3S88L

Crystal structure of sudan ebolavirus glycoprotein (strain gulu) bound to 16f6
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A shared structural solution for neutralizing ebolaviruses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
molecule keywords 16F6 - Heavy chain
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s88L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s88L01
3LMJL 3P9LB 1V05A 3K7UA 3P4NA 1DR9A 3FQTA 5E03A 3TJEL 4OLXH 3QZWB 3MV8D 4CW1A 4OGXH 2WSKA 3BIAX 2MSPA 3D39E 1MCPL 1KCVL 1U8PA 3BP6B 4TVPE 2X4PB 1JF1B 3VFSA 4GH7B 4MCZB 4JPKH 5DFVD 1L6ZA 4MD5A 4B50A 4CJ1A 2VERN 3C6LC 2WANA 5KSVA 3BXNA 1ZSDB 2R2CA 2AJXL 3ARFA 3MOBL 1T1ZA 1F42A 2G9HB 4RQQA 4OFVA 3UTSD 3U0WH 3OAZH 4I3RL 1FDLL 1RJZB 4LIQH 2KQMA 4CJ0A 4M43H 2YD9A 4Y4KA 2VXQL 4MA1C 5BS0B 4PLKD 2KKQA 1D5ZB 3REWB 1EAJA 2GTWA 4GG8A 4NM8L 3DUSB 1NDGB 5IK3B 5B38B 2NY1D 1M7DB 3IDGA 4MAUH 2P5ED 3L5WB 3LHPH 4LDLB 2AK1L 4OLYL 2Q8AH 4O5LH 5M7QA 5E5MB 1LQSR 2YEZB 5DZLA 2CR6A 4H20L 3PWPD 2P48B 4CDGC 2WUBL 2B2XH 3X12A 3QUYD 4HUUA 1UG9A 4DK3A 4PJFA 4RAUB 2R1YA 3D25B 2ESVE 5T1MA 5CD3A 5IHZB 5HXMA 3QQ3A 5HSFA 3BH9A 1U8MB 3BEVB 3OGCA 4YHYC 5TDOA 3WE6B 3SJVD 1OAKL 2PXYB 2EDOA 3DRQB 1XT5A 1DBBL 3U83A 4DUXA 5EZJB 4XNXL 3LEXB 1VB9A 4WNQA 3IVKA 4F7TB 2C3GA 2JIXB 5GGQL 1DLHB 1MCEA 1OWWA 3ZHDA 4XPGH 1EHLH 1AGDA 2V5YA 3ARXA 2CMRL 4NO0A 1JYVA 1A14L 2XICA 3HG1A 1DQLL 2HKFL 3VA6A 4JN2B 1WAAE 2W0FB 1JWSA 2OR7A 1AKJD 2IANA 3WIHH 4FQQA 2P24A 2OK0H 4WV1B 2MPAH 1JGEB 4PJGF 4WHTA 4M48L 4Z5RA 1MFNA 4KJWC 1OAQL 3KPRE 2H2SC 1VERA 3P73A 5E2WH 4PY7B 1RUPH 4YHNB 3CNKA 3QXAB 2CD0A 3VJ6B 2NQCA 3S9DB 4KKCD 4PJFE 1A22B 2IBBA 2OQJA 4X9FA 3U6RB 4NQSB 3ARWA 1RJLA 4UNUA 4HPOL 3SJVE 1HXMB 3WLBB 1MI5B 3JVGA 4OSUH 3UYPA 2FJHA 3CVHL 4NC2B 5FO8A 3BO8A 2XN9B 3H7BA 3K81A 1J1PL 4JHAH 3FOLA 4JFHD 2X4SA 3IS1X 1NLBH 3CZFA 3BWUC 2BVPA 1UYWL 4LSUH 3ZYIA 4TULH 5HYQA 2ITDA 5I18L 3MJ9A 1AO7E 3U4AA 1QKZL 4N1CA 5ETUA 4NO5A 4HEME 4LQ1A 1IKNA 5F96H 5DK2A 5CLWA 3PDOA 5AD0B 4QLRA 1UCBH 2IG2L 3MBED 3DHMA 3VDAA 1JHKL 1KV3A 4PJAA 4OLYH 3FZUD 4AIZB 2H26B 5DEGA 2IALA 5ALCL 3KYAA 3DRTB 5HYJE 3GUTB 3CC5B 3V0AC 1FNEA 2BHYA 1JTTA 4U6VH 2Q7YA 3LN4B 4UNVA 1AJ7L 4XCEA 4XP1L 5T3ZD 2CKBH 5D1ZD 1KCRH 2GTZB 3HMWH 5FCSH 4PP1D 3K1KC 4DCQA 4G42B 4FXLA 5JMRA 2C5DC 1GGIH 2J88H 2WK2A 3Q6GH 2YKLL 3V4UL 3FFCB 1TZGL 1S78D 1S8DA 2RBLA 3D69A 4XNUH 1Z0NA 3GSVB 1FBIL 2IPUG 4GXUN 2G60L 2PW2A 1RIVL 3GSOB 1PKQB 4ONHB 4ZOEA 3T09A 3NGBC 3OAYK 2F8OA 1YQVH 4GBXD 1A9BA 3ECBB 2NZIA 4M5ZL 3SGKA 4LCWA 5BVJB 4E0RB 5J9PA 1HHGB 4HBCL 1F3DJ 3A67L 4LVNC 1RMFL 4PJ5E 2JJSC 4HGMA 1RMFH 3RTQB 4FXKA 2B4CC 1IAOB 4EKXA 4NZUL 4MQXC 3L6FA 5EU7C 1S9KC 1T7YA 4DN3L 1TJGH 4P5TB 3KYNA 4MZ2A 3GSUA 1H3GA 2Z8WC 1XF2B 3LEYH 4JZJA 1RZKH 1TETL 5FUOL 3UC0H 2E3VA 4ZFZA 4BZYA 5FF6A 1WZMA 1BZ9B 1FL5A 1I85C 1U0QA 3O3AA 4EUPA 4NC1E 2VDOL 3VXMD 4Y7MA 4YXLL 1BQLL 4UDUA 3CFCH 4P2QD 1T1YB 5E08L 2RFXB 4HHAA 3MFFA 4JRXA 4TVPL 2B4CH 2HFTA 5FGCE 5I71C 1P69B 1MVUB 5KG9A 2UZXB 2M2DA 4XX1E 1U8JB 2X1XR 3RZCC 5E2UH 4MXWL 1GOHA 3VXQB 4XNMB 1BIIA 4X99A 2B5IB 4G9FD 2ZG3A 1IC7L 2VR5A 3G6JF 4HT1L 5FHAL 4HWUA 3DIFB 3G04A 1MHHA 4AMKH 5E8EB 4XXCC 4L9LB 4U0RB 1ZWIA 2ADIB 3MLZH 4HK0B 2Q6WA 3RTQD 1JV5A 2FL5B 3QG7H 3IJHA 2Z92A 3RJQB 1UACL 4UV7H 2NLJA 1MWAA 4LHUA 4PG2A 4GT7A 4P5TD 5HHOE 4XNXH 2H9GB 2CDGB 3IU3B 2MNUA 5GGRA 1KLUB 1X44A 1U91A 4Z77A 4ODSH 3SPVB 5KSAC 2EEBA 1XIWB 5I1KL 3QWRA 5IJKC 3HPLB 4ZTPH 5CJXA 1T3FB 4P23B 3SKOB 4QHUB 5BJTA 1E4XH 4X6CA 1WTLA 1U92B 3GMNA 5DJ6B 5JW3L 3EO0A 1JZ6A 4ELMB 4RDQF 5HYSG 4B53A 4RFOH 4S1RL 4X6EB 4I48A 2HH0L 1S9WA 4NM4L 1NFDF 4R4ND 2OTUA 3QHFH 3ARDB 5F7EH 5CJOH 2BZDA 4WWKD 3DX9B 3RX8A 3TZVD 1M6OB 1WFOA 4PJAE 5KVDH 1ZHNB 3BJLA 3I02A 2BCKB 6CGTA 3WO3B 4KAQH 1C08B 3DX8B 1ZMYA 3DJ9A 1CLYH 4LAQH 2EDLA 1E0OB 2X1PA 4Z7UE 3V0WL 5DMJB 4G8EA 1F5WA 4XBEL 2GSGB 1OAYH 4H8WC 1TZHB 1MWAL 5C09E 3MV7A 3HE6D 3OB8A 1JHTA 2CUHA 3AY4A 1KEGH 1D5ZA 2GY5A 5F70A 3V95A 1ITBB 5DSCB 1NDGA 5IK3A 1GPOL 5C0RH 1QQDB 2PTUA 4R3SB 3SEPA 2ADGB 1VEPA 4XP4L 3HAEG 2YK1H 5GSRB 3TGXA 4OKVA 4XPHH 4APQC 2XA8L 1VFUA 1T2QL 4WI8A 3VXUD 1X5FA 1ERNA 1DUZA 2QSCH 1RJYA 1LP9E 4FQLH 4J4PC 3U4BL 2XY2A 1QFOA 3IYLW 4JQIH 4XWGH 3DVGA 4PBVC 5TDOB 4QOKB 5IG7A 5GZOD 1I3UA 4IOFD 1DBKL 3VCLB 4TSCH 3W82A 4HX1A 1KSRA 3GRWH 1PFCA 3FQNB 1XGYL 2JIXA 4CGTA 1A1OA 3QH3A 4Y5YC 3VFTB 5IFJB 4ODWB 4YHKL 1MCDA 3HG1B 1MPAL 1JWSB 2XYCA 4H8WL 1G9MC 1J8HB 1QRNA 5TDNB 3I75B 1FBIH 3QXVA 4I5BA 4M9PA 2XKSA 2EIZA 3BAEH 1IM3A 1OD9A 3KS0H 1KXTB 2XKNA 3C5ZA 3IGAA 4AZ8A 4BZ1L 4F7MA 4NN7C 4MNQA 2MHAB 3EYUH 3K1DA 5CIPH 3KGRA 4G6FD 4M5ZH 1PGRB 4IRSD 4JM2C 4BQBA 3LPGA 3GEWB 4PY7A 1WWBX 4L5FH 1RZGA 4PRIB 3JZ7A 3IB4A 4GW5A 3D39B 1XGPB 4NKOB 1QFUH 1D5IH 2OTWA 3MUY1 3Q5TA 4NQSA 4PJIB 4XNUL 2V2TB 4JPVL 3MRHB 3PJSA 4BM7A 4PJ5B 5BCAA 4NRXA 4GRMB 4QNPE 3GMRA 4U1IB 3PHOA 2FJHB 3BISA 2YUWA 4M1GL 1JWUA 1XCTA 3P9WB 4XI5C 2BVEA 1F3JB 5FV2A 1L0QA 3GSXB 1IE5A 4ZUSB 2WUBH 1MAMH 1T0NA 4U31A 1RUAL 4KK9C 4LARH 3TBWA 5L2JB 4YO0B 3MRQA 2XQBH 2HT3C 3HE7C 