4ZZKA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMILPIDSAIEFYKPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Basal-body rod modification protein FlgD
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori (strain g27)
total genus 30
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzkA02
4ZZKA 3OSVA 5K5YA 3C12A 4ZZFA
chains in the Genus database with same CATH superfamily
3B7SA 4M5ZH 1SNRA 1YQ2A 2FWLB 2YRLA 3S36X 4G1EA 1NC2D 5J8OA 2UYLA 1NMAL 1RJYA 2ARJA 5A2IH 2ALWA 2CLRA 4RZCA 1T6WA 3O2WL 3TH3T 4A39A 2C4FT 1C1EL 3TCTA 3VH8A 5EV7A 4UQ3A 1BAFH 2GKIA 4G6ML 4R3SA 4IDJL 4WI0B 3OKNB 4MZ2A 5DHVA 3WY2A 4BM7A 3IXTB 1VGEH 2W9EH 2UVFA 4Q6YA 3WJMB 5I66A 1VADA 1UEYA 1JK9A 5DUBB 3FQUB 1QBAA 4H88L 4H1LB 2ZCHH 1LO0L 5F6IB 2ZOKA 3BT2L 4ZW7A 1T21B 4HCRL 3FRUB 3T6VA 3EYQD 2V5RA 3DYPA 4FP8L 4OJFL 5EO9A 4HS6B 3E2HB 4X4KA 2P28B 1DE4B 1SQMA 4IOFD 2CHXA 3KLQA 4KXZI 1KIQB 1QBMH 3QA3A 3TV8A 3V5HA 4E5XB 2WUBH 4K5LA 4MHHI 4P4KD 2HJFB 3GO1H 4Z7VB 4MS8C 2DQIL 2ENJA 2CR0A 4FYSA 1XGRB 2D9QB 4NCC2 4PJBA 2E6JA 2W60A 4JY5L 3QH3B 1MCOL 4NRZA 5C0IA 3GEWB 5TQ0L 4HF5L 3IDJB 3HB3D 2AI0H 5KBNC 32C2B 4Y9BA 3KWWA 2Z92B 3L2NA 2IFFH 4O2EA 3CZFB 3MBEC 4QRTA 3SE8L 4AL8L 3GTNA 5K9KB 4LEOA 4M93C 1MZZA 2AEPL 5HHQB 3MFGB 4I3RH 4J8RA 1S7UA 4BZ2A 2PETA 3ECBB 5AFAA 1MW0A 5BOZG 1RUQL 1OO2A 1GCFA 1JUFA 1KCLA 2K8QA 2HLEB 1BQHB 3X11A 1EJ6A 5DVNA 5EO0A 2F8XC 1HAUA 1AIZA 2DQUL 3FKUS 4AEHL 4OAWB 4X4YA 5KYWA 4BRJA 1W0WB 3EJYD 2W65B 1XZ0B 4WNQB 2YXMA 3GPSA 3EBIA 1NOAA 1OGAA 3EO9L 2XIBA 5K39A 1X9LA 1NGXB 3RVUD 1XTMA 3VXMB 4PY8J 1WTLA 1SJEA 2IH9A 4OY9A 1HS6A 1DUZB 2P5WE 1X5IA 1G7LB 1KIPA 4JR9H 3VSQA 1DVFA 2QKIB 3L1FA 4YHOH 1PZ3A 2WXHA 1PG7L 4EKJA 4XXDA 3SSGA 2FNBA 4XRCA 4CJ1A 3P9MB 4FTDA 3DX1A 4H8PA 3VXSA 1WFOA 4DGWC 4P9ML 5IESL 4FJZA 3IU3A 4KXAA 3IMBA 4M4RA 1RK0A 3C6LB 3KPLA 4AMKH 4RGOH 4BE6A 1ETA1 5J7CC 3E0GA 3X12B 1QHPA 4I77H 1GGTA 3FOLA 2Z1KA 2ZNXA 7PAZA 1V3JA 5CR8A 1T89C 1OAYL 1H5BC 3RA7H 4PEEA 3I2CL 1N8ZA 3IDMB 3OWEA 2QKSA 4LDOB 3NZ8A 1MPAH 4YL4A 2IO5A 3WIHH 4KRMB 2EDOA 3F7QA 4JRWA 3LVEA 5D1XB 2NY0D 3NFPA 1MXGA 2EZ0D 3S4SA 4JM2A 1F4YL 4HJGB 3HAEA 3GHPA 5HDQH 4WV1B 4S1DD 3MRHB 2D7QA 3OAYH 5F0LB 5HGDB 2D7PA 5EC1B 3GZOA 1CL7L 2QQNL 3MJ7A 4JANA 5BXFB 5FGSA 3FO2B 2J4WL 4YO0B 2FR4B 4KBPA 1AG0A 1FUNA 2OKMA 1JNHA 3L3OC 1T5KA 3BN9D 4HPOH 5D7LE 1DP0A 3QRLA 5HDBF 2VLRE 4CW1A 1RUAH 3MLTA 4JRXA 1RZ8A 3L6FB 3BD5A 1PEWA 4ODWA 4M1DL 4DERA 4IBQA 4XCFL 2CPCA 1UZ6F 4WKZA 3CFMA 4PGEB 4G6JH 3RL2B 2NTSP 4W81A 2MQ3A 3FXIC 4OCXL 5JDSA 1YEFH 4QXUH 5TQ2L 3RYMA 3U6RA 5F96H 3V7MA 1N5YH 4X83A 1A6VH 1IIIA 3M07A 4PJIE 1ZLVH 3W2DL 1HCZA 5BS0B 4XAWH 1NGPH 3F5WB 3GM0A 3TO4B 1DEEB 4JRYD 4LSRL 1E3FA 3A4DA 2OLDA 4YGVA 2G5BA 4AYBA 3QXAA 2BVUA 2ZCKH 3E8UH 4H8UA 3LKPA 1H8SA 2HKFL 3P1VA 4YSEA 2VO5A 3L8QA 4JO2H 3T3PB 4MQXD 1RIUH 2C1PB 1WQVT 5I1KL 1IQWL 2QTVA 3IFPB 2WLYA 7FABL 3PDOA 1FHGA 2MTPA 4JHWH 1JPST 1FCGA 1I1YA 2CHZA 4OZFH 1Z7JA 3O3AA 5K69A 5CILH 1Z9LA 3D3VB 4Y2DB 5AYUL 1ID2A 4AYFA 1DJZA 3BP6A 1Q9KB 5MI0B 3DUHA 4JNXA 4AQ1C 3CLEL 2AEQH 2A6IA 4GKZA 3B2XA 4JPQA 2ZONA 3QJRB 5D2NB 3KPMA 3AG1B 3NSDA 3RURA 5IGXL 1R5WA 5L0QB 4P2OB 4ZMVA 2J73A 2XLLA 4JDZA 5I6XB 3IKKA 1XH1A 1P4LA 3S9DB 1BD2A 1F58H 4M6ML 4Z5RB 1GOFA 4LHJB 3ME0B 4WGKA 3CX5J 3SY6A 4OZHF 1HSBB 5IMKA 4L1HA 3OSKA 3OR7A 3ZRSA 1NWPA 4OKVB 1P6WA 2J57A 3MREB 4FTVB 5C8JA 3BW9A 1T1WB 4N8VG 4M7ZB 2N4IA 1A7NH 5D2LF 2NSXA 1NUDA 4G82A 4UB0H 3VYOA 4GG6A 2AK4A 1H8LA 4B9PA 2B4CL 5EUOB 3QG6A 1MIMH 1MW1A 3EAKA 5AAMA 3QHFL 2H6OA 2V7NB 4QHNA 3LPPA 1MHEB 4K8RH 4UDUA 4NO3A 4F2ME 2NY2B 3LN5B 1JK8B 4W1TA 1OB1B 1UA7A 2H47C 3DWTA 5K9OB 2OMWB 5GGSB 1NMAH 3SYAA 3QUZB 2GFBB 1KNOB 4D9LL 1H6EA 1TU2A 2YOAA 4R90L 5IK3A 4PW3A 3O2WH 1T66D 1J5CA 4RMWA 1O0VA 1C1EH 1MWAA 4LCYA 4WFED 2LQRA 2Y6SD 3UDWA 3DIFB 3ARXA 4G6MH 4IDJH 2XU9A 4XPAL 3F7YA 4ZQKB 4YUEL 4N0YL 3DX6B 4BXVA 5F9WB 1Z9SB 1KJ3L 2GTZA 5D1QE 3PIQB 1XGUB 2YD0A 4H88H 2Q87A 3NN8A 1VFOA 1F6FB 4K7PX 2XV6B 1GA2A 3BT2H 5AW2B 4HCRH 3V4PB 5KTEL 4W9DC 1N2RA 1LDPL 3ZZSA 4FP8H 1P7HL 1NANI 4OJFH 5TPWL 2J5WA 1UD8A 3DDGA 4QOKA 5E6IC 2X1WL 5C08E 2WXFA 4JN2B 1U8JA 4ELDA 4TM9A 4WO4A 4X7TB 4AQAA 4RMTA 4Y16C 3N40P 2VJXA 5A6IA 1T1XA 4MB1A 2DQIH 1T0NA 3ZHKA 1IAII 1QSEA 4O51B 1JS4A 4JY5H 3VM5A 3WGUB 2ZCZA 1S8DA 3FO9B 1MCOH 3KYOA 4FNRA 5TDPA 1HHIB 5TQ0H 3IXAA 4HF5H 5KVEE 1Z2KA 4DP4X 4EVNB 1WHOA 4WW2F 3S88L 5CJXA 4KI1A 1KV3A 1SDDA 4RX4D 1TYEB 2Q6WB 3GMLB 3TS8A 1FG2B 3SE8H 1CTOA 4AL8H 3BWAB 3MHZA 4UUJB 5ECJE 4D9QE 5I76A 4HZAA 2AEPH 4GKLA 1L9SA 3R7QA 3CZJA 4J3OF 3VMNA 5JQHC 2A9AA 5AAPA 2KQMA 4XN5A 1RUQH 1W16A 3ZTJH 5IV2B 3HW7A 4FNPA 3KYAA 1GGIL 1VEMA 4GI9A 2DQUH 4O2CA 5ID1A 1ADQA 4AEHH 1KTDA 3U46B 4XCEB 1I9JL 2L4OA 5I1DB 1KYAA 1FZOA 3WIFA 4QHLB 3EO9H 4HX1B 1KLGB 3EH5B 1QHQA 4K7PL 5DVLA 4L4TD 3BZ4B 3M8OL 3MVSA 5HVFB 2GY7B 3OKLB 3D7PA 2DLHA 2J2ZA 2W92A 3JZ7A 3SDAD 2R2CA 1LO5A 3KM2A 4TQEL 5KANG 2YAFA 3MX0A 1AIFA 4EZMA 3LRGA 1HNFA 1JWUA 2DLTA 1PG7H 2BXYA 3R4RA 4PJ8B 3D09A 4JE0A 4M5SA 5IESH 2NDFA 1IM3B 5J3HC 4QY8A 3CXFA 4P9MH 