4ZZKA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMILPIDSAIEFYKPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basal-body rod modification protein FlgD
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori (strain g27)
molecule tags Motor protein
total genus 30
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzkA02
3OSVA 4ZZKA 3C12A 4ZZFA 5K5YA
chains in the Genus database with same CATH superfamily
4UOZA 2ZSVB 3KBPA 4KJWD 1Z5YD 3GTTA 1NOLA 1PQZB 4PYHA 5IVXE 1OM9A 4U3HA 4DGUA 5IREA 4ABVA 1YECH 1JDDA 1HS6A 4KFZC 2B1HH 2DKMA 3PPEA 5DTFA 1T3FB 2WTRA 5BRZA 1CDBA 2ADIA 3NN8A 3GPSA 3QIWB 2UUDH 3X1BA 4FHKA 5EOCH 3ILQC 4L4VB 3X1GA 5TGBB 4IBLT 2JKRM 1R3IL 4BWTA 1NJ9B 2DWDA 3BSZA 4WW2B 2PTVA 4F7PB 5I30L 4WENB 1Y0LA 1MY5A 2R4SL 4G6KL 4JHWH 3UG4A 2IH3A 4FTDA 1B4LA 3IMBA 3W9EA 1RZFH 2AK4E 4K2UH 1ETZB 4NZRL 2GJPA 5BCAA 4NBYB 2OFQA 1RP8A 5BMFH 2OL3L 1LP9F 1TFPA 3LKSA 2IGFH 5GRYA 5BO0D 1S7QA 4X6CF 1NICA 5IHHA 2X4TA 1U8CB 3DVNA 2CR0A 5GGUB 4HC1A 2D2OA 5FGCB 4FZ8H 2E0PA 4R0LA 4WTWA 4YPGB 1AR1D 5C97A 3V0VA 4GS7C 3ARDC 4N22A 2XQBH 1G6RA 2HVKB 5DK0B 4R3SA 5F9AC 4MJHA 4LVHB 5EO1A 5MEPB 5D7JC 1AYOA 2UWEA 5FFOA 4HJGB 1QLFB 4CU7A 1KGIA 3CVHB 1NAMA 5CINL 1T03L 2XJKA 1CXKA 1J7VR 5H2BB 3EBAA 4FMKA 5G55A 5EU7C 5DLMH 5JPNC 5D7EA 4XN1A 3NJLA 1CXFA 3TEYA 1HSBB 1MWOA 3MN8A 4BH8A 3RWIB 5D71L 4NUJA 5IHBA 4Y9FA 1SBSL 3VXUD 2KDYA 4X5PA 3GMMA 4JR9H 3CSTA 2DQ6A 1EBPA 4KQ3H 4ZAKA 5F88A 4IBUA 2F7RA 4ATTA 3WTSA 1TOXA 3VFOA 4L0YA 1MLBA 3BT2H 4XPHL 1UACH 1ACYH 4CSPA 32C2B 4H7VA 4UNUA 3WKML 5D5ME 2C9XA 2OXGA 4ELDA 3WDIA 1E6OL 3FRUB 3TASA 4K7PH 1NUFA 4DKAA 2F7OA 3OR7B 5I1LA 3EGSB 1AMYA 1JFHA 5HHOB 2MHAB 3L3HB 3CZNA 1FGVH 2W91A 4NFDA 1NGYA 1TZGL 3LNHA 3NAAL 3CAFA 3RZCD 3U4BL 2PR4L 4ETQB 3BCDA 3ZYZA 1ZTXL 3IDMA 4MNHB 2X41A 4K71B 1SVCP 3UCQA 3L9YA 3GIVB 1O9VA 2NY4D 3OZKA 4A63A 2F54A 4A68A 3NA4A 5T3ZH 5I17A 2Q7YA 3ABZA 3KYKH 4NNXA 5JHBA 3MRQB 1XGUB 4LCIH 3MRHA 4NQDE 3GUTA 4GIPD 2X6UA 4HIHA 4F2EA 4L8DB 3SE8L 5JW4M 4NC1C 4JFEB 2YAMA 4KJYB 4XBPA 5CIPH 2WINB 4D7BA 2FK9A 1S9XA 4Z77B 3DHPA 5F3BA 4XNXL 3C60A 1I85A 1OTSC 3US0A 5JUEL 3IDIA 4NKIL 3D6GA 3DXAE 4HK3N 5KSAD 1IIIA 4PJEE 1GHFL 1LO4H 2WUCH 4Y16B 4FYSA 1UXMA 1X6NA 1AR1C 1AXIB 4HUVB 4BCYA 2Y2WA 4J3OF 4AQ8A 2CRIA 4FG0A 1TETL 1L7TL 4V33A 5EBLA 4ONFL 5DO2C 3ATDA 3O6FD 1ZGLB 3H6JA 5GS3A 4YDKL 3ILPB 5AOLA 3AQDA 3X1NA 4NUPA 1RK1B 3HBQA 3O8XA 2VLKB 3PABB 4WWPA 2TAAA 4YDIL 2QGCA 3QZLA 2J72A 3G6AB 3HHMA 3UTTB 1BBDL 5ECGA 1MFUA 1RUQL 3OBAA 4OIIH 2GITB 4HGWB 4HXAL 4NQTA 1L7IL 3K80A 1EX0A 1MI5A 1N5YL 3S34H 3WE1A 1UD3A 1I7ZA 3FB5A 1UATA 5ANME 5AOMA 5SWZA 3FCBA 4PJBE 3MNMA 1BJ1H 1XH3B 1EXUA 5MHSE 1KEGL 2YSSB 3II3A 4YHNB 3MV7D 5FA3B 4WNJA 4Z7VF 4B9CA 3U7WH 3QRGH 1IC5L 3T4YA 1PX3A 4BFOA 3ULUL 3RUGF 3SKUD 3VNYA 2M83A 5JOPD 3WO4C 5K9KB 5CP7B 3WJJA 4QO1A 3IE4A 2N56A 5JW3L 3SDAD 3KPPB 1QI3A 4J3BA 4DEPB 1FO0B 1Y6NR 2QT6A 3K2UH 5DQ9A 1OAKH 2ALWA 3WSQL 2WV3A 4QXGL 2W65B 2GIMA 4FC3E 4OW6A 3O3BA 4AX3A 4MJIA 4J3UA 4OD1L 2E75C 2ZUYA 3EO0A 3K6FA 3L5WB 4TYUA 3ZKSD 4WI4A 2UXTA 3PDOA 3WE6B 5ACLA 2GHZA 3A22A 4Y4HA 3TZVA 2AQQA 1N3NA 3P02A 1F90L 3ZKNC 1SYSA 2A6IB 2WYZA 1M05A 3INOA 4JRFA 4OCNC 4KKLD 4LSPH 1Q9LA 4Z76A 1NC2D 4HAGA 2OR8A 1QD0A 1T0MA 5M7QA 5F7LB 4UF7C 1U91A 1AKJA 4BK5C 4YDZA 5FHAL 3HB3C 5IQLA 4F37K 3LKOB 4WJG3 1PZUB 5I26A 3F5WB 2XWRA 1J8KA 3X12B 1CI5A 1ZT7A 5B3SB 3NYKA 4H20L 1Z9SB 2JXMB 1OP9A 1RIHL 5F7DB 4PBDA 4EOWL 4YR6A 2ORBH 4IOIB 4HPYL 4TUJA 4YJZL 4PJCB 3I9GL 3K7UA 3Q06A 3I02A 2B20A 3MCLL 2CO3A 4QJ5B 4Z3HA 3P4OA 3V2AR 1ZS8B 1N12A 2OMVA 1J18A 3ZSSA 3G5YB 4JY5L 3ZQWA 3EH1A 1N6QH 2XYCA 1IGIL 3DRTA 4LKCA 3KCPA 1JZ6A 4NQVA 4BRJA 5DJ2B 4P59H 4TUKH 4MCZA 3NFPB 1S7VB 2EVGA 3TF7C 4JRLA 3EZJB 1KJ2L 3MRPA 4MAYB 5DURB 2GEQA 3STZB 1NC4B 5IQ7H 2JMRA 3A24A 1EZSA 1A1OA 1O0VA 3FUIA 1UB6B 2IGTA 1UXSA 1JF1A 3RIFF 5E6YA 4LASL 3ZKQD 1R5WB 2B8OT 1F3DJ 1N5AA 4L0PB 4BFEA 2HB0A 4I48B 5BRPA 1S7XA 3VE0A 2BVOB 1FC1A 5T3ZD 3AY4C 3MKKA 2OZNA 4AL8L 2YD5A 2FR4A 5KJRL 1KPVA 3LEXA 4H88H 4L4TB 5AAWC 3S88H 1EEUA 3LRMA 2Y5TB 4UBDD 5IW1A 5C3TA 4PGCA 3WHXA 5DGQA 4ZMNA 1R3JA 1A6TA 2G0LA 3GHEL 3LIZL 2ZCZA 1BZ9A 3MBXH 4U1KB 1HWGB 1CFVL 3V0WH 1TQCB 4FMFA 2K3HA 3HVDA 4XX5A 1FNFA 3CMGA 3IN0A 4DP1X 4L1BA 2R2BB 5AKSA 4JKMA 2AEPL 2H0PA 3MYJA 4WFFD 1TXKA 2FX7H 3FUHA 4U0RC 4XXWA 3K0YA 4YBQC 5E24E 1OHZA 2JCWA 1P9MA 1MY7A 4JGUA 5E9AA 4FNUA 4MMYA 1TJMA 2KLRA 1BYPA 1Q4NX 5E2TL 4S0HA 1I4FB 2HTLC 4E36A 3S5LB 4A38A 4YDVA 2NY7H 3WUWG 4ZFGL 1YG9A 1RPKA 2X6AA 2AK1H 2VZTA 5C08B 1QASA 4JM2B 1HL8A 1CS6A 5IFAH 3IGAA 2V3FA 1CE6B 4QNPF 1KBKA 5ALCL 3RRQA 3T3PE 4WHYH 3D07A 4IOSD 3ALWA 5EDSA 2XZCL 3BSZL 5DJZA 4WO0A 5DYOB 2C8NA 4AVJA 2DYPB 2WANA 1V7ML 3FK3A 2ED6A 5DS2A 3SSGA 2XXMB 3C6SA 4XO8A 1NM9A 4HUUB 3RGVB 4HIXL 5DFVD 1THCA 1HNYA 9PCYA 2DQCL 1MVUA 3LZQA 3IVKA 4GP8B 5FO8A 4NQED 3MJ6A 1GGIL 4RQQB 4LCWB 1KIRB 3MBWB 2ZD0A 3K3QA 3TPKA 4N2GA 4PREA 4HC1L 4B7IA 4M4RA 3ZQ9A 2YOCA 4F8PA 2FIRT 2Z93B 5C6TH 2WWNA 2P48B 4JREC 4MBRA 1G6RL 3BGAA 1T66D 1BQHB 5HHXH 3ZDXB 1XIWC 3UAEA 