLZL 4G3YH 4F1SA 5ERWA 4HJGB 3EFOA 3KW7A 1UWEL 3ULSB 1XF5B 1A6VH 1KIUA 3UCRA 3ZU8A 3IGFA 3EZ8A 3LNIA 1QLRA 2FQFA 3B6SB 5CLTA 5HYQA 2XCMC 1CICC 3L3GA 3NJLA 5HDRA 4JZNB 3U30C 2YAHA 2E3VA 4XMPL 1DFXA 4NCDA 1ZWIA 2AQQA 4B0MM 2VZ1A 5MENE 1DVFA 2XXFA 2L3BA 4JFPB 4PJ7F 4HD5A 4PRAB 1NAMB 1F4YH 4WUUA 1BZEA 3PGDB 1HS6A 3GRWA 4F8NA 1FAKT 2XJLA 1YZZA 2VLKB 2IANE 1JTOA 3AG4B 4GEJA 3HEIB 2LLNA 1KENL 1S7QA 4Y1AB 1SLWA 4QR7A 3V0WH 1YUHA 3GBDA 5LAXB 2GY7B 4WW2B 4CA4A 4U7MA 1UTDA 3FRUA 3EF7A 3CIQA 1LILA 5DO2C 3LZNA 3RL1A 2NY1D 4NZTH 1CU4H 1UOVA 2BZ7A 2OKMA 1E42A 2C3VA 4Q74A 5JHLH 5DD3L 1G7MB 3VCLA 1YDPB 1O7DC 1S8DA 1TCRA 4MA3B 3WO3B 3OR7B 1YMHB 4OM0H 4D9RE 3D69B 3FZUC 3MROA 4EE2A 3EH1A 4U1MA 1KJ2L 4RGNB 3P54A 3VMNA 2Y7NA 2CIIB 1HC1A 4WDIB 2O6FA 1L5GB 1FL5A 3T4AC 5F6HJ 25C8H 4PRIA 4P04A 3SDAC 1W6LA 4LCUA 1NCJA 4FTVE 3ULUF 1XGUA 2BWIA 3EO0B 4QRTB 3QG7H 5K9QG 4XMKH 3LMJL 4MCMA 4XWOC 3KLHD 3D25A 4HGMA 4XRCB 5JLZB 4YR6A 4GO8A 2EE9A 1L0QA 4U3HA 3BQUB 1DE4A 1N4XH 1JWUA 2AGJH 1B4TA 3VXSD 2J1WA 3AXLA 3OKKA 3X11A 2GI0A 3BPOC 2X2UA 3GGWA 3E38A 3GKWH 4W9ZA 5DGRA 3POHA 1TIUA 1CC3A 5T1DL 4TRPH 3LY6A 3QEHB 4X4MA 5MHSD 4Y2DA 5B3JF 5KZCB 3QPXL 3BKJL 1B4RA 2V5RA 4M5SA 3EO9H 4G7VH 1ZGLP 3GK8L 5CP3A 2B59A 5KVEH 3T09A 1TZGH 3WTUA 3G5WA 2QLYA 4Z7NB 1QI5A 1M6UA 1KCKA 2XBDA 1U3ZA 1XGQA 3TJPA 2UX6A 3DVGA 3EZJB 3LEYL 4JFED 1NC4A 1R24A 5HHXH 2EE6A 5D70L 5CEZL 3IJSA 1INQB 1IAII 4B9KC 2ZUTA 4QRPE 5EOTA 5DK0A 5FB8A 1HNFA 1F45A 3ESVF 5F89A 1SBBA 2BSTA 2E75C 5FGRA 1G43A 1YNKH 3ASNB 4H5SA 4Z9KB 3VXME 3AACA 1CL7H 1G5GA 3PP3K 3QDGE 5F96H 1L9TA 4JHBA 3TBWA 5C6TH 5AW1B 3DUUB 2X44D 4YC2C 3ZE2E 1J8KA 1CPUA 2AERT 4F91B 3U46B 1E8WA 4Y4FA 4F80A 1I3RA 4UTBL 5IKCA 1SYVA 3S36L 2CJUL 1LNUB 3U1PA 5FW6A 4MNGE 4L4TD 3NIFF 3ZDXE 3U6XS 4KHTH 1AIFB 1DCLA 1JBJA 4LCWB 2E27L 