3U25A 4ZMTA 5BZWA 3GMMB 3GSWB 2X4UB 2XTJD 3L5XL 3DO7B 4P2RD 4OIAA 1ZWIB 2YFNA 2AFNA 3CC5A 4XWGL 3ULVL 4HOZA 1KJ2L 2F08A 4IRSB 4ZTPL 1TZAA 2B9BA 1U33A 2O6CA 1AGFA 1EJOL 1UADC 3I2CH 3LOWA 4KKZA 4KJYA 2XPGA 1VFMA 3JUZA 1G0XA 3CK0L 1JPTL 5DK2A 1CE1L 1REIA 3FO1A 1FNSL 3QO0A 2J1XA 1FH2A 2ICEC 5E1AA 3ULUL 4M61B 4ZFGL 5I0DA 1QFOA 4N6RB 1QOKA 3WUWG 5IFJA 1F4YH 4HIJB 2EXWC 5BO1L 2HLAB 2GT9B 3VTTA 2B16A 2EE0A 2GTWB 3OPZL 4NQVB 2FL5B 4H13C 1INDL 2BSSB 4BSWB 1HX0A 1FZKA 1BGXL 4BFIB 2AXFB 3HC0B 4WWOA 4TTDC 1CL7H 2QQNH 5ANMA 2IQ9L 2J4WH 1KGIA 1BF2A 2BVEA 5E00B 1KBPA 1QTYT 5CF3A 2YHGA 2G3XA 1KF9B 3N91A 4AVJA 4MMZA 1RD6A 2X1OA 3QEQA 5BRQA 4GBXC 4OQTL 3MRIA 2MIZA 5C6WH 4M1DH 1C16A 2NXZB 4WEEA 1NANH 4XCFH 2VDOL 3AREB 3UMNA 5I16A 2Z4QA 3FB5A 4LLMB 3GJFA 3ILPA 5LHDA 1CE6B 5KZCD 3G5YB 3RZCD 2XQ0A 3S3CB 1WBXB 4OCXH 1GPOL 2NZ9C 5TQ2H 5BPPA 4AEIL 3D33A 3NP3A 4CRPA 2EQDA 2FX9L 3FFCA 1JGEB 3NJXA 3W2DH 2G3MA 2XFXB 4PTTB 1EGJL 5FLVA 1F41A 1WWCA 4U6VL 2ZX5A 4J3XA 4OFDA 3PXHA 1C08B 2JB6B 3WDIA 1I4FB 3EGDA 2FATL 4LSRH 4C54A 1ZHBB 1WFJA 2VR7A 3VXUE 4EDXB 1F6AB 2HKFH 4N2OA 1Z3GL 1FC1A 5KAQG 1X6LA 4CA4A 3D0VA 4FFWD 3K6NA 4HPHA 1Q9LA 3GKWL 5I1KH 1IQWH 4BQ9A 2LLLA 1EEQA 1XAUA 7FABH 3FTYA 1FC2D 1USZA 3UTPD 1QFPA 2ZNWA 3U48A 1JWSB 1RMFL 4DESA 3HOGA 4LP8A 5KYYA 2F9BT 4IOIB 5AYUH 3CLFL 3DUSB 5IEKB 1XCTB 5KG9B 3MXVL 3CLEH 1ITCA 4AQOA 2O6PA 3U9WA 1BF8A 4P4KA 3FO0L 4QRPB 4OCMC 4JFUA 1KPUB 5IGXH 2ZSWB 5JIPA 1I7RA 2VWEC 4HAGA 1HI6B 4NQDD 3STBA 3CFCL 1P7KA 3L7FB 4RAUA 5T1LB 3C8KB 3KEHA 1T3FA 4QRSB 2LLNA 4M6MH 5HJGA 1GGCL 3HE6D 3KBFA 5CLZA 2ZUXA 1ZA6B 3HS0A 2BC4B 4F91B 4OF6A 2BH0A 1JV5B 1FHNA 1ZY9A 4PBVC 3UYPA 4Y4FC 4BQBA 2VE6B 2V3EA 1KDIA 4ZUUB 2F53E 3CZEA 2WOYA 3HG1B 4PWEA 3UJIL 4LDEB 5F72S 1EZUA 5J12B 4L37A 1R3KB 2B4CH 3QUMB 2GJZA 3WNOA 3QHFH 5DJ2B 4JKKA 4J23A 3W9EB 3QARA 1ASOA 5EH1A 2NNAB 2X3AA 1M2VA 2PWHA 3GB7B 5D72L 3FUKA 3NIDF 4OFQA 4QRQB 2QR0A 3M1BA 4UT6L 5SX5H 4XMTA 5HYJE 3CPLB 4D9LH 1I8MB 4HUVB 1YRKA 4R90H 1FI8C 2YAOA 1E8WA 4JG5A 1MCQA 1L7IL 3BVVA 4JS7A 3MRMB 4XPAH 1RH8A 1ETB1 2WQAA 3S5LB 4YUEH 3ZHDA 2BOCB 1AXSA 1HINL 3WTSA 5HDBE 3JWNE 1KJ3H 2F54A 3HRPA 3D4ZA 5JHLL 2B9AA 3CN1A 1NLBL 4NI3A 3TZVB 4F8LA 1B0IA 5KTEH 1OD7A 1L6XA 1MI5E 1SJHB 4J3UA 4MJ6A 3GK8L 1LDPH 1UZ6E 2P7TB 2UXTA 3FOMA 3GSQB 4HKJB 4X4XB 4BYHA 5TPWH 4Z23A 3MRKA 5J4MA 2I26N 2R0KL 1PZ5A 1RURL 3UYRL 4MLIA 4QF1A 3ROOA 1OAJA 4LVOC 1FVDA 2C9RA 5C3IA 5AW6B 4LRIA 3L9EA 3R0NA 2K8MA 1EEYB 4XZUB 5D7IA 4ZMXA 3NA9L 2NQDA 2NY4C 1Q90A 3D12B 4GS7B 4NNXA 3APMA 1I85C 4WFFE 1EO7A 3FRPG 5KSAC 3S88H 3RWGB 5I19L 4NBXB 4Z7AA 4PP2A 1KTLA 3CDZA 2GHWB 3I9AA 4V2BA 1UZGA 3ZJAA 2VSMB 4AGNA 4CU7A 1MH5B 3RRQA 4KROD 1WPCA 3PPSA 3NQKA 1GZQA 4Z7OF 1GGIH 4FEMA 2HP4A 2XWZA 4Z7VF 3SDCC 1S9XB 3LQAC 2P8MB 1I9JH 1KC5L 4L3EE 2EIZB 2QLYA 4N86A 5AW3B 4I3GA 5D6CB 4DZBA 5C9KA 1KT2A 1U8NA 4GLRI 3F65A 3PGFL 4K7PH 4N2EA 3ETSA 4NQEA 3U30B 1YSOA 2WMPA 3MGAA 1J8SA 3M8OH 4GJTB 4NKDA 4X9GA 2VN7A 3H3PL 4G42B 3EJJX 1JWMA 5I8CA 1NBCA 4TQEH 1BWMA 4G80A 1Z5HA 4NSKB 3LVTA 4I18B 4OZHE 4F15C 3NBNA 4R4BB 5KVFL 2EC9T 1FG9C 1MHHA 2AJYL 3T6XA 4PH8A 3C60A 1MFAL 3EIFA 2A6JB 2YPLA 1ZT7B 3OF6A 3WFHB 2NY3B 2Y7QA 3VFGL 1NEZG 3L5XH 2Z6FA 5KVGL 3VGEA 1F2QA 2CLZA 3KH3A 3L4VA 1T04B 4XWGH 2B1HL 1E3XA 1W9XA 4LOEA 4K7FB 1JV2B 2E7BA 4XNYL 3ULVH 1KJ2H 1MW3A 1C5CL 1HHJB 5E8OB 4LZKA 5DHYA 3QDMA 1UWFA 2PO6D 3VD1A 3AXIA 4ZTPH 5C0CE 2JKRM 5I8OL 3VI3F 1B88A 1EJOH 2AJ3A 3DROB 4N8VA 4KHTL 4WVRA 4AI7A 3HC3L 3CK0H 1JPTH 1YEIL 4HU8A 1CE1H 1A14L 5FUOL 1FNSH 3DV4A 2FVNA 2JJSC 3ULUH 1E8XA 4ZFGH 3VM7A 2VW4A 4FCHA 4PCKA 5JYMA 4HXAL 5BO1H 1T7WA 3EBAA 3VWJD 3ZL2A 4WI5A 4TUUA 3OPZH 3LQZB 3DYMA 4KHXL 3HLKA 4QUOA 2JIXD 1INDH 3VI4A 1LD9B 1BGXH 4PRPB 2CALA 2PCFB 3QUYB 3WKML 3NACL 2IQ9H 2EDRA 4HEPG 3WN5C 1ZLDA 1AE6L 1PLAA 3N44B 5G55A 2LGNA 4O4YL 3PAVA 2CUAA 2D0HA 2OR7A 5J9PB 1NBZA 3DURB 5A16B 3TH2T 1G7HA 3LNHA 5FECA 4OQTH 2TSBA 1K8IA 2BP3A 2OJZL 2WLLA 4BXSV 2B4CC 3IMUA 2FHBA 2VDOH 2QGDA 4NUMA 1NIAA 3RJDA 4AYSA 4E42A 3V6FB 1BX2B 5I28A 1GPOH 3CFTA 2D7NA 4AEIH 3QEUB 1A4BA 5H2BB 1A6TB 4PI2A 2FX9H 4PJAF 2FSEB 1EGJH 4MS8D 1W0VA 4U6VH 1G4RA 2X4TB 2YGOA 1UWXH 3UZVB 4R7LA 5CD3A 2FATH 4OFYA 3GGWA 1SMDA 4A7TA 1XVSA 3N1GC 1XTLA 1Z3GH 3B6SB 3CLWA 3VXNB 4NZTL 1NBQA 4GQZA 4Z3GA 5CP3A 3CFDB 4MJHA 2E46A 3GKWH 4FG6C 3VJ6A 2ICWB 1WBYA 5AVVB 3B43A 1YYLL 4GKOA 1DCLA 1IC0A 2YFOA 5CIPB 1TVBB 1RMFH 3D2TA 4TKWA 1RIVL 1ICTA 4AIEA 5DLLA 3CLFH 5IHLB 1AR1C 2ZWLT 3MXVH 3ASNB 2AJZB 1XAKA 2OL3L 5FW8A 2WQXA 3TGXA 1R0AL 2O1AA 4DO4A 5J6GA 1BVLB 3FO0H 3TURA 4GLRH 5A2JH 4YDKL 2DIAA 4G7SB 1IO4C 1CICC 1U3HC 2HX7A 1KACB 4U2YA 1BV8A 2LR4A 3DGGA 3CFCH 3QZOA 1F4XL 5A6LA 5AAWC 1BQLL 4XNDA 4GG8B 5L7XL 1GGCH 3DX0A 3T3PF 4LPTA 3CQQA 4ZYKA 1PS3A 3AB0C 4K5OA 2H26B 3NJFA 2Y6TE 2WB1A 1YC8A 4Y5YC 3VXTA 5DRNA 1GMIA 1CXLA 3KHOA 1TVHA 3PGCB 3UJIH 4BFNA 2YA1A 5JPMB 3CVDA 2B15A 4JREB 3RX7A 5CN2A 4G1EB 1KN2L 2I9LB 2UYLB 3QP3A 4PWGA 2ARJB 1VGKB 2KERA 4NO5B 4YPGA 3WFZA 3LRHA 3MO1B 4G8FA 3VH8B 1JBJA 3EDDA 4G9FB 4UQ3B 2OYKA 1ZHLA 4R3SB 