1MNUH 4DGIL 1G5GA 1Z0NA 1I9JH 2OMZB 1NAML 4LIQH 4MA3A 3BJ91 4KZEL 4GAYA 4QKTA 3GSNA 5L88L 1AGEB 3LS4H 4B95C 2WZ6A 1BV8A 4HCRA 5IVOA 3TWCH 5HDBE 4A66A 4OFYA 1MKFA 1REIA 2FH6A 3BKCL 5E4EB 2IG2H 1EJOH 1H3WM 3LQAC 3RE0A 1OAXL 4ZPVA 2FGWH 2NXZD 3N43F 2H1PL 4P23C 3NH7H 4KRPC 1TO5A 3RBSA 2AK4D 5KYYA 1JPFB 2PPDA 5FGBA 2A9MH 3LH8A 1E9QA 1B0GA 1T4KB 2HLAA 2UX6A 4S10A 4G3YH 3D48R 3KPQB 3SKNB 2B1AL 4XPTH 3VG0L 4F7CA 3IFNH 4F7EB 3FKUS 1MCJA 5HYFA 4JFFB 4U1NB 4YK4B 4PJIF 4OZHE 1GOFA 2VITA 3C9NB 3WFCL 4JRYE 4X98A 1PG7H 4XCEA 2W60B 3VG9C 3EHBC 3G08A 4APQB 1ASQA 4LLVA 2M26A 3NA9H 2J12B 4M7ZC 2RCSH 4HKJB 4XN7A 3ABGA 4OGYH 4L18A 1X5AA 3BDYL 2IOMA 4O2EB 5FW6A 4I18B 2Y06H 3DO4A 2ZCHH 1BEYL 1SJEB 4EN3C 1KXVA 1NGZB 1T83C 3RVUD 4RSYA 3T0AA 2K0RA 4UQDA 2NSXA 4WI3A 3GO1H 4LDEB 3ESNA 2ODIA 4IRZA 4QOKB 3IXTB 1ICTA 3KPRE 1KC5H 5CZXD 5EO9B 4V1DE 1ZSDA 3AS1A 3GMRA 4GAGH 4DCQA 3VGHA 1MFAL 4W9GC 5DDHB 5DF0A 6FABH 3B3IA 4DOHB 4MJ5B 2VISA 5IB2A 5EU4A 3UDWA 1YZZA 1IBGL 1FVEA 4CKVX 1CICA 3WIHH 3QUXB 2EKSB 5HPMB 1JK8A 3N3EA 4GNKB 5JDSB 1BF8A 2ARJB 4DKEL 3CDYA 3BH4A 2ID5A 3S5LG 4QY8B 1EO8L 3DTDA 5I1AA 3TV8A 3H1ZA 4BUHA 5IW6A 1MFBH 2YXMA 3MUY1 1ES0B 3MGTA 3OMNB 1U58B 3EYUH 1R6VA 1CT8A 4OKVB 3QQ3B 1PGRB 1SOXA 5D2NA 3VI4E 4Q9QH 1G9NH 5KVDE 5KZCD 5SWSE 3KGSA 5CJBA 4TS6A 1F2XK 1SOQA 3OLDA 4NS0A 4BQ8A 2AJYH 3A67L 2PXYC 3Q1SH 2F8IA 3HS0A 4NQDD 3U0PA 3TT1H 4ODTH 1F3RB 3FHAA 3OX8A 1DO5A 5AW2B 1YPZF 5IR1A 1FDLH 3ZKXB 1Q8MA 3AADB 3UPAA 4OAWA 1AZCA 4UV4L 4DWHA 3OKNA 2A38A 1XF2A 4B0MB 5CJQL 2G4EA 3IPEA 3QEQE 1BIHA 3GDCA 1K4DA 1FA4A 1XBDA 4I1NB 5CM1A 3RQ3A 2VW7A 1HEJC 1HL4A 1WFMA 3RVWD 3DXAD 4XCYB 3VWJC 2J44A 5DFWH 3V0JA 4UYPA 1BQHG 3MFFB 1MOEA 2QPSA 4YHZL 2ICEB 4Y4KD 4AE0A 1DJGA 3BP7B 2LVCA 3UXFA 3OKYA 3APMA 1RZKH 3QCVH 1NLDH 3BXNB 4N2IA 4X5RA 2NY6D 5AD0A 4Y4FB 2BP3A 4M8VA 1EJ8A 3ZE2B 4O9HL 2CDGB 1UQSA 2F74A 3D9AH 3N9GL 4EZKA 4W9HC 2HT2D 5J11C 1WHPA 2K6ZA 3H54A 5CWSB 2FWUA 3DHMA 3UG3A 1TQBC 2K7QA 3BPNC 2JTYA 3HRZC 3KJ4B 4FQXA 5CXPA 2PCFB 4M9PA 2Z7YA 1ORSA 3X13A 4KKCD 4X0NA 2OR9H 2X3BA 2NLJB 1JI1A 2X0WA 4EJ1C 1CZ8L 1DJIA 4Z7QF 4LPCA 4FQ1L 1MRDH 4PJ8D 2PTTA 3VFMA 5A40E 3ZT5A 3J7HA 5E8EA 3WJMB 3QG6A 1JFQH 5IMOB 1MW2A 3MV8D 4AENA 5G4OA 2Z31A 1TVDA 1FSKB 3M1CA 1OANA 2HVJB 2NY5C 4J12A 3C5SB 4BZ2A 1YYMH 4IBYA 4UUJB 4F24A 2V4LA 5ID1A 1U8IA 4LP5A 2RB8A 4L3EE 4XBMA 1VZIA 4Q74A 4GBXC 3U46B 3LEVH 1KPRB 2WVVB 4P57A 5I19H 2L7UA 5ICYA 3CFDA 4KGLA 3C8KB 3NIDF 5E1AA 2A73A 3C5JA 4KAQL 3S3JA 3KEHA 5ADOH 5MERA 2X70A 4ZTPH 5H94B 5D96B 4PCTA 5EOCJ 3ZTNL 1WGOA 3BUYA 1QMUA 2QADD 2EEXA 2E9BA 5LCVA 2I9LA 3CXHK 3VJ6A 4UIMB 2WKLA 2J21A 2XXGA 3AUWB 3WNKA 2C34A 3U9PH 2YBRA 1G9MC 3UC0H 1JUFB 3Q2CA 3NESA 1W8NA 3H56A 5IQ9B 4NFCA 3FPYA 2RFXB 3MNWB 5FYKU 4GOSA 4HETA 1K6QL 1M7IB 2XBDA 2YGOA 5A16A 3MRJA 4ZUWA 5I1EL 2YMXH 4NDMB 4XB7A 4A1RA 1N26A 1XL6A 4L8CB 4LNVA 3EGDB 2GBUA 3V0IA 3FUDA 2WXRA 4QRPA 1GTNA 3QK0A 5HHNA 3FFDA 5ICZB 2X44D 1HZLA 4HUXA 1XAUA 3L1EA 2VDNH 4P2QE 2APWA 3OLGA 3PV6B 2L8AA 3ETBF 3F58L 1R4XA 3VW3L 3FT4B 1Y18A 1VZHA 2DB8A 4NN5C 3VAEA 2HAZA 5BQ7B 3DX7A 1YEFL 3OHXA 1VGKA 2P5WE 2EYTB 3B5HA 3D3VA 3VXSA 1I75A 1FL5A 2HYMA 4HKZA 4OZGF 1D5XA 3CDCA 4WCYH 5EWIH 1DQQB 1P7KB 4M6OL 4BE5A 1VENA 4LQFL 4Z7OF 5C0JA 4KY1L 5I1HH 2FBJL 4NPYB 2WP3O 3ZU8A 1CYGA 4NWTL 5AW3B 1R24B 4ZOBA 4PB9H 5JOFA 2EXSA 5FUZH 1KNOA 4PBXA 1U8KA 3BFWA 1WAAE 2YMOA 4N0CD 2CO2A 3L3GA 3ECBA 3VXPA 3ZE1E 3OXRA 3CFMA 3L7FB 5ES4B 3TH3T 1F4HA 2OJEA 3DPBB 1HESA 1CGXA 1YYLH 2WNXA 3W39B 2BVPA 3ULVE 2VXVH 3RL2B 3VQ1C 4WI7A 5I0YA 1E8XA 2C3HA 2IAAC 4I4WA 4AT6B 3BEVA 3QNFA 1N0LA 3RI5F 3V4VB 2COVD 4OD2A 4PJXA 1BAWA 1CD8A 4PJ5E 4L29A 4YSOA 2A4CA 5DUBB 3VI3E 1PFCA 1PLCA 4XH2B 4N90E 1SXSA 4OLZH 4K7FB 1EAQA 1U8OA 2BH0A 2FYVA 4PBVC 1CDUA 2X05A 4QAMB 3G6JE 4NP9A 3CQPA 4OIFA 2HKHH 3ARYA 3ARGD 3FN0H 4ENEC 1UB5A 4PJ7B 3GWJA 2BP8B 3CZFA 2J4WH 4NENA 4IMKA 3RWDA 4JG5A 3C87A 2ZG3A 4M02A 3KL5A 3DGDA 2R7EB 2VLRD 4UINL 5E5MB 4RGMC 5I2IA 1F4XH 5KVDH 2VDLL 2WB1A 5D1XA 1BZOA 5C07E 3SJVD 4RIRA 1TEYA 3BVWA 4FCAA 4R83A 2NOYA 4MD4B 3A4DA 2OCCB 1K3IA 3LPGA 2JIXB 4GXUN 1BOGA 1CYWA 1RUPL 2Z6FA 3QEGL 1AQKH 2Y23A 5E6ZA 4DN3L 3H9SE 1R46A 2V9QA 4IGBB 5BZWA 3ZO9A 4B9PA 2A9DA 5DC0A 5DMIH 2VLME 1YNKH 4HIJA 2D2CC 1PQZA 4WUKH 4Y19D 1CD0A 3T65A 2MSPA 1D2OA 3UTSD 2AS5M 4JKLA 5CJXC 3VWKA 1CDGA 4ZUVB 3QR2A 1T3FA 3QCUL 4PRIB 4JFTA 2WQSA 3GSNL 1QSEB 3QWQB 4Y9EA 5F96H 3CPLB 3QIWA 3UPCA 3C6LC 4ONHB 4OFQA 3S96A 3NIFB 1W0VB 3QYMA 3BOVA 2JELH 4G8GD 5EU7E 4F7PA 1BJMA 4RDQF 4NKQB 3O9WD 3QJZA 1P69B 4MCYB 1MVYA 4Q0XH 3RFZA 1ETZA 4H8VA 3LSOA 2BOCA 5A6MA 2JCCB 4P9MH 4MYPA 5C0IB 4Z7NF 2R29A 2O6FA 4PRPD 1WITA 5KJ7E 1BJ1J 5GGTH 4S1DC 2C7UB 1CLOH 5EUOE 3HMWH 5FUCE 4EUPB 1L0PA 1P6FA 2DL2A 2NY1B 2YOAA 5FECB 4J3SA 3RJQB 5JXEA 1ONQA 4FXGA 1QBBA 4F8LA 1MCPL 3FSAA 3FN9A 1KY6A 4PSPA 3TBSA 1T89C 1U2YA 1YNTB 2Y1YA 2HVKA 4XP6H 3RPIB 2I27N 3MDJA 5MEPA 2GTWB 1HQ4A 4HJGA 5MENA 2J88L 1QLFA 4P4KD 3CVHA 1CFMA 3WJLA 3GEFA 1HXYA 1F4WH 3ESOA 4XNMB 4Q9RH 1TJHL 3QDMB 2BW5A 5HYJB 3JVGA 4NBXB 5I8CB 1CGSL 4U31A 