1D9KA

Crystal structure of complex between d10 tcr and pmhc i-ak/ca
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
QVRQSPQSLTVWEGETTILNCSYEDSTFDYFPWYRQFPGKSPALLIAISLVSNKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAATGSFNKLTFGAGTRLAVSPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-CELL RECEPTOR D10 (ALPHA CHAIN)
publication title The crystal structure of a T cell receptor in complex with peptide and MHC class II.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 110
sequence length 110
chains with identical sequence E
ec nomenclature
pdb deposition date 1999-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d9kA00
2GHWB 5J13C 2ZUUA 2ICEB 4IMLA 5EBWA 1UACH 1LEGB 2VLLB 3I6LE 4XWOD 3WFEH 5MHSD 2PYFA 3VRLE 2GAZB 5DHYA 5B8CC 1X6LA 4JPWL 3ARQA 4MNQD 3U9PL 1Y6NR 2ATPA 1OGAD 5EUKB 2EE3A 1CG9A 1BEYL 1NGQH 4NOFA 4Y2DC 3BPNB 4JM2C 1OB1A 4W4OC 4ONHA 2HLFC 4GBXD 1KFAH 3P9LB 3WFZA 2NZ9C 5FOBA 1INDL 1GXEA 1DBKH 5JQ6H 4M8VA 1RK0A 1EBPA 4OGAD 4I2XA 5I1GH 3BIKA 4U1LA 2FGWL 5D8JL 2PO6B 4JKPL 5A2IH 4XCEB 3NOIA 5IT2H 1U6AH 1F3DH 5FK9B 1BFOB 1J18A 1KTLB 4XBPB 1H15A 2EDXA 1I7UB 2NY2C 2VZUA 1SEBB 2VXSH 5D7LD 2LVCA 4XVJL 4PJ8C 5E6IB 3SEPA 3GBML 2VZ1A 2A6IB 3MRHA 4U6VL 2BVQB 3THML 2QQNH 4HD9A 4HW6A 1SJHB 3F58L 4L8DB 2FJFA 1YN6A 4ELME 5DUBB 3MSPA 1GGYA 5CD5D 1C5CH 1EEQA 1NH6A 1JF6A 4MNGA 3BPCA 3UCRA 3CU1A 5B39A 1AI1L 2W1NA 4JHBA 3IXAB 2D03L 4XMLL 5J4MA 1FFQA 1MHHA 4TNVF 4ZUUB 2VR5A 1RZ8A 5H8DA 2WLYA 1X5AA 1T4KA 5D7JD 1KYOK 2AJ3B 3SJVE 2EICA 2OTPA 3WSQH 5BV7L 4AM0A 1MCFA 4Y1AE 4OLWH 1UZ6E 1DEEA 3A6BL 5IEHB 4Y4HC 2X10A 3QXTA 4JFDA 4LSSH 5JDJA 4M6OH 1QFWH 1ZHNB 4S10A 4OCYH 5DHVA 4LEXH 3SGKA 2W9LA 4GAFB 1ITCA 3SQBA 2FEDD 3QDMD 1G1CA 4LVEA 1JMZA 4UIKL 3VA2C 2P1YA 5HD8D 1JHLH 4Z7VA 3T77B 4G6JH 4Q6IB 1N0XL 4MHHG 4XAWH 3OG6B 5JPMA 1TZGH 1CGTA 3MV9E 5FYKD 5L8JB 1S9XB 4DVBA 1JPTH 2F8VA 3NACL 1CQKA 1GC1C 1Y0LA 2NY4C 2PKDA 2ZCLH 4U1KB 4J2XA 5IESL 5JW4M 1RUKH 3PJSB 2HJLA 3O45A 2Y23A 5IFJA 4IDLA 4IIQC 4JFEB 5FB8B 5IFHH 5DD5L 1X5GA 1ZS8B 3VMNA 3TZVB 5I74C 3TYGH 3TO2A 1IQWL 4BFEA 4JY6A 5MI0B 3JWDH 1FBIL 5C09D 5CZKA 2ADGB 3IB4A 3O3BA 2E7LA 1WFUA 1JCKA 4YHZL 3IDNB 3B9VA 4KQ4H 4WFFE 2DICA 4XAKE 1WV7T 1JP5A 2P8MB 3T3ME 5H2BA 2VWEC 4OM0H 2I9LB 1OAYL 1RMFL 5ADPH 1MCQA 3RVWC 4OGYL 4UT9H 3KPRA 2VUOA 2N7BA 3UJJH 1BVKB 2J4WH 3M45A 3SDYH 4FQJL 3BXNA 4G7VL 3B9EA 3P73B 4YBHA 2ZKHL 3D39E 5IVXB 3QUZC 3DTXB 1J0JA 4BZ1L 5BO1H 3N85L 4NFDA 5F7YC 5C2BL 5FEBA 4IS6A 1J8HA 3GMRB 1FORH 3T8XB 1PVHA 3MV7B 1XIWD 2FHCA 3LHPH 2OR8A 5HI4D 4M7ZC 4NO5A 4CMHC 5GHWH 3MLPA 3WHXA 3TH3T 2NY7H 4NQDB 3ARUA 5CBAB 4MAYD 3GSOA 5F1NA 5CJQH 2J6EA 1ADQL 5J9PA 2ZSWB 3MNVA 4PB9L 5JIHA 4HDIA 1IGCH 3HC4H 3C60A 4XCNB 1UT9A 1NBVL 4F7CA 3HE7B 4UT7L 2W91A 4G9FE 3N1FC 5IW6B 4E41A 1FLRH 3KPSB 4HUXB 4FG6C 2XKNB 3MLSL 4L8CB 1GGCH 3BQUC 4O51B 3PDGA 5TDOA 3WJJC 4PJIF 1JF5A 3BDXA 5CEXA 2AAVA 1QACA 2CDGB 2GEEA 3QFJE 2PXYB 5LCVL 5HYSG 2APFA 2YSSA 3DSFL 4ZPTB 3CNKA 3MNWB 3VFGH 2CO6B 4OCWL 1M7DB 4K7PL 3ARFD 2OZ4A 4LP5A 5CJXA 2YBRA 4PRBB 3GMLA 3LD8B 4LMQI 3CXDH 4EI5A 1S7WA 1IEHA 3L3OA 4IRSC 2UWEB 1DQDH 1U42A 5DRNB 5EU4A 5DC4B 4X5WA 3LQAL 3CFEA 1QTYT 4UDTB 4POUB 1KV3A 2AXFA 2CLZB 4JPKL 4LNRB 3PHSA 5IQ7H 1VPOL 5AYQA 5B38A 1A6TA 3P11H 3VXNB 3EOAB 4QF1B 4FP8H 3RVXD 5GS0H 3HAEB 4IOIB 3RL1A 1HE7A 2DQEH 4FTVB 1N4XL 5GRVL 4LU5H 4NGHL 1T1XA 4PJAA 5ESVA 5I71C 2CGRH 4XPFL 2I5YH 3O6MH 1HH9B 2J12B 4NC0B 3VD4A 1XGYH 1G7IB 5JPNB 4U3XA 4NKDA 1RZKH 5EFIA 3H9SA 4XVSL 1IAIM 3KJ4C 2DIBA 2AXHA 4BFIB 2HFTA 1WFNA 1J0IA 2QEJA 4OLVL 4YXKH 3FOLB 4JZNB 3G6DH 5JW4N 1A6VL 4ZUWA 5T5FH 4NN6C 5DURB 4J1UA 4JHAH 4E41E 4R9HA 4FXKA 3CSGA 4GS7C 4WVRA 1R5VA 4XNZC 2IADA 1L9MA 3H3BC 4LCYB 3CXHJ 4YHKH 1KCVH 3AROA 4DGYH 1CQYA 3DARA 1CLZH 3O3EA 1I4FA 3RGVC 5HHOA 3L95B 2ICES 2JK5B 3T0VA 1F11B 2R4RH 4OZGA 5TPWL 3TV3H 4NWUH 2Q86A 2HT3D 4MVBC 2YN3A 4JG0L 3GI9L 3WIIH 1QVOB 2F53E 3NAAH 5KSVA 5E7FA 3W2DL 4C59B 3I85A 1S9VA 4X4ZA 3X13B 1OT2A 4KU1A 2E6QA 5EU3A 3SCMD 1NAMH 4F7EA 3ARPA 5I1CL 4X4ME 3MPCA 4K9EH 3FT3B 4MSWB 4BK5A 3EFFA 5TDNB 2HLAB 5LQBH 2CK2A 3LZFH 3QDGA 1CLYH 4LRNH 5TE7L 2OK0L 4QRTB 1MCCA 2FBOJ 3ECBB 4CL7A 1RZIA 2OI9B 1CXEA 2D31A 2I07B 1DUZA 2DL2A 1FCGA 1MHEB 2VAAA 5SX5K 3TJEL 3BX7C 5ECJE 4JVUA 1BQLL 15C8H 5C6TL 5IWLC 4TSBL 4HS3B 3FO0L 2BVYA 2PYEE 2UV3A 3QUYB 3E0GA 1SJEB 5EZOL 1NANH 1BFVL 4DW2L 3TT3L 2P8LB 5E00A 4Z7VF 1D5ZB 1FVCB 3JV0A 1K6QL 2O5XH 5DD1H 3O9WD 3RDTA 3MRDA 1NGYB 4P2QD 2CRYA 3BT2L 2QQLH 3VGGA 1AQKL 3WFHA 1P7QA 4PUBH 4R7NB 4PJ5D 4NJ9L 5IROA 3ZHKA 4MWFB 3VI4F 1MAJA 1K85A 4XP1H 4ZDHA 5D71L 2AJUH 3H9ZA 4LLWA 4JFQB 1AY1H 4KPHH 5F9OH 3U30C 4TSCL 2AGJH 2NY5H 4O5LL 1JI1A 3NCMA 2CDEA 4YXHL 4LIQE 3AS3A 1QO3B 5K33A 1T5WB 2AJXL 5CGMA 4R2GB 5FV1L 2MFNA 4Z7WE 2VLME 1RZFL 3TPUA 4ONFH 1JGEB 3FB8B 4I0PA 4O9HH 3SDDB 1KN4L 2GK0B 5A2FA 2ADFL 3P9MA 2FCBA 4PV8A 5DTFA 1A1MB 4X6FA 5HPOA 1SBSL 3AMLA 2EXWC 2EZ0C 1FH5H 4PR5A 5HHXL 4CDGC 4D2NA 5DHVH 2F54D 3QDGE 5F1OB 4KK6C 3BO8B 4UAOC 1BJ1H 3TJHD 3Q5YA 3NA9H 4OCSL 5LJYH 3DXAE 3S35H 3R1GH 4NRYA 3RWEB 1IGMH 4Y4KD 5E94B 