5D72H 2LVEA 5I1CH 4MMYA 3MNDA 4UT6H 3UYOD 4YE0A 1ORSA 4AV0A 1CGYA 3BSZL 5E56A 4KX8A 1HZLA 4OLWL 4BHUI 5I66B 1JK9B 1L7IH 3DMMA 4KVNL 5JLZA 2XWEA 3FK3A 4WK4B 4Q0XL 5AZUA 4BH8B 1N4XL 1I1FA 1Q9OA 1WAAF 3L2LA 4B53A 4KDTC 1OGSA 4QNPE 1H6UA 4AVIA 1HINH 1F3DH 2J88L 5I6PA 5AG8A 1JF6A 5JHLH 1QSVA 4OI9A 5SWZA 1A25A 1NLBH 4UMGA 3QDGD 4XN9A 2Y7LA 2Z0BA 3Q8FA 4N2MA 2A2QT 5SWSD 5SWQB 3GK8H 1J8HA 1VAHA 3GC3A 3I6GB 4PJBB 3P73A 3QPKA 4ADIA 3MCKA 2DY2A 2R0KH 1RURH 2W60B 4LPYA 3TCXA 3UYRH 4NRZB 1F45A 4BA0A 1Z6JT 1JYWA 1XF5A 2PWFA 3D07A 2LOEA 1SJVA 2GSGA 5DVKA 3ULUC 3KWWB 4UBDD 3FCGA 3KBHE 3KGSA 3NGBC 3GPEA 1J5DA 3NA9H 4NM4L 4NT6B 4PJGF 3SDDA 2WUCL 1S9VA 1E8YA 4LEOB 2XZAL 3DJSA 3LKQB 4J8RB 2VDQB 4M5TA 2GJ6B 2YGNA 4CC4A 5I19H 3O4LD 4YSDA 5DWPA 2ZXCA 1JUFB 4N3TA 2L7QA 5EO0B 3ZQ9A 3QYMA 5ESQA 5GGRY 4OI8A 3KHQA 3BN3B 1QPPA 1XFPA 1CFMA 4XI5C 2NPLX 4IMKA 3WEMA 5K39B 1IUZA 2BVQA 3RTLA 3SQOL 2J20A 2PYFB 1U2HA 3F3HA 1SJEB 4MLSA 3NJIA 3OHXB 5D1ZA 1WS8A 1KC5H 1KIPB 1O6SB 1IU1A 2VLJE 4FKEA 3LIZA 5ICZB 1PG7W 4JHBA 5KOMC 3TFKC 1O9VA 3EYSL 5IQ9B 3PGFH 4MX7A 3ORJA 5CS7A 4XXDB 1ET7A 1NGQL 5FWQA 3SQRA 5C0AA 3H3PH 3VXSB 3ISRA 1MFNA 4WUUB 5AVUB 3ZR5A 3D4YA 3FONA 3IU3B 4M4RB 3KPLB 4MRBA 5KVFH 4Q6IA 3SBWC 5E8NB 2OX5B 4Y5VC 5CBAA 1B4JL 1JTPA 2AJYH 1OSPL 2HZHA 3JV5A 1MFAH 3TC9A 3QNYB 3HNSL 3VFGH 3F7LA 1M7IA 4BZYA 3WY1A 5DK3A 5KVGH 3DSNA 3DX9A 1N8ZB 4CSSA 1F02I 2B1HH 4XNYH 3FJTA 1FYTA 1C5CH 3MLWL 5D4IA 5TDNA 1XSIA 2YK1L 3ZOAA 4LEBA 3BWUC 1JDAA 5I8OH 2XKSA 2YC1B 5IUCA 4GSXA 2YGPA 4KHTH 4QTIL 1KYOJ 1MFMA 3F62A 3GBEA 3BQUC 3S4SB 3HAEB 3HC3H 4KNQA 1YEIH 3OB0H 4NCDA 1A14H 5FUOH 4J4PC 4WK2B 1AQ8A 5FA4A 3ECUA 3GBML 4HXAH 4U6XA 5IKCA 3MJ7B 4JANB 3H2WA 5C3TA 1FO0L 1T2XA 2R0ZL 4R7NB 2YD8A 4KHXH 5JIIA 1S5HB 3RVWC 1VFAA 4WI2A 3WKMH 4CW1B 3DPBB 3T0EA 3QUXA 3NACH 4JRXB 1RZ8B 3FT4A 5ICYB 1AE6H 1X5MA 4O4YH 4E9RA 1K6QL 3I85A 4WKZB 1FNLA 1A7QL 1IC4L 4GKSA 4OW6A 3DTUB 3U6RB 2OJZH 2WO3B 3O3EA 1ZK5A 3V7AG 1DBKL 4Y1TA 5E4EC 2ROYA 2QBWA 2X10A 4YVUA 1KB5A 3SO5A 2VJ0A 4X0KA 1BXXA 4ZMWA 1BVNP 1IBHA 2ZJSL 3P2BA 3U0TA 4RGND 4JFQB 2I85A 2O26U 5E6ID 2EUZA 4J8QA 2VYRE 5IQMA 4F3FA 1XGTA 4JFFB 4Y16D 4EI5C 3P9LB 3CN0A 3H0TA 3QXAB 1BEXA 4GP8B 5DZPA 2B1OA 3O8XC 4HK0A 4MJ2A 3AMKA 3FCSB 4DIXA 1D5XA 3RHWF 3PJSB 4EF3A 4BBWA 2EIKB 1EAOA 5E8DL 3WDJA 5EU4B 3VAEA 3HZ3A 4K5MA 1SHWA 4NZTH 5F7UA 1HL4A 4IBWA 4Z7VE 1UM6L 2CIKB 2LV4A 2DKUA 2ATPB 2VQ4A 2CUIA 4F5CA 5BJTA 5I8KL 5KJRL 2A6IB 3PF2A 2PYEA 3HBPA 1FVEA 1RIVH 2VRKA 3KPMB 4HC1A 5T1KD 3UIYA 2YAMA 3OJDB 2R7EA 5C0FB 2FJUB 1RZQA 1UB6B 4UQ2A 1D9KC 4X9FA 3ESOA 3G6JF 1INQA 2OL3H 3HZMA 1R0AH 4PV8A 1P4LB 3NK4A 1UWGL 5LAXB 5BRPA 4YDKH 5ICXB 3QORB 3MV9E 3OR7B 5CEXA 5GISL 4IU3B 4O2FA 4R0LB 1LMIA 1F4XH 1ZKAA 1J0JA 2WIIA 1BQLH 4YJZL 5C8JB 3BW9B 2DM4A 4XC1L 5BZZA 5L7XH 5A2AA 3UG3A 4ONHB 3HPJB 2BHFA 1OE2A 5JO5B 1WD8A 3WTUA 1AOHA 2AV7A 4Y4KD 3TASA 4CAGA 2AK4B 3ZE0F 1N0LA 5LLIC 4PJ7A 3KL0A 3UZEA 3VI3E 3V0VA 3TEWA 4DNLA 3VXME 4UDUB 1HXMB 5INDA 4M6OL 1NEZA 4OBRA 4V2CB 3OKMB 4CGUB 4LSVL 2GBUA 1KN2H 5ABZA 4G5ZL 4XMPL 2E8YA 1TU2B 5IK3B 1CXKA 3BVUA 3P4MB 1BMWA 1I9EA 1MWAB 4MNGB 5L0QC 1SVZA 3S0PA 4PSRA 2V2TB 1ZTMA 4TSBL 3ZO0A 2AQTA 2XC8A 1EZVX 1WWBX 3JTTA 1U2YA 4X9HA 1CVSC 2OJEA 4J3TA 2H2SD 2IANA 3BSZH 3G5WA 3TOPA 5LGHL 4OLWH 4M7JL 1QABA 3H85A 2EUXA 1SXBA 2GTZB 2YBGA 4KVNH 3OMIB 1ZA3A 2AQ2A 1V54B 4Q0XH 4APQB 1N4XH 4NO0D 2NNCA 3CMOL 2XDHA 2EXWD 5ISZB 2QDVA 1MVUB 2ZOOA 4H1LH 2WQ8A 3SO3B 1NFIB 3RDTA 3V4PL 2J88H 3TNNA 2X89A 3F2LA 4FYQA 2X40A 5C70A 2ZG3A 1I3UA 1DVSA 4TTDD 2W0FA 5C09E 5D1XE 4X98A 3EJUA 4GQ9L 4OM0L 1JGIA 4XVJL 2CCVA 3CX5K 2AAAA 2E4TA 1CK0L 2R2HB 5CN3A 3RFZC 4H26B 1WUNT 3LRLA 3PL6B 2DWTA 5TDPB 5E03A 3IXAB 4EEEA 2P49B 4PJAE 2FT8A 4GBXD 3LQMA 5FXCH 4PRHA 4X6DA 3ZU8A 5MEPA 4NM4H 2Y07L 2WUCH 4RIRA 3RVXC 1F5WA 2X4NB 2XZAH 3FQYA 2NZ9D 4TL5A 1ERNA 4PRIA 1XR9A 4GEJA 1S7VB 5HHVL 3HKFA 3W0WB 43CAA 3QXVA 1CMOA 3PABA 4M00A 1FDLL 4LCCB 2PCPB 4C4BA 4ZFOL 4XO8A 4F2FA 3CFUA 3KLAB 3W5MA 5DDHA 1MVYA 1NFDB 4O2CB 1PD1A 4Y1AB 5CEYA 4JPVL 2YUVA 4KNTA 2ORBL 5HD8C 3RWIA 4J2QA 3WIFB 4LGSB 3HN8A 4EUPG 1AVAA 3SQOH 1M1XA 3DK0A 1UA3A 1V3MA 5BS0E 5IG7A 4IIQB 2HJLA 1SYSA 1I8KA 1N12A 2HX9A 2J2ZB 4MBRA 4XAKD 3MOQA 3MX0B 3MQIA 1RCYA 1EXHA 3TWYA 4FQXB 3EYSH 5E24E 1G6RB 1IEAA 5F89B 2VOTA 3D69B 3R19A 1K8DB 5E0QA 1NGQH 4PLNC 1C5DB 1NM9A 4DVBA 3H56A 4KO9A 2ZXEB 4PJXA 3FYIB 2DTSA 3GTVA 3POHA 3T3PE 5I6LA 3MKGA 3QIWA 4ETYA 1RIHL 3KPOA 1X7SA 3NFNA 4JFDA 3VFVB 3K4ZA 3G5XA 3CC5B 1NMBL 2ROXA 4WRLA 5E95B 1WZAA 4L4VA 4JHZA 4AJWA 3N41B 4HHAA 5CKGA 2ZQKA 5IFHL 5FGCB 3HNSH 3D3VE 2TRHA 3V0AC 1AGFB 1RLBA 4YDIL 1JZHA 2XPGB 2WYIA 3CPUA 3L45A 4MBOA 5DK2B 3MLWH 2YK1H 5M95B 1OAZL 2ZIDA 2OMYA 2ZWNA 3QO0B 4B9ZA 4F37K 5I2IB 3C6SA 3MOBL 4Y4FD 5I71B 4QTIH 4BA8A 4HIIA 5DURD 4LLYA 3K0YA 3SPVA 3V2AR 1GGUA 3L5WA 5DZJA 1AQHA 1T1YB 1GCYA 1YPZB 3CMGA 2IAMC 3PWPD 4KXCA 4U6HA 5EN2B 3GBMH 2DD8L 3BH9A 5JHAA 4PWJA 5FYJL 4FTVE 4QMEA 2Z7YA 1FO0H 1WAAE 2R0ZH 3KPSB 4UTAA 5T8IA 3QR0A 2GUOB 4X99B 3KPRB 3D39B 2WLZA 3W56A 2D0FA 5D93B 