3WIFA 3DOIA 1UZ8B 3RWIA 4OI8A 2R0LL 1C1EL 2I85A 1EO7A 4N3UA 3J2PA 2FD6L 1T2QH 1ORQB 1MHCB 5FEBA 5JW5A 4AQAB 1ACZA 3LZFH 1WVZA 3QWNA 3FTSA 3TIDA 3L5XL 4YHOL 2YUXA 3IU3A 1KPUB 4LGSB 2EQDA 3D4GA 1DUZB 3WNMA 4HK0A 4D9LH 1F8TL 2CHDA 3TEWA 4HKXB 4G7VL 4NC1E 1LWHA 2HT4D 1RHHB 4Y2OB 1VCBC 4R90L 1ZT4B 1BZ8A 4RGND 5HHOA 2MHAA 5IHZA 3DTUB 4DNLA 1QVOA 3CWGA 5L9DH 1QEWB 4Q2ZB 4AG4L 4U3XA 5B7EA 1HOEA 3K72A 2MFNA 2ESVB 2WBJC 4FTVB 3PWUA 4MGXA 1T7VA 4QPEA 3SE9H 1AFVL 4MNHA 1IJ9A 4C55A 1W16A 4WDIA 3V0GA 1PCXA 1TEFA 1EZUA 2YK1H 4HWUA 3ETBJ 1QSFD 3QJXA 5F9WC 3NIGE 3QR0A 4OLUH 3MV9B 1P4IL 3HNTH 3IJSA 4G6JL 2DWEB 2C1OB 2F53E 3KPRD 3NFNB 1X5YA 5IIEA 4X4XB 5I16B 4XBGA 4V1DD 4XMVA 3T8VA 1A4KB 1TU2B 4FNTA 4XMPL 4U1GB 3I6GB 4JFEA 1JGVL 1G9HA 4KJYA 2PPAA 4B9IA 3FQRB 3NJNA 4X8CA 1JGLL 3W5MA 4JK0D 2XQ0A 4Z0XB 1KGYE 1QZ1A 5I6KA 1B3IA 1DCEA 3BIKA 3H9YA 1GZQB 3PQYA 1IGFH 4YXHH 4B9GA 4YBHA 3FCUB 5D1ZI 4M3JA 3NZHL 5D1QA 1NBZB 4JPKL 3PGCA 4KKRA 2V7NB 2CG9X 4BHUI 1DFBL 4HIPA 3NJMA 4JFOB 3VM5A 4RMWA 3KWXA 3FOMA 4I13B 1TTGA 4G7QB 2BVQA 1U3HD 3Q0HA 1ZGLA 3X3FL 1CG9B 4NQXA 4C83B 2G2RB 2WO4A 2KERA 1IGYB 1RK1A 3IS1X 3U0TA 5LQBL 2VLKA 3PABA 3D85A 4JRXA 4DUXA 4LBEA 3BGMB 4GW4A 4DQOL 3G6AA 4GXUM 3UTTA 3UBXG 3W3BA 1M3IA 1A7QL 2VXTL 2EXTA 3PWVB 3WS6A 3VXQA 1QFPA 3CFJB 1AO7B 2GITA 4HGWA 4WTXA 3MLPA 3D4CA 1Y07A 3DRQB 4G8IB 4X7SL 2OTUB 4K94L 4R8WL 1ZVSB 3KPMA 4GQZA 5CLZA 4I1PA 2MPAL 5EIQA 1RPUA 4KROB 3ZDWA 3HNVL 2WXGA 1KXHA 5E51A 3F6IA 2VQ4A 3KLKA 4TVUA 4J7RA 1WSST 2NMSA 1HDMA 3TJHD 2OP4H 3HBGA 2JVUA 1AS8A 1GY1A 1W0YT 4JHVA 1ECZA 1PJWA 1AZUA 1FFRA 1FYTA 3E2HB 5GS1C 3FQUB 4HZLA 4LEOA 1I3GL 2FAUA 1XF5B 1ZHKB 2X87A 1QRNE 4DP8X 2EO1A 3VXOB 5AYUH 1FO0A 1LP9B 2GVYA 4GYBA 4DTGL 2LABA 4X6FA 4X6CB 3SPCA 3T6QC 1L9MA 3MLRL 4NPJA 4OJEH 4QRUA 2AVFA 2BJMH 2YA1A 1CU4H 3HE7B 3MLVL 4NKOB 3SPGA 2XG5B 5IGXL 1A66A 2EAEA 3SGDI 4RESB 3JWDL 3WE6A 3NJVA 2CIKA 4JZNA 3WXWL 5LCVL 5EN2A 2EKJA 3CZLA 4Y5XA 1ZKAA 4NO0B 2A6IA 2EINB 4KKAD 3VNZA 1OALA 2RBLA 4DW2L 1CL7L 3F64A 1EEQA 1A7RL 1GAFL 2Y6SD 1B90A 5AZEH 5F7NC 1HT6A 1JPTL 2E9IA 3EJQA 4N2NA 5KANI 2YHGA 1PLGH 5TK4A 4G6MH 4MAUL 2Z8WC 3ZDZF 2ZKHH 2A74C 5TTRA 2KQMA 3FUFA 4L3ED 4UOW1 1DZBA 2DMCA 2Y4SA 1WUZA 2BC4A 2XIDA 3BVXA 3EJJX 4N2BA 4ZQKB 4AZ8B 1NANI 3O41B 3L4VA 4XAWH 4DHLA 3DSFH 5D7LD 3FB6B 3B5GA 3X12A 1P0SE 1NLBL 4X5XA 1ZPLA 1CLZL 4BUGA 1U8HB 3TBTB 3O4LD 1Z9SA 2JXMA 4IOIA 3GKWH 3QQDB 3VVWA 2DF3A 1NWOA 3FQWB 3MU3A 1J8HE 4LL1A 3C6EA 2H3NA 3OKDA 5LBVA 3VD3A 3ZZSA 1ZS8A 2ZJSL 2YPLD 4NO2A 1H3GA 4Z7WE 2DRUA 5FYJE 3SDXB 3G5YA 1NCBL 4Y8AA 5I73B 2YD8A 3T1FA 1J0IA 2NXYB 4UAOB 3FSWA 5DJ2A 3FFCE 4ISVA 3NFPA 1F1GA 5ERWB 5BS0B 3VD0A 2XQYG 1S7VA 1MWAB 5C0AB 2KQNA 4MWFB 3ARQA 4H44C 4F5CA 4IS6B 3NP4A 4ORGA 3STZA 1NC4A 2XN9B 3P0YH 4QYOA 1QQDB 5FO7B 2XSKA 5SV3A 2Z91B 5IROC 1GGYA 4F2FA 3PWJA 1SHXA 4I9WE 2WNWA 4MB1A 5DMJB 4HXBL 1R5WA 4M3HA 4M4PA 3X11A 4JFUA 2VR5A 3MXWL 2XN0A 3T2OA 3WY1A 4JDTL 3U6XA 4P2QD 3BZDA 4I48A 4NC2B 3MRCB 2BVOA 5F93C 3KBFA 3QXVA 1EEYB 4JZOA 3D39E 3N5AA 4WTZG 5SV4A 3BWAB 3VFWB 3SO3C 3FQ1A 4M8QA 1Z5LA 4I0PC 4YH6A 4XO4A 2FJFA 5FS5A 2Z1PA 3RY5A 3ZN6A 4ZUSA 4E0RB 4A2LA 3O4OC 2OA9A 2NY2C 1MFEH 1YDPB 5E9DA 2F5BL 2J8OA 2NNFA 5HD8C 1FL6B 3SOBH 1NCWH 2IXQB 1Q0YL 4P5TD 4LCCC 4NIKB 5AVTB 1BECA 4UT9A 5CEZL 1OCCB 2F61A 2ZX7A 1HHHB 1UWGL 2C7FA 1P2CB 2X1QA 5K93A 1X5IA 3HUJE 1E42A 2UZYA 4IRJC 2ADGB 5HDQL 5IW3A 4KMQA 3V6FA 5BV7L 4QHLA 3BQUC 1YY9D 3EYQD 15C8L 5I6LA 2EEFA 3D4YA 3TJEL 4MQSB 1I4FA 4JL2A 3KR3H 1OGAB 1IFHL 5BO1L 1RXLA 1E2ZA 1NANH 2YAEA 3F01A 3EF7A 1S6NA 4KNUA 3ZZ1A 1XCXA 3S5LA 3VFTB 2OAAA 1OOAA 4XAKE 2FHCA 3QHTC 3IEAA 3H55A 2FDBP 5KW9L 2ZTBA 5T5NF 3CZGA 4C56A 1E5YA 1E9OB 1JCKA 2VXUH 4N90D 2YGVA 4MMZC 1INQA 4AGMA 1JDCA 3U0WH 1DJYA 1Z6JT 5C09B 1J0JA 1KN2L 1FNHA 1WV7T 2WVTA 4FCHA 3WTXA 5DYOA 5AOJA 2JJUA 2R4RL 1JRHH 2HRHA 4JMXA 4OQTH 4N8PA 4P07A 3ZTJH 5J8OA 3RGVA 2D03L 1IM3A 1KYDA 2D0FA 4PH8A 3VD1A 2RALA 1PEWA 5JPMB 3WIIL 2VNCA 1FNLA 2ZXEB 4J4PC 3RYMA 3WLBB 3IRCA 3WN5C 2R29L 1TQSA 5E99H 1SRDA 4RQQA 2IANA 2LU7A 5C07D 1QBLH 1G7LB 2IPTH 3MBWA 3UTZA 1WAPA 3CVIL 3VFSA 5CFHA 2ODHA 1DQJB 4IBWA 3KWWB 1NBYB 1H5BA 3KJ6L 2Z93A 5D7SH 3JWOH 5TF1L 4KDWA 1EO5A 1RP9A 3Q5OA 1ZA3B 4FLOA 1XVSA 4HSCX 4U3SB 3VTMA 2CXKA 3BN3B 5A2AA 4WO4C 5CCJA 1CGTA 1HILB 3GS4A 3VSVA 1BQHA 4M8RA 4Y1SA 2BSEA 4N2MA 4ADGA 3PJSA 3WNPA 3BD4A 3CVHL 3D12B 4WGWB 5IESH 1UH4A 2ERJC 1EHLH 4LEBA 2JKWA 3TNMA 3V7MA 3VO0A 1AGEA 4GINA 5IG7A 4IEFB 4RISH 5PAZA 1KG0A 3MNVA 1VAHA 3UBHA 5IEKB 1IMHC 1HSAA 2Y07L 2HUEA 4NT6B 4BKTC 1OARH 1TF4A 5EA0H 1QKZL 2A77L 5E2VL 4R4ND 4Y2DA 4J39A 3ZXAC 3DV4B 5HXMA 1GJWA 3S37X 1JPFA 1MFVA 1OTTC 1T4KA 3B7RL 5FM4A 3ZDYF 4FP8L 1K3ZA 3NCCB 2XWJA 2MPVA 3RB5A 4XWGH 4FQJL 3FU7B 3ZTEA 4EDXB 3JYCA 4YHLH 3SKNA 1U6AL 3CDFA 1YN6B 4NQSB 2VB5A 2QQNL 3F7VA 4JFFA 2CH8A 3B9DA 2DWYA 4POZC 2HP4A 1KBWA 2VDRB 3CK0H 3MLXL 4F15C 5LBSH 1KCUH 1RLWA 1ZT1B 1CGUA 4WJ5A 2XTJC 3F6LA 3S5ZA 4APQA 1KLGA 1M71B 3O0LA 4Q6IC 4JCWA 3RDTD 1MCNA 4IJ3C 2MCPL 4O2EA 4I18A 2DDQL 4AIEA 4BSWA 1YEJH 4U1HB 