2R56H

Crystal structure of a recombinant ige fab fragment in complex with bovine beta-lactoglobulin allergen
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVSLRESGGGLVQPGRSLRLSCTASGFTFRHHGMTWVRQAPGKGLEWVASLSGSGTKTHFADSVKGRFTISRDNSNNTLYLQMDNVRDEDTAIYYCAKAKRVGATGYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-lactoglobulin
publication title Molecular interactions between a recombinant IgE antibody and the beta-lactoglobulin allergen.
pubmed doi rcsb
source organism Bos taurus
total genus 43
structure length 221
sequence length 221
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r56H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r56H01
2HFFB 3S34H 3QAZC 1YY8A 3SE9L 2L7UA 4M8QA 1V3LA 4B50A 3DO7A 4UDUA 1U42A 3KPRA 5DRXB 4PG2C 3EOBA 1YEKH 3HMWH 5F88B 4J3TA 4GBXB 3CDFA 4NPYB 1IGJA 3D18A 1IC7H 1PYWB 4Y0GA 1FFPB 2CLZA 3O0RH 3RVWC 3TT1H 5B22A 1AC6A 1Q94A 5TH2B 2OK0H 1J05B 2BY1A 1AD0B 2Q20A 2IPKB 4R0LB 1K8DA 3PWJA 3CH1A 1D9KC 5IMMA 3W9EA 4LIQE 4POUB 2VITB 4WENB 1CD9B 3HE7B 4JVUA 3RY5A 5EIVA 3VWJD 3GJEA 4NZJA 1EJ6A 1EHLL 4YZFE 5E2VL 3V0VB 3U0WL 4M6ML 3C8KB 5AG9A 4L4TB 1VACB 4TSAL 2OP4H 3TM6A 3ZTJG 1FNGB 3F58H 3O9WA 1NGZB 3GBML 2F58H 2IADA 3MNZA 4EI5B 4OCXH 2R4SH 3QFJA 1JZ8A 4KUCF 5C0JA 1TVHB 4DKFL 4KI5F 4PY7B 3D48R 4WY7L 1DUYB 5D93C 2A6KA 2HAZA 1QVOA 4WTXA 1TJGL 4Y5VA 1E4XI 2O61B 1JPTL 3CFEB 5JA9A 4PRID 4R97C 4P46C 4FQIH 3QDGA 4FZ8H 4JFZH 1PG7W 3O2WL 3UTZA 5CWSA 2E7HA 4LAQH 2APFA 4XNMA 2FGWL 4JDTL 3FL7A 4C55A 1G9NH 1LP9F 4UV7L 2VERN 1C5CH 3AREC 4S1SH 3G5YB 1P4IH 4QRUB 3PF2A 4K23L 4QT5B 4HWBA 2J88L 2JJVA 4L3EA 4WEMB 1DBKL 1IEAB 2AK4E 2DD8H 5I8EA 5C6PB 4MJ6B 2NTFA 3LV3B 4M7JH 3QIUB 4O2FB 2HLAA 5IVZB 1I8KA 5FOBB 1A3LL 3QXUA 2FDBP 2VR4A 4I1NB 4H25A 2QADD 1A64A 1U6AL 1KEMH 1MCFA 5I1AA 3OKEB 1OT1A 3BJ91 3O8XD 1T1XB 5E6ID 3UBXB 1B0RB 1U8PA 1EMTL 5KSBB 3EDJA 4U2ZA 1OAXH 3FT4A 4N8PA 1XZ0B 3B9KB 4JZJA 1T03H 1RUAL 1YNTB 4YDIL 5CEYB 2V9QA 3H7LA 4L1DA 4F7CB 3AU1B 1CE6B 4BQ9A 2BSED 2CXGA 1EDQA 4KUCD 2JELH 4KI5D 5BS0E 5K93A 2G9HB 1SVZA 2HTLD 2YK1L 2BOBA 3TBYA 4X7TB 4NJ9H 4YHIB 3ARFC 3L6FA 4W6XB 3PGCB 3ARZA 3AS0A 4I5BA 1T7VA 4R3SB 4OM1H 1S7QB 3U7YL 4AT6B 4R7NA 1EEUA 1QBMH 4PJXF 2DLFL 4H0IA 2QLVB 3VMNA 3QUML 4ZAKA 4KJPD 1NMCC 5BQ7A 5HHME 4WUUD 4PJ5A 3OG4B 2G75A 1YEFL 3VG9C 1IGFL 2IAMB 5LG1A 5C3TA 5IB5B 4JPKL 4MD5A 1MCWM 1AP2A 4GFTB 4TYUA 4RGOL 3CMOL 4DN3H 4BFBD 3IXAB 3HC4H 4AEFA 3ULUH 2XWJA 3DURA 4AEIH 3B2VH 4WI5A 4X0KA 1TQBC 1CLZH 4NZUL 2PXYB 2YD3A 4I2XB 3TH4T 1AO7B 1LO2L 2VRAA 2HTKC 5DLMH 5JW3L 2PW2B 3JV4A 3FRPA 4XVTL 4H26B 1JWSB 2JTDA 3TESA 3MUY1 1NLDL 3DV6A 5FGCB 1Q9KA 3SDYL 4H88L 1QO3B 9CGTA 5L8KB 3S5LA 4XX1E 1S9YA 3RUGF 1I3VA 3VFMB 1AIFA 3AB0B 3D2UA 4HW6A 5ID1B 4OAWA 4MAYA 1CFQA 1NCUA 3KLAA 5E08L 2DJ4A 2X05A 3TZVB 2ZUQB 3ARBC 2OTWA 2AI0L 3GHBL 2QV2A 1JNNL 3CPLA 1U8KB 1OSZA 3C60C 4HCRA 1U2CA 3GB7A 4HKJA 1FO0A 2DM2A 3MLUL 4Y5XA 1DQLL 1FYHB 3SN6N 3EYUH 1ZT4A 4KKLD 5DJ6B 3BIBX 4OCRH 5AWNH 3IDMB 2H9GB 3CXDL 3RNKA 1BQLH 2CXKA 5JUEL 5EZIL 1ZXQA 5ICXA 1E6JL 3FRUB 1A7NL 4LSUH 3ZKXB 1NDGA 2DB8A 3UPCA 1BMGA 3OX8B 2R1XB 3QUYA 4HJGB 1T2QL 4D3CH 2F53D 2DQTL 4S1RL 5J89A 3QFDA 1AXTH 5I16A 4PJFF 4NNXB 1NUDA 1WAAE 1N8ZB 2M2DA 4YGVA 4N0YL 5HGHB 1UH3A 5JMRA 1KN2H 5E24E 1MQKH 4HKBA 1KV3A 3VXTB 4M8VA 3FFDA 4ZS6D 3HUJA 3SDDC 3H3PH 5GZOD 3Q1SH 4OZIB 4KUZH 3BUTA 4MXQD 3VFUB 5CS7A 1T5WB 3GHEL 3DSFH 5JLZB 2VDRH 5CSGA 3GO1L 2PUQT 4NKIL 1HI6A 3BSZH 1VADB 3BUYA 1KJ2H 4OGAD 3WS6A 4YHML 2R8SH 5EC2B 2V5RA 4I9WE 3SE9H 1UM6L 2H1PL 5D6CA 1WBXB 1L7TL 1MFBH 2HKFL 1X5JA 4J6RH 2E27H 4OD3L 4PJAF 4G6FD 3RU8L 5C09E 2VZTA 3HG1D 4U49A 3ZLQC 1RZFL 2GK0B 3WIFB 5A16A 1CYGA 3O3DA 5JW5B 4POZD 1T83A 3UPRB 1R5VB 5E0QA 1F8TH 4X6DB 2CLRB 1Q1JL 3GEWB 4NP4L 4D8PB 4EIGB 5BXFB 5MEQA 5EUOF 1GXEA 3SPVB 4M6MH 5T3ZH 3NZHH 4TSAH 1DEEB 4WW2A 5MEOA 3GBMH 4JANB 2W91A 4YK4C 1PFCA 4FFWC 4LK4A 4F58H 1CQYA 4U6XB 3GMMB 3BP5B 4IOIB 4BZ2L 4U05A 3HFMH 4PTTB 1KCLA 3RZCA 4PP1D 2E8YA 4WY7H 5ESAB 4OF8A 3RWEA 1EEYA 3LQAH 4O02L 5LAXB 3REWB 4I18B 4PGZA 3CLFL 2H8PB 3D0LB 4CVUA 1XIWB 3QULA 1JPFB 3MRHB 1ADQH 3GSRB 5DD6A 4XP1H 1MNUH 1OSPH 2ZUUA 2Z92B 2BDNL 4NO2A 5AUMA 4L8CA 2FGWH 1A21A 1SYVB 5F70A 5GS1A 3VXQA 2YXMA 1XGPB 4UV7H 3CSYA 1XF4B 4K23H 1T1ZA 3KAAA 15C8H 2J88H 5IHLB 1KCUL 5F89A 3A6OA 3OGOE 2FBJL 1CXEA 1B0GA 2F5BH 1U8OA 1TLKA 3UTOA 3T3MF 2AJVL 2NY3B 1R5IA 1MJUH 3I2CL 2FHCA 4R90L 2YBRB 2JCCB 4OSUH 1XH3B 4IMLA 3VE0B 2YD1A 4XCFL 5C0BE 1OTSC 4J1UA 2KZ1B 1U6AH 3N0PB 3TIDA 4V2BA 2W9LA 4N5EC 3JSSA 1P4LB 3ARGD 3WO3B 1FSKC 4S0TD 4D9RD 4GRLC 2C7UB 4ELMA 4XBEH 1VPOH 5JHLL 1P7QB 3AXLA 4LDLB 4RZCA 1U95B 3HZKB 2HT2C 1QSFE 2WAHA 4YDIH 5IQ7H 4FP8L 2P8LB 3FO9A 4QWWD 1YN6A 1IRAY 4Y2DC 3GSOB 2YK1H 1TETH 2V7HB 3DYPA 3P4OB 5MENB 4LHUA 3PL6B 3T0DA 5KVGH 4N0UE 5IROA 3BEVA 4X83A 1NGPH 3LB6C 2GJZB 3ZKMC 4EDXB 4IRSB 3IJYA 1DBBL 4LASL 3GIZH 1AHWB 5F7KC 1OGAB 2KL6A 2BVEA 4KROC 4Y19E 5C08E 4BUGA 3PQYD 1YEFH 4K9EL 1BP3B 3GBLA 2A83A 5GS2H 5BRZA 2HVKB 4TSBL 3LS4H 4G3YH 2EIZA 3L95A 5IB1A 4KVCL 5FOJA 1DN2A 1WZ1H 2FYYB 4ZUVA 3LN5B 5FYJU 4NZUH 4GAFB 