2R56H

Crystal structure of a recombinant ige fab fragment in complex with bovine beta-lactoglobulin allergen
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
b'QVSLRESGGGLVQPGRSLRLSCTASGFTFRHHGMTWVRQAPGKGLEWVASLSGSGTKTHFADSVKGRFTISRDNSNNTLYLQMDNVRDEDTAIYYCAKAKRVGATGYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Molecular interactions between a recombinant IgE antibody and the beta-lactoglobulin allergen.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 43
structure length 221
sequence length 221
chains with identical sequence I
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r56H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r56H01
1ZGLM 1A2YB 4QRRD 3BKJH 4Y19B 2P5ED 4OCYH 4KVNL 1NL0L 1QLFB 2X4SA 4OIBA 3MRBA 4MJID 1U58B 3CSYB 3O4LB 1WCBB 2BNQE 1CXFA 1DLHB 2A74A 3CDGA 3FO1B 5ILTH 2DD8L 4M1DL 3KPTA 4FNLL 5IB1A 5DMGD 2X10A 2DKUA 2X4RA 3AVEA 3C08L 3U6RB 4WDIB 3KDMA 4OD3H 3OAYK 1MI5E 1UT9A 3SKJH 3KLHC 1CFSA 5HSFA 3GMRB 4DAGH 1XCQB 4LLDA 3CSGA 5DQJB 3IRZA 3O4OC 4WV1B 1V3JA 3MXWL 2CR6A 4EIGB 1YQ2A 4RFOL 4F7MB 2FJGB 2X4QB 2A73A 4PLJC 2IH3B 3N50A 2F19H 4M7ZC 1EMTH 3W82A 5FGBA 1GGCL 1ZS8A 2F74B 3V5HB 3P4NB 1ZLWK 4P2OA 4K9EH 3DBXB 1ACYH 5D6CB 5D72L 3MGAA 1NFDF 4Z77A 1ACZA 1P84J 1KPRB 4DJMA 3E2HC 4MNQD 4KK8C 4OZGF 1J8HB 1A14H 1CYGA 3AAZA 4I3RH 1QBLL 3DI3B 3LOWA 1T0MA 5BVPL 4QT5B 5IMLA 1PSKH 4JDTH 3DVGB 4FQ1L 3NACL 4W6XB 4HPOH 1VCAA 3MA7B 3P9MB 2IQAA 3VCLA 3STZA 4KI5C 4U1KB 1KF9B 4MD5B 3SY0A 2D7QA 4I0KA 4WTXA 1CK0H 5FFLA 2VJXA 4A2LA 1NFKA 4JPVH 4XMLL 3OKYA 2H8PA 5INDB 4YHIB 4GT7A 2HN7B 2FHCA 1BECA 5FUZH 2NY2D 1EGJL 2J5LB 3QFDB 1EX0A 1N26A 3M17A 5EU5A 2D9CA 1FNFA 1A6VH 4HX1B 5B38A 2HA1A 4GRMA 4JHWL 4YBQD 4BH7B 1CG9A 1U42A 3P0GB 3QG7L 43CAA 2ADFL 5JIPA 3GI8L 5DC4B 4R4BB 3D9AH 2E5EA 1AGCA 2I25N 5EO9A 4WIQA 1Y6MR 3SDCC 5IB2A 1UM4L 4HIXL 3FT4B 5TH2B 1HHGA 3MMEB 2EEBA 2LU7A 2R0ZL 3OGCA 2J7LA 4AZ8A 4L3EB 5F1IB 5C3LD 3MRGB 1UB5A 1QO3B 5JZ7D 3A6CL 3RWIB 5E8OB 3SKOB 5HGHB 2E6JA 5KVDH 2NY4B 4PJAB 2PXYA 4M7LT 4DFHA 2IPUK 2W9EL 1B3JA 1LE5A 2IBGA 1OF2B 4XNQB 1Y18B 3AY4C 2VDKH 4PJBB 5ADOL 3O81A 2EC8A 4BK4A 1A6ZB 2R69H 4ODWB 3ZDZE 1DBAL 4JPIA 4KHXL 1WWWX 3C8KB 3QQ4A 3SQOL 2OSLA 5T5FH 1Q9KB 1X44A 5DD1L 5HGDB 1MJUL 1G6RL 3BEWA 3JTTB 4WTZA 2YD1A 3O6FC 4JHZA 4WI2A 1HSBA 3ARXA 4YE4L 1CGVA 5B8CA 4M7JH 1EAJA 1KT2B 3RWDB 1ROWA 1RZJC 4YHZH 5FO9B 1UWEL 5AD0A 4JFHD 2C7UB 4NQVA 1ZHBA 1UXSA 2GEEA 4I0PD 5CGTA 1UVQA 4GRWF 4YDKH 2EYSB 3I3BA 3IU3B 2X1OA 4Q9BA 2NYYC 4RMUA 3KJ6H 1JV5A 1HINL 3VG9B 2X9WA 4NZTH 5CEZH 1UC6A 2Z93B 3Q6FA 2Z8VC 4XHJD 1NMCB 4LHUD 3O11B 2Y9RT 1XF5A 2XWTB 2YD5A 5EC2A 2DQJH 3MRQA 4OV5A 2BDNL 3T1FA 4KKCC 4PJDF 1JWUA 4YHOH 3QI9C 4QRSB 1UKQA 4ORGA 2GITA 1OSZB 1EEYA 4Y5VB 3V5KB 2C4XA 2QQNL 5C1MB 2JF1A 4IRZH 2W0FA 3C9NA 2BSRA 3IXAA 2Y07L 4Z5RB 2GJZB 4OFKA 3LIZH 4TOYL 2I07A 5E0QA 3MJ9H 3FZUD 1MUJA 4G8EB 3O6KH 5D93B 5JHDD 3JWOC 3ZT7A 3G08B 3RDTD 3ALXA 2E9IA 1TJIL 3G5ZA 2M1KA 2YN5A 4LHQB 3GKWL 3P77B 4MJ6A 1OGAA 5BO1L 2WINB 5E2WH 3WFHA 5C0ND 3WHE1 4LLVB 3CFCH 3SGEI 1ZGLA 1R24A 3DTXA 2DI7A 1AY1H 4U1GB 3DGGA 4XPHL 4ZPTB 4OZFA 3IFNH 4HJ0D 4R97C 5I1DA 1S5HA 4LGPB 3C5SB 1EAPA 3QIBA 4Z7VE 1N6VA 4HUVB 3CFJB 1CGSL 2IPKA 4EVNB 3DUUB 4PRHD 3SDDC 5HHPA 4MB4A 2R2EB 1QVOA 2PTVA 1CS6A 4PRAB 5GGTL 1RHHB 1G9MH 4BUHA 5C9JA 1RZGB 4P23A 3C60A 5I18H 1NCWL 1Q0XL 1G7IB 3K0WA 3GMMA 2EYTA 3EO0B 2EEDA 1JFQL 1RZJL 1MFCH 3CH1A 3QEGH 2WWMC 2WM0A 5IGXL 5FYJE 1D5XA 2CKBH 2ZUQB 1EVTC 5FKPB 2C3WA 2XRAH 4PGZA 3LAFA 5DGQA 2JK5A 2AJ3B 3WIFA 1F6AA 4OZIA 1UACL 1NCAH 2JJWA 3MREB 3TWCL 4PREA 4NBZB 1UG9A 1YNLL 4A2MA 1I3VA 5TPWL 5BS0A 5ID1B 1YDPB 2PO6A 4XBEL 4M62L 1C7SA 4QKXB 2DQHH 4E5XB 3JV4B 1BMGA 3EOBA 1PZ5A 2ITDB 4P3DA 3B5TA 5BJTA 5J1TC 1KV3A 4PB0H 5JXEC 3O6LH 2CO7B 3CFBA 5ITBH 3UYRL 1N5YH 4Z7OE 3VDBA 1ED3A 3JWOL 4K7PX 5EZOH 4DVRL 5JR1H 4TUKH 2CMRH 2XKSA 3OGOE 4HZLB 3QAZC 5AG9A 1UM6L 2P24A 4YHPB 1A6PA 1MHEB 5HHOA 3ULUE 1FDLH 5IEHB 1GVIA 3RX8A 5GS1A 1HH9A 1C5CL 1RIHL 1LE9B 1S3KL 4IJ3B 3ARGA 5C6TH 3QEUA 1EUTA 3FQWB 4M5ZL 1JPFA 3RP1A 3CXDH 3VRJA 4AEHH 5F6IB 4FQIL 3U4EB 4TNWK 1A7NH 3OX8B 4TYUA 4AL8L 1FAKT 4OLUL 3WHE0 1LMKA 4OI9A 3NCYS 1VA9A 4JDZA 3BZ4A 5I6XC 4ZTPL 3M8OL 3TZVD 2HTKC 2VZOA 1WWBX 2R0LH 3ARVA 1T1YA 3AROA 4X9HA 4G6MH 4QHUB 1P2CB 4M6AA 4X8JA 2O5YL 4LKCB 1KG0A 2Q7YB 3OG6B 3QEHA 3ZE1E 4N0UB 3NTCH 5EFIB 1JI2A 5E6IC 4ZUUA 1OTUC 1BZQK 5I1LB 5TDPA 5I16A 5IF0A 4TSAL 2YKLL 4GW5A 2A6JA 1CZ8L 2EXYC 4EZMA 2CDFB 3PWVA 4KAQH 1G1CA 2HRPL 3GSQA 1I7RB 4GMSL 2FBJL 5FECA 3HAEH 1YEKH 2NY3C 2UV3A 2WBJA 4NKMB 4JQXA 5D71H 4M7KH 5IBLC 1CD1A 4GAJL 1ES0B 1IGMH 3RTQC 4KVCH 1GZQA 4R7NB 3RY4A 3TCXA 3U2SA 4NQSA 2COQA 3BEVA 4XP9L 1MFEH 4UAOC 4XHQA 3TA3B 4KROB 4D0DB 2VQ1B 1A6UL 2Y5EA 3ELAT 2PR4L 1EFXA 1U8MA 3C8HA 3VI4F 4WO4D 3UO1L 2H45A 1JPTH 3TH2T 1U3HC 4JO4L 1R0AL 4KFZC 3LB6D 2ATKA 5L0QC 1IC1A 2DQIH 2R29L 3LN4A 1QSEA 1W0VB 3RUGB 3AB0B 3V4PH 3PWLB 1IEBB 1CICB 1MCWM 5C08B 1XGRB 5EPMA 3ECBA 3UTSB 2DTML 2R2BB 1E4WH 3BKYL 1MCJA 3L9RA 1XZ0A 4OZ4B 4Y4FD 3W11D 5F9JA 3C87A 2K9UA 2NY5H 5MEQB 5EA0L 2XWBA 4LEXL 