2OMXB 2QPUA 2NX5E 2IJ0C 4KXBA 1U8MB 3QDJE 5E6ID 1WWWX 4J3OG 4NJAH 1U0QA 3QO0B 4ANWA 2O5XH 3TBWB 1Q1PA 3IXTA 2CRYA 2QHRL 5EO9A 1BBJB 1FRGL 1K8DB 1A7PL 1JGDB 3CXDL 3RZCB 1FCGA 5KS9E 2BWIA 2PO6D 4ODVH 5D8JH 5DDHA 3ESVF 3KWUA 2VXSL 5FYJH 5KYNA 4PRBB 5EZLB 3HKFA 2YXFA 1SFDA 3QFJE 3BUQA 5IMKA 4WFGE 2NY4B 5E2WL 2APSA 3QUXA 5MI0C 5HJ3A 3HHRB 5JDSA 2YZ1A 3TA4D 2ARJA 2QV4A 2YWYA 3QPKA 3VSUA 3MRMB 4QY8A 3IJYA 4XMKH 2WQUA 3BPOB 1WZ1H 1MEXL 3C09C 1AE6H 4NJ9L 4GY4A 1BW8A 1ES0A 5D4JA 1B6DA 4EE2A 3EG9B 1ZS2A 4KVNH 2P80A 4TLTA 4KTDH 3T0EA 5IB1B 4HF5H 5HHME 5GPRA 4OKVA 3H7BA 3EYSL 5KSAB 3ROOB 2EDOA 2GW5A 2VC2H 3D18B 1VADB 1FHNA 5D70L 2PPCA 1NSNH 1C12B 2CPCA 1XSJA 3ORJA 2QHLA 2VR6A 4X42A 3VXRD 3MOBL 4NQUA 1T0OA 3NUKA 2J6EH 4N0UE 4ALAC 3EYFA 3O6FB 3L3KB 3QIBD 5A2BA 3NCXA 3MLTB 5AG8A 3CQFA 5ACMA 2EYSA 2BHZA 4MMXC 2VZ3A 4N2OA 1QLEH 5D1ZC 3OD3A 4JQXC 3FMGH 5F9DC 1ZLSH 3CN3A 3M88A 4BSJA 2WN3A 4XCYA 3CJJA 3NSYA 1BM3H 2FL5B 3C2AL 3KVPA 5J56B 2EZ0D 4AQ1B 3MCYA 5DJDB 4CVWA 4DKFL 1NIAA 2XVLA 4IHBA 1ZSHA 5LXGL 4OZIF 1GR7A 1S5HB 2IFGA 3BP7A 1KCSL 1NFDA 1C8PA 1OK8A 2CO1A 3BXNA 1FO0L 2BHYA 1BAFH 1JHKH 3A4AA 4Y4FA 5KEZA 3TA3B 1NMCC 1PMYA 2X9XA 5JQHC 2CDGA 4BINA 5E9NA 3NCJL 3MV7B 1CTMA 5CWSA 4P04A 4WFED 4DN4L 3K5SA 3GIZH 2PCFA 3SPVB 3AXLB 3TT3H 3VFGH 3K8KA 1I7TA 3CMOL 3DMMD 5HYIA 3SDAB 1PZ5A 4LSRL 1Y6MR 2VMFA 2Z0BA 4QTIL 4ZODA 4DF9A 2O61B 5DK2A 2EXYD 4LRNL 2Y6TE 3CXHJ 2F08A 1MRFL 2X9ZA 4HH9A 5IMOA 2YD3A 3QPQD 4XVTH 1PY0A 4PRHE 3GYRA 2AMUA 4PJGE 3KYAA 1A14H 4R0LC 3QCTH 3N43B 2DLFL 1A5FH 4OB5H 1E65A 5C7XL 3HN3A 3JSSA 2X5PA 3VFUA 2AKRB 1N59A 1JHLL 1DBKH 4XOBA 4GG6E 5ABZA 1JV2A 3D8MA 1KPRA 4XVOA 3VFVB 2VQ1A 1NC2B 3B1TA 2BHFA 3UAJA 1KF9B 2NT1A 1BZDA 4UOJA 3K46A 4PJIB 4N5UA 1TJGL 2L0DA 1B0WA 3FYEB 4RRPM 1CBVH 2BOBA 1XCQA 3CFCL 3VFNB 3RG1C 1VZGA 1E67A 5GJSL 3U4AA 2X4UB 3S3BB 2NUTB 4A2MA 4B9FA 2AV7B 4ZJ9A 4DPAX 4OJAA 3LRSB 5CN3A 1JUFA 1KCWA 5CZVL 2HT3C 2XKNB 3UAAA 3C08L 3RVTD 4QDGA 4ZAKC 3EFDH 1GIGL 2LR4A 1WWAX 5IT2L 2RFXA 3OF6A 4R2GC 3MNWA 3QUYD 3BKYH 1IBZA 2FJHB 1XB8A 2V8MA 3CFQA 1ZK5A 2CJTA 4R97B 1XEDA 4IHOB 5HJBA 4PY7A 4NDMA 3BAIA 2E8YA 4M6NL 3EGDA 4G8EA 2ZUUA 5I18H 2FRGP 2MH4A 4YSEA 3M07A 2K4AA 2DLIA 2VR7A 3KH3A 3OAUL 1MQ8A 4D9QD 1TNNA 1YA5A 2BIPA 4LARH 4ORZC 3UO1L 5EOQH 2YZ8A 2R0ZH 3PV6A 1DJSA 5IHWA 2R8SH 3ALPA 4JB9H 1EQWA 4ZD3H 1UKSA 1ZRUA 2BERA 4IMLB 4JFDD 4N2EA 3BP5B 3SQBA 4AZUA 4QWWD 3HE6D 3P2BA 4XGZA 1A8ZA 3BH9A 5A43C 1T7WA 2VKWA 4BA0A 3U1PA 3ZSTA 1T6WA 5B39B 4P46D 2HJLB 3GSWB 3QZBA 3N44F 1OT4A 5FYJD 3KLAA 3NCFB 5F6HI 4U7MA 3DK2A 3MZGB 2FX8L 3D2UD 2CMRH 2Z65C 5IVNA 1BF5A 1AGCB 3KWVA 3NEXA 1H15B 3P30L 3VA2C 4KWUA 4KK9D 1ZY9A 1UWYA 1I85C 5LLIC 3SQRA 1A9EA 4CDGC 1BXAA 3L7FA 3BZFB 5AW7B 1YC7A 1FIGH 4PY8I 3DPBA 4YWGH 1UENA 3RL2A 4PJ9A 3EDJA 1WP6A 1HIMH 5CIPB 4Z7UF 1QTPA 4PJFB 3UC2A 4LOFA 1INEL 3I9IA 3AXIA 3HR6A 3ZQXA 1YPZB 4AT6A 3B2VH 3V4VA 4HAKA 2XRAL 2WP3T 1INDH 3SDCB 1N7ML 1I3RB 4LNRA 4FLQA 3QNZB 4XH2A 3O8XC 1X9LA 2YKLL 4PW3A 1RULH 1LE9B 1Z0MA 1EVTC 5F7BA 3D52A 3RKDD 4RWYL 2PW2B 3JTTB 3LDBC 2DJ4A 3CX2A 1Q72H 4FQCL 1HNFA 4URTB 3FZUC 5DHMC 2Q8AH 3T8XA 1OEZW 3TBYB 2DM3A 1I7UB 5AWNH 5B4MD 4FEMA 4OJYA 2VDOH 3AFLA 4R7DB 4JKKA 1JNLH 4MD4A 4X8JB 4NRXB 1A1MB 5GQBA 4PRAA 1JOIA 2WYIA 1YNLL 4TPRH 3RY6C 5LDSA 2ZSWB 4ELME 3QWOA 3CZKA 1FE8H 4Z7QB 3BUTA 3LKRB 3IFOA 5KBMA 4HOMA 3RNKA 3GSXB 4TQEL 1DVFD 3PWNA 2CO6A 3AU1B 1BGXH 4MD0A 3HI1B 1MREH 4NQEB 4FQLL 4XCFL 1GL4B 4Y0GA 1EUTA 3ECUA 3O3DA 3QZMA 3V79C 1R75A 3TCLB 2A9CA 4QHMB 5HGAB 4ONHA 5ACZA 2FUQA 2IPUK 4G80A 4EIUA 1W0VA 5A2CA 2AJXL 4JO3L 5KVFH 1PYWB 3LRGA 3SCMA 4XPAL 3TZVC 5DWUL 4FKHA 4UNIA 2WW8A 3UBXA 4AKOA 5I76B 3MA9L 4PS4L 4ZX5A 3I3EA 3NIDB 4QRSB 4KRMB 2JCCA 3GB7B 1WPCA 3HC2A 1JDAA 4U6VH 2VN3A 4WU7B 2J25A 5HDLA 4NUMA 3LRKA 3MLSH 4JFXB 2XZAH 4P9HH 1BZEA 4P5KB 1DBMH 2PP7A 2EACA 2P4AB 2YD6A 2BNQE 4OGAD 5KSBA 2VZVA 4P5MB 1TMCB 3U1SH 2BVUA 2F15A 5AB2A 1CCZA 4DGWC 1W8OA 1PZSA 2FEDC 2NXZB 1O7DE 1YNTA 2AK4B 1T1YB 2HX9A 3L3IB 2HKAA 1JWSB 2GTWA 5DJ6B 1AYRA 4QI3A 3BO8A 2AC0A 3TN0D 4KTGA 1B4TA 1ZANH 3BCFA 4XNMA 1MJJB 3I85A 3ULSB 1KJ3L 3QDMA 2GY7B 2YWZA 5HYJA 2NSQA 3E1ZA 3WEXA 1ESOA 2XZZA 5I8CA 5EU6E 2CUAA 2PYFB 4IDJH 3LKQA 5B39G 1A2YA 1I3VA 4LF3A 5T1LD 4ABWA 1A4BA 3ZL4H 2FWOB 1HU8A 1UZ8A 4N8UA 2K6YA 2RHEA 4PM1A 4Z5RB 5FFGA 3LKPB 2O5NA 4CSSA 3IMTA 4H2AA 1BG9A 1TTUA 2ZCKL 1MHCA 1XR9A 5KTEH 3QJHB 2PCXA 1G7IB 3SKOA 4AQAA 1S3KL 2VDQH 4BKLB 4DEWA 1KPUA 4PW4A 4ZMQA 5I0ZA 2FO8A 4LLQB 5INCB 1BMWA 4MNQD 5GJTL 4UQEA 4MHHI 3WTUA 4HKXA 4FG2A 5JA8B 3QJOA 4IBQA 1ML0A 1RHHA 1ET7A 4YSUA 3B2DC 5E1QA 4RFEB 3QAZB 3ZX1A 1ZT4A 4JN1L 3A47A 2P26A 1FL3B 4R4BB 2Q0ZX 3OJDA 4D94A 2ZKXA 1CMOA 3TESA 4Q2ZA 3I2CL 4WEMB 4XE0A 3IRPX 3T3ME 3FSVA 2BLFA 1LD9B 3P11H 3BE1L 1PL3A 1GGTA 1AGBB 4JDEA 4GP4B 4QF1B 4OCMC 4XCCH 4X9GA 3HAEG 5HHPB 3EO9H 3ETTA 5ILTH 2FQGA 4FABL 3MLWL 1Z7JA 3HS9A 2HJKA 2VIRB 8FABB 3QDJD 1IFRA 5CD3A 3MJGX 1N6UA 4XN4A 4PS3A 3U82B 1WFIA 3T2NL 3N42B 5B3NA 4H0LC 2DWEA 3H0TB 2C1OA 3QUMH 4RAVB 3NFNA 4X4XA 5I16A 2IAMD 3BKJH 1AD9B 3L1FA 