3MCYA 1WA0X 3BRDA 4HJIA 1OWRM 4POZC 4ZNCD 2X6CA 5EUOE 1RAMA 4X6BA 2YPKA 3MRIB 3LD8B 3U6XS 2OMZB 1BXVA 1K6QH 1OT1A 5FCUL 5AKSA 3WY3A 3X2QB 3GJFB 1A7QH 2EO1A 4DSYA 3VSVA 5ENWA 5A2KH 2F74B 2X9WA 1IC4H 5E94A 4Z7QB 2BPBA 4PRNA 5I1JL 1M71A 1DBKH 3B2UC 1BF5A 3H2PA 2UZIL 5EF3A 4GP4B 4PJGE 3FBQA 2C4XA 2ZJSH 4WNSA 3STZA 1VKXA 4NZUL 4KK9C 5LGKA 3GJEB 3QXWA 2X53A 1XT5A 2DQCL 1JRHL 2DM3A 2X3BA 2JKLA 1EHNA 3FB6A 4HDIA 5HYSG 1KXVA 4J27A 1S3RA 1Q9LB 3N44F 3LY6A 2NY4D 4HBQA 4JPIB 4PRAA 5E8DH 3DTXA 4U1LA 3BDXA 3ML9A 3PU7A 5KSAD 1QZNA 2A9BA 1QEXA 2NX5D 1G84A 2WM0A 1QSFE 3VW3L 1UM6H 2HFEB 1JHTA 1OALA 4TVUA 3QR1A 5F97E 4AY0A 5CLYA 5EEXA 4OLVL 3RPBA 2B3RA 5I8KH 4OUOA 5KJRH 5SWSA 4I7ZC 4JFVA 3K1KC 4EZJA 4DO5A 3AROA 3JV6A 4G8GA 5FDWA 4L48A 1AS7A 2DIBA 1I7RB 3TBWB 1P7KB 3SGJA 5GHWL 2HUHA 1TZHA 2I5YL 3S3JA 2P8LA 1UWGH 5C0DA 3UJJL 5LBSA 2EACA 5JW3L 5AL0A 4G83A 4PJEF 5GISH 3UYPB 4XC1H 1U36A 1H6TA 4P99A 4TYUA 2K45A 4LT7A 1SLXA 1T0MA 5L6YL 1ZHNA 5JHDD 1TCRB 5L2KA 5KJ4A 3QUML 1KXHA 3AWGA 4PRDA 5KSBF 3WJLC 2H32A 4KGJA 4M6OH 4WWNA 2IDCA 3CHXA 4LSVH 1LQSR 3P3RA 4B9FA 2NZ1A 2XXMB 1EH9A 4G5ZH 4XMPH 3NESA 5AOLA 3ARGA 4HWEL 1QAWA 4ZQTA 4X5RA 1A7OL 3LEYL 2QVFB 1W8EA 1X4YA 2V9RA 4TSBH 4L8BA 4W9ZA 2VSKB 3J2PA 2DQTL 4BFJA 3CQFA 3HCVB 1JGUL 2NDGA 3CN2A 5CLTA 5LGHH 4K0OA 4M7JH 4BKLA 1ZLEA 2MOGA 4ZO9A 1AKJA 4LLVA 1A8ZA 3CMOH 3R0MA 1BVOA 3U4KA 4XCNA 1T5WB 1XEDA 3UBHA 3V4PH 1IZKA 4LCIL 3IMVA 4ZS6C 3B9AA 4XVOA 2C3WA 1YY9C 2AEOA 2DH2A 3LAFA 4A37A 1FVDB 1C7TA 1ZVSB 3K2UL 4GQ9H 4OM0H 3MYZA 4NAJA 4X6CB 4XVJH 1CK0H 1GC1L 1T22B 1UQSB 3OQRA 4ZMYA 4ZNEA 2DWSA 4KMTL 4HUMB 3IS0X 3IDUA 5E99L 4ZAKA 1NKGA 4BFFA 3RQ3A 2FSDA 4A6YA 3GZQA 1JRHI 1IGTA 2Y07H 1KTLB 1ZIAA 5A3IC 4I0PA 1NDMA 5FYLL 5HHVH 3JTBA 3VFRA 1A7RL 5DVOA 1MWOA 1WICA 1IGIL 4KO5A 1FDLH 2P9RA 4L0YA 1UENA 3MUY1 1BZEA 4XHJC 5IB1A 1GZQB 1BZ7A 1IGML 2N01B 2HKHL 4MAUL 3ZTEA 4AGLA 2XOTA 4JPVH 2WD0A 2ZOLA 3DRTA 2R23B 3RWDA 1EK3A 3S8FB 4KJWC 2P52A 4MA1C 1KT2B 2IH3A 1CLCA 4F58H 1GOHA 1U8NB 2G2RA 4XCCL 3AXHA 3G6JE 4NQEB 4LNRA 2F1AA 3DETC 1K72A 1QLFB 4NC2B 3P2DA 1JNNL 3C09C 2M26A 3GXDA 4GAJL 4K9JA 5MEND 4XPGL 4NBZB 1U92A 4IKKA 3RGVA 1MHHB 2MEJB 3GHEL 3ARWA 1QRNB 1OCCB 1UKQA 5I75C 4DP9X 3PFUA 2WYZA 1RIHH 3BP7A 2ATKA 4XOEA 3THML 2X4SB 4L5FL 3RWEB 1RXLA 2CLZB 1NMBH 4HLJA 1CICD 5FLUA 1AYRA 4P07A 2A38A 3ZE0E 1PCXA 3FQWA 5DHYB 3QDMB 3MV8D 1JN6B 5IFHH 4E0RA 1FBIL 2ED8A 1VDGA 3N0AA 1EA9C 2E75C 4NKQB 2AJ3B 4N8VB 2FTAA 4YDIH 5EF1A 2EC9U 1WT5C 1WCBB 3SQBA 1OAZH 3EJSA 3TBBA 2B77A 4MCYB 5DJ8B 3RWFA 3MOBH 2UX7A 1LJMA 4HKBA 1WYJA 3ETBJ 4WZ9A 4MNQD 2PF6A 5JQ6L 2EYRB 4I9WD 5F9JB 2VWEE 3D6GA 1FL5B 5T1KA 3LN9A 4P48A 3SE4A 1LQBC 3ZLQC 1MDAA 3QJHA 1XGQA 1SOSA 2DD8H 1YN6A 3HZYB 4WAFA 4AM0B 5T1MB 1II4E 4A7GA 5I6MA 5FYJH 5F8QC 2JLPA 3RWHB 5C2UB 3BMVA 4H0HB 3UGUA 1M7XA 1XIWA 3QXDA 1EAJA 3HG1E 4NCC1 3F6JA 2FJSA 4PJ5D 2VB5A 3ASOB 1FF5A 4U49A 2GIXA 5HYJD 4JVWA 1BPVA 2EE2A 2G9KA 4TVPL 2WLLB 3C5JA 5EBMA 1IZJA 2L7EA 5FCUH 3WKYA 4OUUB 2NR6A 2JELL 2P5WA 2YXFA 4XNQA 3T0BA 4E42B 3EFOA 2DJUA 2CMRL 2R15A 1KWGA 4ZFZB 1BMZA 3C12A 1FLTX 4X6EA 5I1JH 4CMHC 4HIXL 4TXVB 1A6ZB 3CZUB 4UTBL 2A9ML 3ULVD 2X09A 2UZIH 1KBVA 4I1RA 4DGVL 4Q14A 1KCWA 4I0CC 1EXUB 4LHQB 4NZUH 4RFNC 1BG9A 4XNMA 3LV3A 1RSYA 2WXQA 3II2A 4DKFL 5CD3B 1BFOA 2DQCH 1GIGL 1JRHH 1WH0A 1L9RA 4WI7A 3CFBB 4OIIL 2EKJA 4YBHA 5MERA 3ULUD 2BY3A 1XCWA 3FTWA 3VJ6B 1MFCL 1PFCA 3VMOA 1I8IA 3UERA 4AV4A 4I1NB 4TUOA 3UTSD 5INCA 5E2TL 4URTB 4NN7B 4FX5A 2G2PA 3EH3B 2Z8RA 3RX5A 1CDUA 1IQDA 1BYPA 5C7XL 4MJIB 1NA8A 4OLVH 2APSA 4X4ZA 1N8OE 1HDMB 2YXVA 3JWNG 4RFEB 2CKNA 1A4JA 4CN4A 1U42A 2P3YA 3IJEB 4HOWA 3LJ3A 5GGVY 1O75A 1IGYA 4N26A 1B2WL 2I5YH 3UJJH 2VDPB 2C3XA 4H40A 3AS3A 5JW3H 3UP1A 4P23A 5D7LA 1OM9A 3TFKD 5J13B 3FUMA 4ZYKB 4W9FC 2CJUL 2VLRA 5BQDA 2VABA 2AQSA 1U91B 3MZGB 4Y19E 3OXSB 1CFNB 4L8SA 4U1MB 1L9PA 2NUPA 4K3DL 1PKOA 5DRNB 1TVHB 2WBWB 2COQA 5L6YH 2WBJC 1M53A 4IGBD 4I9XA 4LCWD 4LKXA 3QNXB 3F6IA 3BEVA 3B3IB 4NC0B 3QUMH 4PJIA 1L4IA 4YPGB 4NQXA 5EORL 4G8FB 2X6UA 2AQQA 1ZHLB 4XO4A 4YIQA 4G1MA 1VPOL 4MMYB 2Q76A 3VWKD 3QR2A 5DRZA 1MLBA 4NUGL 4HWEH 3WS6A 4XT1C 3G5ZB 1X5KA 1A7OH 3LEYH 4D0BB 2E7LC 1JNJA 3TV3L 4LAJH 4MD5B 3DMMB 5A43C 3IRCA 5ESVB 2FJFB 4D3CL 3WUWB 2DQTH 3EHBB 1Q9OB 1GJIA 2IXQA 1JGUH 1J0ZA 3EOYG 2EDFA 1J1PL 3QO1B 3K2IA 2H7WA 3KDPB 1HK6A 4P5TB 1R1CA 2IDSA 4ONOA 3ARDC 5BVPL 5F1IB 4HV8A 2VMDA 5DZNA 3UAJC 3QUHA 4HS3A 3UGEA 4BSVA 2PPAA 1XF1A 4LCIH 3ARTA 1OD9A 4XE0A 5B3JF 3MCKB 3IBEA 4DGYL 4KQ3L 1VCBC 1PZ2A 3D18B 3FFDA 3SJVE 3ARBA 1XF5B 2CA4A 2OSLB 3K2UH 5DJ6B 3OSVA 2R51A 2GSGB 4IRJB 2CO7B 5FYKU 2V5TA 4UQBA 1GC1H 1UJ3A 1CFSB 3BSHA 4IHBA 5IBUG 3SGKA 4KMTH 1PQZA 5E99H 3AACA 2CJSA 2JKSA 4JFHD 2BVOB 2PTUA 5ESAB 4DCQB 2MMXA 1KULA 4BZ2L 3MBXL 1LXMA 3CHPA 2VDQL 1J9TA 3EBHA 3WLBA 3PP4L 1FGNL 3KCPA 5ESQB 5FYLH 5FFOA 1A7RH 2BNRD 3BIAX 4Z3JA 1IGIH 4GRLB 4L18A 3LYRA 4JUTA 2BIHA 5CUSL 4FGMA 2XTSA 3QEGL 4PS8A 1HT6A 4KWUA 4Y9CA 3O8XD 1QTPA 1IGMH 4LXFA 3BUDA 2HKHH 3MGOA 3QI9A 4MD0A 4MAUH 2WY3B 4F2MA 4B0MB 4CVUA 2MKWA 