2AV1A 4KV5E 3DI2B 1JL8A 2VZUA 4YDLB 5HYQB 2XTJB 3WDIA 3LKSB 3MFGB 4BFGA 3CXHJ 3MUHL 3NIDF 1IAKB 3L3DA 4S10A 4RMRA 1ES0A 4XRCA 1BECA 4RAVA 3QNXB 1CGXA 1D5MB 4N5ED 4NOFA 3WFEL 4EDXA 4YWGL 3V5DB 2WNGA 4F57L 2HFEA 3SDCA 4MHHI 3MUZ1 4Y16A 5DEGB 2CGRL 2PYEA 1EGJL 3VFUB 1NGPH 1X4XA 5K9JH 1T2QH 5I9QB 1T5XA 2VDKL 2VZSA 4RFEB 3SDAD 1RVFH 5AUMA 3LKOB 4W4OA 1BD2A 4LF3A 3GSNA 4MVBC 2WMPA 4L3ED 1S7WA 3QXDA 1JWMA 1MCRA 1RAMA 4K9EC 3NTCL 5SWSD 1N2RB 3R1GH 3RP1A 2QADB 1DBKH 4MXWH 1K4DA 1U8NB 4ZYKA 3BT2H 1JE6A 1LO2L 5FYKD 1R3HB 5BV7H 3D69B 4HIEA 1BMGA 4O00A 3GI8H 4BH8A 3FHAA 1A3LL 2JJUA 2F5AH 1WIPA 4JEGB 3CK0L 2YN3A 4ZS7L 5LCVH 3CFKB 4KK8C 1CXLA 3S3SA 4WI4A 3HAEB 3HZYB 3G6DH 4GRLC 3U2SB 3UTQB 1DVFA 3ARED 2ED8A 1DEEB 5I8EB 1NCUA 5L2KD 5HD8D 5ILTL 4JFFE 1QVOA 2NY4B 3ZDXE 5GGTA 3L6FB 5L7XL 5GRVL 1R3JA 1HHHA 2AXJA 4OCXH 1SYVA 2AGJL 2F5BL 3ARGC 3HS0A 4LSSL 4OFYA 1N6QH 2K7QA 4Y4FB 4G43A 4Q9QL 5FF6B 1BZ9A 1FL5B 4F37K 4AH2B 5A3IC 2AXGB 2Z0BA 1Z9OA 2V7HB 4KMQA 1OAQH 3T2PA 1S5HA 2EECA 2HH0H 4JCMA 1WUNT 3MCKA 3TP4A 2AQ2A 4D8PA 1ZHBB 4PJCE 3IRPX 5HGHB 1JMXA 3O9WC 3H3PH 4MLIA 4MVBD 1ACYH 4PRNA 2GQHA 4X4XA 4JG1L 2LTQC 4OGXL 4WW2A 3C6LD 1QSEA 3NCYS 4N0FB 3BQUB 1XR9B 5J1SC 3B2UC 2YWZA 4KU1A 3MZTA 1ZWIB 2ADIA 1Z6JT 3HNSH 4L9LC 3MRFB 1R5IA 3KJ6L 1A47A 4L8SA 4QF1B 4QOKD 2APVA 4MWFB 1JV5B 3VFPB 5K9KA 1CDHA 3K46A 4YHML 4NP4L 4HQQH 2VZTA 3BWAB 4Z95L 3T2QA 2LU7A 2PW1A 1X7QB 2H9GA 3P4LA 2YPLA 3RZCB 3QHZL 5KSUB 1KLUA 2H32H 4H25B 2A74B 1G0YR 3GJFK 4PJ7B 2PXYD 3LHPL 1RUPL 3LRHA 2A0LD 5E95B 3SDXA 2HTKC 4L1DA 1Q0YL 2NTFA 1NCDH 4ERSH 3OB0H 4O58L 3BW9A 5DC0A 2IANE 5ENWA 5EWIH 5DJ2B 1MCHA 5JHLH 3BUYB 2WWMD 4WFFD 2RAMA 4ELMA 3P0YL 2W91A 3N0PB 4POZD 1CDJA 4Z7NF 3MOAH 1K9TA 5HI5D 4DKEL 5BRZE 1NAMB 3NFSL 1FG2A 2EDBA 1J12A 1EAPA 1V7NH 1BQLH 4KDWA 4P5TC 1UXWB 3AS3A 3ZYZA 1NPUA 2YN5A 1FGVL 4JFHE 4ONFL 4HXBL 1SBSL 3RVVD 3D87B 4MLSA 2VYRE 5T3ZH 1FH5H 2G60H 1T2JA 1OF2A 4ORGA 1NBYA 4HW6A 3S35H 5JA9A 2HMIC 2H32B 1UCTA 1JUFB 4LVOC 1ZLWH 2GJJA 1BREA 3X11A 4G8EB 4HPYH 2HLAA 3OXSB 4U7KA 2BP3A 1BVLA 1C5DA 2O26U 3KDMB 5FGCB 4OCWL 3FT4A 4OCWH 2DWEB 1G6VK 1FL3A 1MY7A 3I3BA 1JPSH 4HWEL 3D5OF 1IEBA 2ADGA 4S0TD 5D7IE 5E2WL 1HYSD 1HNFA 4WDIA 1NC2B 4M4PA 3O2WL 3UTPD 4PRPD 3FJTA 2DD8L 4LHQB 2GW5A 5JZ7C 2N7AA 5CBAB 2MCPH 1RJYB 1TETH 2CO7B 5FUOH 4MQXD 3MNZB 3HNVH 3CCHB 1MFAL 1UM6H 4OM1H 1PBYA 1XF1A 4LLUA 7FABL 5IBLD 2ARJA 2C3XA 5C0BA 3BKJH 4J3XA 1P7QB 2ZKHL 2X1WL 4NO2A 2B4CL 3FQNA 3QUXB 4LASH 3V52L 1OGTA 5H35B 4ODHH 5E6IB 1A1OB 1HNGA 3SGEI 4OCMC 4YHLL 1L0YA 4RFOL 3MNVA 1OLZA 1KJ3L 4YHPB 3BPCA 4I9WD 4CADB 4OV5B 1L4IA 1DFBH 5F1KC 1CBVL 4HQQL 4ELKB 1SVCP 3FO9A 1X5GA 3BEWA 4P4RA 1U8IA 5JNYA 5EZOL 1XF5A 1N7ML 1H5BC 4D2NA 4WY7H 1BQHG 3IGAB 2XKNB 2VKWA 4X98B 4P57B 2O5XL 5F3BB 4IIQC 2FIKA 5C0EA 4X9BA 3BKYL 4FFYH 1E4WH 4LHJB 5FO9A 1XH3B 4ZFGH 3UYRH 3EFFA 2C1OB 4JPKL 4LLYA 5EU7E 3UTSA 3L7EA 3FAXA 3RPIA 3G5ZA 5DMIL 4AIOA 2UZIL 3HPJA 5DMIH 5C3TA 3BRFA 4HZLA 5F7DB 2NZ9D 4OQ1A 3NFPB 3Q0HA 3CPLA 1CD8A 3IDJB 5F1IB 4K7PH 4WFGE 3QWQB 1FNGB 1TTGA 3T65B 4EIGB 4HUMB 4LKCB 2AJVL 5FGSA 3GSXA 1E4XL 5ALBH 1ZLSH 5GRJH 5KW9L 1WCBB 4JCLA 1YUHB 1BP3B 2W9DL 1V3LA 1AR1C 2VZ1A 4NQEE 5DTFA 5L0QB 5LGHL 3O2DA 2DQDH 4HS8L 5C71A 3BI9X 4FQIL 3OKLA 3NOIA 3GMMB 1FFRA 4GKZB 4X7EC 1VFAB 4XRCB 1ES0B 5J8OA 1IMHC 4RAVB 1F4HA 1XGYH 4KZEH 4C83A 4Z0XB 4Q7DA 3GSNH 5JQ6L 1C16A 2P47B 5EA0L 2E8YA 4M00A 1YEJH 4P2RE 2CDEA 2FX9L 2FX9H 4O5LL 2FZ3B 3AGVA 1NUGA 4WUUA 4RFEA 3ZE1E 4LF3B 4Y4FC 3TVMD 3WLWC 2BXZA 4L8SC 3ARGB 3EOBB 1U8OB 4KUZL 4HMDA 1E6JL 2J12B 2XRAL 4FG6D 3GMPB 3WFZA 4XGZB 1U8NA 4ZYKB 5CZVL 1KENH 5K59F 3OPZH 5JPNB 2NY4C 3T3PF 5HYJA 4YXKL 4YR6A 1JPGA 5LG1A 3ULSA 1G7HB 5H94A 2ZG2A 1AD0B 3HAEA 4XWGL 2G2RA 2OXHA 1KIUA 3K8MA 4Y1AE 3WNKA 5F1OB 2GJZA 1QACA 4ODTH 2VDMH 4DGIH 2BHZA 2ATKB 3HZMB 3F8UB 5DJAA 2FJFA 3BN9D 3HFMH 2NW2A 4LNRB 4Z7VE 4XBGB 3C60A 2UVEA 4OD2A 5ITFB 3RHWK 3UPRA 4UINH 5I1HH 4I18C 4G6JH 2DQFB 1HHHB 3UBXB 4ZFGL 5FFLA 2A73A 4UV7L 4HWNA 5DJ8A 5CINH 1SYSB 4ONGL 4O2CA 2XWJA 5FDWB 2OZ4L 1J10A 1ETZB 4KHXL 3QFDA 2CK2A 1S9XA 4ZAKC 3MBEA 1YMHA 3KLHD 2XZAH 1LDPH 4JFEA 2YUZA 4HK3N 5K9JL 3PP4H 4NQCD 4JREC 3T1FB 3DX7B 4G8GD 1EO7A 2F53D 1C7TA 3SO3B 1WWWX 4OZHF 2Q1EA 4KI1A 1CFQB 1HWHB 3TYFA 3HB3D 4XPBH 1MF2H 4KJQD 2P5WA 3S35L 3OJDB 3WS3A 4XAKE 2XTJC 1QYGH 2B1AH 3CVIH 1K3ZA 1QO3A 3CH1A 1I1AD 2L4OA 3HE7B 3ZMRA 4K71C 4KK5D 5T1KA 5I8CA 4DKAA 2XTJE 1QSVA 3T0ED 2CKBA 4KMTL 4U6YA 1FN4B 2I07B 1SJEA 1I8LA 1JJUA 3KHQA 4M61A 3QPQC 4LHUG 1HYRC 3JWOH 4P3WA 3TC9A 4PGEA 5KANI 2X6MA 4DEPB 2YPLB 4UQ3A 4R96A 5BQ7A 1UH4A 3H42L 1M1SA 3QQ4B 4X4ZA 2VDNH 1BJ8A 4XMKL 1U8KA 3U48A 4OZIF 4PJCB 2BOCA 3DMMA 5FYKH 4H5SB 1C5CH 5DJ2A 1DQML 3BUYA 5KJRL 4Q9QH 4QKXB 1L7TL 1NMAL 4M7JH 5LQBL 4JFFB 4OBRA 4DJMA 2V2WB 4OZGF 2HJKB 1GGBH 4XH2B 4HH9A 1MCLA 4P2QA 3H9SB 2BVYA 4M7LL 4O2EA 3A6OA 4Y5XB 4KVCH 2ZCHL 3EDDA 3C08L 5J13B 5JHDB 1WSST 1I75A 4PB9L 1I7ZA 3MV8E 1NBYB 1MREL 1W72A 4JPIA 5EDXA 1FIGL 1MPAH 3QIUA 5C2UB 2ID5A 4PJBE 3TT1H 1FCCA 1EFQA 1EJ6A 5FM5O 5GRJL 1NGYA 1C5DB 1DEDA 