1A02N 3VXSA 4FZ8L 3AS0A 1T6WA 1BFVH 5D7JB 3OJ2C 4Z0BH 5CZVL 3MLXH 3D39B 2VXQH 3EYSH 1BBJA 1CLOL 4GBXD 3MV01 4V2BA 4F7EA 2R23B 2J1KA 2FGWL 3KXFB 3RVTC 5SWQB 1QD0A 5DHVB 2EIZA 1LP9B 4APQC 1M7IB 1SBBA 3S4SB 15C8L 2WW8A 4P3CH 4QRRB 5FYKU 4XC3L 2P5EB 2NTFB 5D7IA 2BVPA 4KY1L 1CXLA 3NIDF 1CLZL 4MJIB 1NLBH 2QQKL 2EE9A 5IG7B 1ZSDB 4PG9A 1IC4L 3DECA 5J6GA 1I1AD 4BM7A 3E6HA 4HS3A 1AO7E 3VXPA 4WW2A 2Z35A 3T8XB 3MNWA 3L3JB 2FEDD 4CNIA 4YUEL 1LEIA 4ODXB 5EUKB 4F2MB 5D2NE 2YUZA 3B2VH 3QWOA 1FYTA 2AW2A 1P4BL 3NFNA 4M6MH 3J8F7 2BVTA 2H32H 1CVSC 4URTB 3MUY1 2QSQA 5EO0A 5FK9B 4TRPH 1OGAE 2X4UA 3O3AB 4K2UL 5D1QC 5EU7C 5FHBL 1BM3L 3KPSD 1BGXL 2FB4L 1NUFA 3BZFB 4M93C 4X6CB 1BLNB 2XXCB 4QXWA 1NGWB 3TIDA 1IM3A 4XWGH 5FA4B 1EEZB 4XXDB 4JZOA 1XIWD 2DQUL 5FYLD 1AGEB 4Y4HA 4Z7WB 3SDAA 3L3OA 1J0ZA 2HTLD 1RIUL 1YUHB 5BV7B 3ARFA 3BGFB 2Y23A 3H3PL 3TVMC 3LS5L 4LCYA 4OD1H 4B53A 2WUBH 2MPAL 3BUYA 2NY2B 5EU6A 3AREA 3QQ9D 5MP6L 4FFZL 1KTDA 3WFZA 1G0YR 3FAXA 5E9DD 3B9VA 4HPYL 1KN4H 5LJYH 5TDNA 4I13B 4WHDA 2J88H 5GS0C 3DIFA 4WEBH 5CINH 5E8EB 4BZ1L 2JJVA 1P7KB 1SJHB 4OZIE 2FH6A 5D1ZC 4OCNC 2IAND 1J1PL 1FFQA 1TVBB 4KMLB 3S96B 5CJOL 5BS0E 4JAMA 3VWJC 1WF5A 2ADIA 1S8DA 3SGKA 1S7WB 3HE6A 4CVZA 5ICYB 2P7TB 1EO5A 4FQXA 3EUUA 5D9SB 5IB5B 2D9QB 4W6YB 5KSBF 4C56A 1K8IA 4JFZL 5ICZB 1M05A 1QP1A 3IT8D 4R9HA 1U8IA 4IMLA 1OM3H 3OBAA 3FQUB 4KK9D 3KYOB 1MFDH 4IRSD 3HNSH 1RZFL 2FSEA 4K3JL 4BKLB 5KN5A 5C0AA 5IQ9B 1FLRL 1KEGH 2B2XL 4UV7H 5HHOE 1JF1B 5ANMB 4I0PB 3LHPL 1LQSR 4RGMB 4DKEL 3P4OA 2BJMH 2HAZA 1VHPA 3X14B 5GSVA 2R1XB 2ZCKH 4TVSa 5IESH 1AXTL 1IAKB 1NGZA 2EH8H 5KW9H 3HG1A 1ZHKB 3SJVA 3OB0H 1KCKA 4Q2ZB 1SVCP 4FZEH 1JL8A 3DO3A 4XVTL 2O5XH 2AS5M 4DVBA 2APFA 2X6MA 4PRPD 5IEKB 3PQYA 1EO8L 1FNEA 4NN5C 4IHOA 1KLUA 4GQ9L 4M43H 4P5TA 1M6OA 1OAUL 3HZMB 5KJRL 1RUKH 4PJFA 1JN6A 1QSVA 4S0SD 5GS0L 3HE7D 4M6NL 2EEAA 3QUXC 1IC7L 5FYKL 4KZEL 3RDTB 2Y25A 4XPAL 1FE8H 4PJHF 1OWWA 4HWBA 4ZAKA 3KYKH 4JKMA 3B9KA 4WI8A 1TFHA 3BDBA 3UBXA 3MOAL 3B5HA 2A6KB 3IAGC 4UT9L 2MSPA 5A2IH 4J4PA 1X3DA 2VISB 1DUYA 1T7VA 3PL6D 3CX5J 4ZUTA 4E9LA 3HCVB 2WP3T 3HI5L 4RAVB 1LO3H 4BELD 1J05B 1A0QH 2ZUWA 4RBPH 4PRHB 1Q9LA 1LWRA 2ZCLL 1GAFH 1B6DA 4IRJD 5CSZA 3GEWB 3REVB 5GJSL 2E8YA 1UWXH 3LH2H 5MEOA 4GMTH 1QSEE 1MCOH 5J57B 1H3WM 3Q5TA 3M07A 1KN2L 2DQGH 1BIIA 5CP3A 4AEIL 2G5RA 3MRPA 1CDBA 3NABH 5FGRA 1RI8A 3VXUD 3LEVL 4GQPH 4JDVA 4QNPF 4NWTH 4OZHB 3T3PF 3O3BB 4LLUB 3NCJL 2H1PH 2DM7A 4XP5L 3LPWA 3VXSE 1OHQA 2EO9A 3MRFA 3JBG7 4JB9H 2YD9A 1TETH 3WLWC 2EZ0C 3FRUB 3FB5A 1E6OH 4F15B 2B0SH 3OKMB 1IQDB 3U79A 1LEKA 1BPVA 3O8XD 3CAFA 1WC7A 1I7ZB 4YXKH 4PR5A 4UV4L 1DEDA 2W1NA 4H1LH 5HHMD 1JGVL 1R5IA 1D9KC 2G2RB 4NFCA 5D7IE 5E00A 3VFUB 2K1MA 4MDIA 2CK0H 3TCLA 5BOZG 3KPNB 3RFZC 5IT2L 1Q38A 3QUKA 3EOAB 4G9FA 4J3SA 3C5ZD 5C8JA 1TZGH 3GMLA 3HTLX 5K9OB 3OXSB 3BIKA 1DQTA 3G6DH 4ZSOA 2LE9A 4DN3L 2P5WD 2AVGA 4Q6IA 5IKCB 3BISA 4OFYD 1OTSD 2UY7A 5MHSD 1A7RH 2D4DA 4HQQH 2P4AB 4NRYA 2YD4A 3SE3C 3VDCA 1QKZH 5HYFA 1XF4A 4M8QB 3HC4L 1YYLL 2VZVA 2BVOA 1LO5B 2YOCA 1RJLB 1FYTE 3T0DA 1M7DA 3GDBA 1Q9WB 3G9AB 3O2DL 4DGYL 3CXHK 3UP1A 5BVJB 3MRHB 3TBWA 2W38A 3TZVB 2VDPL 5DC9B 5E7FA 1MVUA 2BVUA 5J3HD 2E9JA 1KJ2A 4N9GB 3U36A 2KZ1B 4LLWA 1BZ7A 2ZUTA 1T2JA 4F58H 5F7HA 1S78C 4MDJB 3F7VA 2XQYG 2DMCA 5F7DB 2A9NH 1S7TB 3MFFA 4WWKD 5DRXA 1E4KC 3IFPB 3QDMA 3GI9L 1MH5B 3RIFF 1FN4B 2XI9A 5LCVL 5LGJB 1D5BA 3MLVH 4GAYB 1Z9SA 1ZWIB 3LQZB 1NFIA 1UA6H 3HZYA 3V7MA 5TDOB 1YN6A 3NCMA 5EU6E 1LNUB 3VXTA 3VFPA 1MCPL 3AUVA 2X09A 5ESVA 3VFGH 3GUTB 5IHZB 5FO7A 3RWJB 1XF2A 5B22A 1QHOA 3D18B 3I6KB 4R0LC 4WO4B 2ATPA 3K4ZA 4JFDD 4WW1B 4MQTB 1QG3A 9CGTA 1BJ1H 4FQJL 4HIIA 5K9KA 4UIKL 2HLAA 4YFLI 3GM8A 5JPNA 3PHOA 1EZVY 3FRPA 5HI4C 1JZ3A 4OLXL 5F88B 4CDHA 1AQKL 1I9IL 4IIQA 4ODUA 2UUDH 2JELL 2MHAA 3TLRA 2YC1A 4Y4FB 3O3EA 2X89D 1Z9LA 4W4OA 3HMXH 4C56E 5CMAA 3QCTL 5DK2B 5DFVD 3VFMA 4D9RE 1AE6L 4HFWA 4OIIH 4YDLC 3WIHH 1UB6A 3MLRH 3OKOB 3P11L 5A3ID 4GBXB 4S1DC 1BP3B 1AGDA 4ELMB 3LQAC 1HOCB 1KC5H 4F33B 1QFWL 2EDNA 4Z7VF 2C5DC 3FCTB 3KPPB 3RZWA 5FGCB 4CVXA 5FF6B 1KB5L 2VLLA 2J6EA 3MNVA 4IM8A 1N64H 5IBTH 3BGAA 3GMQA 2DQFB 4FOMA 4PP1C 2V5RA 1WBZB 3HG1E 3SJVE 2DJUA 1IC5L 1I1AB 1LILA 3EYOB 2YK1L 3IF1B 4ZODA 4Z6AT 1KIRA 2X4NA 3GBMH 2BMKA 5L8JB 4X4ZA 4ZS7H 4JFED 4U6TA 4PY8J 4NKIL 3VFWB 4WTWA 2B1AH 2QR0B 2SEBA 3H9SD 4PJFE 2FHFA 4J3WA 5JW5B 6CGTA 1YPZB 3O45B 1NCBL 3GMOB 1T5WA 2BZDA 3UZQA 4R3SA 3CDYA 1MJ7L 4LCWA 5GRJL 4IDJH 2AKRA 2DL2A 4ACPA 4DOHB 1JNLH 2WBWB 5JMOC 4JZNA 1M4KA 4I9WE 4GKNA 1FAIH 4UINL 3FQXB 5F6HJ 1AFVH 5DEZA 5F89A 4WUUA 4K94C 4QWWC 1P5UA 3KPSB 2JTDA 3ULUC 2F54B 3QWQB 5B3JE 3CUPB 1S7XA 2XYCA 1I8IB 3CFDA 1IAOA 4NBXB 4O9HH 5EDXA 2B20A 1ZLVH 3DARA 3NAAH 3S35H 1NFDB 5CJ5A 2KQMA 3KPRD 4KTEL 4MA8L 4NHCL 2YWZA 3ROLA 1DBBH 3DXAD 4OZGB 3RGVD 2OBGA 5ID0B 4OCWL 4PYHA 2ARJB 5HDBF 3EDJA 1VFOA 2EXWD 4MGXA 4N90D 3PWPD 4XPBL 1CDHA 3G5XB 4JGUA 2GK0B 3JWDC 3T0WA 2XA8L 5E9DB 3QIWD 5E4EC 3QH3A 3H7BB 5KVMC 1LEGA 1QLEH 1FO0L 1A21A 1KACB 3NGBB 3OAYH 4PRID 5FYJL 5D7LD 2DM4A 4LVHC 4G6KH 2DMBA 3QEQD 3MACL 1HIMH 5C0DB 1OAKH 1YC7A 