3S88L

Crystal structure of sudan ebolavirus glycoprotein (strain gulu) bound to 16f6
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIVMTQSHKFMSTSVGDRVTITCKASQDVTTAVAWYQQKPGHSPKLLIYWASTRHTGVPDRFTGSGSGTAFTLTLNSVQAEDLALYYCQQHYSTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords 16F6 - Heavy chain
publication title A shared structural solution for neutralizing ebolaviruses.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s88L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s88L01
1QEWB 1C12B 1J18A 5JIHA 5ALCH 4ERSH 1ACZA 3LPWA 3MZGB 5A16B 1NLDH 3D5OF 1J86A 3CUPB 3WNOA 1LEKA 4OQTH 3VXME 4EVNB 1JZ6A 4TUJB 3ARED 1QEWA 3IFLL 5EU6B 1C12A 2OJZL 4ZTPL 4L4TB 2H26B 1XF4B 5A16A 4U1LA 3CUPA 1I3RB 1Q1JH 4KAQH 3VMNA 2Y07L 3TZVC 4EVNA 3GSNL 3H3PL 1IM3B 4TUJA 5EU6A 4G42B 3MJ9H 4L4TA 2BRQA 4MDIB 1XF4A 2KKQA 3P0YH 1FO0L 4LCWE 5AYUL 5DUML 4G80A 5E99L 2DI7A 4AEIH 1KCSL 3GIZL 3HKFA 2QBWA 4J8RB 5JXEC 1IM3A 4G42A 4DOHB 3MLUH 3ZDXF 2Z93B 1A02N 2V5SA 4B50A 4JE4B 4OKVB 4MDIA 1HIMH 4TUKL 4K3JH 2HVJA 3WJLA 2BVOA 3IDUA 4KK5D 4J8RA 4YLQT 5C2BL 4WFHD 1FH5H 4OKVA 3CMOL 1FBIH 3IJSB 4WIQA 2XI9A 4A6YH 2YA2A 4GQ9H 4PJFB 3KYOB 3AM8C 4HGMA 3SKUD 4WRLA 2MCPH 1NGQL 1ES0A 5F3HB 2VDOL 1YEFH 3IJSA 4WJ5A 3AMKA 4XBGB 2PYEB 3HC3L 5GZOC 5TF1L 2ILLA 4PJFA 3KYOA 2J1KA 2CRZA 1EGJA 4H8WC 5EU7E 4PJFF 1AGEB 1DVFB 4XBGA 1N0XH 2PYEA 1ACYH 4UT6L 3RA7L 3B4NA 4HCRH 2PETA 1QNZL 3MBXL 1WQVT 2ZUVA 1AGEA 4XCEB 1DVFA 4F58L 3E8UL 1FRGL 4H0GA 1FIGL 2DQDH 5KSAD 1U3HD 1KCUL 3NCJL 4HT1L 3WIIL 4MJIE 4XCEA 3S37L 2D03L 5GS2D 3G5YB 3SKNB 1TVBB 2EZ0C 4KQ4L 2OLDA 4R2GD 4P57B 1C5DB 4J6RH 3SCMC 3GZKA 4XVTH 1MJ7H 4GBXB 3G5YA 3SKNA 1TVBA 1N2RB 1XF1A 3NACH 4M6ML 2R4RL 1U91A 1C5DA 3RVTC 1UWXK 4GW5B 4QHKI 4R26H 2VDKH 1YC7A 4GBXA 1SBSH 4NWTH 1LNUB 3O9WB 5HI4D 1N2RA 3LRHA 3N9GL 2ED7A 5ID0A 4FQIH 3T0BA 3QHFL 4GW5A 4M3JA 1LNUA 3GO1L 3O9WA 3X12B 3JV6B 4Z77B 5B3JE 1U8KB 2EDTA 2R56L 3KLSA 4GRMB 5FHBH 4RMTA 3X12A 3O2DH 1WBXB 3JV6A 4Z77A 1U8KA 3GBNH 3QRGL 4M9PA 5GGQL 4OZ4B 5IOPB 4GRMA 1CL7H 4KJQC 5EORL 2Y25A 1NUDA 3HRZB 3FB8B 1QFWM 1M7IB 3I9GL 1WBXA 1WZLA 2P24B 3HUJE 4L8DB 5I17B 3TA3A 4OZ4A 4XHJC 5IOPA 1D6EB 1H3TA 3HRZA 1DFBH 3FB8A 5K9QG 1M7IA 2P24A 4L8DA 4JRYE 5I17A 5IHUH 3NIGF 4F9PC 2PO6D 1RVFH 4NN7B 3BE1H 1D6EA 5F3BB 1FCCA 4JY6A 3C60D 1YECH 1U8PB 2HT3D 5F96H 3I3DA 3UTPD 3WJLC 5F3BA 1G9EA 3EHBD 1U8PA 4EN3D 1AP2B 4M1GL 4JDTH 2Z92B 4XAKD 2B2XH 4Z7WE 4X9BA 4KI5E 4MZ3A 4JRXB 1I9IH 4ONFL 1LO5B 3UZVB 5DFVC 1SHMA 4JFFE 1AP2A 2P48B 1AR2A 4R8WL 1OTTC 1YN7B 1CDGA 1KB5L 2Z92A 4K07A 3VMPA 4UT7H 3V4UL 1T3FB 2R0KL 1AC0A 3K2UL 4JRXA 2F58H 1SYVB 5SV4A 1QFPA 1LO5A 3ZO0A 3L3JA 4JR9L 1AY1L 1FL5B 1ZEAL 1YN7A 2AGJL 3NCBB 5EPMB 1JGUL 4JZOB 1KXVC 4JANB 1SYVA 5HHMD 2NY2C 1CXKA 1I3GL 3ZTJG 1A6TB 4U31A 1I8KB 5EPMA 3NFSH 4K8RC 1IGJB 4JZOA 2XWTA 4JANA 4Y89A 1DVFC 1A3RL 3GK8L 1XR9B 2NYYD 3WNNA 5JPMB 1OCWL 4JREB 3TJEH 1A6TA 1I8KA 2DDQH 1PKQE 5D6DA 1PDKA 1XR9A 4XCCL 1KCLA 1Q9OB 5JPMA 1XZ0B 3DOSA 5ICXB 4OF8A 4Z6AT 3KVQA 3OPZL 1YMMB 5FYLD 1Q9OA 1XZ0A 5ICXA 4UNUA 4ZDHB 1UWGL 2DMBA 1NGXB 5I74B 1YMMA 1A7OH 1FG2B 3RI5F 3CLEH 3DHMA 4PV8B 3ECBB 5D72H 1FNEB 1LO4H 4U0QB 4LCIH 3VFPB 4HXBL 4ZS6D 4ZDHA 1F3JB 1NGXA 4BQ6A 4ZD3H 1FG2A 3DURB 5IM7B 4PV8A 5B3NA 1S8DB 5J1AB 2R9HC 3ECBA 1RIUH 4X5WB 4RX4A 1AGDB 1FNEA 1YDPB 3IETB 4E41A 3VFPA 1NBQA 1CGVA 1F3JA 3UJTH 5IM7A 5MHSE 1S8DA 5J1AA 4K8RL 4X5WA 3TYGL 1AGDA 1YDPA 2D2OA 3IETA 2H3NB 1CE1H 4GQPH 5GIRB 4LPTA 4EXKA 3MLVL 4Y8AA 4WW2B 2E7HA 3TA3C 2AEPL 4CU6A 2L4OA 4APQC 4NYLB 1V3JA 2H3NA 3OZ9H 3U2SA 4RRPG 5GIRA 3DWTA 3ZYZA 4F57H 2PYFB 4WHCA 4LPYA 4MS8C 3ARFB 4BQ9A 1JN6B 4WW2A 1C8PA 4NC1E 4JLRB 5C0BD 4LL9A 4NYLA 1GZPB 4WW2F 2PYFA 2EXWC 3ARFA 4UQ2B 5F71A 1JN6A 2EKJA 4TQEH 4JLRA 4X9FA 3W0WB 2A6JB 4B53A 1GZPA 4NQDD 2K3TA 4DVRH 4ZG1A 4UQ2A 4ZUVB 1BZ9B 3W0WA 3O4OB 5I73B 4BUGA 2A6JA 5IHZB 1FFNB 3G6JB 4R97B 5IMOB 4ZUVA 1BZ9A 5E1HB 4XNYH 3U4AA 4BUHA 4PLKC 1CFQB 5IHZA 1FFNA 5B8CB 3G6JA 5CP3A 1X44A 5IMOA 1JFQH 5IROC 3BRDA 1JPST 2D0HA 2EC8A 2XZZA 2DS4A 3G6JF 1CFQA 1D5ZA 5B8CA 4QGTA 1B4JH 1J5OL 3REVB 1UACH 4W6WB 4OLVH 3CXDL 5D1XD 4OIAA 4TYUA 5E03A 3REVA 1WIUA 3I50H 1RAMA 5I1CH 1KGCE 5TH2B 4NM4L 4XP6L 4X80H 5CD3B 3QG7L 2HG5B 1CIDA 5EC2B 5JDJA 5TH2A 3QDMD 4JREC 1I8MB 1JHLL 5F7FA 4FP8H 2IPTH 3F7YB 2QSQA 5CD3A 2P5WB 2WBJD 2HG5A 2Q7NA 5EC2A 1FNHA 1PEWA 4NCC1 1I8MA 4Q9RH 4Y4HC 2NTFB 3QIWD 4D9LH 5ALBH 3F7YA 4O58H 3UTQB 2P5WA 1UFUA 2KPNA 5KN5B 3QSKB 1URLA 1AE6H 2EIDA 1OW0A 4FQPA 1NCCL 4FQCL 2H1PH 3LRGA 1PJ9A 3RWCB 4ELMF 1F13A 3IXAB 2VWEC 2NTFA 2VDLL 1KELL 4Q0XH 3UTQA 1EK3A 2MWCA 5KN5A 5CILL 2DKUA 3SE8L 1KUMA 5JR1L 1INEH 3RWCA 1B0RB 3IXAA 2PF6A 5F7UA 2B39A 1CIUA 3MRGB 1JF6A 4M1CC 2MCG1 3S98A 2A77L 3RHWK 5F93C 4EQ3A 5TPWH 4LGSB 4MXVE 4X83A 1B0RA 2YWZA 4MQ7B 1MNUL 4P9ML 2CLVB 5EO9B 3MRGA 3MUGB 3AS2A 1WWCA 3SOBL 3AS3A 3IDXL 4Q2ZB 4MA7L 4MQ7A 3VD7A 4BM7A 5D1ZD 2CLVA 5EO9A 2DI8A 3MOQA 1RZJC 2HRPH 3MUGA 3QIBB 3EOTH 4LLUB 5IESL 4GLRH 5EA0H 3UXFA 4NZUL 1OT1A 3KPOB 4JHAH 4Q2ZA 3QUML 5DMIL 2HAZA 4JFFD 2ZCKH 3ARFC 3HA0A 3QIBA 