3L95B 4IOSD 3PV6A 5T1DL 4X5LA 3CUPA 2DLGA 3WO4C 2VAAA 4NBYB 3LIZL 5TGBB 4UNTA 3SHSA 1UKSA 1UENA 3VXNA 4APQB 2XY1A 3QPQD 4F9PA 2PTVA 2BVQA 4DGYH 4NQEB 4WDIB 2FCBA 2IAMB 2R4SL 1EUUA 2GSIB 5EUOF 4N9GB 4KUCD 1OAUH 1GHFH 2R4RH 4Z7UF 3U36A 4ALAL 5CBAA 3PHQB 3RL1A 3O6FD 5BO1H 3O4LB 2HG5A 3QCVH 1Z3GH 5F72S 3BDBA 1GOGA 3IT8D 2ARJB 3BX7C 5F9OL 2A9MH 3MRLB 5F3HB 2A9ML 1CXIA 3PL6C 3EO9H 4PV9B 5GPRA 1G1CA 4QTHB 4IMLB 1PVHA 3O8XB 1OGTB 5H35A 3MV8A 4L9DA 5E94A 2ZCKH 3MGAA 4YHPA 3HN3A 4PJBA 4XCFL 1LP9F 3H3BC 4OV5A 4MXQD 2NW3A 3K2MC 5FYJD 1U95A 1ZT7A 3TWCH 2DOCA 4JPWL 2ZP0T 4F8TA 5JXAH 5L2KE 4J3VA 5ISZA 5HVHB 5L9DL 1O5DT 1OT1A 1D5IL 4YHIA 1NJ9A 4OIIH 4P48A 3VFOA 3O3DB 1G7QB 3WIHL 2ARWA 3R0NA 1H3UA 4KHTH 5GZNC 2C1OA 1RVFL 1MAML 5T1LB 1KPRB 1D9KA 1INQA 2C7UA 4JRYE 5I1LB 4DFHA 5EN2A 3KLHC 4FMFA 1FORH 3RWDB 2ZZUT 3IDJA 4X7CC 3TA3C 1H0DA 1I9IL 4XC1L 4NZRH 5DI8A 3O2DL 2JJTA 5C6PB 4UMGA 1WEJL 5ID0A 2FR4B 3NCFB 3EAKA 3EYVB 4KI5C 4LU5H 1D5XA 3VE0A 4Q9CA 3MODH 3CK0H 1YEIL 4FFZL 2AK4A 1T89C 4LLVA 5ESQB 1LDPL 3SCMA 1I8LC 3SKJL 5I76B 4FQXA 1HZHH 5CGYD 4NSKA 3HLAB 4CN1A 5DHYB 5GS1C 3RFZC 1VFAA 4HWBL 5MENA 2VZVA 1UWGH 3TH3T 3VGHA 4MSWA 2IBZX 5IGXL 1MNUH 1NCTA 1CT8A 2CJUL 1Q9LB 4S2SB 4TULL 1C16B 4BSJA 1OT2A 1BX2B 1I1AB 2AXFA 3EIFA 9CGTA 4N90D 3RGVD 4PG9B 4XCCH 3CXHK 1IQDB 4XPTH 4IHOB 1LEKA 3JWDC 4KMTH 2GAZA 3CSGA 1EA9C 4GXVH 1ORSB 2W9EH 4MD0A 5E2JA 1RUKL 1FRGH 1KG0B 5A1AA 3MLSH 3BKYH 5DUPH 3TO4C 4WO4C 2X4RA 3D1MC 1BJ1J 3FN3A 5I2IB 3HA0A 5F88A 4K3DL 2PYEE 5F7YC 1A6TA 1NGWA 4XP1H 4CMHB 5EIVA 5GGTL 5SX5K 1AP2A 2YPLE 1INDH 1KPVB 3TYGL 3U0PA 4CNIA 2F54D 2YKLH 5C1MB 2NY6C 5GGVH 5B21A 1HHIA 3BKJL 1Z5LA 5AYUL 4FTVD 3H9HB 1PG7L 2ATKA 4TNWK 5DK3A 3HZMA 2JELL 4WWKC 1JPFB 1J05B 4ODXA 5D7LE 3IDXL 3MMEA 1NAML 3CDGB 5IROA 3UPRB 1M7IA 2DQFA 4MJIE 2DJSA 4R2GB 4WI3A 3NACL 3RVUC 1N6UA 4L5FL 3TM6A 4BZ2H 3ROOB 5ACMA 5I15L 3TPUA 2XV6B 1IQWL 3U9UB 3WDJA 1AHWB 4N8CL 1VKXA 3VWJA 1MCOL 4QT5B 2DWDA 3UTPE 4W81A 4HFUL 5FCUH 4HIIB 3QJHA 2B5IC 4OLVL 1JGDB 5CMAB 4JFEB 2CLVB 2XZZA 3EOAA 2CRYA 2DM2A 4P4KC 5CHNB 5C0JA 1SY6H 3E3QC 5KSBB 3OJ2C 4LPUA 3ARDC 3DX7A 3T4YB 3QFJE 1WBXB 5HHME 1BQUA 2FX8H 1V3MA 3UBXG 3TIDA 3QZWG 3WS3B 4OLXL 1G9NL 2VDRH 5TE7L 3AXLB 4KJPC 4JFYA 3BVNB 1FGVH 3C8KA 5ESAB 2ZOKA 5J0BA 4N8VA 3F7YB 4Q58C 4Y8DC 4EN3B 3FHQA 4OCRL 3QUYA 3OKKA 1JFQH 5I30H 1GGCL 1DBJL 1OY3B 2NX5E 5CJQL 5IT2H 5E8PA 1IC7H 1LO2H 4HPYL 1UZ8A 5SX4H 1QEWB 4FQHA 2WBJD 4UQ3B 5BQ7B 5JUEL 1JVKA 2C3VB 3QQ4A 1UZ6E 3DSFL 4F7EB 5FEBA 2FBOJ 1K6QL 3KLAB 2DTMH 4KMLB 2AJYH 4RWYL 3MRDB 4NRZB 1U8KB 2LU3A 4F3FB 4P5MB 1M05A 1TZGH 3ZHKA 3QT2A 1RUQH 3ARUA 2VSCA 1A7RH 1YC8A 2G5RA 3QYCA 4Q6IB 3BAEL 4OFYD 1A2YB 1NUDA 5L8JB 4KI5F 1T21B 5BMFH 1E6JH 1UEYA 4B41A 4ZTPL 1YQVL 5DQ9B 4QXWA 3PABA 4OB5H 3ZE2F 2Y06H 4I8DA 2YRLA 1VACA 1QPPA 1MCSA 1U58A 3TBSA 4KTDL 4MXVE 1GVIA 5DD1L 5JXED 5HBBA 1MI5E 2F53B 1G7IA 4JPIB 4YK4C 3PWJA 5FECA 1B2WL 2QL1A 1RZJL 3X3GH 1QYGL 2B1AL 3UTTA 5CEYB 4YHYB 5I17A 1PJ9A 3IFOA 4HLJA 4Z7VB 5KS9A 1F00I 1DBAL 1Z0MA 2DM7A 3CUPB 1BOGB 3VGEA 3FQRB 2O5XH 4N9OB 2A1WL 4NFDA 3H9SE 1HH9B 4YPGB 5TDPB 32C2B 3W2DL 1MQKH 2AKRA 1I7UA 2BVQB 5DMGC 4NQEA 4GRWE 1WGOA 4OAWA 5CEZE 5IB2A 4ZFOA 1K85A 3BDYH 1OAYL 4F2MB 1KEGL 3RL1B 1JRHL 2A6JB 2HG5B 2H2PD 4MA1B 2CQVA 5EO9B 4MXVF 4JN1L 4K8RC 4KQ4H 4JZJC 3OG4B 5C3LD 1R5WB 4Y2DD 4HT1H 1N26A 3W0WA 5ICXA 4XC3L 1IGML 1LD9A 1CXHA 3LCYA 2OYPA 4IMLA 1U3HC 3H8NA 5E6YA 2ZOLB 1XZ0B 3IXTA 4GAYA 3M1BB 2WLYA 3FONB 1OGAE 3NCJL 4MZ3A 3CZJA 4PGZA 2OI9B 2NY6D 4TTDD 4AT6A 3HUJA 1VADA 4D9RE 4RMVA 3RA7H 3SGKC 4OZFB 4PGBA 4X6FA 5JHDD 4HIJB 1MH5B 1AO7B 1R0AL 4F58L 3H9SD 4YHIB 4K8RH 4JDVB 3W9DB 4J3TA 2H2SD 4LCIH 1IGJA 2CXGA 5EA0H 8CGTA 3QDME 3QEGH 3SBWC 1K4CB 5B8CA 4KPHL 3MJGX 4FNLH 3RNQA 5A16A 2P5EB 3TBVB 2FO4A 5LGHH 4NKMB 5A3ID 4YBHA 3PWNB 2XZAL 3FT3B 3KPNB 4FTVA 5LBSH 3PNWB 3PXHA 5F7MC 4AEEA 4LSRH 3E8UL 2CLRA 2VABB 5ICYA 3GIVB 2FR4A 1E6OL 2GJ6B 3U0TB 5IVOA 5K93A 1KCUL 3MCG1 3AMLA 1FAIH 3STZA 3IU4L 5JZ7D 1N64L 2R29L 4ZUUB 4LLVB 2CRIA 4OCSL 4UT9H 4N8VG 3SCMB 3WSQH 4FQXB 2DQHL 4XB7A 2VLMD 1G6RH 1SMOA 3VWKB 2P8PB 2ILLA 4CDHA 2R23B 3SY0B 3N9GH 4CVUA 5CP7B 4W6WB 1K8IA 5D7LA 5I0ZA 3LZFH 4UT7L 3QXUA 1KCSL 3O6KH 2BNQE 1RU9H 5FM4A 3BZEA 5D93B 4OZGA 1Q9LA 4S2SA 1ZEAL 2AXFB 4J7RA 5D1XA 4EN3D 4PJXB 5D2NE 3RI5F 3C6LB 4ZUTA 3IDNA 5HPOA 1J8HD 1KJMA 4OZIA 1KNOA 1HINL 1RZKL 1CFTA 3VFRA 2D7QA 3ELAT 4NJAH 1BZ7A 5TE6H 4JRXD 2EE2A 5EC1B 2DI8A 2PETA 2EH8L 3O6FC 3BYYA 3MR9A 5DJXB 2A2QT 3KR3L 3MRBB 5JIIA 5EBMA 5J89A 3QSKB 2HFFA 4N0UB 5B4MC 3HI5L 4RRPA 1QBLH 1WVZA 1VEOA 3QEUA 1KLGA 3F12B 1PW3A 4OCRH 3HMXH 4LEXH 5L6YL 1KPVA 4X6DF 3VH8G 3U0PB 2J1KA 2X10A 4CNIB 3R1GL 4XP5H 1N3NB 1UXSA 3HI6L 3QDJD 1IJ9A 3KYKL 1EPFA 1ND0A 2V17L 35C8H 2ZWLT 3L3OA 4NNPH 4KKAC 4L4VD 2BSRB 3NZ8B 3WUZA 4PFEA 4HFWB 1JGLL 3EHBD 4O02H 2BERA 2ZSVA 3C60C 5D70L 4GQPH 3ZE0E 1T83A 1E4WL 1AXIB 4FHBD 2JCCA 5CD5C 5DD1H 3PE9A 3K3QA 2JJTC 4Y0GA 5HGDA 1AHWA 1KXQE 1ADQH 1AD9A 3GSQA 5SWSB 1OB1B 4NN6C 2NY5C 4XZUB 3D2UB 5IGXH 5F89B 1XF3B 5DFTA 5D8JH 43CAA 