1ZRUA 2YEZB 3HNTL 5D1ZB 5J1AA 3QJSB 3D4GA 3K2MC 5DMJB 1T6BX 4LIQE 3BT0A 3GSOA 1KCRL 2EYSA 4XCCH 1D2PA 1BLNA 5I5RA 3N42F 5C0AB 2BWQA 2B5IB 4JUSA 4MJJA 1ZHKB 1JPGA 4OSUL 1JNNH 4GAJH 2IWEA 2OA9A 4H25A 4XPGH 4BFEA 4AK1A 1PFOA 2XQYK 3GHEH 1V3KA 5D1QA 5CBAB 5AKVA 4F7PA 5I0ZA 1HNGA 4K3EL 4ABWA 2Y1YA 2V2WB 1H3WM 3C6EA 3THMH 1M7IB 1NFDF 4MAYA 5J6HA 1ZGLM 2UY7B 4L5FH 1TYJA 3DSNB 2Z35B 4ZX5A 3LEXA 2MNUA 3MNMA 5C08A 1FYTB 2Z31C 2BSCA 3ATAA 4WFGE 3FN9A 3ZKQD 1FBIH 3MLVL 3OTTA 5KSBE 2KL6A 1SJMA 1W2KT 1XSJA 2DMBA 1CF1A 1CQKA 3CVCA 3FT2A 3MJ8B 5FUCC 5HHNA 2NX5A 1QFWM 1CLZL 4J3OG 4UF7C 5DD6A 3ZTCC 2Q5BA 2YA2A 3O6ML 1ZGLA 2WQWA 4CU6A 1XXDC 4L8DA 5EG6C 4AMWA 4KKNA 3MCG1 4WY7L 3JV4B 5JQ6H 1X44A 2N7SA 3US1A 1KIRB 3Q7JA 3LXUX 5DMGC 5TK4A 3OQ3B 3T0XA 3SYPA 3WN6A 1P5UC 4BGDA 4L3CA 3FT4B 1OSZB 1NLDL 3HE7B 3SEPA 3JSSA 4P9HC 4UQCA 3G04B 3KNBA 3N85L 5AW9B 4KZ0A 3IDXL 3QDJE 3Q2CA 4E41B 3P4OA 2D3NA 5AOZA 3EYFB 4YE4L 1X5ZA 3BXNA 5HGBA 1KCSL 4WUKL 1YNLL 4GKSB 4NQCE 5ACLA 4TVPH 1M05A 5FO9A 4FA8A 1M6OA 1IM9D 1IBZA 4YHML 1O9ZA 2XN9E 3VXPA 2E56A 2JELH 4A38A 4G9FE 2CDFB 5JHDA 1PL3A 5CZRA 1FWXA 2OCJA 2CMRH 2IH1B 4BDVB 3TCLB 5ABAA 3UBXG 3D34A 1EFXD 4HIXH 4NJ9L 1TKWA 2A9MH 4UTBH 4F3FB 3N43F 2UZXA 4DGVH 4ZX3A 1A9BA 3ARFA 4IBSA 3QG7L 3T2NL 4Z78B 1B0RB 4HK0B 3FTSA 1CXIA 4KTEL 1D5XB 5I1GL 1LE5B 3I3EA 4A2FA 2NY6B 4DKFH 1OSYA 2IVFC 3P4NA 3L17A 1IT9L 1GIGH 2F8VA 5T3ZE 1CFTA 3BUYA 4OIIH 3D9AL 3UBGA 5JW5A 3FRPB 2F1EA 3WXWL 1TZIA 3B2PA 4B7LA 1MFCH 3RVXD 4QJ3B 1AR2A 3AZUA 3WELA 4WHYG 2WLIB 4KO6A 3MMEA 1C7SA 4EN3C 2DWDB 2HSIA 3VTMA 1C9SA 4Z7QF 1MIEL 1E5BA 1RFDL 4ZBJA 5E4IA 2APTA 2EDLA 4PV8B 3UPRB 1PJWA 1JYVA 4KXDA 3ABGA 5L4JA 1E30A 4JFPB 4AJYV 4FNSA 5EU3B 1FFTB 3KBEA 4TNWK 1AC0A 3BESR 4O2FB 5EUKB 3UZQA 2YJLA 5AOJA 2QV2A 1B2WH 2VN3A 2UX6A 3BAXA 3UTQA 4FFVC 3HRZC 2CJUH 3DJRA 4KZDL 4UQAA 1DQJA 4NQUA 1QHOA 4NUPA 4F7CA 1UXMA 4K3DH 2J6WA 3NRPA 2H6UA 5K9QG 1NEZB 1HKFA 2Z1PA 4NPYB 1S9WA 4Q58C 4NRXA 1TEYA 1CXFA 3A47A 3AS1A 4OJAA 2Z7WA 3AADB 4C56B 4UZGA 2RACA 2IAAC 4PUBL 3H7BB 2XACC 1YMMB 3EDJA 3S37X 2WQRA 5E6ZA 1B90A 2OMTA 3O9WA 1MWAL 4WUUE 2YMOA 4MDRA 1VPOH 4PY8I 3RNKA 4ABQA 1XSKA 3JTTB 4GIAA 4LBEA 4AGQA 2IGLA 4CKVX 1NIFA 4NUGH 4XN4A 1MCBA 4DO6A 3ISYA 2Q86A 3TV3H 5IIEB 3VXUA 3BPNC 3HMWL 4GXFA 4D3CH 5C92A 2HVKA 2MHAA 2VDNB 3QIBC 5FIEA 1J1PH 5IT2L 1AHMA 3ES6A 4Z0XA 2IAMD 1GYCA 3TNNB 5L4IA 3AFLA 1W15A 2WLNA 2ICCA 5D7KD 1IGJB 5BVPH 2W0FB 2VLKE 3AQXA 5EU6D 4LLQA 2D7TL 2UWEF 4DGYH 2NW2A 5J57B 4KQ3H 1ZTXL 2C3VB 5HGAB 4G3YL 1X9RA 4L29B 3OM3B 3FQNA 3BHBA 4TMPA 3M1OA 4HWNA 3QWQB 4KRPB 2YN3A 3KMDA 4JDVA 1IAOA 3GMPB 2VZSA 2A3TA 2QHLA 4PGJA 2CK2A 4XP9L 1OKEA 2R1YA 3PABB 3PHQB 4BZ2H 3MBXH 1JJUA 3DC0A 4LCUA 2VDQH 2N1TE 2OBGA 5DDHB 3PP4H 2W07A 2GC4C 1FGNH 4KK9D 5GS0L 2F53A 5JIQA 5CEYB 2C34A 4HW6A 3W5NA 5E4AA 4YXKL 1AAJA 3O6FB 5CUSH 2FWOB 3LN4B 2P5EE 4A63A 1Q4NX 3B9VA 1XZWA 3NPZB 5E4OA 4X6CF 4BFKA 4DKAA 3HNTH 5KYXB 3TFBA 5HYJA 1KCRH 2CO1A 3Q3GA 2OZ4A 4IBTA 1H3PL 2A6DA 5E08L 4J39A 4JFFE 2FECI 2XY2A 3I9GL 2WYHA 5D8JL 2DPKA 4PJ6A 1E67A 5GZND 3V0FA 3P0GB 4P46A 2VRAA 5DD3L 2Y2YA 1YJDL 4OSUH 3TESA 4JDTL 3KPOB 3NFNB 3O2DA 1BXUA 4JFDB 1KJ2A 1UT9A 2I60L 2WTOA 5F0JB 3TVMC 2OTUA 4K3EH 3TA3B 1RK7A 4L4VB 5C0EB 4M29A 1XF2B 4HHAB 4U3XA 3S3SA 1MI5A 1O6TA 3SDYL 3STLA 3QZBA 4NUJA 3DX7A 1URLA 4OBSA 5C0BD 2OMYB 4WWKC 3MLVH 5TE7L 1JMXA 4HT1L 3VYPA 1OP5H 1O5PA 4X5XA 1CLZH 3FULA 4JEGB 4RAVB 5D7JA 4OGYL 5C0NC 4Y4HC 3HAEH 2PXYA 4ZO7A 3OKEA 3FHEA 3O6MH 3JWDC 4ZOAA 2YRBA 1E8ZA 1HSAB 4WY7H 1K5NA 4FG4A 1J05A 2R4RL 1CXEA 3BVTA 1LO3L 3EOAA 3IEAA 3VNYA 2C3HA 4YK4B 4YFLF 3SGDI 3WG7B 1AHWC 5I9QC 3IB4A 5HY9B 4P5KB 4PJFB 3BZFA 1NLDH 5ACMA 5JA9A 3L95B 4X6BB 5SV3A 1UOVA 4EIBA 3N85H 4IBZA 1A1NB 3IDXH 3OB8A 3P3TA 5B3JE 2X4QA 4LPVA 4XC3H 4L3EA 4WDIA 1MFBL 3BPCB 4YE4H 5KYUB 1WWAX 5ENWB 1KCSH 4WUKH 1YNLH 5E94B 2WK2A 4PRNB 1EGJA 1M71B 5T3XE 3LPGA 4MASA 4YHMH 4MGXA 1P4IL 5DK0A 1JPFA 3DDFA 4MNGE 5TDOB 3S3DB 4A68A 4EIGB 3JVGA 2APWA 3QFDA 3IPFA 4K3HA 4OZHA 1YY9D 1KELL 2C9PA 3EO1A 4NJ9H 1OF2A 4QT5B 2ZUSA 3VO0A 4FHKA 4PB0L 1BJ1H 3T2NH 3QG7H 3FB6B 4HDIB 5ISZE 4KTEH 4F57L 1T83A 5I1GH 5A2FA 3H6AA 3ABMB 3RBGA 2C9SA 1I7UA 4MMXB 2X2IA 4WFHE 3D30A 4PRAB 1IT9H 4JZJB 4RBPK 5DJXA 3D9AH 3WXWH 5BV7L 3CX2A 5C0CA 1RERA 1BM3L 2J8UB 4YC2C 2KZ1B 5LCVA 3RTQB 5A3ID 1BREA 5DZVA 1KENL 1F3DJ 5AW1B 3SZKC 1B4TA 1BZ9B 4G8GB 3TO2B 2MQCA 4XHJD 1MIEH 5AOMA 5I8EA 1RFDH 2I7OA 5I15L 1MEXL 1EHLL 4JFED 2Y5QA 1DYZA 4XHQA 5B1CA 5HI4D 3BAYA 3CVIL 4KJWD 2DMCA 1KFGA 2PP7A 5GSVB 3IN2A 1Q0YL 3K5SA 4GKNA 4PGBA 5TE4L 5FFGA 3ZDYB 4P0DA 4HGWA 5ALBL 5EFIA 3RJOA 1FGVL 4RETB 3NDYE 1NFDE 1NCHA 1A9EA 1LK2A 4P57B 3EJQA 4BINA 4Y1AE 1J8RA 4YNYA 4ZMAT 3FT3B 4KZDH 1ZHNB 1GTFA 3FQXB 4OJDH 5B7MA 5L2KB 3ML8A 3FFOA 1NTDA 1DR9A 3QIUB 4K9EL 1PF3A 3OMZA 4PRDB 2XIDA 3WDHA 2IG2L 4XH2B 1PY4A 3KDMB 3FUNA 3LRMA 4MDJA 3MRDA 1U8CB 4BH7A 1M9WA 2VR3A 4Z8FL 2LFGA 4WW2A 3RBSA 4MB4A 4PUBH 1AGDA 1P84J 1DVFC 1MWAH 2ESVB 4Y5XB 1Q0EA 3ALPA 1HCYA 35C8L 1F6LL 2VISA 4Q74A 3D3VD 4YHIA 1DUYA 5BRZB 2B14A 2DYPD 