4LLUA 5AZ2L 3RVVC 4NDMB 1I85A 3QA3B 4KKBD 1H8OA 3K4ZA 3KPOA 3PWVB 3VA2C 3K8KA 2X89D 3MXWH 2D7TH 3SKMB 1XMWA 4DCQB 3BAEL 4FZEH 5SWZE 4NDMA 3QA3A 2YD3A 2NY4C 3U79A 3PWVA 1G7MB 2Z8WC 4ZO9A 4RZCA 3SKMA 2CPCA 4G9DB 1B3JA 1HZHL 4DCQA 4LVEA 3RVXC 3ZTJH 4XPHH 2WAHA 5D7LE 3BP4B 4N0YL 1BAFH 1G7MA 2Y5TB 1MRDL 4G9DA 4YFLI 5T33H 5BV7B 1TJHL 1U3YA 3QG6B 1T21B 1MHPH 2FJHB 3BP4A 5TF0A 4BFBD 1T66D 1A14L 1QZ1A 2Y5TA 5B8CC 1IEBB 4U1JB 2Z31B 3PQYB 4PRHD 2F5BH 2NCMA 3QG6A 1CDCA 1T21A 3WNLA 2FJHA 2HT4D 1RUAH 1QFUH 4DFHA 4H20H 4U1JA 4TRPL 4PR5A 2Z31A 1U8OB 3PQYA 3DX8B 5T3XL 4OM0L 5C0CA 1ZHLB 2EDYA 3WLBB 3QFJD 2EYRB 1MCLA 3SDDC 5EZOH 1BJ1J 3ULVD 4KTDH 5DRWB 1U8OA 5E9DE 3DX8A 3QUZC 1ZHLA 3BP7B 1VGEH 3WDJA 3WLBA 1UWXH 3DVFA 6FABH 2EYRA 3O11A 4ODVH 5DRWA 3OAUL 3QEQE 3BP7A 3SDXE 1HH9B 5AAMA 1B4RA 2W92A 4N8VG 2HKHH 2NW2B 4PRBB 3T0WA 3N85H 1R5WB 4J23A 4DN4H 4OGYH 3R0NA 3MRJB 2NLJB 3GMRB 2YRLA 4JPVH 3DX7B 1HH9A 1A9BB 1F3RB 1CT8A 1DN0B 1MAJA 2NW2A 5GGRY 4PRBA 1NKRA 2D4DA 4LSQH 2Y9RT 1R5WA 3U9UB 3ETBF 3MRJA 2NLJA 4PJ8D 3GMRA 1BF8A 5T5NG 3DX7A 5CZXD 4LARH 1FDLH 4NJAL 4S2SB 3RIFK 3U9UA 3UEZA 3MMEB 3NABL 4P5TB 4F2MA 1Y6KR 2MQCA 4YFDB 4YX2H 3PXHA 4OM1L 3O8XC 1NCBH 3MMEA 4QOKD 1AO7E 4JVUA 4P5TA 1CXFA 5F8RC 3AS1A 3O6LL 3WN5B 1FGVH 2X1PA 4TN9A 4JM2D 3V7AE 4HK3J 4PRNB 4RFNB 3WN5A 5DEGB 3LS4H 5BO1L 4RWYH 1DUYB 5EZIL 4PRNA 4XPGL 1I85C 1OAYL 5DEGA 1I1AD 2RQ8A 2AK1L 5JZ7C 1RUPL 3U0PB 2DN7A 1U36A 1WBYB 3KLAB 3Q0HA 4KK8D 4XMKH 3MV8E 1JZ7A 1F4WL 4M9OA 4KK6C 3NIDF 2V9RA 5CKAA 2N7AA 2OTUB 3MCLL 3ARBD 2R29H 3QIUD 3RNKB 3U0PA 2VXTL 1WBYA 3KLAA 2FBJL 3IYLW 3B6SB 1UM5L 2OTUA 1KGCD 1J1OL 5BS0B 3EYVB 3RNKA 4Y19D 5ISZE 1NBYB 1MHHB 3NCYP 4DUVA 4X0KB 3RNQB 2WBWB 4D0BB 1FNGB 4YXHH 5EUKB 3B6SA 4HGKC 1X5GA 4M1DL 5BS0A 3AB0C 3EYVA 4BSWB 4G9FB 1NBYA 2YRZA 4DN3L 1Z0MA 3KPRE 4X0KA 3RNQA 3GMLA 4D0BA 1FNGA 1L0YA 5EUKA 4FRWA 1UA6L 1VCAA 4HFUH 2YK1H 4V2BA 4FTVE 4BSWA 4UINH 4XP4L 4G9FA 4M5ZH 5CEZE 4U4BA 2X70B 3UO1H 2X2YA 1I7UB 3H7LA 2VKWA 2HFGH 4N1CA 5DXWA 2X70A 4OLWH 3DROB 1WF5A 3DSNA 4N0FB 1H3XA 3WBDA 4LVOB 3EFDH 1VENA 3V0WH 1UCTA 2MHAB 3DROA 4LRNL 5L6YH 3T4YB 4N0FA 1KN2L 4KZDH 3ZDZF 4QRPB 2MHAA 2K9UA 3KPTA 4OD3L 4U1MB 4CGTA 3T4YA 1RUQL 2BSTB 3ES6B 4UB0L 1IQWL 4QRPA 5CD5D 4M7JL 3TM6A 3T2NH 4KVCL 1W72L 2WLYA 2BSTA 3ES6A 3WNKA 2J6EH 2XZCH 4PB0H 5IFAL 2ICWJ 3QHTC 1IT9L 2NY5C 4OI9A 3ULSB 4RNRB 3QCVH 4RAHA 7FABL 4Z18A 4PRPB 1GC1H 3R1GL 3ULSA 2WNGA 1UZ8B 4RNRA 5J11C 4PRPA 1YNTB 4D3CL 4M8VA 5D7LD 2DYPD 1CU4L 1UZ8A 1YEKH 2ZJSH 1F6FB 1BF2A 3TN0A 5FUCE 1YNTA 3D3VE 4HWEH 2V5RA 2IFFH 3QNZB 5GS0C 3NFNB 4PJ9D 2ICES 3B9VA 4BA8A 2DBLH 1R0AH 2PW1B 4I9WD 4XCNB 5H2BB 4PGJA 1KCVL 3QNZA 2LU3A 3NFNA 3O4LB 3B9KD 4YDIH 2VO5A 2Q3ZA 5CSZB 4XMPL 2PW1A 1MFAL 3LIZH 1G1CA 4XCNA 5H2BA 1HILB 2ZKHH 2DIBA 4NKDB 1OSPH 4WFED 5EH1A 4M7ZB 4L3EE 5T1KD 3O4LA 4PREB 2CDEB 1P6FA 1I8LA 2FECL 5CSZA 2NY5L 2VDQH 3VDBA 2B1AL 2RJMA 5F88A 3HNTL 2P5EB 5T3ZL 5GRUH 2VLJE 1F3DH 1HILA 5F7MC 4NKDA 4JKKA 1CFVH 3UDWC 4PREA 2CDEA 3MV9E 2FYYB 4HC1H 4LU5L 3QJHB 5ITBL 1QSFB 4AM0B 2P5EA 3UPCA 5FO9B 1CDYA 5D7JC 1G7JB 3OKKB 5KVEL 5L88L 1MLBB 4UTAH 2VR4A 2FYYA 4XPAL 3QJHA 4MQXD 2A2QT 1QSFA 1RMFH 5JOEA 5D1QC 2VDRH 4RGND 4WENB 5FO9A 1G7JA 2EC9U 3OKKA 1MLBA 1G6RL 2IAND 4Z7QF 3FHQA 4QTIL 5GS0L 1CGWA 1JRHL 1CD9B 2DQIL 1JTTA 3QDGE 3QCUL 4LSSH 3VCLB 3LEVH 2ARWA 5AG8A 4WW1B 5I8KL 4I0PB 4QCIA 5ANMB 3S3PA 4ZSOB 4KJPD 5K33A 4P5KB 1I7ZB 3U82B 3WNPA 4WW1A 4FQJH 2PTTB 4I0PA 5ANMA 5I8OH 5FYJH 3OJVC 5E2VL 1NAKH 4ZSOA 4P5KA 1I7ZA 4GRWB 5IJKA 5LXGL 1S9KC 4HBCL 3UC0L 1KENL 1MCBA 4MQSB 2PTTA 5GJSH 5E8EB 2MMXA 1M05B 1T89A 5FYKL 1G9MH 5E1AB 3GNML 5JHLL 5HYFA 1CICB 1T7XA 3ALXA 3OBAA 4Y2DB 4GRWF 5E8EA 4LIQE 4YFEA 2MQ3A 1M05A 3VU2A 5E1AA 5I1GH 2Z35A 4YO0B 1CICA 5F21B 1LO0H 1WZ1L 2Q20A 4Y2DA 5GGSY 3LH2H 2ZCLL 2VAJA 5DD6A 5GGVH 4XB8A 3MRCB 4YO0A 2R4SH 4X6CF 3MFFB 4UILH 2XKUA 5DLML 4MNQD 4DW2L 4R90L 1H0DB 1GIGH 3MRCA 5A43C 2IGFH 3MFFA 1GAFH 3TN0C 4LLDB 3ZYJA 5A3ID 1JWMB 5ISZD 1DQQB 4MA1B 1HYSC 5KOMC 1Q94B 1H0DA 4PFEA 4L9LB 1V7NH 4M7LL 3HNSL 1MREH 2W65A 1JWMA 1MJ8L 5FGCE 1U0QA 2R2BB 1Q94A 4L9LA 2ZZUT 2G60L 5DSCB 2Q1EA 4FTVD 5CEZD 2GK0B 3VXMB 3QQ4B 3IFLH 4LPUA 1RD6A 4ZTPH 4LFHG 4HS3B 4MXQC 5DSCA 5FM8A 3QUXD 1I8LC 4HWBA 4KKNA 3BD4A 2GK0A 3PGDB 3GSNH 3VXMA 3QQ4A 4Z7OE 4M7ZC 1SJEB 4HS3A 1Z9MA 4QGYA 1FO0H 2J88H 5KOVC 5AYUH 5DUMH 4LCWB 5E99H 4EEEA 3HFML 1KCSH 3GIZH 3PGDA 5HVWA 3MODL 3DNKA 5E8DH 1SJEA 4NUGL 4X5XB 4MZ2A 2YD2A 4TUKH 4LCWA 3MZTA 1J12A 3BP5B 3GBML 4KKCC 2FO4B 4KRPC 2VL5B 3M8OL 4FNLL 5CIPH 3VXUD 5C2BH 1A6UL 4X5XA 1NAMB 4K3DL 4ONGL 1X4YA 1EMTH 3BP5A 4K7PH 1CR9L 2FO4A 2VL5A 3FRPG 5CHNB 5IVZB 4M61B 3TCXA 4S0TD 1NGQH 1X5LA 1NAMA 2VDOH 3LKPB 1MCCA 2AQ2A 4ZUSB 2NY0C 2W0LA 4JO2L 3DYPA 2VRAA 3QUYD 3SJVE 3CSPA 5TF1H 1S5IH 5CHNA 4XNQB 5IVZA 4M61A 3TBVB 1EEQA 1K5NB 4I0PC 3C5JB 1INDL 4ZUSA 1JTOA 1GVIA 2DM7A 1TCRB 3SDYL 3EZJB 3RA7H 5JOFA 4K2UL 4XNQA 3U4EA 3TBVA 1K5NA 3C5JA 3MBXH 5EULV 2VAAB 1P4LB 2WQRA 4F58H 3WFHB 1T89C 1FRGH 1TCRA 3RZCD 3KGRA 3GDBA 1GPOL 4QRTB 5FEBA 1ZK9A 1KCUH 3NCJH 4HT1H 