4KGJA 2PTUA 4Z76A 2RBLA 5IV2A 3S37H 2IANB 1MRCL 4PUBL 5DJZB 2ZSVA 4MMZC 1ZLWH 5T5NF 4PG2C 4YDVB 3Q1SH 4HGWA 4HWEL 1GGTA 2DM2A 5IHLB 4NKQB 1T6VN 2YUWA 3N85L 4Z7QF 1IBGH 2YN3A 2H6PA 1U8LB 2NCMA 3MGTB 4MVBD 5DSCB 2OXGA 1OP3H 1HH6B 1DLFL 1MCDA 2W65A 3ZMRA 1G7QB 3TFKD 2NY6D 2CLZA 1X5HA 3CVIL 5EOCH 3JVGC 4RZCB 2GCYB 5DJ6B 4G9FE 1RV6X 4IRSB 4K3DL 3BN9C 1VFBA 4K71C 4NQED 3ZO0A 2WQ8A 5I1IH 2E27H 4XCEA 1HZHL 1QEWB 4ZSOE 2OQJB 2PCPA 1J1OH 1S7UA 3FFCD 4K94L 5IVZA 1RULL 5KS9B 5DMKB 5FUOL 3MBED 2DLGA 5HJ3B 3UBXI 3ULUL 2EDYA 3IETA 1Z9MA 5C7XH 4PYGA 3WNNA 2VDQL 1WEJH 4WHTA 2IQ9H 5BZDB 4FABL 4WJ5A 1HEZA 1UENA 2JB5H 5DUMH 3ARSA 3ARUA 4P9MH 4XRCA 2ESVA 2BXYA 2H2PC 3WLBA 4LLQA 32C2B 1UQSB 3BDYL 5ECJE 3K1KC 3SKMA 1M71B 4LRNH 3VXQA 1IGJB 1OGTB 2ICWB 4L8CB 1RZ8B 5HYJA 4KK6D 1HNGA 1NJ9B 4LNRA 1KPVA 1IGCH 3S88L 4GRWB 4PRPB 1BIHA 2ZOKA 4HXBH 2GSGB 3F7YA 3FT2B 5EORL 3JWDL 5FHAH 5JIIA 2NZ9D 1YMMA 2HKHL 1NGQL 1CQKA 3MXVL 1H3XA 4HT1L 2NXZD 4N0CC 5IHUL 1E27B 3LKQA 3TT1H 3HE7B 3H3KA 1RJYB 1G7MA 4PJDB 5HPOA 1EIBA 4PGCA 5CGYD 2VLME 4NRZA 1WZ1L 3CVHA 1BOGB 3IGAA 3L3KA 1XT5A 4ODSL 4XNZC 4M6OL 3QDME 2P45B 1VFUA 4JM2A 2MMXA 1BD2D 1E4XH 2R1YB 2I9LA 1CD0A 3I02B 3IJYA 4OB5L 2VDNL 4HIHA 5DA4A 4PTTB 4P2QD 3MUHL 2DDQL 2WWKO 4PJCF 4P4KA 4HK3N 3TNMA 4QRQA 3PL6B 1MAKA 1F90L 1NCUA 7FABH 3ARZA 3WFBH 4AT6B 3JSSA 2EYRB 4NQTA 5D2NC 4P46D 4GJTB 5EO1A 2NY1D 3ROOB 3GMPA 3GRWH 4OKVA 3D2UD 2Q8AL 1A7PH 4IRJB 4ZUSB 3GB7B 5ESAB 4X7CC 1T20B 3TBVB 4WRLA 4CW1A 4M7LH 5ACZA 1EXUA 3OKKA 3U7YL 4GLRH 4GS7C 2ZJSH 3ARTA 4AMKH 4C59B 2A6IA 4L4VB 2NTSP 5DEGA 1IEHA 1RUML 2NW3A 2FYYA 2MCPH 4P49A 3QIBC 3QFJA 4TSCH 3QR2A 4O4YL 5C0JA 1LO2L 1FRGL 2QTEA 4YR6B 3GO1L 4PJ8A 2BC4B 3MX0A 1MCNA 5IK3A 2NY0D 3D0VA 5D7KD 3ZKXC 3BKML 3RKDD 1FPTH 4P23C 2B8OT 3C60C 3ZTJG 1OAZL 5MENA 5DRZA 3WYRA 1NH6A 2ERJC 3O8XB 4I2XA 4BZ2L 2RHEA 1OVZA 4ERSL 2QSTA 3T2NH 3HUJA 5HHMB 1RD6A 2JJTA 1B2WL 1RU9L 2VC2L 2WIIA 1P6AB 5MEPB 3P73A 3IDYC 5AZEH 2UZIH 5HVGB 1UCBL 8FABA 2PYFA 1RIVH 2Y4SA 3C5ZB 3MLTB 5F1NB 3S36X 1ZLSH 3ZKSD 4N5ED 5C0IA 1OP9A 3VFOB 4X5XA 1K5NA 1T2XA 2MQ0A 2P5WB 1N3NA 1OT1A 4PP2B 4JO2L 2OR9H 4R7DA 4LIQH 1U8QA 4L4TD 2BVEA 4OM0L 5MI0B 4X99B 2A0LC 4M3KB 2DKMA 4S1RL 4PJIF 4F8QA 2CKBA 4OZIF 5HY9B 1REIA 3IU4L 2BNUB 3IJSB 1NDGB 3V6BR 2ZOLA 5DK0B 2CIIA 4XBGA 1MRFH 1JGUH 3MRNA 4IS6A 5L2JB 4LCWE 1FFPB 3VFSA 3TESA 2CJUH 4O2CA 2KL6A 2P8PB 5LXGL 2GAZB 4X5WB 3NA9H 3GHBH 4M1GH 6FABH 1YEFH 1JRHL 5HPMA 4WUUE 4GG6F 4LPYA 4K7FB 3QNZB 1QFOA 3SCMA 2AJYH 4NM4H 4QRTB 5F7KC 5GS1C 2HH0L 1DE4A 3EO9L 4LSPH 3QAZB 4XMPH 4FMFA 1JPSH 5E99L 1V8HA 5K59F 4ZNCD 5J12B 4LARH 4BQ6A 3IVKA 3GIZL 4NO0D 4WWKB 4ODHL 2VIRA 3RWGB 2QQQA 2JLLA 4KJPC 2V7HA 5L88L 3EGSA 3EJJX 1T03L 4RGNE 2Y7QA 1DQMH 3P4LA 3D85D 3OPZL 4CMMB 1QQDA 1EK3A 3G6AB 3UX9B 4GUPA 3WO3B 2R4SH 2HVJB 3MJ7B 4JFPB 1FFNA 3SKNB 3I6GA 3EO1B 3VXNA 4NGHL 2O5ZH 3QHFH 1AHWA 4U6HA 1FZJB 5JORA 1UKSA 5IB3A 4UT7H 4MCZA 5FV1L 1A7QH 4MQXC 1BQHA 4JFDB 3UTTD 1FJ1A 2P49B 4S2SA 1WK0A 3PV7A 2R56H 2LVEA 5JLZA 5DHVH 3ARQA 4JQXC 3V0VA 4H8WH 3E6FB 3B4NA 1JGLH 3DYMA 1WBYB 3BQUD 4PJ5E 5DJDB 3RNKA 3PJSA 2WLYA 3TIEA 4LSUH 1PEZA 4ZQKB 3GFUA 1EJ6A 4V2CB 1B0RB 2DWEB 1ZGLP 1N59A 3PP3K 3LEXA 1S9YB 2Y06L 3S37X 1DBKH 2DIJA 4HUXB 1F3RB 1BOYA 2ENSA 3MRLB 1PLGH 5EIQA 1YEJH 3MLYH 3DO7B 3HZKA 1HHJB 1SVZA 5CHNB 4Z0XB 3RTQB 4UUJA 4QTIH 5EUOB 3VXRB 5I76A 4ENEC 2BERA 1PGRB 1INDL 1X5XA 4HCRL 1T89C 4DGVH 3X12B 4TVPE 1MFAL 5KG9B 2X41A 3NCBB 4HG4K 1K3ZA 1T1ZB 4DW2L 1W0WB 4QOKA 5D2LA 5FM5M 1YEDB 2YSSB 4U2YA 1EFQA 4L9DA 5L9DL 2JCCA 3EKCA 5KVEL 4WWID 3AXLB 4ZYKA 4EDXB 3TH3T 3F58H 4CKVX 4FTVA 3VXOB 43C9B 2GUOA 3CPLA 4OD2B 1CDYA 5DI8A 2WAHA 2AABL 2XZAL 4X6EB 4JREC 1TVHA 1HXYA 3G6JA 5GZOD 1UJ3A 1Z5LB 3DHJA 2OTWB 2QSVA 3LRSB 2LAGB 4UNUA 5HYJE 1IILE 4PV9A 4ISVB 5K9JH 3FJTA 4XMKL 3MZTA 2HG5A 3C09B 4Y5YA 5LKNA 4JFEB 3U9PL 1YMME 2XKNB 2Q86B 5IUSA 3T65A 3D69A 1R3LB 2ICES 3Q48A 1YN7B 3PWJA 4LCIH 4WFGD 2VDOH 4XGZB 1U8PA 4MZ2A 1IT9H 3TV3L 5ITFA 5BV7H 3KYMB 3QXTA 3INUL 1U93B 4M1CC 4NKDA 3DUSB 2ICEA 5AG8A 1TIUA 3FQTA 1T7YA 2BSSB 1DN0A 4EIZC 5TE7L 4RA0C 3OG4B 1FGNL 3R06B 3ULVC 4GO6B 3SN6N 2HT3C 3MROB 4G8IB 4WW2C 5A43C 4PLKD 4UB0H 1MRDL 1OAXH 1CFVH 2H3NA 5AYQA 3GSWA 3UPCA 1WV7T 3QPQC 2WQRA 4JHAL 4YFLF 3QG6B 1GPOH 4PJ7B 3T2OA 2VN7A 5ETUB 3NN8A 1CE1H 1NAMA 1UM5H 3HC0B 3MRIB 3KPRB 2RFXB 4R8WH 5ERWA 1AXIB 5C0BA 1TZIA 4XX1E 2IWGA 3DXAB 3RGVB 3QUYB 4JFYA 3K4AA 2F5BL 5SX5H 3DX9B 1B4JH 3FT3B 3VFVA 2I9TB 4ETQA 1AC0A 5D6DA 1JGDB 2J8UF 2FJFB 3R0NA 4X6BB 5I8OL 3BMVA 4X6FB 5ADPL 3GK8L 1I8MA 2LVCA 2RB8A 3QIWB 2GTWA 2R4RH 4PRIB 1F97A 1PD6A 2JB6A 3NCYP 1RK1B 2VDRL 5D7LB 5AAWA 4D9LH 4RAUB 3OTTA 3QEQB 1FNGA 4Y4HC 1G9NL 4X7TB 3NFPA 5EN2B 3FB8B 2V2TA 4X98A 1N0XL 1RUAH 1U3YA 3NZ8A 5INCA 3PABA 5DD5L 3ARFC 2C1OB 4N0YH 2AK4A 2EC9U 1N2RA 5JIHA 4HFUH 4ZUVB 3QXVA 4MCYB 5MENE 1S9KC 3AREC 1GH7A 1Z3GH 4LOUD 2VR9A 4I2XE 5DO2D 2CDEA 5GSRA 4KJYB 2YXMA 2P47B 3DETD 3HUJE 1A1MB 5I0ZA 3DRTA 1ZEAL 4JQVA 3MRCB 3ZE0E 3CZFB 3OV6A 5E5MA 4LSQL 2C3XA 3PGDB 3MOBL 4Q97A 1NUDA 2Z0BA 4C83A 4WCYL 5KSAA 2EH7H 1KSRA 1ZT1B 3U30C 