5DS8A 2W91A 3CVHA 1D6VL 3HMWH 3L9YA 1WJ3A 3H9SD 2BS8A 4NYLA 3H55A 2ZUQC 3SGDH 3T0DA 5JA8B 5IW1B 1LO2L 5DJZA 4P2OD 5IT2H 3S35X 3VNZA 3HR5A 3OJ2C 3C5ZB 4NP4L 5H37G 1W8NA 3MXWL 3QFGA 4N2GA 4XCYA 3QQNA 5GS1A 2GEQA 1Q94A 3RWJA 1R3JA 4GRWB 2D7TH 4RDQF 2EIJB 3D48R 4M5YL 1QLEB 1WZ1L 1ZTXH 2BZCA 2XCMC 1I8UA 3DJZA 5TF1L 4G3YH 1YPZE 3V0IA 2ATAA 5LNEA 4X8GA 4JM2C 1ORQA 3SCMB 1WFTA 1GW0A 1F86A 3WE6A 5E1GA 2FWUA 3MNZB 2RGSA 1XH3B 4A6YB 5B39G 3ZE2B 1L5GA 1SFHA 8CGTA 3KPSE 2JJWA 3CU7A 2QGEA 4Y1SA 1G7JB 3MBWA 2YD2A 3KPRE 3D39E 4ODXB 3WFEL 3UBXA 1EAPA 4YSCA 4KZEL 3QUZD 1UD4A 5EBGA 1NC4D 4XB8A 2KDYA 3JV0A 4XX1G 3WAKA 4MNHA 1XF3A 5GS0H 1PZDA 3BKCL 1CPUA 4R4NC 2OMVA 5DC4B 4YXKH 3DRTB 1FNFA 3KW8A 5FS5A 1G0DA 2X4PA 5LO7A 4Z7QE 3ARZA 2ZUYA 5IZ7A 4LVHC 3NSCA 3IMWA 4Z3FA 8FABA 4R2GC 4QYAA 3FMGL 5CCHE 3ZVVA 3S35L 3IDGA 1AGBB 2ZUTA 1FAKT 4NAQA 3VXRB 1G9NC 5E08H 4FLHA 1H3PH 1ETZB 1F2XK 1J1XL 2HA1A 5F7FA 1HEZB 3I9GH 3CFJB 3RNQB 5D8JH 3VFNB 1JCVA 2ZX6A 4P59L 3OR6B 4GXUM 2YZ1A 4M8RA 4QRRB 1UGNA 5DD3H 1MLCA 1YJDH 2O93L 4JDTH 3BP7B 5HVHC 2IIJA 5E8PA 1AKPA 1YNTF 3VCLB 4CDHA 2I60H 1BEYL 2M83A 3BKJL 1ASQA 1I9RL 3IT8D 1I8LA 3ESVF 1R46A 1MCRA 2EKSA 1A02N 1UWEL 3BI9X 4N2CA 4TRPL 2FJHB 1H9VA 3SDYH 4P2QB 2A73B 2HRHA 2BNQE 1JXKA 3FU7A 4HH9B 3EXJA 3S96A 4BUHA 1QQDB 4G5AA 2ZXGA 4A7UA 3K6IA 3BAJA 1A9VA 2VTFA 3AAZA 3SQBB 3DXAD 2WTPA 1XQ4A 5TE7H 3GLDA 4YAQB 4HT1H 3RWFB 5TF0A 5C7ZA 4FQLL 3OKYA 3ZO9A 1MFUA 1QWHA 2XHNA 5B4MC 4OGYH 1JZ6A 2JH2A 1YN6B 2D9CA 3N5AA 3KLHC 3FH8A 4LGRB 1NUFA 2R4RH 4JO1L 4F24A 4WK0B 1LO3H 1Y18B 4DEWA 3L3IA 2P44B 3RVTC 3D0AA 4M48L 2LLGA 3QXDB 3RKDD 2V9QA 3HI5L 3V4LA 3JYBA 3C5JB 4BFOA 5ANHA 4ZMLA 5EBMB 1I1AC 1UXWA 1RZIB 3ILQD 3JT2A 2UWEE 2FBRA 4PJ8D 4XNQB 1FNAA 1MFBH 1CF8H 4DQOL 3EFOB 3TJHD 1IM3D 2VLJA 4BUQA 3GJFH 5EEWA 2FHFA 3ARDD 4YSUA 1HNYA 1P4IH 2P1YA 3D0LA 3HFML 3L4XA 4LESA 5HTSA 2BHYA 3VQ1C 3KWUA 3EH2A 3FNKA 2J21A 1JZGA 1MCKA 4JMNA 4RFOL 2X6BA 2YSSB 3IKCB 1RZFL 1GXEA 3UDWC 1KELH 5DEGA 4DP2X 1BFOB 5BUGA 2B39A 3QCVL 4PB0H 3U1QA 1WP6A 2FEEL 3GBLA 3GSVB 4IIZA 5MERB 5I73C 5MEOB 3VD4A 4F57H 4MHHG 1FFOB 2AKRA 3WU1A 4YSTA 4AUYA 1IGFL 4ZW6A 3M17B 3B8SA 4JQVA 4YLQT 1I8IB 1SN0A 4HIEA 4NN6B 1HQRA 5INCB 2KZWA 1FFPB 1TVDA 5BV7H 3NZUA 4JG9A 1BM3H 2EYTB 4X6CE 3DUUB 5FHBL 5FYJD 3BRGC 4BV1A 1KPVB 2PCYA 2E9JA 4JO8A 4N90D 4HJ0C 4WO4C 4G7VL 1P69B 1N10A 1KENH 4TNEA 5B1AB 4CSTA 5JXEC 1GH7A 5IEHB 2VC2L 5EU6A 3NCWA 1X5AA 2EXTA 3QXUA 4EUPB 1A4JB 3WFBL 2AQNA 1NCWL 5I15H 1MEXH 1EHLH 1IGYB 1S7QB 3L3DB 3TN0C 5DJAB 3B9KB 4AYID 1IC7L 1SY6A 1ZEAL 2APBA 1QA9A 2C1OA 3CVIH 5CJXC 5D7LB 2A99A 5IR1A 2VDPL 1Q0YH 3QHTC 2WJ7A 4TQHA 5TE4H 2DKMA 5CJOL 1OK8A 1Q8MA 1U95B 5ALBH 3SYQA 1FGVH 3IBOA 1MQKL 4L8SB 4S0TD 4XZ4A 1UB5B 2E3VA 4PJ9C 2ZG1A 3IVKB 3IJ8A 5GS0C 5JUEL 1AZVA 3J8F7 4H2AA 1PW3A 4LKXB 3BEVB 4B27A 4OI7A 3IAPA 4K9EH 1MCCA 4HBCL 2IG2H 4JGUA 1JI2A 3R1GL 4ZSOB 1W6LA 4WI0A 4CADB 1E50A 3BSZA 1UVQB 2K1MA 3OKNA 4MVBD 1E6JL 3IXTA 4Z8FH 2Z31D 3MJ9A 3HUJF 3E9UA 3FQUA 5DJ0B 1QRNE 4H1LA 4A2LA 1FNHA 1ND0B 3TEUA 2YMTA 1U0QA 3FRUA 2A74B 3MV7B 35C8H 5DMKB 1W80A 4HS6A 2QT6A 2PW2A 1DE4A 4Q9RL 1D6VH 1KTJA 3QC5X 4DKDC 4E5XA 2XX1A 2XN2A 4QRPD 4KK6C 2ENSA 1LO2H 4Z7VA 1TYRA 5HVWA 4FL4C 3JBG7 1CFQA 1INEL 3WNMA 4HIPA 5GGRB 4YSQA 4XN1A 5EZJB 5DMGD 4LDCA 4NP4H 1AGCA 2YD6A 4K7PY 4YHPB 3MXWH 2DQGL 3LKNB 3BWSA 2EP6A 3V55A 1KJMB 4HSQA 1E4JA 3RI5K 1P0SE 2Z92A 1MRCL 1WIPA 1BQKA 2P8PA 4ZXBB 1JL8A 4M5YH 5K9KA 1WZ1H 5TF1H 1JPSL 2UZYB 2I9TA 4Z76B 2X7LB 5I1AB 3MV9A 3QGVA 5AKRA 2G5RA 4M02A 4YHKL 5HYQB 5FX3A 1T4WA 4BD4A 2W95A 3ARSA 3FU6A 1AZNA 1N9PA 4KY1L 3WFEH 2YLKA 4PQXA 1S7XB 1COBA 2W65A 3A67L 1XZ0A 4L1TA 4WNQA 1BZDA 1E42A 4KZEH 4PTUB 4QHKJ 3VI3A 1NGXA 5IBLC 1WIOA 3VXMA 4BK8A 1AACA 3QI9B 5HYSB 4R5XA 3APFA 2IV8A 3BKCH 5DQDL 4BFGA 4F2MB 4MMZC 1UCTA 3LB6C 2W9LA 4YOKA 5J1AB 3QDAA 1DQLL 4G6FD 1EEZB 1U8IB 2QKIA 1UT2A 1QP1A 1V7ML 3L08A 2J8HA 2X38A 4G6AC 3LIZL 4FQIL 1BLNB 4OT1L 1H3GA 2R9HC 3FMGH 3TZVD 4AE1A 3P9MA 1NDGA 4YSPA 2MQ0A 3ARPA 3S35H 2ARWA 4RISL 3C6LA 4FZ8L 4XGZB 1J1XH 3HEIB 4WTZG 1JXGA 2WW8A 4GH7B 5D1QB 3NCYS 3SYCA 1UD3A 4P59H 4NOFA 3ETTA 4F7PB 1NC2B 4LPUA 1UZ8A 3V79C 5D4JA 5J6HB 1BVKB 2FLMA 3LH8A 4N5UA 1I53A 1BEYH 1TLKA 3BKJH 2EUVA 3KVDD 1I9RH 1IBBA 4DP0X 3NCMA 5C08B 1UWEH 3BGFB 1MCLA 3UAFA 4TRPH 3Q5YA 2XWCA 3J27A 5C09A 5D1XA 4EI0A 5BV7C 2E74C 3ATDA 2X05A 4HJGA 1TQCB 3FT2B 4LHUG 4RMVA 5HHNB 1Z9MA 1MFEL 2IOMA 4GSQA 3FN0L 4WV1A 5FYLD 2J55A 3MRHA 4N1HB 3T65B 4PJAA 3UTTD 3RZWA 3AU0A 5EF0A 1ZGLB 1KDJA 4IOFC 5EC1A 4FQLH 1MW2A 2NYKA 3FO2A 4P4KC 1PDKB 4YO0A 3CAFA 1R3IL 2FR4A 2CDGB 1A4CA 4E9QA 3RDJA 3O0RL 5CCGE 5LB1A 4FMFA 3QT2A 3L3OA 4D2NA 2V4LA 1NCUA 4IHOA 4ATWA 4X0NA 1LHZA 4JO1H 3HS0C 1OVZA 1IBYA 5JW4R 1W8OA 3HB3B 4PV1C 2KQNA 4M48H 3CQPA 4PGEA 4FKHA 2YUXA 1ZXQA 3G6DL 3BIKB 3HI5H 3ZKXC 3BXNB 5CEZD 4QD2E 3IAGC 4BE5A 5DHDA 3D85A 2DB8A 1NMCC 3QIBD 2LU5A 2XJLA 5BS0A 2CRIA 4K9EC 2IMNA 1BJMA 3TYGL 4DQOH 4FLSA 1KB5L 2PLTA 1BECA 1BYOA 2NY3D 3F5WA 3TO4A 5H37A 5DUML 4FKKA 4MJ5B 3HFMH 3II1A 1EUUA 4PB9L 1VZHA 