2R56H

Crystal structure of a recombinant ige fab fragment in complex with bovine beta-lactoglobulin allergen
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVSLRESGGGLVQPGRSLRLSCTASGFTFRHHGMTWVRQAPGKGLEWVASLSGSGTKTHFADSVKGRFTISRDNSNNTLYLQMDNVRDEDTAIYYCAKAKRVGATGYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interactions between a recombinant IgE antibody and the beta-lactoglobulin allergen.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords Beta-lactoglobulin
total genus 43
structure length 221
sequence length 221
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r56H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r56H01
2R29L 3RWIB 1A6AA 2Z92A 2RAMA 3KXFE 1BREA 1ITBB 3S6CA 1W72B 2XA3A 1DBKL 1IGJB 4KHXL 4PRHA 1TETL 3GK8H 3EZJB 4GRLC 4Q9RH 2OZ4H 5K9KA 3BJ91 4J1UA 4G8GA 3RX7A 3PHSA 4KZDL 2HKFL 2NZ9C 1K8IB 1G84A 1SEBA 1C16B 3FQWA 1Y6KR 2DYPA 5ANMB 4MAYA 1BQSA 3KLHC 4U33A 2BRQA 5C2BH 3FO9A 5JPNB 5EIIA 3AREC 2LTQC 4R97B 4KHTL 2XPGB 3RWFB 2HT3C 4ZO7A 1MIML 4F7EB 1BP3B 3CC5A 1BFOA 3GJEB 5FHBH 2BMKB 4M48L 1JGVH 3K80A 1I8KA 5D96B 2V5SA 2CUIA 5D8JL 4DGVH 3V5KA 4X4YA 3V4UH 4BFIA 4A2LA 1QR1B 3MRPA 3UYPA 5DJYB 4Z78A 5DRNA 5C08E 2A6DA 1F8TL 3M1BB 4G9FE 3HB3C 3MNVB 4PY8J 2Q3ZA 3BZDA 2A77H 5I74B 2X1QA 4F8QA 5IT2H 3MFFB 4Z0BL 1WC7A 3AU1B 3SDAA 3U46B 1OW0A 2GJJA 2WBJB 2PYEA 4G3YL 3QUXB 2Z35B 5H37G 3WO3B 1MVUA 4O02L 5ICZB 1KXVC 1NKRA 3T2NH 4OF3A 4L8BA 4O51A 5FOJA 4WUUE 4EJ1C 3V52L 4XCNA 4OB5L 1MUJB 4FQXA 1PYWA 5IFHL 1BQLH 4H8WC 4HK0B 2BY0A 1RHHB 4WENB 1WEJL 3O3EA 1HHJB 1RJZB 1YC8A 4PJBA 2QSVA 2GSIA 2IQ9L 4I4WA 5A2FA 5DD5H 1D5IH 3RWFA 4D3CH 1YUHA 1FVDA 3N1GC 5ITBH 1V3KA 2N7BA 4DN4L 3L3IB 2N1KA 5ENWA 2B4CC 3IETA 1ZTXL 3D3VD 1J5OH 2HLAA 4ZPVA 4MS8C 4JRXD 3JV0A 4YHYB 4W70A 5DHXB 4YC2B 4BKLB 4QRSB 4AMKL 1XGTA 2VMFA 5EG6C 4J1UB 2VSDA 1Q38A 1KTDA 4PJ5B 2CK0H 2D9QB 3WFDH 3BPLB 4LCUB 3ARDC 1VGEL 1L7TL 3AAZA 4N8CL 3NFPB 3L3OB 1OSPH 3GRWL 3REWB 5LVEA 3X11B 3JV6A 4JKWA 4JREC 4ETQB 4F37F 3MRDB 2AK1H 4XPTH 1N6QL 1MWAB 1RIVH 3H7LA 4LSTL 3WDIA 4GRLA 5F21B 5DJ6B 4DKEH 3OG6B 4XZUB 4EI5D 3BPNC 3SBWC 5DA4A 4ONGL 1CFQB 5HDBE 5EUKB 3OKLB 4TVPD 4P2QA 1GGBH 2CUMA 5HHXH 2R15A 3O8XA 5TDOA 4JREB 4Z7VF 1RUQH 3SE3C 3L1OL 1O7VA 2K1MA 2BJMH 4DKEL 1TENA 2GY7B 3T4AA 4O2EB 2YC1B 3MJ7B 3OR6A 3MLTA 1QSEB 2ADJA 3NTCL 3L3DA 5GRZA 1MJJA 2WBJD 1UH4A 3G9VA 2EDRA 2Y5TA 3QUYA 1A7PL 3HE7B 2P49B 2Q8BH 2W65A 2ZCHH 2R39A 3GSUB 4QRPB 2P44B 3WV0A 2G75B 2XZCH 5CILL 5EOQH 1FO0H 2IBGA 5L8KB 1J8HE 3PHOA 4WU5B 3TBYA 1XEDA 3MV11 2P24A 4KJPC 1EEQA 3OAUH 4M8VA 4DGIH 4M1GH 2HA1A 3BMWA 4U6YB 1UJTA 3QFDB 2YWYA 1OAZH 5IFJB 5GIRA 3FO0L 5DF0A 1OP3K 4OFVA 3HNTH 1U3ZA 4QXWA 2UZIH 1BIHA 4XXCC 2DI7A 4NQEB 3D85A 4H1LG 4WV1B 3T3PF 3G04A 4K94L 4KMQA 1CD1A 4PY8I 4I0PD 3RVWC 4PJFF 1WWAX 4R26L 4L3CA 1LP9E 5E5RB 4U1KB 2B5IB 2D7MA 3MLVL 2ID5A 3SDXF 1NC2B 5EIQA 4Z5RA 4F8TA 5IQ9B 5D9SB 3FONA 1BQHG 3S5LA 5MHSE 4TSBH 1FQ9C 2J4WH 5H37H 5CEZD 5DR5H 1YQ2A 2AV7A 3X14B 4ELKB 1CFVH 3RA7H 3QEQE 4DZBB 1ADQH 1CG9B 1RFDH 3RWHB 1CZ8H 4MNQA 1CD0A 3ZKMC 4JB9H 4L1DA 4I2XE 1JRHH 5GZOC 5I1GL 2X89A 2VRAA 5IMOB 1JPSH 2F15A 1HQRA 2GK0B 3MOBH 3O3AA 1DQJA 1MY7A 1EHLH 3ROLB 4ZXBB 4PJHA 3MV7E 4NNPL 1CIDA 1T7YA 3TVMC 1NBQA 1OGAB 1JFQL 2E6QA 2DQIH 2VR5A 2ARWA 2A73B 5I1HH 1OTTC 1AJ7H 1Z3GH 3FQWB 3GGWA 3QAZB 4OCRH 4OKVA 3D25B 2XQBH 4HJGB 4LLYA 1T03H 4EUPB 1PLGL 1D9KB 4PBWD 1PFCA 4OGZA 4P46B 2AJYH 2FJFA 4NC2B 4WFED 1J9CT 4JDVA 5CEZH 1R3HB 1KJMA 3F58L 4PP1D 1KIRA 5T33L 4XPAL 4TTDC 5EOCL 4CL7A 4HULB 5FECA 1CD1B 1RZIA 1GC1C 4CVWA 1U3HB 4Y5YA 5DVMA 3BZ4A 2R2EB 1EGJA 3MRQA 1BM3L 4KTDH 4NUGL 5DMJB 1A8JH 3DX8A 1CXHA 4G6AD 5C0AA 1C5CH 5D1QA 3C6LB 5JOPD 3VDAA 4LL9A 3DGGB 2P24B 3ZTJG 3VGEA 1LDSA 1I7RB 5KSUA 4W68A 2FIRT 3ARWA 3ARFB 3MZTA 5IVXA 1DDHA 3BIKA 4YPGB 2Y36H 3TA3D 1UXSB 3CFIC 5FGBA 2AEQL 1QBMH 4KMTH 4KDTA 4J3UA 3RKPA 5CBEB 2EYTB 3RJDA 1AE6L 3ARVA 2X4RA 5E9DB 1RK0B 4JRYB 5KSBE 4DOHB 4X5XB 4XPBL 4FXKB 3RUGA 1FNEB 3HAEH 3MODL 2W1NA 3N1PC 3MYZA 3PGFL 4OAWA 4XHJC 4OF7A 4Y4KC 4FQJH 4RAVB 4LP4A 4R2GD 2SEBA 2EYTA 1PKQE 5I17A 5B38A 3V7MA 4QEGA 2J7LA 1YC7A 5HYSG 4U2ZA 3SE8L 4YDIL 5GZNC 1P4LA 4RQQA 1E28A 4AL8H 1NC4D 4M93C 15C8L 1MCSA 3ZYOA 2AJUH 1UT9A 5DD5L 4K3JH 4S1SL 3W39A 1G9NH 2FYYB 2DLFH 2KKQA 1N4XL 3OKDB 4PRNB 4X99A 4ZUWB 5BRZD 2Y06L 2H1PH 1GZQB 1P1ZA 3PGDA 1UVQB 3PIQA 4RGOH 5DT1L 1KTDB 2AJSL 2UVEA 1MRCL 3TYGH 5JPNA 3U1SH 5D2LB 3QQNA 4MA7L 4RZCB 1FGNL 4Y2DC 1YMHB 2AV7B 3DV4B 3MLYL 5HI4C 5F3HB 2ZSVA 5TF1H 3STBA 3S88H 2XRAH 1DQDH 3EO9L 4WUKL 5LAXA 1DSFH 3FB8A 3TO4B 4Z7WF 1CFNB 4BUGA 2COQA 4MJID 2PW1A 5HHOE 1G7MA 2DQTL 5DHYB 3ZTJH 3BQUA 2ZZUT 3CCHA 2L7UA 4MJIE 5BZDA 2A6KA 2A77L 5ALBH 5GGSY 4H0HB 3KYMA 2V2XB 1N64L 1JP5A 1KCKA 1CTOA 3B3IB 3O3BA 3O4OC 5K93A 1U93A 4HUUA 5IVZB 2W60B 5LQBL 3QQ9D 4OQTA 5DJ0B 1F11B 1HQRB 5KJRL 2HTLD 4LSQH 1OWRM 4HS8L 1IGMH 1CTNA 4QXGL 1HILA 2DLIA 4FABH 2WLZA 2ADFL 5ISZB 2Q20A 1B4JH 3N1FC 5SX4I 2IANB 3HZYB 3P30H 2CMRL 3HC4H 3VH8G 2VYRE 3NABL 1EJOL 5E8EB 3FOLA 2BFVL 3OKNA 4G6KL 4KTEL 4Y19B 1SY6L 3ZT5A 2DQFB 4TUOB 5EZIL 