1J11A 2FJGB 4G5ZL 1M7IA 1ZA3B 3UZQA 4CVZA 1JRHL 4FXKB 3MRMA 2YPLE 1BEYH 5JW3H 4YFLI 1Z3GL 4XVTH 3PWNB 2BSRA 4YX2H 1A9BA 1VFUA 3RWCA 4RRPG 3B2UD 3HE6B 1GOGA 3P30L 5DA4A 5F1NB 5IVXA 3V5DA 1M71A 4CVXB 2DRUA 2DI8A 1ZGLA 2XNAB 4PR5A 3K2MC 2HP4A 1T7WA 3OKMB 2MFNA 3IAQA 4OCSL 5TE7L 1UB5A 5D7IB 4KMQA 3QPXL 1XF5B 5E08H 2W0KA 3H9YA 3GGWB 1HEZA 2AI0H 5D2LF 1JNNH 1I75A 3K81A 3TN0D 1BREA 5JHDE 5CZVL 5FV1L 4M8QB 4LVOC 1N6VA 4H1LA 4JM4H 3QWQB 2JB6A 4UDUB 2OMBA 5IHBA 5ANMA 3QI9D 4RIRA 1DDHB 3EOBB 4JGUA 4RFNC 3JTSA 3CXDH 3T0EC 2ATKA 1UC6A 1E6JH 3D18B 4Y5YC 2FWOA 4WEBL 1H5BA 3PWPD 2ICCA 2WUBL 1Q94B 2VJXA 1KJ2A 4X9FA 3GMPB 1MIML 1B2WL 3CSPA 2G5BB 2C5DC 3G5VA 5L6YL 3QJFA 4GQ9H 3PWJB 3CH1B 5IMMB 4J4PC 1CGYA 1SJVA 5FA3A 1RZ7L 2AGJL 4N0YH 4X7DC 3KLHD 3MBEA 2XZQH 3AFLA 5F71A 1RAMA 2BNQE 1PLGL 4TRPH 1NCTA 3HC3L 1JN6B 1Z9SA 3O9WB 4G6AD 2IADB 2BRQA 3MNZB 1QFUL 2Z8RA 1FPTL 3QFJB 2WBJC 4QKXB 5C0JB 5CINH 3FT2A 3IDUA 3F7QA 3GHEH 1TTFA 3GMQA 1AKJB 5J11B 2DDQL 1R3IL 4PJEA 3FB7A 2A6KB 2NXYD 3VXRE 2X4RB 3C5ZD 1QVOB 4Y5VB 3DBXA 3JTTA 4B41A 3BQUD 5JOPD 4NT6A 3QDGB 2AJ3A 5D7LE 5IEHA 3UTZB 1GH7A 5CWSB 2R2BA 3WDJA 4KPHL 4XNMB 1BJMA 3QUZD 2HKFH 4CJ1A 4OD3H 5E4IA 3SGJC 5SWZD 5C0CE 5LGHH 2VE6B 2V2XA 4WFHD 5D7KD 1I85A 1RZFH 1NUNB 4B53A 4Y7MA 1MFCL 2MCPH 3HZMA 4H0GA 5I8EB 5HJ3B 2NTFB 1R3HA 4GMTL 4JO1H 4PJHE 1VFBA 3BAEL 4HXBL 2HLAB 2NLJA 3QUXC 1BIIB 2HKHL 1I8KB 4QO1A 1UJTA 2GJ6A 1NBZA 4H25B 3MSPA 4JE4B 4NP4H 5I1AB 5ISZD 5E9DE 1Z5LA 1FGNH 5L0QC 4Y1AA 5C2BL 4PLJC 4XCCL 5EBGA 1U8PB 3KXFE 4P5TD 1RJCA 5D1XC 3FT4B 3MXVL 4XHJC 5IMKA 1YYLH 4K7FA 1YEDB 4L4VE 2YWZA 4UU9A 3JZ7A 3OHXB 3EIFA 4P23D 3UAJD 1INEH 4PBWD 1JHLL 5D1QD 3VWKB 3FFCE 1RZ8A 3QUKA 2BOBB 4O2CA 3RVWD 2NY2B 1C7TA 4WFFE 3L6FB 4RMWA 1LEIA 4I5BB 3I85A 5FM5O 1D9KD 1YNKH 2BDNH 1CIUA 4R7NB 3QDHA 4JPWH 4IDJL 3L3GA 4ZAKB 2WUCL 4R7DA 3CDCA 1T6WA 5ACLA 5BQ7B 4PJ5B 2E7CA 2G75B 2PN5A 2YD2A 2XTJB 4JRXE 3MRDA 1QBBA 1KBGH 4MD5B 5LQBH 1SY6L 4OGZA 2AJVH 5F6IB 3V8CA 4JFXA 2XWJB 3DURB 4X0KB 4XCFH 1MFDL 3SBWA 5LXGL 3JV4B 1TJIH 4P9ML 3QUMA 3O6ML 1DSFL 4JFYA 2EIEA 3DV6B 4K7PY 2VLLA 4P46D 5FYKE 3UYPA 4UQ2A 1Q9KB 5INDA 1MCWW 5JHLH 4P9HL 3S5LB 1S9YB 1WZMA 4MA3A 1AIFB 1I1AC 2FL5B 3D2UB 3E6HB 4OGYH 1R24A 1G9EA 3ARED 2EDYA 1BD2D 4FP8H 4M7KL 4OAWB 5HHPA 1CFQB 5HI4C 3OR7A 1JWMA 5C07D 3KLAB 3W5NA 5D8JH 3IAPA 2MOVA 2Y4SA 3ARQA 2OTWB 4XH2B 3CPLB 2D0GA 1OSZB 3BH8A 3GB7B 4HKJB 1FO0B 2R2HA 4XVJH 1JHKH 1UJ3B 2BXYA 3EDKA 4UUJA 1ZLVK 3STLA 4BFIA 4Y5XB 1TQCB 1YDPA 3ABZA 1ZT4B 3CFBA 4LASH 2NY4B 1IKFH 3RKDD 3RNKB 2CIIB 2H2SD 2YR3A 4NRZA 2DOCA 4EVNA 3QWRD 4XPHH 1NDGB 4X9GA 3NA9H 4TSBH 4FNLH 4GW4A 5FECA 2CDEA 3QUYB 5GS3A 2HA1A 5I76A 5DQJA 4YBLB 2EC9U 3QFDB 5I16B 3DX6A 4YGVB 3H3KA 3MLSL 1AGEA 1KPUA 1XEDA 3MUGB 1IJ9A 4LSQH 2P42B 3LPWA 3QEQD 3K8LA 2ESVB 4PJ9D 1KLUA 2XXMB 1CIDA 2DJUA 2F54D 3HUJB 4Z7NF 5CJOL 2IMNA 1KENH 5F9JB 4KMLB 1A7OL 1NAMH 1PDKA 5FM5M 5E5UB 4WTZA 1RULL 4APQC 5TE7H 3UJJH 1RIVL 4RWYL 1EVTC 1MCRA 5EIQA 3ZYJA 3QPXH 3TA3B 2VISB 1Y6MR 1XGYH 4KQ3H 2W60A 4FFYL 5B38A 1GAFL 3EDEA 5HDBF 4UTBL 4Z7QE 5CZVH 5D6CB 2B8OT 1M6OB 4LLVB 3DHMA 4YQXL 2IBBA 1C1EH 1C16A 4DEPC 2AXGB 2ZCKH 3LEYH 3DNKA 3L5HA 4M62L 4NQDA 1FDLL 1F3JA 3OAZK 3V4PL 5A16B 1F4YH 3VGEA 2WMPA 3O3DB 3FO0L 3HNTL 2DTML 2YN5A 4RGNE 1MIMH 1UGNA 2GT9A 2BC4A 1B2WH 2ORBH 1MHPH 2W9EL 1AJ7L 3FRPG 5CILH 3NN8B 3KJ6H 2EDKA 2GCYA 1RZ7H 4R8WL 2DQUH 2WNGA 4FQHA 4QHNA 1PG7L 5MEQB 1PLGH 1SBSH 3GSQA 1DCLA 3RPIA 1YMMA 3C60D 1OTTC 4WW2B 3QXVA 5MEOB 5IF0B 2WK2A 4KKAC 5TDOA 3QG7L 5IJVA 1KJ3L 5DFVD 1RIHL 4HD9A 5I71C 2FX8H 2XWTA 3RZCB 4QXGL 5HVFB 4PP2A 2AJXL 3MA9L 3RWEB 1EEYB 4X4ME 1B4RA 4JREB 1E4XL 4P2RE 2FX7L 3QULB 1TENA 3LDBB 4CJ0A 1JPST 4NO2B 4YC2B 4YDLB 3X3FL 4L8CB 2MTPA 4KPHH 3C2SA 1HH6A 3VXQB 1U8LA 5M94B 1FLRL 2R0ZL 4GAJH 3CSYB 4NN6C 1WUNT 1T1ZB 2D7NA 1OF2A 3LD8B 5F89B 5H2BA 5FFLA 4HPYL 2JJWA 4O51A 4A2MA 1B0GB 4U1SA 1MFCH 1U8OB 2ZWLT 3BP4A 4PG9A 3SDDD 4M7ZC 5K9OA 1QBLL 3K4AA 3L5IA 4M1CD 4GMTH 1MAJA 4Z78A 1R5IB 3BAEH 5EO0A 4QRRA 1QSED 4LCIH 5LWYH 1UCBH 3IGAB 3ZE0F 1A1MA 1J87A 3FQWA 3HNSL 4J1UB 1YPZE 2Z91A 1W0WB 4JGJA 2IBZY 1C08A 3TIDB 1D5ZA 3D39D 5E1AA 3LEVH 2X6MA 3VXSD 4XMPL 1MLCA 1H3PH 1NC2D 5C2BH 1AXSA 1QLEL 1HINH 2XQBL 4XCCH 4LLMA 3SGEI 4FXGA 3Q2CA 1LNUA 2B4CH 1WV7T 3AXLB 4RZCB 1F42A 4G8GD 4ZXBD 3MXVH 1QR4A 3AS1A 3BP7A 1YEJL 3CU7A 4L4TE 3D87B 1JHLH 3AS2A 1ORSB 3TCLA 1T80A 2H3NA 2SEBB 1YN6B 4BYHA 1W8OA 5GS0D 2LABA 1INDH 3E3QE 2HLFC 3A6CH 5ETUA 1S7SA 3SDXF 2FO1A 5FGSA 4X8JA 3WNMA 4GS7C 4Q2ZB 3DMMD 4Z8FH 1K5NA 2D7QA 3IJYB 4DW2L 4IDJH 3OKDA 3VFSA 2C4XA 3TO4C 1HDMA 4LSRH 4WO4B 2VH5L 1P84K 1AY1L 4MJIA 3RVUC 2A83B 5BRZB 3BP6A 5J56B 4MDIA 3HNVL 1SY6H 1JZ3A 4L29A 4L1HA 5IB1B 5IHZA 4HC1H 5E2TL 3K0WA 5IB4A 4JFPA 2PYED 4CN4A 4QNPF 1KF9B 1M7IB 4PRHD 4CVZB 3O45A 3MRMB 2X4UB 5LXGH 2XZAL 4WI9A 4OLYL 1A6UL 4P9MH 2E7BA 3O6MH 4U1NA 4EEEA 4IDLA 1A9BB 2ZOKA 1VDGA 1S3KH 2HFGL 1J12A 2DKUA 1BFVL 2BHYA 4F7MA 3P3YA 3BPCA 3ARBA 5IVXB 4JFQA 1M71B 1PZUB 5JTWA 2ITCA 1ZGLB 3T08A 4Z7VB 4PR5B 1WBYA 1I1FA 2NY0C 3DVIA 1OM3L 4XPFL 1EZVY 5KSBE 4PGEA 1JGUL 