5JLZA 2VXQL 2E9BA 1IL1A 3H2WA 5DDHB 4QNPE 5HVFB 4K3DH 1SMAA 2FD6L 3L1OL 5MERA 4FQIH 3HMXH 2DLFL 5EBMB 2J8UF 2ZSVB 1Z0NA 2I26N 3MBXH 1MLBB 4TUJA 1KIRB 3RY6A 3QEQB 4M3KB 3A0OA 1LK3L 3STLB 4CMMA 3ZLQC 1XF3A 4JN1H 5E5RB 1I85C 1S78D 4UV7H 4ERSH 1BP3B 4GRLD 4WEUD 4K07A 2UZYB 5TE4L 4KKLC 2VITB 3RIAK 3UBXG 4BQ9A 1T7XA 1WZ1H 4CADB 3DROB 1KTKE 2IALA 3V4UH 3PL6B 4MMZC 3IDIA 4L8SC 3OXRB 1KJMB 1HXYA 1CL7L 1R3IH 3LKPA 2BNQA 3BP7A 2A0LD 2R2EA 5ID1B 2X9WA 3I3DA 4GSDL 1M7IB 1U92B 3FQWB 1K5NA 3CX5K 1YYMH 3DMMB 5E9DA 5T1LA 2DD8L 3TN0D 3KPTA 2GK2A 3UJTL 1A4KA 3ZT5A 1Z6JT 1WWBX 4MZ3A 4APQD 1QRKA 2J88H 3IXTB 5HYSB 3CFBB 2AEWA 1ZANL 4IDJH 5CEZH 5HI3D 5IMMA 4AH2B 1F4AA 4K94C 2NXZC 4Y4FA 2IBZX 4W68A 1W8OA 3LS4L 4ZPVA 4ZD3L 5GGSA 4NHUB 1AR1D 1N64H 4MD5A 1I9RH 5DFWH 4F37F 3N9GL 4DVRH 5D2LA 1HYSC 4BUGA 4LRIC 1QLFB 5F7WC 1LEKA 1I1AD 3SE4C 3VDBA 2BCKA 4W6YB 3F12A 3SGJA 3SGDH 4E5XA 3KPNB 1J1PL 3FCTA 4PJHE 4OLUH 4D3CL 4DZBB 1QFUH 2O5ZH 3T4AB 3NCFB 4EN3C 1D5IH 1CICD 3FT4B 3QWOA 4JAMA 4AEEA 1UZ8A 2ZJSL 5DJXB 4U2YA 2VXVH 3WKMH 3ULUC 1QFWM 2XQYG 2KQNA 1I9IL 3ARGB 3GMNA 4KZDH 2P8PB 2B39A 4DGVL 2VZTA 1QSZA 3AXLB 5EO1A 3UJIH 2A2QT 5DJAB 1B9ZA 3T0AA 3BRDA 3VXPB 3RKDC 1W72A 1A9EB 1AGFB 1RHFA 3MROA 3IDMA 5FDWB 4YHIA 2CRMA 3O6FD 5JQHC 3AREA 4GXVH 4PJAF 2Z93B 4QRSB 1QZ1A 2GFBB 4FFWC 3S5LA 3NIGF 3MRJA 4LCCC 2BC4B 3RWGA 3BPNC 1EMTL 1FRGH 2O5YL 1QLRB 3VE0A 1F45A 1XGPA 4M7LH 5T1MA 4KK8C 5DD0L 4KVCL 4YWGH 3PIQB 1RAMA 1MFEL 3OB0K 3WV0A 3LKRA 5D2NB 5C0AB 2CKBH 3FTGA 1HCVA 3TBVA 4ZOCA 3VWKA 1CE1H 1X5ZA 5IB4A 5SWZE 3I02B 4DKEH 2QHRH 4K3HA 1JNLH 1CFBA 3L5JA 1GVIA 4WWKC 5HHPA 3QDJA 1LWRA 1HNFA 1GAFL 4N90D 5D1QA 1YQVH 4OZGF 5E6IC 3V9FA 1UACL 1FFPA 4ZFOL 3WFEL 1ZK9A 4NYLA 1ZHLA 2NY3D 5DMKB 3PQYB 4FXGB 4TRPH 4PJGF 4L1DA 3QHFH 3HR6A 1RD6A 3VMOA 3ZZ1A 1D7FA 1NGQL 3DUUB 4JM4H 1IKNA 4BQ6A 3W82A 2E7HA 4GXUN 5I8OH 5KZCD 4CVZB 5FO8B 5T1DH 1KFAL 4YO0B 3AAZB 1DBKL 5JQ6L 3QJFA 5I1GL 3D0VB 4JANB 1G0XA 4H0HB 1JZ8A 5IT2L 1U6AL 4HKJB 2ADJB 4H5SA 1G6RH 4NM8H 2VXSL 5KVGH 4XPHH 1X4XA 5FM5O 3PDOB 5KBNC 1K8IB 2H9GA 2QQNL 3TLRA 5I17B 3MMEA 1HNGA 3Q6FA 3QCVH 2HFFA 1U3ZA 2NNAA 1JPFB 5C0ND 3WIHA 4C56B 4FQXA 1IJ9A 2IAMC 1C5CL 3UPRB 5LAXB 1UQSB 1MOEA 4HWBA 1ZLSH 3TNMB 4G8IB 1SJXA 1A7RH 2H2SD 5BV7C 2WBJD 5C3TA 1IT9H 2DDQH 3AY4C 5JORB 1AO7B 5F44A 4MD0A 3TZVC 5GGUB 1AC0A 2QSCH 5GJSH 3WSQL 4O02H 4OLWL 1WC7A 3IF1B 1NUDA 4HLZH 4I1NB 3MJ8B 2MKWA 2P5ED 2W0FA 4LSSL 4M6OL 1QFWL 4MJ5B 3G04A 4YQXH 5D1XC 1G7LA 3HZKA 5E1AB 2AP2A 5KN5B 1EFXD 1R3JB 4OCYL 2P5WB 4LEXL 4Y7MA 2R56H 3G6AB 3WUZA 3CX2A 5LVEA 3L7EB 2CIKA 4GBXB 1KJ2B 5DUPH 1UC6A 4UMGA 1JHLL 2C7UB 4G6JL 4IRJA 3C5ZA 5GSVB 1U0QA 1DUYA 4XAWL 2H6PB 4P2OD 1TZGL 3VRIB 1FYTA 1JPTL 5D4QA 3UTZA 3VXOB 2ZCLL 2VN4A 2OXHA 1PG7W 4XC3H 2FR4A 1RUKL 1MCSA 1NFIA 4XCFH 3S35X 2V9QA 3QULB 4NQCD 1M71B 5CGYD 1LK2B 1KYOJ 5HHNA 3T0EC 1VGKB 5IFHL 1E27A 1T83A 4M1CC 4X6BA 5D7LB 3NH7H 3RHWK 3WNNA 3TYGL 3VWJA 4JFYB 5JOPE 5FUCC 4G3YH 1U8KA 2YD4A 3JWDL 1A5FH 3D18A 1X44A 4WO4D 1JYXA 3EHBC 4YHPB 1UKSA 5ANMA 3B4NA 3NFPB 1KXVC 5JA8B 1G0DA 3CFIC 4KQ4L 4NC2B 5CP7A 4Z7OF 3QXAB 2IH3B 5IG7A 4KTDH 4S2SA 3VGAC 4OM0L 2R0ZL 5ADPL 1X5FA 4KH2A 4UT9L 5D7JB 1HDMA 3WLBB 3UJJL 4HIEB 4ETQB 2J4WL 3SDYL 4HGMA 3Q6GH 3WDHA 5D7SH 4BZYA 1JWUA 1QSFD 1P6FA 1ZA6A 2X70B 3STBA 2XTJD 1A3QA 4ZG1A 2CLRA 5I1LB 5I66A 1YEJH 43CAB 2FIKA 1VADB 4Y5YA 1YDPB 5BO1L 5KG9B 2RGSA 2YKLH 4MQSB 3MNZA 4U49A 4HAGA 1FORL 3CDGA 1K4DA 3LHPL 4JN2A 1XCTA 1BPVA 3HB3C 5DRXA 3P4NB 3KS0J 3OJMB 5GHWL 2KKQA 2NY7L 1UWGH 1OTTC 1RJZB 3C6LA 2P7TA 5CJQL 1AXSA 2ESVA 3QQ4A 2JE8A 1H3PH 2C1OA 1X4YA 2VB5A 2FLRT 5D2LF 4LAQH 2JLLA 4MXVF 1IGCL 5D7IF 3HC4L 4BH7A 1U58B 3DO7A 5HGDA 1U91B 5K9QI 3B2VH 3QO0B 5J1AA 3PGDB 5DMGD 4HGWB 1FLRL 5FO9B 5C09B 3U0TA 1GGCL 3V6FA 5IF0A 1D5XB 1MPAH 4DUWA 2VKWA 3VFUB 3ULVF 1HQRB 1N6QH 4HWUA 2ARJA 2Z31A 5JDSA 4I4WB 3VFGL 1DQLH 1FL3B 1CGXA 1FHGA 4TTDD 1JI2A 3LQAC 5IVXE 1BECA 3FQXA 5IHLB 3QFDB 3CXDL 4XBGA 5FA4B 3LQZB 3V0WH 3EYOA 4NC1C 5CS7A 4Z7NF 1DQDL 1MUJA 5B3JE 1JNHB 3MV7E 4JJ5A 3GSQB 1NCAH 1YEFH 2AJZA 2V2XB 4XTRD 5IFAL 5IQ7L 5EU6A 1WCBA 1DVFC 3VJ6A 3P11L 3ARVA 5BXFB 4ZAKA 2H32B 1XIWB 2EDYA 4FP8L 2ICWA 4KI5C 4GJTB 3MQIA 5GS0L 3BJ91 1ED3B 3O81A 2A6DA 4BFBD 1TZIB 3LY6A 4PJBA 2DQEL 4MAYB 1BIIA 4LF3A 4LU5L 4HIHB 3HG1A 4ENED 4YJZL 2CGRL 2I5YL 3BZ4A 3JV6B 3O6ML 1YY9D 3ZSSA 3ALWA 5L0QC 2NYYC 1TCMA 3DI3B 3KPSE 3S88H 1XGYL 4M48H 4P4KA 2C9AA 3B3IB 3OX8A 1VFBA 4RAUB 3U9UA 1RZKL 2V7NB 2EEAA 4P3DB 2R2HB 1PZ5A 5E4EC 4ZUSB 4YXKL 1DBBH 2BNRA 3G6DL 1MCHA 3BP6A 5T3ZE 3IJYA 5T5FL 4NKOB 1T89A 1ND0A 4JHAL 4U6XA 1DQJB 4M4PA 1UKQA 4ODSH 4OZIA 1I7RB 3GRWA 2UWEE 1FG2A 4L9LB 3DLQR 4YHKL 1KCVL 1EGJH 3ARFB 4YDVB 3O0RH 4BKLB 4DGYL 1CLZL 3DGGA 2PW1B 3M1BB 4M61B 4YDLB 1PLGH 2R4RL 3WS6A 1RZGA 3TV3L 4NWUL 2R1XA 5I1AA 3X11A 5GRXG 3IFLH 4HFWA 4POYA 3BKYH 5DJDB 4JHWH 3U36B 3VW3H 2ARJQ 2OMBA 4N9GB 5DRWB 1DDHB 3WIIL 1ORQA 2EE9A 1OCWH 3NAAL 3FQNB 3K3QA 4MLIA 3SDAD 4FTVE 4R26H 1NAML 3HZMB 5C8JB 2VLKD 4KRPD 3K4AA 1S7QB 1MRFH 2EEBA 4K9EL 2W9EH 3TNNB 5SWSD 1EDQA 1GH7A 1W0WA 5J3HD 1B0RA 3MFGB 4AL8H 