4XI5D 1AC6A 3IU4H 3CFCL 1I3RA 3CVHL 1K8DA 3WFHB 2HAZA 5CZXD 3GJFA 5F70A 3PGFH 1JHTB 3SE4A 4I18A 1JNHA 1S5HB 3TESA 1D6EA 4IRJD 2R9HC 4UIKL 4AQ1B 3T65B 1S7QB 4FG6D 1YEGH 4WUUD 3C60B 3KPLB 2IPTH 2DLHA 2HJKB 2MSPA 4U6YA 5D7IF 5DJAA 5INDB 3PP4L 1A6WL 5IV2B 2NXZB 1NFIB 1EFXA 5HHOD 43CAB 2DWEA 3QG6B 4HUXA 3VXNB 3HB3D 1CL7L 4RNRB 2CLZA 2NW3B 5C9KA 3IB4A 4Y4KB 3C9NB 3S3SA 1DQMH 3HPLA 4GMSL 3VFWA 2BY2A 4HWEH 3JUZA 3GO1L 5TF0A 3O3DB 3D3VA 4NBYB 5I1JH 3LN9A 5L9DL 4G43B 2ZSVB 4HG4J 4N0FB 4Q6IB 3QUKB 4G8GE 4X5WA 4P9HH 3CFKB 3OQ3B 3PDOB 5C0EA 4TSCL 3RZWA 1JF1A 5C08D 4ZTPH 5C0BB 5BRZE 4OGYL 1OT2A 4N1CA 1DBBL 1SEQH 3T0VA 5I0ZA 1MCEA 4FQPA 3GSNL 3LDBC 4LRIC 3FCTB 3CVIH 4WU7A 5E6IC 2YBRA 4E41B 1K4DA 2X4QA 3EIFA 3BRFA 2GKIA 1BJ1J 3ET9F 3WFEH 1FFRA 3FZUC 1A5FH 2Q6WB 5EZOH 4M7KL 4K3JL 3UTSB 5C0CE 3MV9D 1P4LB 4G6MH 1WCBB 5H2BA 1IAIH 2EICA 4FXGB 3C08H 3WS3B 1FNLA 1INDH 3BPCB 3MV01 3QDJD 1ZT1A 5GGTA 4M5ZH 3VXPA 3D0VA 1FNSL 3O8XD 3T1FB 4LSQL 3JXAA 4OF5A 1AHWC 3B2VH 5CMAB 4G7VL 4ZMAT 2BVEA 3BEWA 1XGTB 3TJHD 3UBXI 1P7QA 3GMRB 1KB5B 2UZYB 2HH0H 4JJHA 5INDA 3NCFB 4L4VB 4WO4C 3VGBA 2AAVA 2GT9B 2HLFD 1S9WB 3NFSH 4ISVB 3AGVA 1MI5E 3R8BB 4FHBD 1MCBA 3IAPA 1KELL 1X9QA 5JW5A 3L9RB 2EKSB 3ARDA 4KKCC 5ICYB 5E8NA 4XWOC 3K8LA 2X9XA 1JZ6A 1RZ7H 4D94A 4TUKH 1ODAA 4PP2A 4LPXA 1QOKA 2PTUA 4Q97A 4LVNC 1V7MH 3THML 2VXTL 1M6OA 1W2KT 5J7CC 4GRWB 3ZKQD 3L5WB 3LKQB 5EC2A 3MLZH 4I0PA 4XP1H 4YR6A 3S4SA 2V17L 5D7LA 3FJTA 4YFDB 5CJXA 1N3NA 3F7QA 1MREL 4QRTA 3VRLE 1I1AA 1FNHA 1S7RA 1EHNA 5D72L 1KN2H 3SKNB 5B22A 5T33H 3VGAB 3BD4A 2DIJA 3RVUD 1T5XB 4APQA 3MV7D 3LS4L 2ZSWB 3FT3B 5HYQA 1M05A 4R3SA 4EUPH 1M7IA 4NRZA 2HJFB 4GS7C 3D39A 4ZSOA 3RPIA 3BRDA 2X89D 4RGNB 3QIWB 4HDIB 4YHNA 1VADA 1FL3A 3T1WA 4LLWA 4PGBA 4QRQB 1MWAH 4NWTL 2OL3A 3GMLA 4U7SA 6FABH 1VB9A 1T1WA 3QHFL 4YBQC 5JIIA 5SX5K 3N0PB 1MFBL 4XMPH 4OZHE 1CFSA 1D9KD 3WUWB 1F90L 1T7WA 1YYML 5ANMA 3O45B 3K74B 4I3RL 3LV3B 3QXWA 4R7DB 4KMLB 3WUWA 5L0QC 2E6PA 4NQCA 1J7VR 4RIRB 1BZ9B 1V7NL 2DWEB 3QG6A 4HUXB 1RZJL 3SE9H 2OJZH 4MNGE 4JFHD 4ZDHB 1O0VA 2OTPA 3MX0A 2IQAA 4M3KB 4NNYA 1DR9A 2FHFA 4NZJA 1KJVA 5EO9A 4HUWB 4YHIB 2GK2A 3E1F1 3CLFH 1FJ1B 1ORSB 1A14H 5DD0L 3RP1A 2DM7A 3VXRE 3QUXA 2Z8RA 2YPKA 5I17B 5D6CA 4WNQB 1QNZH 4JPIA 1XAUA 3D2UA 4OLZH 3QPXL 1F58L 3BPOB 5DRXA 1VPOH 1NEZG 2NY5H 5FIEA 3GSRA 5GJSH 5C09D 4P57A 1RZGA 1MCFA 4ZFFB 4LMQE 3P77B 4Q2ZA 4ZFZB 2D7QA 1UB6A 5GS0C 3GSXA 2D7TH 5HDQL 1L7IH 1QSEA 2ADJB 4NN6C 5DZOA 5HYIA 1KEGL 4IMLB 4HPYL 1NLDL 3P73A 5BXFB 2FIKA 4HFWB 5GS1B 1ULVA 3ORJA 4S1DC 4QXGH 4P2YA 2F53E 5SWQB 1TITA 4PJCA 5IWLC 4JY5L 2FO4B 2MOVA 4QHNB 4X9BA 1HHHB 3MQIA 1NBZB 3O3UN 4WO4D 5F9WB 4FQLL 3UYRH 1NCBL 5IROA 3ZKNC 4N8VB 1JE6A 3KNBB 5SWSE 4XVJL 2J6EH 2Z9TA 1KEGH 3QDMD 3QHTC 5CD3B 4G9FD 4XNYL 3G5XA 3RAJH 1BHGA 3MACH 2NXYB 3MJ8B 3QDGB 4HJJL 1CF8L 4KDWA 1A1OA 3QJFB 2V7HB 1OSZB 2APXA 3MLRH 3NOIA 2RGSA 3FO1A 1L7TH 3MJ6A 2VDNH 2UZXB 3QCUL 1B4JL 4QKXB 4NJAL 5F9OH 1X5IA 2VLLB 2YUXA 2R4RL 1NFDA 4DGYL 4Y2DB 1BMGA 3BH9A 4MD4B 1IGML 1UZ8B 4HIEB 5I1CH 2V6HA 2ZG3A 3FHQA 2YD8A 4UOJA 1P1ZB 1QLFB 5DJ2B 4IOFD 4QYOA 1G7JA 1CK0L 2VC2H 3KYOA 4PJ5E 4AYFA 4RRPA 4U1GC 4EKXA 2X4QB 4JFXB 4AIZA 1KJ2B 1C7SA 2A0LD 2IQ9H 4S2SA 3U7WL 3ULVL 3WHXB 5KN5A 1YEEH 3B5HA 3S37L 3FB6B 4PJDB 4O58L 3WJLA 4XX1E 4Y8AA 3QXAA 4DEPC 5D2NB 5JDSA 2Y6SC 1INEH 2H41A 4L4VD 5F9WC 3LSOB 4LIQL 1TJHL 5L6YH 2FB4H 3PXJA 4YHPB 5HJ3B 4G3YH 4MNGB 4J3OC 1G6VK 2VLRB 1MQKL 4BSVB 1J0YA 1O7SA 1FRGH 3TN0A 4HZLB 4HKZB 4RFEB 1IAII 1X5GA 4ENEC 2WM0A 3ME0A 1UKTA 1R5VA 3O4OB 3QCVL 1EEZB 3SKOB 3FRPA 1GGYA 4BSJA 1YYMH 4NZUL 4MXQD 4XMPL 3SDCD 4Z6AT 5HGBA 1TJIH 2YUZA 3D5OF 3DRTB 4G8EA 3FOMA 4NQDE 3KPSD 1I7RA 5B4MD 1KG0A 5BVPL 4M4PA 4XGZA 3O2DL 3O41B 2NNAB 5ICYA 3U79A 1T2QL 1JGLL 2VZSA 3Q5YA 1R0AH 3E6HB 4EDWL 1U8OA 1J05B 5JORA 2HTKD 2QQLL 3MLZL 4BELD 5T3ZH 3VRLF 3DUUB 4MSWA 3EOBB 4Y8DC 4S10A 1M4KA 3M17B 1XCTA 4XCCH 3UAJC 2VOTA 4DVRL 5IVXE 2ZKHH 4NHUB 4G9DA 4JY6B 1V5JA 5JW3L 4U1LB 3AB0C 3WN5C 4KUCF 3K4DA 3X17A 1T89C 4LVNB 2YN5A 4YIQB 2FGWH 1SQ2N 5EU6D 5EU4B 4HMCA 5IB1A 3WFCL 5DWUL 3VG0H 4PLNC 2EYSA 1VESA 4LPUA 1QZ1A 4OD3H 2G2RB 3GMNA 3K8MA 2CRMA 1U0QA 5K9QG 1TPXB 1JPSL 2PCPA 3H2WA 2ESVE 1EERB 4HC1L 5F7WC 4Q6YA 3VRIB 1Q9WB 2J2ZA 3T3PE 1CGYA 4XH2B 2P5WE 4KK5C 5DLML 3EBAA 5F89A 1CGSL 3SDDA 1HINL 3QUMA 1YMHA 1CXLA 4MQ7A 2A9MH 4MD0B 4FP8L 4RDQF 3S35L 4IJ3B 4YQXL 5I8OH 4XMKH 4YZFF 3K1DA 2DS4A 4DGVL 2P45B 2AEPL 1IC7L 3MGAA 2BVOB 3L3JA 4JFEE 1RUKH 3NIFF 3X3FH 1OAQH 3HPLB 1G7IB 3QA3B 4PJDF 5GS0L 3VFRB 3R4DA 2EEBA 4YHYC 2JCCE 4ODUA 5JW5B 1M71B 5I16A 1JWUA 5DFVC 5KS9E 3FO0H 4U1JB 1T1YA 4YGVA 5FA4A 1FFPB 2WK2A 3PWPD 3ARDD 2IG2H 4HC1H 5GZOD 4M7KH 1B6UA 2L4OA 3OZ9H 3STLB 4WFHE 2WLYA 4Z95H 4Z8FH 1S7WB 3DLQR 3N1MC 3H0TB 3RUGB 1S78D 2JJTA 5KTEL 1MQKH 1GL4B 4XAKE 2FIKB 3LEYH 1YEFH 5BJTB 1EA9C 5K9OA 4LIQH 3GNMH 3FKUS 3L5HA 2DBLL 2JJUA 5BZWB 5C0AE 5GJTH 4QOKB 5GHWH 2HFFA 4BQBA 3GSOA 2VXVH 5GRXG 5AAWA 5D7LD 5HGHB 2FR4A 2R23B 3P77A 3R0MA 3BGFB 1CXFA 2JB5H 4H25A 3B9EA 3RGVD 1G6RH 1I1AD 2VZOA 3TZVA 1RURL 4FQIH 1O5DT 3HNSL 3V5KB 2IH1A 