1H3XA 3DROA 3L3JB 2QSVA 1NH6A 1P6AB 3U4EB 4GRLD 2EYRB 1EFXD 4U7SA 1I1YA 5HY9B 4QXTB 3TF7C 1SJXA 4G8IA 4NGHH 2A77L 3WFHA 3BIKA 4R26H 5F96L 2EO1A 2X4TB 5C0GB 2GITA 3U7YL 1Y6KR 3KPQB 5DHVH 4POYA 4M6AA 3QDJE 2XI9A 1F4AA 1BAFH 3TIDB 3L3IA 3BRGC 4U1JB 5GHWL 4W4NA 2NY7L 1Z9LA 4FQIH 1G0DA 4ZUVB 3BRDA 3QHFL 1I7RB 5ECJE 4YBLB 1JNHA 1W8NA 3TA3D 1GJIA 3RVTD 1J87A 4HKZB 4HLZH 1L9NA 4KQ4L 2W0PA 5CEXA 3BD5A 3AREA 1N0XL 4BSVA 1AY1L 4BKLA 3V6FB 5H2BA 2ZUQB 2FH6A 4P4KD 4ZXBD 4OLWH 1KGCD 3HNTL 4UTAH 2P5WE 1KJVA 5DRZA 1LE5A 2APTA 4HWZB 3RVXD 1L7TH 4ZFFB 1T7XA 3LKPA 1I1FA 4Y2DA 1DQJA 5F7WC 4TOYH 5TH2B 3U1SH 4OD1H 4KUZH 1ITCA 3QQ9C 1S78C 1AO7D 4KJWD 4DOHB 5JIPA 2DICA 2JKXA 4M93B 3SJVA 2VXVH 5CD5D 5DC9B 3ARQA 3HI5H 1W0YT 1ZLUH 1U3HA 3C09B 3GMQB 5HVGB 1FFPA 3F7QA 4DN4L 1KC5L 4GAJL 1RD6A 5DFVC 4MB5A 4HXAL 3AB0B 5DQ9A 1JNLH 3PABB 2W65A 1EXUB 1NMCB 1KTLA 3PWVA 5IOPA 3VW3L 3LKRB 4ZPVA 2Y07H 3S88L 1A7OH 2J6EH 4MJ5B 3QO0B 3GB7B 3UMTA 2R39A 3LKNA 1G7IB 4XAWH 4ODUB 2HRLA 1KEML 2NCMA 1L9MA 2W92A 1GGIL 2J88L 4GRWB 5D2NA 4EI5A 1K8DB 5GRUL 4LVEA 4JZOB 4OZIE 4JO1L 4QOKE 1BOGA 2LFGA 3WXWH 1CI5A 2OZ4H 2R0WH 5TDPA 2Q76A 2E7LC 3G5XB 1HKLL 1I7UB 2AKRB 2GK0A 4RIRA 2R0LH 4NPYA 1FO0B 3PGCB 3CLFH 2VLJB 3EYQD 4OTXL 3WCYA 2VDPH 3WFBL 4F2MA 2BNUA 1BEYH 3IDUA 1JZ2A 2A6JA 4JFOA 4L4JA 3CFEB 4PJFF 2FLRT 5F1NB 1CTNA 5D7IA 4GAGH 1BBJB 4DZBB 1OGAB 3QQ9D 5KBNC 5MEQB 3DXAB 3TWCL 5IBTL 4LRNH 4Y16D 5EB9A 1LEGB 4LRNL 4IRJB 4QHNB 4WU7B 2PYED 3BUTA 2QSTA 5CBEA 5KSAB 4XMLH 4JFQA 5DYOB 5KVGH 5EUOE 2RCSH 3BE1H 4F9LA 4NJAL 5IW3A 4JJ5B 4NQVA 5HJ3A 3HNVL 3GJFH 3BPOC 3WUWA 4X6DA 1IAIL 3D9AH 5C7XL 3FONA 4W70A 5EIIB 3STLA 4PTTA 1I9RH 5DA4A 2WAHA 2EDKA 1W0WB 3OL2A 2GIYA 2LAGB 4G80B 4P2OB 4E5XB 3HMXA 3STBA 3UTZB 1AGFA 1NBQA 1RZ8A 5BS0D 1HQ4B 4RNRB 1B0RB 4XVUC 4PB0H 4J2XA 2NY1B 4UDTB 4HKBA 4RISH 1SEQH 3BT2L 2QADD 4M7LH 5IB5A 3BPLC 3L5XH 3WMSA 1EMTH 3LB6C 1NCDL 1C1EH 5IHUL 2G75A 1CF8L 4JO3H 4P46D 5EOCH 1L7IL 3TN0B 4NHUA 5IIEA 5L2KA 5DRXA 2VIRB 4GQ9L 2RGSA 3A6CH 1S7XB 3LD8B 3V2AR 1CE1L 2YS4A 5DJCA 1B9ZA 1G9MH 3UYRL 4R97C 1YMME 5GGUA 3FB5A 4K07A 3N85L 1FC2D 1P2CB 5SWQB 2BNQB 3H6JA 3VXME 4MAYC 5D7KD 1NLBL 3Q3GB 3THML 2R1WB 4AENA 3EYOB 2O61A 4U0QB 5EU6A 5AZEH 3SQOL 3VH8B 2YD1A 3BGFC 3V7AE 5BMFL 4KJQC 2QQQA 1EIBA 2IPTL 5ISZD 3MNWA 3H0TB 1YNKH 4KRNA 4NJ9L 2JLLA 5CP7A 1K8IB 5D7LB 5DHVA 3O41B 5GS1A 3ULUE 4LSQL 4M93C 3UJJL 2WINA 1X4YA 5CJQH 4U1KB 1XGTB 2EDDA 1RK1B 3P9LA 1YYMH 4KK9D 3CDFA 3BH8A 4PP1C 2LVEA 3ZDYF 1A7QH 4Z7VF 1F13A 1BEYL 4G6FB 3SDXF 2LABA 3BP6A 2FATH 4C56D 1MFAH 4MA3A 1GCFA 1CDCA 3CGTA 1F3DH 4RMSA 1P4BL 1GC1L 3QO1B 3QI9A 5BRZB 2X89D 1CG9A 5FB8B 2EKSA 1AC0A 4QRRB 4M8QA 3X14A 3CFIC 1IARB 4QY8B 2G9HA 3OG6B 2AK4D 5SV3A 4ODHL 2CMRH 1JYWA 4GSDH 5LGJB 3H3PL 5HDBF 2H3NB 1R3KB 5KZCD 3PWLB 4L3AA 4DVBB 1JGUL 1IGTB 5LBSL 4UV4H 1N3NA 1UXSB 3DUSA 3DYPA 5B38A 3D0VA 3VXUE 1LHZA 2YMXL 3D3VD 4JR9H 3EFDL 3EKCA 1QHPA 1H15B 3MV7E 3OBAA 3SE3C 4DVRH 3SO5A 2ZSVB 4HUUB 1JNLL 3UP1A 1KBGL 4QRUB 3CU1A 5INDA 1RZFL 3S97C 5IF0B 5I74B 2BSSB 3BH9B 3TZVA 1U8MA 1BBDL 4X7SH 4NQDD 5HHNB 4KHTL 3WXVL 5HGDB 2N4IA 4KH2A 2DIJA 4NT6B 1AD9B 1L7IH 5FGRA 3MRIB 4URTB 5EZJA 4QRTB 1QBBA 2EDWA 4CVZA 3MA7A 4JKLA 2I9LA 4Y19A 1JF6A 1MHCA 1GL4B 1UKTA 4GBXC 3WIFB 1CZ8H 4UIKH 4A2LA 1MCQA 4Y8AA 1HINH 4KK6D 4ZSOA 1REIA 5MP6H 5F93C 2KZWA 1CYGA 5F7UA 5F9AC 2BDNH 1BVZA 1C8PA 1KN4H 4JANB 1G7MB 3VG0H 4ONOA 4GLRI 4WHTB 5TQ2L 3RWEB 4Z7OF 1UKQA 5F8RC 4KUCF 2IJ0C 2QKIB 1HZHL 2R2BA 4OFDA 3P73B 4RGMC 1J1XH 2F53E 1D9KC 3WIIL 2VLJE 1X5ZA 1R3LB 3D3VB 5D9SB 2LV4A 4GMTL 3O4OC 5CEXB 1LDSA 3RY6C 5D7JB 2YBRB 1UH3A 2NY5L 4RGNE 1FZOA 3OKNA 5FA3B 4NQDE 3CAFA 3D85B 4KGLA 4LCYB 4UZGA 4L4VB 4FZ8H 1FYTE 5D2LA 5EH1A 5DURB 1WBZA 2HJLB 3C60D 4HMEA 3WNPA 1FFOB 1LE5B 4DGVH 5A2JH 1A3LH 4BA8A 1QPXA 3BO8B 1ZHKA 1NKOA 5DUMH 1Q72H 4P0DA 4FQ1L 3U7AA 1BZQK 2BMKB 1C12B 5JO5B 2Q86B 3O3EB 3PQYE 3U46A 2BVPB 1RULH 4PJDE 5E2VH 2V5SA 5LXGL 1OAZH 3V79C 1FNFA 3C8HA 5DD3H 3OKDA 3I6LD 4IRSA 4C54A 4F15B 4R2GD 2ARJQ 3DX6A 1WIUA 3RUGB 3FFDB 1J0JA 4MNGE 1SEQL 2EDJA 5TF1H 2E7CA 5F9DC 3KPRB 2Y36L 1EMTL 2W59A 4GW1B 5BXFA 3MV9B 3B8YA 3AS2A 4J6RH 2H26A 2IALB 5GGVL 4MCZA 2AGJH 3DBXA 4MAYD 2XZCH 3GUTA 1WC7A 5BW7C 1ZVSB 2E9JA 5F44A 4IDLA 4Z7NE 2EXYC 3ARFB 2RB8A 3LH2L 3GKZA 4U6TA 4LAQL 5GJTH 4LPVA 1GGBL 1CVRA 4M7LT 4HV8B 3NIFE 3LEYL 3NACH 3T0EA 3C5ZC 1PX3A 4HS3A 5LWYH 1F45A 4U6XA 3BP5B 3QDMB 3TBTB 4PIRF 5CWSB 1LO4L 3QP3A 5D7JC 1H3VA 1BD2E 1ZHLA 5IB4A 4ENEC 2F8VA 4XXDB 4JHBA 4TRPH 5DUBA 2DLHA 4FNLL 1G9ML 5CD3B 5IR1B 2R1YB 3D25A 1JTOA 1MJ8H 4G3YH 3QUYC 4ELMF 3DV6B 4JRXE 5J9PB 3OMZA 1HHGA 1V7MH 4DZBA 4RGNC 3RTQA 3DXAA 5AZEL 1J86A 5DD0L 5ITBH 1EZVX 2O5YH 3H7LA 5LKNA 2OL3A 2HAZA 4WNQB 3IVKB 4IOIA 2D9QB 4HUKB 5DYOA 4ZAKA 5HDQL 1DLHA 1HHKB 3ULUL 5BO1L 5F6IB 4JY5L 3UZEA 2L7UA 2OJZL 1ZA3B 2EXWC 4HKXB 1Y18A 3B3IA 3WUWB 1WQVT 3L1OH 4JZJB 4X6DB 4PJ7F 1P4BH 3ORJA 3G5VB 5I1GH 1C5BL 2W07A 3RY6A 2IC2A 1OPGH 3QULB 4JFZL 1Q0YH 5EU3A 5C0DB 1NEUA 4ESKA 5E9DD 3UX9B 4P2OA 1ZANL 4E5XA 3BHBA 5CJ8A 1TJIH 1MLBA 3GHEL 3V7AG 