1HN1A 1TJHH 2DQEH 3ULVL 1TCRB 5KSBB 3FFCB 4WNQB 1P4LA 5F7EH 3MBEB 3B3IA 3SGKC 3VI3E 3HE6C 2FL5A 3BHBA 1Q9OB 1R5VB 2FO4B 3QUZD 5CILL 3GIVA 4FQXC 4HKXA 4Q58C 4RFEB 1J5OH 3ESUF 1KCUH 1TCMA 4E0RB 1MCRA 3VWJB 1BX2A 3KPOA 2Y6SC 5E2VL 5D5ME 3HMWH 1WZMA 2IGFH 2CLVA 3B2UD 1KLGA 1LK2B 1T80A 4Y5XA 3P30L 3LN5A 2DBJA 5IMKB 3VJ6B 5CZXC 4JANA 3BFOA 4EN3A 4GRLA 4WGWB 1HQRA 3QQ3A 3AMKA 4JHBA 2OI9C 3BP5A 4C4KT 1KCVH 3VH8B 1T04B 2NXZB 4K8RC 4ZMAT 1WT5C 2PXYD 1IGTB 4HV8A 3T0EC 1KYOK 4FQHA 4Y16A 4X7EC 5J11C 4OLEA 3UYPA 2WK2A 4G43B 3KPQB 1CE6B 1VGKB 3FO2B 4H0IA 2V2WB 3DSNA 1BF8A 1UWGL 2E7MA 1BD2B 2OK0H 5LAXB 5JA9A 3BW9B 1BEYL 1DSFL 2VWEE 2GFBA 3KG5A 3QDJD 3C6SA 4P2QB 4BFIB 1N6QL 2BSED 5I30L 4PJ9A 2DI8A 4KRPC 3FO9A 3RNQA 1HKFA 3TYFA 1K8DA 5E8NB 3VWKC 1FVDA 1U8HB 4OCRL 4K23H 4P46B 3EJYD 2Y5TB 4NN5B 1F3DH 2NY1B 4PGEA 1JZ2A 3AU1A 3DNKA 4EUPB 4EOWH 3D2UB 4U1HB 1WFUA 2HYMA 3WS3A 1ONQA 2FR4A 3NFSH 5TQ0L 4PJEA 4MD0B 4U0RB 3EDDA 4JY4A 3V5DA 2BNQB 1QNZH 2HFGH 3PDGA 3BWAB 3GSXB 1EO7A 4N8PA 4J4PC 1RURH 4PV8B 4QY8A 2R39A 3FAWA 4N68A 3WFEH 1MCCA 2HFEA 4YGVA 1P1ZB 3V6FA 4X4XB 1F4YL 3QPXL 5DK3A 1A6WH 2VLJA 3LKNA 4DTGH 5IIEB 5J1AA 3WXVH 2NY0B 5DLML 2OL3L 1ORQB 4HDIB 1MSPA 3E3QE 3L3HA 4QOKE 5FB8B 4ODBD 5D2LE 1FC1A 4Y89A 2R9HC 3R4DA 5E94B 5FUCE 4L8SB 2JCCE 3GMNB 4W6WB 3RWEB 4D0BA 2G5BB 2VZ3A 1TDQA 2DJ4A 1OGAD 4FTVE 2X4OA 1QFHA 5AYUL 4Q6YA 2BVYA 3OWEA 4MD4A 2L0DA 1P4IL 3G6JE 3NH7L 3MV9A 3MGOB 4Y1AA 1HILB 5F7FA 2FNBA 3NCEB 4MQ7B 5HDLA 4NSKB 4TNVF 5EBMA 2C1PA 4L8BA 3EAKA 5EOTA 1DQDH 5IMOA 1LK3H 3D0LA 1IAIH 4NNXB 5I17B 1PG7H 2FBOJ 2Z92B 3CNKA 4BJLA 3UJIL 4G8GA 4OGYH 2ED8A 4L4TB 3CFEA 3IDNB 5SWSE 5BCAA 3S8WA 4XCCL 3WO4C 3LV3B 4PGBA 4FFVD 5FO8B 1EERB 4JR9L 2YRZA 1CFNB 5IJVA 5DJYB 3AMLA 4JVWA 4R26L 2NNAB 4OLVL 2CGRL 2FX9L 3EFDH 4MX7B 4OF7A 4PTUB 3OMZA 3CXHJ 2OTPA 1FCGA 5E56A 3IDMA 4HWZA 2YZ1A 4HWBL 2PYEA 2CO6B 3EZ8A 4L9LC 1PKQA 2AJSL 3QXAB 4KDWA 4LK4A 4MXVE 3MNZA 3QDHA 4UDUB 4PFEA 1DUZB 3GNML 2GI7A 4CVUA 5HYSB 4EI5D 1H0DB 3BZEA 2XN9A 3O6ML 3HNVL 3TBTA 3PE9A 4NM8L 5IROC 3RY6A 5IM7A 4H1LA 1CTOA 5TGBA 5BS0D 4P59L 3GJFK 1S7VA 3BP7A 3FONB 5AZ2L 2A83A 3O9WA 1EGJA 5GS2D 5F44A 3IKCB 4NO0B 1TQBC 1DVFA 2R0KH 1I1FA 4XP1H 2CRIA 3ZT5A 5A16B 5C0BE 3VGDA 4L4JA 5I1JH 3FB6A 5L8LB 3D85B 3T4AB 4WY7H 4MWFA 1MJJA 1NC2A 4J1UA 5T3XD 1U8JA 1HQ4B 4NDMB 5J13C 5HHXL 4OM1H 3MXWH 3NCFB 4HEME 4OQ1A 1SBSH 3RIAF 1UZ6E 3WIIL 3WN5C 2VUOA 2W92A 3QJFB 1BVLB 5J9PA 4FQ2H 1LD9A 1EBAA 4LSDA 3OR6A 3OKNB 4GG8A 4NCC2 3K2UH 3WUWA 2QSCL 4HKJB 3NVQA 5JXAL 1CU4H 1EHXA 5JUEL 5I0DA 5ISZD 5IFHH 1I9RH 5DQ9A 3ET9F 3ARGD 2MQ3A 1CGUA 1VEPA 2AK4E 2XG4A 4J3VA 2V17H 4ZFGH 4XAWL 5C0EA 2VXSL 2Z31B 1GZPB 1XGUB 3BXNB 4KXZI 1KCRH 3QUMB 1SHMA 3JUZA 2NLJB 1G6RA 5CKGA 4CDGC 4FQ1H 2YBRB 4HIEA 5F3BB 1NCCL 3MLZL 4N9OB 2D2OA 4AJ0A 4D2NA 3V7AE 3EOTH 1MREL 5J4MA 1CDGA 1AI1H 4LCUB 4N8CH 5K9QG 2D7OA 4IIQC 1TZHA 3NZHH 3PDOA 1KJVB 2WBJD 5T1MB 3ZDYF 5CBEB 1HHHB 1HYSD 4O2EA 4W4OC 2P8MB 2ADFH 1DN2A 3L1OH 1Q0YH 3TO4D 4UT6H 5J6HA 3HNTL 3DX8A 4YNYA 1QA9B 4LKXB 4QRPA 4F57H 3U1SL 2VERN 5GGUB 4YDJA 3RPIA 1JHLL 4L5FL 2VR5A 3ARYA 2Q6WA 2GTZA 4Z7VB 2CQVA 4WFFE 3BPCA 1EFXD 3RWHA 1YY8A 4I18C 4RFNC 3ZL4L 1FGVH 1TQCB 1BQUA 3GJFB 3HPLB 4JN1L 1FIGH 5A1AA 5I71B 5FYLH 4KK5C 4XAKE 5EBGA 3UPAA 3SDCA 3MLWH 1MHCB 3DROB 1QLFA 1KJ2L 3SDYH 4JPWH 1G7JB 4JG1L 1IGIL 5I74C 3O2WH 1QSED 2UWEA 3HMXA 4NUJB 1J18A 5IFAH 3R8BB 2FH8A 3O4LA 3P4MA 5C71A 2AQ1A 4HD9A 3WBDA 2A9MH 4RIRB 2QJDA 1FNHA 3U6RA 4LDOB 1DBAH 1FO0B 1ZVYA 2BFVL 4KHXH 2P46B 3LEYL 4YEEA 35C8H 5GQBA 3AY4A 4CGTA 3MJ8A 4BQ8A 4JVPA 5FM8A 3UCRA 1BQLH 1U92A 3SE9L 3LZFL 4G9DB 2ICWJ 4CN1A 4H26A 4RNRB 1G7LA 3VE0A 1RUQL 3BQUC 1BQSA 3U0WL 4L1DA 4LFHD 3QNXB 1KOAA 3VFNB 2QKIA 1OPGL 1H8OA 2HP4A 1JGEA 2ZCHL 3DSFL 2E7HA 1L7TH 4NO5A 4D8PB 5HGBB 1Y6KR 1GGBL 1RZIA 2Y1VA 3AS1A 1KPRA 3T2QA 1AIFA 1F4XL 2X4SB 3MRBB 1VPOH 1F8TL 4PJEE 1CR9L 5FDWA 3CDGB 3TPUA 5IB1B 3BH8A 4HIJB 5IOPB 5KVFH 1MQKL 5L6YL 5C0RL 1OCWL 1CFSB 3IDGA 3QI9A 4LLDB 4LSRH 1YEEH 4MAYD 2D7TL 4L3CB 2VLJE 1WFTA 3FFDA 3RI5K 1U0QA 2A73B 3BSZL 1I7TA 1HHIA 2N56A 1QRNA 3WFCH 3HC3H 4NQXA 1FYTD 4KPHL 4P9HH 4P2OB 1GOFA 4U1MA 1WAAA 2XTJD 2Q3AA 1VKXB 1NAKL 4Y4KC 1NGPH 3C5JB 1BREA 4Z77B 2F53A 3MUZ1 2VXTL 1JTTA 3FT4A 4OFVA 4P2YA 5DFTA 2J6EL 1JVKA 4N8VA 5F1IA 1BJ8A 1XEDA 2HKFL 1CN4A 1YECH 3ILQD 3RVWD 3RWIA 3MV9E 3MJ6A 5HGHA 3SKOA 4Y1AE 1DQLL 1RZ7L 2B1HH 4GRWH 4PJAA 4XPTL 4B5EA 3FO0L 5IMLB 3G5VA 4K9EC 3BPLB 1GHFH 1OF2A 3VCLB 2IQAB 3STZB 3SY0B 1J0KA 3CC5A 4XXCC 4QEGA 4O2FB 4G8GE 3SDDA 2H8PB 4AENA 5I1CL 3QUZB 4JRXA 1T4KA 1YEIL 1G84A 1Q9KA 3ZE2E 3M17B 2F58H 5EU5B 2OYPA 2G75A 3D48R 3TPKA 3PNWA 4PIRF 5B38B 4GRMB 1RPQA 1CG9B 5HDQL 1KT2A 5DJCA 1A1OA 2OP4L 1LVEA 2C7UA 2PYEE 3QB7C 3V52H 1AGCB 1YNLH 5EO9B 2E7LC 1P7HL 5IB2B 4PB9L 1PKQE 5CS7A 2Q1EA 5HHNA 4WUKL 5IMMB 4FG6D 4D9QE 1DCLA 2VL4A 1KELH 1UB5B 3BD5A 4OF5A 3UTZA 4LVNC 2XN9E 4K7PL 2Q8BL 3WNLA 4OLYH 2PXYB 25C8H 4Z78B 3BKJL 5C6WH 1CT8B 2XWTA 4OCYL 3W0WE 1H15A 4H88H 8CGTA 3WNPA 4V1DA 1OOAA 4QRSA 2B5IB 4LF3A 3VH8G 4C56D 1MCSA 4HS6B 4UBDC 5ILTL 1G7PA 4KI1A 3BUTA 3BPOC 