2VAAA 3WIIH 1P4LA 5DD0L 1PX4A 4MJIB 3WFHA 2N1KA 3ARRA 4G6FD 4QRTA 4TULL 5HYIA 4YXKL 4IDJL 4RMRA 5C0JB 1CICC 2JTDA 3ZZ1A 2WW8A 3K4DA 1C1EL 1ADQH 2EXYC 4MJIA 4M6MH 2R4RH 3LB6C 1SY6A 1PAMA 3H2WA 5C0JA 4YHOL 3C2AL 4LEOB 4GKSB 4MAUH 1YJDC 4F7PB 1D5XB 2C3WA 4LHUD 3N9GH 1F8TL 1N7ML 3QHFH 3LPGA 4X4YB 4LEOA 4GKSA 2FECI 4F7PA 1D5XA 4L3ED 4P2OD 3HPLB 4JDZB 2DQEL 4X4YA 3WJJA 1CGTA 1D3CA 5DEFB 4Y4FB 1BFVL 2YUXA 4NRYB 3U83A 2GCYB 3HPLA 4JDZA 1PW3A 5F9WC 5GGQH 2OZ4L 3X3FL 1WWAX 5EORH 5DEFA 4GW1B 5L2KE 1EHAA 4Y4FA 3I9GH 5IB1B 4NRYA 3T77B 2GCYA 1R3JB 3D25A 3HUJB 4KY1H 4U2ZA 1GJIA 1OAXH 4C57C 3H9YA 4GW1A 1NGYB 4FQ1L 1Y18B 1RULL 5IB1A 3T77A 1R3JA 1JRHI 3QWQB 3HUJA 4JRYB 4LQ1A 3VFNB 3OKEB 3T04D 2AP2A 5D9SA 2I9TB 2D4FA 1I7TB 3HUJF 3QDGD 1FFOB 1NGYA 4FN0A 4JRYA 3VFNA 2AJXL 3L3IB 3OKEA 5I2IB 2I9TA 4U6TA 4WTZG 4D0CB 5I75B 1I7TA 4WO4D 2OK0L 1FFOA 4ZS7L 1DANT 2O5ZL 3HI5L 5DF0A 3LN4B 3L3IA 5I2IA 4D0CA 4Z7WB 3ARGC 5CZKA 4ONFH 1CLCA 4P23D 5HI5D 4CADB 3LN4A 5KJRH 4JFFB 2X4SB 1KB5H 4LKCB 3BZDA 2HFTA 3V4UH 4Z7WA 5GGVY 2R0KH 3K2UH 3GMMB 4LOUC 4QYOB 3I02B 1I8IB 2YA1A 3BKYH 3V6OE 3LMJL 4JR9H 4CADA 4Z7WF 2XICA 1AY1H 4XRCB 4KI5F 1ZEAH 2AGJH 2X4SA 4LKCA 2YS4A 2GSGB 1JGUH 1GGBL 4H25B 5I0DA 3KG5A 3GMMA 4G8GE 4QYOA 3D9AL 3I02A 1I8IA 5JIIA 4GG8A 4XRCA 1I3GH 2DB8A 1Z9OA 2GSGA 3ISWA 4H25A 2VABB 2KQMA 1A3RH 2V5MA 2R0LL 3GK8H 1J0JA 3VH8A 4AMKL 3FO2B 4YHNB 3CVHL 3TBSB 1PKQB 2VABA 3NZ8B 1AXIB 2AEWA 3EYSL 5BRZD 4XCCH 4NP4L 4I48B 4RISH 3FO2A 4YHNA 2C4FU 4HIHB 2K7QA 2KZ1B 3TBSA 1W8NA 1MCOL 1JCKA 1PKQA 3LHPL 3BGFB 3NZ8A 4P46C 5FF6B 1G0YR 2VXUL 3OPZH 1S7QB 1H3GA 2CKBA 3SBWC 2EIBA 3OWEA 4I48A 4WI6A 2ZCHH 4HIHA 4XPFL 3IKKA 4Y4KA 1MFBH 1MFDL 3KHOA 5FF6A 4BFIA 1S7QA 3CD4A 4Y16C 1EO8L 2OL3B 1D6VH 4LK4A 4ONHB 4R7NB 3RY4A 4IMLB 2AXHA 1HHIB 1QSVA 4HXBH 3VRLF 5IW6B 5C0AD 4G6AC 2YUWA 4KK9C 4ONHA 5F6HJ 2L0DA 3ARWA 4R7NA 1UH3A 3VGGA 4IMLA 3DUHA 3SDAC 1HHIA 2B20A 3FHAA 3GSOB 5IW6A 12E8L 4LSVL 5CEYB 2GQHA 1CLYL 2HTKD 4Q6IC 1OM3L 3MA9L 4KKLC 4K7PY 3BPOB 3GSOA 1UWEL 1IC4L 4JRWA 3MLVH 1RJCA 2Y23A 5CEYA 5F7NC 3PWPE 2FD6L 2AEPH 3CFCL 3IRPX 4YC2B 4OCRL 1NPUA 5IBLD 5BQ7B 2QKIB 4JHBA 1DQML 5E7FA 3PXJA 2X05A 4LHJB 2FH6A 1TZGL 2QKIA 3QO1B 4JFDD 3VRJB 4F33B 1J10A 4F37F 2J4WL 1UENA 4JM2B 2BZDA 4BELD 1A6WL 3QO1A 5I75C 2NXYC 3LEXB 3VRJA 3FT3A 4YWGL 1YEJL 4JM2A 1CG9B 3L1OL 4LSRL 1LK3L 2VKXA 1JP5A 1QQDB 3FQXB 4WY7L 3UBXI 3LEXA 1LDSA 4JM2F 3WUWB 4W4OA 1CG9A 1QQDA 3FQXA 1J5OH 3WUWA 1WGOA 1UCBL 4JKWA 3PHOB 3UROR 3ZTNL 3CXDH 3ARBB 2YD7A 1GOFA 4WWID 4NQED 3QO0B 4KMLB 5L2JB 4I3RH 3PHOA 3QT2A 3ARBA 2GJZB 5GZND 4DFIA 3O3DB 4UV4L 4JAMB 2ORBL 5HVFB 3BRFA 2DLGA 3MBED 2OXHA 4XP6H 5DQJB 2VB5A 3BSZL 3QG7H 5L2JA 2FIRT 1N64L 4GT7A 5FFLA 2GJZA 1SEQL 3DHJA 4OGXL 1VFMA 3O3DA 1FZOB 3UTOA 4QT5B 4JAMA 5J06A 3MOAL 5I9QB 4X5LA 3DMMD 1KPVB 1PD6A 4NN6B 4XC1L 4FA8A 2DM3A 5FUOL 5I71C 4G6KL 1FZOA 4NRZB 4QT5A 4Y4KC 1KPVA 1RZ7H 5F9JB 3HE6D 5F6IC 3RGVC 4KV5F 2DM2A 1NCCH 2IAMB 4FQCH 1ZS8B 5BVPL 4NRZA 4XI5D 3GHEL 2HVKB 2VDLH 5F9JA 1X5FA 3INUL 2J8OA 1JGEB 4JQXA 4HXAL 4R7DA 5CILH 2AI0H 5K9KB 3SE8H 2IAMA 2NX5D 5JR1H 1T7ZA 1ZS8A 1JNLH 3UYRL 4LCUB 1IKFL 2HVKA 1S7VB 3FFDB 1JGEA 3ZT7A 1DBKL 1J7VR 2OS7A 2A77H 5K9KA 2M1KA 4V1DE 4PD4K 2NZ9C 1DBJH 4LCUA 3F58H 2FLRT 1S7VA 3FFDA 5C86A 5DJZB 2AJSL 5J0BA 3SOBH 1T80A 3IDXH 5F1NB 3RQ3A 1VGKB 4LBEB 1KCRL 4MA7H 4PYHA 4N1HB 3BPOC 1EV2E 1G7LB 1OARL 2BX5A 5DJZA 4MXVF 5IESH 2OP4L 5F1NA 3QUMH 1VGKA 3TJHC 3FO0L 2BVEA 4LBEA 4YC2C 5DMIH 1G7LA 4NQUA 2GJ6D 3RZWA 5AZ2H 5D71L 3C5ZD 1W8OA 3GB7B 3R4DA 3FB5B 4L1DA 4BSJA 3GSUB 3EBAA 3BAEH 3LEYL 3VD4A 1CDJA 5SWZB 4D0DB 1UEMA 1FFPB 3CU7A 3GB7A 5GJTL 2IQ9L 1HZHH 3W11C 2X1OA 3QXDA 1R5VB 5C07D 4HG4J 1TTUA 5SWZA 4PJHF 4N0YH 4D0DA 5D7LB 4CN4A 2APVA 1FFPA 3JBG7 1B9ZA 1MRDH 1B90A 4OFYA 4G6MH 3CX2A 3TT3L 1TJHH 1A0QL 5ESAB 1B6UA 1DL7L 1R5VA 2HLFC 2A6IB 1A4JB 3AS0A 4LDOB 1E6JL 1A14H 3OAYK 2F53D 3HTLX 5ESAA 4LLMB 4QWWD 1NDGB 2F9BT 1A4JA 3DETC 4FQLL 2ZUQB 2W9EL 4HGWB 1FLRL 2VDNL 1T5WB 5EOQL 4OF7A 4FFYL 5DZNA 3GRWL 4TRPH 5T3XH 5D2LE 4LLMA 1NDGA 3KXFD 3ABZA 3NMEA 4HGWA 1W0YT 3QWRA 1T5WA 3RY5A 5I76B 2VQTA 5E9DB 4YHLL 4ZFGL 1MFCL 4PJXE 4KROB 1CE6B 1PKOA 3ET9F 3A67L 5I76A 3HC4H 1OGAE 5E9DA 4LNRB 4IOIB 3QEQB 3SDXB 1CE6A 1JK8B 1QSEE 1CVRA 5I1DB 5I9QC 3BW9B 1LMKA 4DKEH 4LNRA 3MRFB 4IOIA 3KPQB 3QEQA 2V2WB 3SDXA 1JK8A 5I1DA 1NUFA 4P9HL 5EDXA 1C7TA 2DJSA 4PRDB 1QP1A 3SDXF 1PZUB 3BW9A 5I1JL 1NGPL 1JL8A 5DFWH 3MRFA 3KPQA 5CCKL 3G08B 1EO7A 3KNBB 4PRDA 1FZKA 2JIXA 2KUTA 4J3OC 4OCYH 3NABH 2FBOJ 3G08A 1P84J 5FYJU 3KNBA 3TP4A 4OM1H 5IVOA 2FEDD 4J1UB 4OQTA 1AO7B 2CH8A 3O6LH 5IK3B 2G75B 2V17H 3S9DB 1T5XB 1MCSA 1F2XK 3TH4T 4J1UA 2BDNL 3D2UB 4P2YA 1AO7A 5IK3A 1BFTA 2G75A 2Q8AH 2FX7L 1T5XA 2CGRL 1PZ5B 3MJ9A 5I19L 4EIGB 5EZIH 4FOMA 4XPGH 3DO3A 4P2QE 4M03A 3D2UA 1K8IB 1PZ5A 4WTXA 2B5IC 1RUPH 2M26A 4XX1G 3VD9A 2HT2C 4I77L 3TT1L 3LCYA 5LGHL 4A6YB 1K8IA 3MV8B 2RBLA 2OJEB 1J0HA 3REWB 3K7UA 2XKNB 3MCLH 1MPAL 2VXTH 4NHUB 4GKNB 2FBJH 4A6YA 3MV8A 2OJEA 3REWA 4DKAA 1CXEA 4YAQB 2XKNA 3WLWC 1J1OH 3T1WA 3NIFE 5ISZB 