4R7NB 4Z7WE 3W11D 3RWCB 5D1ZB 4WGWB 4TVSa 3QIWC 5JQ6H 4B0MM 5GIRA 3QI9C 4PJEA 5C9JA 1R5VA 4U3HA 3S5LG 2WWMC 3U6RA 2J2ZA 4H88L 3V6BR 1MVFA 4I2XE 1IVLA 4OFKA 5GISL 3TN0A 3G04B 1NANH 2IADB 3JTTA 3KJ6H 2VIRA 5I8KL 1ONQB 4X6CE 5TE6L 3QCTH 3S36X 3LEVL 4EEEA 3EZJB 3LQZB 3BD3A 2NY3C 1OP5H 2VN4A 4M3JA 4G6ML 5DMGD 3H7BB 4JGUA 3RVXC 3FB5B 4M1DL 4JRYD 2JCCE 2X4SB 3Q1SH 1KIPA 3VG9C 3ULVE 1CK0L 4FXGB 3LMJH 1BFVL 1PG7W 2C26A 5T5NG 4Z8FH 4XTRD 3C6SA 2CDGA 3ULUF 3SGJA 1HDMA 3PG2A 4YFLI 2VLLB 3KNBA 4NQDA 3SPVA 2ICWI 3QBTB 4ONGH 1MCPH 2CLZA 4S1SL 4JFED 4MGXA 5DHVB 5JIHA 3O41A 4D9LH 5KVGL 4LCCA 5IBUG 3VXTB 1MJJA 4H26B 4G9FB 4X5XB 3VGFA 1MFDH 1J0KA 1AXSA 1RK1A 3VXMB 1CDIA 1YY9C 4XC3H 1G84A 4PJDA 3BH8B 1X5JA 2P8LA 3W5MA 4X6CF 5E08H 4I3SH 3ZL4L 1MIMH 1I3GH 1TITA 4NQCB 5T5FH 4PJIF 2BVOA 4WHYG 3M17B 3QNZB 1MRDH 3ARDA 2XG4A 2OZ4A 1DFBL 5HDBE 2VXUH 1M6OA 5BRZA 3NCCB 5CGYC 1B4RA 3G9AB 3V9FA 1ORQA 4PY8I 3ULVD 1CF8H 4R97B 4QY8A 3VD4A 2GT9A 3RDTC 1TZHA 3F7RA 3LD8C 3ZE1F 3QXWA 3DETC 4KDTC 1VPOH 4OQTA 5D5ME 3ECBA 1PEZA 1IGTA 4I0PD 1A6ZA 3HZKB 1RULL 5E2VL 3DO3A 1QQDA 3S6CA 5CSBA 1S7RB 1OHQA 4Y4HC 4M02A 4NKDA 1HXYB 4PJGB 3RVVC 2GUOA 4GG6B 3R06B 1W2KT 5GS0H 2DI9A 1B0GB 1NFIB 4FTVE 3WS6C 4KKCC 1XGRB 4U1HA 1KUMA 2DQGH 4JGMA 4MA7L 4FFWC 3IXAA 5D7LD 3I50L 3O3AB 1HH6A 4I9WE 3VD5A 1RQ5A 3QRGL 4CVZB 1SM3L 3RGVA 4UDUB 4DTGL 1R3IL 3GSRB 1PYWA 1T1XA 2UYLB 1D5BB 5I66B 1HCVA 1KELH 1U3JA 1WEJH 5I15H 5J1AB 1BQHA 1FQ9C 3WFBH 4M3KB 1PLGL 3C09C 5EZOH 4Q6YA 1ZGLM 5IUSA 1MVUA 1J8HA 3NPSB 4HGWA 5FKAB 5D5MA 3QUZD 5IESL 3QAZC 3I75A 2PN5A 3AS1A 3FKUS 4X99B 4ZQKB 3X13A 4OI7A 4PRPE 3SOBH 4OCNC 5EBGA 1CTOA 4CMHC 4XBEH 1JF5A 1Q94B 5D1QA 5GZND 4XMLL 3N1GC 1FYTB 2C1PA 4NCDA 5TPWL 4YHOH 2KPNA 2Y5TA 4YHOL 5HVWA 3HZVB 4Y89A 3VGAB 4F57H 2AEPL 2DKSA 3CLEH 1MFDL 1CICB 1P5VA 5E5UB 3RPKA 4WHCA 3GO1H 1OARL 4I0CC 4S1QH 1MWAB 2VDRL 5TE7H 3LAFA 4YDKH 5H37G 3IU3A 1YNKL 1WBZB 2HJLA 5E24E 3OAYH 3CXDL 5KSBF 5EBLA 1CGSL 4JHZA 4ZUSA 4P99A 1UADC 2FWOB 1RZFH 1U2HA 3T0VA 3MRQB 1BOYA 4W6XB 4WVRA 4WTZG 3GMNB 5DJ6A 2MKWA 4AEFA 1JGLH 3AB0C 3FFDA 2BRRL 3P2TA 4PJAF 5JIKA 3JVGC 4LCIL 1OAKH 3HG1D 3SN6N 3OHXA 4X4ME 4NQXA 4NKIL 1XGUB 3HI6H 1DN0B 2H45A 3RDTB 4PBWD 3DBXB 2PYEB 3PDDA 3S37L 2Y6SD 3VFUA 1KFAH 1T5XB 2H6PA 1I8MA 3DX8A 1KN4L 1BD2B 4XVUD 3KYMB 2NR6D 2VTFA 4XVSL 5FA4A 3S34H 2MCG1 1S7WB 3L3GA 3MV7B 2A77H 4EI5C 1TIUA 2DQGL 4HS3B 3A67H 4U6XB 2UWEA 2WM0A 5SV4A 1BWWA 2GJ6D 5D6CB 3T0XA 1R3HA 1FCGA 1N64H 4S1RH 4BH8B 4LRIC 1I3RB 4HIHB 1I4FB 5DZNA 4GRWH 4LFHD 5GSRA 2C4FU 5C07E 4CU6A 4S1SH 5KS9E 5IM7A 4JZNB 3IDYB 1U8HB 4HH8A 5BZWB 5IR1A 4X7SL 3LKQA 3OZ9H 5HDOA 5C0FB 3UTQA 4J12A 5MEND 1DVFB 1N0XH 2PKDA 2HRPL 1BFVH 5C7XH 2X05A 4R90L 5TJWK 4OFPA 4FQJL 1ZEAH 3ESVF 3V5KB 3IF1B 3IKKA 3O8XC 4WHYH 4KWUA 5IW6B 1QD0A 1MJ7H 4P3CL 2XN9D 1HHKA 3UPAA 2FYYB 5CILH 2HFGL 2PUQT 4X9IA 4AY0A 2R0ZH 4A6YL 2VLKB 2WP3O 3GBNH 3KPSB 1OLLA 4MXQC 3G5VA 4Z7WF 4X9HA 3J7HA 3W0WE 1N8ZB 3D3VE 2V7HA 3MXVL 3RY5A 5C0DA 2NY0C 2EIZB 5I73B 1IM3B 3EJYC 3ARDD 3BHBB 3GNMH 1IBGH 4I3SL 4MNQB 3RIAF 4LBEB 1SBBA 2IFFL 3SDYH 3ZKND 2R8SH 4HF5L 4PJ8D 3M07A 5D1ZA 1ZTXL 5MEOA 1IGFL 1U8LB 4CAGA 1IGFH 5HGHA 3U1SL 3QIWB 3N1PC 4ERSL 4NDMB 1LE9A 4PLJC 2OTWB 2ZCHH 4PJIA 3IFPB 5L88L 4EUPH 5DS8B 3FB6B 3MBEC 4KZDL 1A7PL 4NRXB 3QDMD 4GRMA 3GMRB 4U1IA 5J6GB 3FZUC 5I0DA 2BY1A 4OV6F 1YY8B 3NZHH 2EZ0D 4ODVL 1NFDB 1R5IB 3KJ4B 3MRFA 1I8IB 3LV3B 1EVTC 4YFLF 1FV1A 5T3ZL 1MCIA 2XWBB 5J13C 4UIKL 4Y5XC 5LXGH 5JPMB 3MYJB 2QQLH 5T33L 1QTYT 3TBWB 5L2JA 1FZKB 3MROB 4JM4H 3RZCA 3QIBC 4Y5VC 4ZMAT 1IGIH 1GZPB 1JP5A 2VLLA 3QXTA 3KNBB 4NQDB 5DJYA 1GZQB 3MOBH 5BV7C 1P4LB 2H41A 3L3DB 3G9VA 5JW4M 2A6IB 3QNXA 1D5MA 5AG8A 3MLRH 4NGHL 2AW2A 4WU5B 4GMTH 4JPVH 3B5GA 1JNJA 3GSNL 4Y16B 1ZLWK 5IQ9B 4ZSOE 4M6NH 3WNNA 4MJ4A 4LRIA 3VXMA 5CKGA 1SY6A 3MC0A 1FG2B 3WHE0 4IDJH 4ENED 3LPFA 4X7DC 3OZ9L 1CFVH 1GRWA 4PS4H 3L3KB 1GPOH 5C0RL 5EULV 2XPGB 3D39D 1MCOH 3CFJA 4ORGB 1J8HE 4HIEB 1SEBB 2NTSP 4K71B 3HR5A 1XR8B 5DD3L 1TVBB 5CFHA 1OTSC 4K7PY 2WBJA 3GBNL 2GCYA 1S9YB 4X0KA 1ZLVH 3MYZA 3U2SA 3MRJA 1A6ZB 3HZKA 5F6IC 1FL3B 4N0CD 1QBAA 3G6AB 3N1QC 4KROD 1QBLL 1ROWA 1VGKB 4PRHB 1H8NA 3NCYP 4RGNB 1J88A 4PRDA 5CJ5A 1W72H 2VLME 2APWA 3OKEA 1R3JB 3AS0A 3ETBF 1T6VN 1NFIA 4EI6A 3GDBA 1SYVB 3HS0B 4KPHH 1XGRA 1FAKT 1JGVH 3MA9H 4OD3H 4U1HB 4G43B 2ICWJ 2D3VA 5C0BB 3C5SA 4LSDA 2AXGA 3VD9A 5J11B 4OT1H 4HPOH 1S5HB 2E9IA 3RWGB 4O02L 1E27B 4P2CG 1T1XB 4R4BA 1F4YH 4JY4A 4LGSB 3UAJC 4UU9A 2IMNA 1BQHB 3DECA 3ZL4H 5HHXL 4ELKA 4JFFD 1ZT1B 2AJ3A 1NAKH 3TH2T 1MCFA 1LK2A 5TF1L 5DXWA 4WW2B 4UT9L 1XGQA 3MREA 1QSEB 4P57A 4JHAL 3ZTNH 2DKUA 5FKPB 3BP4A 1AE6L 3TIEB 5LAXB 2ESVA 4LMQI 1Q94A 5D1QB 2Z93B 5C0EB 3CVHB 3EJZC 1OTTD 5FO9B 3IKCB 4D0BB 2ICWB 4JVWA 4LLYB 2BFVL 1T89A 4J1UA 3VFPA 5K9KB 4N8PA 5BZDB 1AFVH 3DMMC 3VMPA 1RFDL 4XBPA 4HZLB 5F7DA 5ADOL 2MOVA 3F58L 2ADFH 1CQKA 5F7NC 1MOEA 4U6VL 5KSUA 1WZLA 4KKNA 1QLFB 2A38A 2NY0B 3GJEB 3MODL 4LKCA 1UJ3B 4ZG1A 2E8ZA 3V5HA 4J3WA 3WD5H 1EO8L 1JYXA 5HI4C 4H88H 5ENWB 4DZ8B 3HNTH 4CKVX 1MRCH 1YYLL 1HN1A 