3CBKB 1M05B 1HEZA 2QADD 1J1OH 2VR5A 1RURL 2C5DC 4OLYH 5F7FA 1QSFE 1ZT1A 1NFDE 5ITFB 1VZGA 3G5XA 4G6KL 2OMBA 1NGZA 4CKVX 3TM6A 1Q9OA 3E0GA 2UV3A 2Y6SC 5D71H 4IU2A 4R90L 2ENYA 4NIYE 1SJHB 2GSGB 3FU8A 5D4QA 4N2AA 2WTOA 1FFNA 2VJ0A 3TL5A 1ES0B 1PZ5A 4FZEL 3MJ9H 2W9DH 1SXCA 3BWSA 3N0PB 2V2TA 3MCKA 1DO6A 2D31B 2VDQL 1OCRB 1MHPL 4LKXB 5CLXA 2HKFL 2AJVH 3TVMD 2OPCA 4QHPA 1V05A 2IQAA 3KWXA 5C07E 4RBPH 1WHPA 1ZIAA 2GT9B 4UV7L 4IOSD 5KG9B 4UTAH 2FEDD 3OB0K 1MW1A 3WELA 1IGYB 3VGDA 4GOSA 3JWNG 4HWZA 3GMLA 2QZQA 2F54E 1X7QA 5DC9B 5CF3A 1WCQA 2MMXA 3QJHA 3GINA 1F97A 1CDJA 5DHMC 4KKRA 1W72H 1U92A 1DQVA 1AGDB 2XU9A 3KL3A 5DFAA 4I18C 1KTJA 2WXPA 5KVDH 3L1OL 1ZXQA 1OGPA 2LHAA 4FXGA 2MPVA 4JGJA 4XC1L 5AG9A 4RX4A 4ZOBA 4H8WL 1UKTA 2WXIA 3MYJA 4KDTC 5DR5L 3UTTA 2VDMB 3NRPA 1IV8A 5E8DL 2CUAA 2R15A 1D2PA 1JF1B 4ETQB 2JJTA 4YSEA 1HEJC 5CJQH 2G5BB 5DZPA 1IB5A 2Z1PA 2HPTA 4G8IA 4KX7A 4S1SH 2WQAA 1G0XA 2MJWA 4XMTA 3MOAL 5KBLA 4PJBA 2X2JA 5AOJA 3N06B 4WHCA 4BDVA 4WO4D 4BKTC 4KKBC 3MV7A 1W0VA 2CK0H 2X2HA 4XNZB 2F18A 1G7IA 4FTVD 4GRWB 2QSCL 1L6PA 3C8KB 5CJOL 2NNXA 4G9FA 5I1DB 3T0EA 4JO8A 4XN4A 4GKNA 1AE6L 4Z3IA 1TVBB 3H54A 2GBUA 2J88H 4NIKB 4BH7B 4F2MB 4PJ8D 3DURA 1WITA 4L8BB 3B3BA 1DCEA 2CNYA 2E46A 2PCXA 3C2AL 4E41B 4X9IA 4QRRB 4CSZA 4JVPA 4XCNB 3P30L 3CFEB 3TT3L 5F6HI 3BWUF 5EH1A 4A67A 2YC1A 3J7HA 5FA4A 5JQIB 4ODSH 3P2BA 2G5UA 4JFQA 2I9LA 5EBWB 5I0ZA 4NN7B 4MCZB 2IDUA 1IGFH 4YHLL 1JD7A 3GHEL 3IMBA 1RZFL 4X7TA 5A2CA 4B60A 4BK5A 3ULVF 1FFPA 1IGMH 4E9SA 3RAJH 3JUYA 2OQJA 2YWZA 8FABB 1S7SA 4DZ8A 3BVUA 4C4KO 2ZE0A 3IFPB 4X98A 4NQCD 5IMOB 5IB1A 1MAMH 3MUGB 3SDYL 1MI5E 4AK1A 1HZHL 1LK2B 2NY6C 2OMYA 2EDKA 4AYDC 1BMWA 4X80H 2HFGH 3NCWA 4YDLB 4QJ4B 4ZRGA 5IB4A 5E2TH 2J6WA 3GZKA 43CAB 2W60A 4Y2NA 2BSBA 5HYJB 4XTRC 1KYFA 2FX9H 2W1NA 2CUMA 3HHSA 