2WIIB 5JXAL 4NHUA 4GKNA 3OJMB 3HLAB 1AQDB 3W5NA 4YAQA 4M1DH 4PY8I 4QHUB 5J7CC 1JYXA 5HXMA 4DN3H 4FHBD 5ISZA 4KTEL 2D0GA 2WIIA 3H6JA 1E28B 3KPRB 3FOMB 3T3PE 3HLAA 1AQDA 4ONOA 1UA6H 4NO5A 1G0XA 4QHUA 2VH5L 2XT1B 4HCRA 2ICWB 4X6EB 1JF1B 4FTVB 4LLVB 1Z2KA 4WI5A 3GI8L 1E28A 2EDEA 3KPRA 3O6FD 3MUY1 2NW3B 4LMQI 4LPVA 3BKCL 2ICWA 4X6EA 1JF1A 4FTVA 4LLVA 1A7RL 3THML 4PBXA 3QQNA 2E7CA 4XVUD 4U1KB 2NW3A 5BZDB 1RZKH 5H37G 5ACMA 5DJ2B 2BSRB 2NY6D 4GAGL 1KNOB 2CKNA 4U1KA 4IRSB 2ATPB 1S7SB 4JO1L 3BWAB 2A73B 1KN2H 1VFUA 3ZT6A 5BZDA 4TTDC 3I75B 4TNWF 5CGYD 2DJ4A 3GJFB 2BSRA 5DJ2A 1KNOA 2OYPA 1QFWL 4IRSA 2ATPA 2DQUL 4J2XA 1S7SA 3BWAA 2A73A 1RUQH 5F7LB 2NY1D 3NVQA 3I75A 4DEPC 4F7TB 3GJFA 2DM4A 1IQWH 1EJOL 1PY4A 4M7JH 4CJ0A 1XAUA 1T20B 1W72H 2IFGA 4IOFC 3WNMA 4YH6A 1JZ5A 3PP3K 4F7TA 5IFAH 3E3QC 2YBRB 5INDB 2D3VA 1O7SA 3O2DA 3WXWL 1IT9H 1UGNA 4HIIB 3S35X 1T20A 1UADC 4TNVF 1FYHB 7FABH 2YBRA 5INDA 1NEZB 3R1GH 1YEIL 4HIIA 4KJWD 4YHZH 5LVEA 2A9MH 3VDCA 4P48A 1WSST 2APFA 2BK8A 2OMNA 4X7CC 1NEZA 4D3CH 4X98B 1S78D 1UXWB 2VZUA 1JIBA 1CU4H 4N90D 4YHMH 1HE7A 4DZ8B 3P11L 5JQ6L 3D3VB 4X98A 3V4PL 1UXWA 1EBAA 3Q3GA 3ULUD 2OCFD 3RX5A 4F7EB 2HH0L 1HKFA 2B1HL 1GYAA 3SE3C 2CK0L 4DZ8A 3D3VA 1Q0YL 3BQUD 1VADB 1KCVH 1J0KA 4F7EA 5I15L 5EG6C 2ERJC 4U6XB 5HHXL 3D85D 4XMPH 4JN1L 3OGOE 1MFAH 1J1PH 1KPUB 2D9CA 4U6XA 3EDEA 5HTSA 3E6HB 2B1AH 3VXOB 5ALCL 4DKFL 3HNTH 3QXUA 4V2CB 3V8CA 1KPUA 2VLJB 2MJWA 4Q7DA 1AHWB 3RU8H 3KJ4B 3MV9B 4LCYB 3E6HA 4LU5H 1KN4H 4KQ3L 3VXOA 5ITBH 1OGAD 2VLJA 3H9SD 2VIRB 5KVEH 1AHWA 3MV9A 1BGXL 4LCYA 4M6NL 3BZFB 4OTXL 1F4YH 2VIRA 1IQDB 4M02A 4AEIL 3EDKA 4J7RA 1G6RH 4NN5B 4IDLA 1QBML 3E2HC 4LLYB 3BZFA 4OFKA 4QTIH 5GS0H 1JRHH 2DQIH 4K3JL 3DGCR 3QCUH 4MAYB 3MLTB 1IQDA 5I8KH 1IM9D 1BP3B 5MERB 1YYML 2GK2A 4LLYA 2Y4SA 4CDGC 5BOPA 4JN2B 3IDYB 2WWKT 1NC4D 3MLTA 4MAYA 5FM5O 2CLRB 1OD9A 1DLHB 5MERA 5HD8C 3B9DA 5E2VH 4DGIH 4C58B 2APBA 1YEFL 4JN2A 4F8QA 5LXGH 1INQB 3BO8B 2F5AL 2CLRA 4HBCH 1KENH 1DLHA 1MJUL 2B0SL 2UYLB 4GKZB 3R8QA 4OI8A 2HMID 4OGAD 1OAQL 5E4IA 3TO4D 3P4MB 3WS3B 4RBPK 5FYKH 1S9YB 1F11B 2IBZX 5DS8B 1INQA 3GNMH 3BO8A 1W0VB 3VWJB 3RVWC 1N0XL 5JHLH 2UYLA 1KLFA 4GKZA 1C16B 4AG4L 4TPRL 3H3KA 1IGYB 2WUCL 3P4MA 1KTDB 4OFIA 3WS3A 5C6TL 3TCLA 1FC2D 1S9YA 1F11A 1CS6A 4HUVB 2Z91B 4P2QD 5DS8A 3ILQC 4IMKA 1W0VA 3VWJA 2F74B 1WZ1H 1C16A 3MRHB 2EDRA 2ATKB 1IGYA 2ZCLH 1KTDA 5DK0B 1ZA3B 4PLJD 5C1MB 4HUVA 2YUVA 5DTFA 2Z91A 5A40E 1MF2H 3CFJB 2F74A 4Z0XA 1WCQA 1XIWB 5ILTL 1LO2L 3MRHA 1IVLA 3IFOB 2ATKA 5DK0A 3MV7D 1ZA3A 4DW2H 4R90H 5ADPH 4J6RL 4XVTL 1JMXA 1U93B 1MJ7L 4ETYA 4POYA 3CFJA 3NACL 1XIWA 3IFOA 1QRNE 2CMRL 2D7OA 3C09B 1O0VA 2X1WL 3NCMA 3TWCH 3L7FB 1S7XB 1U93A 2IBGA 4M7LH 3EYQD 4LVHB 3HNSH 4Z7VE 1JYWA 4I18B 5CP7B 1MJ8H 1DR9A 3TZVD 3Q1SL 5FGCB 3FZUC 3L7FA 4S1DC 2WUBH 2G60H 1FVEA 2EDHA 3LZFL 1YY9C 3OAYH 4I18A 5CP7A 5ABDE 2C3VB 4I8DA 4PP1D 5JXED 5JORB 2A83B 5SWSE 3GBNL 3BP6A 4JFZL 4WEBL 4Y5XB 2C3VA 2FCBA 3AREC 1EEZB 5F9AC 5JORA 1CL7L 2A83A 4BQBA 3BPLB 3HFMH 4Y5XA 5H37H 1MI5D 4IHOB 3OF6D 3UTTD 1EEZA 4OLZH 3I3EA 4WI4A 4NUGH 2JJTA 5EIQA 5IHUL 4PGEA 2WP3T 5IHLB 3GBMH 4KTYA 2OSLB 4IHOA 5GZOD 3M8OH 2GFBB 4FNLH 1RVFL 4G43B 3BE1L 1A6UH 4K3DH 2LQRA 1WCBB 3L5IA 5E4EB 2EECA 4KK5C 1CR9H 1K3ZA 2GFBA 2DJUA 5J1SC 4HKXB 3DLQR 1WCBA 2WLZA 4JO2H 1MHEB 1FSKB 4C83B 2B2XL 3SJVB 3L5WB 3FFCE 4MAYC 4OV5B 4HKXA 3ORJA 2FNBA 1INDH 5D7SL 4XH2B 4HJGB 2OQJB 1KYOK 1MHEA 3BEWB 1A1NB 3T2QA 4C83A 3SDYH 1QYGL 3BGMB 3SJVA 2YUZA 5MEQB 3L5WA 1FV1B 2BVTA 1T6VN 4XH2A 4HJGA 2OQJA 2BVQB 3BEWA 1A1NA 4ZFOB 3BGMA 2AK4D 1GPOH 5MEQA 3SY0B 3CX5K 3MOBL 4X99B 4OQ1A 4DUXA 1FV1A 4M3KB 4YGVB 3RVTD 4QY8B 2BVQA 5DD0H 4ZFOA 5KSAC 3SY0A 3VWJC 4X99A 4IDJH 4YGVA 2QJDA 4QY8A 3ILPB 4GS7B 1WEJL 4FS0A 4ODUB 5HYJB 4OZFG 4R2GC 1FIEA 4Y0GA 1IGML 2HN7B 4YHOH 3C2AH 3HZYB 3ILPA 3HE7B 4S1RL 2P8MB 1FORL 1EERB 3P9WB 4ODUA 5HYJA 5I6XC 1F8TH 5J56B 2HN7A 1N7MH 4PUBL 3HG1E 3HZYA 4ORZC 1XIWC 3HE7A 4R4NC 4KGLA 2VWEE 2P8MA 1AR1C 3TBYB 1EEYB 3PL6B 2EDDA 1E4WH 4XHJD 4Z8FL 4E41E 1LO4L 1BFVH 3C09C 3FT2B 5EU6D 5C0RL 5I66B 3TBYA 1EEYA 3DXAE 3PL6A 3MRPB 4HBQA 4L4TD 4ZD3L 3W2DL 3X3FH 4GG6A 3BESR 1MUJB 4H0IA 5L2KB 1KTLB 4ZYKB 5EZLB 1U8IB 5I66A 3ZHKA 3MRPA 2Y72A 3CC5B 5CJXC 3UJTL 2BMKB 3RJQB 4HK0B 1MUJA 5EBWB 1NMAL 3KYKL 1KTLA 2XOTA 1RULH 4FQ1H 4ZYKA 5L2KA 5EZLA 1U8IA 3UPRB 3HR5B 2P49B 3V79C 2EDKA 3CC5A 2DQTL 5T3XE 3TPKA 3WKNA 4Y5XC 1KTKE 5EBWA 4YDKH 4ZAKB 2A6DA 5DFVD 3UPRA 4PRAB 1J0IA 3HR5A 1CK0H 1T04B 4LCCC 3MLZH 4NKIL 1KCKA 3BPLC 4FQHB 1AQKH 2W0PA 2WSKA 1UEYA 1CGXA 3MRQA 4EI5A 3VI3E 4ZAKA 1KB9K 1VFBB 4ZS7H 2O5ZH 3HI5H 1BFSA 4PRAA 1T04A 2DLTA 1G9NL 1AI1L 2FGZA 4L8SC 1MQ8A 4NCDA 2EH7L 1F97A 4FQHA 3G5ZA 3UCRA 3NFPB 4TQEL 3U30C 1MCRA 5C71A 1ED3B 2ZG1A 1J8HE 3EHBC 1VFBA 1P2CB 2LABA 2NY2D 4PG2A 3BPNB 3X3GL 3DUUB 3VG9B 1ED3A 3OKDB 1DVFD 2J8UE 4GRLB 3DX6B 3LMJH 1P2CA 1DSFH 5DWUL 5C92A 1MWAB 5KAQF 3DUUA 1GGBH 5LKNA 1HCVA 3KYAA 3O2VL 1FSKC 3D9AH 4G8GB 4GRLA 3DX6A 4X4ZA 2V7HB 3PP3H 1MWAA 4YIQB 1DP0A 1KJ2B 1KT2A 2VLRE 3BIKA 2E7LA 4G8GA 4RRPA 4ZNCD 1B4JL 4Z7UE 