4P5SA 4M7LL 1KTLB 2W9EH 3DYPA 1OWRM 1ZHBB 4F7TB 2GHWB 2JJTC 3TBCA 2YUZA 3OKMB 3QFJD 4JQIH 1EMTH 2XQYA 2YPVA 4UTBH 4XXWC 3KWTA 1GGUA 1NDTA 2VDKL 5DEFB 1CLCA 3DDGA 5KZCB 1MZYA 4AVKA 5D7IE 4KRLB 2OCFD 1A3RL 3LPOA 5CLWA 2V7NA 3GSUB 2ZAHA 1A6UL 1V3JA 4JKPH 3IFLH 4NQDB 4JFOA 1CXIA 4Y1AE 1S4IA 4WNQA 4K8RL 1KIUB 3F12B 3O6LH 1MH5B 1CGYA 2WNGA 4C83A 1A7BA 2G2RA 2HTKC 1BIIB 1R34A 4X4YA 1PG7X 4OD3L 1IGYA 1MFCH 1KCBA 3O0RH 4LL9A 5HHMD 2GAZA 3BGMA 3DXAB 3AWFA 5K39B 4LFHD 4CVXA 5IBLC 3EUUA 1C9SA 4KHXH 3W81A 4G9DB 3CCHB 4Y4KB 1AO7A 4TOYL 1YEHL 4E68A 1SBBA 3NJJA 1CD1B 5I8EB 2WQRA 2WWKO 3PHQB 4ZNEE 1ZVSA 3FDWA 2NY6B 3HI5H 2ENJA 1MHPH 3FB7A 5E03A 3FT3A 1BFOA 5CILL 1FZJA 4P4RB 2OMNA 1DEEB 3EJYD 4HKBA 3QQ9D 4LCYA 2XTLA 2AJSH 4QT5A 3MRKA 4KOBA 1T20B 4XNBA 3HLKA 4JY4A 3EYOB 1KULA 1EHKB 2C9PA 3D69B 3QJRB 1HHKA 1XF5A 1ZHKA 4X6BA 5FW7A 3VXOA 3AT9A 4I77L 4N6QA 3V8CA 1NFKA 1LP9A 4Z7NB 4PJ8B 5E6UB 2WCGA 4X6CA 4EQ3A 4PJBB 4QLRA 4BZYA 5IMLA 3MV8B 5ID0B 5T1MB 4NKOA 3HE7A 5I6MA 4MVBD 4Q9BA 2P8LA 3DI2B 5DUJA 1RZ7H 1HWWA 2ZUVA 1UD5A 4C4KT 2ENQA 2X4OA 1X7SA 4LSUH 4PCYA 1GYAA 4G5ZH 4Y5VB 1B0RB 4G8AC 4NO0A 4F9PA 3PL6C 1BZ7B 2ZUSA 4LKXB 1X5FA 3AG1B 1XZ0B 3HHSB 1FH2A 4NOFA 5C0CE 4E5XG 4FQQA 5BZZA 3MYZA 4GRLA 4JLRA 3TO2B 1M3JA 3AMLA 3THMH 1ZV5A 4EKJA 1FBIH 4H8UA 2GYSA 4PRHD 2UYLB 2YO3A 1NCJA 4XBEH 2HH0H 4OLVL 4I89A 4E41D 2GT9B 2W59A 4EBQL 4ZQKA 3O3EA 4GXVH 4AZ8A 2H2SC 1QRKA 3O41A 4OCSL 1XB3A 2X09A 3FB6A 2FLBT 1F02I 4TSBH 5HYSB 1ZAGA 3RL1B 1D6VH 1U8HA 4XB8A 1LK3L 1YQ2A 2V17L 3F84A 4OUOA 4BCZA 2Q76B 2V6HA 5E7BA 4GQRA 1OO2A 1G7PA 3RU8H 3FQWA 1KXVC 4JZJB 4UM9B 4OZFG 4N2KA 1RZPA 1WLHA 1AMXA 1O9WA 3G6DL 1ZTXE 2FUTA 2E9WA 1R0AL 4FULA 4N0FB 1BDYA 3KHQA 3WFHB 3OLEA 3G5VA 3KPTA 3ZBMA 1EDYA 3QG7L 4EIGB 1MQKL 2A4EA 3CHPA 1S8DB 4XMUA 2PYEE 1MWAA 2PWDA 3CU1A 5D55A 5J12C 5C0AA 4ZQTA 1GTFA 2ZZUT 3H2PA 4UQ2B 4IS6A 2PP9A 4JPIB 4WI9A 2FWSA 1KN4L 1QQDA 3BVNB 5FO7A 5GRUH 2Z91A 5AW1B 3HCVA 2Q6WB 4HPHA 4XPFH 4P99A 1FP5A 3LN4B 1D6EB 3BP4B 2YMTA 4O02A 4GRWH 4PV9A 3T0BA 2JI1A 5J1AB 2HRLA 3HC4L 4ENZA 4XN9A 5EBMA 1FH5H 4PLJC 4L1HA 1KWKA 1XGZA 4ZFOB 3RWHB 4R7XA 5FK9A 4YLCA 2JE8A 5C0BD 2NZ9D 2WXIA 1OIOA 4I3GA 2IFFH 5EF1A 3HFML 4S1RH 3RTQD 1DQLL 3ARDA 3IGFA 3KNBA 1HXMB 1J1OL 4WHYG 5LGKA 4E0RA 5L0QC 4GMSL 1YDPA 1UG9A 2BSTB 3HS0C 5D7JA 2J5LC 3QC6X 1FL6A 5CBAB 2IXQA 4LSTH 3BFOA 4M43H 4H1LH 4U4IA 1DTUA 2FB4H 4P2RA 1A7OL 3F8UB 3W38A 2UVFA 4RDQG 4P3DB 1HHHA 1BVNT 4F2MB 2NR6D 1J1PH 3TP4A 3A0OA 4KH2A 4NIYE 5GZOD 2ADGA 2DQHH 2BFVH 1PTZA 2HRPH 4LSVL 2A0LD 3E8VA 3FONB 1HEZB 4ZMWA 3HG1D 2CLZB 2QZ5A 2NPLX 4G2AA 5AQ0A 3KPSE 1QFWI 2DM7A 5KVEL 2DL9A 1DBBL 3ULUE 2BMKB 2VLRB 4PR5B 4XVJH 1YEIH 4GEJA 2MNJB 3GHPA 4R26H 4XNUL 4I1RA 1CPUA 1ZGLM 3GLDA 2Q86B 4W6YB 1VESA 3X17A 2X4SB 1X6LA 3OPZL 4Z7VA 4KFMA 5CKAA 1CDYA 3SDDD 3RUGA 5IMMB 5F9OL 5DA0B 4JHUA 5DFAA 3UTPD 1YEGL 3EAKA 3LZOA 4BELD 4ZO9A 1SN0A 2EDNA 5HY9B 1A6WL 3VXMA 4QCIB 4Y19B 3TURA 1DJZA 3BIBX 4J23A 1GCYA 3UTSB 3DHJA 5D2LF 3WLBA 4N3TA 1D9KD 4U1JB 3G5ZB 4WLCA 2O26U 1F4AA 5GGVY 3RGBA 1M4KA 2B77A 2Z31C 2QSCL 3TYGL 5IY5B 1R3IH 3B2PA 4XP1L 4G6KH 2PABA 2R4SH 3T3PB 3KVDD 2WHVA 1DQJA 3KWWA 3DJRA 3NCYP 3L45A 1PDKB 3O9WB 4NZRH 1WTGT 5E8DL 1ZA3A 5J9PB 3VRLF 3OWRA 3FNKA 4RBPK 5KG9B 1MIEL 1HILA 2BNUA 4DESA 2F19L 3QDAA 5ADPL 1HK6A 4PRPB 3AQZA 2XTJE 2VAJA 3QNYA 1NA8A 4P3CL 5B1CA 2APTA 3B34A 2FZ3B 3F00A 4YGVA 4NT6A 5DHYB 3ZHNA 2OJZL 3SGKC 4X9HA 1K2DA 3H3KA 4EI0A 1T03H 5CINH 1QG3A 1TLMA 4ZSOE 5J06A 3WEBA 4MNGE 4P4KB 1RMFH 1GC1C 2QELA 1M9WA 3FU7A 2ZUQB 4EDXA 3TVMB 3KLDA 3TCXA 2HWZL 4KV5F 4I85A 4F33A 4NQSA 1SYVA 4ZYKB 4BJLA 5DC4B 2F53A 5DD6B 1SBSH 2XNAB 1IGCL 3PE9A 4HU8A 3AAZB 3QI9C 5E6SB 3UZVA 3PXHA 3VXUA 5F97E 1ZT1A 1CE1L 1C5BL 2ZUXA 1M71A 1IGTB 2N1TE 2QDVA 5FR3A 3PNWB 5IFJA 3ZTCC 2FLRT 3WKMH 3Q48A 3FO2B 4GUPB 1UJ3B 3HZKB 1PNCA 4U1HA 4OFIA 2OMXA 4MSWB 2N7SA 3LHPL 4M6ML 5EU6D 1YLBB 2B5IC 5IBTL 2VDNB 1Z5HA 4RGNB 3QO0A 1PBYA 1PD1A 2YGQA 4KI1A 3TBWA 3NAAH 4Y5YB 3QIUD 3U4BH 3H42L 4LESA 3K2MC 3TV3L 3GXUB 1RU9L 2PR4H 1JGDA 3RZCA 1NIFA 1ZTXH 4V11A 2FQDA 3ECQA 4GIAA 5EZLA 4JG0L 4GKSB 1NINA 4JAMA 4G9FE 3QZWB 3TX4A 4WEBL 3EBHA 4BFNA 2YPVL 1H6EA 1KXQA 1QSFB 4NP4L 1I31A 5GIRB 1D7CA 5F3HB 4XMXA 1NCCL 4JE4B 4OFPA 5AVZB 3NVQA 3SE8H 1TKWB 3KPRB 3VD9A 4LZKA 3CZJA 4V1DB 4WI5A 5DSCA 5DRWB 5E2UL 4PTUB 3IJHB 3QDGD 3FU5A 5KVGH 4HSAC 2BP0A 4XNXH 1GJIA 3ZJAA 2QR0B 4KK5D 4YEEA 4LSQH 4YFEA 3L3DB 5I75B 4NKIH 2JLPA 5IB1A 1JJUA 2OI9B 1GHFH 1GPOL 4H8WC 3ZIMA 3ROOA 1IL1B 4PJAF 5C8JB 4XP5L 4AI7A 3D18A 1PD6A 1T1XA 5LBGA 1JZ4A 1ZLDA 4PVBA 3MCG1 5BRZE 2BY1A 5DVKA 2PNDA 3GZPA 5AOKA 1TETH 1L7TH 5C0GA 4ONFH 2KC0A 4IMKC 2EYRB 2FECL 4JO2L 4K3GA 4PP1C 2ARJQ 1I9RL 1AP2B 4YDKH 4Y1TA 3DK0A 3DLQR 1U3HB 3F65A 3NRFA 4GW1B 5K1NA 2EP6A 3MLTA 4KJQD 5K5YA 1HEHC 3GTVA 4YDIH 1SY6L 1KGCE 3H3PL 3BWUC 4XP4L 3QJTB 1BBDH 2RH0A 1F86A 2ZF8A 1MDAA 1RUQH 1TVHA 3QJFB 4ZMTA 4HXAH 5ESQB 1L7IH 5SWSB 1N5YH 3V4PH 5DJDA 1QPPA 1QHOA 2FYYB 3QA3B 3KGTA 3R06A 3WFBL 1JAEA 1KEGH 3BP6B 3NFSL 5D9SA 3KLSA 2O6EA 4HS6B 1RV6X 3BVVA 1IC5H 