4JLRB 4JPIB 4M61A 2QADC 4OD3L 2OSLB 2W07A 4POUB 3SKJL 3WV0A 3BEWB 4DAGL 5GGVY 4G8EA 1HSBB 4G6AD 5DVKA 1IARB 4WFED 5DO2C 5B8CB 5C0AD 3VGAB 2F19L 4NQVB 1ZHBB 3P77A 1EMTL 1UVQB 2LTQB 4LLVA 1MOEA 4K9EL 4JM2C 1ACYL 4PJCB 1F13A 5E1AA 3Q6FB 1K2DA 3HG1D 4WI9A 4EUPG 1MF2H 2FX7H 4R96B 3CLEH 4XNZB 1OSPL 1XF5B 4MB3A 5EC2B 3UTPE 1A14L 4HUVA 3CFJA 3MRQB 1CFBA 4EVNA 4OV5B 3T1FB 3WFDH 4I3RL 3LSOA 4M8VA 5DRWB 4G6FD 4ORGB 3MR9B 2GITB 4G5ZH 1PSKL 4JDTL 3S98A 4DEPC 2X42A 3PQYD 4HPOL 4JGMA 3C9NB 4P5TD 3STLA 3IXAB 4R2GC 4TVPL 1G7IA 1CK0L 2I07B 4AIXA 3SGDH 2WV3A 1TLKA 4UQ2A 4JPVL 5C07D 1E4JA 1MUJB 3BI9X 4UQ3B 4XNYH 5I8EA 4M3JA 3V0WL 4GW1A 4FMKA 4BZYA 2N7AA 5FUZL 5E6IA 3DI2B 4U7KA 3RVUD 2IAMD 5GHWH 4XNMB 4ZAKD 4J3OC 3MLPA 1A6VL 3B9KD 4MJ6B 1OGAB 5L2KE 4MA1B 3WFHB 3VFTB 3UPRA 1ZGLB 1R24B 3DTXB 4XC1H 1HDMA 1T0NB 1RUPH 3D9AL 3DGGB 3CU1A 3FOMB 5BZWA 4QRPE 5DJ8A 1NANI 4EI6A 5I1DB 5E8DH 1S5HB 1JZ8A 1EEUA 1EAPB 1BBDH 1CBVH 1CXIA 3M45A 2IPKB 2YEZB 1T0PB 4BSVB 1JPGA 3JXAA 5KVDL 1L6XA 1QVOB 2P42B 2ITDA 4OI7A 4J3UA 1KFAH 4Y19E 1S9WB 5C9JB 4K3EH 5DD0L 4P23B 1U3HA 4ZXBC 4M5YH 2VDKL 4OGAD 2UWEE 1WFNA 4XNUH 3O4LE 4X4YA 4NUGH 3MO1B 4NJ9H 4ZPVB 2XPGA 3D5OF 4HJJH 4F37F 4WEMB 2R69L 4O00A 5DJXA 5HVWA 3CH1B 2F15A 3QDGA 2NXYD 1RJCA 1D5XB 5T5FL 1KJ3H 1G9MC 4YHPA 4EQ3A 4YHYB 3RUGF 5A2JH 5IEHA 1CLOH 5J0BA 4NNYA 4U1IB 2JK5B 1LE9A 3FB7A 5HGAB 4MJ5A 4PJIB 3WIFB 1F6AB 4OZIB 1ADQH 3HI6L 2E6QA 4YHZL 3MYJA 4WI3A 4EI5B 2D7NA 2B39A 4PREB 3U4EA 2A2QT 3I50H 5BS0B 5I15H 4YDKL 4U1LA 4OBSA 2OTUA 3OX8A 3S3SA 4P2RA 2PO6B 3KJ6L 1QPXA 3VRLF 2ZSWA 5SWZA 4NZTL 5CEZL 3QXDA 4X9BA 5HYSG 3P40A 1A4KA 4GG6B 1FFOA 3EOBB 4LCCB 1PZ5B 1FNLA 4P3DB 4APQA 1W8OA 5BJTB 4GXVH 4JFFA 5CJ8A 1A6TB 2DQJL 3CFBB 5H37G 3RL1B 4HWNA 4DQOH 4YHOL 5GRZA 1ED3B 1OD7A 3UAJC 1Z0MA 3ESVF 4G9FD 2Q7YA 2VOTA 4N0UA 5BRZD 1AP2A 2IFGA 3BKCH 4IRZL 4NN6C 2XNAA 3LIZL 3MJ9L 1MWAB 1XGPA 1VB9A 4DK6A 5HHOB 4UTAH 3O6KL 5GS1B 4KRLB 2C3GA 5ISZB 1PG7W 5F96H 3WXWH 3ARGB 1I8KB 1F4HA 1ZE3C 3KHQA 1N4XH 1JPFB 1RFDH 2DIBA 3VRJB 1QRNE 5FHBH 1J9CT 5E2WL 4GKSB 3CFCL 4D0DA 1LO4H 3BRGC 2AJXH 3I2CH 1AY1L 2DQDL 1WAAE 3KYNB 2UZYB 1I1CA 3IFNL 4JDZB 3BZ4B 2F53E 1AHWC 2P8LA 3BIAX 4HK0A 5JDSA 1T1YB 5LVEA 4HG4J 4M4PA 1W0VA 5I1KH 2IC2A 4XT1C 2EDEA 4X8JB 4PJAE 2Z8RA 1AR1C 1FSKB 1KG0B 1G9ML 1KCSH 2DAVA 1XR8A 3DURA 1FBIH 1S5IH 1XGRA 3P9LB 4N0FA 5TDPB 5IF0B 3V8CA 4AIZB 2VKXA 5I18L 4GW5B 1DDHB 1ITCA 1SEBA 3OKLA 1A1NA 2A6JB 4AEFA 1F4AA 1PJ9A 5IW1A 3PWVB 4Z7UA 3QDMD 4AG4L 5MEQA 4NHUA 3GSQB 5FECB 1MFCL 1JIBA 2WBJB 1MIEH 4JRXE 5HI5D 1U8OB 3QEGL 1CD1B 5H35A 4Z7WF 3R0MA 3V6OC 5HI3D 3TVMA 2CKBL 1GZQB 4PBVC 3U2SB 3D39A 5HD8C 2XRAL 4RISH 1B0GB 3BEVB 3TN0D 4DZ8A 1NCAL 3VRIA 3DVFA 4J8RA 1EFXB 4WFHE 4ZTOH 3S4SA 3KJ4B 4QRRA 5FUCC 2P5EA 4KKAD 1CD9B 1RVFH 1A3RH 2ATKB 2BCKA 4UTBL 4MJIA 4LSVH 3LN4B 1NBVH 2DQHL 1QSEB 3RVVD 4XCYA 5D1ZA 1I8LA 3EYQC 3VXMA 4PB0L 3O6LL 2P44B 3PP3H 5HHQB 5ITBL 1UZ8A 3QRGH 1D5ZA 5EPMB 1N5YL 4V1DE 1XZ0B 1YJDH 4ZUWA 4TTDC 5T3ZD 5I1HH 5EZOL 5F9JB 3SE4A 5JR1L 1QFWM 4JREB 3RA7H 3T8XA 4TUKL 2CMRL 2Z91A 2AJVH 4Y5YC 2HWZH 1E6JH 5ABDE 4ODXA 2R8SH 5E2UH 4B0MM 2B2XH 3DHMA 1MPAH 1FDLL 1BBJB 4HF5H 4CRPA 2L4OA 4L3ED 4F7EB 2IG2H 4ZO8A 4YHLH 1CGXA 4OQTH 3W9EB 2EIZB 1TMCB 4AEHL 5FK9A 4G80A 3FHAA 3WDHA 3ZKMD 2ZUVA 4MNQA 5D7IB 5HYQB 5F7MC 2BVPB 1NGWA 3K2MC 1K9TA 5FA4A 3WKMH 3U83A 4G7YH 4PG9B 5CD5C 2DI9A 2ZP0T 2V6HA 5F93C 1EH9A 2R0LL 3BP4A 4UOW1 2XTLA 4G6ML 4LHJB 3E6HB 1DBJH 2EKSB 3VXPB 2Z35B 4FQPA 3NTCL 3FN3A 3MNWB 4MAYB 3ZKND 2J8UB 5KTEH 1IFHH 1IC7H 1T21A 4HUUA 1AXSA 3EYUH 4MXVF 4QGTA 4RBPK 1D6EA 3L7FB 3C6LC 4PY8I 3QWOB 5GS3A 5D71L 1FYTB 4M7KL 2CUIA 4KC3B 4LCWD 1IRAY 1IGML 4KVCL 5TF1H 2IFFH 4N1CA 2VABB 2XG5A 2V5YA 5EO0B 1MFEL 2W0PA 1P7QD 2X4UB 4WUUD 1H5BC 1VESA 4ZOAA 4RMSA 3S9DB 1XGQA 3QCVH 1CDCA 1OARH 3RHWF 1IM3B 1F45A 3OAZK 2FLBT 4JZOB 1JPTL 3WD5H 2X4TB 4JGJA 3SDAB 2CIKA 2DQIL 3L3OB 2P7TA 5D4QA 1UZ6F 3V4PL 1U8NB 4RGND 4LCYB 1IAIM 1OD9A 3WJJA 3SHSA 1E4WL 3BUYB 5EU6B 4MNHA 4MS8D 5T33H 3AREB 3MRKB 3W9DB 1KTDB 2NY5L 2X05A 3QULB 1VSCA 2XXMB 4WI6A 3TYGH 1BFVL 3QDGE 2QV2A 5TDNB 3DOSA 2W9LA 5IFJA 2ILLA 1VENA 3TGXA 5FCUH 3MLXL 2VXQL 3EYSL 4I0PA 3QYCA 4LAQH 1G7HA 5B38G 3LRHA 4G7VH 1IAKA 4EUPH 4LHUA 1KYOJ 1ZHKA 5D1XC 4P3CL 5CJXC 4FFYH 4JAMB 4XTRC 4Q2ZA 2ZZUT 2ADIB 4JKWA 1RHFA 1S8DB 4P2RE 5DF0A 1I7UB 4CVZB 2CKNA 5SWZE 4KTYA 1SM3H 3CSBA 3TC9A 4C56B 4E41A 3EHBD 2P48B 1K8IB 4JZJC 2UZXB 4JFQA 1JHKH 3K8LA 4JFFE 4LSSH 5F9AC 4FN0A 1M05B 5FM5O 3HZMA 4O58H 4TVPD 5D8JH 5IBUB 2OX5A 2HRLA 4EN3C 2RGSA 4PY7A 4XP4H 4LIQE 5JHDA 2I24N 4N0UE 4HH8A 3T3MF 3U46A 2FSEB 3QIUC 2XTJC 3SEPA 1UH4A 5C0AB 5KN5B 1XCTA 3K81A 5C0FA 3KYAA 4Y16C 2BOBA 2OI9B 5D7SH 3B2VL 3PGCB 2I27N 5CBAA 2HT2C 2AXHA 4TUOA 4F3FB 3L6FA 4LMQI 4WTZG 4M6ML 2F5AH 3U4BH 4JY6A 5GSVB 3QQNA 2HMID 2CDGB 3KPMA 3N1FC 4QXTA 2VISA 2ESVD 5K9QI 1FG2A 5KOMC 1NGZB 3F6LA 5J11B 2R1WB 3HG1B 4TRPL 3SE3A 3MPCA 4BFBD 4HKBA 1ZHNA 4RMRA 4TSBH 4PJ9C 3FOLA 4PRHA 3Q0HA 2ZUYA 4XWGL 4DKDC 4PGDB 4G6FB 4DVBB 4CU8A 1H8NA 4GAGH 4HC1H 3PQYB 1FNEB 1P69B 3REVA 4IHOB 1YMMD 1EZVX 1KLUB 4GSDH 