5LQBL 4BQ8A 3LZFL 1CFNA 4OD2A 2LFGA 1CLYL 4LRNL 4J7RA 1XR8B 2DTSA 1YUHB 3MOQA 3GSNB 3BAEH 2L0DA 2WIIB 1MVUB 3HG1E 1G7MB 1QHOA 1KB5A 2CUHA 4ZOEA 1UXWB 3KHOA 4NDMB 1SY6A 5F8RC 3GO1H 4TVPD 1T20A 4ONGH 15C8L 1ITBB 5SX4H 1BZ9A 4XT1C 3LN4A 2BNRE 4JZJA 3L3JA 2WINB 3GSUB 3MA7A 2IJ0C 1WEJH 2ITDA 4ZYKA 3HLAA 1AP2A 3WNLA 1YMMD 1BX2A 5I76B 2HP4A 3PHOB 4YNYB 3B9KC 2VQ1A 3BZDA 1H3TA 2O5XL 5DD1L 4LPUA 1QEWA 1V7NH 2AQ3A 2EIZA 2QQLL 4YGVA 2XQYK 3IDYB 2FSEB 1NGXB 4JGJA 3GSVB 5JOFB 1KLUA 1UWXH 4PUBL 4A2LA 4HWBH 5IVOA 3ZKXB 5ILTH 4KJWC 3DVNB 4XP1L 2AJUL 1AY1L 4KPHL 5F9OL 2AGJL 2NY5L 1MAMH 3KPOB 4R97B 2VOTA 5AUMB 2PW2A 5F9WC 3K7UA 3PWLB 2YRZA 4LGRB 2PTTB 4Z0XA 2GCYA 4ONFL 1U8QB 4O9HL 5CJ5A 3MZTA 1KPVA 1LILA 4UBDC 5D1ZD 3UTTD 1A1NB 2KZ1B 2GT9A 4HZAA 1T03H 3NTCH 4PRHD 3EDEA 1FH5L 2FWOA 4N0FA 5LGJA 3SOBH 1QPPA 4P5MA 5CZVH 1I8IA 5FXCH 4OAWB 5J06A 4U1GC 3NA9L 3DBXA 5KSAD 5DJ6A 3S35L 3R1GL 1IGML 5ETUB 2DMBA 2OYPA 4DUVA 4L4TA 3V5KB 4HLZG 4E0RA 2XA3A 4K3DL 5B8CA 5F3BA 3T0DA 3MJ7A 4JKMA 4FQIL 4RNRA 3HMXL 5CHNA 1QA9B 3O4OC 4JPIB 4P23D 3QEGH 1KLGB 3WD5H 4Y2DA 3MBXL 3QDAA 3PWPD 1ZLVK 5E8PB 3GMPA 4W4OA 3EIFA 4X7DC 2HFEA 1HHGB 3OKDA 3MV8B 3OL2A 3C8KB 2NMSA 5TFSH 2ICWI 4JN1L 1KIUA 2FL5B 4P2QB 4F15B 3UZEA 4UV7L 4ERSL 3G5XA 5I9QC 3LKNA 4PP1D 1TQBB 3HS0A 3MOAH 1WZ1L 4PJ5B 5C3LD 1SYVB 3LPWA 4N0CC 3V4UL 2DLEA 4PGCB 3ILPB 5FKAB 1R3IL 3V2AR 4PJ8A 5IB2B 2E7MA 1EAPB 1S5IH 2YC1B 1YYML 2X4NB 3EO0A 1F4WH 2J88L 5LG1A 2NXYC 2OP4H 4IDJL 5CEZL 1QRNA 1XGQB 2X2YA 1F8TH 1BIHA 5EBLB 4MXQC 1N64L 1I9RL 2F54B 5B4MC 1FFOA 4PGEB 1REIA 4DVRL 4X4YB 3TCLA 1WZLA 3PNWA 3FT2B 2Q6WA 3QZWG 2BY3A 1X5YA 4OGXH 4Y4KB 3VCLA 3DX9A 5D2NC 2XNAA 4JREB 1EBAA 5GGVY 2NR6C 4OLUL 1P4LA 3OKKA 1QFUL 2O5ZL 3QEQE 2Y06H 4Y4HA 4YZFE 1D5IL 1Y18A 1JUFA 4L4TE 2YEZB 5J57B 4XPGH 3W0WD 4ODWB 1NEZG 3V6ZA 2VXVL 3CX5J 3WKML 3ROOB 1JF1B 1FP5A 1ORSB 4KZDL 3ZT7A 4LHUA 2NW3B 3AUVA 3VA6A 4X7FC 3UJIL 1KNOA 3GIVB 3QIBC 5IM7B 3FHAA 2WWMC 4POZD 5IB1A 2Q7YB 1KJVA 3E2HB 3FQUB 1ZWIB 4GRLB 5FYKU 5H35A 2P24B 4GXVL 4OIBA 1MCDA 3HNVH 3MLUH 2YD3A 5A16A 3RX5A 2B5IC 2PF6A 2VLJD 4E42A 3QNYA 3WNOA 1IM9D 2Z92A 1FRGL 2EYTB 2JB5H 2E7CA 3T2QA 1II4E 1JPGB 1BLNB 2YN5A 4M7LL 1MI5D 3B5HA 3DUSA 1R24B 3HC3H 4PGZA 5DYOA 4DZ8A 2OM5A 4YWGL 1DL7H 5CD3B 4I0KA 5IMOB 5J6HA 4MJIA 2CKBL 3CK0H 4APQB 5LBSH 3P77A 1E4KA 4KUZH 1CE1L 3DHMA 3MA9H 5EZJA 4OZIF 4K2UH 4DKEL 2QHRL 1JNLL 5BQ7B 2AERT 3DV6B 1S7SA 1VFAB 2YXFA 4Y16C 4BSWA 4U31A 5DVOA 3IDGA 1YQVL 5IK3B 4FMKA 4Z76A 1NBZB 2NZIA 3GBNH 1EVUA 5KSUA 3ME0A 3E6FA 4TRPL 4F9PC 5JW5B 1WZKA 1CICB 3QHFL 3QUZA 1BF2A 1CD1A 4M93C 4P46C 4HPYH 4JM4L 2ADIA 3MLZH 7FABH 3HE6C 4YIQA 3TBSA 2DYPA 1T0MB 5I8OL 5DQJA 5JHDA 5CEYB 4ODXA 5IKCB 5T1DL 4K7FB 5FHBH 4L3EA 5DLMH 4P48A 5BJTA 3UTOA 4I77H 2FYYA 5KVDH 3BYYA 3O6FB 2XKUA 5HTSA 2Z91A 1OAKH 5F7UA 1R3KB 3HPLB 3ZE1F 1FLTX 2C4FT 1G6RL 1J7VR 2IBGA 4NM8L 4V1DD 2Q7NA 5BRZD 4EZMA 5K9KB 1U8JA 2D3VA 4MXWH 5KVGL 4JB9H 4NBYB 4XPHL 2VMFA 4JDZB 2YRPA 4MB3A 3OJ2C 2VO5A 5DJCA 4U1NB 3CDFA 3GHEH 1U3HD 3BQUA 3QCVL 3NCYS 3PWVB 5DFTA 4WI8A 1AD9B 3I9GH 4JGUA 3PHQB 2SEBA 4ELMF 2A74A 4PRPD 4MNQA 3WHE0 1ZLSL 5C0EA 1OGAA 1A7RL 4HIJB 3PQYE 2EO1A 5EOCH 4ZNEA 4JLRB 4KKAD 5DT1H 1IT9L 2BVUA 2DDQL 2D4DA 1KCLA 3WL9B 2CIIB 2QSCL 1U8IB 1OT1A 2JF1A 4IMKC 2BSTB 2NY3B 2FHBA 5GJSL 4F7TA 1OF2A 3MGTB 4O02L 4IRSA 1JFQH 1E0OB 4EQ3A 4X9GA 5CSBA 5C0CD 4PJXB 4YQXL 1N59B 1PY9A 1XZ0B 4HCRA 2GITA 4EDXA 4F8TA 5BZWA 2R56L 5HVHB 2DL9A 5KZCB 1B4JH 5T5NG 1T3FA 3W81A 1BD2A 3F7YA 2NX5D 1CXHA 4U6HB 3SJVD 3ILQD 5DUPL 1U9KA 3U2SA 1LE5B 1WWCA 2I9TB 1AC6A 3HCVB 4UV4H 2P48B 3FONA 1QNZH 1VFUA 4WFHE 2B2XH 1WLHA 3MYJA 4G42A 5GGRA 1AGCA 4QTHA 4XC3L 4U33A 4XCFL 1GZPB 4JFPA 2EYRB 5EORH 3JWDC 5MEND 1YYLH 3QG7H 1AHWC 4Q74A 4PJFB 3NH7L 4KJYB 4C56E 3G08A 3TT1H 4N8VA 2GSGB 1EEYB 1MJJA 4H26A 4R4BA 4G3YL 1OGTA 1A5FL 1TJIH 3D0LB 3HR5A 5DEGA 1CFSA 4QT5A 1BBJA 4JQXC 1I75A 4Y8AA 5JOEA 1VENA 4JM2F 5I2IA 2ZWLT 2DKMA 5MHSE 3TFKD 2Z8SA 4KTDL 4ZODA 3E6HA 5IHZB 3UTSA 3I6GA 2PR4H 3CZFB 4MNQE 5JR1H 3KGRA 1F6AA 3RGVA 1OGAE 3KLHC 2EYSA 1KPUA 4LGSB 1IILE 3QDMA 1OQXA 3Q6GL 4PJEF 5D7SL 3TM6A 2B1AH 1FZMA 4I13B 2P5EB 3NCBB 1LMKA 4U3HA 3U7YH 4U1HA 1ZSDB 2ERJB 4XGZA 1YEJL 1NGPH 1SHMA 1EFXB 3K4DA 2YKLL 3MRPA 5F7MC 4LKXB 4NQTA 5J0BA 3L3HB 2WQRA 1G9MH 1DR9A 5SV3A 1KEMH 2GUOA 1U95B 3P2TA 4PGJA 5IBUG 1KG0B 2EH8H 3EYVB 2ZCHH 4X80H 3FOMA 4RMVA 2UY7A 3WS3B 1NMAH 1EXUA 1UWGL 5D7LE 4JQVC 1FSKC 1OSPH 3IJHA 4RZCB 1I1RA 4WHTA 1H3PL 3K8KA 4X8JB 2QADC 4FRWA 4XP5H 5CIPH 4G43A 4JFDD 4LAQL 2EIEA 3RI5K 4NQCB 5I0DA 4HZLA 3A6OA 4X5LA 4K8RD 3DIFA 4YDJA 4JRXB 5FECB 3QCUH 3REWA 5E24E 3LEVH 3B2VL 3W39B 4NP4H 2DLHA 5DO2C 2HT2D 2F19H 1TPXC 5IWLA 4WO4B 1NEZB 4QXWA 2GSIB 4RWHA 1YC8A 1MPAL 4NZRH 4HKXB 1ERNA 1M6OA 4N5UA 1PYWB 3BW9B 4GRWB 3FZUD 1N6QL 1N26A 4PTUB 1TQCB 2MCG1 1VSCA 2VTFA 4HWZB 1DQLL 1M05A 5DMYA 1IAOB 3CC5B 2K9UA 4X6DB 4H1LH 1R3HB 3UTSE 5C0IA 4MNHA 3V0WL 4RMUA 4N68A 2XTJB 5IBTH 1EUTA 1YNLH 1HQ4B 5C71A 4YX2H 5FFLA 4WFED 1S7TA 3QDME 1BBDH 1IMHC 1NCAL 1YEFL 4GG8B 3TA3D 2D7MA 4N1EA 5KW9H 5GS0C 2AK4B 1KXTB 5K59F 2HTKC 