5I74C 4X4YB 3D0LB 4UB0L 1FZJB 4X6CF 1BFOB 3OMZA 1R5IA 2HG5B 4LKCB 4RGNE 4N0UB 3UTZA 1U9KA 3VE0A 5EOQL 1YN6B 1KPVB 4GRMA 3RL1B 2HT4D 2IPTL 4OZGE 1JGLH 1G7QA 2N56A 3EJYC 1J0ZA 1Q9LA 4P5MB 5KG9B 3L3HA 3SBWA 4WW2B 4P2QD 3KWWA 8FABB 4OJFL 4YWGH 4KTYA 1S5IL 2KDGA 5MI0C 3QCUH 1ZHNA 5I0DA 5C0ND 3MV8A 4RMRA 4NQCB 4PJCE 3FAXA 5CCKH 4BJLA 4MNQE 1MPAL 1A5FL 5KG9A 3BUYB 5I18H 3LQAH 3GMOA 3VFSA 3WDHA 3F5WA 3REVB 1KF9B 3QUYD 5CUSH 5EUOF 2V5MA 1DBMH 1DBAL 4NKQB 1U8OB 1OLZA 4KK6C 1C1EH 4UV7H 5IGXH 1AGBA 1R3JA 2GSIB 4I4WB 4KGLA 4WU7B 1UM6H 3E6FA 4GAJH 3CFBA 4NJAH 1LP9A 4IDJH 5D2NC 1YMMA 3JWOH 3FOMB 1U8JB 4JFZL 4TUOA 3P9LB 4HUMB 1P6FA 1B0GA 4K7PL 3ROOA 1J87A 3QIUD 2I9TA 4PJIE 4JZJC 2WUCH 5EH1A 3LS5H 4QHKJ 3ULVC 1BFTA 3CSBA 4HW6A 2VZTA 5J3HD 4UMGA 3B83A 2GJZB 4X7TA 4JRYE 1HSBB 4MXVE 1XF4A 2G5BA 3DMMB 4GMTH 4Z0BH 3TJEH 1HE7A 4LVOC 1OP3H 4ZOCA 3WKNA 1T0NB 4UT7H 5KSVB 3ULUC 4GG6A 4IIQB 2R2BB 3FN0L 1AD9B 1ZT4A 1DEEA 2IFGA 1QSED 4AK1A 4F7MA 1NJ9B 1T1YB 4YGVB 4HAFA 4NZRL 1S7QA 5CEZL 4KQ3H 4J2XA 3F65A 4J7RA 4MNQD 4KJWC 4O00A 3HPJB 1YEKL 4J6RL 2NY1B 4TULL 3S3PA 5AZEL 5BZDB 5GSVB 2J5LB 5DURB 2DQIL 2BFVH 1NGQL 1HI6B 4PB9H 4DOHE 2ORBH 1WZ1L 2H2PC 4RCAA 1A47A 4RMWA 4HJ0C 3V8CA 3ZDZF 1QQDB 3AMKA 4G9FA 2IANA 1CGSH 4P4KB 2XA8L 3HZVA 1P4BH 4H1LH 4M62L 4NBXB 3O2VL 5EWIH 1NEUA 5J11B 1CVSC 4PGBB 4LRIA 1U92A 2FJFB 2DJSA 1L0XA 3CU7A 3L7FB 1BVLB 3WLWD 4EQ3A 1P2CA 1YNKL 2R8SH 5L7XL 5D7LE 3SGDH 1UEMA 2R29H 3I02A 2ZSWA 3FT3A 4LRNL 5FFLA 5C0AD 3RL2A 2EYSB 3TCLA 2I60H 2AJZA 1H8NA 3DIFA 4OFKA 3H42H 1NBZA 2YA2A 1S7SB 4S0SD 1YY8A 1ZVSA 1FIEA 1LE9B 4Q9BA 2NY2D 1IC4H 5HPOA 2GHWB 4PJ7E 1ZEAH 5GGVL 1RJYA 3CLFL 6FABL 4JFPB 2ILLA 4L3EB 2QKIB 1J18A 1UJ3B 4B53A 4XAWH 3RVTC 4H26A 3WCYA 3KJ4C 4MLIA 4DZ8B 3Q5TA 1NC2A 3DI3B 3QIWD 1MIEL 5HVFB 3GSNA 4UTBH 5IEKA 1JK8B 3LZFL 1AGCA 3UZVB 4EOWL 3OB0H 4FA8A 4JZNB 5I1GH 1IL1A 1JHLH 1ZHLA 1QLRA 4OCSL 4P49A 5CINL 2YSSB 5FYJE 1NC4A 2DF3A 4NJ9H 1JCKA 1ZWIA 4D9LL 1CDCA 2OSLA 3ZE0E 1MCRA 1J8KA 2ZUWA 1IKNA 2Z35A 5CP3H 2XN9E 2EIBA 2EYRB 4ODXB 5HDOA 5JOFB 1KIRB 4Y4FC 5DMKB 5CGTA 4PJXE 3BUTA 1FZOA 1WV7T 3QXAB 4P5TB 4CADB 3IFLH 1E27B 4K94H 3FB6A 4ETYA 1J0HA 3HUJB 4OSUL 5DUBB 3EZ8A 3GMQA 4NM8L 2RCSH 1HCVA 4NJ9L 4N0YL 1LEGA 4XRCB 3Q3GA 3U4EA 3S36X 1WISA 1RZKC 4X6BB 5T1MB 1OAUH 1AY1H 4LAJH 1H0DB 3IS1X 4F7EA 3GMNB 3QEHB 3LVEA 1J0IA 4Z7WA 3TH4T 3E2HB 4HLJA 4CVZA 5C0JA 4Y2DA 5KBNC 1OAQL 5ICXB 1Q1JH 2YEZB 4D9RD 5DFVD 2VABA 3H9SE 5F7MC 5HYJB 5DJDA 4WFFD 4WY7L 2PKDA 3OSKA 3DWTA 4RAUA 3AAZB 1A1OB 1LNUA 4GBXD 3QXUA 1NDGB 1VA9A 2BY3A 5EU3A 4QRTB 1VGKA 3SDDD 3BIAX 2BCKB 4MDJB 3EGSB 4YR6B 3S4SB 3B4NA 4UOW1 2NX5A 2X4PB 4G42B 3B2UC 2KPNA 3T8XA 2APTA 4NT6B 4ZTPL 5K33A 3QULB 1XR8B 5L7XH 3VG9C 2GK0A 1ZXQA 2W38A 3BE1L 5HSFA 3LIZL 3VG0L 4OTXL 1XF5A 5MEOA 2IH1B 1FDLL 1LO0L 4FZEL 5DJZA 4ZAKC 3NA4A 3GO1H 4HK0A 5EO1A 4GXVH 2X4UB 2NQCA 1JGUL 3GMQB 3FOLB 5FGBC 2QSCH 3GSXB 3V0WL 4HBCH 5LGJA 3PHQA 3T04D 4NQDA 5AD0B 1AQDB 3WS6A 4LBEA 3MJ7A 4L8DB 4L29A 2DKMA 3OB0K 2XTJD 4ZOEA 4C59B 5EBWB 1YPZE 4HGWA 5DHVA 2FWOB 2F74B 3MGTA 3K4AA 3LKOB 3QFJA 5EBMB 5J6HB 4OZ4A 2QQLH 4HSQA 1WC7B 3SDAB 3ILPB 5D1QC 1L0QA 1RK0A 3W11D 1MJ8H 5CJBA 1DQQA 4L8DA 4LBEB 2CJUL 5KJRH 1AGEA 3QQ9C 3MREB 3I85A 4XP9H 2EH7L 4JHWL 5C08A 3M1BA 5HDBF 1DVFA 3L6FB 4JKPL 3SY0A 5FUCE 1UC6A 4ZAKD 3CCHB 3VG9B 1L0YA 2WBJC 3WIHA 4OZIF 1RULL 4JDTL 1T6VN 1INQB 4AENA 4OIBA 4DJMA 5HI3C 3FB8B 3TO4A 3FT2A 4OLYH 4R7DA 3ABZA 1B3JA 3T0AA 3L1OH 1PEWA 2X7LA 3FL7A 4D9QE 4Z7OE 3V8OA 2VE6A 2HFEB 3DX9B 3HZVB 3QUKA 3JTSA 3FFDB 4YGAB 3MRIB 4ONGH 4GXUM 2HVJA 3A67L 4BSWA 3OKMB 1SEBB 2OL3B 3GMLB 3DVNB 2D0GA 4K7PY 4POZC 2I9LA 3MV8D 3PWUB 1F4HA 2CIIB 4KI5E 4HQQH 4JZJB 2IAMB 4OKVB 4X6FB 3DX7A 1IGJA 3D39B 1GIGL 2YHGA 5ESQB 3TH2T 5I19H 5L88L 3U0TB 3ULUF 1E28B 4ETQA 2D7TL 5HDQH 1A6AB 5KTEH 1QHPA 1X4ZA 4OCXL 2CKBA 4N0CD 4UNTA 4ZTOH 2CDFB 1ZHKB 3BN3B 5E56A 1Z6JT 5M7QA 2PW2A 1JNHB 1S5HA 3BHBA 2VDPL 3RBSA 4OF0A 2DN7A 1WUNT 1ZEAL 3CK0L 4HIIA 4OZFH 5A16B 4GG6B 1HH9B 1MOEA 2RHEA 3H8NA 5D7IA 5D70L 3TBVA 2VDQH 1T66C 5LQBH 1JGDA 4HCRH 4GRWH 4XP1L 3QIUA 1RURH 5IB4A 3WDJA 3DSFH 4OJFH 4YXLH 1IAKB 2ZG2A 3KPNB 3T0ED 1Q72L 2APFA 5I30L 2KQNA 3OL2A 4QRRD 4OZIB 1REIA 2H2PD 3WBDA 3X3FL 2VZUA 1QA9A 3FQTA 3RVXC 3KPNA 3RAJL 3Q48A 1OL0A 3UTTD 4GKNB 2YR3A 3V5DB 1HWGB 3HZKB 1VSCA 4S1RL 3E8UH 1KBGL 1T22B 4Y19E 3UO1H 1Q9KA 5CIPH 1ORSA 3H9HA 4IOFC 1H9VA 1H3VA 5CKAA 4AY0A 4L8SB 4XP6H 3NA9L 3SE3A 1JNNL 2W0KA 4X5LA 2R2BA 4P46C 1B88A 5F8QC 5H35A 3O8XC 4K9EL 5GXBB 3MRJA 3V6OE 3GIZH 4PGZA 4BFGA 4JDVB 3MV8B 4G8GB 4NFCA 5EOCJ 5IOPB 3UTQA 1D9KA 2GJZA 4XP5H 3RHWK 1X5HA 4ODBD 4WO4B 4Z7NE 1JZ2A 4PRDB 2H6PA 1CXEA 2P5WA 4LCIH 3JTSB 2EH7H 2B39A 5ERWB 3ARFD 3GBNH 3HC3L 2AJVL 4NZTH 1F2XK 1AH1A 3UTSA 2FBOJ 3K2UL 4P23A 3N85H 3QIUB 5IB4B 3ZKSD 4L3EA 3I75B 5K9JL 1HH9A 1J11A 1KTRL 2AK4A 2FX7L 3EKCA 3V4VL 1KFAH 3PNWA 4G6JL 5EC1B 5FM8A 5KVMC 5EPMA 1YMME 2D9CA 3FCTA 5FUCC 2QHRL 1NLBH 1U3HD 2GI7A 4FFZL 5KOMC 3QZWA 2ED8A 4XCYB 1EK3A 1CFBA 4CDGC 2Q8AH 4LCIL 2GSGB 5J1TC 5IR1B 4FQ1H 5FV2A 2ZUVA 4JPKH 2BXZA 3EJZC 2IBBA 3PL6C 