5JW5B 1VKXB 3O4OC 3QUZB 2J8UA 1J8HE 2HRHA 3MV01 4OY9A 4BKLB 1XGYL 5KYXB 3SBQA 3P4NA 3QDME 1BVNT 2D03L 2Q5BA 3FB7B 1BMGA 2F5AH 4GP4B 5TF0A 3T71A 2DI9A 3IAGC 3W56A 2J8OA 5KBNC 1KEML 3J2PA 3B7RL 3F6JA 4AV0A 5ETUB 1VF5C 3DJRA 4UAHA 2V2WA 4QXUH 3CX5J 3OKEA 4TSCH 1JDAA 3UABA 2R8SH 1H8SA 1U91B 2W9EL 4P2RA 3DARA 4R0LC 3VD7A 1DBJL 3MV9B 1PU0A 1U8HA 3TV8A 1C12B 1WEJH 1WHOA 4B9JA 1SHMA 4YPJA 5LDSA 3BSZL 3VXRD 3DRQA 4TQHA 5FM5M 2R0WL 5IMLA 1F00I 4GXFA 5TD4A 4LLUB 4IDJL 4K73A 3AGVA 4NAQA 4Z1PA 1KXVA 2HH0H 2K8MA 1PG7W 1AGBB 2KQMA 4P4KA 1E4KC 3FF8A 5D2NE 2PTTA 4D0CA 2I85A 1KUMA 2FD6H 1TVDA 1RZ8A 3AQZA 1WFIA 4LVOB 1NGQL 2VZ3A 3VB9A 5DZLA 4UOZA 3F7RA 5BOJA 1YEDB 4F8TA 1MIMH 2ADJA 4WV1B 4JFWA 3C9NB 3DTXB 4Q89A 3US9A 5GS0L 4Q2ZB 2VW7A 5CR1A 1OM9A 1VADA 1SQ2N 1HOCB 3V8CA 2BINA 2B1AL 3HG4A 4JVWA 4Z7VF 2KLTA 4W9GC 5DMIH 1NJ9B 4DUWA 2EIKB 4F7PA 1SN0A 1UM6L 5JPNA 3VFSB 3EJYD 1GCFA 3HB3B 1X9QA 1ETZA 2E0PA 3P2TA 5I0XA 1PEZA 1F6FB 4I9WE 1BM3H 4K3HA 5HPMB 3VXRE 4BQ8A 5F7YC 2NTFB 4OAWB 2OTWB 1GIGL 4G42B 3RA7L 4PTUA 3O8XA 3FB8B 3WUWA 1R3IH 3D33A 3DBXB 5DEGB 4JPKL 5GJSL 3LKSA 5AVUB 2B4CC 4A04A 4YK4B 1EJ6A 1TZIA 5AZ2L 4GQRA 1E4XH 3OR6B 4M1GL 2HJLA 4HLJA 5K9KB 1P9MA 3CE1A 3S88L 3EJJX 3CXHJ 3FCTA 5EBMB 4WEUD 4XOAA 3HFML 4WJ5B 2EVIA 3V4PH 5AAWC 1FJ1A 4Y4HC 5DHYA 3CUPA 4HJJH 4QTHB 4WEMB 3SO3C 4EOWH 1KCRL 3PGCB 5HI4C 4MB1A 5SWSA 4BE6A 2PR4L 4NQDB 3K8MA 1FL3B 1CE1H 3W2DH 4OLZL 4MA8H 4L8DA 2X4SA 1KJ2B 3TN0C 1U33A 5A3ID 3CHQA 5E00B 1O5PA 5L2JA 2ZG1A 4M4PA 4ZS7H 2FGWL 1MCFA 1JGEA 3NJJA 5IK3A 3O0RL 4ZUUA 1OT1A 2FJGA 3T65A 3W0WE 4WW1A 5LN4A 2XX0A 1AH1A 4NQEA 1A7PL 4TLUA 4PGCB 1CF8H 1EVTC 1R4XA 3OXRB 4JRYB 4G6FB 4XNZC 1KJVA 5I0YA 1U95B 1SHWA 1QHOA 3MJ8A 1XH3A 3QNYA 2H26B 3OZKA 1N3NA 4IMLB 1JZDC 5AKRA 4AZ8B 5LQBH 3X1GA 2BVPA 1D5ZA 1JK8B 4J4PC 3V6BR 