4ZZKA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMILPIDSAIEFYKPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori (strain g27)
molecule tags Motor protein
molecule keywords Basal-body rod modification protein FlgD
total genus 30
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzkA02
4ZZFA 4ZZKA 5K5YA 3C12A 3OSVA
chains in the Genus database with same CATH superfamily
2ADJB 3L9YA 1HX0A 3AMKA 1I1FB 4R90L 4TNWK 1OK0A 4HIIA 1PZ5B 3WFEH 2AF2A 2O5ZH 3JYCA 1AZVA 4DKEL 1IKNA 4TXVB 1IEBB 1NMBH 3KYMB 1D5ZB 4AX3A 1WAAF 3CFCL 4NJAL 3RDTB 1P7HL 2GJ6B 1E4HA 3TNNA 5IWLC 2WIIA 2ZPKL 4MJIA 3RKPA 5I0ZA 5L6YL 4JGMA 2BINA 3X17A 2NX5A 3OQRA 2UWEB 3QDAA 4HUWB 3IDNA 1DYZA 1XGUB 2Y23A 2QJDA 2DKUA 3WIAA 3NDYE 1RZFH 5D1XD 2CDEB 2GUOA 3MXVL 4FHJA 3OKKA 5KSUB 1JNHA 5CU9A 1IUZA 4NLAA 4X9HA 1JK8B 4PUBL 3UJTL 2QKSA 1C5DA 1L0YA 4HFUH 2ITDA 3V7AG 3U82B 5EULV 3DKHA 3V2AR 4PAZA 5CLTA 3CPLA 1IGML 2JCCA 3EYVA 4OLEA 3RL1A 1CDBA 3TU6A 5KW9L 2IMMA 5AWNL 1BVNT 1R3JB 3L3HA 5LDUA 1U92A 2CRIA 2N3JA 3IBOA 4TSBL 2V7NA 4X4YA 3CQPA 3BH9A 3DGGB 3BKJH 4AVIA 4MJ5A 1JHKH 4OM1L 4G3YL 4XTRC 1CIDA 2JKWA 1NFIB 2XWBA 1CT8A 3UP6A 3P3RA 4JPKH 5HVHB 3V0WH 1FC2D 3LN4B 2D03H 1KBKA 3SDXF 1QFPA 5I18H 1KEMH 4P07A 1RK7A 3CN1A 4P5TB 3RZCC 3LSOA 4ELKA 4ANXA 2E4TA 3B9KD 2IJ0C 1WJ3A 2D8KA 3FTYA 4HUCA 1QABA 1ZV5A 4P57B 2YKKA 3I6LD 5E4EC 2JV6A 3SE8H 1ZV9A 2ZQKA 3DROB 4QRAA 2AGJL 5FWQA 4JFDD 1N7ML 4PRIA 4YVUA 3CVHB 1MFEL 2OL3H 2YPVL 3IXAB 1ZVYA 3KGUA 2ZT9C 4U1JA 1WFUA 2VITA 3C6LB 5JQIB 1IC5H 3EJUA 1DSWA 1FL3A 1LD9A 2W0LA 2EICA 3DRTB 4ZX5A 4NHCL 4W9CC 5C7XL 3BVWA 2Q0ZX 1RLWA 1PMYA 2WLLB 5D7LD 3VFPA 5DVOA 1R5WB 1EDHA 2WWOA 3MRRB 2FO8A 4WO4B 4FG0A 1MFMA 3BVVA 1DLHA 1WICA 4MMXB 3KPTA 5IVOA 2Q8AL 5HYSG 1QLFA 3IETA 4J7RA 1XD0A 1GJIA 4AGQA 4UM8B 5I1JL 5EN2B 4RGNC 5EC1A 4LKXA 3SCMA 1MWOA 3A6CH 4Z7WB 2VQTA 4L3EB 5CAYB 2IPKB 2R0KH 1DN0A 1KIUA 3P3YA 1SN2A 2ATKA 4YK4C 5BO0D 2YQGA 5ICXA 1SF3A 1MCJA 5LBSL 1B0RB 