2PYFB 3SGEI 2EECA 4KU1A 5FHAH 2XKNB 1TVHA 1NMAH 2ICCA 3O3DA 4WEMB 3WL9B 3QJFA 1F90H 4IMKA 2Z4QB 4MS8D 4QF1B 4YDJB 1Q9LB 4P5MA 4WV1A 5MERB 3ULVF 2OR8A 4LKXA 5IV2A 2BVUA 1MWAL 4NWTH 5IBLD 4D0DB 3HE7D 3RIAK 1NGQH 1W8OA 5T5NF 2H8PA 1F6FB 4N68A 4GQ9H 4ZOAA 1FZMB 2IGFL 1GZPA 3E6HA 1UWXH 1OQXA 5HPMB 1RVFL 4WEUD 3O2DH 1RJZA 2H2SC 4PJBB 4OUUA 5E2JA 3F12B 3IDJB 1X44A 3RU8L 1TZGL 3HR5A 1AGDA 1JIBA 2OBGA 3SGKA 2XZQH 4MCYB 1QSFA 1QFWH 1I9JH 1KOAA 2IPUK 4UINH 3R1GL 2AKRB 3DSFL 1C5BL 4EZMA 5IB3B 3FB5B 3BPNB 5CMAA 3P0VH 1ERNA 4F3FB 4OZ4B 5MEPA 3H9SA 5TGBB 1PZ5A 4Y1AB 5JLZB 1TLKA 3RIAF 1DBBH 1MHEB 1SEQL 5HHXL 1FLRL 4R0LC 1ZV5A 4EUPA 1OY3B 5HHMD 4CJ0A 3RNQA 5LXGH 4W6YB 4C55A 4EI6B 1UWXK 2AJ3B 3TPUA 5IR1A 4JO1H 3C5ZC 3RL2B 3TCLB 3MLXL 2VAJA 5DRNB 5AYUL 5GS2D 4HLZG 4PY7A 2IQAB 3EOTL 2VB5A 4LLUA 1ZA6A 4PJ9B 4EDXB 1W0VB 3ULVH 4MB4A 4MAYD 1OW0C 2AXHA 1WT5A 5EC1A 4RBPK 3P4MA 2R8SL 4LCUA 4BZ1H 3OKOA 5IMLA 3GJEA 5A2JH 5E2WH 5T3XL 3FTGA 1OAYL 1NL0L 3OKMA 3LHPL 5DDHB 2XT1B 3FFCA 4P3DA 5DEFB 3HI5H 1U8KB 1SJXA 3TFKD 3CFKA 3PDOA 1MPAH 2ZCKH 2APVA 5J89A 1G6RA 4TRPL 3GMOB 5JUEL 3VFSB 4DGIL 1JHLL 3PQYA 2BCKA 1B4RA 5DT1H 12E8H 1AKJD 5B8CC 4AT6A 5F1NB 3FFCB 4P3DB 2VDNL 3CPLB 3W39B 1IAIL 2PYEE 4ZPTB 5BO1H 5KSBF 1YQVL 5I66A 1RK1A 1MJUL 3WE6B 2W9LA 5KVFL 1VADB 4JFDA 5CSGA 4HFUH 2CLVA 1AP2B 4ZSOB 4WW2C 5L2KE 4OF6A 3RTQD 2IC2A 4X6CE 3FAWA 3QPXH 4TRPH 1A7RL 1J8HB 1W0WA 3UEZA 5T1DL 4K71C 4YO0A 1DLHA 3VXSB 3LKSB 4K94C 3TYFA 4NOFA 4OGYH 5D7JC 5I1KL 1F5WA 1TVBA 4C56A 3DHJA 1DZBA 3WFHA 4DK6A 4NC0B 3VGGA 4WU5A 4OIIH 3QCTL 5DUMH 4HWBA 5DVLA 5SWQA 2B0SL 1H8SA 4O4YL 5CZVH 5GHWL 4H25B 3MRBB 4FQHB 3KPRA 3HUJA 5FYKE 1IBGH 3SN6N 5ID1A 4OZIA 4ORGB 5HHQA 1I7TA 3QPQC 2W59A 2PO6B 4ZUVA 1DDHB 3WKMH 4QXUH 1B2WH 4GW4A 4M93B 5GGVY 1UADC 1T0PB 1WCQA 3OTTA 4P3CL 3RGHA 4JRXA 5J1AA 1HHGB 3NCJL 4NQXA 1KJ2A 5DD1L 4OLEA 1RUPL 2C7UA 1JWMB 2KBGA 1FORL 2PTTB 3QUZA 3QXDA 5IBUB 4FFYL 3TT1H 3ARGB 3ZDYE 3P9MB 1UWGL 5IMMB 1B0RA 1QLFA 1FAIH 2DQJH 5FYLD 3CVHH 4WFFE 4WIQA 1A4JB 1I9JL 5GS0H 3LEXB 2XQYK 1FG9C 4I0KA 3KYNB 3DX7B 3TJHC 2LAAA 1P7KA 4U6HB 5J0BA 1AI1H 3DI2B 2NX5E 1EJOH 2VISB 3NPZB 5SWSB 4WW1A 4XTRD 1TVHB 4BSWB 2E27H 1DQLL 1X7QB 2VNCA 3PJSA 1QFWI 4JKMA 4UDUA 3H6JA 1Z9LA 5JUEH 3LAFA 4JFFA 4NM4L 1UYWL 3MUJA 2XYCA 3KPMA 5IMLB 1F4XL 5I75C 2O61A 4X6BA 5T1MA 3ZKXC 3MOAH 4QYOB 1GOGA 5CJQH 5TE4L 3NBNA 5DWUH 4YX2H 5HYJE 4PGDB 5HGAB 3FT4B 2BC4A 3GK8L 3IKKA 3P73B 1WWBX 4JY4A 1RZKH 3NZ8A 4QHUB 3WSQH 1IVLA 4PJIB 1UFUA 4ZXBC 3LS4H 4Z7UB 3WO4B 3RGVC 1RAMA 2X2YA 4P4RA 4BFBD 4HS6B 4ODSL 1X5YA 4AEIH 5KANG 4NRXB 4KKAD 5JNYB 3WIIL 4D0CA 2PYEB 2IWGA 4HKBA 4R26H 1X6LA 2IMMA 2O5ZH 1LO4L 2EDKA 3UTPE 1CDGA 3CD4A 5J8OA 4NO3A 4MYWB 4K3GA 5D2LF 3TV3H 1PG7X 3U7YH 1QFUL 4WCYL 4LSRH 1WGOA 1T2JA 4AH2B 4U3HA 5DI8B 1CLZH 1G7HA 3Q5OA 4HUVA 2Q1EA 5MEQB 5BVPH 1YEJH 2OS7A 3GMMB 2Y07H 4AL8L 3SQBA 1WSST 1QSZA 3C2SA 1CLCA 2ZG1A 3IDIA 5A2KH 4YNYA 4OV5A 3I6LE 5CILH 1EMTH 2EEDA 1MCQA 2KH2B 3E6FB 3KVQA 3VFNB 3C6LC 1J1PL 2YN3A 2ENSA 3CC5B 3GI9L 1RSFA 2YA1A 2LQRA 3MBXH 3GKWL 4KI5D 4TPRH 2XTJB 1WWWX 1NAMA 5FYJL 5CP7B 2DIAA 2DM2A 2VXSH 3CUPA 4NDMA 3SO5A 1G9NC 4ZFZA 2NYYC 3OJDA 5TH2A 3RIFF 3SDDB 3ZE1F 3NIGF 4N8VG 4Z76A 4RRPG 4UB0H 4PJHF 5JOEA 3S98A 1L9MA 4LSVL 5JW4N 5F7DB 2HVKA 2Y6SD 2VLJE 4D0CB 4QHLA 2X4NB 4LOUC 3CAFA 1YEHL 3VXPB 4EOWH 1PAMA 4XZUA 4YXKH 1MFEL 4G80A 4DEPB 5J6GA 2A6IB 3PGCB 1MFCL 3O6MH 1YEFL 1FGVH 4LVHB 1C5CL 1GRWA 3V6ZA 2Q6WA 1U92B 3G6JF 3DRQB 3RRQA 2ATPA 4XHJD 5BS0B 2ADIA 5ALCH 4LVEA 3ZE0F 1F2QA 4H20L 2FRGP 5FYLL 3RWCA 3PDGA 4Y5VC 5B39B 5DJ2A 2AABH 5D1QD 2FZ3B 3VD9A 4DGYH 1IILE 5C0CD 1IGFL 1LO2L 2GIYA 2ZP0T 3DX9A 3KPPA 5C0EB 3MNZB 4XNUL 1BVKA 3L3IA 4OCXH 4R2GB 4O2FA 5DQJB 2BNRB 3N9GL 4F58H 1D5IL 3DSNA 3QWQB 1NGPL 1KB5H 5ANME 5BJTA 3O41A 4HUNB 2R2CA 1MF2H 4G7YH 25C8L 4N1EA 1JFQH 4AZ8A 5I1EH 2OQJB 4ZFGL 1KXTB 4KZEH 3EYQC 4XNMB 1CL7H 3CVIL 4LASL 1YN6A 4W6XB 2VDML 1JV5B 1URLA 4JHZA 4KJYA 3TT1L 2F8OA 4G8FB 1NJ9A 1L4IA 1VACB 1N59B 3QFDA 1B0RB 1QP1A 4D9QD 5ETUB 4NFDA 1DQQB 3VXRA 4OM1H 1MFBH 3AU1A 1NCCL 5FKPB 4KKLC 2YD5A 5D6DC 3DVGA 3EJZD 4P4KD 3TZVB 1A4KB 4OZFG 3MRNB 1MI5B 4NO2A 1Z2KA 2X70B 2RJMA 4ZO8A 5IKCA 3MO1A 2P8PB 2XTLA 4R6UA 2IAND 2VZVA 4U1SB 4GBXC 1TXKA 4P59H 3HAEG 4PRIE 5HHQB 1U6AL 1B9ZA 3MRPB 3BVNB 3VFPA 3JZ7A 1E4KC 4Q9QH 5CHNA 3TVMD 2LFGA 3KPRB 1UACL 3G5YA 4NO2B 3ZT6A 3H9SD 3BIKB 4U1GB 1F4YL 5E8NB 4D9RE 2R0ZH 3JV4A 5J1SC 1CFQA 4IOIA 2NY6B 2W91A 1BZ7A 4XCCL 2O61B 2BMKA 2D03L 1BZQK 1Y18B 1QPXA 1UACH 3M45A 4PJGA 1FSKB 3LCYA 2OTUA 3RI5F 2HKHH 4MJIA 1Q9OA 4GMTL 3TJEL 5ITFA 5GGRA 4JM4L 3LQAL 3BQUD 2GJ6E 4NKIH 1H3TA 1C16A 2MCPH 3PWJA 2CD0A 4ZQKB 4ALAL 2BNQD 4FQCL 1FGVL 3BGFC 1V7ML 3THMH 1WJ3A 4YIQA 5ACMA 2HFTA 4FNLL 1RIUH 4HMDA 1F4YH 1N7ML 1S5IH 2ADFH 1OSZA 2GAZB 3BP5B 4L5FH 4GFTB 1ED3B 4PJFB 4XNQA 5I8KL 4Z7WE 2R4SH 2X5PA 3MRRB 1U8NA 4Z7VB 2OL3H 4PGJA 4YDLB 1U42A 5E8PB 4HWZB 5ENWB 5TE6L 4HIJA 2E7LC 5IB2A 3VWKA 4WTWA 3MBEC 4GKOA 2Q87A 3C2AH 5F7KC 3B9KA 2KL6A 4AIOA 5FYJH 2ADIB 1A64A 1QHOA 1LK2A 4TNWK 1YN7A 1KG0B 3BMVA 1IM3B 5D7JA 1NGZB 3RVWD 3QNXB 