1A9BB 2XTLA 1SXSA 4ZRGA 1KGJA 2QVTA 3RVUC 2AVFA 2AABL 4RFOH 3LZOA 1RZFH 3IFPA 1JZ2A 3EH1A 1MF2L 1FVCA 5GIRB 3CE1A 1CFTB 3QCVH 4QO1B 4U6YB 2AGJL 4PJFF 1TZIB 1T1ZB 3HI1B 3TIDB 3ZUNC 5B39A 3A5VA 3D3VA 4Y2DA 4DFHA 2VR6A 1IGFH 3CBJB 1Q9KA 5DVMA 4ADGA 4D8OA 5CP3H 2N0KA 3PLYA 1D7DA 5JW4N 4UT7L 1QI3A 1YLBB 3MMEB 4KH2A 4TLKA 4AQ1A 4DUXA 3KXFE 3P2TA 3EH4B 2WCSA 4PRPD 5FHBH 4HC1L 1CGVA 5H4YA 1OWWA 4Y7OC 4YHLL 4POYA 4S11A 4G7VH 2FHCA 3T8XA 5ABDE 3I6LD 2VC2H 4Z5RA 5FUZL 3KPTA 4GSDL 1D6EB 1HSBA 4LB8A 1JZ4A 1EHKB 3WFBH 3ARVA 4OKVA 4E9TA 4TVPD 4FTVA 3ZT7A 1NCWH 1WAAA 3ZT6A 1T1WA 2NY0C 2WXLA 3Q2NA 1H3XA 1IC7H 1ZEAH 2X9YA 3GI9L 2CAKA 4TNVK 5DS2A 1W72A 2WSDA 4NHCL 3X3FL 3S8GB 3BH4A 2VDPH 4I88A 1JGLL 5KUMA 5CJOH 2OP4L 5EUOA 1MQKH 2V7NA 4F9LA 2A0LC 3EJTA 1ZJBA 4R7XA 1U4EA 4R5TA 2J8UF 4DK6A 5I6KA 2BX5A 4OJCA 1OB1A 2ARJQ 4AENB 5K9OA 4GT0A 5JUEH 1AO7E 1HQ4B 25C8L 1S9WB 1DZBA 2KLTA 4JN1L 2GFBA 4NRXB 3ARYA 1ET8A 1CDBA 2YAPA 3BN9C 3FDWA 4HZLA 4UAOB 4UV4L 2ENQA 2Q3AA 4JW3A 2WZAA 4HBCH 4NI6A 4M8UA 2BDNL 3DIFA 4DP6X 4HPYL 3R1GH 5DTFB 5SX5K 4PJGA 2CHNA 3AY2A 3OZKA 1DJIA 2ZAGA 1E6JH 3RNKB 4L1SA 5B8CB 4LBEB 2HG5B 1SUHA 1CD1A 2Z91A 3FZUC 1Z9SA 4HUKB 1XGUA 4JFZL 1I8AA 4HKXB 3CSYB 2HVKB 4LRNL 4B7IA 3IGAA 1TENA 4N1CA 1ZGLP 2VDNL 5C0ND 3H42L 4Y4HD 4JFWA 3ES6B 4Z0XB 3S48A 3C60C 5IWLA 1J5HA 1NPNA 2HFFB 1E2ZA 4NKMA 5D96B 4Q9RH 4P2AA 2JB5L 4XBGA 2YKKA 3WFDL 5D5MF 1UXSA 3ZMNA 1A4KB 4ONGL 2DTML 1E9OA 1QSFA 3IK2A 5IB2A 4MKTA 3L1OL 3N1FC 1TTUA 2W9DL 4LLQB 4O51A 1INEH 2I07A 2E86A 2NW2B 3FO9A 4DUVA 1HHIA 4ODVL 2DQGH 4EVNA 3FQNB 3BEWB 3QJXA 4IJ3C 4ZZFA 4Z7UB 3B3BA 1H3UA 2Q6WA 3GMLA 1WFMA 1FG2A 2GTQA 3MKKA 4V1DE 4DFIA 1JPSH 4DOHB 2I7SA 1WF5A 4QXTB 2EVJA 2E76C 4LPCA 3NQIA 2R1YB 4POUB 4YHKH 5IV2A 3I9IA 4NZ8A 5DVPA 4LCUB 3IPBA 5EEZA 2H9GB 4PGDB 3DX2A 4KY1H 2F53B 1V27A 2EEAA 3G08A 4XCEA 4JVUA 4YDMA 3U46A 3WHXB 3WNKA 1JMZA 1I1CA 3A67H 3OWRA 4P49A 5IW3A 5I1DA 3GSNB 4ENZA 3ZYJA 4HX1A 5CN1A 5L9DL 3CN4A 4Q9CA 1QSZA 3BPOB 2WSKA 5DQDH 3BZ4A 3FCBA 3ABLB 1N68A 3FPYA 4GRWF 5HVGB 1PIFA 1DQLH 4JGJA 1AP2B 1FIEA 4OR1A 4GO9A 1IEHA 4XP6L 2A6DB 1V7MH 3LIZH 5C2BL 3X3GL 4FQIH 4OT1H 4RVBA 3ZE2F 2GK2A 3GMMA 1MY5A 2X4UA 4RISH 3DO7A 4OV5A 4FZ8H 4HOMA 5C0RL 1LGVA 3UCRA 3GXUB 5E6RB 3OAUL 4D9RD 2J8OA 5CINL 4AC4A 1FN4B 4KPHL 5DD5L 4IRSA 3QJZA 1MI5B 5FF6B 2Y6SC 4L05A 5DJDB 2ZD0A 1MAKA 1EO5A 2NY1C 2CR3A 1VB9A 3MRJB 2KMWA 3OVUB 4UT9A 2E7CA 4LU5L 2NW3A 3RAJL 4OF8A 4M61A 2KZKA 3LZPA 3T4AA 2XZQL 1OP3H 4HIJA 2HLAA 4KV5F 5I74B 1Q0XL 4HFWB 3KLKA 2GJ6D 3LS4L 3UO1L 2GTWA 5ADOL 1MFEH 3FN0H 5IMMA 2FL5A 3ATFA 4BSWA 3PWUA 4JO4L 3HUJE 2AXFA 5T33L 3GMOB 5CGBA 3GI8L 3NJJA 2IV9A 1K5NB 4XTRC 4O58L 1R3IH 4KMLB 1EDYA 1MN4A 1OGAD 1NL0L 3PAYA 1SF5A 1J0KA 3O0RH 3AT0A 2P42B 1FLRL 1L9TA 1LEKB 3CHRA 3BZFB 2WKOF 2D3VA 3FC8A 1HE7A 1X9UA 3AREA 4Z7WF 4HK3J 2COVD 4P5RA 4LLMA 1MSPA 1CE6A 1GOGA 1L6PA 3G5YA 3T6ZA 4JGNA 3G6DH 5D71L 1WBXA 4WDIB 3QZPA 5HHME 3VRJB 4CU8A 2ZSVB 3VXSD 4ONFL 1DJGA 3O81A 4MB5A 4MWFB 1HCVA 1ZCRA 1P5VB 5T5NF 2V8LA 3BH8B 1YMME 3G6JA 5DK0B 1JPFB 2XFXA 2L7UA 3EZ8A 2O5NA 1F1GA 3K8MA 1JF1B 3TYGH 1KB5H 1K4DB 1YAIA 1C08A 1ZDSA 2JB6A 5ALCL 3W57A 2JFCA 4HUWA 5EBWA 5IJVB 4OZHB 2IQAA 3CIAA 3EO1B 5DUMH 7PCYA 3D51A 3QWOA 3V95A 1ZHBA 4PB9H 3Q01A 1ZLSL 2X12A 3X1FA 1EZSA 1F97A 2NNFA 2ZUWA 3QQ4B 4FXLA 2ENPA 2AABH 2VCOA 5LAPA 1H0DB 4Q8BA 5IW6A 5D2LB 4WW1A 3KJ4C 5IBUB 1MF2H 3AY4A 3EADA 4JM2D 4L4TB 1P4BL 4Y88A 1A4AA 4EZLA 1GKEA 3D52A 5H4ZA 5IREA 3QRFM 1JWSA 2AGJH 3SDAB 3BVNA 3F84A 1NEPA 1XB8A 3AUVA 5C0CB 4PS3A 3DUSA 5IEKA 3BFWA 3EGXB 3QZWG 1WTGT 3MUZ1 1JE6A 4UT7H 4HLZG 2LT9A 1VJSA 2GI7A 4FQQA 4NIYE 4GG6F 5L4FA 2ZSWA 5EWIL 2XTJB 2NQ3A 4A7SA 4P2RB 4ZTOL 4HC1H 3P30L 3ZE1B 1HI6A 4YHLH 3WMQA 3L7FA 5T1LA 3WEAA 1TTFA 3C8KA 4JRXD 4JKWA 4R4ND 4QRSA 2APFA 2GIMA 3MRRB 5FUZH 3AXLA 4GSDH 2BC4A 1ZSHA 4CDGC 3SDDC 1JHLL 4GKNB 3GTTA 4M43L 3W39B 1JV5A 1SHXA 2ZOWA 2DBLL 4U1JB 1F1DA 2VE6A 5AZ2H 3X3FH 3GI9H 3KLLA 4ZUUA 4NHCH 3HG1A 4LPWA 4R7DA 4CC4C 1JXJA 1JGLH 5E6SB 3NPSB 4NLHA 2OP4H 1S9KC 4EJ1C 5KOVC 1TFPA 4KUCD 4UDTB 4W9GC 5DJ2A 5EBLA 3U7YL 3W9EA 4QRFA 2EDMA 3KR3L 2HJKB 3FSOA 1QWNA 3GB7A 4IMKC 3VGAC 3U36A 25C8H 3C08L 5EZIL 3BD4A 4QRQA 4MDJB 3VGGA 4JN1H 1SQ2N 4HUVA 3CPLA 1I8MA 1NBYB 4UV4H 4N2NA 4ZTEA 5CKAA 4YHYB 3OMNB 5HJ3A 2Q9OA 5HI5D 2XI9A 4TSCL 1AGDB 3L4WA 2BDNH 2VH5L 4HPYH 1EEUA 3MRMA 1KLUA 1CGTA 3TBTA 2G9HA 2JKNA 4HVBA 4LHUA 4N85A 2BOCA 4YHIB 3M6DA 4W9EC 4FN0A 2MPAL 3GLEA 3MUJA 3PUUA 3CVHB 3RZCB 5F9DC 4JFZH 4G8EB 1QBML 1ZVYA 1L9QA 1RUPL 2GSIB 2ZT9C 4KI5F 4LRNH 3FT9A 1R5VA 4NYLB 4Q6IC 4QYOB 2QV4A 5LGYA 4HKJA 1TTAA 2P7TA 2VDNH 3GSQA 4X4XA 3SKMB 3H42H 3S8WA 3KPQB 2FQEA 4RGMC 1PAZA 2JB5H 2WVVB 5FA3A 3NIFF 3WFDH 1ZIBA 1BD2D 4ONGH 4L2YA 1H15B 2DTMH 4XCYB 4DZ8B 4PR5A 5GRJL 3QFJE 3MRPB 4GI6A 1Q94B 3RWJB 3IF1A 4F8QA 2W9DH 1R3JB 5TFSL 1EEYA 4XZUA 3RVTD 4AUJA 1UASA 3QCUL 2PTTB 4X6FB 2HAZA 4UM9A 3U9PL 4ODVH 2FX7L 3KPNB 3T2QA 2G4GA 1WS7A 3TM6A 1IAMA 1PD0A 3RWGA 2AK4D 1IEBA 2EECA 5J1TC 3A4EA 2K4WA 2ZTBA 5F8RC 4A6YL 3MBWB 1XR8B 1MH5A 1D5ZA 