5BMFL 2V7HA 4HUNB 3PWJB 4ZNEE 4AMKH 3CVHH 3BH9B 3P4OB 4YIQA 3RX7A 1KJ2A 3G6DL 4S0SD 3EYSH 4GBXD 4NP4H 3PWJA 3BH9A 1MIEL 4TSCL 1MCOH 3LHPH 5JW4R 1H8NA 3T0EC 2VXUH 3O9WD 1HHGB 5EUOF 4EZMA 2AJVL 4X80L 5L8LB 1MSPA 4XPFH 2YZ1A 1MFDH 3BGAA 1FN4B 5EWIL 4LP4A 3TIDB 1CD8A 1SM3L 5CJ8A 4GS7C 1EO8H 1HHGA 4ENEC 3UTZB 3UZEA 2IPTL 4TVPD 2W38A 1TQCB 1FN4A 3VD3A 1W0WB 3V5KB 3U6RB 1BZ7A 3UTZA 3TA3D 3P0GB 3NGBB 5IVXE 1W0WA 4UU9B 2FHFA 2XFXB 4LSVH 3RAJL 3STLB 3AGVA 3KR3L 4E42B 1JZ2A 1RURL 1OM3H 3M1BB 3MA9H 2R1XB 3MNZB 5I1EL 1UWEH 4UU9A 1IC4H 4FFVC 2EXWD 2XFXA 3STLA 2FD6H 3CFCH 3PWPB 4E42A 1PVHA 3M1BA 3SE4A 3JVGA 2X9YA 2R1XA 3MNZA 4OCRH 3RKDD 1HSBB 3CK0L 1NCDL 3PWPA 4KGJA 3S36X 5FB8B 2FX8L 1DQMH 5I8EB 1FNAA 2SEBB 1JF5A 2Q86B 1HSBA 3HMXA 1MJJB 3QEGL 4OBSA 1TZGH 1ZTXL 2H41A 4NIKB 5FB8A 2HKFL 5EA0L 5FYLL 5I8EA 2H32H 4RGOL 4EI5C 4JRXD 2SEBA 2J4WH 2IC2A 5C0GB 2Q86A 1MJJA 2X10A 2M2DA 4N1EA 1A6WH 2ZCKL 3TBWA 5IKCB 4RGMC 4YWGH 2XYCA 3EOYG 5C0GA 1YEJH 1RFDL 2FX9L 3L1OH 4LSRH 1M1SA 2BNRE 2DLIA 3A0OA 5IKCA 3OX8B 4BSVB 4L5FL 5K59E 2ZP0T 4NQTA 4FFWD 5HHNB 3AC0A 5IUSA 1MH5B 5DQ9B 2V5TA 3BPNC 3C9NB 4RBPH 3OX8A 4BSVA 2YPLE 3LDBC 4N5UA 1UCBH 3O3UN 4JPKL 5HHVL 4GRLC 5HHNA 3ZTNH 1MH5A 1GL4B 5DQ9A 4DUWA 3C9NA 4OZHF 1MHPL 1J11A 4OZFH 2GJJA 3H42L 1TFHA 2E7LC 3E6FB 3D48R 5D1XC 3ZKNC 2XN9A 1BWWA 2VITB 1YZZA 4BKLA 5C0CE 1EZVX 3ZE0E 2X5PA 1YYLL 2R0WL 3BSZH 2J6EA 1N64H 1YMMD 3EOAB 5HYSG 4NJ9L 1SEQH 3HI6L 1NJ9A 4OGXH 3UTSE 2VITA 3MOAH 5DUBA 1ITBB 2Y7QB 2E7MA 2JF1A 1VESA 1R3KB 4WFGE 5FUOH 3EOAA 4G6KH 4BH7B 1T22B 4RX4D 5KS9F 4E41D 2Y7QA 1LVEA 1VGEL 1LILA 1R3KA 4JO3L 6FABL 4O00A 4M1CD 2CD0A 1WFNA 3RBGA 1VEPA 4BH7A 4JKMA 1T22A 5BVPH 3GHEH 2ENSA 1S9VB 4Y1AE 4UDUB 1K8DB 4OF6A 3INUH 4HXAH 1AC6A 2VLME 2FRGP 1MVUB 3BYYA 4KI1A 4OGYL 1UZ6E 3UYRH 3T4AB 1S9VA 4UDUA 1K8DA 2UUDK 1DBKH 2YA0A 3RWHB 3QNXB 2XQYK 4TVSa 4F7MB 3DVNB 4V1DB 1MVUA 4ZXBB 3NGBC 4R0LB 2EE6A 4XVJL 2BOBB 4D2NA 3VXRE 3ARFD 2AJSH 3KS0J 5JHDE 3RWHA 3QNXA 4PJIA 4F7MA 3DVNA 5T3ZE 2NY1B 3G6AB 4V1DA 3SE4C 3JVGC 3EKCA 2GY7B 4XTRD 1KCRH 4ZXBA 4R0LA 2BOBA 1OARH 1HCFX 5DDHB 2VYRE 4C56A 1QLRB 3TLRA 4N8PA 4YX2L 2OP4H 3W0WD 3G6AA 1NCWL 1NCBL 2C7UB 2HTLC 5D1ZC 1HINL 5DDHA 4N8VB 2E5EA 3F5WB 4KFZC 5D71H 1QLRA 4OLEA 4HC1A 4J3SA 1KV3A 2C7UA 2Z8RA 4TVPH 3VWKA 2D31A 4PJ7E 5FCUL 4N8VA 1L7IL 2BJML 2JB6B 2ZPKL 3DVIA 3F5WA 3LEYH 2J8HA 1V05A 3BFOA 2BY2A 2NY7H 4NGHL 5T1DL 5E6IB 4RWYL 4G6JL 5GJTH 2IQ9H 1KSRA 3PIQB 4RAUB 1Z9LA 2JB6A 3GSVA 3TF7C 3MYZA 2VLRD 5E6IA 1ZKAA 3L95B 3PIQA 4RAUA 5HVHB 3TT3H 1MCPL 1A0QH 4WV1B 1DL7H 4ZO8A 3UYPA 4LDLB 4ODXB 1JYNA 1RZFL 3L95A 2IALB 1BJ8A 1HWGB 1IKNA 2XV6B 4WV1A 3K46A 3QUZD 3BQUB 4OIBA 4FQLH 1T66C 4ODXA 5FYKE 1HOCB 2XIDA 2W9EH 3B2VL 5FK9A 1YMHB 2VDNH 4OB5H 3JWDC 2IALA 4FFYH 3GRWH 5D93C 3ULUF 4YXHL 1ZVSB 5D2LB 3TNNB 5IWLA 1HOCA 4G9FE 1KULA 1YMHA 5C70A 1IARB 1Q9WB 3FTGB 2P5WD 3QI9B 1ZVSA 2IMNA 5D2LA 4YHLH 1MFCH 4MB5A 4XX1E 4HFUL 3TNNA 3GSWB 4PJXB 3RWJB 5SWQB 3A67H 4U3XA 2VN7A 3ULVC 1HYRC 3KPSE 1Q9WA 3FTGA 2OX5A 3QI9A 3U1SL 3ZKSD 3U7WL 2YRPA 3GSWA 4PJXA 1GC1C 3RWJA 3CXHK 3PGCB 1QSEB 5SWQA 4MYWB 1F6AB 1QSZA 4PJXF 4OJFL 1UB5B 4LRIC 5C0FB 1RPQA 4NQXB 4OCSH 4QXGH 1NKOA 3DV4B 3PGCA 1QSEA 1N5YL 3CPLB 4P9HH 3TIEA 5FECB 1A5FL 1F6AA 1EHXA 5IB3B 1WAAE 5FUZL 1UB5A 5L6YL 3P77B 1FZMB 3MV01 5C0FA 1PLGL 5CCKH 4NQXA 3DV4A 4KZDL 3BMWA 3GHBL 3CPLA 1CBVH 2GUOB 5FECA 2Z8SA 1VPOL 2P8PB 5IB3A 4PJ8C 4GAFB 3P77A 1FZMA 1J9CT 2X4TB 1HXYB 5JDSB 3JWDL 3F7PC 3WUZA 1T2JA 5HYQA 1IAOA 2GUOA 4QNPE 2P8PA 3QIBD 3DYMA 5DR5H 1LGVA 3X13B 2X4TA 1HXYA 2XQYG 1D9KB 5JDSA 5HDBE 3GSNB 2Y6SC 4R0LC 1U2HA 4MJ2A 3W9DB 4UIMB 2XZCL 5JZ7D 3Q5OA 5IJVB 5DJCB 2V9TA 5AEAA 1FO0B 2JCCE 2NPLX 3CZJA 1RHHB 2BDNH 1D9KA 2OL3L 5I8CB 3ULVL 3GSNA 4LSTL 1K9TA 2CGRH 4UIMA 4U7MA 4GUPB 5IJVA 5DJCA 4MNGE 1BIHA 1FO0A 1MAKA 1KJ3H 1RHHA 4FXKB 4P2QB 4YBHA 5I8CA 3FQTB 5CIPB 5IQ7L 4YHPB 3VWKC 1IEAB 4WDIB 4GUPA 2CR6A 2I60L 4CRPA 4I77H 3TT1H 4QHMA 1P1ZB 4FXKA 1H5BB 2E6PA 4P2QA 5LGHH 1I1AC 1N4XL 3HNVL 3FQTA 5CIPA 2RGSA 4YHPA 1MPAH 1EX0A 3BDYL 1IEAA 4WDIA 3DV6B 2FLBT 2GKIA 4PJDE 1P1ZA 1WICA 1H5BA 4LAQL 1JGVL 2E8ZA 3ARTA 2NY3B 4S1SH 4QEGA 4KWUA 2B4CL 4HZAA 3DV6A 5E5MB 2Z31D 4OFPA 4ZFZB 4AQ1B 2DBLL 5C0CD 5JXAH 2BERA 1IKNC 3W5MA 5E5MA 4GXUN 4WV1C 1T1YB 1EH9A 4WUUE 4ZFZA 4KTEH 1Z9SA 2EDLA 5E56A 2ZKHL 2A6KB 1G6VK 1IGFL 1CVSC 2VH5H 4O02L 1OD7A 2VDQL 2N7BA 1T1YA 2CRIA 3RIFF 3GI8H 2BOCB 3OKLB 5F9OH 2A6KA 1FFRA 3QDJE 1YNLL 5IBUG 1G9MC 1WFTA 3NA4A 3BKCH 1I9RH 3THMH 3T3PF 2EDOA 5EOCH 1A7RH 3VFRB 2BOCA 1IEHA 3OKLA 3K4AA 4Y1AD 3T09A 1NEUA 2V2TB 1RU9L 3T2PA 3BISA 3VFRA 3QQ9D 3MNVB 1A6ZB 2X4UB 5J13C 1LE5B 2HLAB 2VDRL 4N0CC 4GAGH 4UBDC 4KH2A 4JO1H 2V2TA 4XP5H 4J3VA 2JKXA 1TPXC 2AV1B 1A6ZA 3MNVA 4JQIL 4KKAC 3S6CA 1LE5A 2HLAA 3AM8A 4NO0B 1V3MA 2BY3A 1OP5K 4HKBB 1FE8L 5C08E 1OAKL 2DQUH 4EBQL 3L6FB 4ZSOE 4NO2A 5T3ZD 1FL3B 2AV1A 4FZ8L 2XZAL 4NO0A 1EJOH 4P5TD 5B39G 4HKBA 5HY9B 4K23L 4FQJL 2J7LA 3L6FA 1FL3A 1NAKL 3P9LB 4HAFA 5CD5C 3WXWH 5HY9A 4UUJB 4YBLC 5GJSL 3P9LA 5IR1B 4POZC 5IQ9B 4NQCE 5CLTA 2JK5B 5GRWA 2XXMB 