2VR4A 5DK0B 2AEIT 2R23A 3HMXH 3OX8A 2Y72A 1OTSC 5J6GB 1VGEH 2CSPA 2E9WA 4N0RA 1RIUL 1NPUA 5E8EA 4FQHA 1AD0A 1SMOA 4WUUA 4QOKD 3OF6A 1RUKL 4G9DB 1MF2L 1K6QL 1C12A 4NO3B 1AR2A 4YHPA 5HJ3A 1BJ8A 3TO2B 3U30C 1EFXD 5FCUH 2H32A 1QLEH 3S96B 4G8FA 4YHIA 1IGFH 2FGZA 3SDXA 3U9PL 3MR9A 1RZ7L 5HBBA 3P9LA 1T5WA 4MHHG 1GCFA 2AJXH 1SVCP 1H3UA 4M6NH 3BP6A 4KK6D 5EZJB 3S36L 3VWJB 3DUSA 1B90A 4PB0H 2G75A 3QNYA 3KLHD 5T3ZE 2HT2C 1NBYA 2LTQB 4R97C 4X9HA 1P53A 4KRPD 3FO9B 2BDNL 4HWZA 1TNNA 2XNAB 4IRSD 3X13A 4X4XB 4CNIB 1JZ8A 3NN8B 1EUUA 3C5ZA 1D5XB 4ODHH 4V1DD 1EHXA 1Z0MA 3NIFE 2B1HL 2FEEI 2IADA 4XVTH 3QBTB 1WVZA 1T1WB 1HHKA 1LO5A 5EU6E 1BX2A 5KS9F 5A3ID 5BOPA 4ODVL 1KLGA 4LDLB 3T08A 2IH3B 3C08L 2D4FA 3AXLA 2WANA 1S7TA 2DQCL 3GFUA 1MIEH 2QEJA 1ZK9A 2EC9U 4MA8H 4TOYL 4F7PB 4RSVA 4OI7A 2A73A 1CDYA 5EU4A 4CVZB 2YKLH 1T20A 3W9DB 1NCDH 2Y9RT 3GSQA 1UQSB 4PTTB 4NNPH 4F7PA 1J1PH 3RNQB 1BEYH 4MXWH 5E1HB 1DQJB 1MRFH 3D9AL 2BNRD 4HCRL 5I73B 5DQDL 1QYGH 1I1AB 1K4CA 3PV6B 4YHOH 1QSEE 1OP5K 1GGTA 3KPMB 4R0LB 1MH5B 4GOSA 3UTTB 1MLCA 4HH9B 4O5LL 4NQDD 5L9DH 3RWGB 1I7TB 4E42A 1JI2A 1NKOA 4TSBL 3CGTA 3QFJD 3HG1E 4X83A 4K9EH 1G0XA 4ONOA 4OGXH 3GSVA 1ZLSH 4LCYA 3EJJX 3GMMA 4E9LA 1Q72H 3IFNL 3IS0X 2MKLC 4X7FC 1P9MC 1IFHL 4NQSA 4PJGF 3MREA 3U7WH 2EE3A 1QLRB 4BZYA 4YX2L 3IXTA 3VI4F 3O9WB 2CLVB 32C2A 1FZKA 5KSVA 2QQKH 2JK5A 1K2DA 3MJ9A 1II4E 5DZLA 1KLUB 1SJEB 1E6OL 2GY5A 4H26B 43C9A 5EN2B 2DQJL 4PS4L 3U4BH 2ITDA 2MTPA 1KXQE 5EPMB 3VXUE 3EYOA 5FO7A 4WV1C 2VDPH 1RJYB 4YC2C 5JA9A 1IQDA 1T66D 3CFDA 3CH1B 3ISWA 4K9EC 3F7VA 3O2WH 4NOBA 3W9DA 3P11H 4HIEA 4CKVX 4OBSA 4JO3H 3MZGB 2HRLA 1HIML 3L7FA 3QDME 5CKGA 1NUGA 5JW4R 1G6RL 3NCBB 1P2CB 4K07A 5TFSL 4KJQD 1ZSDB 5AYQA 4NKMB 3KPQB 4HIXL 2Z8SA 4U0QB 5F1KC 2G60L 4J3WA 1RZKL 4RIRA 3L5JA 4FMKA 2VL5A 1GGBL 4M9OA 5LGHH 4PTUB 2YMXL 4AEFA 3GNML 5KVDH 5FYKH 3T0EA 5E1AA 1ZGLA 5BMFL 4L3EE 4NKDA 1WITA 3HG1B 4CNIA 1FL5B 4M03A 4FFVC 3A6OA 3RL1A 4KKNA 3JSSA 3HE6A 5BVJA 3MRFB 1BJMA 4U05A 5GGUB 3L5XL 1ZLUK 4OGAD 5FO9B 1TZHA 3IDUA 5I2IA 3BEVA 3BYTA 2WAHA 4U6XB 1E0OB 1U58A 5DK3A 3GHEH 1BAFL 3ZDXE 4KUZL 4CU7A 3I50L 5GRUH 3VXUD 5TQ2L 1OT1A 1EEZA 3CDCA 4MZ3A 2A1WL 4XBEL 1UB6B 4NKIL 3VXRD 5L0QB 2Y23A 4HFUL 2MHAA 1I85C 1RZJH 2VTFA 1LHZA 4KAQH 4RGND 3NABH 2HMIC 2YRZA 3S35H 1H8OA 2V5TA 4JPIB 3OXRB 1JN6B 1QRND 2D7PA 3WL9A 5TPWH 2PN5A 4BZ2L 2FEDC 2BVQB 2YD3A 3L5WA 3LKQA 4NRXA 1A14L 3STLA 5IB5A 3VJ6B 5CBEA 2PTVA 4BK5A 2I9TB 2CDFA 2ZCKL 2CIKB 2CLRB 4I48A 4N0YH 2IEPA 4L3ED 4A2MA 1P5UA 2GJ6B 3U0TA 3HNVL 4ONHA 3IDJA 2QSTA 2OMBA 3QG7L 1JUFA 4X6FA 5E2WL 5DVOA 4PLJC 5KANI 3SKMB 2AVGA 5F88B 1MY5A 2R69H 2NMSA 3CSGA 1TZHB 1KB5L 4KK8D 3QCTH 5DUML 4NUJA 3MLTB 4OZHB 5C86A 1P7QB 4MD0A 4G5ZH 2FD6L 3PJSB 4D9LH 1WWCA 3QHFH 5E2UL 3TA3A 3IETB 4QT5A 2FJGA 4LCWA 1VFBB 1PLGH 1T7XA 1VFAA 1VKXB 3HMWL 1CXIA 2NW3A 4OCNC 4GQ9L 1T21A 1DEDA 4PY7B 1GXEA 3O6FB 2DKSA 1WCBA 3VH8B 3FQXB 1TTFA 1FVCB 2XZQL 2DICA 2UUDH 4XXDA 1T21B 1V3LA 4YXKL 4WGVB 3QI9C 5MEND 2NW2A 1PY9A 4GKSA 4PJXF 1ADQA 5ICZA 5B39G 3ULUH 1N0XL 3W0WD 5DRZB 3OXSB 4P9MH 3HI5L 2EDHA 3GSWB 3ES6B 2F8XC 1MRDH 1U8IA 4KJQC 2OJEB 4PB0L 1NAMB 4HT1H 4WWID 3UTQB 2O93L 5FKAA 4PG9B 1YNKH 5K9OB 3GRWH 1T6WA 2C3HA 2YXFA 1RHHA 2ADGB 1LWRA 2YZ8A 4QLRA 1I8KB 1T83A 3MRGA 1SYSB 3QUYC 2VXUL 4YO0B 1IEBB 5TE4H 4PJBE 1GHFH 5C6WH 5EWIL 1DP0A 4KJYB 4LU5H 5C9JA 3RIFK 2VLMD 4LNVA 1QYGL 5D7KE 1U95B 3QA3A 3MRGB 1CL7I 1XGUB 5JMOC 1CBVL 4N0CC 2J88L 4QTHB 1MFNA 3P40A 3UC0H 4NRYB 4WFGD 5FM5M 4ZS7H 3D0VB 3K3QA 3QQ4A 2VIRA 3NTCH 1S9YB 3B43A 2XXMB 1E4WH 3JWNC 4JPVL 4QOKE 4V1DA 2A6DB 1G9ML 5D2LE 3DTXA 3U4AA 4KQ4H 3TT3H 3GKZA 3I3DA 3QCVH 3GSWA 4JVWA 3WNNA 4BH8A 4X7SH 3U0WH 5IJKC 2R1WA 3LKRA 3ZYZA 2J6EA 4X7EC 3FTGB 1K4CB 3PV6A 3DRQA 2D4DA 1MFAL 4CMHB 1EHLL 4JGMA 5CJOL 1NSNH 1F02I 3KPTA 3HI6L 4KRLB 3MLUH 3UX9B 4OI8A 3RTQA 1PKQA 2CKBB 5GRVL 1I75A 2HJFA 5D93C 1XZ0A 3K7UA 4YDKL 5EO0A 3WFCH 3OBAA 4NKDB 3LS5L 4MNHB 3LQAC 4DW2H 5KSBA 3BKCH 2EZ0D 4LAQH 4M02A 5BS0E 2FL5A 2JJWA 1QRKA 1NQBA 6CGTA 4LLDB 1KJ2L 2Q8AL 3RZCC 3O2VH 3NIGE 2ZUTA 4YZFE 1IKFH 4KI5C 3KPRD 4OD1L 4JG0H 5JQ6H 4PJHE 3M17A 3LKOA 5EBMA 3D85B 1UKQA 5HVWA 4Z18A 4UV7L 1ZTXH 4U6VL 3SCMA 1U41A 2UYLB 3BN9C 5KS9B 1KACB 3VGDA 5CD3A 4Y4FB 2M26A 4X4XA 4OZIE 5AD0A 4YBHA 1AXTH 3HI1B 3RVVC 4D3CL 5DD3H 2V9QA 5C2BL 3I6GB 1UEYA 3QR2A 4I5BA 2FYYA 1BVZA 3V5DA 4CBPA 4U0RB 3DUSB 3V7AE 3IU4L 4Z7OF 3QUZD 4NHCH 1IMHC 4D8PB 1T80A 4NQXB 2GW5A 3MV9B 2DTML 4MMXC 4DZ8A 1IKNC 1M7XA 5EN2A 1B2WL 5FO8A 3BYYA 1DE4B 4NGHL 3HC4L 5SWSD 1QFPA 4DN3L 2YPVL 4YE4L 3C8KB 8CGTA 4XPFL 3CX2A 4ZAKB 3H3KA 2Z4QA 4U1NB 3A6CH 4ZFOA 5J6HA 1DFBH 3B2UD 4NGHH 3ZYJA 2XZAH 5KVDL 3WS3A 3QDJA 4O9HL 5I1KH 3V0AC 3W5MA 4FFVD 4MCZB 4FXGA 4JAMA 1QUNA 3U9UB 5C8JB 1NCAL 4QWWC 1J8HA 1W0WB 4CU6A 4HAGA 3GSQB 1FV1A 5B8CA 4UUJA 4LSTH 1TCMA 1KSRA 2OP4H 2VDLH 2QR0B 3P9WB 1P7QD 5E2TL 4YWGL 1G9NL 4DFHA 1LEIB 4PV8B 5AYUH 3NCCB 2EDJA 1KLGB 3SGJC 2ESVB 2H32H 1XR8A 2A38A 3DX8B 4GAYA 4HS3B 1G7PB 3MRFA 1XF3B 3B9KB 1JZ5A 4YBLB 5EIIB 3DXAA 4HBCL 4RZCA 4JHWH 1AIFA 1WT5C 4NP4L 2DJUA 5EA0H 3NN8A 4GG6F 