4PY8I 1O5DT 5FYKE 3SHSA 4L9LC 2XIDA 4Y19A 3AS0A 3HN3A 2OJEB 4RIRA 5EO9A 1CR9H 1C08A 5F6HJ 1EEZA 4GFTB 1VGEH 2OQJA 3K1KC 1P6AB 3G5ZB 2ED8A 1G1YA 3KPRD 1UADC 2K7QA 1G7HB 4M9PA 3QO1B 4NNXB 1RZKC 5DEFB 2P44B 1T1WA 1PKQB 5GS1C 2K1MA 3FRPG 5CEZD 3S88L 3QA3A 4PJDA 1HHHA 5C09E 4RGNC 4M48L 3QIWC 1P1ZA 5C7XH 1J8HD 5ICXB 4NQVB 4QYOB 1LP9A 5C0DA 1YY8A 1DBBL 5IB3A 2HVJB 4JFXB 5DA0B 2HYMA 4ODSL 4LEOB 4V2CB 3ZMRA 1MWAH 3QWRD 1EA9C 3VD5A 1FV1B 1IEAB 4HK3J 1EGJL 4EVNB 3C60D 3O0RL 1I85A 1HHJB 3JBG7 1PLGL 4LLDB 4Q0XH 4OZFH 2R0LH 2R1WB 3V95A 1RIHH 5DQ9B 1XF4B 4C55A 1G7JB 3IFLL 4LSTH 1MCNA 3QEUA 3BKYL 4JHWL 2BNUA 1J0YA 2RBLA 3U6RA 3VW3L 2CXGA 3B6SB 5ID0B 1OCWL 4K9EC 4D0CA 1JGDA 2Y5EA 3BN9D 5HJ3B 1F02I 1IFHH 4R26L 1NGWB 3UAJC 4Z78B 4HLJA 1IE5A 5TF1H 1MRFL 1F3RB 2W9EL 2FO1A 3ZL4H 1MHCB 3CSBA 4WW2C 3QUMB 4XXDB 1UM4H 4AL8L 4EI5D 5L2KD 4GG6F 5CBEA 3GMOB 1HOCB 2BP3A 2V9TA 4M7KH 4NUJA 5EO0A 3BAEL 1I8MB 1CT8B 1MCEA 1MF2H 1KTDA 4TQEH 4GLRH 2Y4SA 5IBLD 4LRIA 4KGJA 5C0BD 3K1DA 2BXYA 3ARDD 3BGFB 3VFSA 5M94B 2FO4B 3OHXB 3SE4A 3MBEC 3ZDYF 3GSWB 1UB5B 3GO1L 2DI9A 4JFHD 2EC9T 4XHJD 4A6YH 1GJIA 4QHLA 3FB6A 4ONGL 4PJ7F 5CMAB 2EKSA 4EN3A 3KWWA 3K0WA 2NY6D 4XH2B 1DTUA 3MRLB 4LSDA 1NFDA 3LPFA 3EDKA 4U1SB 1U93A 3DHJA 3VRJA 2H1PH 3VFWB 5E8NB 1MCJA 5TQ0H 4XPBH 1YZZA 4LVOB 1WEJL 5ACZB 1OAQH 1A22B 1C5BH 3HUJB 5E99H 1FNGB 4EXPX 3A6CH 4PLKC 3MV11 2R2BB 5DJ8A 1V7NL 3SCMA 1OM3H 3RP1A 3WO3B 4BH8B 5DZOA 3H9SD 2NY5C 2WBWB 3CZJA 3RVTC 1ZVHA 3RZCC 2UUDK 1NUNB 1OP3H 4LCCA 4HWBL 1VEPA 1F58H 5ILTL 5I8KH 1RUQH 2Z4QB 4CU8A 4LLQA 3STZA 1DE4B 1XF5A 1MAML 1S7RA 2LU3A 3P0YH 1HEZA 2OL3B 1FAIH 2GQHA 3SDAB 1UVQB 4EI6B 3MRGA 3CAFA 1HSBA 1TNMA 4OLEA 2VLKB 4LCWA 4KRPB 4XVUD 2YZ1A 4YR6B 5SWSB 3DURB 4RGMB 1LVEA 1OSZB 1S9YB 5HHOD 3UTPD 4Z7WF 1GOFA 1DBMH 1AQDB 1Q1JH 1T03L 5F9AC 3NTCL 2W0LA 3DVFA 4RISH 4WWKA 4RSVA 4DKAA 2JELH 3DRTA 3SOBL 1B90A 4Y5XA 5I18H 5CZVL 3OR6B 3AMKA 1NCWH 1PDKA 4LAJH 5ENWA 1BQUA 1MCOH 5IMKB 4HK0A 2APBA 1FIGH 1SJHA 3BESR 3MGOA 3O9WA 3OPZH 4PV9A 5BZDB 1ZT1B 2APVA 1XGRA 4DKFH 4WHYH 4UQ3A 5FOJA 3KYOB 3QEGL 3WD5L 4LQFH 5BCAA 2FECL 4F7MA 3S96A 3EYSH 3QDGD 2V2WB 4WW1B 4XNMA 1YEEH 3GBLA 1K4CA 3KPLA 4JO3H 4OI8A 1YMMB 4HJGA 4RFNC 3V4VH 5TFSL 5D93C 4LIQH 3CVHH 4Z7UE 3H7BB 2A9MH 1V3MA 1SM3H 5CUSH 3MOAL 4YAQA 1WGOA 2QR0B 2FJGB 3IGAA 4L8BA 2WLZA 2CO7B 1XH3A 5FM5M 5EU5B 1I3RB 2VC2H 1S5IL 3QNXB 43C9A 1F4WL 4OV5B 1OL0A 3RDTD 1ZT4A 5INCA 2X4RB 3CUPA 2NCMA 2OP4L 4DCQA 1ZGLM 3MREA 3UTTB 1K2DB 1BZ7B 1TZHA 3L5IA 2IAMA 4LPXA 4HXBH 4OD1H 4X99B 3VU2A 5I16A 1RIVH 1F8TL 4D9RD 1P7QD 4HUUB 4M6AA 4NRXA 4PYHA 2Y6SC 1IEBA 3O8XD 4KDVA 3ROLA 3TBTB 3OKMB 4YEFA 3JV4B 3DX7B 4GMSH 4LLVA 5KSAB 5I1EH 4OGXL 2BX5A 3INUH 3BISA 1CVSC 2BVEA 3ARBC 1WAAE 1TETH 4LSQH 2Y06L 4EEEA 4P23B 5T3XD 5DS8A 4I0PD 4XPGL 4X6EA 2D7QA 5D1XA 5AD0A 3RTQC 3ISWA 5MEQA 4P2QE 4CW1A 4ZFGH 4XCYB 3OV6A 4R0LC 1A3LH 2VSCA 4JFFA 1FJ1B 1FZKA 3IJSB 3QQNA 5C07A 3G6JA 4AIXA 3SN6N 3EOYG 4PJ5E 3TN0A 2JTDA 1N5AB 5TDPB 4RFEA 3O4LA 4G8EA 3HNVL 4K55A 2E5EA 3MLUL 4GW1B 4HG4K 3TBYA 4PJDF 5GRJH 3BZEB 2VH5H 4NO3A 5IEKB 3DRQA 3T0EA 2JB5L 5HYJB 1RZ7H 3NMEA 3PABA 4MDJA 4PP2A 4CVXA 1LP9F 4LBEA 2DM2A 2DTMH 3HC3L 3MOBH 1DL7L 2D7NA 2F8XC 3WLWD 4U4BA 4HUWB 5B39G 3CK0L 2F54E 3AM8A 2H26B 3QPXH 5LBSL 4KUZL 3V5HB 1DLHB 3MA9L 4JFOB 4WV1C 4K2UL 3G5VA 4EUPA 1C12A 4ZO6A 1U8HA 3ZKSD 2UYLA 2NTSP 3MX0A 1KIQA 1FNEA 4ZS6D 3CCHA 2C26A 4H1LG 3VFPB 5FUZH 2BNQD 3ZHLA 4NRZA 3GBNL 3SO5A 4ETYA 4GW4B 1DN0B 5E9DD 5T1LD 4OI9A 5FGCB 2AXJA 2RHEA 2VDKH 2RB8A 5HI5C 1U8LA 3L3KB 1FNAA 3W0WB 2G5BA 2LVEA 2VIRB 4CNIA 4F7PB 4QLRA 4HPYL 1LD9B 3MLZL 5H94B 7FABL 3QPQC 3VMPA 1U8PB 1XGTA 4Y4FD 5F88A 3O11A 4QRRA 4IOFD 1UWEH 5FYLD 5J6GA 4D0BA 5FHBL 1HSAB 1IM3A 5DLML 2Y07H 5J89A 4I77L 4ORGB 3QNZB 5KVDL 3VH8B 4PRNB 1NEUA 4X6CF 4KHXH 1OAKL 5GIRB 1Q0XH 3QB7C 3BPOB 3VXMA 1IM9B 2GJZB 1OTSC 4F3FA 4CN1A 3FMGH 3TIDB 4KMTH 2LU7A 2HVKA 4HBCH 4MXWL 4JB9L 3BD5A 3T1FA 4TPRH 3B5TA 3ULVD 5EG6C 2W60A 3SDXA 1SJVA 2VJXA 3EFDH 1NFDF 2HJFA 1DLFH 3GHEL 5F3HB 3ZO0A 2VR9A 1W0VA 3ULUF 4MQXC 4YFEA 2J5LB 4Y5VC 3ARED 3I9GL 4LHQB 1Q94A 3RWCA 2UVEA 4I18C 4Z5RA 3OKNB 4MA3B 5HYIA 4G8GA 5EOCL 5DT1L 3EO9H 4L9DA 1ZVSB 3GGWB 4OZFG 4WTWA 4ZUVA 3L5XH 3VFNA 1TMCB 1JFQL 3MO1A 4OF5A 5EULV 1FO0H 2VQUA 3RUGA 2C4FU 1NC2A 5HY9A 5IB5A 3D25B 3MRMB 4AQOA 5MEPB 3CSPA 1T0NB 2XZQH 1B0GA 4HKZA 4YC2B 1DVFA 1TENA 3ZKQD 3PE9A 1T7ZA 3DYMA 1IGYB 1B4JL 4MCZB 3NPSB 3QDJD 4S1DD 3LEXA 5D1QD 4QRRE 3EYQD 5DQDH 2OR7A 4UV4L 1QNZL 4TUOA 5IJVB 3MRCB 2B2XL 3DVGA 3VG9C 3QH3B 5HHMD 3ULUH 1DSFH 1ZLUK 3IU3A 2P49B 4QKXB 3SGEH 4GRMA 2C3VB 4V1DB 5EORL 5BRZB 1A9BA 4KFZC 3RWDA 1YYLL 3QG7L 2WBJA 3HA0A 3WO4C 3TT1L 1G7QB 3HZYB 1SVCP 2HG5A 1UJ3B 3WE6B 1U3HB 1FL6B 1TJIL 4KK9D 5IUSA 3B43A 4N90E 4M7LT 2QSQA 4XNQB 2K3TA 3LSOA 2X4TB 5DD6B 5EC1B 3LN5A 4PGDA 2JJWA 3H0TA 1IZJA 4HJJH 1KJ3H 5ERWB 2PR4L 5JR1L 4H0GA 5F1SA 4CJ0A 2A83B 1N8ZA 3LKOA 4U1JA 1AD0B 4TNVK 1EX0A 1NGZA 2HJKA 3OQ3B 1H3WM 2B1AL 4KY1H 5B38G 3GJFB 5C0CB 3U7YL 4QCIA 4P2OA 5JXEC 5CZXD 1NGPL 3R0NA 1I7ZB 2BOCA 4PG9A 2RFXA 4FQXD 4OBRA 3C8HA 1CK0H 3D2UD 