1IFHL 1YEIH 4UUJA 5IG7B 3SCMB 2XZQL 4FQXA 5FIEA 5B22A 3PF2A 5IR1A 5IQ9A 3EW3B 4YZFF 2JK5A 4GXVL 2E3VA 4NSKB 1LO0L 4HPOH 5IG7A 1YEDB 4W70A 3LH2L 3SCMA 4KZEL 7CGTA 2VISB 3VGDA 5EN2B 3J8F7 3P11H 5JQ6H 5F9DC 4NSKA 3ZHLA 5DMJB 3V4PH 3EIFA 1YEDA 3SKOB 2HH0H 3HN3A 4HW6A 4S11A 3P4LA 1FYTE 2VISA 5EN2A 2CK0H 3VGBA 1GIGL 5CJQL 2Q76B 1HNFA 1F2QA 1Q0YH 4POUB 3SKOA 5I15H 1CLZH 1KB5B 1YC8A 4JGUA 2ZG2A 1VDGA 4FXGB 2DQGL 2Q76A 5HHXH 4JN1H 5FHAL 1V7NL 2Q87A 1KB5A 4G9FD 4JZJB 4IOSD 4FXGA 2NY3C 4DKFH 25C8L 4MLSA 2F8OA 2YMXL 4U1LB 1CCZA 5CGMA 1Z6JT 4JZJA 4ODSL 4BFGA 4KQ3H 2DWEB 4JFYB 4G80B 1G1YA 2PKDA 3DO7B 4WEUD 4FQQB 1BGXH 4HMCA 4M6NH 4OTXH 4HFWB 4F9PA 1ZLVK 4JEGB 2DWEA 2J88L 1J0ZA 2HVJB 4BZYA 4JFYA 5FA3B 2BVOB 3DO7A 4L29A 3VW3L 4FQQA 3P0VL 1QBMH 5DJ0B 3WIHL 1PG7X 2ADFL 3JXAA 4HFWA 4OFDA 5E8DL 4RGNC 15C8L 4YFLF 3RWDB 4TOYL 4PB9L 4HS8L 5FA3A 4HV8B 1ZE3C 4QRUB 4PGZA 1YYMH 4QRPD 4U6YB 5D5MB 5DJ0A 1AXSB 4BK5A 2BRRL 2I07B 1ES0B 3QZWG 1H3UA 1G7HB 3RWDA 4HV8A 4WJ5B 3WDHA 4QRUA 1EMTL 4K7PL 4HPYL 4U6YA 5D5MA 1AXSA 1ZLUK 5E24E 2I07A 5E2UL 4Q97A 5BW7A 1G7HA 3A6OA 2UUDH 2OR7A 4DVBB 3MUJA 2F5AH 3RWFB 2RR3A 1MJUH 2B0SH 2W60B 1OAQH 2VNCA 1S5IL 4I5BB 2NY2B 1NCAL 4CU7A 4GMTL 4DVBA 3RWFA 1KJVB 3QYCA 2W60A 3DI3B 1EUTA 4AG4H 5SX4I 3UJIH 4TPRH 4ORGB 4I5BA 2WUCH 4PRPD 5C6TH 4UT9L 2YPKB 2LFGA 2V6HA 2CO7B 1KJVA 1SMOA 3HZKB 1CGYA 4ORGA 5KANI 3TN0D 4EOWL 4HF5L 4Q9QH 2YPKA 3V9FA 3VXSE 1HYSD 4XNZC 5LAXB 2H45A 4FQXC 2GYSA 32C2B 5AZEL 3HZKA 5ILTH 1LO2H 3RKPA 4OCLC 3ZKQD 1U91B 1A7NL 5LAXA 1ADQL 4G7YH 4L4JA 3OKYA 32C2A 3QPXL 3FRPA 2CMRH 1QRNB 1OAZL 2XKSA 5ID0B 4MAUL 3SGDI 3O4LD 4JFHD 4NKQB 4I0CC 2J3SA 2BNQB 4Z7VB 3KAAA 1QRNA 4HLZG 4M5YL 4KMTL 3Q1SH 3VFGL 2BHZA 5ITFB 2YN5A 1A21A 4M6AA 3LZFH 4XPBL 3DRQB 2HYMA 3MA7B 2BNQA 4Z7VA 4ZTOL 4YJZL 3IU4H 2P5ED 4BFEA 3F6LA 1XCTB 4JG1L 3OG4B 3QAZB 4Z7VF 4D8PB 5ITFA 5SWSB 3OKMB 5HGGS 3GIVB 1QRKA 1NMCB 2DTML 3TA3B 3DRQA 4JFZH 3MA7A 4WEBH 4APQB 1BWMA 1QSFD 4KKCD 4MMXC 1XCTA 4D8PA 5SWSA 5IB5B 1T1XB 3QUXC 3OKMA 4JZJC 3GIVA 3VRIB 4JVPA 3TNMB 4LP5A 4APQA 5GHWL 4KY1L 5MEOB 1OAXL 2ZUYA 5IB5A 1NFDE 1T1XA 4JY6B 3W39A 3VRIA 4ELKA 3UX9B 3TNMA 5IP4A 2JB5L 3NCEB 3RY6C 4AT6B 4Z9KB 5MEOA 1VEMA 4K9EL 5LCVL 3NPZB 4I0PD 5JW4M 2VERN 1GGIL 4IM8A 2AAVA 2JE8A 5KZCB 4AT6A 2C1OB 4JDVB 3OGCB 3IJHA 4JVWA 5GISL 3ZDYE 5AYQA 5JQHC 4MCZB 4OKDA 1VFOA 1QD0A 2C1OA 3MJ7B 4JDVA 1QPPA 3OGCA 3MGAA 4LMQE 2BHYA 3FFCB 1FHGA 3L3JB 5D7SH 3GKZA 2UY6A 4CKVX 1XF3B 4MCZA 2AEQH 5KJRL 4M48H 5BW7C 1QYGH 2MFNA 3MJ7A 5ACZB 5IROA 1T6WA 3FFCA 3ESUF 2X42A 4UIKL 1CICD 3VFWB 5CEZL 3BKYL 4UTBL 4Y2DD 1XF3A 3ARDB 4L3CB 5ACZA 3MOBH 2XWTB 4YGAB 3LB6D 3VFWA 1EIBA 5J6HB 3ARDA 5ENWA 3RZCC 4L3CA 1MCNA 2YEZB 5GRVL 1RY7B 3TC9A 3CDFA 4G7VL 5GGTL 5J6HA 3S5LG 3S88H 4PLNC 4WTZA 1WEJH 1QKZL 2YEZA 5DJDB 3QUMB 1IGMH 3L3GB 3HB3D 4J12A 4HMDA 4XAWL 3T08A 4S1RH 2KZWA 1IGCL 4J4PA 4RISL 1FORH 4Y4HB 3I6LD 1MRFH 5DJDA 3QUMA 1PSKL 2ID5A 3I85A 3L3GA 4OLYL 5KVMC 4PUBH 1J0YA 3HG1B 2XRAH 3HC0B 5MENE 3KWWB 2ZCHL 3RRQA 4Y4HA 3F62A 1MFBL 4H88H 2O5YL 4AENB 3QR2A 1OT2A 3U36B 2NR6C 4Z8FH 4MB3A 3HG1A 1D6VL 3HC0A 5FDWB 3KWWA 4P2OC 2JELH 4E41B 3VXMD 4FG6C 5C0RH 4LEXH 2EDWA 3DXAB 4AENA 3W2DH 1Y6MR 4U2YA 3U36A 4S10A 5HGBB 1KXQE 5FDWA 3LSOB 3RVUD 3VXPB 3DXAA 5DD3L 1U95A 3EAKA 5HGBA 1UQSB 3C6LB 2E9BA 4LCWD 1NMAH 3KYKH 4ETQB 3LSOA 3U2SB 3PWUB 3L3KB 4R4FL 3VXPA 2WV3A 3B5GA 3QAZC 4B5EA 4MXWH 5C9JB 5GS2H 1CZ8H 2DQTH 2IWGA 1NMCC 1EFQA 1UQSA 3C6LA 3KLHC 5FM4A 4ETQA 4YPGB 3DPBA 5ERWB 3PWUA 3L3KA 3GM8A 1HK6A 5C9JA 4NKIH 2Y06H 2XY2A 4LOUD 2DLFL 3FONB 4YPGA 5ERWA 3LV3B 1G9NH 1AI1H 2EH7H 2O61A 4PRIE 4WO4C 1R24B 1QLFB 2NY4B 4IRJA 3FONA 1J8HB 1L4IA 3LV3A 3D6GA 5A2KH 2PXYC 1Q9KB 5C09E 1ZAGA 3X3GH 1R24A 1QLFA 2VLKE 1HI6B 3N06B 4P23C 5FA4B 5HI5C 1WT5C 1J8HA 2J8UB 5DWUH 2AXJA 1Q9KA 2ZNXA 2Z0BA 3CH8A 1HI6A 3T0VA 5FA4A 3O2VH 1D5ZB 4ODWB 3GGWB 3F12B 3JWNC 2ZUTA 2J8UA 1GH7A 1RJLB 1SEBB 3GSXB 3G04B 1UJ3C 4F37K 1LWRA 4MJID 4ODWA 2VLRB 3GGWA 3F12A 1I1CA 5BMFH 1U8LB 2DIAA 4K3GA 1RJLA 1SEBA 4Z7UB 3GSXA 2BSSB 3G04A 1OQOA 5I18H 3G6DH 1OVZA 3ARDC 2VLRA 4WFFE 4WUKL 5J6GB 1U8LA 3SDDB 4Z7UA 2BSSA 4ZNEA 2VR9A 4I3RL 4OV6F 3QUZB 1MIEH 4TSCH 5INCB 3DSFH 1IAMA 2FIKB 5HHOA 3WV0A 1JWSB 2D7QA 4G6AD 5J6GA 3SDDA 4KK9D 2AJVH 4HLZH 3NAAH 3QUZA 3BIAX 5JLZB 5INCA 5EWIH 1A7QL 1L7TL 1SM3H 4J4PC 2FIKA 4I4WA 1JWSA 4KXZI 1WJ3A 4GRWH 3NOIA 1RZGB 5DMYA 2AKRB 4AZ8A 4PJEE 5JLZA 4KKLD 3UYOD 1CLOH 5F1OB 1BOYA 4Y4FD 3PUCA 1RZ7L 1RZGA 2AKRA 4IRZL 1NBVL 5IVXB 3RAJH 1IZJA 5JA8B 3KR3H 5FOBB 1F4XL 1RURH 2AI0L 2P1YA 4YHKH 5I1EH 1KPRA 5HGAB 5IVXA 1SVZA 2DTSA 1FVCB 2UZYB 4P5MB 4DK3A 1JNLL 1TIUA 2A0LD 1BM3L 2HTKC 1WWBX 4JRYD 5FOBA 3O8XB 4F15C 2K7PA 5HGAA 1KIRB 3EUUA 1FVCA 4P5MA 4Q58C 5FGSA 5EIIB 5DURD 1DBJL 3CK0H 3F58L 3OMZA 1NCDH 5EBMB 4CVZB 3O8XA 1OPGL 2FX8H 2F54E 2FGWL 1K6QL 5C0EB 1ZLVH 1KIRA 1BQSA 3C6LC 3PP4L 3HRPA 1HNGA 5HPMB 2IEPA 5EIIA 3QEGH 4WGVB 5EBMA 1ZTXH 4CVZA 2PTVA 4F80A 4UDTB 5H94A 3WMSA 2HKFH 4PG9B 5C0EA 3N1MC 4MWFB 5FYLH 4RGOH 4KI5D 4CU8A 5HPMA 4EDWL 1DCLA 3ZYIA 3PJSB 1FQ9C 4FXLA 