4OBSA 2YRLA 4HV8A 1UB5B 4HS8H 4IRJB 1AQKH 2EDTA 2VXUL 4I0PD 1V8HA 3ME0A 4EUPB 4JY5L 5E8NA 1I9JL 1HEZB 1WTLA 1FFOA 2BFVH 1KELL 5KSVA 2YD7A 4H1LB 4ETQA 5IWLC 1HIML 2JB6B 2C3VA 2V2WA 5ANMB 4URTB 3DWTA 4RIRB 1ZAGA 4YZFF 4LKXA 4IRZL 3MLTA 3O2DH 5FYLD 1XF3B 4PLKC 4G43A 1A02N 3W9DA 4KU1A 4OI8A 2ATKB 5GGVL 1NL0H 2FWOB 1H5BB 3V7MA 2X09A 1G7IA 2I27N 4D0CB 1DVFC 3DXAA 5CD5D 1E4WL 1ZKAA 3G5VB 1KTKE 2V9TA 3QJFB 5FUOL 3FO2A 1J0YA 2OTPA 5FA3B 3K74B 4O5LL 4YJZL 3BW9A 3QDMD 2BRRH 2DBLL 3D85D 3LH2L 3C87A 3T0VA 3B8YA 4I2XE 3LB6D 1AO7E 4LLWA 3M8OL 3ZKMD 2WWMC 3MNVA 1ZA6A 1DLFL 2FO4A 4KROD 4YAQA 2GI7A 1ITCA 5GIRA 3GMQB 1HCFX 3ARWA 1GIGL 3QWOA 4LHUG 5C6WH 4WGVB 3GK8H 3W82A 3EOYG 1O7VA 1OTUC 4L3AA 1Y18A 3DBXB 3JTTB 4UNUA 4NT6B 4UTBH 1KOAA 4HBQA 2AJ3B 4TVPE 3AM8C 1MH5B 2OI9C 4OTXH 2R2BB 4G9FA 4KHXH 5J6HB 4JFDA 5KW9L 1GGTA 4OZGA 5D70L 3CVIL 3N1PC 3TVMC 3MNWB 4FQCL 3V4PH 3HZMB 4GW1B 1R3HB 3HNTH 1HKFA 1FZMA 1VFBB 2DTMH 3MV9E 3PP4L 4Q9RL 5C9JA 2B1HH 2W9EH 2NLJB 3PJSA 4NOBA 5FIEA 4C54A 3BD4A 3B9AA 3RA7L 2GJ6B 1NBZB 4R8WH 5B3NA 2ZKHH 1X5HA 1A2YA 5JPMA 3C8DA 3WS3B 1Z5LB 3RKPA 3KS0J 4Y1AB 3SGKA 3MRGA 4KAQL 4ZUWA 3TFKD 5HGDA 3DV4A 2R69L 3VDAA 3MGOA 4AYFA 3OBAA 5IMKB 3V0WL 4K7FB 3QG7H 1F4XH 3W0WE 4OKVA 5EO1A 4KQ4L 4RMRA 1RIHH 4MS8C 5E2UL 1NBYA 1RZ8B 4QXGH 3GKWH 4PJCF 4OZIE 1TJHH 2COQA 4O2CB 1E4XH 1X5FA 1U3HC 2FX7H 4LRIA 2B2XH 4KJQC 5CLTA 1IAOA 2G5RA 3IT8D 4QLRA 3QIBD 1LEIB 4JKLA 5IBLD 4X6CA 4BM7A 5DK3A 3V0AC 4HUVA 2ILLA 3X3FH 4CW1A 5HYFA 3VRJA 1OAKL 4YHKL 1T4KA 1DP0A 4IIQC 1DQDL 2XA8H 2R0ZH 1TZIA 4R7DB 4RFEA 2JK5A 3F6LA 4I0CC 3GJFK 1WWAX 4KY1H 4HPYH 4PJGA 2FSEA 5F7WC 1QBLH 5F9DC 1CG9A 5GRXG 43C9A 1RZJC 1TZHA 4TQEH 1UM4H 2WBJD 1WT5C 4M6OH 3QQNA 5D71H 4GRLA 3H8NA 2WANA 3NCFB 2DQDL 4GXVH 4H8WC 3PGFH 3QIWB 3GBNL 5DVOA 5ECJE 4KK6D 4ZUSA 4XMPH 5CIPA 3QUMB 2DQEL 3HZVA 2ARJA 4X6DE 4JFYB 4I3GA 2VLLB 2I9LA 1FIGL 3QCVH 4J12A 4UQ2B 2EICA 4NKOA 5T5NF 3VH8B 3EJZC 2BVYA 2FD6H 3CU1A 5F93C 4ZFGH 1CFTA 1YNLL 2HG5A 2EDBA 5IVOA 3IDIA 4JM2C 4OCMC 4MA3B 4OZHF 1R24B 2NXZB 1KB5H 4IEFB 5HHPB 3WV0A 5EWIH 4NKDA 5HHMD 3OR7B 1JWMB 1B4JH 1VEOA 1CGTA 4KDWA 1W72L 3MLYH 2A1WL 3BH9A 4IS6A 1UA6H 4HH9A 1AR2A 1WAAF 4Y4HD 2L7JA 1FG2A 3BH8B 1IM9A 3STLB 2R2HB 2OXHA 5CJQL 4UUJB 4BFIB 2DMCA 3BD3A 2QHLA 4LRNH 3VRLF 4DW2H 1YDPB 3CFBB 4M1GH 5C0DA 2XWBA 1CLYH 4G6KL 4NRZB 3GMOA 5H94A 4DQOL 2VH5H 3IJHA 4U0RB 4EVNB 3QUZB 3C09B 4PRIA 4JCLA 3HN3A 4LSVL 3VFTA 4GW4B 5FECB 2CDEB 4V1DE 3SKNB 4MWFA 3NTCL 5E2TH 5DQJB 4RGNC 1B6UA 4ZODA 4LCCC 1I3GL 4KKCC 5GJSL 1S7TA 5BV7C 3PWLB 3FKUS 1AGEB 1KPUB 3MRKA 4OLYH 1A6UH 1W2KT 1CXLA 2JCCE 3O6KL 5DC4B 3VXNA 1ZS8A 1CE1H 2GTZA 1KPVA 2ZPKL 3PG2A 1KLUB 1YQVH 2Y25A 1BFVH 2QHRL 3SGDI 5JO5B 3ALWA 4CDGC 1YEEL 4S1DC 2X10A 4XWGH 1OM3H 4XPFH 4HH8A 1JGUH 2RGSA 3F7VA 5DS8A 3SKOA 1RK1B 4PJ8D 2OS7A 3T0EA 1MELA 5K59E 2MPAL 2W60B 5B38B 1KELH 2OMNA 2JE8A 4NFCA 4UZGA 4NKQB 4AEEA 1KB9K 5D5MA 1HIMH 1WSST 4YPGA 1KFAL 2AK4A 5IV2B 4KK8C 1GL4B 1C16B 4IRZH 4YHPA 4ALAL 5MENE 3W5MA 2RAMA 2VQUA 1RJZA 4ZO6A 4J4PA 4NQDB 2MCG1 5T3XD 4QYOB 3ARSA 4O2EB 1UM5H 2B1AL 2Q8BL 1KLGA 1YEIL 2VL4A 3FTGA 2GT9B 4A6YH 2BC4B 4TUKL 5FKPB 1I1AD 3ZTNH 2R0KH 3OKYA 4GBXC 4QRTA 5FUOH 1JZ7A 2GCYB 4DGIH 1I8MA 1FAIH 1PG7X 5HI4D 2EEAA 4O5LH 2XTLA 4FQHB 4WUUA 4HS6A 1P53A 3MFFA 3OF6A 2AERT 5DC0A 1PAMA 4K94H 5DA0B 3GSQB 3RPIB 5D93B 3RVTC 3U9PH 2WIMA 4R0LC 1YMMB 4EDWH 5L2KE 3O4OC 4I9WD 3CVHH 3M8OH 4HSQA 4R97B 4N0CD 3TJHC 2I60L 5TDOB 5ACMA 1U91A 5IJVB 1KIRA 3KLDA 1A3QA 3T4AA 1NC4D 1AGDA 4LGRB 2XWTB 3CXHJ 4KDTC 2FATL 4LU5L 3EAKA 5C09D 4HX1A 3V7AG 3HAEA 3E3QC 3RNQA 3LMJL 4LSPL 5CZXD 5DMKA 5FHAL 1OP5K 3MRQA 4YXKL 5I17A 2OR9L 1Q9LA 2A6IA 5DMIL 1OW0C 3ZE2E 2A9NH 1HH6B 4MNGA 2VLKA 1U8LB 5IBTL 3QUXA 2NY5C 2ADGA 3V79C 1OARL 2AQ2A 3CVIH 3WD5L 5IESL 5KG9A 1OF2B 1LD9A 3DUUA 4NHUA 4YO0A 5H2BB 5DJAB 3D0VA 3T2NL 2DYPA 4O51B 4U1SB 4W4OA 4PG9B 4F7EB 1WEJL 3BP4B 3KPRE 5K9OB 1LDPL 3IYLW 3U9UA 4Z78B 5EO0B 4QRRB 2LAAA 2EDFA 5ALCL 4Q9RH 2R0LL 5GHWL 1A1MB 4RAHA 2K7PA 3FQWB 5D1XA 2Z4QB 2Z91B 1C08B 4YHOL 5ITBH 2O93L 2HWZL 4BQBA 5DUML 2Y36L 5E1AB 3SKMA 2AXJA 1MLCB 2HJFB 4EN3C 5AD0A 3U0PA 3BZEB 5AZ2L 1MREL 1AXSB 43CAA 4LLMB 3CLEL 1RU9L 4N8VG 3NH7L 1EHAA 1LNUB 4I4WA 4KHTH 2F53A 1GC1C 2R69H 3Q3GB 3KPLA 3ARFB 2NY6C 1IEBA 4WTZG 1V7NH 2PR4L 3VXUA 1VKXA 1HYSD 4QTHB 5DR5L 5MHSE 4XMLL 1PJ9A 4HLJA 4HJJL 4LVNB 3TCLB 1I7ZA 5E2UH 2H3NB 3LKNA 1GZPA 5CKGA 1G1CA 5I0DA 2GKIA 3CZJA 3QFJE 1G6RL 1AE6L 5ETUB 1NMCB 1S7SB 3B9KC 5D96C 4GKSA 4DJMA 2ADJA 5BW7A 3VG9B 1JV5A 4X8JB 2F15A 1TNMA 1KCKA 3L3DA 1BHGA 1K5NB 4OFYA 3IJSA 2VDML 4NQCD 4YHKH 3TYFA 1BJ1H 3OKDB 1DQDH 5KVDL 3VFSB 1TQBB 3QDGE 4AIXA 1I7UA 1YJDC 4MYWB 4XI5C 1HDMB 3EBAA 5IFHL 3FT3A 2Q86A 5CLWA 4MJIB 1NPUA 1P5VA 5GRVK 2IPTL 3BP6B 3I3DA 4X7SH 1CZ8L 4MDIB 4KKAD 1CU4L 2O5YL 4L29B 1REIA 3FB6A 1I9IH 2VDOH 2J8UF 5IHZB 5IB4B 4JFPB 4KI1A 1QSFD 4HIXL 4L3EE 5DYOB 5KOVC 3GBNH 2F5AL 3BGFC 3O45B 4KRPC 3HG1A 3EYVA 4YWGL 2DQEH 3DRQA 4HFWA 4U1NB 2VQ1A 3THML 2ZOKB 3BXNA 4ZFZA 3KR3L 1FIGH 1KT2A 4PRPB 3WIHL 4KMTL 2PXYC 3NA4A 3QEHB 1Q9OB 5FYJD 2EO9A 2AV7B 4GQPH 