4Q7DA 3ULUH 1XGPB 3QIWC 4JUTA 2UWEE 4WUUD 3UYRH 5F7AA 1FZOA 3BZ5A 2ZG2A 4LAQL 4WW2C 3SPVA 1EXHA 3PP4L 5JW3H 2Z7UA 4R4FH 5KWYC 2EIKB 1H8LA 1Z3GH 4GQ9L 2H4EA 1XR8B 2QPEB 3RWEB 3SDAA 2NY3D 1B88A 4IU3B 3DV6B 4MFHA 4X0KB 4XRCB 4QXGH 3SPJA 4F8QA 4EI5B 4F1ZA 2O61A 2X3AA 1YEKL 4NC0B 1QNZL 3GMNB 4PWIA 1JPEA 5KAQG 3ZMRA 1ROWA 2FHFA 2P8PB 2NYYD 2W80C 4Y16D 1I8IB 3FFCA 3ZO0A 2B0SL 2V37A 1QYGL 3FL7A 4W81A 5FO9A 2XBZA 3SQOH 1RK0B 2AKRA 3MREA 2OYLA 4NHUB 4LVHC 3ZDYB 3T4AB 3VFVA 1NC2A 2CUMA 4U1IB 4MA7H 4EDWL 4I5BB 2WC7A 4UU9B 1MCIA 2YRLA 3HG4A 3PPSA 4TM9A 4CBZA 4PJIA 2N01B 1N4XL 5AALA 1NMAL 1JXDA 4HS3A 5BXFB 1LMIA 1W15A 2HXAA 3LVTA 5HVGB 5ICXA 3VFNA 4OCLC 1BPLB 4L3EB 2X4UA 3DX6B 4CVZB 2WKOF 2NUTA 4ESKA 4ZZKA 5C92A 4ZFFB 1ZA6A 3DX9B 5D7LB 3LRSA 4H20H 2F54E 5CD5C 1RIHH 1H9DA 4EOWH 1JWUB 2XKNA 3CSPA 3Q7JA 4U05A 3O4LB 4HPYH 5F6HJ 1XD0A 5GZND 1BFVL 1CF1A 3I9GH 3I50L 2HRGA 5F0LB 1MWAL 1NCNA 4PD4K 1AS7A 2ZOKB 3U79A 2E7LA 1CLVA 2FJHA 3LXUX 5C0NC 4DGYL 1OW0A 4K5OA 5CLYA 2MOVA 1HC1A 4HHWA 4PY8J 1IGIH 5DGRA 1IBHA 1OSPL 1C16B 2ICWA 4FN0A 4J5VA 2Q20A 4O02L 4R7NB 1I1FB 5J6GB 1DFXA 3AGWA 4XWOC 4F27A 1PSKL 3K1DA 3CBJB 1IAII 1KJ2H 3OKKA 4CADB 4WV1B 4K71C 1YJDC 1S78C 3BP5A 3PWPD 4BH7B 3AMKA 5KUKA 3ROLA 2GK2A 3HPLA 5EIIG 3AWEA 4U1MA 5B39A 2DLTA 1JNNH 4WW2F 3GSWA 1C5DB 2NDFA 2BP5M 1NFIA 1HJCA 1UUNA 5T5NG 4J3XA 3BAKA 3UO8B 4B41A 4P2QB 3B43A 1MRCL 3RLSA 4FA8A 1LQBC 1GGBL 4UQCA 4AL8H 2PYED 2ZXQA 1MI5E 2LTQB 5KJRH 1CFQA 1K8IB 2CHWA 4W4NA 3P9LB 4Y9CA 3TC9A 5EHFA 3PAZA 5SWZE 1X4YA 2DBLL 2XIIA 5JORB 2ADJB 3WAJA 3DIFB 4CW1A 1PAZA 4UZGA 5LWYL 4ZBJA 1RD6A 2O4EA 4GRWF 1N64H 4ZX6A 1BXUA 3AZUA 4P23A 3ATBA 1YAZA 1YPZA 3D25A 4HJTA 4P5TB 3BESR 3QORD 4LAJH 2B9BA 2HG5B 4X6EA 1NWPA 3QNZA 4J1UB 2G2PA 1OSEA 1XSOA 1YMMA 4S2SB 4KKPA 4ANXA 1ZHLB 1ZE3C 3ZE1B 1LE9A 3V4LA 3CC5B 3HAEA 4RFOH 3T0VA 2PW2A 3OGOE 2ZAIA 4BFGA 5E2TH 1MAJA 4PTTB 2WOBA 1N67A 4MJIE 1UJTA 2FJUB 2I32A 3WDJA 3TBYA 4JJ5B 4WTQA 3DI3B 1HHIB 1W0WB 4X9FA 3RWJB 2CGZA 4HUKB 4PSRA 5I74B 2YGNA 3O45A 3PHAA 2D7QA 5ALCH 4EN3A 2V3EA 2YEZB 4JFHE 2CNYA 3GSRA 2MJWA 2QSVA 4MAYD 4NRXA 4X8JA 2E9GA 3BSZH 2O5YL 1QOKA 1V7MH 2XETA 2IH1A 1DDTA 2DMHA 4OIBA 3AROA 1U8PA 1SHMA 1VFAB 4HIXH 4UAHA 2DQCH 3MOAL 2EXWD 2DQEL 1WFNA 3GSXA 4DEPC 3DX0A 3ULUD 3NCWA 1GGIH 5DMGC 1DSFL 1E4XI 4YZFF 2J8UF 1MIML 3HI1A 4IKNA 4NQEA 5C07B 5BVPL 5ITBL 2I26N 3T77B 4HC1H 4JANB 3TCLA 3WMQA 3Q8EA 2Z9TA 2CO7B 3FH8A 3DBXB 1F5WA 5CCGE 2FQFA 4WQOA 5I76A 3FUKA 3NBNA 1NAMH 4KZEH 3ARED 4QRSA 1IIKA 1N10A 3EFFB 3FOLA 3GB7A 2HVBA 1C08A 5L88H 3HN8A 1JPGB 4JFXA 1AAJA 3BKCH 3DX2A 5JZ7C 1UD2A 4FI6A 4P5KA 5EUKA 1OAXH 4B60A 4P5MA 2EDQA 2H1PH 1EK3A 2DH3A 2ZT9C 2PXYA 1C5CL 4TXVB 1QO3A 1ZMYA 4GI9A 4LGRB 5DR5L 1NCUA 3PHOA 1D7BA 5DJ6A 2B1AH 2WBXA 3VG0H 1SM3L 1PCSA 2WZPD 5J3HC 1XGYL 4E9LA 5HI3D 5EUOB 3SY0B 4OM0L 1QFHA 1SVBA 3WFCH 4BFKA 5DVMA 4UT6A 3SE4A 3ZT6A 4KPHH 2BZCA 1LLAA 2HSIA 3IMVA 2WIIB 2F0CA 2FWOA 2H32H 5ETUB 1KMGA 4Z5RA 3X14B 3LKPA 3PDDA 2ZE0A 2QL1A 3RJOA 4IBSA 4TTGA 4HH8A 2GEEA 3BDYH 3QUKB 2BSRB 3RDTB 4I2XB 4BKLA 1BEYH 3INUL 4ZMYA 3V6ZB 1AR2A 4ODBD 2YC1B 4LLQA 5INCA 3F7PC 4UV7L 2EDWA 4UZSA 4E5XA 1TG8A 4MAYC 2X4QA 5F1NB 3EDEA 3WEAA 5E6IB 4W9CC 3HRZA 4Q52A 4WZ9A 4OZGA 5T3XE 4P49A 4RFEA 1L9TA 2WLLB 2WWMC 4HPOL 1FL3A 4R4BA 5IOKA 1VDGA 4O4YL 3GMOA 4Y89A 1YUKB 4UDUB 2PO6B 1U3NA 1LD9A 2CKBB 2AABL 3I6KA 3L6FB 5CHNA 4Q4EA 3VXNA 1AGBA 1AH1A 4QHNB 4GB9A 1IBGH 4FI8A 5DQDL 4S1QL 3V6OA 4XHJC 5HHPA 3PXLA 5AYTA 2VR3A 5HGBB 4X7CC 1ZEAL 3DJ9A 4DKEH 1JD9A 4LDOB 5ESVA 4Z7UB 3MSPA 3RZWA 1S7WA 3GLAA 1EO8H 4AWJC 1F1AA 2A6KA 3W2DH 3G04B 4YNYA 3SKMB 1FPTL 3TO4B 4P5RA 4GBXA 1OSZB 4BFIB 1QBML 3H0TA 4MXWL 3R7QA 1T1ZB 4KKBC 5GRVL 2B16A 2FTAA 1TQCC 1AD9A 2X1XR 4XNQB 1KTLA 4CKQA 5EEZA 5H35A 1ZHBA 3N6YA 4GI8A 3OKMA 3BSHA 1I1YA 2YXWA 1R1CA 1YSOA 2C3VA 3I9PA 3QZNA 1XCWA 4UM8B 2YFOA 3L9RA 1Q1JL 4YIQA 5DEFA 5IKCB 3NIGB 1DCLA 1Q94B 3A67H 5EH1A 3G3LA 4A7UA 3VXRB 2EDRA 2KZWA 1TCMA 1NIBA 3GSQB 4N5ED 1D7DA 4UV4H 3QIBB 3S36L 4K0OA 2JKNA 3WBDA 2DTML 1HCZA 4P8QA 4E9RA 4D8PB 5FAAA 1A02N 4JM2C 1V27A 5JR1L 3VGEA 2MWCA 1EZVX 4O2FA 4PJCF 3MBED 4HWBH 5TH2B 2WCPA 5A2LH 2XVKA 5K39A 4TNFA 5FPIA 1L9SA 2QEJA 2FSEB 1TCRA 4G9DA 4HJUA 5TE7L 4TSCL 2Q1EA 1P1ZA 3CFKB 2PR9A 5DEZA 4CRPA 5JIQA 3RGVC 4FQHB 3PHQA 5I1DB 3JTSA 5CEXB 1GGCL 4PGDA 4O9HH 3KDMA 4M7JL 4O5LL 3B2UD 3PDGA 5INDB 4NNPL 2XVGA 5GS0C 4YHKH 1RZFL 5LKNA 5DC2A 4FX5A 1IAKB 1DEEA 1FLRL 1PLBA 1Z9PA 2AV1B 5BMFL 5IBUB 2HZHA 3JT2A 1T20A 3L5IA 1P84K 4KI5C 4F58L 4PGJA 3DMMB 5AVRB 4FQ1H 1TDQA 4Y9BA 4PYGA 2WWKT 2VZSA 4FXLA 4PJ8A 2AHIA 4Z1PA 4JO4L 3QULB 3HJ0A 4ICXA 1AQHA 3QXWA 3MV8A 5ID0A 1XXDC 5T1MA 1UA6L 4D0CA 4NCC1 2AXHA 3QSKB 5CGBA 3GMPA 2VXQA 3U2SA 2FCBA 5ISZD 3U9WA 4NNYB 2MIZA 3MRBB 1HINL 1YMHB 5I5IA 3ESUF 2VDPL 1XV8A 2QLYA 2UZIL 4UT7L 5DO8A 1BZ7A 2WXLA 4LKXA 5JMRA 3HHSA 2VO5A 2FO4A 1FZKB 4Z3FA 3BDXA 3RPBA 3TO2A 2GUOB 3ME0B 4JHAL 3L4YA 5TQ2L 3P0GB 4YK4C 5E8NA 1AY1L 4JBSA 3WNLA 5HI4D 2AQNA 4KQ3L 4N8VG 1CUOA 2GT9A 2PCPB 2IWKA 4MB3A 3KGRA 5B3JE 4IRSD 4APQC 1ACYL 