5F1IB 4UDTA 5DJAB 3UAJC 1CI5A 1X6NA 4PG9A 4MWFA 3WKML 4IRJC 4EUPG 2XPGB 2R2CA 2DLHA 1NL0L 4R6UA 3PJSA 1FLTX 2VDPL 1RFDH 4RZCB 2FX9H 1ZGLM 5F1IA 4GAYB 5DJAA 1ZLUH 2BNRB 1OGTB 2QHLA 3B8YA 5JOPE 2XPGA 1VACB 4L5FH 5GRJL 3ZHDA 4MA3B 4GAYA 2HP4A 2BNRA 1OGTA 5DHXB 1VACA 5HHVH 3B9EA 4JPKH 2YPLB 5KVGL 3ARPA 4MA3A 3K2MC 3AB0B 1IAIM 4G6ML 5K59F 5TDPB 4KDWA 4CW1B 3H42H 4JY5L 3OTTA 4YHIB 2AEIT 2YPLA 2XTJE 3RP1A 5DJ8B 1AGBB 4CMHC 4PR5B 1W72A 3TYFB 1FVDB 5C0CB 5TDPA 4Y4KD 5IW3A 4ELME 1YYLH 2R0WH 4CW1A 3RGVD 4YHIA 2IBZY 4NJ9H 5DJ8A 3HI6H 1AGBA 3UTSB 3PHQB 3TYFA 1FVDA 4I2XE 5IB2B 3MBEC 5IMMB 1S7RB 3IFPB 5SV3A 3IS1X 2EKSB 4OGZA 4N5ED 3ZE0F 3O11B 3UTSA 3PHQA 5CGTA 2QLVB 2QL1A 5IB2A 5IMMA 2X6MA 5AWNL 1C08A 1S7RA 2B7DT 3IFPA 4JO3H 4LPWA 2EKSA 1ZHNB 5C0ND 1BOGB 1D5IL 3HC4L 3CDGA 5DUPH 4Y1AB 4X7EC 1CT8B 2BP3A 3G9VA 4M7KH 5DHVH 1JBJA 1KIPB 1ZHNA 5MHSD 1BOGA 4XP9H 4XI5C 3MRRB 4DKEL 3RL1B 1A4KA 1CFBA 4Y1AA 1KBGL 3WE6B 1KIPA 3TFKC 3TJHD 3MRRA 3RL1A 4XVJH 3E3QE 3QEHB 1H15B 3V6FB 3VXRB 4F2MB 4N9OB 3WE6A 2R8SL 5JHDB 1BPVA 1IRAY 5TGBB 3OR7B 4OCYL 1SMAA 1K2DB 1FL6B 4QRRE 1TZIB 3QEHA 1H15A 2YD5A 3V6FA 3VXRA 3S3SA 2Q6WB 3IDIB 5AUMB 5JHDA 2RFXB 5TGBA 1NCWH 4U3HA 3OR7A 5ADOL 4JY4B 1K2DA 1FL6A 2I5YL 4O2FB 1TZIA 4ODHL 3WS6A 1HINH 2VZOA 5J11B 1XT5A 3W11D 3AROA 4YE4L 4L4VE 5IMKB 5E6YA 2V17L 3QNYB 4PJ5E 2Q6WA 3TV3L 3IDIA 4NWUL 5AUMA 2RFXA 5IEHB 4JY4A 4O2FA 3MLPA 4ESKA 5FCUH 1L7IH 2BJMH 2ZPKH 4PJ7B 5IMKA 1G6RB 3QNYA 1RQ5A 2Q8AL 2HLFD 4P49A 5IEHA 3C5ZC 5T1DH 4NGHH 4G6JH 5ACLA 1UG9A 4PJ7A 5DMKB 4XNXL 1G6RA 2P45B 1CN4A 4MA8L 3ZSSA 3DETD 2YC1A 4EXPX 3FN9A 2WP3O 3L3HB 4PJ7F 1RZKC 1MQKH 3OB8A 2KBGA 1ZANH 1MCPH 5DMKA 5HDQL 3CNKA 3L3HA 1RZFH 4NO3A 4K3EL 5EBGA 3RIAK 5D96C 1JZ8A 2ESVE 5KSBE 1II4E 3B2VH 2H2PD 1XGRB 2CO6B 4NZRL 2H6PB 3GMLB 3IF1B 4JQVA 2BY1A 4RFEB 4QWWC 4D9RE 1OY3B 5A2JH 5D7JB 1XGRA 1DBML 2WQ8A 3UDWA 2D7NA 4MLIA 2H6PA 2AXGA 4NCC2 3IF1A 1IJ9A 4RFEA 3V5HB 1HQRB 5D1QB 3NBNA 5D7JA 3DYOA 4N9GB 3W81A 1AFVL 1VERA 4LNVA 3KPSB 3V5HA 4MMZC 3U1SH 4LPXA 1HQRA 4YR6B 5D1QA 3U7WH 2IAMD 3WIFB 4XXCC 4H0HB 4ODBD 4N9GA 3GUTB 1HN1A 3UPAA 3KPSA 4OJFH 2VOTA 1RIVL 3VFTB 4YR6A 3P3YA 5MEPB 4OI7A 3WIFA 1RZKL 1N5YH 1MLCB 4YBQD 5IFJB 3GUTA 1A5FH 3V4VL 1KC5L 1LD9B 5FUZH 4OIIL 1G84A 3VFTA 5MEPA 1PLGH 1EA9C 4UI2A 3GHBH 4K94C 1MLCA 2ITDB 1ROWA 5D2NC 4WI2A 5IFJA 1VPOH 3LQAC 1U3JA 1LD9A 1WAAA 1A7PL 4AL8H 4CNIA 3JWDH 3L7EB 3GMQB 3DECA 3C8KB 2ITDA 5F89B 1IE5A 1MIMH 3L7EA 3GMQA 1CTOA 3C8KA 2QADC 5F89A 3Q2CA 3JWOL 5D7KE 2CDGB 1UC6A 4TNWK 3MLWL 4H26B 5GRVK 2HT2D 3K80A 2JCCB 3F7RA 3MLRL 2OL3H 2Z9TA 3P2TA 5CBAB 4QNPF 2BCKB 4OF3A 3ULVH 4JM4H 4LSTH 4EUPH 2EICA 4PPTA 3WS6C 5T1LB 2CDGA 4H26A 4M8QB 4MNGB 4OT1L 1BD2E 2JCCA 4YHZL 5SX4H 5SWZD 2A9ML 4NC0B 5CBAA 2BCKA 3GJFK 5IQ7H 2JCCF 4L3AA 3WLWD 5T1LA 4OFYD 3EYUL 3TN0B 2I60H 2QQLL 4M8QA 4MNGA 4MJ5B 1N4XH 3HNVH 5JUEL 4YHML 3B2UC 3BDYH 3TVMC 4Y2OA 4TNVK 4NM8L 4MJ5A 4PJDB 4K94L 4LAQH 1JGVH 3LQAL 4OCWL 4YK4C 4GSDH 4UNVA 1Q0XL 2B4CH 4YEFA 1RJZB 3QRFM 5J3HD 4PJDA 4TSBL 3HMXL 4LVNC 4MNHA 4HUMB 4GO6B 3FO1B 3QWRD 5D70L 3SGDH 1RJZA 5F88B 4WUUB 1J1PL 3V0VB 1CYGA 4FABL 3FO1A 1SVCP 1IGFH 5FXCH 3M17B 3A6BH 4JQVC 4O02H 5E9DD 4WUUA 1P7QB 4ALAH 5DO2C 4KROD 3ZDZE 1YNLH 3V0VA 3QDJB 4DQOH 1GRWA 1ORQB 3RU8L 1F6LL 2W0FB 3M17A 1KN4L 4PJAE 3D0VB 4OSUL 3WEXB 1P7QA 3B5TA 4KRPB 4PYGA 3QEQD 5T5FH 1LO3L 3QDJA 4JHZA 1ORQA 1RU9H 1U8NB 2W0FA 3D0VA 3WEXA 4WFHE 1RV6X 4XVUC 2PNDA 3SDCB 4E9LA 1F4YL 4QCIB 4RMWA 1U8NA 2NY0B 2JIXD 1R3HB 3X14B 4IOFD 4U33A 4JQIH 4LSPH 3SDCA 1U8JB 1FE8H 4MVBC 1OAKH 5C08B 4Z0BL 5KVFL 1JMZA 1R3HA 4EBQH 3X14A 1TVHB 4HWZB 5CGYC 4FZ8H 2XZAH 2FHBA 1U8JA 2A1WL 3Q6GL 5IT2L 4OD2B 4K23H 3S34L 5C08A 1MCJA 5E08L 1TVHA 4PV9B 4DGIL 4HWZA 2LTQB 4NT6B 3L3DB 3WYRA 3K8MA 3PDDA 4OLXL 3KPPB 1AO7D 4XWOD 2HFFB 4OD2A 5J89A 4Y5YC 2MQ0A 1BREA 2OZ4A 4QF1B 4O2CB 4PV9A 4NT6A 3SN6N 3L3DA 5FV2A 1U6AH 3D2UD 3KPPA 2Z35B 2HFFA 4ZPVB 4NQCB 1IFHH 1T0NB 6CGTA 3RTQB 3JSSA 2ICEB 5AG9A 2XZQH 2PR4L 3NCCB 4QF1A 4O2CA 5DD6B 1JGLL 5E2TL 1QBLL 4OZGB 5IHBA 4G3YL 4ZPVA 4LHQB 1P69B 1T0NA 4GXVH 4KJWC 4NQCA 3RTQA 2ICEA 1BBJB 4YDLB 5C2UB 3O2WL 4KZEH 2IMMA 4QRQB 4OZGA 4F9LC 4ZMAT 3VJ6B 4CMMB 1MF2L 3MV8D 2EDNA 5C6PB 1M4KA 3BWUC 1BBJA 2AJZB 3MXVL 4QRQA 5ADPL 1FYTB 3VJ6A 5CJQH 4CMMA 3AFLA 1ULVA 3AXLB 2W65B 2AJZA 4XVSL 1VEOA 4M43H 4OF5A 3QQ3B 3ROLB 1FYTA 4A2LA 3FAWA 3TWCL 2DQGH 5FM5M 1EVUA 5F9WB 5FHAH 4FFZL 1BBDL 3AXLA 3FT4B 3VA6A 3RGHA 1DQJB 3KPRD 3QQ3A 3ROLA 3GJEB 5F1KC 1X5XA 25C8H 2WUBL 5LBSL 3U48A 3G9AB 2KDGA 2YMXH 3GEWB 3ZKXC 3FT4A 2EC9T 5DHYB 4X8XA 3S37X 5F7EH 4U0RC 4ODSH 1DQJA 2CUIA 3GJEA 1BJ1H 1X5HA 3PWLB 1OWRM 3CVHB 1Y0LB 5DHYA 5F6HI 1XH3B 3FO9B 1C5BL 3PWLA 3SKJL 3RL2B 2I27N 3MCG1 3CVHA 1Y0LA 1XH3A 3VW3H 4PBWD 3P0VH 3BOVA 3WIHH 3FO9A 4OLZL 2ADFH 4IRSD 4NFCA 1EZVY 2C5DC 15C8H 3RL2A 1T0PB 1WZKA 4PB9H 4TOYH 4HS8H 3RPKA 1UM6L 3ARGB 5ETUB 5BJTA 1BLNB 4CAGA 2BRRH 3ULUL 4XAKE 3MRBB 3MYJB 2OR9L 1P7HL 1N6QH 5IF0B 1DBAL 1T2QH 3ARGA 2LV4A 5ETUA 2VC2H 4HPYH 5IFHL 1BLNA 3SDCC 5E2UH 3MRBA 5D8JL 3MYJA 4LHUG 5IF0A 1HH6B 1CDHA 