4F7MB 3BPCB 3ARBB 4JFQB 1T22A 2ITCB 2APWA 1Q0XH 1WBYB 1I1FB 2D0HA 5EBMA 4WU7A 4XWOC 4JG0L 2ED7A 4PGEB 5HHOA 4Y19D 5C08D 3LHPL 4HV8B 2ZCHL 5DURD 4K71C 1U36A 2D7OA 5E8NB 4D94A 1W72H 2VDKH 4PIRF 5L2JA 1FFOB 5J06A 3AB0C 5IBUG 5KSVB 4ZOAA 1F3DJ 1WBZA 5H8DA 4ETQB 4Y8DC 5CJQH 1SHMA 4U6TA 3D3VA 4LKXB 2EDEA 4BH7A 3MLTB 4G43B 3W9DB 4O58L 4F8TA 2YPLD 3TZVC 5TDPB 4G6KH 5DO2C 4DQOH 5I19L 4PJDA 5DRNA 4MB3A 1WVZA 1G7IB 2OLDA 4U6VL 1CFVL 4HAFA 2HT4D 5F9WB 2BJMH 3DXAB 4KKBC 3U1SH 2XTJE 3U4BH 2OZ4A 2BX5A 1MY7A 3S88H 1IQWL 2CKBH 4MXWL 1I3GH 5GJSH 5HHQA 3ZKXC 1AH1A 3BW9B 2HLFD 3CDGB 1WFTA 3O6KH 5LJYH 2V5MA 2ITDB 3GSXA 4PJAA 2ZPKH 3DI3B 4APQA 5IUSA 4LNRA 2GAZA 5EU4A 4FHBD 2GHWB 4LLWB 1G0DA 3BEWB 4ENED 3QHTC 1FL3A 3MNVB 4S10A 5ILTH 1HNFA 1ZA6B 3RTQC 5GS0L 3UTTB 1YEEH 4P4RA 3QCUL 2FO4B 3TO4D 1Z9MA 1MPAH 4YAQB 1WTGT 5GIRB 4RMVA 3F6IA 3SE3C 4PJHF 2V5TA 3R0MA 4NWUL 4LSTL 5A40E 3MFGB 4ACPA 3B43A 4M5YL 1X4XA 1XF2B 1N26A 3SOBL 4KJWC 5I1EL 3BWAA 3OKNA 4LOUC 4G9FB 4QRPA 4JFDB 4OF6A 1AC0A 1QLFB 5SV3A 4ALAH 1RV6X 4Q9BA 2BVOA 5LGKA 5C2UB 4M7LL 4OZGB 3WXVL 1ZGLP 1FL5A 3UTPE 5I8KL 1OD7A 2GFBA 4OB5L 4CRPA 3GSNB 1FZMB 2Q8BH 3RVVC 2IANA 5EORL 5C9JB 3HS0A 3OZ9H 3PJSB 3RDTA 2NY1B 5D7JA 4YK4B 5SWSA 3LN4A 2DLHA 3JV5A 35C8L 1A2YB 1IGML 1GCFA 1OCWH 1UEMA 5DRWB 2L4OA 1SEQH 4PRHB 1HSBA 1WZKA 1XCQA 4XB7A 3S6CA 3MRGB 2GSGA 5HGDB 1OHQA 3DV4B 3MLVH 3MGOB 5GGSA 1PKQE 1MHEA 2I60H 2VXTL 3SEPA 4OKVB 5EO1B 4Y16A 3P77A 1NCAL 3KG5A 5KSUA 1N6UA 1NBYB 5DHVA 4EBQL 1G7HA 5C0CD 3N9GL 5DC9B 1ZVSA 5AYUL 2VWEE 2FATH 2W9DL 3W11C 2E9IA 3MV8A 4XNZB 3IETB 3VGBA 3AROA 1IAOB 4LSPH 3K4ZA 1DVFD 4LSDA 4WNQA 4X6CB 5DRZA 4R4NC 4YXKH 1HHGA 4CW1B 5DMIH 4LEXL 4XNXH 3VRJB 2A6JB 1T4KB 4RMUA 1FFRA 1ZT7A 4GMSH 1TZIB 4ORGA 5FCUH 2JK5B 5E9DD 2VXSL 3WD5H 2Z9TA 1WF5A 3F7YA 5IESH 3GNML 4HK0B 4HGWA 3MLZL 4DKEL 1OWRM 4PJGB 4UINH 3TN0A 4ZO8A 1YEHL 5HI5D 3KXFD 1LDPH 4O9HL 5K9JH 1CG9B 3QQ9C 4FQ1L 43C9B 1TZHB 4NC1E 4WCYH 5ALCH 2R0LH 4QRQA 4GRLB 5TF0A 2HFEA 4GSDL 5KTEH 4G80B 4GG8B 4PUBH 4X6FB 5GHWH 1XGUA 1ZLVH 4HK3N 4MNQD 1JL8A 2AVGA 5T1LA 2HWZH 3TWCL 3TNMA 5DUMH 1I4FA 3FFCD 1YJDL 1OTUD 3B5GA 5CIPB 3S96A 4HFUL 3VU2A 3PWPA 2VR9A 3R4DA 4I77H 2B7DT 3PP3K 1IZJA 3CLEH 4NKOB 4WFFD 4Y2DB 3NH7H 5E2JA 1CFTB 4OJFL 2HG5B 3CSBA 2PR4H 5DK2A 2WWKO 5DR5H 4XMLH 5JHDA 3O3BA 4P4KC 2K3TA 3S4SA 3S3PA 1BFOA 4NKDB 4JRXD 2FEEI 3V52L 2W92A 1G6RH 1D6EB 4HHAA 1NQBA 1MCKA 3BH9B 4IS6B 4JO3L 4HH9B 1YN7A 1FG2B 1IM9B 5C3LD 2UUDK 2VDMH 3X3GL 5C0DB 2QSTA 5KVDH 2XWBB 2WLZA 4WWKC 5IFHH 1EERB 3HI6L 3GMOB 5H94B 4X80L 4P3DA 3IJHB 3CFKA 1DL7H 1U2HA 4XCNA 4FMKA 4HULB 1T89A 4JM2F 5TPWL 1HN1A 2IPTH 5FYKD 3VFTB 3VDCA 4D0DA 1CZ8H 2BMKA 4HUXA 5HHNA 3WUWA 1OOAA 1BOYA 1ONQA 3JWDH 1W72A 4MWFB 2VDNL 1L4IA 2ZSVA 5F6HI 4HIXH 3HRPA 2FX9L 3C6LA 4NFDA 3WEXA 4TNVF 1ERNA 4N90D 4CU6A 1F2QA 3MRKB 4C58B 2BVQA 4YWGH 3WHE1 3VXNB 3FO1A 1ZS8B 2C3XA 3VFRA 2GTZB 1KPVB 4Z7QF 1XGQA 3THMH 2JJSC 3ULVL 3OKKA 4K7PH 4LLYA 1UENA 3OAZH 3ZHDA 1Y6KR 1ZV5A 3WIHH 2XY2A 5EU3A 2X4QB 4FFVC 4KMTH 4LQFL 4WDIA 1X5YA 3DUSA 4F33A 2AXHA 4JN1L 1IL1A 2EDOA 4DWHA 5C70A 4LVOB 1XR8A 5F1OB 4ELME 5IWLA 1NEZB 2BSTB 3F7VB 5DS8B 4PYGA 3SKOB 1GGIL 1OPGL 4Y88A 3IS1X 3T0EB 3G08A 4XVSL 3WFEL 4Y8AA 4JPIA 2IQAA 3RY6A 3UEZA 2BXZA 2K9UA 2QBWA 5D5MB 1DTUA 2PF6A 4P23A 3KYMA 1U8QA 2AK4B 1TZGH 1TVBA 4X6EA 1ZHKA 5D1QA 2Q7YA 4YHPB 4LARL 4FQQA 1RJZB 1CVRA 4O58H 4U1KA 3DSNA 4P59H 3SKJL 4PJBA 3EGSA 3EO9L 4Z95H 1HHJA 4OLZL 1TTGA 1M05B 1T0MA 3B5HA 1KLGB 3FTGB 4JM2D 4YXLL 1RMFL 4QGTA 5IHUL 2MKWA 5HD8D 2IG2L 4UQ3B 1P9MA 3MRBB 4MXWH 5BRZE 4CN6A 4G8FB 4FXLA 4HS6B 3MFFB 4UT9H 3D9AH 4JZOA 1CD1A 4L4VA 12E8L 1CXFA 2YOCA 3G04A 3NIDE 1S7UA 2AW2A 4LBEA 5BS0B 4Y4FA 4LF3A 1A7RL 4WFEE 4F80A 2HRPL 1FNSH 5I15L 1IC1A 3WFDL 5GS0H 2QSQA 1KIRB 2E8ZA 3T4AB 3QCUH 1AGDB 3AM8A 3HMXH 3VXPA 5BVPH 2FECI 4GLRH 4P5MA 4X7CC 1CICD 5IVXE 3OSKA 2DQGH 3O9WC 1EK3A 4HX1B 3HAEB 5HVWA 3ORJA 4LSTH 3RNQB 3WXWH 5DMKB 2LAGB 1U41A 2J4WH 3TVMA 4J3XA 4E41D 3BN9C 3MRQB 2OQJA 3ESVF 2PW1A 3CH8A 1NFIA 5I17B 1Q9LB 2A6IB 4G7VL 4ODXA 1BD2A 5E2WL 2RCSL 4E42A 3Q0HA 1CLOH 2VLKB 3QUXB 4Y5VC 3JWOL 4NZTL 4M7LH 1MCOH 5KG9B 3GRWH 4YNYA 4OF5A 1N0XH 1LD9B 3DUUB 4YO0B 4XP9H 3D0VB 5ANME 5HHXL 2DYPB 2ZCLL 4JFEA 3QDJD 5L0QB 1FYTA 4OB5H 3UBXI 1JMXA 5E99H 4BH8A 2JIXA 5B39B 1A7PL 4RAUA 5EORH 3QP3A 4X7EC 2K7QA 1IGCL 4BSJA 1N3NA 5D1XB 2APBA 4LLQA 1BJ1J 5F1SA 35C8H 3SKMB 1AGFA 4OQTL 4OUOA 5DEFA 1IBGL 3U0PB 5AD0B 2LTQC 3FZUD 4P2RD 43CAB 4Z9KB 1H3GA 1NBVL 5DGQA 4I4WB 2ENYA 3KPLB 1IEBB 4KK8D 3VXUB 3CMGA 1VKXB 1JI2A 5HGAA 2J8OA 4M4PA 2Q87A 1I7ZB 1JHTA 1IM3A 3LKNB 3HHRB 1GZPB 3N9GH 5AYUH 3BKYL 2HRLA 2GSIA 3T09A 4JZJC 3IDJA 4F9PC 4GKSB 2ADJB 3LPFA 2UZXB 3H6JA 1JV5B 1WCQA 1QEWA 3BT2H 2GK2A 4GBXD 4PJEE 3ZKNC 1Y0LA 1A6PA 4MXVE 1PQZA 2ARWA 3IJSB 2M26A 1WT5A 4RA3A 2V5SA 3TYFB 5TQ0L 5T3XL 4F15C 1D7FA 3DX7A 1I7UB 1NCNA 5HI3C 3FT3B 3HI1A 3VMPA 3FN0L 2Q6WA 2Q86B 2HJKA 4WHTA 3MLZH 2YZ8A 3RVTD 4IM8A 1YEHH 4K3DH 2H32H 3EOTH 3HE7D 3TJHD 1VGKA 1G6RA 4OD1L 3FB6B 2UZIH 1HCVA 3LIZH 4G6MH 4ZAKC 4MMXC 5KSBF 3EJYD 4GSDH 2DM7A 1N0LA 4L4TD 1YZZA 