3U4AA 1G9ML 4FQQA 2NX5B 1FFNB 4KV5F 1KEML 2CLVB 3RY4A 3D3VA 1JHTB 3SJVB 3TYFA 3KPMB 2N1KA 1YEGH 3S8WA 4IMLB 5EBWB 2EH8L 2EDBA 2ZCHL 1F5WA 4X80L 2GKIA 1NMAL 1YPZA 2PYFB 3IRPX 3LKSA 4HMCA 5DHYB 1OSPL 5DK2A 4XP5L 2ATPB 4LVNB 5IMLA 1CG9B 2JCCA 2XQBH 3CH8A 4WJ5A 1T6VN 1OB1B 3QCUL 3LEVL 4ONHB 5ESQA 4NP4L 2Z9TA 3S6CA 4WUUA 4WTXA 5FOBB 3QIUC 2HA1A 2EDTA 4IRJD 4NQSA 3C5ZD 3IFPA 1RK0B 1QSFA 4PG2C 4NZRL 4I2XB 3BIKB 4U1LB 1MCWW 1FYTD 3G6JF 2Q76A 2P5EE 1H15B 3B9KA 4MJ6A 2UVFA 4LCIH 1OQOA 2BFVH 1VHPA 3WYRA 4HS6A 3VWJD 5C08A 5IBTL 1YNLL 3C6SA 3MRHB 2FH8A 4YX2L 5GRWA 2RAMA 1JGUH 3S36H 3U0PA 1BBDL 1Q9LA 2FJFB 3OZ9H 1YN6B 4HKBA 5E2WH 4QRPA 4KKCC 5KW9L 1DBAH 4O2CA 1UM6H 4MNGB 3BPCB 1NSNH 5B39B 3R06A 4H8WH 1JZ2A 1CR9L 3HMWH 1MHHB 1RZ8B 5E2UH 1VGEL 2HKHH 1TFHA 3B8YA 2VYRE 2YUZA 2FX9H 4S1SH 1T4KB 4FFVD 3C08H 4NQCE 4O2FA 1Y6KR 4MA1B 2G75A 4N9OB 3WUWA 4AM0B 1B2WH 5GGVH 4G8FA 1DEEB 3HPJA 4JFDB 4KKNA 3KXFD 2PTVA 3MLWH 5ALCH 3KYNA 2AKRA 4KHTH 1QQDA 5DHVB 1WCQA 5C7XL 3H9HA 2HT4C 3X3GH 4Z7VB 5DMJB 2ILLA 5GZOC 4WI4A 1AE6H 5JPMB 2VDPH 5EUOA 4PBXA 4U0RB 4X6DE 4DVBB 3C6LD 1MWAL 3WDIA 2DBLH 2ESVD 1Y0LB 1QSFE 3F7PC 3U7WH 3DX8A 4JPVH 1HI6A 2HJLB 3O45B 5SX5H 5IFJB 4LKCA 4I5BA 3QBTB 2BSSB 2FATH 4Q0XL 3KPNA 3U82B 2R0LL 4MA8H 2QHLA 3TO2B 1RIHL 5EN2A 2YA0A 4EUPH 4JY6B 4LSTL 1R5WA 3H6JA 5HGBA 1LO3H 3O3BB 3ZE0F 4NO2A 3EO1A 5FA3A 5EIIA 1T04A 4NQXA 1C7SA 4ALAH 1IFHL 3KNBA 2Z31D 4LSPH 5H2BB 3SDXF 2YPKA 3T1WA 3EBAA 5TF1L 1I9JH 1WQVT 3GJFK 5I30H 3ZL4L 4AQ1B 1UM4L 3DX6A 3BXNB 3WFCH 2EO9A 4G80A 3MLVH 1I3GH 3LS5H 4M7KL 5T3ZH 2XOTA 3V6OE 2GI7A 1H5BC 1NMBH 1MF2L 3BWAA 3PP3K 4TQEL 3LB6D 5DRZA 2XWJA 1F00I 2CRZA 2YPLA 5EU6D 4AENA 4OLXH 4IS6B 1F4XH 1J8HB 4K3GA 3WXVH 3RUGF 2GJ6A 4A6YL 4ZAKD 3HI6H 4QTIH 4NO5B 2H2PD 4D9LH 1TJHH 1S7XA 2EDLA 3WHXB 3RKPA 3LQMA 5ABDE 3GSOB 5F1NB 1R0AH 2H1PL 1T7VA 1TJGH 5J9PB 5TQ0L 3MNVB 4WEMB 3REVA 4XPBL 3S37H 4HDIB 4MHHI 4KI5F 1P69B 2HN7A 1OAQL 3QIBA 1P2CA 1C5BL 1X3DA 3EJZD 3C60B 1D6EA 5E99L 2MPAH 5KS9A 2H3NA 3A6CL 3HAEH 2EDJA 3RA7H 4UTBH 4F7CB 1OM3L 2G9HA 4LARH 4RMTA 1KELH 1QUNA 4K71B 2CKNA 1BF8A 4E41B 4BJLA 4G5ZH 3B9AA 1F58L 1OLLA 5TDOB 5I8KL 1RUQL 1X9QA 5CEXB 4R6UA 3V7MA 3P0YL 1JN6A 1FAIL 3WNKA 2EC9U 2YSSB 5KVMC 1ETZA 1VCAA 3CJJA 4I48A 1XCQA 5JMOC 4NBXB 5FO7A 2YBRB 3GMLB 1Z0MA 4EI5B 1MFNA 4HK3N 4ODTH 3O2WH 1YEDA 1S7WB 4H88H 1DBML 4C54A 3L3OB 1Q1JL 5EU4B 4X5WB 4ZFOA 3EDDA 3CFEB 1KACB 1TVBA 1UCBH 4RISL 4Y16A 3SO3B 2JELL 2AVGA 1L9NA 2AXFB 5AG9A 5J12B 5I18L 2XYCA 4LLYA 4NHCH 5EB9A 1NCWL 1UXSA 1MCOL 4OGZA 5B38B 1A6TB 3AVEA 2ZZUT 3EKCA 5GJTH 1FIGL 5BVJA 5BS0D 5BVPH 3OPZL 1QP1A 4F9PA 4DKFL 2NY6B 3FO1A 3HUJE 3RL1B 4KROB 4LQFL 4P46A 4MS8D 3HE6A 3EYSL 1T1XB 4PJAB 2W0KA 1YEEL 5ESVB 4JO3L 1NLBH 1J88A 3V4VL 3HFMH 5H37G 3MRRA 3VXSA 3VI3E 1YPZF 3T3PE 4LIQL 4NKDB 3CVHL 5EFIB 3H9SB 3JVGC 3TH4T 2A9ML 4M4RA 3HTLX 3QXVA 1SM3L 2EH7H 5CUSL 5DFVC 1LDPH 2NY0D 1PX3A 2VLKE 4JRWA 4ZUWB 2JCCF 5D1ZA 4NNPH 4PRHA 4J1UB 5SWSE 3SQOH 4GAJH 4FXKB 1R5VB 2APTA 4YHYB 1CBVH 4FQLH 2IADB 4UNTA 3SJVA 3M8OH 2VC2L 4J3TA 3FRUA 3U79A 1OAUH 3RWFA 3O3EB 3GKZA 5MP6H 1I4FB 4JCLA 5HHOB 3I2CH 1Y6MR 4B50A 4OZGB 5LWYH 2Q86B 5K9QG 2Z35A 4OD1L 4OQTH 4HXBL 5KAQG 1RIVL 2IG2H 4WGVB 1C5DA 4TVPE 1Q72H 1LO4H 1JV5A 2O61A 1X7QA 3PWPA 3GMQA 2X4OA 3QQ9C 4ELKA 2H8PA 2DJSA 3QR2A 4IJ3B 4YBQD 5KSVB 4GMSL 1UH2A 2FDBP 3BPLB 5I1EL 2DM3A 4IMKA 4V2BA 3OGCA 3INUL 5EU3B 4PREA 3S36X 4R7DA 1S7VA 1CL7I 1JIBA 4F7EB 1TETL 4LSQL 4NZTH 3X12A 1A8JH 4PJ9C 1DP0A 1YMME 2OSLA 1FDLH 3EFFB 3VGDA 3RBGA 3QDGB 2VN7A 4ZFGL 4BSVA 1A3LL 5C0FA 3CFJA 4OUOA 1RZIB 3Q0HA 2D31B 1GYAA 1DUZB 3UBXA 1D9KC 4OFYA 2DQJH 2VAAB 5IIEA 3ARWA 4KJPC 3SE8H 5CINH 2OTUA 2DWDA 1H3GA 4GKZA 5GRJL 2VH5L 4Y2DD 4YBLC 1RZ7L 1JRHH 1AHWA 5DVMA 4JM2D 3UTTE 4PRHE 2DTML 4CBPA 2HLFD 3MOBL 5E00B 1F4YH 3MYZA 2FJHA 2GY5A 1UENA 4QO1A 4AJ0A 3BRFA 3BMVA 2NZ9D 5JW4R 4UIMA 3QPXL 3MRDB 5EUOF 4QRUA 5F71A 1FG9C 5DA4A 1HXMA 1EAJA 4UOW0 2H45A 3WFHB 5J11B 4B7LA 1MRCH 1P7QB 1H8NA 4ZDHB 2X41A 4LLWB 3DYPA 5E8OA 3RGHA 5FGBC 1WT5C 2NY2D 1QFPA 2CDEB 5FUZL 3PWPE 4P2CG 1D3CA 4F37K 5LGHH 3I3EA 1V3KA 4PJ8D 3T65A 1I1CA 4XRCA 4HG4J 1U3JA 3TPUB 2P45B 3BH8A 3BP4A 4NBZB 2VDKL 2YD1A 2VXQH 4JG1H 4LDOB 4R4NC 3WN5C 5JNYA 3P9MB 4PV8B 5E03A 5DTFB 4X6FB 4NKMA 1QRND 3T0WA 3W9DA 4PR5B 3BEWA 2YRLA 3VGHA 1UWEL 3PGCA 1A7PH 1OVZA 1DFBH 2Y07L 1MI5A 3BJLA 5A2JH 4NRYB 4X7SH 3MRFA 3RBSA 5JLZB 4Q6YA 5L8LB 4KHXL 1IL1B 5F89A 4JQVA 1Q0XL 5CAYB 1N6VA 5MERB 3LDBB 1EFQA 3JSSA 4Y4HD 1GOHA 3FMGL 5F8QC 4Y8DC 1Q9KA 4TUJB 4KMTL 4HBCL 3T0BA 3O6LH 4TPRL 4P9HC 1IC7H 2RQ8A 1E4WH 1Q9OA 3CFKA 3RRQA 4CMMB 1HILA 5HGAA 1XF3B 3EFDL 1DLFL 1LNUA 1P4BH 3NCCB 3S37X 4XPTH 2R1YA 2AXGA 2NY4D 4OLYH 2QV2A 2IALB 3EO9L 3IVKA 5KS9F 2WM0A 3IDIB 1LE9A 1MCKA 3Q2CA 5JTWA 1HXYB 3LKPB 2BNQB 3BP7B 3W0WE 1J1XH 2R2EB 4RAVA 4W70A 1K5NB 5E9DB 5T1LB 3TPKA 3L5XL 1UJ3C 1A4JA 1FO0L 2ZG2A 2OBGA 1A4KB 4MJID 2OS7A 4X0KA 3KLSA 3IRZA 1FFRA 1FE8H 2ZG1A 5IMMB 2XZQL 3EYUH 4BUHA 4Y4FB 4ZPVB 3WKNA 5GGSB 5IJKA 4OZHA 4MD5B 4RQQA 4URTB 4BKLA 2VLJE 4PJIA 5D2LB 4D0DA 3RVWD 4FN0A 1MQKH 1LEKB 4DAGH 5DQDL 