1SDAB 3S35L 5A2IH 5FXCH 3MNDA 4EIZC 3RL1A 2LFEA 3M6DA 1U93B 3AS3A 3EYVA 3BVDB 1TNMA 4I18C 1IBDA 3QUYB 4J27A 4JM2F 3S35X 1E8ZA 1FGVL 3UAFA 1Y6KR 2WXQA 3PAUA 1T80A 3KCWA 1KBBA 4JZJA 3DO7B 1ET8A 1U95A 3OXSB 4AITA 4DP5X 3WFHA 3B9KD 4Q89A 5D2NE 1QPKA 2AP2A 3BSGA 3F58H 5CJXA 5FDWA 1M2OA 2NW3B 4OY9A 4Q6YA 5I6OA 5T3ZL 3TIEA 5ESAB 1YEFH 4L3AA 5B38B 3KYKL 4JFDB 2WIMA 3C6LA 1XGRA 4UQ2A 3HE6B 1VKXB 1ECYA 3E38A 4JPIA 1O7VA 4HDIA 3QUXC 3SBWC 4A7TA 1A6AB 3FU3A 3LQMA 4PG2C 5IEHB 3BVNA 3HC3L 3LQAL 3MOQA 4M6OH 5EOTB 3CH1A 3P4MB 4LQFH 4KY1H 2ZX8A 3C60D 4P46B 4F9LC 2FBJH 4NUQA 5LUMA 4KI5F 1Y7VA 4TNWF 4XR8C 2AZAA 1ADQA 1D6EA 4UQ3A 5CLTA 3WS3B 1JYXA 4I3SL 4HUMB 3FULA 4N6RB 3WIHA 3LQZB 1TPXB 2IDTA 3RVXD 4M62H 4JDZA 1FF5A 2P46B 3T0EC 3EGXB 4FG6D 2OQJA 4QKXB 2XA8L 1MF2L 2QFPA 1DQIA 2Z64C 1VGEL 1XHHA 2Y7LA 4GI6A 1SMDA 5I66B 5EB9A 5IM7B 1T89A 3CGTA 2MEJB 1HXMA 2NNCA 4OLEA 5BPPA 2Y36L 2O93L 2KH2B 2YFNA 5CBAA 4OF5A 3ZKXC 2NY0D 1T22B 3H9HA 3DBSA 5I1IL 4TQIA 5HHVL 1LHZA 4H25B 3F62A 3R4RA 2CGYA 1JGIA 4DK6A 4F2MA 1F11A 1AGFA 4M8UA 4TNEA 1NDMA 2X10A 4Y9GA 3CBRA 2H9GA 3ARGA 1HEZA 2OR7A 4YDJB 5GGQH 2CLZA 3CXFA 5IZ7A 2ICEC 4QRQB 3WNJA 1NCOA 1AJ7L 3VU1A 5KN5A 4NM4L 1QLEB 2VDLH 4OH2A 1H3XA 1EFXD 1U3JA 4PR5A 4TL5A 2XA3A 1E5UI 3SJVA 3QRGL 5KBNC 4Y4FC 2Q86A 2X4SA 1RUPH 1WEJL 1ZK9A 3FPXA 3QAQA 3D50A 2G3MA 4QXTA 4DN3H 1WH0A 2ZXAA 2JQMA 4TUUA 3HUJB 4X9BA 2HMID 1RZJC 2WSDA 1EDHA 2IEPA 1OCZB 4ECNA 3KJ4C 3SE6A 2CDFB 3K2UL 2OJ1A 5JHMA 2ZKYA 1DVFB 4Y19A 1U8JB 3UTSA 3LNGA 1SGKA 3QCUH 1RURL 4LXFA 1E7UA 4U1JA 3GSNH 4Y4HD 4N9OB 5BUPA 1FSKC 3VDAA 1OL0A 3TTSA 1GVIA 1Q9OB 1G1OA 5GRZA 3BYYA 4G8GA 1N70A 3GHBL 2WTPA 1AC0A 2PMZA 1SEQL 3O9WA 4YHIB 1VB9A 4TQPA 3RHWK 1R3HB 5AB9A 4GFTB 3UPRB 1XWVA 5JHLA 5KG9A 1HYSD 2OMBA 1T04B 4YO0B 3SODB 3ZE0E 4OZ4B 4MQTB 1NCDL 1F45A 2NQ3A 4AVHA 1OSYA 2XWTB 5KSVB 4PRPA 2VN5A 4QRPE 3RILA 5F7YC 3RKPA 4HQQH 2PETA 4MXVE 3K6DA 5D96C 4UT6L 2WYHA 2I25N 3OKOB 4N8CL 3MMEB 4MLIA 4G72B 3LYRA 1RKRA 4DP0X 2EADA 3DX1A 5TE4L 4CN6A 1B0IA 2FEJA 1HE7A 2J88H 3D3VE 3VXSE 1E2WA 3N1MC 1G9EA 2AEQL 4P4KA 4GKZB 1TJHH 2HLFC 3TN0B 4MXQD 4PGEA 3GFUA 4F7MA 2JI2A 2X6VA 2VZUA 3CVDA 5CEYB 3CLEL 3CFBB 4H13C 1L9QA 1J12A 2GFBB 4ZYKA 4K7PY 2PP8A 5T1LB 1C1EH 2V33A 4G5AA 1JGEA 5DD6A 2FD6H 1SFHA 2KHAA 3AAZA 3HI6H 5FCUL 4XN2A 2H7WA 1I82A 3D0VB 3S8GB 2ZCLL 3J27A 4DH2A 2IADB 3NSFA 1J9SA 5CS7A 4JO5A 4FFVC 3L5XH 3TNNB 5BOJA 4KVPA 5AKTA 4C4BA 3PNWA 2KI6A 3WXVL 5D4HA 1F8TH 2BNRD 1Z9MA 4MNQB 4G7VH 4BGLA 2WQ8A 3IK2A 4GUPA 4PRID 1UZ6E 5FB8B 1EGJA 1M7DB 1X4XA 2NY5L 3ZE2F 1M1XA 4R90H 3VMOA 4E9WA 4ES9A 4PJXE 2WLYA 2V2XA 3GJFH 5AUMB 2KMWA 4CN1A 2DQJL 4AG4H 3WY4A 2HPOA 3IN2A 1H3PL 1VERA 2A83A 2IDUA 1U33A 3CNKA 3FXIC 3ABLB 3CLFL 3E8UH 3QHFL 4M5YH 3F05A 3VGFA 5EC1A 5AVUB 3L3JB 3P77B 1IKFH 2C5DC 3O11B 2TRYA 4DFIA 2H41A 5D1XE 3MBXL 1QSFA 3QDJB 3HR5A 4W9KC 4G6JH 5IUSA 4N2HA 4LLDB 1NEZG 1NCIA 1TKWA 1XCTB 2HFGL 3FH5A 1X5KA 1G9ML 2H6PB 2L3BA 2QSQA 3FT1A 4NCDA 1JGVH 4XMPH 3STLA 7PAZA 2FX7L 2IAMB 3FHEA 3OZ9H 5DRWA 2IBZX 5AW4B 1JGLH 4HISA 5CN2A 1JTTA 1KIPB 3N1PC 3AGVA 2JKLA 3QFJB 5D6CA 5JYMA 4EVNB 4YGAB 1KB3A 3NZHH 4UDTB 3QUZD 5C8JA 1GJUA 2A74A 1FFPA 2AK1L 1YCSA 5E0QA 2AJZB 2ZKWA 2XWBA 4LP8A 5IFAL 2EYRA 3T6XA 3P4LA 1AP2A 3X3FH 3L4ZA 5LAXB 4NQCD 4N2FA 3QRLA 5JA9A 2VRQA 2CBQA 4DQOH 4AH2B 3EOYG 5HHMB 4KH9A 4X8XA 3PWLA 1A7QH 2VXTH 4L8BA 1FVDB 4NRZB 4YUEH 3MRRA 4A2DA 3WHE1 3QJFA 4IGBC 2VDOB 3IPFA 4K94H 3CHXA 2FYYA 5KYUA 3QA3A 4LL4A 5D2LB 2JJWA 2MPAH 4N0UB 3SO5A 5LHDA 3HNVH 2H26B 5BUGA 4Y7OC 4O51B 4L37A 2F7QA 2ZQKA 4OCYL 3LNEA 3RP1A 4HS6A 5E23A 4AIZB 1BLNA 1XGPA 5E8PB 5B21A 2VXQL 5MENE 4HP5A 5DQJA 3OGCA 1OZUA 5IROA 1JWMA 4UQ9A 1I3GH 1KUMA 2CLVA 2VL5B 1PX8A 2H2PC 1B6UA 2H6UA 3GK8L 5J89A 3F7LA 4P06A 4DTGH 4NZUH 5G5DB 4QTFA 3RWEA 4IU3A 3DV6A 1GKOA 3MLRH 5AB1A 3VGDA 2QQLH 1SVZA 3TWCL 2R9HC 5IGXH 4ZMLA 2IG2L 2J3SA 1Q0XL 1TYEB 2CNZA 3PJNA 3OJ2C 4PWKA 4LVNB 2BZ7A 3JWDH 2LLGA 1U8NB 3WXWH 2NY1C 4PB0L 3BEWA 1D5BB 4GW5B 4Q56A 1F13A 1J05B 4GG8B 4PD4J 5CSZB 1RK0A 2QDWA 1CL7H 2JFCA 3MR9A 4DETA 1A7RH 4DW2H 4NHUA 1GAFH 3IFNL 2AGJL 4ZW5A 1JPTH 2Y0SA 5F0PB 3T4AA 5HHOE 2XXFA 2FH8A 3LH2L 1FNGB 2WTOA 5HYEA 4LCCA 4I5BA 3FTZA 4UU9A 1YEDB 1DSWA 2WO3B 4MAUH 4X7TA 3W0WD 1T5XA 3RWCB 4HWNA 5BXFA 1L0QA 3OV6A 2ZP0T 4PRHB 4DIXA 3PGDB 3BQUA 4I3RH 4E41B 3WTTA 2VLLB 1ODUA 4MS8C 4ZFFA 2X89D 3U6XS 3DX9A 5D7LA 1CLZH 2ZCHL 4MB5A 4PJ7F 4B9YA 2XKSA 3O4LA 1SXZA 3P54A 5JHDD 4K3JL 1OF0A 5JIHA 4RAUB 5I0VA 4HJEA 4HEPA 3V5HB 3QR1A 5L8KB 4JFEE 2DD8L 1TYRA 2YPLA 1NCAL 2VDQB 2O6DA 3IJ9A 1JV5A 4JDVB 1NOFA 3A4FA 3KLLA 1GYUA 2Q3AA 2PWGA 1KTBA 3E3QC 4NSKB 3GJEA 3LB6D 3PQYE 1CICD 1ADQL 1V55B 3EBIA 4M7KL 1DSYA 1IGML 2W9DL 5D1QE 4J4PA 4J3WA 3WIHL 5C86A 1ZTMA 1I8KB 3REWA 2F68X 1J5HA 1M6UA 4CADA 2Z0UA 4WV1A 4KHTL 2X9WA 5DHVH 1J5OL 3S6CA 3ZY7A 2PF6A 5JQ6H 1EAPB 5J7CC 2WOYA 1NGQL 1MFBL 3NIFF 4KO9A 3OMZA 4NXKA 4XOEA 4HXBH 2VLKE 1F2QA 4KTYA 3ZKMD 5EDXA 2G0KA 3MXWH 4JRXE 2UX7A 1C5DA 4YHYB 1ND0B 5KBPA 2BCMA 4JDTH 4AQOA 1URLA 2CJUH 3UTTE 2PN5A 1K4CA 3L48A 3I74A 4ZRGA 