4P5TB 5EU7E 1M6OB 2FIKB 1FL6A 2YMXH 1FNSH 4FQLH 4PJFB 5C07B 4Y2OA 1KB5A 1V7NH 2EE2A 5DS8B 4OD1L 1JWMA 1QOKA 2WUBL 2DQTH 4PJXA 5F7NC 1J0IA 1CIUA 1GOHA 4DWHA 4OZHA 4LDEB 4Z7UE 5ACMA 4ZAKB 2W59A 2RAMA 1GYAA 4NWUH 3B9KB 4PJGF 3UBXB 2EIBA 1KN4L 3RIAK 2UUDK 2PUQT 3EW3B 3Q3GB 3D39E 4P4KD 1T22A 2VSCA 3FRUA 1DUYB 4WEBL 5CINL 1UH2A 2MJWA 4ZUTB 5I1EH 1IQDA 2K7PA 1ZVSA 3GGWA 4XPFH 1PDKA 3SGEH 1LP9E 3QXUA 1Q9LB 3RL2A 4YPGA 3DMMC 4QRRE 3T2PA 3IRPX 2P5EE 2ZG3A 3ARDC 4R0LA 1D5IH 5CSZB 4QHNA 5FYKE 2HLFD 2XZQH 2VZ1A 4X4MA 4MJIE 5MEOB 2CXGA 3ABZA 5CWSB 3UMTA 3MLUH 4NOFA 3VXME 1BIIB 2FD6H 4XVSL 1TPXC 2APBA 3MRPB 3KAAA 2NXYB 5E6ZA 4U4BA 5DVNA 1OM3L 4DKFL 1D3CA 1XGYH 4Y2DC 3LMJL 1MFDL 1U41A 3QFJD 1BWWA 3UJTH 5FKAA 4PJ8D 2GQHA 1KEGL 3MRFB 4YK4C 5JQ6H 4UV7L 4I5BB 4DZBB 2BNRD 4OAWA 5MEND 2BJML 4J12A 1AH1A 3F65A 1MAMH 1UXWA 2OJEB 1F2QA 1LEKB 2ZCKL 5JOEA 1WC7B 1O7SA 4PR5B 1NMBH 2EH8L 5KW9L 3TZVA 1X5AA 4MNQE 1R5IB 4FZEL 4N9GA 5E00B 3UTSD 4MDIB 3QUMH 1DL7H 1AD9A 3MRMA 2A77H 4G9FB 4G3YH 2XY2A 5ICXA 1CLYH 5C8JB 3GMLB 3RVUC 4NKIH 2IAMC 4M43L 1DANT 3BIKB 4ZSOB 3W39A 1S7TA 2FATH 1SJXA 4I1NB 1RUKL 1XGTA 4Q6IB 1MH5A 4YBHA 1FN4A 1Q94A 4NRYB 1ZLVK 3MBXH 1FG9C 1XF4B 1C5DA 3EIFA 3KYKL 4KMTH 1TQBB 2VE6B 3RWJA 3T04D 1M7DB 2DKSA 3VFRA 4LQFH 1A7BA 4UILH 4J3TA 3TBWB 2FLRT 1YPZF 5DUPH 1MVUB 1LO3L 3U36B 1A0QL 4LLWB 1CWVA 5DD6B 3GJFH 4XCFH 3F7VB 1HI6A 3CIQA 1GAFL 1TTFA 3MC0A 4OCSL 1RQ5A 4Y4FA 3LH2L 4GMTL 1MCOL 3SO3B 2E9BA 1JYWA 1TXKA 3QDMB 2DQGL 1D5BB 3OR7A 5DK2A 4NKOA 1FO0H 3NABL 3HZYB 3OJDA 3TJHD 1FZOA 1RMFH 4PLOB 3EJZC 4NWTL 1AD0B 1V3MA 1HHKB 3VXTB 3VFPB 4OGXL 3TN0B 2H1PL 5ESVB 4ZS6D 3P9WB 1XF2B 1HOCA 4GKZB 4IEFB 1OP3K 2DM3A 5BOPA 3X3FH 2Q76A 3FCTA 3E8UL 4JB9L 2WANA 1TETL 2GSIA 1T1XA 2ATPB 2M2DA 3T0XA 4C54A 1RY7B 5DGRA 4X0KA 2B0SL 1IKFH 1GL4B 2AJUH 2NR6D 4HIIB 4XVJH 3LD8B 5K9KB 1FP5A 2HLAB 2I60H 2DQFA 4YXKL 4YDIH 3PHOB 3BPNC 4HW6A 3CFKA 2JJSC 3MV7D 4IIQB 4ODUB 2ADGB 1I1AA 2MHAB 2YC1B 2FEEL 2CK0L 3O3EB 4PG2A 3KWWA 5CAYB 4E41E 4KI5F 2AEQH 1TZGL 4LVOC 4G8FA 1IKNC 3VFMB 2Z4QB 4HFWB 3G6DL 3SPVA 3ARBC 3VFWA 1C8PA 2QR0A 4CMHB 1UB6B 5F3HA 5JW5A 1MHPH 3V8OA 3CU7A 3JVGA 5JHDE 2YA2A 4QOKD 5I2IA 1A7RL 5TFSH 1TTGA 1T1WB 4HQQL 3IDIB 1V5JA 2H2SC 4AEEA 1QKZL 3KNBB 4CVXB 5I74B 4R90H 5GRYA 4POZD 4LFHG 4FTVD 4HMDA 3HS0A 3MNVB 3SDXF 1BWMA 4M9PA 4WI4A 4WV1C 2A1WL 4JFXA 1KBGH 3GMQB 3CUPA 2OLDA 3CMOH 5KS9F 1I8IA 5CIPA 1XIWA 2UWEF 5T1LD 1U91A 1Q72H 1S7RA 2AP2A 3QWRD 4PRHE 1V7ML 1KIRB 4RWYH 5KANG 4F58L 4HUMB 1F6LL 5IHUH 5HI5C 2BMKB 1UKTA 1DANU 3K74B 2RQ8A 4D3CH 4MLIA 3OJMB 1RK0B 2A9NL 2VMFA 5FA3A 2Q20A 2SEBB 1WZ1H 4ONFH 4ODSH 3MOQA 5GIRA 4I3SH 1A9BA 3MLVL 3OSKA 1QZ1A 1UA6L 2VDNH 4LCWB 4PJXE 2AKRB 4NNPH 3RY5A 4JZNB 4GKNB 4OZHE 1A7OH 1JNJA 1P7QB 4MJ4A 4PS4H 5CJQH 5F89B 3VFGL 1KB9K 1AKJA 4WUUB 3G9VA 1AO7A 2D0GA 4NP4H 5DZLA 1S7XB 5DWUH 3CFDB 2Q8AH 1IAOB 2J5LC 4ODTH 1NGXA 2W91A 1NQBA 4FQQA 4LL9A 4L29A 1ZMYA 3LKSA 2BHUA 5D2NA 1MCWW 2ZPKH 4RGNB 1G7QA 4JM4H 2O61A 4X4ME 5EG6C 1QRKA 4RZCA 1YEGH 3HMXL 5EWIH 2GCYA 5TE4H 1Z6JT 5FOJA 4IRSA 1GC1H 4UIMA 1JYXA 3QH3B 1LEGB 1QEWA 2NY4C 4OIIL 2MOVA 5KSUA 4NQUA 3WIHL 4WENB 3MLRL 5EU4A 2E6PA 2IJ0C 5HJ3A 2XQYK 4P0DA 2VH5H 1VDGA 3SE8H 1AGFA 1JPST 1U2CA 4R4NC 1KC5L 1JTOA 1DR9A 2Z9TA 4KTDH 3ZYZA 1T66D 5GPRA 1YNTA 4RGOH 5C2BH 3LPGA 4B50A 2NW2A 1IGJA 1OGTA 2LAAA 2ICWA 3TM6A 4BYHA 2FZ3A 1N64L 5IBTL 5EBLA 2ADJA 2GY5A 4FQCH 3TO2B 5DMIH 3KLDA 1WVZA 4FFWD 3MFGB 5K93A 2W65B 3SOBH 3T0AA 1FVCA 2CLZB 5FV2A 1CFQA 3GBML 4I48A 3OAUH 4GH7B 4ZS7L 3S5LA 1VFBB 3VG9C 1L7IH 5KSAD 4XCEB 1NMCC 1GIGH 1F3JA 1YYMH 2B1AL 1MIMH 1PW3A 4MZ3A 1S7UB 1XF3A 5IVZB 5JNYA 5I73B 1YY9C 4NO2A 5DVMA 5IBUG 3GSNB 3IETB 4K07A 2DLIA 3BESR 3I02A 1JUFA 4WHTB 5C9KA 4OF6A 1HEZB 4IDJL 4Y5VC 1JNLL 1E28A 4PTTA 4RDQF 3KR3H 4XRCB 1FAIL 2ESVB 4OSUH 3WLBB 4LLQB 3PL6A 1S9VA 3VXQB 4HCRA 5HVHB 4G42A 4JEGB 2E7BA 1BFTA 5D93C 1KPVB 2HH0H 3ROOA 4CL7A 2ZOKB 5F1SA 3F7YB 3BYTA 3HB3C 4O9HL 4GRLD 1YMMB 3RZCD 3ZDXE 1G9EA 1HCFX 1T20A 1KIQB 3NAAL 3S35L 5M95B 3BJ91 5T1DH 3T1WA 1C1EH 1NC4A 1DBBL 3LKQB 4ZO9A 2X4PA 3SBWA 4U1GC 1G7MB 4NC0B 2MCG1 2H26B 3RPKA 2HVKA 4PGCB 3IFLH 3VXUA 4NRZB 3CVHB 4KHTH 4YHML 3IGAB 3L3KB 3GHEH 1WZLA 4HBCH 4MXQD 1X6LA 2I9LB 3VW3H 3X13B 3GSUA 2VDLH 2DB8A 4OGZA 3IFOA 3K3QA 4YR6A 4HIHB 3P0YH 1OAYL 3CLFL 4P4KB 1HIML 4O51A 1OAKL 1OTTD 4ELME 5J56B 5I19H 3UBXG 3O8XA 4KJQD 5EO1B 3S37L 5FGCE 3IDJA 4YHKH 2QHRH 7CGTA 3GMPB 2WZPD 2IBZY 3FTGB 4OKVB 1U8KA 2ZUQC 2VL5A 4Z7NE 1NSNH 3GJEB 5GS2H 4X7FC 1VEOA 1IBGL 4JO1H 3RX5A 4CW1B 4GOSA 5ACZB 2EDJA 3BWUC 3C5ZA 1EXUB 3OKKB 1KIUA 5I9QB 1INDH 2A6IB 5DRNA 5T3XH 5EOCL 1YQVH 1C16A 3LKPA 2NW3B 2FYYB 3PHSA 4OFYA 4XCNA 3LN9A 3QFJB 1SEQH 3UTQA 5I1IL 2E27L 3DYOA 4PJ8B 3FQRA 1J1OL 4CJ1A 4CUCA 1W72B 1I1YA 4KKBD 1MWAH 4XI5C 5HY9A 5IK3B 1T89A 1U95B 3IJSA 3D0VB 1NDGA 3GM0A 1IM9A 2BNRB 1ZLUK 5C7XL 2IADA 5IB4B 1WEJL 5MENB 5DRZB 1K6QH 2IQ9L 3WL9A 5EUOF 5AWNH 3RVXC 2BX5A 2JB5L 3CD4A 5DUML 4DOHE 1FZKA 2AABH 4I2XB 4P9ML 2ORBH 3WNKA 1HNFA 2GAZA 2C4FT 4X5WA 2X70A 3HUJB 2CPCA 5DVOA 4LRNL 3VGBA 3KPSE 2WIIB 3QNZA 3B8SA 