5IOPA 2PN5A 3LV3A 4PJCA 2HH0H 2BCKB 4Q2ZA 1LO5A 3F12B 1T1ZA 4E5XB 1F3DJ 5DJDA 1MI5E 3ULUL 1DSFL 3QWOB 3QUZD 4JAMB 3VD7A 5GS1A 5DK0A 2LE9A 1UZ8B 4PRPA 1ZOXA 2VDRH 3QIWA 3NA4A 3K2UH 1NBYA 3GMNB 1QFWI 2R23A 2DYPD 4ZXBC 2X42A 2Y7QA 5JHDD 3QUXC 5EO1B 1KULA 4KJQC 4OF0A 1W72B 3TO4C 4L3ED 3MROB 1WIPA 2W65A 3IDMB 4YHIB 3RVUC 1KIPA 3AREB 1A2YA 3P40A 4EOWH 4WY7H 5ITFA 3S5LB 3UMTA 1SEQH 3VXRA 2J8OA 3MRJB 1FNLA 5CKGA 3RWGB 4D9QD 4HJJL 1KJ3L 2BXZA 5C0JA 2ZUYA 5JO5A 2UZIH 2J3SA 1X5LA 3VE0B 3UBXI 1PG7H 1YN7A 5K9JH 1XGPB 2VISA 5T1MB 1F3JA 1BREA 3VGFA 4KY1L 3LKRB 5HDQH 1IRAY 3FTGB 4FG6D 3TBVB 1Z9OA 3Q1SH 4YH6A 3VFOA 3VWKB 1G9MC 1NAMA 3B9DA 4Z8FH 3BQUD 3E3QE 5GGQH 5IB4B 1BVZA 4PS4H 4NFBA 4ZUTA 1ZA3A 4GKOA 1MQ8A 3IU4H 1CK0L 1F6FB 5HHPB 2AQ2A 3QDJB 4U7KA 5MENA 3BKCH 4AIZA 1IKFH 4XNUH 5D1QB 5DJYA 2IF7A 1NL0H 1YEGL 3UTQA 4WW2A 1FFPB 3X17A 2V9RA 4V1DE 5BRZE 4NYLB 1ZHLB 4PJIE 3FQTA 4IRSD 5HHMB 2V7HA 2HTLC 4JVWA 3PV7A 3FFCD 1ES0A 1WFTA 1T2XA 2XQBL 2GY7B 3B5GA 1T2QH 3KYKH 2D0GA 3MBEA 5KSBA 4PRPE 1BD2D 4FQPA 1P53A 3C5JA 4XZUA 2WQ8A 5DI8A 4QHUA 2DQFA 1R6VA 2LV4A 3QJFB 3RX7A 4PTTA 4F2MA 4PY7A 1IC5H 3HC0A 5FYJH 1KJ2H 4H5SB 5C0CE 4KGLA 1JMXA 4M6MH 1TNNA 4RX4A 2X9XA 5HHQA 1AGBA 4LCIL 5F21B 3AB0B 3FB5A 2BFVL 1IGFH 1CN4A 4CU7A 3RZCA 1KLGA 5GGTH 2NX5E 3SBWC 4F33A 1JGUL 3S36L 3MMEB 4U6YA 5E2WL 3OZ9L 2QLVB 3Q6FB 4U0RC 2HFFB 3A67H 2NNAB 5HGHA 1DBAL 1ZVYA 4FQXB 3LMJH 4KTYA 3MV8A 3VXUA 2VABA 1JZ5A 3C9NA 1QSEA 1UM6L 3ETBF 1NSNL 4JGMA 1JGLH 4M43H 5EC2A 4H8WL 3HMWL 3UTSD 1IAKA 2I60H 5E2UL 2HKHL 3V52H 1FL5A 2FX9L 1QBLH 4MD0B 4S1SL 3RGVD 2BVTA 3C08L 5MENE 2YUXA 3ZT6A 2GTZA 3O3AB 3R8QA 1B2WL 5GGVL 1WC7B 4MVBD 4AMKH 2BSED 4FFZH 4JO1H 1BJ8A 5DJ2A 2W0FB 1B6UA 3B2UC 3G04B 2BERA 1G7LB 3HZKB 3MLWL 5ALCL 3QJHA 3HMXA 4KHTL 4LMQE 5M7QA 3BKMH 2XZAH 2EDFA 4I2XE 3ALXA 3MR9A 1FN4A 2CIKB 3ORJA 2W38A 3X3GL 2VLRD 5GZNC 5EU7E 4IRJB 4HV8B 2EE2A 3C5ZB 5I73C 5ISZA 3BH9A 1DUYB 1VFOA 1AE6L 3AU1A 2VDPL 5EBLA 4Q9RH 1FYTB 3DVIA 3UTZB 3L5WA 2DBLL 1IC4H 4HPOH 4P5TC 1T66C 3TA3A 2FR4B 4GMTH 2A77H 3U7WL 1NFIB 3F7RA 4JPVL 1MLCA 2ZP0T 4OCXH 5TH2A 4X7CC 5HHNB 1QR1A 1E27B 5TGBA 2FATL 4X6BB 4JVPA 4OD3H 4TNWF 3SPVA 4MA8L 2R0ZH 3K81A 2XT1B 3TP4A 4MNGE 4G9DA 1U8KB 1I1FA 3D18B 5T1KA 1LO3L 3S7GA 1X5HA 3BP5A 4LSRH 5ANMB 1C16A 1CXIA 4UDUA 4N0RA 4DN4H 1MSPA 5CP7B 5IG7B 4ALAL 4S2SB 1DQTA 2J8UA 4LSPL 1KT2A 1I9JL 1QR4A 4HBQA 4JFDE 5I30L 3GHBH 1HDMB 3RWJA 3PXHA 1EZVY 3QXWA 3WFCL 5F7DA 4QHKI 1JWUB 1G6VK 4KDTC 1DQQA 5CJ8A 3MLVL 1M7XA 4RWYH 1I3GL 3LS5L 1IGTA 4ZTOH 4KQ3H 1V3LA 2CLRB 5T3ZL 1S8DA 1YNTA 5I66B 1FZJA 5C0RH 1IARB 1NMBL 2FIKB 4Y5YB 4GUPA 4K3EH 4Z7VE 4QXGH 2R29H 2AEPH 5DVLA 1WIUA 3QWRA 2M26A 2QSTA 4OLXL 3BOVA 3MNZB 1F4XL 3WNMA 1KSRA 3CDGB 4Y19D 3WXVL 4KWUA 1NPUA 3ARBA 1K4DB 4JN2B 5CJXC 1XCTB 3HI6L 4QTIL 1KXQE 5J1TC 5DRXB 4D9LL 1TJHL 3VI4E 4UT6H 3RTQA 1XF1A 4FQ1H 3C6LB 2P7TB 1AXSB 2EXWD 2ESVB 4OZHF 1TJGL 4R0LA 2EZ0D 3QQ4B 1R0AL 2C1OB 3S37L 4C83A 4WFEE 4KK6D 1R3LA 4BH7B 2MPAL 3DO7B 3QAZB 5HGDB 4PJCF 3RA7L 4UTBL 2J2ZA 2N7AA 4TUKH 1TVHA 4H25A 3KYAA 4LARL 4RAHA 1KELL 2X4SA 3E1F1 5J1AB 3RVVC 1AXTH 3ET9F 2HMIC 1CE6A 4KROC 4G5ZL 1I7TA 4YDIH 1ZLVH 3U0TB 5L2KA 3V6FB 4KMQA 5IF0B 4KDWA 2CKBA 3KPRE 2V5TA 3CLEH 4U1IA 2ZG3A 9CGTA 2ARJB 2Z31B 5JDSB 4WU5A 5E2VH 5C0BA 2F15A 3ARDA 5IFAH 4ZFZA 5IHUH 1NC4A 1NANI 1T21A 3FQXB 4NQED 3RAJH 5CEZE 2J8UE 4LOUC 1T7YA 4WV1A 4XBGB 4ODTL 3O2WL 3EYOB 4H88L 3CH1A 2EDHA 1MUJB 1J8HE 4KKLD 2VL5A 1UCBL 4JJ5B 2AJZB 1A7QH 4DFHA 4LVHB 1PG7X 5J56B 1CFQA 3P0GB 4NHCL 4MD4A 5EU6B 2VRAA 1VKXA 1WCBB 1MVFA 3VJ6B 3IDUA 4TSAH 4ZAKB 5GJTL 4DN3H 5BVPL 2ICWB 4LHUG 4YEEA 3D87B 2A6DB 4Y88A 4X5XA 4PJBB 1BIIB 3F7VA 4LF3B 1UH3A 3BIAX 2NXZD 3HG1B 1GGBH 2IBZY 4HEME 3BZ4B 5IW1A 1NLBL 1NMCB 3SDCC 4L4VA 2LQRA 3IKCA 1HYSD 3BPLC 3HFML 4WW2F 5DF0A 4P4KB 5F72S 1G6RA 1Q38A 1VFBB 4FQHA 3U9UB 2MKLC 1JZ6A 2LU4A 4JRYA 3JWOH 3X3FH 1PZ5B 1XGUA 1I3VA 2EH7L 2IPTH 2BNRB 1LDPL 3GSNH 2J8HA 3BP6B 4HGKC 4EN3D 3IJYB 1ONQA 4NNPL 1EJOH 1ND0B 2BMKA 1HH6A 4U6XB 4GAJL 3NABH 4W6WB 2C3XA 3SQOL 3ULUD 4OZIB 1CBVL 5KSBF 4FQLL 5L2KE 2PTUA 5C1MB 3M8OL 4PJGA 3OKLA 1FG2B 3RPIA 1OAUL 3G5YA 4R3SA 5I1DA 2OXGA 1J12A 3NZHH 3RKDD 5MP6L 3DGGB 4OJFH 1WBZA 3I2CL 5AYUH 5C0BE 5TE6H 4BK4A 1WF5A 1JVKA 1RZGB 3GSXA 5LWYL 4Y5VA 1OPGH 2R1XB 1PAMA 5I1AB 4OQTL 3X11B 5GSRA 4I18A 2OCFD 4HFWB 2IG2L 4FFWD 4JFHE 3SKMA 1Q72L 1LO4L 4ODHH 1AKJA 1ORQB 3IFOA 5AWNH 4OM1H 2OX5A 5E6ZA 3UO1H 3CLFH 5INDA 35C8H 4KK8D 4PJAE 4LCWD 1ZXQA 3VFTA 1RJYA 4LPYA 4NZTL 4W6XB 3NIGE 1FDLL 1W0WB 2IPKA 4ZQKA 4JCMA 1B0RB 2WK2A 1CFNB 4OD2B 1U8MA 4X9FA 2YMXH 5IROC 5C6PB 1RJCA 2JB6A 3H9SE 2KQMA 5HPMA 4WWKD 4ZOBA 1A6AA 3NCJH 3WXWH 1QBMH 4K3JH 1KB5B 5E6ID 1QSVA 2DQJL 5F6IB 5IGXH 2DQUH 4OFDA 1VA9A 2BHYA 4J4PC 1T20B 3MRKA 3SE8L 5CINL 4M5ZH 3SGDI 2YPVH 5E8EA 4XXCC 1BZ9B 3UTPE 5HHOE 2APXA 3LN4B 4JZJB 5D96C 3ARYA 4HULB 1JRHL 3L3JB 5A43C 4OZGE 3MA7B 3O8XA 1PW3A 1NLDH 2ITDB 4ZYKB 4QHNA 3HLAB 1AP2B 1F4YL 1BX2B 4PD4K 2VQ1B 3QWQB 3VFRA 4OT1H 3BIBX 4PJGE 1QEWB 3W5NA 5D72H 2Q20A 2EIZB 1EPFA 4YGVB 5ICZA 4ZMAT 1ZT7A 1MRCL 1F2QA 1KLUB 4IM8A 