5I0VA 3FCUB 4PJFE 4DN3L 3E6HB 3Q0HA 4Y19A 1Q1JL 1IAIM 1QMUA 1JFHA 2BERA 4MNHB 4M3JA 1U8LB 4XNXL 1Z9OA 4UIMB 3QUXC 2WWKT 4NOBA 1S9XA 1P84K 2FT6A 2P8MA 3T0EC 5I1HL 2EIZA 4NQDB 4JR9L 3HE6C 5D6CA 3SDCA 5KBLA 4I0KA 3BDYL 4LSSL 5L9DH 4OD2B 1YA5A 4LQFL 3T0AA 4CSZA 2EE9A 1OHZA 3IDYB 4QRUB 3T77B 1XCXA 4XXWA 2YD5A 2KPWA 4MCMA 5PCYA 2IDQA 3BLKA 1KTRL 3IDGB 4NSKA 4HIHA 1CDGA 1D7FA 4I18A 3ZK0A 4PS4L 4XP6H 4R4BA 1B4RA 4Q52A 5C2BH 3X3GH 2XA3A 5HDRA 4QOKD 3OKKA 4W9IC 2A6JA 1ZT7A 1MLCB 3WFHA 4AQEB 4WO4D 4KKBC 4HJ0D 1J7VR 2P26A 4Y2OA 3CH8A 5C0RH 5E8PB 1T04A 1X5JA 3OAUH 2CDEA 4K7FA 1KV7A 1JV2A 4FJ6A 5F7NC 1QSED 5CINH 4XNZB 1XSOA 3DARA 3OBAA 2R69A 4KPHH 5DD5H 2XWTA 2HT2D 2J8UE 4U7SA 3DROA 4OF7A 5DMIL 2ODHA 1U2CA 3FU7B 3LKSB 3NA4A 4N8CL 1AGEB 4MCNA 4KITB 1OE3A 1TQVA 3M1CA 2QPFA 4LU5H 3SJVA 1AC6A 4NQQA 3RAJH 5KS9B 2NY5L 2CBMA 2XNAB 1PBYA 2XZQH 3OB0K 4KGLA 3W0WD 3WHE0 3UO1H 3GMNB 1Q0XH 4H8WL 5ADOH 3LS4H 1H3VA 1NZRA 4U1GC 1WD9A 1YUHA 3AUWB 3LQZA 5GS0D 1QFUL 3TEYA 1C8PA 1HC1A 3NRFA 2ICWJ 1LD9A 4JO4H 3ZKMC 1CDHA 5T33H 2PCFA 3QUYA 3GI8H 1TQBB 4R97C 2EIEA 4O58H 5BZDA 3I3DA 1NWOA 1QLRA 1NL0H 4Q89A 2MOQA 1E0OB 5DFWH 3WN5A 5J9PA 3DURA 1HJBC 5I17B 1FLRH 4TUJB 5D5ME 5LN4A 2GABA 3RUGB 3BVDB 2X2UA 3AQYA 3OKDA 5GRYA 5MHSE 4JQXA 3V6FA 5D71H 3MOAL 3UZEC 4ONFH 4UTBA 3QEUA 5C0JB 2AJUL 5H2BA 4HA1A 5IY5B 1IKOP 1L0QA 4KK6D 1FL6B 3L81A 4LPXA 1QASA 2FSEA 4W9JC 4YDLC 4DPRA 4KROC 3BKYL 2ESVE 2UY6A 5ALCH 3DSFL 2VN6A 4OZGB 3UZVA 5JOPD 1T4KB 2R83A 1JDCA 1E2VA 1RZKL 3NVQA 1N3NB 4EIZC 1IC5L 2WWOA 1ZLSH 3L4TA 4FXGC 3VXNA 3CFEB 3FUEA 2IADA 4RBPH 3CFDA 3FH7A 1AZCA 2ICWA 1J10A 3AC0A 1P4BH 3S7GA 5CIPA 4HIEB 3M45A 3MRLA 1HQRB 1FSKB 1TVBA 1HHHB 3RDTC 1T0PB 1SLVA 3L5IA 1KGWA 5KSBA 1GAFL 2K3TA 4HZ1A 1AD0A 2XVLA 4GRWE 4TLSA 4TUKL 5AZEH 3UTZA 1F3JA 2AJZA 2WVTA 3FQRA 3NIDB 3SYOA 3KPSD 1BVLA 4GW5A 4Q4EA 1TNNA 1IIKA 5EWIH 3E7JA 1KBWA 4ZTOH 5IBLD 3P30H 1DN2A 2PO6C 1ZK9A 2LTQB 3ZE2E 4OLZL 3LB6D 3QEQD 3WTWA 2X5PA 3KVQA 2C1OB 1QA9B 5HGGS 1DSYA 1QTSA 2P45B 3TNMB 5D7SL 3B5GA 1JHLH 4G6AD 2H26A 5IHHA 4HWBA 4M43H 4N0FA 1AZUA 2DBLH 3PDGA 2Q7AA 4Y9EA 2H5UA 4K8RL 1ZDQA 3FFCD 2OM5A 3PGCA 3VWJC 2OSWA 2EIDA 2JK5A 3BZ5A 4Y8AA 5JPMA 4FE9A 2C7UB 1WE5A 2I9LA 4HJJL 3MRNB 4NQCA 3U1SL 4AIZA 1VGKA 4CJ0A 2JIXB 4NO5A 3LTVA 4GFTB 1SXNA 4OQ1A 3U7YH 2XN9A 3KR3H 4KV5E 3MO1A 2GK0B 4G9FA 2MCPL 4C83B 3C08H 3MLYL 5EZIH 1MNNA 2H32H 3VXRE 3TU6A 5FW7A 3T0VA 1PVHA 3F7PC 4LLWA 4TSCH 4D7BA 2JLLA 4AE0A 2VH5H 4IDLA 4BH8A 3RIFK 3AT8A 4QRRE 1DJSA 5F71A 1E4XL 1GZHA 3P69A 2VM4A 2ZF9A 1I82A 2MPAH 3GRGA 2PW2B 1RJZB 3NCXA 1UOWA 4U2ZA 1EZVY 2YGVA 3QIWC 3K4DA 1RUPH 4XP4L 4Z7OB 2IWGA 1PG7X 5SWQA 4U05A 4Z7WE 2WXGA 4P2QE 2A7BA 3I6GA 3G7TA 1CFQB 1RPKA 2ZKHL 1AGCB 2Y1VA 3F01A 2EDYA 5GRJH 3C9NB 1MJ8L 1WGOA 1QR4A 4JX0A 1DBJL 4Y7MA 5FYKE 5HGHA 4OTXL 2LU4A 4IKIA 5TFSH 2ZWSA 3QCUH 2P8PB 3DKHA 4NT6A 3U9PH 3LNGA 4J7RA 1RZGA 2FX7H 4KY2A 4YSRA 3LKQA 4FEIA 2I9TB 3QDHA 3MBEB 1BBDL 4JMXA 4IKNA 4M93B 4N0UB 3MV9B 3FTGA 5FW6A 1IARB 4ADJA 2GJ6A 1SXCA 3WUZA 4HGMA 2V5SA 1B0GA 1ZV2A 2DM2A 2VQTA 4A6YH 2MCAA 2JI2A 3RWCB 3DHMA 5KJ7E 2X0WA 1OTUD 3EYUL 2FD6L 3DJTA 2HTKC 2VERN 3RY5A 3AJ7A 4J5VA 4DN3H 2LAGB 1A65A 1Q1JH 4L1DA 4YDZA 4TQ8A 2NTFB 3VI3B 5CP7A 1HL8A 4ZODA 2PYFA 1OW0A 2B08A 1IAKB 2VO8A 4XNXH 1LWJA 3OHXA 2EAEA 5I1HH 2JXMB 4X7CC 4YDNA 1O6SA 1GGYA 3BDYH 5ICZA 4LSSH 2BFGA 4Z3HA 5AZ2L 3SKJL 2DYRB 2EDHA 1BZQK 4LQFH 5IQ9A 4HJUA 4ORGA 4XXCC 5LVEA 2F54D 3H4FA 5AB0A 4Z7UF 1NJ9B 1VRSA 1HXKA 1NDGB 4WUUA 5K59F 4J28A 1UUNA 4B6ZA 4IKJA 4AWJC 4PS4H 3ZKSD 1TSRA 5E8NA 2OX5A 3ALXA 2MCG1 2VDLL 1ZAGA 3UBFA 4UINL 1UZ8B 3QNYA 4BRVA 4AJ0A 3FL7A 5I23A 3VQ2C 5IP4A 1H5BB 1KXVC 5IVXB 4QKTA 1XO8A 2VLKA 1GR7A 4LK4A 3HBQA 5C09B 1BJ1J 3IGLA 3JTSB 2GQHA 2W94A 2YC1A 1BQ5A 5DRWA 5DMIH 5HXMA 1CYWA 4N8CH 2FDBP 3H9HA 3KYNA 3PS6A 1UM5L 2ZX8A 2CPUA 3UCQA 3J07A 1WVZA 1WV7T 3LH2L 4PJAB 4QWWD 5AALA 1GS8A 2NY5H 3WHE1 4DW2L 2MSPA 5KVEL 4J4PA 2A0LD 5I5IA 4H8WH 4R7NA 3QDGB 4X4ME 4F80A 4AM0Q 1IB5A 1QFUH 2PPFA 3T8VA 5I5MA 1JZ7A 1E4XI 1S5HA 4P3WA 3UTOA 4LP4A 4AH2B 3DV6B 2ZPKL 3DPBA 1CCZA 1HIML 3L3OB 4KI5E 2PWGA 4IHOB 2DI7A 5ICYA 4UBDC 1QFWL 4DEPC 2CBQA 4NQED 4PGCB 3FZUD 2OCFD 3NIFE 4JPWL 3I6KB 4FRWA 4O5LL 2P5EA 2GAZA 2OQJA 1RP8A 3SD5A 1WITA 3D85B 5F6HJ 1M7DA 3GDCA 2YWYA 3NCJL 1P6FA 3MRQA 4ZSOE 2ID5A 3RLSA 1TPXC 2C26A 1CLVA 4ZUSA 3C60D 3MOAH 5CBEA 3ZHFA 1UD2A 2YPLD 3O4LB 3OF6D 2RTTA 4JFQA 2AJUH 4MA7L 2EE3A 3QJOA 4JFFA 3CHQA 3P9LA 1UC6A 5FM5M 3BKYH 5GS3A 3FCSA 3GM8A 3ARGC 5FHAL 4FYTA 3JQOB 4EI5A 5AVZB 3QDMD 1Z3RA 2X70B 2Y72A 3DSFH 3LNFA 3HHMA 3MV7E 3PJSA 4HG4J 4YHZL 2FGZA 3OG4B 4JM0A 2Q7YB 1WA1X 4I4WB 1RZKH 1FVCB 5EU4A 1IC5H 3GMQB 1EBAA 3HFFA 3T9WA 4F33B 5B39B 4YN3A 1D5RA 4AZUA 3B83A 2CIKA 5AEAA 3FQ1A 2ATPA 1U21A 4N4YB 1SVCP 3VFPB 3K74B 5AVYB 5CAYB 3MDJA 1NCCL 3NSFA 4L9LC 5TJWK 4AQ1B 5C0FA 3OJDA 1GAFH 5IVNA 1UB6A 4TUKH 5BQ7B 5HHOE 2PR4L 1D9KA 3T8XB 4LFHG 3U1PA 5LAXA 5BCAA 3HN5A 3M7FB 5ICXA 3QORA 1PJ9A 2GJRA 5DGRA 1WHPA 3NRQA 4WIQA 4IU3A 4R0LA 5C07B 3PQYE 3UIZA 4EUPH 4OLZH 5EOTA 4ZAKC