1RV6X 3QPQD 2VQTA 5AUMA 3JBG7 1K8IA 3MRCA 4DW2L 1JRHI 4P4KC 4BQ9A 3VW3H 1FBIL 2VIRB 1N64H 4NQVB 2X1PA 3GHEL 4UDTB 4JR9L 4P0DA 3SDCC 3HMXA 3P0YL 3QDGA 3QDMB 2DQUL 5F6IC 4FG6C 3BSZL 2VITA 5E4IA 3MLUL 2OP4L 2VDLL 5ICXA 2DQTH 3SOBH 1WICA 1JYNA 4R2GC 2O5YH 3DOSA 1Q9OB 2C3XA 1DQDL 1A6VL 3V7AG 4FQJL 1I9IL 4PUBH 3IDMB 1IT9H 1NUDA 4UV4L 4APQD 1JPFB 3LN4B 3RVUC 5F1OB 1AGCB 4NHUA 3OR7A 2X1WL 5EDXA 3MROB 3MGOB 3AY4C 1OD7A 3VXUA 5TFSH 4ZODA 3X14A 3QFJE 1HK6A 4MXVF 4Y16C 3VXTA 2R1XA 1MCLA 3D18A 1XGPB 1I8MA 5ADOL 1N26A 4U1HB 5F96L 4S1SH 4Y88A 2IJ0C 3BW9B 2AGJH 5CGYD 3OR6B 1IARB 4ZFFA 1AKJB 4J8RA 4JN2A 3RDTB 3ARBA 1IC7H 4C83B 5C71A 2AJYL 4HXAL 4D8PA 3MV9E 1JTTA 2KZWA 1KN2L 3FZUD 2E9BA 1KTKE 4OLZL 1I7UB 1HXMB 4NQCD 4PV9B 4AMKH 4MA1C 4AIXA 3P0VL 3RZCA 3I84A 1M1SA 4X0KA 4UINL 4Y4HB 3TV3L 4MAYB 3BDYH 3LPGA 2FO1A 1ND0A 3BISA 1FE8H 3T77A 5D7IE 1XF2B 4KMTL 4P9HL 3CLEH 1WZLA 2LU3A 3L3JB 4KDVA 1QSVA 2DM3A 1MFEH 2DQCH 4LHUA 2HVJB 5KVEH 4P4RB 1RZFL 1PX3A 1F3DH 1D5BB 3D2UD 3RHWF 2ZJSH 1E4KA 4JPKL 3T4AB 3VA6A 5H2BB 4OFYA 2BC4B 5KN5B 4HBQA 3MOAL 4K3EL 5DEFA 4I9WE 1VHPA 4L9DA 2VSCA 5KVGH 3PP3H 3C6LD 1ZANH 4OLVL 1JTPA 5DMYA 4KI1A 2IAMD 2F19H 4HWUA 1T04B 1JRHL 2BSED 3FQNB 4OQTL 1KULA 1CXKA 3QDJE 2J8HA 1NGYB 4OCYH 1T5XA 4OZGA 3MC0A 4HD9A 3TPKA 3LRHA 2AJVH 1E4XI 2NYYD 4NZTL 3DGCR 1M7DA 2FX9L 5E08L 3C5JA 5IIEA 4DAGL 4A6YL 3BP5A 3LEVH 1KLFA 5CD5C 1F13A 3W0WA 1AJ7L 1NLBL 1A3RL 4FFZH 2Z93B 4YLQT 2CKNA 5DQDH 1JPGB 2ZUQB 3EOAB 4O2CA 2EYRA 4ODXA 3L3GB 3WNMA 5I30H 3T0DA 2DQDH 3QIBC 3KPOA 2JELL 1D3CA 3O6FC 4LEOB 3LEXA 1ZLVK 4FABL 1RUAH 1FFPA 4X6CB 4AEHL 1OAZL 2IF7A 4L8SC 5FGCE 3OHXA 4Z78B 3F8UB 1GGCH 2HKFH 2BERA 5FYLE 3G6DH 1W8NA 4PUBL 3H3PH 2ZOLA 4NM8H 1TCRA 4PRAA 4QY8B 1MUJA 5DA0B 4JFZH 1KN4L 1NANI 3IFOB 2LVEA 3IJYA 1QEWB 4C54A 2HT3D 3BW9A 4TVPH 1A6PA 5IGXL 3H7BA 3ARED 3REVA 4AH2A 3OXSA 1J88A 1WZ1H 2DQEH 3LKPA 2XRAL 1MAML 4RFNC 4OLWL 3ES6A 1NMBL 5L8LB 3K4ZA 3KHQA 1FN4A 2OL3L 3WHE0 4LLDA 4M43L 3C5SA 2AEWA 2EXYC 2NY7L 3IDMA 4M7JL 2ATPB 5BS0A 4XC3L 1S7VB 3KXFB 2AJZB 1GYAA 1XCQB 4RGOL 2DMKA 3ULVE 1T1XA 3VWKD 1B0GB 2X1XR 1OF2A 3B9KD 1WTLA 5C0JB 5DD3L 5IK3B 1ZLWH 3PV7A 1A9EB 2NY0C 5I19L 2IMNA 1C5DA 5C0FB 2NX5D 1S7TB 3NPSB 4U6VH 5BV7C 2VQ1A 5D7JD 3VI4E 1VKXA 5FA3B 3MRKB 4XVJH 2X4OB 4B41A 5DO2D 1F45A 4Y89A 2IADB 4U3CA 3FRPG 2R0ZL 4JGJA 4DK3A 5FM5O 2OM5A 5FUOL 3RWDA 4CMHC 4DUVA 1QSFE 1NL0H 1OAYH 2FZ3A 1PBYA 4QOKA 3MLRL 4IS6A 3MRKA 4CADA 4UT7L 1K85A 2C4XA 1BBJA 4P3CH 5BV7B 1HSAB 2AK1L 2NTFB 3EYVB 3ARRA 5BV7L 1QBML 4JM2D 5E7BA 1XGYL 2BHZA 3IVKA 1XGRB 4WEBL 1Q0XL 3VFGH 2FH6A 1IBGL 1YNTA 3AS2A 3DHMA 1OLLA 4YHKH 2AQ3A 1CS6A 4Z8FL 1NFDE 1QD0A 3NMEA 4JCMA 4W81A 5F3BB 3VJ6A 1U8MA 4MHHI 5F6IB 4XPGH 4U1JA 2R4SL 3TF7C 4HF5H 3NCYS 5IB5B 1ES0B 3Q6FB 4ZD3L 5T1KD 5TQ0H 4AQOA 2DOCA 4F2MB 1V3MA 2BSSA 4LCYB 5EZLA 2H1PL 1NANH 4IOSD 5L8JB 1A7RH 5JHLL 4L8CA 4ZAKA 1ZS8A 1L7IL 1XFPA 3V2AR 1MJJB 5ESAA 3NIDE 1R3KB 3V9FA 4ORGA 1IKFL 3TO4D 2QSCL 3V0WH 5FB8B 2WZPD 4NHCL 4M1CC 4GAGH 2D03H 5F89B 4L8CB 1N8ZB 3W9EB 1E4WL 4GW1B 4PRAB 4QY8A 4W6WB 4M48H 3DURB 3BIBX 3U83A 5MI0B 4PRID 1BBDH 1R3JB 4I3RH 3T0EC 4EIZC 2D7NA 3HE6B 3VXMB 3FMGL 3B9VA 5C0AB 2HTLC 1N59A 4YDVB 3U48A 4JFFB 4HH8A 5DGQA 2DBLH 4I9WD 3VH8A 3EO1A 3WJLC 4JG0L 2R2EA 3C09C 1OM3L 1CZ8L 4PTUA 1D5BA 2EKJA 1AXSA 5IW6A 2E8YA 5GRVK 5CEZE 2WUCL 1FNFA 3H3PL 2ZNXA 1VERA 1G7MB 2FECI 1XR9A 4KQ4L 3TT3L 4XCFL 2NY2B 1JZ4A 3LMJL 2UY7A 2DDQH 3LY6A 3V4PL 1G7QB 3S88L 3MNZA 2GSGA 2ZKHL 4GAJL 5A1AA 3WD5L 3EOBA 3MLYH 4KRPB 4WHYG 2JJSA 3RWJB 4HIHA 3TVMB 2OTUB 4OLXH 4Z7UE 2OXHA 3VFVA 1JYVA 3FT2B 2LV4A 5IW3A 1OP9A 4YHML 1XF3A 4TNVF 3ARBC 1CR9L 2Y4SA 4K7PX 4LDEB 5HGGS 4S1QL 1K3ZA 4NQCE 4NCDA 3EAKA 1IAIM 4JQXA 1QG3A 3AUVA 3X3GL 3GHBL 4HFWA 5GS1A 2OMNA 2VH5L 5HGHA 2X41A 2FR4B 2X4TA 3ARQA 4R3SB 4Q6IA 3VXQB 3AY4A 1HINH 4MAUL 3ZDYF 4PS4H 4ZOBA 2Y07L 4F9LC 3QWOA 2DLEA 3S96A 2L7JA 3V6FA 4Q2ZB 1R3LB 1OD9A 3ILPA 3MRBA 4QNPE 4OCLC 2GCYA 1UM5H 1A4KA 1FZOB 1XF2A 5FM4A 1J0JA 2CLZB 2VLRA 4HT1L 3IDNB 3V0VA 1FRGL 4RDQG 2FSEB 1TZIB 1FYTB 1CICC 4FQ2L 4FXKA 4K3EH 1JL8A 4I0PB 1ADQL 2F58L 2NY4B 2OSLB 4Z7QE 3ARBD 3D48R 5C9JB 3S36H 1KJVB 4G5ZL 5JIKA 2BHYA 4RWYL 3ARFA 5IVXB 2XWBA 3UTSD 1QRNB 1BOGA 2XACC 3RZCD 4M7LH 3U2SB 4M6AA 4FOMA 4GW4B 1I1CA 1MELA 3MRQB 1SBSH 1BPVA 4R7NB 3VRJA 4LQFH 5ID1B 1GH7A 4YXLL 3KPPB 2NX5B 2X4PA 1YMMD 2EO1A 1CN4A 3VWJC 2NPLX 2YC1A 4Z7NF 2XZZA 4XC1H 2YWZA 4MWFA 5TQ2H 4R0LA 3MV7B 1EMTL 1JPGA 4O2CB 1R3LA 4UTBL 3STZA 1LMKA 2VLJB 3WJJA 2KZ1B 1S9VB 4ODTL 4J4PA 4NZUH 4OFYD 2CH8A 2B5IC 3RWIA 4XBPB 4J12A 3U30B 2XWJA 3AS3A 4C58B 4Y16D 5C7XH 1XIWD 4QHMB 2DMCA 3VFOA 4EBQH 2CUHA 2IAMA 4MA8L 3I50H 5GRUL 5F71A 2AI0L 3WLBB 3O6LL 2AK4B 1H5BC 1YDPA 3H9SB 3NFNA 2OR7A 4P2OC 4JQXC 3GMPB 1A6VH 3BAEH 2BSRB 3O6KL 5CBAA 3QRGL 3T0BA 5JXEA 1WIUA 3MA9L 1QSFB 2HYMA 3KG5A 3O2DA 4HGMA 4LHUB 4KKBC 4LNRA 4V2BA 4IEFB 4DKFL 3B9AA 3HFMH 1S9YA 1QRNA 3S34H 3ZE1E 5CEYB 1A6ZB 4U1IB 1OGTA 5DJCA 4U1KA 2YPLD 1FBIH 3G04B 1INQA 1PG7H 3TBTB 4AENB 3MLSL 5JR1H 1FZKB 4RNRA 1MNUL 5AZ2H 2A1WH 4XBEH 2A83A 4KROD 5AG9A 4F2MA 1XGQB 4FQXB 