4G8GB 1RZ7L 1AKJA 3VXOB 1EAPB 2BNRD 2VNCA 2UUDH 5DJ0B 3AVEA 5ANMA 4OFIA 3TZVC 4EUPG 3L5XL 3KYKH 3RWHB 1DN0A 1IGMH 2YMXH 5E2TL 2C3WA 3K80A 4P9HC 3IDYC 5J06A 2FZ3A 1YEKH 3I9GL 1ZA6A 2X5PA 2H32A 1JUFA 1NCBH 5FGBA 2I25N 1HHJA 1NDMB 1YEDA 3ULVC 4WEMB 3IFNH 3D18A 3ARGA 1GAFL 4XCYA 3RWIB 3O45A 1U8OA 4HUVA 2XXMB 2IAND 3FO1B 3KDMA 4RFNC 2APXA 3FT4B 3UC0L 4U1MB 1U3ZA 1QOKA 2R56H 3ZO0A 1WWAX 3V6OA 2E7LA 3I6GA 3TBYB 1QNZH 1D6VH 1IEBB 1MIEH 5D8JL 1KEMH 2WV3A 4QRSB 1AQKL 1JK8A 3T77A 1JYNA 1OARH 2P5WD 3WKMH 5IVXE 1T0MA 4J4PD 4R7DA 1FDLH 4JB9H 5IP4A 3CD4A 1U8HA 4ALAH 1KIQB 1VFOA 1WAAF 1OW0A 5C0FA 4U6HB 3IDMA 1WF5A 2GJZB 5GGVY 4ZD3L 1GGCH 1H3TA 2ORBH 4C4KO 1J1OL 1FVCA 4G6KH 4QEGA 1QG3A 4FP8H 4UQ2A 1P1ZA 3CLFL 5IW6A 4P2RB 5ITFA 1CXKA 2J8UE 3QUXA 5A2KH 5D2LE 5KVFH 4H1LH 3V7MA 1I85A 3FT2B 2CPCA 1VPOL 3HRPA 3MQIA 3KPSA 3IU4H 2EDHA 5D7SH 4JKWA 5CJXC 2DDQL 3BEWB 5HGAB 4WEBL 4LLDB 4D0CB 5FOBB 3QFDB 5C92A 1XF5B 3FB8A 1CU4L 1ADQA 1CU4H 4MA8H 1RZJC 4X98A 4QCIA 3G08A 4IRSC 4LBEA 3ZKXB 1UB5A 2HT4D 1I1CA 4V2CB 4JVUA 2EH8H 2F54E 1MEXH 1UM6L 3VGGA 4BQ9A 1NBVL 1I9RL 4WWKB 4UV4L 3EFFB 4PJ7E 1DQMH 1GC1C 4KTDH 3RPIB 3G5ZB 2J7LA 4RBPK 4DQOL 1LEIB 2NX5D 5T1KB 5J6GA 2CDFA 5F1IA 1AR2A 1YY8A 4PRBA 3OAZK 5EFIA 1SJHA 2MQCA 3C08H 3RWFB 3VXRE 1WCBA 2XWBA 1DVFD 2F5AL 2UY7A 5FOJA 3WXVH 4OT1L 5HDLA 5DRNB 1TCRB 3O8XD 3DWTA 4IRJC 2VLRE 3DSFH 3SBWA 4GQ9H 4G6AC 1GZPA 3NABL 3U7WL 3CMGA 1HSBA 5JR1L 5GJTL 1Q9WB 5E5RB 4POUB 3TLRA 3EO1A 1ADQL 1A7RL 1KB5L 3TNNA 3WFDL 3NIGE 2VDQH 2N7BA 5IQ9A 4DK6A 2BDNL 5F6HI 3SDAC 1SHMA 5FYJH 5I1CH 1IRAY 1S7SA 4K23H 1B0WA 1EV2E 3FB7A 4AEHL 2F74A 4XCCL 5BS0E 4JY6B 5KAQF 4FQ2H 1ZAGA 1MI5D 1WAAA 1F11B 1MCJA 2PO6D 1JN6A 3QIBD 2NR6C 3DVNB 3GMPA 2NXYB 2EE3A 3GBML 3MJ7A 4XHJD 1I7ZB 2D7PA 4Y2DC 4XGZA 2NYYC 4XX1G 5E9DB 3CFJB 2NMSA 4RMUA 3ES6B 3LQAL 1ZANH 4MS8C 4F7CA 4C55A 3LQAH 4U1GB 3SE4A 1QSED 3F5WA 1SEBA 3GKWH 4P2OC 1TVBA 4L29B 1G0XA 3BQUC 4C56E 1ACYL 1IGYB 1BVKB 3B6SA 5CZXC 2XXCB 2PTTB 3TA3B 5J57B 3MLPA 2WWKO 5DVMA 1S9YA 3ZKMD 2GYSA 2YD5A 1AD0A 4QTIL 2G2RB 3GK8L 3MRJB 3QEGL 5J12C 3VXNB 4APQA 3U9PH 2ITCB 1FVEB 4PJEE 3WHE1 4PJXF 4HDIB 3VRIB 2J3SA 3G6AA 2OMNA 3QWRD 3V6OE 5K9OB 4I3GA 4Y4HA 2BNRB 2AEIT 4DAGL 4PGDA 1NAMH 5ISZE 3OKEB 4JN1H 4FQCL 4NYLB 2VDNL 3OKMA 4EI6B 3BZ4B 1RI8A 5I1IL 4BZ1H 1AY1H 1AGEB 2XWJB 4HSQA 1TTUA 1OTSD 2K7PA 3O11B 4M62L 3W39A 4J6RL 4JHWH 3K4DA 2MFNA 3GMLB 4PV9A 1CLZH 2CIIA 1YMHB 2NZ9C 5FV1L 5TF0A 3MRKA 3RWGA 1Q9KB 5T3XE 2X2YA 1E27A 4AEIL 3LEVH 3AAZB 1KB9J 2DQHH 4DOHE 4PJBB 3W9EA 1EHXA 3V8OA 3T1FA 2EICA 4D9LL 1A7NL 5ACZB 2R9HD 1I9JH 5DMYA 1UT9A 3GJFA 1ZT7B 4QRRE 1H5BA 1NSNH 5AZ2L 4EBQH 1AXTH 5GRXG 1CGYA 3KPSE 1CK0H 1CVSC 4PJXE 2VDOH 3SKJH 2P5WB 5DJZB 1KTDB 4YQXL 4DN4H 4GUPB 1EEZA 4AJ0A 4LPTA 43C9B 4OF8A 3VFOB 3CH1B 2X4OA 2XN9E 2AK4E 1F58L 5I8CB 1IZKA 1G7QA 1NL0H 1S5IL 2HVJB 1A7OL 4IBLT 3SQBA 5KS9F 3NFNA 2VKXA 2EXWD 4M61B 5ADPL 4J1UB 4HUWB 1RK0B 1T5WA 3PWUB 3DETD 1INQB 1MIEL 1NLDH 2P7TB 4M8VA 1J8KA 3QDGA 3QHTC 3WO4B 3I2CL 5AEAA 1HE7A 4NN6B 1J1XL 1IBGL 3OV6A 3MV7D 4WFED 2QQKH 5HHPB 4LLQB 3MLRL 1EJOL 1OGAD 1FAIL 4X8XA 4MAUL 1WK0A 4D9RD 1X9QA 2YD8A 3O2WH 5FUCC 2NNAB 1JZ3A 1UA6L 1HI6A 5IV2A 5ESQA 5ESVB 2YXMA 1CGWA 3D2UD 4DZ8A 5DGRA 3VWJD 4KDVA 3OGOE 4JREB 1HKFA 1O7SA 2V2WA 1IGCH 3Q6FB 1MJUL 3F6IA 1RHHB 1H3WM 5ANMB 2JK5B 1CFSB 1CT8B 1JHLL 2DDQH 3ESUF 5JHDA 5IEKB 3D0LB 5B3JE 3B5TA 5JW3H 3EHBC 3LS5H 4DAGH 4CL7A 1YPZF 1JZ8A 1ZA6B 4GMSH 5E8OB 1IQDA 3QIUB 1CBVH 1X3DA 2ZUTA 1HHJB 3QEHB 1NDMA 2VLKD 5EIQA 1IAIH 1MLCA 4QHMB 5F97E 3FOMA 2AP2A 4PD4K 2Z8VC 3DOSA 2VAAB 2OK0L 2XZCL 3PL6B 3QPXH 2X4RB 1ZS8A 4MNQD 3Q5OA 2I9TA 4V1DA 2OX5A 2FX7L 1CE1H 1UZ6F 2IAMA 1JK8B 3T77B 2DMKA 4Q9BA 1RIUH 4KI5E 3S3JA 3C87A 2LAAA 3CMOH 1NKRA 3U36B 2BNQD 2PYFB 1U42A 2QEJA 5LWYL 4W6YB 5CILL 4OF3A 5EOCL 1TMCB 4RA3A 3DPBA 2FX8L 2YC1A 2FECI 3H9HA 4KQ3H 2P8MA 4S1QL 3NZHL 3DVFA 5JOFA 1DQQA 1S7TA 4B7LA 2GEEA 5AAWA 3VD7A 3MMEB 2VXSL 4FQ2L 5GSVB 1BM3H 4WUKH 1FO0H 1LMKA 3QRFM 3MV8B 3ZE2E 1JZ7A 4OGAD 5C0AA 3SKUD 3F6LA 4X9GA 3WFDH 1T6WA 1XMWA 2G5BB 5B3NA 3P30L 5DR5H 3K4ZA 4L3EA 4HIIA 4YPJA 1NJ9B 1EJOH 2CLVA 1CFNB 3EOAB 3S98A 3O6ML 1UCBL 3DVIA 1K5NB 2IF7A 2IG2H 5CHNA 5C0JB 5I18H 1QR1A 4U2ZA 4FQ1H 4QYOA 3SKNB 3DO7B 4OIAA 1WBXA 2OXGA 1EHNA 3IFNL 1YN6A 3LB6D 1S7QA 1OWRM 4L4VE 4ZODA 2C4FT 1YPZB 2FEEI 1YJDL 1KPRA 3W5NA 1D9KB 2DQJL 4JFYB 5HGBB 4N8VB 2X89A 1INDL 1QNZL 3NIDE 2CDFB 4NNXA 2ZCLH 5E1AB 5DI8B 3QB7C 3OKKB 2J8UB 1KGCE 3DURB 3QDJA 2R15A 4J8RA 1D5XB 4TTDC 1A21A 4UTAL 5C86A 1OP5K 4K55A 4Y4FD 3WLWD 5F6HJ 3ZTJG 2UWEE 3ZDZE 1BF2A 2R0WL 1U6AH 4JKPL 2R0KL 4GRLA 4AG4H 1D6EA 3I6KB 3P9MB 4QRPB 3IJSB 3QZWA 4F7EA 2I5YH 3N9GL 4PY8J 3EO1B 2YA1A 4OTXH 3ZSSA 4KJYA 4P5MA 1U8PB 1EEQA 3EFDH 4NO3B 3W2DH 1B88A 5EOCJ 3B9KC 3MUGA 3RIFF 3SGEH 5E4EC 4Q6IA 3QEQB 4XMPH 4PUBL 2EC8A 4PG9A 1XF4B 3ZT7A 1LEKB 4XVJL 1B90A 4RQQB 4XVJH 4A6YH 3H2WA 5B4MD 1I9JL 4L4TE 3UBXI 1OP3K 5EORL 1NLDL 1EUTA 2APFA 1FE8L 1EGJH 4YK4B 1A6WL 3L5WA 3PP4L 5I2IA 1A6VL 5GGRY 4UUJB 1NGWB 4NC0B 2VN7A 5FUCE 5IB1B 2FEEL 1BFOA 