5BMFH 3P73B 1ZT7A 4PRBA 1IGCL 1F58H 4U2ZA 4Y1AD 2PYFB 8FABB 3TH4T 1J1XH 4IJ3C 5FYLE 2IH1A 5FHAL 1FZMA 5C0IB 1IEAA 5EOQH 4X5XB 1K5NB 5F6IC 4UZGA 1N3NB 1NFDE 3F5WA 5GRUH 4R7DB 2BRRH 4G8GD 4LLYA 3TT1L 3MYZA 4EEEA 1U8QB 5ESQA 4HUWA 2W60A 4YBLB 3LS4H 3ETBF 1XR9A 2CKBB 5EZLA 1Y6NR 1FORH 2HVJA 2ZOLB 3VGFA 5E9DE 5I1GH 5GRXG 1E4XL 2CIIB 3MJ7A 4JFPA 1X5IA 3SKNA 4XBGB 5SX5K 3FQNA 3MRNB 5HTSA 2FIRT 5IW6A 1SY6H 1ADQA 2VXUL 1FZJA 1PFCA 3V4VH 3C2AH 4MNGA 3VFSB 4B7IA 3DV6A 1IGFH 3G5YB 4JFDA 5HPMB 5J8OA 3MTRA 1A3LH 1MLBB 3WFBL 1WBXA 4XVUD 3SCMB 1W8NA 5GZND 5D96B 1DE4B 2XN9D 4IOIA 2VLRA 3GRWL 4CN4A 4C58B 1LDPH 1NBQA 4HGKC 4ZO6A 4NT6B 3O9WD 5SX4I 3IVKB 2X89A 4UU9A 5KVGH 4U6VH 3TA3C 1DVFD 2VIRB 5F7WC 4KROC 3MRLA 4M7LL 3DO7A 3G04A 2V7HB 3EGSB 4KV5F 3MLSH 1AQDA 2XZCH 2Y7QB 2ZJSL 4AMKL 3QNYA 4NZUL 4PJ7F 1QQDB 2FGZA 1ITBB 1NC2D 4BQBA 3A6BH 5A40E 4QO1A 2MCPL 4X7SH 1I4FB 4ODVH 4TSCL 1FFNB 4H20H 2CRYA 1TNMA 3AB0C 2F54D 4U6HB 1CICC 4UMGA 5IB3B 1FPTL 4YQXH 4KJWC 1BQHB 1FJ1B 4OD2A 4S2SB 3VG0H 2AEPH 1WCQA 4N0RA 5JLZB 3E0GA 2AI0H 3V0VB 4R4FH 4PLJD 5D7JC 3MV7B 1JNNH 3PJSB 3RNKB 2AJZA 3LRSA 2HT4C 4HHAB 1N59B 4ISVA 3L3GA 5AZEL 2UZIL 4GRWE 3HZKB 1RIVL 3FRPG 4WU5A 4JFEA 2AK1H 4UUJB 4X9FA 1ZLSL 5I76B 3WDIA 1U2HA 4P2CG 1UEYA 3KHOA 1CIDA 5I8CB 1YN7A 4H8WC 2EDKA 3H9SA 4KK8D 2OR9L 1VERA 3W81A 1FH5H 3MRRA 4LIQL 1FQ9C 1U93A 4QOKB 3DUSA 4G6JH 1ZHLA 2DWDB 3NIFF 1I8LC 3LQMA 4CADA 4H5SA 4KI5D 1WICA 5DMGC 4ZYKB 1KENH 4TNWF 4FTVB 3FMGH 1MRFL 1LHZA 1N8ZA 3CPLB 2FO1A 5DI8B 1MJ8L 3MROA 3SE4C 2VSDA 1I85C 2CJUL 3G6JB 1HXYB 1QPPA 2V5MA 1UJ3B 3NA9L 3GHBL 4M1GL 1UYWL 6FABL 5T1LB 1YEFL 2A6DA 2F8OA 4RA3A 2EDLA 2G60L 5EC1B 5JTWA 2AJYL 3EFFA 4PV9B 4NM4L 2OL3A 2RFXA 5CSGA 3B5GA 2HG5B 4LSPL 4XMPL 1HSAB 1JPSL 3DX9A 1DP0A 3SDCD 2I9TA 3T65B 4LARL 3PWPA 2PW2A 3D69B 4YWGH 4Q7DA 2FJFA 1WZKA 1U8PB 1JRHI 4Q0XH 5ITFB 5IW3A 4X6FA 2V5TA 4QHKI 1A5FH 5LBSH 1WT5A 1V05A 5DJ0B 1BEYH 4PRIA 1DQML 4KU1A 1LO0H 3H9YA 3T0EA 4I4WA 5E2JA 3VXUE 4RAUA 1O7VA 3FQTB 3WEXB 1DN0B 1ZTXH 1WGOA 1S7SA 2R4SL 1NCDH 5I1AB 3X3GH 3H6JA 1BFOB 5F9OL 3L3IA 5BV7C 2O5ZL 2GKIA 3QHFL 4TPRH 3BGFC 5DMJB 1PKOA 4X9IA 2H3NB 3GSWB 1A7QL 2NY2C 3HZVB 4LEOB 5H2BA 1IGYB 3O6FD 3VWKA 3NN8B 5CUSL 1NAMB 4YBQC 4YJZL 1FYHB 1L6ZA 2WSKA 4H8WL 4P4RA 5ERWB 3B9EA 1A1MA 4YGAB 1JGLL 1TZIB 5C0BB 4LSUL 2V2XA 2NQCA 3LVEA 3X11A 3MRCA 3VFVB 4ETQB 1KNOA 2GIYA 4U49A 2BSTA 2NYYD 1DBKL 3HR5A 5JOFB 1PLGL 3PGDA 1YEJL 3MLYL 1SJEB 5F9WC 1I8MB 4QTIL 2DLHA 4HXAH 4NQEA 3IDUA 5JZ7C 1F4YH 1JNHA 3QO0A 4DGVL 2AV1A 2JB6B 2VB5A 3U0TB 2EO1A 4WNQA 5JW3L 4QHMB 1FNGB 4KKCD 4U31A 3QI9D 5TF0A 4OLZH 3NPSB 3RBGA 2V2TB 1CGWA 5MHSE 4RFEA 4Z18A 1NLDH 3NZ8B 5INCB 4M02A 3PABB 2CH8A 5AUMA 3ZHDA 2AK4B 5LQBH 1N2RB 1IE5A 3WJJC 4JQIH 5M94B 3F58L 5C0CD 4HK3J 4M48H 1CF8H 3LKRA 5TE6H 3BO8B 2NX5A 5DD3H 2ZNXA 5GSRB 3VJ6A 3AC0A 2EDHA 1W2KT 3ZSTA 2F53D 3OF6A 3DRTB 2D31B 4L4VD 2FJHA 4I0PC 3OAZH 4RGMC 2QQLH 5E5MB 5K9JL 4JRWA 4N1EA 3CDFA 4JKPH 3H9HA 4ZFOA 4NQDD 4C83B 3LPFA 1JK8A 4XHJC 5KSAB 5HHVH 3F12A 2VDOL 5GGVH 1NCTA 1P4LB 1ZKAA 1VGKA 2AXJA 4H25A 3ARWA 3FO2A 5BV7L 2V2WA 2BOCA 3B3IB 3F8UB 3BHBB 5LAXA 3GIVB 4HKXB 4JRXD 1OT2A 3H0TA 2OZ4H 4N5UA 3CSPA 5FM4A 4X6DA 5A2LH 1BX2B 3D3VA 4LGSB 3MV11 2CLVB 3R1GH 1YNKH 1U36A 3FZUC 1MHHA 4PJHA 4P46A 1QFUH 4Y5XB 4MNGE 4UB0L 4WFHD 2WWMD 3LN5B 1OAXL 1CFVL 4U1HA 3RDTC 4A6YB 3F6IA 4JFDE 4EN3B 4GRLB 1HQRB 3QQ3B 3RZCB 1GPOL 4L9LA 3ULVE 4QHLA 3BP5B 3V6ZA 1CE1L 1UM5L 4TULH 3BH9A 5C0NC 4R8WL 2VLRE 4MSWA 4HV8B 3GSXA 5CLWA 5IROA 1BJ1J 4FQHB 1B4JL 4ZFFA 3VI4E 4HJ0C 1C7TA 3NOIA 4V1DD 5EIIA 2EDWA 3PDDA 1A4JB 1UFUA 3AM8C 3HPJA 4P3WA 3GKZA 4XPGH 3O3DB 5CP3H 2R4RL 1Y0LA 2GFBB 1A8JH 1RJZA 1WTGT 3C6SB 4D9LL 3KS0H 3S3PA 5JXED 1E0OB 1JCKA 1T66C 5C86A 2PNDA 4PJ9B 4QGYA 3RNQB 3TYFB 1K8DB 4JCLA 1RUAL 1FVDB 4EDWH 2DMKA 3ZDZF 4BH8A 4RX4A 4N0YL 4PGEB 3WN5A 3AU1B 4PJGB 4HFUL 4Y0GA 1S7QA 4RAHA 2MFNA 1NKRA 4DCQA 1D5MB 3WS3B 1Z3GL 1ONQB 1X5GA 2VZTA 5DT1H 3OKDA 2FR4B 4YZFE 5BQ7A 2Z8SA 4PJEB 5I66A 5KZCD 3MZGB 4JY4B 4WI7A 4HC1A 3V5DB 4NSKA 4POYA 1EEQA 4HH9B 4XX1G 2K3TA 3V79C 4MB5A 5I17A 3LDBB 4NC1E 4F15C 3T4YA 4L4TA 3TBSB 2DBLH 1QFPA 4JFEE 3T08A 4LU5H 2DYPA 3NIDE 2EH7L 1CLCA 5FO8A 1JHTA 1TJHL 2DQEL 4QCIA 5DJYA 3FN0H 3LKNB 3H9SE 2HTKD 5F7EL 4F7PA 1MLCA 2KH2B 3K8KA 1I3GH 5KANI 1KEMH 4N1HB 4PTUA 5E03A 4TUJB 1J5OL 4DGIH 1KCUL 5E6ID 3B9AA 5IVXA 1OTUD 2LQRA 3QJHA 3K4DA 4QXGH 4D0BB 3NMEA 2EXYD 2IGFL 3QXAA 2NY3D 5CZKA 4KQ3H 3MV9B 3CFIC 4Y1AB 3RTQD 3VXRD 2CRZA 3MODH 4ELKB 2C1PB 2YPLA 5GJTH 4L8BB 2EDOA 5EOTB 1NMAH 1KCVL 2L7JA 1GGUA 4EXKA 3D0LB 1TTUA 4G8GB 4I18A 5CSBA 3UDWC 3MUGA 3CK0H 4Y8AA 3W2DH 3LKOA 3T4AA 3PWPE 1U3HD 5IJVB 3TZVC 4EJ1C 5GGQH 3K7UA 1CGYA 5DHXB 3S36H 2OK0L 4ZFZA 4PRIE 3DWTA 3L5JA 3T0EE 1L9MA 2E9WA 4NYLA 3GBNH 3T0BA 3EYFA 3N1QC 5F7LB 3IDMB 4HWZB 3OKNA 1NCNA 5LG1A 5I75C 4OUUA 3UTTA 1PKQB 1LDSA 3HR6A 3MNZB 1MCQA 3DSFH 4K23L 1ZA3A 5LWYL 1CDUA 1QYGH 3OHXA 1ZA6A 2XN9B 3NIGE 3WUZA 5IM7B 3BQUA 1FV1A 1XH3B 4H1LB 4X80H 5TGBB 4JPKL 4OKDA 1S7VB 5FAAA 2XQBH 4YC2B 5IQ7H 2A83B 1WSST 3O9WB 4P2RD 1IQWH 3QUMA 3NFSL 5MERB 1DVFB 