3QZWA 3LVEA 4P59H 3K2MC 4PB0H 1MAKA 5HDBF 3MTRA 1CD9B 2L4OA 1PY4A 5LGHL 2BVPA 2PW2B 2DWEA 3V8CA 1NEZA 3JUYA 1TTFA 4DJMA 4Z0XB 2GCYB 1AIFA 1I8KA 2ATKB 5JXEA 2NY1B 4JG1L 5I6XC 5FV2A 3LRSA 4C58B 1KPVB 1OD9A 2GT9B 2IAMD 2FWOB 5CP3A 4N0FB 3DV4A 4WU7A 5LGJB 4JFED 4P5MB 1I8IB 5J13B 1A7PL 4I3GA 1DFBL 1RJLA 2D0FA 3DBXB 3TZVD 2R9HC 1NJ9B 5DJ6B 4X7SL 1E4XI 4X7TA 3IDJA 4P2RA 2WANA 3QI9C 4L4TB 4RDQG 3V0AC 4E0RB 5B8CB 5F3BB 1VERA 3MJ7B 4RNRB 5CHNB 1N7MH 2BY0A 3MJ9H 5CSZA 3KJ6H 4Y2DB 5D1XD 3EYFA 4N0UA 3MRNA 3PWJA 3GMPB 1B4RA 2XG4A 3MUGA 1NKOA 2HFEB 3PUCA 4JFFD 3OKDB 5D7KD 3U4EA 4QGYA 3O6LL 4GW5A 4NNYA 4D9RE 5C07D 4X98A 1IC7L 1E4WL 3QIUA 5LXGH 4RRPG 3SGJC 3KLAA 4PG2A 4LPTA 3G5XB 1P4BL 5FKPA 3LKNB 5HVWA 2NLJA 3HS0B 1CIDA 2CSPA 4XPTL 3O4LD 2IFFH 3DJ9A 5E2JA 4FMFA 4OLYL 3JTSA 3R8BB 5BW7C 3BD3A 3U0WH 1L6ZA 1MH5A 5T3XE 4MQ7A 1FNSH 3T0ED 2NY2B 3NFNA 1IGJA 5FF6A 3NBNA 5E08H 1J1XL 4M1CD 4QWWC 2JIXA 4NN7C 4PJ8B 2V2TA 5D6CA 5I0ZA 3EO0B 5D7IA 5C70A 2AK1H 3N1GC 1HCFX 3IDXH 1BQSA 3EHBD 4NQDD 5E5MA 1FE8L 2Y36H 4Q7DA 4KKBC 1D5BA 1QRNB 3EYUL 2DMKA 5L7XH 2CQVA 4FOMA 5C6WH 4ZO9A 3GZKA 5AZ2H 4JO4H 3L3DA 1JTOA 1FFOB 4KI1A 3TCLB 3TVMC 4E9LA 3PNWB 1MQKL 1CCZA 2Q6WB 4DAGL 3ZYJA 1AGDA 5D9SA 3V8OA 3VCLB 2HH0L 1QKZH 3MLTA 3DX9B 3QG6A 4M02A 2XNAB 3VWKC 1P4LB 3OKKB 3KPPA 4PLJC 3N06B 1GOGA 4Y4HB 4LL9A 4Z7OE 1Y18B 1JUFB 2D7OA 4KRMB 3ZE2F 5CSGA 5DJZA 4YHLH 4RA3A 4HUVA 3V6ZB 5EPMA 2VDRL 3K2UL 3SE3A 1B88A 3CFDA 4H20H 4LHUB 4XI5C 5CWSA 4OI7A 4QRRD 2MQCA 3Q3GA 1RK1A 4BZ2H 1KNOB 3BHBA 4FQ2H 3GJEA 3PWNA 4HC1H 3HB3D 1JZ4A 4FZEH 1ZEAH 5IB1B 1KJVB 5M95B 5MEOA 1JWMA 3U46A 1MFAH 1EGJA 3KDMB 5H35B 1OTTD 1KUMA 2BNQE 1MFDH 3QRGH 1CGYA 2OR9H 1WK0A 4R96A 4WY7L 2NY4B 1EVTC 4EOWL 5E9DE 1SEQL 5A16B 1FVEA 3OTTA 2DB8A 3VXMD 3QISA 4GAGH 4E42B 3QNYB 2HFGH 2PO6C 3B83A 2Z92B 3QUKA 3JTTA 2UZIL 2FHFA 3U48A 1U8NA 2QKIA 1BQHA 1PG7L 3KLDA 5K9JL 1WBXA 1E4XH 4U05A 1WTGT 5I74B 4PJXF 5DYOB 4DZ8B 4QOKA 5J6HB 4MJIB 5HDQL 4HQQH 4FXLA 3Q1SL 1HZHH 5FYLE 3P77B 4Z8FL 1C8PA 3MXVH 5D2LE 1RURH 5GGQL 4MXVE 5EZJB 4G6AC 5D7IE 5EBGA 1CDIA 5L8KB 4PS4L 1S7SB 3IU4L 3ZKNC 4P4RA 5DEZA 4G8GD 3BDYH 2IPUK 3BKCL 1IKFL 4XNUL 2EEDA 3IDGB 4ESKA 1NL0L 4ZFFA 4Z76B 5KSUB 5E0QA 4J8RA 3E6FB 4WUKH 3RNQA 2BY2A 1XAUA 2WZPD 3ULVE 3KG5A 3QUZB 2PCPA 1NC2D 4PJFF 1H5BA 1CD1B 1YA5A 3RIFF 1JNNH 2NQCA 1CGUA 1T2QL 3KYKL 4YIQB 1DVFD 1TVDA 4WFGE 5JZ7C 2DYPB 1S9WA 5DQJB 3ES6A 5JHDB 3D5OF 3P4MA 2E3VA 4ODXB 3CPLA 1BZQK 4OV6F 2DQHH 4Z7NE 1T80A 4KI5D 4M7ZB 4L3EB 1NCBH 5BJTB 4CMHB 2FYYB 4LK4A 4WTZG 2VQTA 2Z91B 4Q6IC 3ARTA 3GEWB 2ORBH 1EIBA 1L7IH 1JWSA 1IC5L 2NW2A 2ITCA 7CGTA 5FYJL 1XR9B 1KJ2L 4M6ML 2NYYD 5CCKH 2C1PA 3GUTA 3QT2A 3D2UA 1NDGA 5AAMA 4HSQA 1U8JB 4NUGH 4P3CH 1NKRA 1IGFL 4F9LA 5ESAA 2BOBA 3KYOA 3P30H 5DJCB 5HDLA 4NO0A 3QDJE 5GGTL 1CGWA 2LABA 3BQUB 4H8WC 5F93C 4OSUH 3A67L 2V2WA 5MI0C 4O58H 1LO2H 2SEBB 3LMJL 2A74B 4MNQB 1CTNA 5C0EB 1OGAB 1JGLL 5C86A 4M43L 5HHME 3I50H 3TCXA 2EDDA 2A73A 4CN6A 2I60L 4WCYH 3V52L 1QBLL 4CVUA 4LLUA 2CH8A 4F7TB 1OF2B 5L88H 4IRSB 8FABA 1N5YH 1HHIB 4ZO8A 4AMKL 5EZLA 4FFZL 4JO1L 1BWWA 1EEUA 2GITB 4EDXB 3BKML 1A7OH 5BZWB 4WI6A 2XZAL 3ZTJG 3W9EA 1T3FB 3QXUA 1BD2B 3F7YB 2XN9A 1RHHA 2YA2A 3D3VD 3MRBA 4WGWB 4P49A 3CVIH 3U2SB 4GRWF 4U0QB 3FONB 2VAJA 2Y9RT 5JXAH 4OUUA 4Q9RL 3MYJB 1IGIH 4XP9H 5GGRB 1AGCB 1IC4L 4HPOL 1JTTA 3VXTA 4QTHB 4X6DF 4OFIA 4GMTL 2A77L 3EOBA 4XHQA 4JFPB 3OAUH 4OCXL 2IMNA 3W11C 4HS8H 2ICCA 2OTWA 3G08B 3JVGA 2BHZA 4OD3L 4MYWB 4N8VB 1MJJB 2YK1H 3NFSH 2F5BH 3FQRA 4H26B 1OGTB 4J3VA 4R4BB 4WUUD 3HE7C 3HR5B 5DEGB 1CFSB 3FN9A 4NN6B 4QT5B 4LSRL 1BBJB 3HI1A 2E9IA 3BEVA 2ARWA 1BMGA 4GS7B 1YEIH 3G9VA 5I2IB 4XNZB 4DN4L 2MHAA 3HZVA 3KXFA 2PXYC 3E6HB 3PF2A 2KL6A 3UTSB 4KC3B 4OB5H 3I6GB 4PRIA 3I75A 3B9KD 1F6AB 3RGVB 4AEHH 1NDMA 2EYSB 1KPUB 3GHBL 3N1MC 3QDMB 2EC8A 2UUDH 1UFUA 3F5WA 3FRPA 4KVNH 3Q5OA 2Q3ZA 3LD8C 4GRWH 1FZMB 1QHPA 4RWYL 1K3ZA 5C08D 4S1RH 4ZTOL 3RNKA 4U1HB 4KQ3L 4XGZB 5CP3H 4KJWD 5C0RL 5I1JH 2C3HA 4K3EL 4QRPD 1J11A 2AEQH 4QXGL 2R29L 2AEPL 3MRPB 1FYTE 1NBQA 4ZO7A 5SWQA 2GUOB 3JXAA 3L9RA 4PJ9A 3V5DA 3T09A 3VXQA 3FOMB 4UT6L 1EXUB 4NM4H 4UBDD 4FQ1L 3BGMA 1YECH 3IJHB 4WHTB 3LOWA 2BDNH 2EDEA 5D5MA 4G43B 2DLTA 2XPGA 1D9KA 4HZLB 4X4XA 5ANME 3DIFB 4YDJB 2QSVA 3REWB 3HI5H 4TUKL 2E8YA 2CD0A 1A02N 1AXTL 1BM3H 2IQAA 1CLCA 4YDIL 2WIMA 4G7YH 5F1IA 1M6OB 4J3OC 3CLEL 1ZMYA 3GMMA 5SX4I 3S4SA 1HSAA 5E2VL 1WWAX 1IAIH 2Y25A 4P4KC 2R2CA 1M05B 3HNTH 5IHUL 1YJDC 4UU9A 3KXFE 3RAJL 4U7SA 5A2LH 1D5MA 4P5KA 5C0IB 4MNHB 4PRIE 1QFHA 4ODUA 4XP4H 1KB9K 4F57H 4LDLB 5I8CA 1S7TB 4S0SD 2A1WH 4N0CD 3SKNA 2XY2A 1A7QL 3O41A 3U30B 2MWCA 2VKXA 1J05A 2Y5TA 3PG2A 5FGBA 1WT5A 4IHOB 4Q97A 4TSAL 3KAAA 4Y19B 4RIRB 4AY0A 3VD9A 1X4ZA 2ESVE 5EO9B 3WDJA 4DN3L 1C08B 5A3IC 1EEZB 2OQJB 2X7LA 3WN5A 1JK8A 2NXYD 4ZSOA 3EW3B 5J8OA 1GGBL 1N2RA 4MXQD 1ZVSA 1T1WB 5B4MD 4UAOB 5GXBB 3QA3B 4D94A 4PJDB 1HHHB 1K8DA 1YEHH 4XVTH 4TULH 3QUMH 1T22A 2OI9C 2YPLD 1P1ZB 4JJHA 4M62H 2X9YA 3BWUC 3WEXA 3H3PH 4Q9BA 3JWOL 4CUCA 4DUXA 5C0AD 1LP9B 2GJ6D 2AI0H 3X3FL 2NR6D 5C0DB 2IPTL 5GGSY 1YY8B 3GSNL 5ICYA 