4N8CL 2XTJC 5HYSG 3L5WB 1BGXL 1JPGA 3EYVB 1BM3H 3HB3D 4EI5D 3DRQB 4HFWB 2VQ1B 3BXNB 1IQDB 4PGDA 1EFXD 5CZKA 1KT2B 2GJ6E 4JGMA 3ROOA 5I30L 5GRUH 1LO3L 5E8EA 3OKOB 2OL3L 4JY4A 1T22B 3HCVB 1WJ3A 4Y1AE 2QQQA 3K2UL 5EU7E 4GAYA 5EBMB 1NJ9A 5HHOB 2N4IA 1BWMA 2WBWB 1EAPB 5AAWA 2ZG3A 1FH5L 3QO0A 5L2JB 3MTRA 1HHHA 4XPAH 4FQXA 1UZ6F 4Y4KC 1GVIA 3FQUA 4D9LH 1WBZB 3WIHA 4K8RD 4MAYC 3WMSA 5J6GA 3EYOA 3D3VB 4WI6A 2X44D 3HR5A 4BH7B 3VFPA 2Y7QA 3BE1L 4JLRA 4LCCA 3P73B 3QIUD 5MI0C 3MLRL 1JJUA 4ZTPH 4PJDB 5DRNB 3CFJA 5TPWH 3DRTA 3UTQA 1FCCA 1NMAL 4Y5XC 1TQCC 3NCCB 4XNUL 1ZLUK 3O3EA 2NY4C 3PXHA 5CEZD 1G9MC 2FX9H 4KTEL 2J8HA 5HHQB 4WGWB 1FN4B 5DEGB 1D5BA 3DECA 4ODBD 3B9KD 3GSXB 4JPVL 4APQB 3ULVH 4LNRB 1KTDA 5EU4B 3GSVA 4G7YL 4YBLC 4OGXL 4M43H 4LQFH 2AEIT 1R5WB 3NFNA 4FZEL 1FL3B 4JN1H 4R6UA 3RBGA 4P4RB 5DD0H 2J6EL 1EH9A 3KPNA 1HHKA 1A4KA 4OIIH 4YDVA 5DMGD 2BVPA 2VWEC 5C0NC 2DLIA 3RPKA 4ODTH 1MCEA 2EYSA 3PHSA 4JO4L 2X4TA 2BSSB 8FABA 3R06A 3BWAB 3OKNB 2HN7A 2IAMD 3CX5J 4QRPB 4LARH 5F3HA 2BVOB 3WS6C 5E95B 4Z5RA 3SKJH 5C0BB 3WJJA 4JY6A 1E6OH 5F3BA 1FL5B 4XRCA 4NNYA 1RZIA 4OLZH 2PXYD 2DN7A 2PO6C 3MOAH 1AO7D 1U58A 2FCBA 5EOQH 4YXLH 1RMFH 3HS0B 3TO2B 1YC7A 4D9QE 5IHUH 5A43C 2P5WA 2R2CA 2CR3A 5F1IA 3RDTB 3UJTL 2IG2H 5D7JB 5SWSB 4OZIF 3LN4B 4U1JA 4AEHL 3BYYA 2EECA 2FZ3A 1R3LA 2JB5L 2AQ1A 4PD4K 1RHHB 2B5IB 5I71B 1I1RA 5FYJL 3GJFH 1IKNA 2Z8SA 3PGDA 12E8H 1T83C 1YEGH 1SVCP 4EZMA 4LGSB 1DZBA 2FRGP 1XCQB 4NJAH 3IDNA 1MHHB 1A7RH 4TVPD 5GGSB 2HRPH 1MHEB 5CFHA 4Y16B 3P77B 5KVFL 2XACC 3TZVD 5DO2D 2VN4A 5KSUB 4E0RA 1MWAL 1SMOA 5DHVB 1G7HB 4YIQB 1T3FA 1ZVSB 4WW2C 3MV8B 1CFNA 3L7FA 5DVKA 1CBVH 1P4BL 2D0FA 4WNQB 3K4DA 4FQLL 3EYFA 5DRZB 4JO2L 2H41A 4U1MB 1HHGB 3WHE0 2VZ3A 3EKCA 5L88L 2RCSH 1ZT7B 1N4XH 1UB6A 1VSCA 5D72L 1OY3B 1PX3A 1B6DA 2HT3C 4ORGB 4X6DF 4LKCA 1MRFL 4YHYC 3F7YB 4YPJA 2G2RB 3ZE1E 4HGWB 3K3QA 5C0EA 4HBCH 2ZCLH 5I75C 3LS5L 4YDLC 4XXDA 5GS1C 1O7SA 4NQDE 4QRQB 3ALXA 2HFEB 5BCAA 1XGUB 3CIQA 1IGCH 1FQ9C 3ALPA 5T1LB 3NAAL 3TNMB 4JJHA 1I4FB 1IBGH 4XTRD 3S96B 3IU4L 4HLZH 4F3FB 1ACYL 1P1ZA 1PEWA 4Z7OF 3WE6A 1F4WH 4M6AA 4KJWD 4QOKE 5B4MD 2AJUH 5DK2B 3T1WA 3VFGL 4MLSA 4UMGA 1KTLA 4GS7B 1ZTXL 4OCLC 3MLPA 5JHDB 1YMME 3O3BB 1L7IH 1YQ2A 3S4SB 1BFOB 5T1MA 1FFNA 1VB9A 3D85A 3BKYH 3VD4A 5EA0H 4HHAB 1GZQA 5DZLA 3KYAA 3ULUC 2DQJL 4ONGL 3T0BA 1N5YH 4I3SL 4GH7B 4DN4H 5H35B 5C7XH 2JCCF 4PRBA 5TQ0H 2VLME 5HYJA 4HIJA 4Z0BL 5T3XH 4Z0XB 3PIQA 2I26N 1GGBH 5J4MA 4P3DB 3CFKB 3FN0H 5IROC 4XCNB 4OFIA 2Y06L 1OAZL 1KCVL 5EULV 2A77H 2W07A 4D0DB 2BMKB 3WUWB 1K4CA 4J3WA 5MP6H 4PB9H 3SQBA 1RJLA 1ONQB 3TH2T 1XGTA 5DQDL 2BNQB 2CMRH 2ZSVB 3NPZB 1YUHA 2IGFL 4TUJA 3C6LB 1RZKC 1CFBA 4LPXA 3BZ4A 4MQSB 3WEXB 3L3JA 2ICES 4QY8A 5TFSL 3F5WA 2NY0B 2BVQB 3CC5B 4ZFOL 2R29H 3FO1B 1U8JA 5LKNA 2DQFA 3QEGL 1XGQB 4JKPH 1U8MA 3I6KA 1EGJH 2A9MH 5I1KL 1FZKB 1A1NA 4LLYB 1RVFH 4GRWB 1N59B 5I30H 4EOWL 1OP9A 4HIHA 2X40A 5CD3A 1RJYA 2J3SA 4UILL 3DUSB 1LO3H 2M8XA 3VXRB 1E4JA 3BRFA 1CGVA 4R96B 3KNBA 4F33B 1UCTA 2IH1A 1G9ML 1IL1B 3AAZA 1XIWD 1XR8B 4J2XA 5D7LB 4TNWF 5GRWA 4KV5F 5HSFA 2XIDA 1FH5H 4C4KO 1I9EA 1OAYH 3G08B 3G6JA 3EYQC 3KPQA 4PS4L 3FB5B 5DJ2A 4JHWH 2R15A 2VLRA 2W1NA 3AMLA 3MACL 3KYMB 4IMKA 1TVBB 2RQ8A 1ZHKB 3N1MC 4X6EB 2Q7YB 1T2JA 3MV9A 3HMWL 4FQQB 5M95B 2EZ0D 2NY3D 1E4KC 4U1KB 4PJBB 3EGSB 1IC7L 1HHJB 1FE8H 2EKSA 5EC1A 3VD9A 3O0RL 4HGKC 3TT1L 1T0MB 3P9MB 2HH0L 1P6AB 1F6LL 5CUSL 4XAWH 3N1QC 3BKMH 1Q9WA 1KIQA 4MJIE 4KTEH 5DJCA 2YUWA 4TNWK 3T2QA 1CCZA 2XY1A 1CWVA 1MI5A 3RTQA 1P7QD 2C26A 4JZOB 1CD1B 4JDVB 4L4VB 1T2XA 4U7MA 4YE4H 1BQUA 3G04B 3T2PA 5IGXH 1F97A 2MQ0A 4FFZH 4GG6A 5D7IF 3F58L 2EH7H 1S7UB 3ROLA 3KLSA 4HUKB 4LBEB 4Y4FB 2R4SL 3UCRA 3ZE2F 1QRKA 4FZEH 3MBEC 2W0LA 4LVHB 3ZL4H 1K2DA 4OIBA 2OJEA 2P8PA 4ZSOA 5C0IA 3RGVA 5IIEB 5I1IH 2OI9B 1Q0YL 5MEND 3PL6D 3VXPB 4MB5A 4WUKL 2CO7B 3G5ZA 4UI2A 4IRSD 2OTUA 5L7XL 2W0FA 4JO4H 4U1LA 5IM7B 4JFZL 3TVMB 4YFDB 1OGAD 4AENA 2OQJB 4ZFFA 2PW1B 5I1JL 1S7WA 1NFIB 4ODXB 2CRIA 3C08L 4BQ6A 4E42B 3HLAA 1G9NL 1C5CL 4S1SL 1P4IL 2P43B 1KC5L 3SDCA 3MRJA 1K8IB 3SO5A 1HXMA 4YNYB 2E9JA 5EZOH 5I1GH 1ORQB 4KTYA 3MJ8A 4PJCA 2NPLX 3PHOA 4JFEB 1FYTB 4WHYG 4M7JL 1FFQA 4Y4HA 2JIXB 4QTIL 3A0OA 5IW6A 4RAUB 4Z7UA 1CXKA 5IEKA 3DYMA 2VUYA 3NCJH 3UJTH 3Q48A 1G7QA 1N3NB 1OWWA 4LLQB 1KEML 1I85C 3P9WB 4XT1C 3HE6D 4N1HB 3ARRA 4AEHH 4Q97A 3BIKA 3N85H 1AGFB 3D1MC 3DTXA 5DEFB 4TTDC 1CLCA 2LU3A 5F7YC 3DXAE 5FYJH 3VXMA 5J57B 3DVNB 1NANH 4CMHC 1OAXL 2D7MA 1U3HB 4TSCL 3S3JA 3VG0L 1RUKL 1T03L 4P2OC 2FB4L 3MA7A 4ZUTA 4OF0A 3FQNA 4QHMA 3NPSB 4UB0L 5HGAB 5KVFH 1JNHA 2JELL 2VXQL 5EU7C 1IM3B 4M3JA 4XGZA 4IIQB 1GPOH 2GSIB 2XN9A 4NJ9L 3ZDXE 5J1TC 2EH8H 4OQTA 1C8PA 1P4BH 3C5JA 4EQ2A 1V7MH 4FQLH 1LHZA 3ARDC 5JW4M 1PQZB 2OSLA 5L88H 4KK9C 4AM0A 5IT2H 3OPZH 5ID0A 5D72H 4FN0A 2OYPA 1I3UA 3DX7B 1HZHL 3GI9H 4O4YL 4QRSA 1MRFH 4HWZB 4WIQA 3HI1B 4WHTB 4F9LC 3TBTA 4G9FE 1J1PH 4JFDE 5IMLA 3ULUL 1VGKB 3EUUA 4OZGE 3L9RA 3WFHA 1J9CT 2NW2A 4XAKE 5KVEL 3DLQR 1KN4L 3REVA 4OBRA 2DIAA 5MHSD 3MOQA 5GGTL 2YSSA 5KSAC 3O9WD 3BPLC 4Z77A 5BO1H 1JPGB 3GI8H 1TFHA 