4HIXH 3ZTNH 2ITCA 1I8LA 5DMIH 1EO8H 1KPRB 3IYLW 1X4YA 2BNUA 1U3JA 5GS3A 1Q1JL 4J3SA 1DQLH 3T65A 5E5MA 2AABL 3WUWG 4N90E 1T22A 2XN9B 1FFOB 3FB5A 3SPVB 3TBYB 3ZKXB 4POZD 3W5NA 5F44A 3RTQC 1GGIH 2PYFA 5J13B 4NQDB 4DKFH 1F97A 3PG2A 4HX1B 4DVBB 4I8DA 5D7SL 3RWDB 2JCCA 4Y7MA 2NXYC 1RIHH 3MBEA 2VDRL 4FFYH 3T4YA 4L3AA 2F53B 1LK2B 3ZTNL 5FA3A 1T04A 3FQNA 4GJTB 1Z9SA 4I5BB 1IM3A 3PQYD 1N6UA 2A9NL 4JO3L 1RIHL 5JPMB 3V6ZB 3P4LA 2XPGA 1X5XA 4HDIA 3QIWA 4GSDH 3RUGF 2WV3A 1A7OH 1DUYA 4XP4L 5DTFA 4LGPB 5MENA 4XI5C 2WBKA 3DMMD 4BM7A 3U0WL 4LGSB 1NAKL 5C0IA 5C7XL 1FL5A 2BZDA 4JFDD 2BP3A 4G43A 4Q74A 5HHME 3IVKB 1AFVL 4RFNB 3KXFA 3EYVA 4BYHA 2FEEL 4JJ5B 5JIPA 2CIIA 5HGDA 2YD7A 3EDFA 4LP5A 1BGXL 4PJXA 1HHKB 3EYSH 3MOQA 5GJTL 2EDOA 2ARJA 1ZSDA 2BY1A 3EOYG 3KWWB 3K46A 4GS7B 3EYFB 4Z7UF 5DD0H 3HHRB 5D7LB 5IBTH 3TEUA 5H94A 4PJCF 4CUCA 5ITFB 4JHAH 1JVKA 5HY9A 1FNGB 5D7KD 1IGTB 2QLVB 1OARH 4LARL 2FBJH 3MPCA 5I71C 4R4NC 4JM2A 3DYMA 4QRPE 3W11C 2QHLA 4BFEA 1HHGA 5DEGA 5C1MB 3I2CH 2OZ4L 3I75A 5IQ7H 3RWHA 1IRAY 1CCZA 5F9OL 2F53A 4Q0XH 4WI3A 3U4EB 4LLUB 1KT2A 1BQLL 3ARBB 2GFBA 12E8L 1YEHH 4GLRI 3OKNB 2Y36L 3FQTB 2H6PB 4M43H 5HVHB 1I1FA 5IJVB 1BFVH 2XOTA 3GSOB 4HJJH 4FQQA 2PXYA 4ODHL 3FQUA 2HH0L 2K3TA 1BIIB 3SE4C 1MVFA 4KY1L 3BEWB 3SQOL 1MCNA 1EAPB 5IBUG 5F93C 1J0KA 2DM4A 3CSPA 2GCYB 5T1LD 2Q7YB 3OAZH 1G0YR 1T7ZA 3O9WA 4JN1L 1DLHB 5IT2L 4DUWA 1RFDL 4ZS6C 1KNOB 5FHAL 4PD4J 3NZ8B 4QHUA 5EFIA 3F58H 4XVSL 3CFJB 2E27L 1CFTA 4CMMA 4JFDB 3PL6D 1TVDA 1X5JA 3PHOB 1BECA 2ZOLB 4M61B 1GAFH 3SDDC 1G7IA 3LQZA 4JFFD 4LFHD 4UILH 5DC9B 4XVUD 4HMEA 1QR4A 5K59E 2I9LB 4JM2B 4LPYA 5AZEH 2RR3A 3A0OA 4PGEB 1DVFC 5BVJB 2D31B 3BUYA 3RWGA 4LKXB 2A9ML 4MD4A 1BVKB 4GG8A 3IF1A 4E41E 3O0RH 3U9PH 1LO2H 2R0KH 1X5FA 3MLWL 3TNMA 4F9PA 2Z31D 2VE6B 1QFOA 4XNQB 1RJCA 3JWDC 3RU8H 3F6LA 4JB9L 4GAYB 4XH2A 2M8XA 4P2QB 4KRNA 3P3YA 3OKDA 4PRNA 2NR6D 5E24E 1HKFA 3ARPA 2I60L 3L3KB 4PJGE 2Q76A 3ARGC 3QXTA 1CDIA 4NWUH 2XZCL 5EUOE 1T3FB 3SKJL 2EDYA 3BWAA 2F58H 1XH3A 5B4MC 1T1XB 2GJ6A 3DARA 5TE7H 4NBZB 4ZSOE 4X6EB 1AQKH 5ESQA 1H15B 2GTWB 1NEZB 1OAXL 1T3FA 1S7VA 2X10A 3BT2L 4P9ML 3L3KA 1HHHA 1P84K 5E2VH 3MLPA 1KIQA 3JUYA 1I85A 3O3AB 3U36A 4H1LB 4JKKA 4YUEL 5HHNA 3GJFB 3UPRA 5MEPB 2AK4E 1DVFD 2FJGB 4OCMC 2VDRH 1FYHB 1JPST 2E6JA 2F74A 3MGTB 4JRYA 1LP9F 1NDMA 2HN7B 4JN2B 3RDTA 3GIVB 4JZOB 1DJSA 5C0DA 2FB4L 3V6OA 5FO8B 4Y5YC 1SJEA 3IFOA 2CXGA 2E7HA 3DROB 1R0AL 4Y4KA 3ARGD 2VERN 1JYXA 2NNAA 3MCG1 4NN5B 4I2XA 1PQZB 4JR9H 3HE6C 2EXWC 1YEKH 3ARDB 5ISZE 4TYUA 1WBZB 3SY0B 4OV5B 1FPTH 1CICB 4MAUH 5HDLA 3TIEB 1F11A 3PL6B 4EXKA 4I0CC 4U7KA 4I48B 2BJML 4TTGA 3IRZA 5FEBA 5F3BA 3GBNL 3HC3H 3ARTA 3FN0H 5DD1H 2HP4A 5E70A 5F7HA 1Y0LA 2BVQA 3G08B 2V2XA 1YEIH 4P9HC 5F1IA 3VMOA 3HZKA 2Z0BA 1JN6A 1XIWC 3KYKH 2BVOA 3MV8E 5ALBL 2XKNA 3G5ZA 5E9DE 4L29B 1NH6A 3LKNB 2W65B 3VD4A 1NCUA 4X6DB 5IESH 1UM4L 1I9RL 1S8DA 3EFDL 3V5HB 4CN4A 5IJVA 3PQYB 5DC4B 3LV3A 1HH6A 2BSRA 1ZLWK 3DYPA 2EDQA 3LQMA 3ZZ1A 4WTZG 3ARYA 5LXGL 4MX7B 1NDMB 2HN7A 4NN7C 4R8WH 4X6DE 1I9IH 4YBLC 1JPTH 1N2RA 1HYRC 4QRRA 5GRJL 1U58B 3ALWA 5KZCB 4I3GA 4QRRE 1LE9A 2WIIB 3VFOB 2B1AH 2R1WB 2V5RA 4QXTA 3G6JE 4YFLI 4OLYL 4FMFA 3PXHA 4JE4B 4S11A 4Y5XA 4G7YL 5IF0A 2DQHH 4XXDB 4JGUA 4X5WB 5CCKL 1RULH 3GM8A 4JDTH 3MRDA 4PR5B 2UWEF 5BQ7B 2ICWA 3QQ3B 3TPUB 3STZB 3FONB 4YXHL 1IGCH 3S9DB 1KLUA 4NPYB 5IROC 4H5SB 5D5MA 1DQTA 2F8VA 1EEUA 3CK0H 4F3FA 43CAA 4H20H 4P2RA 3MJ9H 5F7LB 3S35X 3MACL 5JXED 5E9DA 2Z92B 3CDYA 3QDAA 1DLFH 2J8UB 3CFEB 4P4KA 5IMMA 1PY4A 5ITBL 1NC4B 2N4IA 1AO7E 5DJXB 3GSNH 3QRFM 1AGDB 1D6EB 1QBBA 3G6AA 1KCSH 4F15B 2C1OB 3CVHA 3KPSB 4LLQB 2XWBB 3DV6B 3I9GL 1WBZA 3ZSTA 1JWMA 4HS8H 1BOGB 1VENA 3VWJA 4ESKA 2QR0A 2GTZB 2H3NA 3DX6A 5EB9A 5HGBB 3Q3GB 4K23L 3DV6A 4WI5A 4HK3J 1F4WL 3SDYH 5I6XB 2W0LA 3T2QA 1DBKH 2AK4D 2OJEA 2PO6A 3SDXB 3WNOA 1KYOK 2NCMA 5F8RC 2DQEL 5CWSB 5DUPL 3MXVH 4HKZA 4R96B 1R3IH 5I1EL 2E7MA 2HFGL 2AJSH 2XG5A 3SCMB 4NUGH 4FQLH 3UYRL 5FK9B 2F5AH 1U3HA 4MNGA 2WMPA 2IAMC 1HILB 1N4XH 2NXZD 3GRWA 5D7IB 4M1DH 4M8QA 4LHUD 1I4FA 1MHCA 3X12A 1KIQB 4X4ZA 3WUZA 3CZJA 1IGYB 3MNVA 1FGNH 2I07A 3B3IA 2WQRA 5JIHA 4Q9CA 4Y4HC 1YEJL 2FX9H 3CIQA 5E08H 1XH3B 2ZUQC 2EIDA 3EYUL 2IBZY 1NFDF 3GKWH 2PNDA 1QBLL 5DHYA 4OD2B 4JQVA 1YA5A 4P2QE 3PWUA 4G6FD 3AXLB 3KJ4B 5KSAA 4H8WL 3OJ2C 4HPOL 2FATL 2P43B 3QULA 5KAQG 2X05A 1ONQB 1TJIL 3D39E 1FNGA 1FG2B 3P4NB 2E7BA 4NN7B 5T5FL 1UA6L 3U0PB 1MCPL 2FHBA 1ONQA 4JG1L 3TC9A 1JZ7A 1PX4A 1HHIB 3PWVA 5E1AB 1WBXB 4GXVL 3SEPA 1ZVHA 2P1YA 4WCYH 3WLBA 2EDWA 1A21A 2JJSC 1TJGL 5T3ZD 2VXTH 2LAGB 4QTIL 4R90L 1G7LB 3MJGX 2ESVD 4IMKC 3OF6D 5TDNB 3C87A 1I1AC 4TQEH 1TQBC 4WI7A 2R1YB 2ZCLH 2HJKA 5GGQL 3ULUE 3RZCB 4I0PC 5KAQF 4P46D 5E6ZA 2DB8A 5IW1B 3ZLQC 1I4FB 2HVKB 2ENYA 2P7TB 5D70H 2APWA 4GKNA 2AI0H 1MLBA 2X4SA 5FCUL 1LEKB 3NGBB 4JLRA 4XRCA 5F6HJ 2VC2L 4QCIB 3AREA 2NLJB 4DTGH 3GUTA 4LSSL 2C3VB 4E41D 1EH9A 4LF3B 2V2WB 1T2QH 1S8DB 5D2NE 3TCXA 4MAYC 3FFCD 1GOHA 1KT2B 5DK0A 2F54D 4XGZB 5B3JE 4QTHA 3PABB 1BJ1H 3HMWH 4ODSH 4F7CA 3BP6B 2Y5EA 3SHSA 1LK3H 3SO3B 1GZPB 5LBSH 3QEUA 5GRWA 