5I17B 2BNRE 2PTTA 3TA3A 3AU1A 4N68A 2WBWB 1MCKA 5F7LB 2FEDC 5IHZA 1HILB 1HH9A 32C2A 3BEVA 4JKMA 1JZ5A 4F58H 4H20H 2ITCA 5I71B 1PKQE 1CDBA 1N7MH 1LGVA 2PXYA 4OAWB 3HUJE 5KVFL 3EOTH 4C59B 3O2VL 3CDGA 3NMEA 5SWZB 1M7IB 4NNYA 5GJSH 3I3EA 1AGDB 3OKMB 4P23D 5DQJA 4JFEE 3UDWC 1AGEA 4Q97A 5M95B 1HSAB 5MHSE 3TPUB 5T33H 5IBLC 3O11A 3OXRA 3JSSA 4BUGA 2DQJH 3O4LE 2R56L 1VKXB 3N85H 3V4VH 4FFYL 4L8BB 2X40A 2BSTA 3IS0X 4JFPA 4IEFB 4NHCH 4TSBH 4OI8A 2DWDB 3MBXL 1DSFL 2P1YA 1Q9KA 4JM2A 3QJHB 3RTQC 4OJFL 1EO8H 3IXTB 3X3FH 1AGBB 3QUXC 4MAYB 3W9EB 3X3FL 5KSBA 1X5KA 3T4YA 4M1DH 4MYWB 4AT6B 3TNMB 4OUUB 3V52H 4X6FB 2OQJB 4HIJA 4E42B 3QRGH 4MJID 5DJZA 4K7FB 4HS8H 1R3IH 3P4OA 3VU2A 5IB3A 1RJLB 3F58H 2X4OB 5IEHA 4LPXA 3TN0C 4KJPD 4EN3A 3O6KL 2EDXA 3TH4T 1L0XA 4R0LB 2OLDA 4N8CH 3GHBL 4CVXB 3NFNB 2OL3L 3MJ9L 4PRPA 3AM8A 3VXPA 5L0QC 5DEFB 3LQMA 4Z7WB 8FABB 3LH2H 4Q6IC 3R4DA 3O4LD 4MQ7A 4XWOD 4G5ZL 1FGNL 1OW0C 2Y9RT 3EDEA 1HQRB 5HHPA 4LLQA 4HZAA 1YDPB 3TO4A 2AEPH 2R0ZL 4TOYL 4PS4L 4MMXC 3MRDA 3KPLA 1G7JB 2LTQB 3GMOB 4PJAB 1NUFA 5I1IH 3MLXL 4C57C 5IV2B 2GFBB 1N5AA 5HDQH 5DVKA 1DL7L 5K9QG 4LPYA 2VE6B 4PTUA 1MJ8L 4G3YL 4LKXA 5GRVK 3WKNA 1S9VB 3MLWL 4OKDA 4DCQB 3MA9L 4K94C 4Z78A 2O5YL 4O4YH 3D0LA 5IEKA 1R0AH 4UOJA 5D1XB 1S8DB 3P0YH 4HS6A 4ZUTB 1B6UA 3PWJB 3NFSH 1BFTA 3HG1E 2FBJH 4P2OD 1CFTB 4WEBH 3WKML 2D7MA 4KRPD 5CEYA 1FNSL 1BIHA 3KWWA 2V9TA 3KXFD 1BZ7B 4KTEL 4PV8A 4P3DA 1J0IA 1FLRL 4P4KB 1E28B 2D0GA 5D7KE 5DJXA 5ACLA 1S7UA 4PP2A 5EU6D 3QUMA 5EO0B 2QQLL 2R1XA 2HFFB 3T3MF 1A4KB 3IFLH 4U49A 2X4UA 1OOAA 2I9TB 5IKCB 3MRNA 4FXKB 1KLGB 5IB2B 4J3OC 1JIBA 4WI2A 4XXCA 2H8PB 4XPFL 1BGXH 1WZKA 2PYFA 4MQSB 4LHUD 3GSUB 3OPZL 1BHGA 3S5LB 3B4NA 3L3OB 2YC1B 3E0GA 4JO4H 1I9IH 5C08A 5C6WH 3O2DH 3QCTL 4HKJA 2V6HA 2Q8BH 5C6TL 4BQ6A 1J18A 2YD4A 2X42A 4IDJL 4ODTL 2JTDA 1XZ0A 1NEZG 3KLDA 2RCSL 3BE1L 3LZFL 4UT7H 3V0VA 4ZNCD 2JCCB 2DLEA 3MLTB 3O6LL 7FABH 4WUUD 1M71A 1Z9SA 3J8F7 4UINL 2R9HC 4EXKA 5I1HL 3VXQA 1AO7A 4C4KT 1IT9H 4OZHB 1PY9A 4L3EB 5IVXF 5F71A 3DIFA 3U4EA 1T1WB 5DRWA 3WV0A 3H42H 2VC2H 1K5NA 4GMSL 1IGJB 4Y1AA 2AJUL 4QYOB 3SKNA 1ZOXA 3DO7A 5IT2L 5JXEA 4K23L 4Q9RH 3AROA 4WGVB 1IILE 2EYTB 3KR3H 5JDSB 3TCLA 3WFEH 3M45A 1X4ZA 2GJ6E 4BFBD 1S7VA 2VLJD 1ZGLP 1LO3L 1G7PA 1Q9OB 2IQAB 1NCBL 1LP9A 4MD4B 5C08E 4PJEF 4IS6B 3FT3A 3KPNA 4FTVB 4IMKC 4PRIE 1DE4A 2DTML 2UWEF 3MLWH 5JR1H 2WIIB 3QUXD 1XIWA 2DJUA 3HPLA 3KG5A 2F54A 2CH8A 4J8RB 5MENE 3FCTA 4QHUA 1IKFH 2FHFA 4F80A 3G6JA 4Z18A 1JGVL 5H2BB 5J6HA 2VQUA 4YLQT 3ZKNC 2OR9L 4WUUE 2FH8A 2DQIH 3VWKA 4X6EA 4I48B 3WS6A 1YA5A 3OR6A 5JTWA 1S9WB 2JELH 2Y7QB 5GXBB 4LLMA 4ZD3H 4MJIB 2Y5EA 2DJ4A 3S36H 2EE9A 3S96B 1QFWI 5FAAA 1B6DA 3W0WD 3MUGB 5MI0C 4PJ9C 4YIQB 3TFKC 3QEQA 3GMQA 1ZHNA 3I02B 4GO6B 1KELL 5T1DH 3RNKA 1CL7H 3ZTNL 1HEZA 4XPAH 2HJFA 3IDNB 4PJ8A 2Z9TA 1EFXB 2UY6A 3MLYH 1GHFL 3KPPB 2X9XA 2F5BH 4LSSH 1N6QL 5IOPB 2E5EA 1QSFD 3PF2A 2X4PA 2VAJA 2R4SH 5EC1A 2IPKB 1T22A 1OM3H 5CCKH 3JV6A 2FSEA 3O0RH 4O51B 3RU8L 6FABL 1FYTD 4PGCA 3GB7A 1FGNH 1LNUA 1AI1H 1PKOA 3DSNA 1CDYA 3F12A 1TJIL 2VUYA 1BFOB 4GSDL 5BS0A 1NANI 2A83B 1JCKA 3AU1B 3UROR 3REWA 1TPXB 4GG8B 4KKBC 1DANU 3MO1A 3FTGB 1CXEA 3DVGB 5CEZL 5JXAL 3I6LE 4RGOH 3RZCD 3WBDA 4HX1B 1FO0A 1DBJH 4LL9A 4NFBA 3BGMB 2NY3B 2VLKE 1TQCB 4JQIL 4KXZI 1PEWA 3MRPB 4NRYB 1BJ1H 3CFEA 3BZFA 2BC4B 4LSPL 4XNYL 5CSZA 1QRNB 1CCZA 4K8RL 4WU7A 5C0IB 4I5BB 1A7PH 1W72L 4Z8FL 4XP9H 3VWKC 1Z3GL 3SCMC 3B2VL 1C5BH 3QHZH 1A1MB 5B39G 3WFHB 5I9QC 1RZGB 3OKOA 3S37H 2IANB 4O58H 2VDQL 4ZUWA 3D39A 4WV1A 1BD2D 4M4RA 1EK3A 3L7FB 4E42A 2VITA 3P4OB 3MRHA 4P23C 1HQ4A 1EDQA 4RNRA 1JNNL 4PJ5A 3E8UH 3OQ3B 1T66C 2X09A 4U1LB 1E6OH 4WW1B 1UQSB 4HWBH 1AGCA 5I75C 5EOQL 1N6VA 5MI0B 5JW4Q 3VDBA 3AREB 4BSVB 2X9WA 4GS7B 4PRPB 4BKLB 1MF2L 1J1OH 4Z7WA 8FABA 5IIEB 3WLBA 1A6AA 1KJVB 5DRZB 1HQRA 4AEHH 2FATL 1XEDA 3L9RB 5FO8B 5DJCB 3UO1L 1QLRB 2XN9A 4Y2DB 4PRHD 1RZIA 2QR0B 4G9DA 1CD0A 3CZFB 1VGEL 2VISB 3JV4B 1RFDH 3T2NL 2R1WA 4AENB 2O61B 2W0LA 4KRMB 3QG6A 1N5AB 3G6JE 1JRHH 1U3HB 4K94L 4D3CH 3SDDD 4IJ3B 1OTTC 3MRMA 5ETUB 2VE6A 4PTUB 3LKOA 1JI2A 4TUKH 5HHVH 1YZZA 4MX7B 1AJ7H 4YFEA 3CSBA 4HUXB 4AIZA 5GGTH 4U1KA 1K4DB 1YNLH 2A9NH 2DS4A 2R8SL 3B9VA 4LPCA 1U6AL 2XACC 1DUYB 1CLOH 1FHGA 2IMMA 4G7YH 5D2NB 4Y5YB 2GTZA 4RISL 4N90E 4AIXA 4G42A 4JZOA 4P4KA 4TUJA 1E28A 4OD3L 4H1LA 4AM0B 2WUCL 1S7UB 4LVNB 3QUMB 5EO0A 2R69H 3OX8B 1UWEH 2GK0B 4RIRB 1MCWW 4YGVA 4HF5H 3LDBB 4H0HB 1WLHA 1WT5C 2E27L 5I19L 3MLSL 3DARA 4JFDD 5BOZG 1TZIA 4N0CC 3NGBB 3ZSTA 4WUKL 3S88H 2YPLD 1FG9C 3D0VB 4HFUH 2XNAB 1J5OH 5F1NA 1QFHA 2YUVA 3LQAC 4ZXBA 5TQ2H 1JRHI 4OGYH 4BUHA 3O4OB 5ITBL 3LVEA 4LP4A 3VFMA 3ALWA 5CBEB 4XB8A 5KSAA 5JW5B 4JB9L 4M5YH 2X1OA 5INDB 1KCUH 1UB6B 3TPKA 1S3KL 3MCKB 4OLZL 4YDIH 4D8PB 1IL1B 2B20A 3DI3B 4Z7UA 3MLTA 2YZ8A 3STLB 5C09A 5EIIA 3NCBB 2VXQH 3RDTD 3UDWA 4PRNB 4P49A 5ADOH 4FG6C 1JFQL 1OL0A 3JTSA 4KKLC 1Q0XH 3UTZA 1AGFB 4O4YL 3BKMH 4YE4L 3V6OC 4N0FA 4Y19B 1CGVA 5EC2B 5HYSB 3MFFB 4GBXB 2IWGA 3MJ8A 3HI1A 5J3HC 5C2BL 3EBAA 2IAMD 3RZWA 4WTZA 2AJSL 3EUUA 3REVB 