5IB3B 4JZOA 1UEMA 1JPSH 1JTPA 3AFLA 4KK5C 2QBWA 4U1MA 5EOTA 1EJOL 1ZGLA 3NABL 4M8QA 1ZHBA 5GS3A 3U83A 3BRGC 3QUYC 3FB7A 2CDFA 2FECI 3K4ZA 1EHXA 3QIBD 1CF8H 3GK8H 4FNLH 3DETC 2WWMD 3NZHL 4PGBA 4J6RH 4OJFL 5DGRA 3OR7A 5AYUL 1I9EA 5TE6L 5BS0A 5EU6E 1OPGL 3S97C 5E70A 5E6YA 3I6KA 4M5YH 2DM4A 3QEUB 2BNUB 4ODHL 3U6RB 5L2JA 1LO0H 2DI7A 4D0CB 1JGDB 1QYGH 4OM1L 5AWNL 1I8LC 1JBJA 4JEGB 4PJBE 1V05A 3UO1L 3OXSA 1F42A 2X4QA 3S3PA 3CLFL 35C8L 5GQBA 3WE6A 1GRWA 4Z7QE 1A6WH 1UKTA 2YOCA 4QRQA 2J7LA 4R2GC 1J86A 3B8SA 3X14A 3RY5A 2F74A 2NXZB 3KVQA 4P57A 2OL3H 5CBEB 3SDDC 1NCCH 2YMXL 3NN8A 3VFMA 5DC0A 4NUJB 5EO0B 4Y16D 2Z8RA 3NCJL 1KTDB 3WXWL 3LIZH 4QY8A 1QBML 3VFSB 4K3JL 4CDHA 4KZEH 4ELMA 1OTUC 2OMNA 3O3DA 4H0IA 1GGTA 5IGXL 2WWKT 3QP3A 2DQUL 3BZFA 4OZIE 4QHLB 1FIEA 3FB6B 5IQ9A 2NY1C 2EKSB 3MUZ1 4EN3B 3KWWB 1DBJH 5C92A 4M5ZL 1NFDB 2YPVL 4P46D 1U93B 5DR5H 1A6ZA 3DNKA 5DUMH 3VRJB 1IQDA 3HE6D 3L3GA 4ZXBA 4TVPH 4Y1AA 1NLDL 3QUXA 1FCCA 5CKAA 1AO7D 4AT6A 3KYMA 3TEUA 1C1EH 4Z7UB 1LEIA 4NSKA 1OW0C 3TO4A 4OT1L 1BOYA 5DJ8B 3VXSD 2AV1A 1OWRM 3SCMB 5J7CC 5D72L 2R4SH 3BUYA 2P4AB 4HX1A 2M2DA 2XFXA 4PRAB 4LCCB 5BS0E 4WENB 4UOW1 2ZUTA 1EH9A 4P59L 4HJ0C 4PB0L 2P5WD 4LLQB 3STZB 1XF5B 3MZGB 1S7RB 3CGTA 3PL6C 1HEZB 3MCLH 3MRGB 4YHNA 5FYJD 3MV9A 1HSBB 4LCWB 1TCRA 3UZQA 3DMMC 3QQ3A 1A14H 1V8HA 3ZE1E 3TBWA 2XZCH 2BVOA 4DK3A 4EQ2A 4WWKB 2ZNXA 3DRTB 4PD4J 2B4CH 4Y5XB 4OF3A 3MC0A 1KPRA 4I8DA 4JM2A 5CIPA 3QHZH 5ENWB 4HK0B 3WFDH 4G6MH 3C2AH 3MGOB 5C9JA 3IETA 1X5KA 3EGSA 3O9WB 4PV9B 1XGRB 1S5HA 4UQ2A 1VEMA 4UQ3B 1N7ML 3QEHA 3MUHL 3I84A 5HGGS 3MJ9L 2AS5M 5I1HH 4KTEH 3KJ6L 1J0KA 4F7MB 1H0DA 3S96B 1LGVA 4PJEA 3L6FA 4F58H 4LLMA 4XNMB 1MCIA 2EXYC 3C5SA 1K4CB 2IFGA 3KPLB 3ARGC 4HIIA 2FB4H 4HJGB 2AV7A 1AR2A 3FAXA 3D39A 3MCG1 5LXGL 2WMPA 4OFYD 2VL4A 4O2EA 1ZLUH 3IS1X 4N5EC 4H1LA 5D5MF 4AYFA 1UA6H 2IFFL 2JJVA 4YAQB 3NIDF 3U0WL 3NIFF 2ICWJ 3IGAB 4L8BB 1INQA 3LKQA 1FNSL 1XH3B 3L3IA 4ZNCD 5E08L 1E28A 3H42H 3QXDB 3RU8H 43C9B 1L0QA 1BOGA 1WBYA 2AK1L 3SBWA 3IDXL 3ZDZF 1ZT4B 3FKUS 3KR3H 1GZQA 4UB0H 5INCB 2Y36L 3CUPB 3T0XA 4DCQB 3ZDXF 3T2PA 3MREB 1TZHB 2IAMB 5L7XL 5I16B 2EE6A 4LNVA 1TLKA 1Z5LA 4NRXB 5BV7B 1VACA 1PQZA 1ZGLP 5AZ2L 4JO4L 1IEBB 1UB6A 2BSSA 4G9FA 3ROLB 2ZNWA 4DKDC 3KLHD 4LLVB 3MFFA 4AK1A 1ZHKA 1QKZL 1W8NA 3QFJA 4MCYA 3BSZH 1CYGA 1E4KC 1KCKA 3O2VH 3O2DA 4HH9A 5E7BA 3S3JA 5CJBA 5DS8B 4X6EB 5D1XB 5AD0B 32C2A 4YHLL 3V6BR 1A1OA 5MEQB 4CW1B 5F70A 1G9EA 3Q48A 4H20L 4JFFB 5K9OA 3N1QC 3TIEA 1FZKB 3FFDA 4XMPH 5C07B 3G6JB 4I9WD 1MWAA 4IIQA 4PJEE 4BZ2L 1T5XA 4FQ2L 4OZ4A 4HC1L 4FZEL 1ZEAL 4N0YH 1QFOA 3TN0B 1R5IA 3MCKA 1MFAL 4Z18A 5FM4A 4L3AA 4RFEB 1MFDL 3ESUF 3O4LB 3QRGL 1U2HA 2IH1A 4G8EB 2OR9L 3MRQA 4OZFA 5EOCJ 5FAAA 4P5TA 2VE6A 1NCDH 1MJ8H 3TBYB 2QADD 4GAGL 3ZKMC 2HFGL 4NO3B 1FVDA 3DRQB 3T0EB 1WVZA 2E6PA 3PABB 3V0VA 4MDJB 4YFLI 4PP2B 4HAFA 3GI8H 3P4OA 4CVXB 4LBEB 1E4XL 1QRNE 4HHAA 5DO2D 1HHKA 4UUJA 1OAXH 3K46A 4HQQL 1I1AB 1HZHL 3NZ8A 3MXVL 5F9JA 1RURL 3G5VB 1KLFA 4EUPB 4GKNA 1C12B 3EJYC 1L4IA 1U8HB 3VRLF 2UYLB 3WUWG 1KIQB 3VGAB 1FNEB 3BDYL 3CCHB 4BYHA 3SKOA 1HKFA 2GTWA 3RWIA 4QHMA 4NRZB 1XT5A 2YD9A 1FZOA 1H3XA 4ACPA 2O26U 4KDTA 4MAUH 4WUKL 3DYOA 4XWOC 1P7HL 1G9NH 2A9NH 1U8LB 4A6YA 2KZWA 5EWIH 2G5BB 4CNIB 4LPVA 1JNNL 3GIZH 1ACZA 5GS0D 3BN3B 1XGTB 5F88B 2HTKD 3O11B 4RA0C 3HRZA 4QRRB 4PRDA 4M00A 2DQHL 3K74B 4L3CA 4D0BB 4L29B 5E4IA 5J6GB 2X4UA 1IM3B 1NCBL 4YPGA 4HUMB 4GBXC 5TQ2H 1NAKH 5IVZA 2F53A 3WIFA 1JYWA 2ORBL 4OGAC 1L7IL 5K59E 1G84A 3VXMB 3PWUA 3WJJA 1MELA 5DJ0A 4MJIE 4F3FB 2E8ZA 1FYHB 5CCKL 4YFLF 4X4MA 4ONOA 4P9HH 4RGND 2IANA 1FAKT 4GG6A 1Q9WA 3QIWD 4NUGL 4P3CL 2HVKB 2A6KA 2R8SH 5DSCA 3T1FB 3GM0A 2W60B 2P43B 3MLXH 5IR1A 3P30L 3SDXB 3V7AE 3OKOA 4JY4A 3D85A 2HJFB 2VWEE 1W0VB 3ULSA 4OSUL 3MJGX 4O58L 1LO2L 1Q94B 4JDVA 3BUTA 1E6JH 1Q0YH 1QLEH 1URLA 4PJ7A 3RWCB 1B3JA 1MFBH 3FFCA 4Z5RB 2FBJH 1P5VA 1UZ6F 3VXRD 4G8GB 5CD5C 2X1XR 3I50L 4MDIA 1MFCH 3D69A 4UTAH 4WCYL 5AG8A 3MRIA 4WDIA 2PYEA 4XMKH 1YMHA 4ZUVB 1V3JA 4F80A 3VFNB 5L88L 3IKKA 5D7JC 3MO1B 1N5YL 3RUGB 2XG5A 5JHDE 2N56A 4X9HA 1NC2B 5IB5B 5HY9B 3GB7A 4L3EE 4Y0GA 2NTFA 1B0GB 4HKZB 1A7OL 1BGXH 1DVFB 1Z2KA 5EIVA 5FDYA 3UAJD 3GJFH 3LEXB 4D9QE 3CVIL 1S7UA 2FEDC 5IVNA 1GIGH 5HD8C 2Q8AH 2D9QB 4MX7A 4TUOB 5JXAL 3DVGB 2LAAA 4XP9L 1IGIL 4JQIH 3CVHA 3PP3H 3V79C 1JNJA 3IU3B 5EIQA 4GRMB 5L0QB 3SDCA 1BVLA 4Z7WA 3FO2A 3OAUL 3SY0A 3OAYK 1V5JA 1A9BB 4HS8L 3RWDB 3RWHA 2WBJB 2DBJA 3MBED 5I8EA 5E4EB 2IANE 4GG6E 3T3MF 2HG5B 2YK1L 3NFSL 2F5BL 4O4YH 4ZNEE 3K8MA 1XF2A 4MB5A 4WNQA 4XB7A 2HRPL 3LSOB 1YEIL 3AS1A 2EDQA 3DXAA 2APWA 3LN5B 4PGDB 2AEIT 3ZDYE 3H0TB 4NZJA 4PJ7E 4OB5L 4RX4D 1UGNA 3VFVA 3FFCE 4PLKD 4AEHL 1N8ZB 1MY7A 3LKOB 4ZOAA 3NPZB 4U1JB 2VLRA 4QXTA 1NGZB 4KVNL 5C0GA 2HJKB 4LCUA 3ZSTA 2G2RA 3T4YA 4RBPK 3RVTD 3RZCD 4S1RL 4QCIB 1BD2E 4P2OB 4W81A 2MJWA 4MA7H 1WFOA 5GRZA 5I1JL 3CFCH 2BOCB 4PG9B 2AEQL 1U8OA 2RFXB 3MV8D 1CIUA 3VXUD 1QSED 3PDDA 4FQQB 5GS2H 3TYFB 3D3VB 1EZVX 2XWBA 3AC0A 4OTXH 2V5YA 1XIWC 2DQGH 1J0ZA 5HI4C 2C5DC 5KOVC 1YPZB 3M17A 4NM4L 4OCMC 1YECL 4GAYA 3FO9A 3LKSB