5DJ0A 4P4KA 3QFJD 4PGDB 3IU4H 4OFPA 4F37F 1ACYH 4I48A 3ROOB 5L9DL 1MF2L 4NIKB 1AKJD 4I8DA 1G7PA 1QKZL 5E8EB 3SBWC 3Q5YA 4JY4B 2KBGA 3VFGH 2NYYC 2WWKT 3I6LD 3X12B 4GAYB 4OCYL 1NJ9B 4OQ1A 3SCMA 1JPSL 3QDGD 3CX2A 4LCWA 4CBPA 5TQ2H 4Q74A 1NCDH 3GMRA 3N1FC 2FEDC 4WWKA 2CKNA 3QO0B 3WSQH 3PDOA 1HHHB 4FQXB 4NO0A 4LEOA 5FGRA 3FQUB 3V4VH 4MLIA 1UXSA 2R9HC 5AAMA 4X4YA 1C5DB 2DTSA 3EYUL 3EYOB 4MQTB 5J6GB 3WLWD 2OL3A 4RGNB 3VFPB 2Y7QB 4LDOB 1RURH 2NNAA 1BQLL 3PWVA 4JLRB 4LCCB 4X6CE 3T1FB 4ONFL 4F37K 4RNRA 2Y06H 5K9QG 3CFJB 1OAZH 5C9KA 3DRTB 3KYOA 1QOKA 5HDQH 3O3EB 4UOW1 2Z35B 4XP6L 1AXTL 4TULL 4LCYB 2C3HA 4PJGE 5L2KA 5B3JE 1KN2L 1D5BB 1IAII 1MQKL 2Q1EA 3QEGH 1BPVA 1T21B 4YR6A 5I1KH 1KTDB 3GSVB 5I8CA 3C5SB 4EOWH 5C8JA 1LK2A 4KUZL 1N7MH 3VWKD 3U7AA 1ND0A 3ZKND 1AXIB 2ICEB 1JTTA 4R26H 3MBXL 1MLBA 2VABA 1A4JA 3RX5A 4U6YA 2NY2D 3DSFL 3VI3E 5DQ9A 5HI3D 1J8HA 2QQNL 3KPNB 4DZBA 1HHKB 3IU3A 5EIIA 1A4KB 5H37H 4YDVB 3ETBF 2BVPB 4HDIA 3K1DA 2XFXA 5LCVL 2R8SL 4PS4H 2EYSB 1KG0A 4ZAKD 1JNJA 3LQZA 8FABB 1NUGA 4PJ5D 2XTJD 3MACH 1MFBL 1CD0A 3ILPA 3KPMA 2E27L 4J6RL 1OL0A 4OZFH 1FZOA 3DO3A 4Z5RB 4ODSL 1JYWA 1ZE3C 4JY6B 2J6EA 1YPZB 3BWUC 1J86A 4XRCB 4MAUH 3QRGH 3I75A 3BDXA 1RD6A 2HH0H 4HXAL 3BD5A 4N1CA 1F8TL 5CUSH 5FO7A 3HUJF 2ICWI 2P5WB 3O4OB 4PRIE 4UBDC 5F1IB 3ZT7A 4R2GC 3C6SB 4ZG1A 5D4QA 4U1JB 1DJSA 4Q9QL 1T1YA 4TTGA 2FZ3B 3LKRA 1R3LB 3M07A 3NGBC 4QXTA 5T3ZL 3NZHL 3H7BA 3PGDB 3D2UD 1P7KA 3IDNB 4CDHA 4F58L 2C4FT 4NZRH 2XT1B 4YUEH 1GGUA 1EFXB 3OB8A 6CGTA 3HFML 3P0VL 1QNZL 3TJEH 5SV4A 1Q0YH 4E0RB 2FECL 2R4RH 4RBPK 3FQTA 3LQAL 1T3FB 4JEGB 3MMEB 2X4NA 4WUKH 1CFNB 3IF1A 3UTPD 3L7FB 3LY6A 4K8RL 5KOMC 5HYEA 5L7XH 1OAQH 5IQ9A 1ADQL 1R6VA 3PP3H 3VJ6B 4XP1L 2NY4D 1AD9A 1MNUL 1MCDA 4G9DA 1OSPL 5IW1A 5I1JH 4HIEA 3C08H 3T0EE 2PNDA 4MA8L 5F9OH 4HPOH 1SMAA 2IJ0C 3GUTA 3D25A 5JDSA 1PY9A 3C2AL 1FNAA 3BO8A 3G5XA 1KC5H 3QUYD 4LKCB 5FYKH 15C8L 5D5ME 1MWAA 2F5BL 3SDAA 3ARTA 5C0EB 2EE6A 4HEPG 3DETD 4EN3B 3DX8A 5CEZL 1MJUL 3JBG7 4XXDB 4OSUL 5C86A 4QTIH 2CDGA 2WQRA 1T66C 5IFJA 4BK4A 5BOZG 3MRNA 4OI9A 4WW2F 4ZOCA 2BVUA 2ESVD 1K6QL 2NY6B 2UUDH 1A3RH 2Z93A 2XPGA 5I18H 3KYNB 3NFSL 3U46A 1KUMA 3V6FA 2R56H 5C0ND 5IFAH 1BLNA 4N5UA 1P6FA 4XBEL 1VPOL 1P1ZB 5A1AA 3WE6B 2Y07L 4WUUE 4TSCH 5D96B 3VG0H 1RUKH 4F9PA 3V9FA 2FB4H 2PTTA 3O11A 5T5FH 5IQ7L 3TA3D 3RL2A 1KTLB 4UB0H 2AABH 1J1XH 2YC1B 3UC0L 2VXQH 1X5LA 3MC0A 2CSPA 1L9NA 5T1MB 1FFNB 1P5UA 7FABH 5GZNC 1TETL 2XZCH 3OJVC 1WICA 2BZDA 1A6TA 4P5KA 1XR9A 3CFIC 3ZYZA 5KVGL 1GZQB 1S8DA 2NZ9C 4WFGE 1NGPL 1IZKA 1DR9A 4LVNC 4YLQT 3ES6A 3GIZL 1T7YA 4PRBB 5HYJB 4HIJB 4LHQB 1HZHH 2D4DA 4O4YH 3TP4A 3BGFB 3PV7A 4KRPB 3LS4L 4G3YL 1TIUA 4XNYL 3BKCH 4MNGE 5E7BA 2VLKE 1K4CB 1RJLB 1WZ1L 1QRNA 1XGTB 3HI5H 1JGEA 5KVEH 3U2SA 5J8OA 1YUHB 1KN4H 4TUJB 3AUVA 2P1YA 3BZ4B 5I1LA 3I9GL 5HHVH 3L3JB 1S7RA 1BEYL 4QY8B 5GGTH 2DMBA 2P44B 4ZPTA 3F5WB 3VCLB 3ZTJH 4OUUA 2C1OA 4YX2L 1BBDH 2YD5A 1LE9A 1U8JB 1A0QL 2DQFB 2AK1L 1U8MB 1A1NB 5F7HA 5L9DH 1MF2H 2YPKA 4K71B 4BUHA 4HIHB 1MEXH 5CD3B 1RJYB 3RZCD 1QKZH 3PXJA 1SJHA 4Y4KA 3KNBB 2IH1B 1MCJA 1K85A 3AAZB 4OCYH 4NNPL 1JPSH 2F53E 2VN7A 3BGMA 5CEXA 4U2YA 4K9EC 1NMBH 2V7NA 4MZ3A 5JIKA 3VXUE 3QCTH 3G6JB 4U7KA 1F11A 4ZFOA 1MCHA 5DJ2B 5BV7H 4RX4A 2VLRB 4JM4L 4QGYA 3S35H 3U4EB 3CCHA 2YMXH 4C57C 3MV9B 3RZWA 4HT1L 1WFUA 1UACL 5FK9A 4S0SD 2EXWC 1KIUA 1AGCA 5D2NA 5GGRA 5DHYA 3WFZA 3NIDF 3IRPX 1ZSDA 4ONFH 2EKSB 1WWCA 2Q76A 2NX5A 4NO5A 2GQHA 3G9VA 3HC0A 4WTWA 4XP6H 5T1KA 4TULH 4GQ9L 1CXIA 3SY0A 2EYTA 2CUMA 5F7FA 1KIQB 1UH4A 5DJCB 3OXRA 1FNEA 5IVXF 2XZQL 2YKLL 4N0FA 1MI5B 4U0QB 4Z7VF 3RTQB 3QQ4B 1IC4H 1PKQA 4OZFA 3W0WB 4TRPL 5DSCA 1FNLA 5IOPA 5F9WC 3O4LA 4GG6B 4JJ5A 3EFFA 4WVRA 3ROLB 4E5XA 1KCRH 3HG1E 1UEYA 3D69A 3MBXH 5CINL 3AGVA 4MNQA 1LK3L 4ZMAT 1K2DB 1U8NA 2OJEB 2P8PB 3QG6A 4ZSOB 5C0IB 3RGVB 2Y72A 2QQNH 3O3AA 4Q0XL 1V3JA 2BNRA 3G5ZB 5LCVH 2OTUB 1G0XA 1EO7A 2W0FB 4HWEH 2X9XA 4U1LB 2JJUA 1J18A 4PJFE 2OJZL 5HHOE 1C7SA 2X7LA 4AENB 4ZFFB 1V5JA 1S7WB 2PO6A 4WO4D 1NLBH 5HDOA 3MRCB 3TGXA 3HLAB 5BRZD 4HAGA 1LE5A 5LGHL 1G1YA 3SDCB 3ISWA 3MRJB 4ODSH 4W6YB 4OCWH 1H8NA 5CAYB 2MCPL 3D3VE 4JAMA 4JO1L 4HXAH 4J23A 3K8MA 5IW3A 2VZOA 5FO9A 5CCKL 5IW6B 1M7XA 4Z7UB 3IFNH 5IEKB 1U9KA 3WKML 4PJDE 4XVUC 1G7QB 5I2IA 4BZYA 1OLZA 3A67L 3OJ2C 4FRWA 1WITA 4Q9QH 1DQML 3BIKB 1FGNL 3DTXB 2XG5A 3VXMB 3LN9A 1S78C 4HUUA 5E00A 4MXVF 3E8UH 2NY1C 3KHOA 2BY0A 5E70A 4ZDHA 5DFWH 1OB1B 1YYLL 4U6HA 4IRJD 3PE9A 1ZVYA 4JZNA 3MA7B 1XGRA 4ZUTB 4PJAE 1INEL 3FQNB 2UY7A 3P0VH 4QHMB 1UWGH 1QNZH 2ZSWA 4LFHD 3SGKC 3V6ZA 5FV2A 4XGZB 3MZGB 4UOW0 4YBQC 5IB2A 2XN9B 1FL6A 5B8CA 4K8RH 3UJIH 2BERA 3S36H 3C5JB 3EFDH 3UP1A 1DEDA 3RIAF 4L4JA 1YNKL 4FTVA 3S37H 2UWEA 3SJVA 2E7LA 2OSLB 4JPWL 4BJLA 3B8SA 1HILA 3VI4F 1IILE 4AM0B 4D9RE 4MA8H 4XNZC 4V1DB 1B9ZA 5ID0B 2RBLA 1BFTA 4LRIC 3C2AH 4UT7L 4X5XA 4QRSB 4XNQA 4PJ7A 4KJYA 1A6VH 1KBGL 5DUBA 3TBTB 1RIUH 1KPRA 5LQBL 4QRPE 2B4CC 5IMLB 5CEZH 3OKLA 1UH2A 3VGAC 1FZJA 1JGVH 4ZYKA 1ZANH 1YC8A 2NW2B 4NM8L 3FAWA 1F90H 5LBSL 3REVB 1DE4A 1K3ZA 1K6QH 5ITFA 3MRLB 3EO0A 2YD9A 1TJIL 