2GT9A 3CX5J 2R56H 3O3BB 4X6EA 3PL6A 1KC5L 5GSRB 3F7PC 4LVOB 1AE6H 1CE6A 1UH3A 3GSVB 2VXQH 2AW2A 5EU6B 3T0XA 3JTTA 4PJXB 3P0GB 2GITA 4NFBA 1AHWB 1P6AB 2YK1H 2NY4C 3W2DH 1AR1D 4NM4H 1LO3H 3V4PH 4HKBB 3BDYL 5D5MF 1HKLL 4M5ZL 4C56D 4QT5B 4EEEA 2BNRA 4UT9L 4RISH 4RGNC 4JZOA 5LBSL 1JBJA 1T1ZA 1RJLA 5T1DH 3VD7A 4BQ6A 4JG1H 1N0XH 4ZPVB 1SM3L 3W0WE 3GMPA 5GGSB 3OAUL 2QHRH 3PUCA 4PJ7A 4Z7QF 3QNZA 5I6XC 3VRIA 4I77L 1ZA3B 1XF1A 1YY8B 1ZVSB 1D5ZB 2W92A 2VLKD 1HHJA 1YQVH 2WP3O 2NW2B 3AVEA 3QNZB 3RY6A 3VWKB 2D2OA 4WI6A 1FNSH 1WK0A 1FAIL 4CGTA 5GZND 4PJ5D 1MCWM 4PRPE 5HYEA 1BQHA 3S5LG 3X11A 4CN1A 1IJ9A 2HMID 2CDEB 1IGYA 1CDBA 4HEME 4ZUUB 5C6TL 4OI9A 1XR9B 2WWKO 1JZ3A 3DNKA 1VFAB 5TGBA 2MWCA 1HYSC 1A1MB 2YD9A 4JRYD 4OLWH 1DFBL 3RDTD 4TN9A 4ODWA 3FB7B 3G08A 5H35B 1WZMA 3WIHL 3CSYB 4PJ9D 1MCJA 1M6OB 3G5VA 1KUMA 5GSRA 2R69L 3WD5H 1IM9B 4JVUA 3K81A 1KPRA 5JORB 1E6JH 3ARGA 3LMJH 5FUZL 1IL1B 4PD4K 3QNYB 1R5WA 1BZ7B 3R8QA 1DUZA 4I3SL 2CK2A 2FLRT 5E0QA 4F37K 3DMMC 5CEXB 3VW3L 4L4VE 3MUGA 1GC1H 4YHKL 4GW1A 1XF5B 1PYWB 5MEOB 1K8DB 4IRSB 2VDOH 2VKWA 1WAAA 1GGCL 1J10A 5IG7A 4E5XB 3MYJA 5E94A 3VMNA 4IRZL 4IMLA 5FYJU 1KB5A 3SO3C 3T8XB 3WXWL 4HXBL 4KXZI 4OIIL 4CU8A 1EPFA 2DYPB 1U91B 1NCNA 3MRHA 4PJAF 4JDZA 1WAAE 5TF1L 1BLNA 4HIIB 2DJ4A 4XT1C 5A16A 5I18L 4IRZH 1S9KC 3UBXG 3ALXA 4WUUB 3FQUB 2CKBL 4ELME 5JNYA 1ZT7B 1G1YA 3QIBA 5EO9B 4CJ1A 1J5OL 4LSUH 1HOCB 4FTVD 3R1GH 3NZHL 1S9XA 4LLAA 2V2TA 3WS6C 3GBML 3P30L 4Z7WB 1CF8H 1OTUD 3CFBB 1FL6A 4QHLB 2C3GA 5E99L 2EIEA 3HE6D 5ID0A 1IQWH 2EC9T 2GUOA 1IQDB 4B50A 4JFOA 3QEQB 1JMXA 4NN5C 5C07A 1U8PB 4RMTA 3WFZA 5C0BA 1G7JB 3TO4C 1FFQA 2YD2A 2LU7A 2Y7QA 4JM2F 4R4BB 1YYLL 5E8PA 5E2VL 4PJAA 4RISL 5B38G 2DAVA 5F6HI 4JO2L 4N9GA 4J3TA 5LWYL 5HYSA 1QO3B 4U31A 1SJHA 2A6JB 4FQ2H 1G9MH 3TN0C 3A6CL 4M4RA 3M8OH 2VXVL 3UJIL 1GZQA 3PGDB 3SKJH 2CR6A 2KUTA 1JGVL 4NKMA 3B2VL 2CRYA 4WHDA 3U7AA 1C5DB 5C0FA 2G2RA 4ZS7L 2JIXD 4DN3H 1UCBL 3HA0A 1H3WM 4Y5VB 1CBVH 2EDXA 2XG4A 3KYKL 1OF2B 4KPHH 3EDDA 3Q1SL 4KC3B 2I27N 2EDDA 4APQB 2XI9A 2JLLA 4IRJB 5LJYH 3KHOA 3UTZB 3QSKB 5I15H 1NGWB 3ZKND 4LVHC 4PG2A 1SYSA 2X44D 4EI5B 3C5SB 4X80H 4AEHH 5D1XC 1NGXB 3CNKA 1BIIA 4DKAA 1TETH 2XWTB 3ZMRA 1NMCC 2NY0D 3W9EA 4IHOB 3T3ME 1TNMA 2WINB 1UCBH 5EBWA 5K9JH 1I7ZA 1RZ8B 1A6UL 4W4OA 3D18B 3DJ9A 1U8HA 3HI6H 3GDBA 2FH8A 3B8SA 3DVIA 4PP2B 5C0CA 3ETBF 2D7OA 4JFYA 5TDOB 1GHFL 1KGCE 3I6KA 4LSVH 4K3HA 5E03A 1TFHA 1AGBB 4PJEF 5D6CB 4NT6A 4LPTA 3U82B 4LCWD 1OM3H 1U93B 3LB6D 7FABL 3SKOA 2BK8A 4WJ5A 4Y16A 1G7HB 1G1CA 4EQ2A 1MI5D 3EGSA 3VGAC 1EZVY 3V6BR 5CJOH 5D71L 3CSYA 1M71A 5I16B 4KKAC 3PWLA 3BZ4B 4V2CB 2CO7B 3I3BA 3GBMH 2ARJB 4NQED 1CFVL 3RA7L 3UYOD 3BZEA 5K9KB 2FLBT 3HG1D 1INDL 3EOAA 5D1XB 1RMFH 4DTGL 1TPXC 4MJ5B 2J4WL 4Z0XA 5HYJA 1JNJA 2MJWA 5AUMB 5IW6B 1CU4L 3BDXA 4J6RH 1N5AB 1CICD 2FECL 4E42B 3X3GH 4LQ1A 4XMLH 1NBVH 3GGWB 5HYSB 1EAJA 1KPVA 2B2XL 4TSAL 1C08A 3SKUD 1ZAGA 3KNBA 2E3VA 2FD6H 5C0BE 5BRZB 1G7PA 2MCG1 4ZTOL 4YDVA 4AM0A 2WUBH 2BNRE 5MP6L 1MCOL 4H8WH 2YPLA 3F7YA 3BKYH 2HJLA 2GUOB 3U2SA 2ESVA 5GSVA 3UZEA 4C57C 2HWZH 2B4CH 2EH8H 4UQ3B 3CFJA 3AFLA 3O11B 1LQSR 1NFDB 5HHVL 5ERWA 5C6PB 5K59F 5KSAC 1RMFL 1FFNB 1KJ3H 4GMSH 5DSCA 1VFUA 3IU3B 2Q86A 2Q8BL 3V95A 2BOCA 1L9NA 1J1XH 2P5EB 1U2HA 4JY6A 5BV7H 1JJUA 4MJ6A 3JTTB 1I1YB 5ECJE 2BNQA 2A9NH 4V1DE 1BLNB 1OP5H 3KYNA 3MFFA 3NA9H 2HFGH 4ZFOL 1ZWIB 2YPKB 1V8HA 4FQQB 1DE4A 3MBED 5CP7A 5KZCD 4WVRA 1NBYB 5E94B 3CZFA 1HCFX 1MRCH 4RGMB 5FYKU 3BGAA 3ZHLA 3HR5B 1U3HC 4P99A 5SWZB 3I9GH 1HN1A 4FZ8L 4XPHH 5I66B 4KUZH 1W0YT 2BVPA 4OUUB 4YDLC 5IQ7L 1CE1L 1QFWM 5FO9A 2PO6C 5E6ID 1YPZB 2DQUH 3OV6A 3QT2A 1KYOJ 2QQNL 1S9WA 4ISVA 3L5XH 5IB2B 5I8CB 3RY4A 3SGJA 1VFOA 4APQC 3SE8H 1IAKA 4CVXB 1UJ3A 4RFOH 4JLRB 5GQBA 3QI9B 4G6AC 4HF5L 4NO0B 4ELMF 2UUDK 4NP4H 1HNGA 1HZHH 2VDOL 1OGAE 1YJDC 4JFDE 5DJ0A 4HKXB 2Q86B 1FO0L 1FSKC 1KB9J 3IDXL 5ACLA 5T3XH 1AXSB 4MQXD 5GGTL 4KH2A 4EDXA 5K9QI 4OLUH 5C0IB 2EXWD 4G80B 1ACZA 3RTQB 1YECH 5CGYC 5ADOH 1DUYB 5LKNA 4KVCH 3KYMB 1PKOA 3IFPB 5D7JB 1S9VA 3FQXA 3ROLA 1DQML 3QIBB 1OHQA 3HS0A 4M6ML 5EU7C 2B0SH 4O4YH 5CZVL 2DBJA 3WE6A 3SCMD 4P2RE 3GM0A 2Q76B 2F9BT 3EO9H 4KY1H 4AG4H 5D96C 3LKRB 4HEPG 2F53D 3T2NL 4B7IA 3TBWB 1PZ5B 2GQHA 3EYOB 3BPLC 4YHLH 5FO7B 1JHKH 3VFVB 2EDLA 4PJ5A 1YJDL 4EVNB 4XX1G 3BO8B 3R06A 4X8JB 3SJVD 5E7FA 2PXYD 3P4NA 2ICEB 1UZ6F 4K8RC 2QQQA 4PBVC 3IDYC 1IGCL 2P5WB 4KVCL 3VWKC 4DWHA 1ZVYA 2VWEE 4G8IA 4LASH 5C09E 4HPYH 1BD2D 4MJ5A 2BVPB 5F88A 5GGTH 1VEOA 1FC1A 2VISA 4IRSA 5SWSA 7CGTA 1YEDB 3C8DA 1AHWA 3AM8A 3C5ZD 2BNQE 4X6DF 3VMPA 2XN9A 2J8UF 3BZFA 1FLTX 2ZOKB 1R5WB 4XMKL 4NRZB 1FZMA 4WY7H 5L2KB 5GGRB 4XNUH 1PJ9A 1OAKL 3BKJH 1MJ8L 5BMFH 2I07B 1U8MB 3SGDI 1CQKA 1G9EA 2XFXB 4FQIL 3BJLA 4F7MB 4Y1AA 3BZFB 5JLZA 3HTLX 4XPBH 1E6OH 2VZ3A 3QI9D 3DURA 1I1YA 3GSNB 2X9YA 3ZYIA 3QFJB 5CSBA 5F7UA 4TVPL 2X4RB 9CGTA 2NZ9D 4B5EA 2ERJC 5D2NA 4MQTB 5JDSB 4XNZC 5J9PA 4E0RB 1J1XL 3HC0A 3OKKA 4JFQA 5E00A 3VXOB 1CGWA 4OB5H 2YD4A 2Z31A 1MAKA 2V2WA 3ZSSA 4MQ7B 3IJSB 5D93B 4BA8A 1KTLA 5JDJA 4OSUH 1FLRH 1HKLH 3VXUB 5DRXB 4JCLA 5ISZA <