4U1GC 4G70B 1HI6A 1H0DB 1KYAA 4CC4C 4Q9QL 4DUWA 1ZXKA 1K8IA 1NH6A 2ZX5A 1HHJA 4LFHG 5EU5A 3P9LA 4N4YB 4NUGL 3OJVC 3S97C 3NTCL 4AYBA 5C0EB 3OR6B 3QUMB 4CNIA 5C0BB 5JORA 1E5ZA 2ADJA 4LGPB 4ONOA 4DSYA 3B4NA 1RJZA 1IC4H 3RTQB 1FDLL 3IDYC 1KFGA 2R2CA 4IBZA 1I8MB 2F5BH 4UTAA 1PZAA 1U3YA 4RMUA 1F56A 2CK0H 1Q0YH 1OCRB 1FYTE 2HLEB 5D4IA 4P5TA 3WEOA 1CXHA 2DLEA 1N6VA 5CEZH 3NACL 1UWGH 2HG5A 2XACC 1IB5A 2WB7A 4HJ0D 5HDQH 4S2SA 1ZHLA 1KYOK 2QSTA 4ZMVA 2FIKB 4C47A 5BV7H 1GZPB 4NO5B 15C8H 1RZ8B 3M45A 4LOUC 4HV8B 1R3KA 3TJEH 4PTTA 5BO1H 3HG1B 4OZIA 2VQUA 5FHBL 3BQVA 4LLYB 1Q9KB 4B3EA 3V5DB 1LMKA 4JJ5A 2ETWA 1VPOL 4Q6IA 3ZTDC 5KW9H 1HHIA 2BS71 4MA8L 4FQXD 3RWJA 4FQIL 5EBWB 4QAWA 5BS0D 1BVNP 2Z35B 3GINA 1KJVB 4KROC 5BZWB 3V9CA 2HX8A 2YEZA 3LX9A 2F8VA 5F0JB 3OPUA 2VOTA 3SYCA 1BQUA 2DTSA 3SDDB 1KN2H 5E4AA 4CMMB 3DSNB 2OXHA 4R96B 1IKNC 2R4RH 3R0NA 4J8RB 3F7KA 3E2HC 3LAFA 2D03H 3I84A 3ALXA 1KLUB 1VFAA 3WFEL 1JFQL 3ABKB 1A4JA 3WIIH 5JHLL 2R29H 4AGOA 3NCMA 1D9KB 2B2XH 1LILA 4HCFA 3K71B 1GXEA 1JPSL 4OCWL 4YX2H 4YDNA 3RWGB 3T77A 1NUDA 1XDTT 1WS8A 4LPUA 3CVIH 3HE7C 3DX3A 5E94B 4QRFA 3KJ6H 5TF1H 2GBAA 4ZW7A 2VABB 5AW9B 2X2HA 4ONGL 4NGHL 3BJLA 4K3DH 4DAGL 3BPCA 1DVTA 2DPKA 2E5EA 1CR9L 3W56A 3DBXA 4LMQI 1FN4B 3TJPA 3P9MB 1A7NL 3K4DA 3FQXA 3GZQA 1E5CA 4JFZL 4WEEA 2QMJA 2X4NB 4GP5B 4K9EH 3OAYK 4ANVA 5I1CL 4X99B 5J5EA 1L6XA 1PKQA 1ETJA 4B9KC 2A6JB 3S37H 3EDDA 2Y07H 1E27A 5J6HB 1MJ8L 4WWKD 1QKZH 2A77H 3KPNB 2XOTA 1AIFA 4XTRD 2PTUA 4OU3A 4F5CE 5C3LD 1FFNB 1QWHA 1JD7A 3T6WA 4X6DF 4Z7AA 5E2JA 4FQJH 3B9VA 1U6AH 3P3TA 2QLVB 1LO2L 4X9YA 4BYHA 4J6RH 5D1ZA 3KYMA 3SY0A 4FFWD 4JQXA 1EGJL 5TK2A 2J43A 2DOCA 2WMPB 2YIHA 3FTYA 3MLXH 2F1EA 4AYFA 4BHUA 2BNQB 2X38A 4LLWA 4LHUB 4X4MA 1OWWA 3H4FA 5I73C 4M3KB 1AI1L 5DZJA 3BZ4A 2MCPH 3WL9A 2NXYC 4K3EH 4UAOC 3QUKA 3RDTA 3D3VD 3ZR5A 4I2XA 2DDQH 2B14A 2W95A 2YC1A 4PCSA 1MLCB 1QABA 4HWZB 3HTLX 5E9DE 1D3CA 2NUPB 4R5VA 4QHUA 1BSIA 4G1EB 4OT1L 5L2KD 3CZSA 1NBQA 2ZWKA 4MRCA 5EU6B 3E80A 3U7YL 5AVYB 3MX0B 4RZCB 2WLLA 4GMTH 2QHRH 5DK3A 1GS8A 2RIKA 4PB9L 1FRGH 4ZS7L 1A7PH 1IBBA 1IGJB 3CXDH 3QIUB 4HYTB 4HIEA 4N8VA 1E4WL 2CAKA 3O3UN 2VXSH 4UDUA 1FGNH 4P05A 2CKBA 3QPXL 3S2CA 5EZJA 2IDFA 4EKXA 5E2WH 4B5EA 1CFNA 4HOXA 2ZIDA 4BZ1A 3ATEA 4AQEB 5LGJB 2XU9A 5HGBA 4GRMB 2AI0H 4Z7UA 5C9KA 4GRWB 2X2YA 3A23A 4C56E 1XQ4A 2YQGA 3D05A 3LVEA 1MEXH 3P69A 4NJ9H 2VDML 3SKMA 4J3OC 1OSZA 1A6ZB 4CJ1A 2J2ZA 1BMGA 1T1ZA 3I3BA 3QDGB 2HPTA 3GC3A 4OLZL 3T3MB 4OCRL 4QRRA 4W4OC 4XNQA 2R0KH 3CFEA 4NRYB 3C5ZD 3MA7B 1O9ZA 3FC8A 2QPDB 3EYSH 1GRWA 1TR7A 2HKHL 3BKML 5HDWA 4RCAA 3EOAA 3DUUB 2J4WL 2P5EA 4DERA 3BUIA 5D70H 1ODAA 4UM8A 3TFKD 2DAVA 2G3ZA 5D1XD 1IZKA 2CLRB 3ZK0A 2IANE 1Q0EA 5IKCA 4U6YB 4PMFA 4H1LB 3OAYH 3FRPB 4OSUL 4LEXL 1KT2A 3IDGB 5ALBH 1ZWIB 5CEZD 3VXRA 4OJDH 1G0YR 1E6JL 3MV11 4MHHG 2H6OA 2DLGA 3IFPB 4IQHA 3GSQA 4MTMA 5GSVB 4ZS6D 1U4EA 2D31A 3QIBA 3WNNA 4NHCH 3MJ9H 4ZTEA 4D8PA 1NMBL 1P84J 2Y2TA 3UG5A 4Q97A 3HOGA 3VCLA 3DETC 3ZDXE 2GBTA 3V0HA 1T5WB 2V7HA 3C2AH 5CCHE 1AHKA 2LU5A 3O3AB 4PLKD 3VWKD 3LXBA 4DKFH 2R1XB 1S9WB 4H5SB 5GHWH 4Z7IA 5LXGH 4JY6A 4KJWC 5D7IB 5FYJU 1KCSH 3CFKA 2EUWA 3SDXF 3DX8A 2L7EA 3QW9A 4A6YA 1EHXA 5FWQA 2NNAA 2P24B 1MG3C 5CP3H 2EIZB 4G6AD 2J8UB 3S3PA 2ZF9A 3V7AG 5CEXA 1JXGA 7FABH 1QFUH 5JPMC 5EEYA 1WJ3A 3V8OA 3MODL 1CXLA 2E7BA 3DECA 3DTXB 5EC2A 4WI0B 4WUUB 4DN4H 1MCFA 1U9KA 1H19A 4UILL 1A8JH 1GW6A 4P2YA 3NJGA 1AXSA 4F3FB 1N2RB 2G30A 4HOZA 1TQVA 1WBYB 3CMOH 4GT7A 1G87A 2ZWSA 4LSRH 1IARB 3NABL 4JFFE 4QTIH 2NY3B 1FG2B 5A7BA 4PP2B 4OLWH 5JXED 3VH8B 1MRFH 3NRQA 4XMZA 4UB0L 4WW1B 3UZEA 1T1WB 5IOPA 1KTDB 4XP6L 4APXB 4YQXL 2DLFH 2GSIB 5MEND 3CFTA 3GZOA 3Q3GA 1MHEB 4NNYA 1JHLH 1OXYA 1YMHA 3MRBA 3W11D 3T0XA 2CR3A 5JIPA 1FQ9C 4Q9RL 2EVJA 3HZ3A 3JV0A 3L13A 1A6PA 4XMLH 4YC2B 5BW7C 1FZKA 1OTUD 2LT9A 2OTWB 2GUOA 4B6ZA 3IDJB 3ME0A 3QH3B 3MKGA 4NO3B 3UYOD 4NM8H 5GJSH 1T2QL 1U2CA 3QQXA 3H9ZA 3LZFL 4DOHE 1QAWA 2AEWA 3A6OA 3Q8BA 1MHHA 2V0AA 2XDHA 1UOVA 4HGKC 4N2CA 5IV2B 2ZOLB 3EH3B 4LHQB 5CZVH 1QI4A 3QJQB 1JZFA 5AL0A 3BD5A 3TBVB 3QYNA 3A6CL 5MEQB 4LHJB 1AS6A 5AAMA 4PWHA 3GXDA 1GIGH 5IT2H 5CLXA 1U93A 3ZE0F 4L23A 4ZZFA 2XZQL 4RX4D 5C0CB 3TA3D 3VTTA 3QUYA 2X0UA 2G5UA 2DQMA 4M6NH 1U92B 4LCVA 4PLKC 4BIKA 3DC0A 4DKDC 1HH9A 3RY6A 1ZLUK 5EO0B 3EJZD 3OXSA 3S2AA 4D3CL 2VSDA 3OAUH 1FZMB 3T0EE 3VFRB 5E6RB 3IKCB 3HNSL 2K70A 5DRNA 4AV4A 4G83A 3O6ML 4TSAL 4NZ8A 3BH8A 3BGFB 1WCBB 3RZCC 1X7QA 2E74C 5C2BL 1XGTA 5T8IA 3L4XA 3JWNC 2AJUL 3EKCA 1EVUA 3F7QA 5F7FA 1DQDH 1R5IB 2CA4A 4S1SH 3OL2A 2RD0A 1MCWM 4NXSA 3ML9A 3PWPB 3HE6A 1PVHA 3X3GL 4H1LG 5LGHL 2NY4C 1KB5A 4BM7A 2VN7A 4NAQA 4TVPE 4FERA 5EOTA 3P4MA 3KVQA 1UM6L 3JUYA 3FO9A 4UTAL 2FX8H 2B4CC 3V5KA 2HKFL 4H8PA 3BPOC 1KENL 2RTTA 3PQYD 3D2UA 4I0PB 4Y2LA 4QTHA 4N6RA 2IIJA 1H8OA 3LQZA 2V3DA 2VRAA 3MQIA 4HUWB 5D1QD 4ZPTA 1DUYB 1L6ZA 2PYEB 2VSCA 5AG9A 1NFDE 4AXWA 4H4NA 4M1DL 4C57C 3EGXA 3ZHFA 5B7MA 1HNGA 4Z9KB 3NJHA 5KSAC 2I60L 1DJHA 5DRZB 5AVVB 3S4SB 4AJYV 2ED9A 3SYAA 1INEH 5IM7A 4G7YL 3US9A 3DX4A 1AVAA 1TZAA 1JZEA