3NFSH 2IANE 2F74A 2EDRA 4X4ZA 3MROA 4P4KB 4TPRL 3RIAK 4Q6YA 5SWSE 4I48B 5I8OH 3OB0K 2Y07H 1QQDA 1G7PB 1X7QA 1MUJA 3FB8A 2R1WA 4GXUN 1ZLUH 4YEFA 1MVFA 4OGYL 3NCYP 4M9PA 1FVDA 3BDYL 3UC0H 1GJIA 4LCWB 4YH6A 5CGYD 3T3ME 5D8JL 3GMRB 5GGTA 3K80A 4WWKB 2IBGA 5F96L 2PTUA 4NO0B 3VWJC 4LEOB 1ZLSL 4HIIA 4C56A 4XVJL 1JHKL 1KNOA 5A2FA 1NAKH 3MV8E 5HVGB 5CJBA 4X4YB 1PVHA 1I1YB 2OL3B 3CZFB 2P5EA 4UAOB 1WCBA 1IKFL 4LMQI 3GSUA 2NNAB 3PWVB 1CICA 1LILA 1AI1H 3RWHB 2W38A 4XPHL 5DJ8B 3NA9L 4RNRB 1WWBX 5IR1A 4FNLL 3BI9X 4XNYH 2GJ6D 2UY6A 3L3HA 4E41A 3TT3L 5T1DL 3OXSA 3BPOC 4GKZA 4TUOA 4P9HC 3KYOB 1MRDH 4AG4H 4RISL 4UIKL 1ZT1A 2YRPA 4Y1AD 2QQLH 2P8MA 4TVSa 5L2KB 4FG6D 3I9GH 4LPYA 4JHAL 4KC3B 3MOBL 4NC2B 4LSQL 4EXPX 2ADIA 1ZHNA 3ULSA 1A0QH 3QDJA 2AK1H 4TVPH 4YBHA 2UVFA 4YR6B 2WP3T 1TCMA 5I8CB 1KENL 3EYSH 4M1DL 1LK2B 5TF1H 1ND0B 3FOMA 1NAML 1MLBB 2VABB 1A4JB 3PWPE 2X1PA 4U6YB 4U4BA 2GITA 2YA2A 4QXWA 5DQ9B 2XOTA 1JGLH 5DJZA 3UJJL 4M03A 4NNPH 1J8HB 4DZBB 1L0YA 4H20H 5K9KA 5EIIB 3UTSA 1IAKA 2QL1A 4HLZG 1PX4A 4HDIB 1E4KA 1XGYL 4C4KT 4KQ3L 4DVBA 2XFXB 5FM4A 1YY8B 1KG0B 3QNXA 3RX7A 3LQZB 3W2DL 3T04D 2WLYA 3DO7B 2QKIA 5I6XC 3O8XC 5E6IC 4X6BA 1X4ZA 1C1EL 3KPRB 3KPMB 4B7LA 2ZCKL 4G6JL 5ALBH 4YDKH 3LEYL 4HT1H 3S7GA 3LKSA 1FZOB 1UACH 2PCPA 5IKCA 1IGJB 4M93B 1X6NA 4JRYA 3BPNC 1F4YL 2CLZB 5T33L 1WFNA 3QIWD 3I75B 3RIFK 3QXTA 2FJHA 2ORBL 1MHPL 3GIVA 3P4NA 2NYYD 4ETYA 5CILL 1K8DB 5FO7B 3KJ6L 2HTLC 3W9EB 4HKXA 1KTRL 5TH2A 2DQUL 3GJEB 1T1YB 2D03H 2F19L 2YKLH 3NZ8A 3LKRB 5D2LE 4CGTA 2IPKA 1AFVH 3AMKA 4QXTB 1CF8H 1SBSL 3H7BB 1NCBL 3MJ9L 3R1GH 3HE7A 2NXZD 1P7KB 2UV3A 1NGQH 4U7SA 4WFHE 3VFVA 1LK3H 1NH6A 2FX8L 4HG4J 4GRWE 1GGCL 3ZE1F 1OLLA 3HPJA 3FQTB 4Q0XH 4WI2A 1J0ZA 2X4NB 5ENWA 3IF1B 2VC2L 3FQRA 4HWBL 4XBGA 5K9QI 4PTUA 2VMFA 5IQ9B 1TMCB 4HJ0C 2OJZH 1AD9B 5IW1B 3EZ8A 1DUYA 3IRZA 4D9QD 4HIEB 4MD0A 1U3JA 3UO1L 2D7TH 1H3UA 2EE9A 4MJ2A 3X11A 4NQEA 2D4FA 4GAJL 4I0KA 3GUTB 3WN5C 5JDSB 5ERWA 3G5XB 2IFFL 4HWNA 4L3EB 1LEGA 3T8XA 1MWAB 3SDAB 4GUPA 2LTQB 2H26A 4CAGA 4QRUA 4LCIL 2VL5A 5D6DA 5LWYL 1UCBL 2CDGB 3EHBC 4PJBE 5CCKH 4JN2A 5IFJB 1ADQA 3MJ6A 3MRNB 3WKMH 4P2OA 2X89A 3A67H 3O3UN 3QIUA 2Z93B 4Z7WA 3LEVL 2CO6B 3QZWG 1X5KA 4O2FA 1H3PL 1DQMH 4W4OC 1GGYA 3R0NA 1IGIH 4IJ3C 1HINL 2XRAL 1BLNB 4LQ1A 2YXFA 1LGVA 2B4CL 4JZJB 1Z9LA 3LVEA 2PTTB 4KVNL 3UBXA 3O11B 1RPQA 3RL2B 3ARDA 1ZMYA 2ZZUT 4BA8A 3UYOD 1JVKA 3TV3L 1INDL 3A6CL 1JYXA 3TBYB 3U0TA 4F7CA 4F15B 4NOFA 1A6TB 4P5KB 1XR9B 2E6QA 5J13C 3BZDA 4NRYA 1MIEL 2XG4A 2DQHL 4F9LA 4PV8A 4NQDD 4Z8FL 1HNGA 4P99A 5DD1H 3ES6B 2XV6B 2ATPA 3LAFA 4ZS6C 4UT7H 4LSRL 3IAGC 2W65A 4KK5C 5BW7C 1V3KA 5GZOC 2VXVH 4AT6A 1JTOA 4MCYA 5KSAA 5TE6H 1BD2E 4M6NH 4MXQC 1AP2B 1LEKA 3JV6A 2QSCL 3IVKA 5CP7A 2F8VA 4HC1L 1QRNB 5A2KH 1JGEB 4NM8H 4P48A 3U2SB 4X8XA 5LBSH 4P2QA 4OGAC 5SX5H 4JFEE 1FYTE 5JXEA 1U93A 1S7RB 3IXAA 1YMMD 4OUUB 2C1OB 1LE9B 1S3KL 3DVFA 4TPRH 5DXWA 1ZHBA 3CNKA 1EPFA 2YRZA 2A0LC 1SJHB 5DVLA 3WDHA 5F6HJ 4Y4KB 1MAMH 2Z8VC 3ARXA 1I8LA 4MHHG 4E9LA 4MAYB 3QR2A 3BDYH 1WIOA 4POZC 4KXZH 4HS8L 1MCIA 1AQKL 3BGMB 5CEXB 4RFOH 5MI0B 2BFVL 4AK1A 5F96H 1S9VA 5FYKU 1ZLSH 5IJKA 3ZYOA 1S9WA 1QP1A 4JHZA 2RB8A 3O2DL 5FO8A 5FHBH 5KAQF 1U8KA 5FK9B 4U31A 5DVNA 4QRRD 1AGCB 5D2NB 5GGRB 4GAGH 4XCEA 5ICXB 5DHYB 5HVHC 1ZSDB 1NL0L 4MJ4A 1YECH 1QSZA 3BKJL 1SJEA 2H9GA 2NX5B 5EO9A 4NO5B 1BVKA 5T1DH 3TT3H 3HC0B 3QT2A 3IDYC 4RISH 4UIKH 3AY4C 5T1KB 3SY0B 2EYTB 5TE4L 3FHQA 1J1OH 3OXRB 1FNEB 1Z6JT 4JHAH 3MOBH 4N0FB 1PKQB 1IAIL 2BRRL 3T0AA 3ARFD 4HKBB 1F4HA 5DSCB 2IF7A 3FFDB 2NZ9D 3O4LB 3EFFB 4LLDA 4M1DH 4E5XB 4CL7A 2ERJC 1MCBA 1EA9C 1CTOA 3D69B 3IB4A 3QA3A 4N8VA 1JFQL 2V9RA 1U8NB 2NQCA 3QG6B 3C9NA 1YA5A 3RI5K 4KZEL 4GLRI 3QNZA 3GK8L 1HI6B 3AVEA 3O3AB 4GJTB 2OM5A 3BUYB 2BNRB 1CN4A 2V17H 1WGOA 5KS9A 1VADA 3W2DH 1EFQA 4OTXL 5EOCL 2PO6B 2RFXA 5DEZA 4NCC2 4KHXL 4YHNA 2HTKD 3QBTB 4MJID 4G6JH 5GJTL 3M45A 1LE5B 3B6SA 1KYOJ 4O00A 4Z7NE 4K94C 1J0IA 5T33H 4NQSA 5F7LB 1H0DA 4LNVA 2YD4A 1J0JA 1FJ1A 2B1HL 3LKQA 5FO9B 2APTA 4QWWC 4L8SC 1A6WH 5JW5A 5I2IB 2ZKHL 2FIRT 2ZUYA 4PRPD 1CGXA 3ZDXF 4QOKA 2F19H 1CL7H 4XPGL 2ZNWA 3T77A 3ARBD 3MRIA 4NN5B 1NCBH 3MJ9H 4R9HA 2X1XR 3RDTC 1QACA 4HUUB 5E00B 3I50L 5BXFA 3LOWA 5D7JC 3RJDA 4ZDHB 3MJGX 4U6HB 4KRMB 3SPVA 4KH2A 1F4XL 4DOHE 3RHWF 1UYWL 1XGRB 4PY8I 2B5IC 4JR9H 2ZSWB 5BJTA 1GGCH 3GKWL 3V6ZB 2BCKA 1TJHL 4LPTA 2Y5EA 4OZ4A 5IB2B 1T5XA 1FL6B 4IOIA 2B2XL 3FQXA 2DF3A 3TPUA 2PYFA 2VC2H 4HWBH 4OZGF 4YHYB 4DUXA 5DD6B 4Y16C 4X98A 4N68A 5LAXA 5I75B 5AUMB 1EXUA 4FTVB 3KPSA 1EJOH 2UWEB 3SJVB 3UO1H 4MVBC 5GS1B 1HILB 3BHBA 1J10A 1OAUH 2XA8L 2O5ZL 3B2UC 3B5TA 5H37G 4PLNC 1D5MA 4X5XB 4F57H 3SO3B 2IFFH 4XNQB 4KY1L 4PJ7B 1JIBA 3DXAD 4RSVA 5KZCB 1QD0A 4ZO9A 3OKLB 2B0SH 2FIKA 4TQEL 1UM4L 4K3JH 1FZJB 4M6OL 3RHWK 5D71L 4ZYKB 2EIDA 1RK0A 3MODL 4IMLB 3WLBA 5DMYA 5FDWA 4I3RL 4GXVL 3PGFL 4OZFG 5DUPH 1KXVC 1M7DA 5ITFB 1NFDA 3EO0B 4RAVA 1UWXK 1WFOA 4X99A 3TN0C 4ZNEA 3KWWA 2F74B 3VD3A 4XP4H 3MROB 2XRAH 2P5WE 1JF1A 3QCVL 3UTTD 4ELMB 3ZSTA 2FD6L 4ZFGL 4OT1L 1QQDB 1N64L 1X7QB 3UYRH 3FB8B 4KVNH 3SE8H 1LO4H 1AGBA 