3VXOB 3BWZA 4DCQB 2AJ3A 4KKCC 4PMFA 5HJBA 4QO1B 5JQ6L 3L3HA 4Q9QL 3NCFB 2IWEA 2NQ3A 3PL6A 3CV5A 1J9CT 3L4WA 1T83C 3HZMB 4S2SA 5L0QB 4PRIE 3DX8A 4O51B 3COOA 5GGTH 4N8PA 4NN7C 5MEPB 3QDMD 4KZDL 3O41B 5DZ9A 4FQHB 4HCFA 1MFDH 2YK1L 4I77H 3ZYOA 3L1EA 2Q8AL 2F5BH 2VMJA 1AZRA 1UACL 1CIUA 4FQJH 5F3FA 3QEQA 1NSNH 4W9JC 2A7BA 1IL1A 3FQRA 5TQ0H 3VJ6A 4RCAA 2P3YA 3SKNA 3MBEB 3EYVB 2PMZA 4JPWH 4X4YA 4Z7IA 3N6YA 1OPGL 2AJZB 1QO3A 3B3IA 5B8CB 4YDLC 5CFHA 3L4CA 4PB0L 3S37X 1IC7L 4R3SB 1FZKB 2FX7H 2D7PA 5DQ9B 2AKRB 1IM3D 4XODA 5KSAD 5CLYA 1WRFA 5CSGA 1HE8A 1EBAA 2VR4A 4G43A 3AU1B 1KXTA 5CZXC 3QEGH 4LSTL 5GRWA 4A6YB 4RAHA 4NUQA 5BZWB 1JMZA 1GC1H 4PJ9D 1HIMH 5B7EA 1FVEA 4EUPH 5G5DA 1AGFA 1JGUL 4E9TA 4GRLC 4TL5A 3NT0A 1IKFH 1R3LB 4ODHL 3NZHL 2HVBA 4BFOA 4XO5A 4K9EC 3W9DA 1Q72L 4HFUH 5AVWB 2GITB 3EOAA 5IM7A 2E9GA 1FAIH 4XZ4A 2MIZA 2FJFB 1EZLA 2BP0B 3LRMA 2NNRA 3IFLH 5GSRA 2VDLH 1KB9K 4AE1A 4IBLT 3SDCB 5LDUA 1IJNA 1S9KC 1UQSA 3VWJA 1VACB 3C75A 3F7VA 5C0BE 2ZYIA 2EYSB 2VDQB 2CBPA 1MQ8A 4LMQE 4DK5A 4FG6D 5DMYA 3GSXA 1BEYH 1H3PH 3ABGA 3HZKA 1NCCH 1SPDA 2CAKA 3MSPA 1Q1JL 4HF5L 1P7HL 2DYPD 5FLVA 4ORZC 2AQTA 1HCYA 4HH8A 2YOCA 1U3HC 3GIVA 1B90A 2FB4H 4QOKA 1HVXA 1S9YB 4B41A 3T08A 4IRSA 1EDYA 4NM4L 1RZJL 4MJ2A 3MRDB 3QORC 1X5GA 1C9SA 1BWWA 3CFDB 4YHZL 3K4ZA 4FNSA 4G8GA 3RJOA 2VM9A 4HEPA 3WIFB 5DD6B 2HLAA 1WQVT 3TO4B 1MNUH 4WV1C 1MFEH 1PG7X 3D52A 2PNDA 1MFVA 3KLAB 3OAUL 4XGZB 1R6VA 4KV5E 2X4QB 3BVVA 2HG5B 4JE4B 4OSUL 4XNAA 3F58L 5EORL 4A2FA 4ICXA 5HGHB 3F7PC 1NIFA 1T21A 2UXGA 4GRMA 3MKKA 4FFVD 3QCTL 3OGCA 3TH2T 1JDCA 1AR1D 3MV11 2YPVL 5CJ8A 1F2QA 1RSFA 3OLEA 3QRGH 2IEPA 4ODTH 3DOSA 4RESB 2GK0B 3EDEA 5AB2A 4ONOA 2NY3C 3PWLA 4XWGL 2C3HA 5C0EB 5IROA 2BZCA 1NBVL 4ZW6A 3P3UA 2VMDA 4QKTA 4KKQA 3ISRA 1JD9A 2OW7A 4LEOA 5HI5D 4QJ5B 5IB3A 3D