3C2SA 1AKJA 4JGJA 5JOFB 2YKLL 2XA8L 4X6CE 5D7KD 3U4EB 1T2XA 1NCAH 3LD8C 2AJYL 2Q3AA 3G5XB 4GMTH 3WD5H 1HH6A 4Z7NE 1YEHL 3KPMB 5HHME 3K0WA 2HMIC 1X5IA 5ECJE 1L9NA 3MACL 4UT9H 3G5XA 1V5JA 1TCMA 2LTQC 3KPMA 2GY5A 1KLUB 2QQKL 3FQUB 5B38G 1A1MB 4EOWH 4HF5H 1GGTA 3VXSB 3EO9H 4P46B 3T0EE 5AZEH 3D18B 1KLUA 1PEZA 3FQUA 1A1MA 1X5ZA 4HWUA 5EU5B 3D3VD 3GMOB 4PLJC 3RTQC 3SGEI 1MHCB 1A7NH 3VXSA 2O5XL 5F7DA 3FZUD 4P46A 4I1NB 3SGJA 2X9XA 4GAJH 5HYJE 3D18A 3QPXH 4Y16B 3SBWA 3MR9B 2H32B 3MJGX 4DGYL 1YY9D 5L9DL 5KTEL 1OAZH 5EU5A 1U58B 3GMOA 4OF0A 1MHCA 3MCKB 1CXIA 4YDLC 5CLWA 3K8LA 3LQMA 4Y16A 3MR9A 2H32A 3D39E 5E5UB 4M5YH 4KMTH 1U58A 3SDAB 4DTGL 3BKJL 3HZMB 3MCKA 3VFGH 4HJ0C 3EYQC 4XPBH 3WSQL 2BSED 4Q6IB 4ZTOH 4WCYL 2QV2A 4KXZH 1E4WL 5MI0C 3SDAA 3H7BB 3HZMA 2OTWB 4GG6E 2VLJD 1IAKB 1ND0B 4JFEB 4JG1H 2H26A 3MJ6A 3D25B 2DTMH 3MV9D 1I3RA 1WISA 4PGBB 4Q6IA 3EJZD 4PP1C 3H7BA 2OTWA 3R8BB 4C59B 2XWJB 4JFEA 1IAKA 1ND0A 5B3JF 1PQZB 3D0LB 4U1IB 4OZFB 4PGBA 5D9SB 5GHWH 5CZVL 3FQWB 4X4ME 2XWJA 2Z93A 1F42A 1PQZA 3D0LA 4U1IA 1NFDB 4OZFA 2XY1A 5C0BE 3RX8A 2JB5H 1JI2A 2MKLC 3FQWA 4K9EH 5LCVH 5J12C 4MAYD 5L0QC 4YDKL 4KMQA 1Z5LB 1NFDA 4MD4B 5DURB 1GGIH 4NQDE 1CK0L 3MLZL 2NXYB 1YY8B 1NFDF 1AQKL 5C0DB 4MD0B 5F3HA 3GFUA 2EE2A 1Z5LA 5GISH 4MD4A 4A2MA 1VA9A 1CF8H 1YY8A 4JFQB 5C0DA 5HPOA 1MCQA 4MD0A 2GIYA 4CUCA 1P9MC 2CRYA 4JFQA 3ZDYF 2E8YA 3VWJD 1ZLSL 4J3TA 3X17A 4UIKH 5DQDH 5CEZH 2J12B 4UTBH 3WO4C 1DSFL 2D9QB 4GG8B 4AEEA 2FH8A 3HAEG 3S97C 4K71B 4M93C 1C5CL 2DBJA 3VH8B 1S7TB 3T3ME 3NA9L 5F7WC 4P59L 4P57A 2ZUWA 5GGTH 4G7VH 1XIWD 2J5LC 1S7TA 2BVYA 4IBLT 4R4ND 1QKZH 1PG7H 3V2AR 5CFHA 1AR1D 3LS5H 4XBPB 4UZGA 3CFEB 2CKBB 4XAWH 3QDME 5I71B 2BXYA 3GJFH 3HZVB 4GMSH 1IGCH 3IB4A 3BKML 1CXLA 4GJTB 4H8WL 4Y4KB 5IGXL 1PSKH 5F6IB 4OLYH 3SGJC 2W59A 4XBPA 3RGVB 3CJJA 3CFEA 3IS0X 4BFIB 1QBBA 1TJIL 3HZVA 5ICZB 1MOEA 2P7TB 5DMGD 5MENB 2DRUA 4YEEA 2O5YH 3CIQA 3RGVA 5ICZA 2ED8A 2P7TA 5MENA 1U8MB 4X6DE 5JNYB 1IL1B 1NGWB 5B4MD 2DF3A 3BN9C 2EEBA 4EJ1C 1NC2B 1U8MA 2E9IA 4IEFB 5JNYA 1IL1A 1OTSD 1NGWA 2YD1A 5DD3H 4E5XB 1QTYT 2APTA 1C7SA 1KXTB 1NC2A 5MP6L 4RDQF 1B0WA 3OXRB 4XCFL 3KHQA 4R4FH 4E5XA 4XC3H 1CWVA 1MRCH 3OXRA 3ZKMD 3BDBA 1BFOB 3GRWA 2P44B 5F7YC 1KEMH 3WXVL 3WL9B 1BVKB 5JA9A 5LQBL 1H3WM 2DLFH 5H35B 1I1RA 1WIPA 4P4KB 1BFOA 2G2RB 4PRIB 1MCDA 1UH2A 3WL9A 1BVKA 1R3IL 1IILE 5H35A 3SJVD 1QO3B 4O5LL 2MOVA 1REIA 4FMKA 1JI1A 2XTLA 3FT3B 4P4KA 3SQOL 2G2RA 4PRIA 1T3FA 5C09B 1T83A 2MTPA 2VLKB 4RQQB 5TQ2L 2F19L 1QO3A 3LRSB 1FL5A 1RIHH 2FEEL 5DT1H 3IT8D 5C09A 5DA0B 3S8WA 2VLKA 1JHTB 4RQQA 4CVWA 3LRSA 2E6QA 1QLEL 1D7FA 3UJJL 2C4FT 1IGJA 1IBGL 2H2SD 1JHTA 3RWEB 3T0ED 1NBZB 3QPQC 2X09A 2ADGB 2UY7A 35C8L 4PRHE 4QKXB 2XN9E 3B83A 3RWEA 4K71C 3VRLE 4WUKH 4ENED 5HYJD 1NBZA 2ADGA 1LHZA 3VG0L 3MREB 3HE7D 4GBXC 3QFJE 4AEHL 3ULVE 1ZWIB 3D39D 1CGSL 1A7QH 3IAGC 3MREA 1A2YB 3E0GA 1L7TH 3O9WC 1EGJL 3RDTB 1ZWIA 3SE9L 4AH2B 2ARJB 3MUZ1 1KF9B 3PL6D 5KAQG 4PJEB 4OCMC 5DEZA 1A2YA 4FFVD 3ZL4L 3DURA 3RDTA 4X6FB 1X5JA 2ARJA 4AH2A 4R7DB 4IRZH 4PJEA 1N3NB 1NBVH 3MGOB 3LN9A 4LIQH 5L2KD 5F7KC 4PJEF 1TJGL 2E27L 4X6FA 1F4XH 2R69H 4HKJB 2RCSL 2A9NL 2R15A 2YPVL 1N3NA 3P30L 3MGOA 4HK3N 2FZ3B 1PYWB 1BM3H 4HKJA 5GS1B 4PJIE 5HYSB 4EI5D 2FWOB 3K1DA 4ZAKD 2FZ3A 1PYWA 1BIIB 2A74B 3FJTA 1M7DB 5GS1A 1OPGH 2BY0A 4C56E 2EDBA 4QOKE 3RKDC 2FGWH 5HYSA 1K6QH 1UKQA 2F54B 4NN7C 3VI4E 1JZ4A 1OTUC 3PP4H 1BX2B 2FWOA 4URTB 1BIIA 2A74A 1M7DA 2EDJA 1EFXB 4H1LG 4X9GA 2F54A 5IVNA 4EDWH 1BX2A 4XNUL 2X1XR 2DICA 3QXWA 2B5IB 1EFXA 3WKMH 4HG4K 1AJ7L 1NL0H 3OKOB 4GRLD 2VDPH 2QSTA 3AY4A 4TVPL 3D1MC 4P4KC 5DVOA 1N6VA 3HAEH 3QXDB 4WWKB 1T83C 3AAZB 2CRMA 5GRJH 2NY7L 1WUNT 5HHPB 3OKOA 4G8GD 3ZKND 3MRDB 2DD8L 1KOAA 3CLFL 5IBTL 5E95B 4WWKA 1CDIA 5TDOB 2X4OB 3AAZA 2UVEA 4QHKJ 5HHPA 4FFWC 5KVGH 3MRDA 1JJUA 4Y19E 1G7QB 3BMVA 4P9HC 3DUSB 1EXUB 5FYJE 5D6DC 5TDOA 2X4OA 1FG9C 4QLRA 4JY5H 1QPXA 2G9HB 1YQVL 2XTJB 1AIFB 2AQ1A 1JV5B 4KV5E 1AD9B 1G7QA 3H9ZA 3DUSA 1F3DJ 3TH2T 1EXUA 3AVEA 4ELMB 1NMBL 1GZQB 3S4SG 2G9HA 2C3XA 1RJYB 4OB5L 3K81A 1AIFA 1JV5A 5TDNB 2WMPA 1AD9A 1FZJB 5E8PB 1NANI 1GOHA 1M6OB 4KUCD 4I2XB 1T03L 2PTUA 5IB4B 4ELMA 4K55A 1GZQA 2OMBA 4JGMA 1MAML 2I24N 2CIIB 1RJYA 3MROB 5TDNA 1FZJA 1Y6NR 5E8PA 3BJLA 5K9OB 1LDPL 3ME0A 1M6OA 5EU4B 4I2XA 5IB4A 5AWNH 4W4NA 5I74C 2CIIA 3MROA 4KPHL 1D5IH 4QO1A 3I2CL 5K9OA 5CWSB 2IH1B 5EU4A 2ZSWB 3I84A 3IDJB 3V7MA 3RDTC 2DMKA 1MELA 2ED9A 1X5AA 1G7PB 2IBBA 4NZTL 1Z3GL 5CWSA 4DEPB 2IH1A 1JZ3A 1DE4B 2ZSWA 4OCSL 4QXGL 1KBGH 5K93A 1JHKL 3IDJA 1EBPA 2K1MA 4BK4A 1P84K 1FZKB 2JIXB 1G7PA 3PWPD 3U0WL 1WZMA 1LEIB 2HTLD 1DE4A 3PHSA 5CINL 3VFMB 4WW2C 2R8SH 1CBVL 5A2LH 3OXSB 2BXZA 1LEIA 4JFXB 4HUWB 1E4KA 4QRRB 5ELIA 3VFMA 3EJYC 1HHJB 2OI9B 4RCAA 2QQNL 3OXSA 4XTRC 5GS1C 4OAWB 2EYTB 4PJHE 4X7SL 3UP1A 5ADOH 5DR5L 2I5YH 3BDXA 4JFXA 4HUWA 4ODHH 4QRRA 4YE4H 3TV3H 1HHJA 4MD5B 4L4VB 4NWUH 4PJ5B 2WWMC 4OAWA 2FEEI 2EYTA 1A47A 1FAKT 2FSEB 4R9HA 2XWBB 4MSWB 1F90L 2X4PB 3PNWB 3P40A 4ZOCA 1FP5A 5I1AB 2HFEB 4MD5A 4L4VA 4OD1H 4PJ5A 4BYHA 3O4OC 5I73C 4R97C 1KJ3L