2NTSP 4X6CF 1KB5L 3VFNA 1FVDB 3FO9B 2DS4A 5EWIL 4WI4A 5ICZA 2IFGA 1B4JL 3TV3H 4HUMB 2ZG1A 3LRGA 3MLYL 3CAFA 4G9FD 4LHUB 3ZE0E 2P8LA 4JFDD 3O6FA 1UA6L 3BEVB 1MIEH 2DQHH 4PJGF 3KLHC 4HIIB 4XVUD 4C56B 1VEPA 5IG7A 1KNOB 1DBAH 4LRNL 5B3JF 3P4OA 3M17A 4M1GL 2P5EB 5DHXB 2RHEA 1WCBB 1CLYL 3GSUB 2VIRA 5E8DL 5E94A 3SQOL 2GJZA 4J8RA 1X6LA 3O2VL 4OLVL 5IR1B 1M1SA 1DN0A 2NY1D 3NIFE 2QSCH 3OR6A 3CXHK 4FFWD 1VHPA 2EIZB 5F7EH 3L95B 4JFHD 3OXSB 4GKZB 4TUOB 4G8EA 4ZUVB 3VI3F 1DQTA 1ZT1B 3MLWL 2VZSA 2HVKA 3CD4A 3RVXC 2P8MB 4GXUM 5FAAA 1F13A 3UXFA 4M4RA 5KN5A 3BQUC 1T89C 4YBQD 3SDXE 1CE1L 2BSRB 2AEWA 1ZHNB 4FQJL 4HUWA 3ULSB 5C6TH 4PJIA 2N7BA 4X9IA 5DK0A 3RWCB 3QYCA 2FR4A 1YQVL 4B5EA 3C6LC 4JQIL 4ERSL 2XQYK 3V5DB 3DGGA 5GQBA 3FOMB 5J0BA 2Z31A 3VGHA 1EHXA 3WO4B 3I6GA 4XWGL 4B0MM 1IT9H 1CVSC 2FBOJ 1FO0H 2GITB 3WIIH 2CD0A 4CVXA 5K9KB 3NACL 3UTSB 1IAKB 5J12B 4DVBB 4QNPE 3QNXB 3P40A 1OTSD 2Y9RT 2QKIB 4LSSL 2DKSA 4X6BB 5C0GA 4N5ED 3JTSB 4L5FH 1NAMA 3LKSB 1I9RH 2PCPB 4P5TC 1A7BA 5IKCB 1URLA 4JRYB 4RBPH 4DAGL 1F6FB 4GRLD 3RY6C 3MV7A 1DDHA 3H9SA 3BDBA 5GISH 3BKJH 1KJ2B 4NM4H 4P23C 4LL9A 3UAJC 1UM5L 4A6YL 5HYJE 2HT2D 2FJHB 5D1QC 3VA2C 3GIVB 3P4NB 5A3IC 3ZTNL 3TF7C 2P4AB 2R0KL 4BSWA 5TE4H 1JGDA 2ZNXA 4HKXB 1FAIL 4DGIL 5C0AA 3GMPA 4Y2DD 3MBEB 3NZ8B 3RWIA 2G5BA 3UX9B 3KDMA 1IAIH 4WW1A 2VLJA 4K94L 1WIPA 2ZOLA 1L6ZA 2ID5A 3U9PL 2AQ3A 3U36A 1CTNA 4EDWL 3VRIA 4JFFA 1CFSA 3CVHL 3KHQA 4MA7H 5K33A 1WWWX 1P9MC 4R4FH 3VFVB 5EPMA 3FT2B 1JFQH 2UYLA 4X9BA 1JF6A 5HDLA 1JN6A 5D5MF 1CGUA 4NQTA 4KZEH 1WISA 3HPJB 1FGVH 4PJEB 3FB7B 1IM9D 4Y4FC 5ENWB 4PRNA 3FQRB 4XBGB 3SHSA 4PTUB 1AKJA 4LVHC 5E4EC 3MJ9A 4RDQF 5IEHB 2X4RA 4CNIA 5EOCH 4N0RA 2BNUA 1EUTA 1S9XA 2D31A 4MD0B 2A9NL 4WHCA 4YFEA 5C1MB 3Q6GL 3G6JE 5EZLA 3X11B 4NQEB 5DFTA 4UNVA 5GJTH 5ERWB 1GRWA 2V2XB 4XHQA 3ULVE 2VLRE 1LEGB 3G6DH 4ZTOL 3T8XB 4NUGL 4GUPB 3MO1A 2H26B 2WSKA 2VE6A 4OF3A 4S2SA 2VL5B 4CMHB 3DARA 4JN2B 1TDQA 4M5ZH 1ZOXA 5ITBL 1S5IL 4P2OB 5HJ3A 4Z7WB 4KKNA 1MJ8L 5JA8B 3BOVA 4M48L 5DWUL 5EU6A 4XPGH 1BIIA 3LCYA 3S97C 3QISA 5E8PA 4J7RA 5CGTA 4KHTL 3I50H 4FOMA 4QHLA 1MI5E 1V7NL 3RKDC 2H2SC 4UU9B 1UYWH 3FJTA 3H9ZA 3T0ED 5JXAH 5JPNA 3ARDB 2NCMA 4GG6E 1TXKA 1MJ7L 4ZS7H 1VFAA 3QUKB 1BQHG 1YEDA 3U0TB 3OHXA 4ODHL 2AK4D 2DLEA 4ZSOE 3VWKA 4NRYB 5KANG 3NPSC 3OQ3B 4PV8B 1S5HA 4J4PD 3B9DA 1F4AA 1SYSA 1CDJA 3B83A 3L3GB 4JQVC 4XXCA 4OLUH 4PJ9C 2ATPB 2O5ZH 2W65B 5I9QC 5D1ZA 1T6VN 3MRDB 4JHBA 1EBPA 4MCYB 2DWEA 5KSAB 4CADA 3BPLB 4HMDA 4IBLT 5EFIA 5IP4A 4X7SL 3N06B 1LEKB 3JV6B 4BZ1L 3IVKB 1ED3A 5I1HH 5CP7B 1I9IL 2VDOL 3L5JA 4JFXB 1X5GA 4BFGA 3MODH 5JQ6H 4I3RH 3OF6D 4WI8A 4PJCE 4P2QB 4MGXA 5EOTA 5C0FA 3IFOA 1U93B 5BS0D 4Z7UE 5AEAA 4HJ0D 4NC0B 5INDB 1ZHBB 4OT1H 4WFGD 4GKNA 4WI3A 1FP5A 1N64H 4K3EH 1SY6A 1BF2A 3IFLL 1Q0XL 1H15A 3VWJA 4HC1A 3VXME 3NCMA 3WFBL 2ADFH 1F00I 1EO8L 1ZEAH 2FL5A 3E6HA 4NCC1 2VDKL 1E0OB 1RZKH 1S9VB 2FH8A 1J0HA 2VLKD 3EHBD 3JWDC 3QUXD 1QG3A 5HYIA 1JZ6A 1S9WB 2DM4A 1S7XA 2XN9E 5A2IH 2R2EA 1QHOA 4WEUD 5DD3H 3EJJX 2YUZA 4XH2A 2DYPD 5FO8B 3NFPA 5GSVA 4PLJD 5E8DH 3SQOH 1D6VL 1UJ3A 4FQXC 4XCEB 1EUUA 3O2VH 4OLVH 5D1XD 4L9DA 1SJEB 5EO9B 1C5BH 4OZHE 4XHJD 5DFVC 2I5YH 2CIIA 1BVKB 4NUJA 2BJML 5MEPA 2GY7B 2EE3A 5I76B 3MUJA 3QNYA 4WHDA 5FXCH 5GGVY 3U1SL 3U4BL 2LU7A 3MLWH 3S88L 1U0QA 1YYML 2YUXA 2CKBL 1JMZA 3DX6B 4H0HB 1XMWA 3O2DA 3MUHL 3Q6FA 4P2YA 4FQJH 2VR5A 3VXUD 3UBXG 4EUPH 3MUGA 4BKLA 1RI8A 4LLDB 4XBPA 4JQIH 3VRLE 4P3WA 4ERSH 1EBAA 3H42H 1W0VA 5ILTL 2OR7A 5T3XE 2ESVA 3QA3B 1FBIH 4N8VB 4RGMB 2J5LB 1BF8A 1MPAL 2W59A 4H1LH 1JYVA 3C9NB 3NIGE 4K55A 4KK5D 3O8XA 5E6IA 3QNZB 1HWHB 4M1CC 5F9JA 2AXFA 2CDFA 3NACH 1MHCA 4OFYD 3QHZL 2X1OA 4AMKH 5KS9B 4PJDF 3WNPA 4LCWE 3MR9A 2Z0BA 4LSSH 3TA3A 2RFXB 2VISA 1KACB 3KPTA 4YHNB 1A7QL 3NMEA 2CRYA 1NGXA 3B6SB 2YHGA 2X1QA 4R2GB 2CRZA 1M6OA 1F3JB 1PBYA 4LLVA 4DAGH 3AC0A 4ZXBC 1N5AA 3Q5TA 4OIAA 2AXGA 3NGBB 5FCSH 4NQSB 1NFKA 1H0DB 2GW5A 2A0LD 1FJ1B 3LKQB 3OZ9L 5GS0C 2X1WL 1P69B 5GGSY 2DL2A 4MQXC 4QF1A 3WJJC 1JE6A 2DQIL 3V95A 4QHNB 4MHHI 4QOKB 1OCWL 1LP9A 1KJVA 4NBZB 1SEQL 3T77B 3NN8A 5HYSA 3MRIB 1NANI 1MCNA 3DMMC 4EIZC 3UMTA 1LMKA 3LRHA 3QXDA 1EHLH 3MLVL 1YMHA 5E2VH 4PGBA 5HHOD 3U0WH 1KXTB 2HJLA 3K7UA 1BBJA 1IMHC 3PHQA 2YEZA 1IKNC 3GMLA 2ICWA 5BJTB 4PP2B 5IF0A 4IOFC 2BCKB 4OZ4B 1Q72L 1G7LA 3WN5A 4DKFH 1T5XB 3FQXB 3TPUB 2PYFB 3D3VD 5ICYA 3VXOA 4X98B 1J8HE 2D9QB 5F7DA 3OB0H 1EXUB 1TJGH 3KPSB 4XNXL 1JPTH 3ZMRA 2Q3AA 3Q6GH 1BZQK 3BHBB 5IBUB 1PSKL 4GMSL 2P24A 3QXWA 5FCUL 3MCKA 1D5MB 3O2WH 3QH3A 4Y2OA 4ZTOH 1TCRA 4NQUA 4NUGH 4UINL 1EV2E 4JDTH 1H8SA 1BX2A 3T2OA 5K9JL 3GMNA 4PBVC 2YZ1A 2FIKB 4WCYL 2XYCA 5KTEL 1RK0B 4PUBL 3WLBB 1T0NA 5FDWB 1DBKH 4I0PC 4APQD 1M7DB 1S5IH 4GT7A 1NFDB 4RAVB 1D5ZB 4PJXA 3FCTA 1J8KA 4X99B 1MJ8H 1I7TA 4M48H 3IGAA 4PGCA 5DWUH 3KWWB 1NSNL 1A3LH 4NQCE 4I77L 1W0WA 1JF1B 1ROWA 4FXGB 1RUML 1UZ8A 4HUNB 1J7VR 2E9BA 3ZT6A 2QR0A 1A47A 1U8IA 3I3BA 3BP7B 1AGBB 1EMTH 3VFNB 1HHIA 5FGBC 1MJ7H 5ICZB 4N9GA 3ARUA 4GO6B 1RUAH 1FRGL 4CU7A 2JJTA 4ODHH 5CD5C 3EDFA 1FIEA 1ORSA 4QRPD 5FUCC 3O6FB 1I8IA 2SEBA 3CUPA 4ZNCD