2NLJA 5SWZD 1I1FB 3RVTD 2VLKA 4OI8A 4ZDHA 1QNZL 4APQD 2HFGL 3JV6B 2L7UA 3IS0X 3DRQA 1RURL 1DEEA 4WO4C 2HJKB 1MQKH 3GSVA 4MWFB 2R2CA 3QZWA 1NC2B 3DX7A 4J1UB 5T3ZH 3ARPA 3LB6C 2QL1A 3WFEL 4NQEE 3LCYA 1II4E 2G9HB 2D7TH 4UDTB 1A6WL 2DL9A 4DTGL 5EOCJ 4HS8H 3BSZH 2CLRA 1LD9B 3WXVL 1KTLA 5JOPD 4Z7OF 2I5YH 3TNNA 3WUWB 3THMH 4NQCD 4Y4FC 1KJVA 3W11C 1HHHA 4YO0A 2VXVH 4OF3A 1DQJA 5DQ9B 3O4OB 4JO3H 5C0GA 1DTUA 1INEH 3ZDXF 1D6VH 3E1F1 2KDGA 4AY0A 4OLWH 3QUYD 2CSPA 3ULUF 5C0EB 4M7ZB 1BQHG 3MV8A 1T3FA 4KH2A 3Q5OA 4GBXC 2NX5E 3LQAL 1G6RB 2HFFA 1RZ7H 4XPTH 3GJFA 5A2FA 3PP4H 3TJEH 4D0CA 4Y4KA 4JJ5B 1JZ5A 5DQDH 2FWOA 4HIEB 5D1QD 1DQDL 5CD3B 3STBA 3E2HB 1LK3L 1ETZA 1IAIL 4P5KB 1PG7L 3QCUH 4OGYL 5EIVA 4W70A 4RIRA 3BAEH 4DFIA 4KDVA 1AJ7H 3OZ9H 4FS0A 1L0YA 1TZHB 1C08A 1I1AC 3EFDL 4HUKB 2X7LB 2VNCA 4PJ5A 4XXCA 3I3EA 3PDOB 3TP4A 4CAGA 3ZE1F 2P43B 1VGEH 2DF3A 3U4AA 4KGLA 3TVMD 4X6DE 4J2XA 3BVNA 1FL3A 3DX8B 3D3VE 2FEDC 4YNYB 4HAFA 3QNXA 5J7CC 3HRZB 4YIQA 2KPNA 4YDJB 1GXEA 3RPIB 3B6SA 3OKEA 3ZHLA 4KRNA 2Q6WB 3GBLA 4J6RH 1FIEA 2JIXA 4PJHE 5IJKA 1T5XA 1JZ6A 1WWAX 2LU4A 3RWHB 4D8PA 1YY8B 5HGBA 5GS0D 3SDXB 1K4DB 2J4WH 1FVEA 4WU7A 2E7LA 1WIUA 5CCKH 2GJ6A 5FYKD 3SDCB 3C8DA 3O3UN 2GJJA 4LPUA 1U6AH 4LASH 1RAMA 2UWEB 2R0KL 2W0KA 3ILPA 4QXUH 4XP1L 5D1ZD 3P4MB 3UJJH 3VXMD 5I1JL 1BFSA 4YX2H 5B4MD 4HIJA 5IOPA 1OLLA 4WY7L 1HKLH 3VWJD 2RJMA 1XIWC 1H3PH 2FX8L 3EYVA 2BXZA 1KB9J 3MJ8B 4OM1L 2KZWA 2HTLC 2DQCH 1U92B 1SBSL 4XH2A 1PY4A 4L3CA 1JZ4A 4H26B 3RJQB 1SYSB 1G7LB 4FQ2L 1NGYA 3VE0B 5D7KE 3O0RL 3K2UL 2WBKA 1GGYA 1X5FA 1JF6A 1CU4L 1A9EA 4R6UA 3QQ9C 5IFHL 1I9RL 2QKIB 4QNPE 4BUGA 3O6FB 1JGEB 3T3PE 4NO5B 5IWLC 1VKXA 2V17L 5IP4A 3C5JA 4QRUB 4ZFGL 2VKWA 3NGBC 1RZIB 4YAQA 3QA3A 3FKUS 2VQTA 1OSPH 2J8OA 2M8XA 1AIFB 1KCRL 4DUXA 4Z8FH 4U6YB 1UGNA 1NEZA 2X1WL 5B39B 2CRMA 5FDWB 5L7XH 4MQSB 4Z95H 1I9JH 5TJWK 4RCAA 3TPUB 3B9DA 3BH8B 1A64A 2CUMA 1QBMH 1RZKH 3I75A 5H94A 4TVPH 4U6XA 3EOTL 4O2FA 2YD2A 1MCLA 3TEUA 3IDGB 3QI9B 4RRPA 4L4TE 3QUZA 3V0WH 1AI1L 4TQEH 4F9PC 4N8CL 4JN2A 3FFDB 3UXFA 1ZANH 1I7TB 3NZHL 5CEXB 4XWOD 5SV3A 3GSNH 1K85A 3CH8A 1HHIB 1NUGA 3V4UH 1QRNB 2X44D 4IMKA 5C0CB 3KPLA 1H3VA 4NQXB 3PIQA 4RMTA 3L1OL 4KK9C 1Q0YL 5IVXE 4IRSC 4U1MB 1BJMA 3QUXD 4UT6L 1AC6A 3QHZH 3CMGA 2BNQD 4NZRH 4F57L 2F53B 4JRYA 3NA4A 4LLMA 2APXA 1MEXH 5IMMA 2V7NA 3ALWA 4N8VB 1DQQA 3H42H 1MI5D 3MJ9A 3T0VA 4P9HC 1FGVL 4Q9QH 1FIGL 5FYLL 4Z78A 3G5VB 4NQDB 1CT8A 2YPLE 4R97B 3MLWL 5DD0H 3SDYL 4JPWL 4RQQB 4F7CA 4XNXH 3CC5B 3O2WL 5IFAL 1VACA 3R8QA 3SDDB 4HS6A 1MCFA 4AENB 3V7AG 4JKLA 2A9ML 4JRXB 1T4KB 4LSTH 4JLRA 3QDJA 3L7EA 3CVHH 35C8L 4ZXBA 2G75B 3PNWB 1OLZA 4ONOA 1BQLL 4J3XA 3HI6H 1CL7L 5DJCB 1A1OB 5LGHH 2I26N 3HE7C 1R3KB 2YA1A 4LP5A 4LLAA 4PBXA 3I9GH 3UTTE 1X7QA 3WE6A 5HHNB 2OMNA 4PJCA 1KPUB 1L7TL 3UTZB 2OJZH 2NZIA 4KKLD 4XZUA 4R96A 1YC8A 3WLWD 2MKLC 4I77H 2EZ0D 2HJFA 1H15B 5I8KH 2H41A 3PL6C 4V1DB 1VPOL 3H8NA 1J8KA 5DRWA 1OWRM 2O26U 4LF3B 5D5MA 3MR9A 2VLKE 4E41D 4E42A 2EICA 3RRQA 4U1SB 1G7PB 4S1SH 4XP6H 1OW0C 1B4RA 5KVFL 4M61B 1P5VA 1D9KD 1NBZB 4EBQH 4ZG1A 1F42A 4IRJC 1CXHA 2YR3A 4UQ3A 1ZT4A 3PWNA 4LSRL 1YEEL 5SV4A 2GT9A 3WNMA 2O93L 1R3HA 1W72H 3SBWC 4XBPA 4XNMA 1C5BH 3BE1L 2Y36H 1X5LA 4NIKB 3WFCL 1EHAA 3HC3L 3S34H 3TT3H 4P9HL 3VFTA 1P6FA 2YPVH 5TQ2H 2DQDH 1T0NA 5E1AB 3U9UA 3FOMA 5KZCB 1K2DB 1NGPL 3WNOA 3CCHA 4IOSD 3MV8E 1ZK9A 1YECL 2YEZA 5IVNA 5T1KD 1X4YA 3LSOB 5E7BA 4BSVA 1HXMA 2B1HL 3MA9H 4LRIC 4QTHA 3O8XC 3OXRA 1NDMA 1S9WA 5BW7C 3VMNA 4OTXH 5JPMA 5I6XB 1GHFL 4WFGE 2F9BT 5JW4N 3STLB 1IAMA 4O02H 3RWCB 4UQ2B 3MO1A 4ZPVA 4AG4H 5I8EB 1S78D 4M00A 4GW1B 4LBEA 1J12A 5E2TH 5GGRY 2AV7A 4FXGA 2X5PA 5E6IB 3BIBX 3P2TA 3C5ZC 4S0TD 2F58L 3SQBA 3RWFA 4ONHB 4U1IA 2AXGB 2Z31D 4PJIA 5HGAA 3AS2A 4FA8A 1OTSC 2NY3B 3UPRB 1ULVA 1HDMB 4EI5A 12E8H 3DV4B 3V6OA 3V52L 5MI0C 3WSQH 5BZWB 1MCBA 2R2HB 5DJ8B 4EI6B 2VDML 4NCDA 4UAOB 2AXFA 3M1BA 4UTBH 1FNAA 1KELL 2H9GA 3A6OA 1JPGB 4GG6A 4NN7C 3HAEA 4LCCA 4OLYL 25C8L 1VFAA 4X83A 1R3JA 1A6TA 4H88L 2GJ6E 4P5MA 4OCMC 3RL1A 1U3HB 5A2KH 4FXLA 1XFPA 1CDJA 5ENWA 1OB1A 5L0QB 2YHGA 3QT2A 4X4YB 5J3HC 5D70H 2XPGB 4HKZA 5DJ2A 5HI4D 4YHNB 5DJXB 2YRLA 3QDGB 1MWAA 2FECL 5ALCH 1KUMA 3QXWA 5J12C 5HDBE 1QLRA 4NNYB 4WWKC 2DLFH 1N7MH 5EU3A 5ISZA 4ZD3H 4QYOA 3FB7B 2D03H 4MJ5B 3ULSB 4ZOBA 1I8KA 1G0DA 5C09A 5EZJA 3WCYA 3MYJB 1ZLUH 1V3KA 2UYLA 4PGJA 5SWSA 1N5AB 4GKSA 4U1LB 2OTUB 2JJUA 2DIAA 4AH2A 4S1DD 3REWA 4P2RB 5BXFA 4AM0A 2ZSWB 3KYNA 5SWZB 3J7HA 3QXDB 1A4KB 2R0WH 1FFOB 2X1PA 1JZ7A 4APQB 1MF2L 4HUNB 2FX7L 3CLEL 4H1LG 4JFFB 3BP6A 2QLVB 1F2XK 5FYJD 1EVUA 3KLAA 1PYWA 3ZT6A 4U3CA 3WFDL 1WFOA 3RAJL 2B4CH 2VAAA 5DTFA 1BZ9B 4G5ZL 3BRFA 2NY7H 1ORSA 4PP1D 3P9LA 1AP2B 4FP8H 4Z7QE 2XNAB 4AIZA 5D7IF 1DDHA 4Y88A 2IPTH 1PBYA 3UTOA 1XGPB 1YA5A 4NQCB 4XNYL 1MELA 3RU8L 1U8OA 1SY6A 3RBSA 5CEZE 3TO4A 3ULVF 4NBYB 5DFVC 5GHWL 4O5LH 5DR5H 5E08H 1B0GA 4MXWH 3WUWG 4WW2F 3C6LA 1EHLH 5A3IC 4XC1L 4JFOB 1S9XA 3MRJA 3PV6A 4S10A 1SQ2N 3JTSA 1RUPL 5ALBH 4ALAL 1C12A 4JRYE 5E8DL 1DFBH 2P8LB 4HK0B 5JDSB 1BBDL 4NZDA 1URLA 1CBVL 1QBBA 5E4IA 5D1QB 4GW4A 1H5BA