1KB5B 5FO7B 2OMBA 1K6QH 5C0AE 1VGEH 4L8SB 4QF1A 3T2NH 5EZLA 5MHSD 4G8FA 5I1DB 2EDRA 4LSTH 5JDSA 2G75B 4XNMA 1S7VB 2CXKA 4JFDB 1J7VR 3S4SA 5EZIL 4CBPA 1SY6L 3B5HA 3HNSL 1HK6A 2R2BB 1ULVA 4NUGH 4X6BB 1P84J 2CRMA 2D03H 1DE4B 3EJYD 4PJ7A 1MJUH 3HRZB 2Q6WB 4PJ8C 5CIPA 5E7FA 3MACL 2Z92B 1P2CA 2ATPB 4R9HA 2QLVB 1DQLH 2HKFH 3OKNB 2NLJB 4LHUB 2UUDK 2VOTA 4L4VA 4WI5A 3VGBA 1YNTB 5FYLL 4HG4J 4QHKI 3B8SA 3S4SG 1MFCL 5K9QI 3L5IA 3QFJA 5C0BD 4NWUH 3ZDYE 4LOUD 5IHUH 1U9KA 4N1HB 3WFCH 1YEIH 4JFXB 4WV1C 2B39A 4R4FH 4PBXA 4E9LA 4R4FL 1XGTA 4DW2H 5F9WB 2KL6A 3IRZA 2E27H 5I19H 2EDYA 1HIMH 4XP9L 4YIQA 3F7VA 1ZGLB 1OF2B 4G5ZH 1OCWL 3VI3E 4L8DB 4PJ8B 2YD6A 1EFXA 2HLAB 3OXSA 4CN6A 1NL0L 3ILQC 1CS6A 2NY6B 2MKLC 2IPKA 1OSPH 1T22B 3RRQA 3OAUL 2FSEB 2BCKA 2M8XA 5E00A 4ZTOL 1VENA 3PV7A 4M8QB 3X14B 1F4YL 4JY5H 3WL9A 2GSGA 3VWJC 2VWEC 2XA3A 1DP0A 5LGJA 1JHTB 1H8OA 5D2NC 2A83A 4JQVC 4ETQA 5A40E 2ZG1A 3TBTA 1QSEE 4JRYA 2NY2D 2FECL 4JG0L 4Z7QE 3PQYB 4O2FB 1CL7I 4K94H 4ZO6A 5E7BA 4K3DH 4YZFE 1ZT4B 4KC3B 4XXDA 1MRFH 1M4KA 2VRAA 4NO2B 2AJSH 4TSCL 4NHCL 3RA7L 3ZYJA 1GGUA 5IF0A 1GGTA 3MNVB 4S0SD 3V6ZB 3BZFB 2DN7A 2DQTH 4LOUC 5CSZB 2PR4L 1F3RB 3GIZH 1U41A 2J4WH 3RKPA 4YAQA 1JPTL 5GRWA 1EEYB 3VFTA 2FIKB 1ZA3A 3BESR 4HKXA 1Y18B 2Y23A 4JRWA 5DA0B 3WIFA 2V5MA 1JTPA 3MXWL 4JO3L 4JVPA 1XH3A 4ZUWB 2PXYC 5TDNA 3GHBH 3WUWG 2B1HH 3L7FA 1MRCL 4JANA 3MV11 1EBAA 4PUBH 1KJ2A 2MHAA 3A6CL 3VXUB 2KBGA 4HK3J 2KQNA 2GHWB 3QNYA 3CPLB 4WW1A 3O9WB 1UQSA 1CR9L 3D3VA 1KT2B 1R3LA 2H1PL 5D9SA 4PJEB 5GIRB 1R5VB 1XGPA 4NKOA 4DW2L 4I0PA 2R69L 2YBRA 5CP3A 3CFCL 3D85A 3PJSB 3OJVC 2IADA 3JTTB 4ODVH 1MIML 1A6AB 4RZCA 3CX5K 1FFOA 1JWUB 2DMCA 4Z0BL 4QRQB 2EC9U 1FL6B 3MJ6A 1F3JA 3C8DA 3IFLL 4GKZA 1V5JA 3RUGE 3BN9C 1P6FA 3ZHLA 4E41B 2Z91A 2QR0A 4G9DB 4C83B 1C12A 2Q86A 5JO5A 5J7CC 4YO0A 3VGDA 2EIEA 4FXGA 4Z0XA 5I1JL 2AV1B 3O3UN 2A6DA 3B2UD 2P43B 2VDPL 4I77H 5HHOB 3MRMB 3ZKSD 2CLZB 4HD9A 3HTLX 3IDIB 2WBKA 3MLVL 5GJSL 3RVWD 3KPRA 2MMXA 3MV9A 1MFBH 3ABZA 4FFVC 5IMOB 1DDHB 6FABH 1OQOA 4HUXA 1T2XA 3SDCB 3MRRB 1TENA 5DLML 1W0VB 3M8OL 3QUZA 3RL2B 1KCKA 5DFWH 3UJIH 3KPSD 2YD2A 2ZSWB 3GHEH 3CFBB 1Z9MA 3NIFF 3PDGA 4NZTH 4GKSA 5F9OH 4ZS6C 3OF6D 2DTSA 2XRAH 3GSNB 5DVLA 2BVOB 3ULSB 3M17A 3T0EB 4PJBF 3T2OA 4XPFH 1PSKL 3EYFB 4H1LB 4QXUL 2W38A 3WNOA 3VFVB 4RSVA 4YGVB 1K2DA 5HYIA 3IETA 1MFEL 1ZHLB 2EH7H 2FD6H 5IB4B 2FJFB 1YECH 2OTPA 5D7JD 2BVTA 4UILH 1F02I 1DANT 2GKIA 4UT6L 1TZIB 4ELME 5ILTH 3CFKA 5ERWB 3LN5A 1QSFE 3S35X 3HZYA 5HYEA 2NX5A 1WFNA 5DJ8B 5IFHL 1SYSA 3U82B 1IC5H 3MJ9H 1AR1D 1WBYB 1A8JH 1RIUL 1QVOB 1S9XB 5TPWH 2AJZB 2WQRA 2E6PA 1MJ7L 4IOIB 3AUVA 1UB6A 1B0GA 4LU5L 4D3CL 4IRZL 1IL1A 5T3XL 1X5HA 1NC4A 4EIZC 5D2LF 2X70B 3ILPA 5C09B 4Y4KD 3UCRA 5KVEH 3IXAB 5KVEL 4YDKL 1LVEA 3EDJA 3HC0A 3OKYA 3TYFB 1CLCA 1DL7H 3MXVH 2OSLA 1RJCA 3JTSB 4PPTA 2BXYA 1OCWH 1V8HA 1MLBB 2CUIA 3GSRA 5HYSA 1QO3B 5T5FL 1ZE3C 3QIUC 5J1AA 5A2IH 3BD4A 3U30B 3SE3A 5FO7A 1OAXL 2X1QA 3WEXA 3R0MA 2NXZD 2QSQA 1FN4A 2I07A 5FKAA 5D5MB 3RIAK 3GKWL 2M1KA 3K0WA 1AE6H 4LMQE 3S4SB 1P7KA 4S1DC 3BIBX 1XR9A 4GFTB 5E2TH 2BRRH 1ONQA 4YEEA 1M7XA 2X41A 4X6BA 4HIXL 3VFNB 3KYOB 1DCLA 2KUTA 3O0RL 5IHLB 5DUPL 1A3RH 5E9DE 5CSGA 1JHLH 2RIKA 4KV5F 3SKMA 4I4WB 3LRGA 1KC5H 3BWAA 1NGQL 1KIPB 5D72H 1D3CA 2BOCB 3QUMH 1X7QA 4H5SA 1YNTA 4OLEA 3NA9L 1HDMB 1QBML 4JAMB 3TYGH 4YH6A 5EBLB 4QTIH 4JFFA 2EDFA 4QHLA 3QFJB 2AEWA 3WJJA 1MY5A 4M5YL 1QFUL 1MHEA 4YFDB 4HH9B 2DLTA 2DQTL 2IH1A 2NTFB 1KB9K 1PQZA 3DXAD 4X5XA 1KPUB 2R0KH 1MFEH 1U93A 2Y4SA 4ONFH 1AXSB 3UTSE 3F7VB 2MQ0A 2AV7A 3O9WD 1NAMA 4FP8L 4KFZC 3S37X 1FVDB 2RHEA 1NEZB 4X7FC 2AEQH 1PD6A 3DUHA 1UXWA 1KCSH 4Z7OE 3SDCC 3OHXB 1EHAA 1NGYB 3QNZA 3KVQA 3PGFL 4LSVH 1DZBA 5GS0C 1T7VA 2VL4A 5IESH 4XNQB 2DQUL 2VUOA 4NN7B 4DUVA 3T0DA 1WISA 1ORQB 4LSTL 2ZUXA 1FO0L 3X11B 3WL9B 2GSIA 3KYMA 4N9GA 5DMKB 4YUEH 3L3GB 5KTEL 4XT1C 3FQUA 4QRPD 1NSNL 5AZ2H 4EBQL 4ETQB 3VFWB 2ZPKL 4Z7QF 2DWEA 4M1CD 3B9AA 1TVDA 4BYHA 1INEL 5B38G 4YWGH 4I77L 1S7RA 1YNLL 3P30H 5DR5L 4O2FA 4ZDHA 4LQFH 5F3HA 2HT4C 3C9NA 3WYRA 2B0SL 1ZTXH 3R06A 4QTHA 1E4KA 1NGPL 5BZWA 3UEZA 5I30L 2PF6A 2DM3A 5E94B 1WFTA 3CCHA 2R0LL 1XIWC 3V6ZA 5CZXD 1TVHA 1ZVHA 1QSFA 2YD3A 3CH8A 1VFBA 2VQ1A 3T0EC 5I16B 3GI8L 1U95B 5J12B 3HAEH 4KZDH 2VDLL 3KPRD 1P7QA 5ISZB 3WIHA 3RGVB 3CJJA 1A9EA 1FNLA 2DMBA 4K2UH 1D5BA 1A4JB 2VLKA 3OB0K 4F7PA 1CQYA 4OZGE 4CN4A 1DQTA 2Y1VA 3FO9B 5DK0B 4P4RB 3QUML 1N8ZA 3N50A 4ISVB 2VSDA 3LOWA 2AQ1A 3NA9H 4K3HA 2APBA 4ZQKA 2J5LB 2ICES 3X13B 2C7UB 1IGCL 1KJ2B 3P40A 5I1LA 4OJFH 5FYJL 1FYTA 2C1PB 1R24B 3KPTA 3MGTA 5KSBE 1HOCB 1U8LA 2Y5TB 3HZVA 3T4AA 4RMTA 1LO5B 1GIGH 3P4MB 1P7HL 2QBWA 3H9ZA 4NJ9H 3HPJB 3RI5K 3ARBD 3FB6A 2XTLA 4MB3A 3MZGB 2EDEA 3T0AA 1KLFA 3NFPA 5E6ID 1NC2D 3TJHC 3FAWA 3O3BA 1FNGA 2VLRD 5DHYA 1LO4H 3INUL 5C0AD 1T20A 1FZKA 3SOBL 3T8XA 1YMMD 1KTRL 2FHCA 5FYLE 1G7LB 1UVQB 1O0VA 1GZQA 5HHOA 2DLIA 4R8WH 4HJGA 3IDIA 4IHOA 3F62A 1PG7X 3SGDI 2GAZB 1NBZA 1ORSA 2Q7NA 4WU5A 4UTBL 4Q9RL 4U0RC 4MMZC 5IHBA 3MLXH 3MRRA 2X7LB 3QUZB 4OBSA 4KK6C 2HTKD 3GNML 2NY2C