2Y7MA 4Z8FH 3JWOL 4LNRA 4XPGH 4YBQC 3S97C 5DMYA 3QO0B 4KFZC 1QG3A 2YN3A 1UEYA 4KTEL 1YEEH 1SEBB 3ME0A 4OZHE 2NT0A 3TS8A 4BFFA 2F7QA 4PP1D 1OARL 4EQ3A 5ID0A 3N1QC 3BUQA 3QUHA 5D6CB 4MQTB 5FX3A 4DK5A 1NAKL 1Z9SB 2IOOA 5C9JA 1PYWB 1FI8C 4R2GB 1OSZB 5H37A 5AQ0A 4FTVD 3MA9L 4YHYB 1M4KA 1RULH 1Z1WA 4H25A 4XO8A 2IXQA 4J6RH 4YSOA 2YPLA 1NC4B 2AEQL 2WHVA 4K94L 4S0SD 4F8LA 5FDWA 4WI8A 4YIQA 2H2PD 2G4GA 3N40F 1IM9A 5CJXA 1LMKA 4M62H 3PP3K 3RYMA 2K6ZA 3LNGA 3B43A 1R3HA 4HPYL 4N2OA 4OQTA 4P2OA 5F8RC 3PP4H 5GHWH 4L3FA 1KMGA 4E68A 2GSMB 2ZYHA 5EA0L 2EJ1A 3MUZ1 3QA3B 1KELL 1F4YL 5GRZA 3B2XA 2Y9RT 3EOAA 1N6VA 1TJGL 4PJHF 3VB9A 5DEJA 5TDNA 5ISZE 3L3IA 2Q3ZA 1RZJH 2J1YA 5I1KH 5EU7E 1H8LA 2X28A 4TF4A 3RKDD 4ADGA 1I8MB 1ACXA 1AQKH 2IGFH 1QHQA 1UCBL 1Z5HA 4WI3A 3OBAA 4MCZA 4P06A 4FG2A 3F7YB 5I2IB 5GZOD 3LXBA 2QKIB 2R27A 3U4BL 1IBZA 2MPVA 4ZOBA 4XHJD 3CUPB 1ML0A 3DO3A 2IH9A 4Y4FB 3QFGA 2VUKA 3VFGH 2XG5A 4NKOB 1JZDC 4XPFL 3RZCD 3NTCH 3NCCB 4XXCC 5DD5L 4IMLB 5GSRB 4HUKB 1GSMA 3GO1H 4N8VG 4WUKH 3SDAC 4YWGL 2OXHA 4I77H 4RSYA 4B0MM 2FCBA 3GXMA 4XP1L 1AJ7L 3IGFA 3T6VA 1MJUH 1S5IL 3QJFB 5I6LA 5BRPA 1NDTA 2E9BA 2UYLB 3QDGB 4A6YB 4JDZA 4F91B 5E4OA 3W0WB 1CYGA 3ESUF 4KPHL 2C7UA 3TBWA 3ZK0A 2B77A 1WLHA 3BEVB 2H26B 3IEAA 1COBA 2WCSA 1ZHKA 5E9AA 4E41B 5C1MB 2H3XC 3WFHB 1IKFL 5SWSA 4FFVD 3P4NB 4JFYB 4FJYA 3ZKXC 1AXSB 2X4OA 3P73A 3MODL 2NNCA 3QORD 1QRNA 4QY8B 2PABA 1S7UA 3B2VL 2NY1B 3UIYA 3EJJX 3D2UB 1P4BL 3KL5A 4N2FA 4N1CA 3GSUB 5GGTL 3ZT7A 1LP9F 4QNPE 2WPGA 3NCWA 3BKYH 3NCXA 1IO4C 3K72B 4RRPM 4DEPC 5ACMA 1QASA 1G0DA 3NFSH 3V6OC 5DQJA 2BW4A 3MOBL 1LEKA 1U8KA 4FABL 4YVNA 2R29A 4P23A 4EI5C 2EUZA 3T8XB 4FNPA 4G59C 4YBLB 3FUIA 2D9CA 3KHQA 5E8EB 2AQQA 4EI6B 1D2PA 3A5VA 3COOA 2HKAA 1KCRL 2AJUL 3MNMA 5L2JB 3ET9F 3H6AA 4ODSH 2X4TB 2F8IA 5J11B 1NINA 1E7UA 1KJ2H 4YSUA 4MMZC 3KL0A 2HG5B 3ZE2B 1FJ1A 2XPGA 3FTGA 4UQ9A 4I1RA 1E8ZA 4M03A 3AB0B 4PVLA 2H4EA 1FH5H 3MNZB 4Q6IB 4G8EA 3UO1H 3HI5L 3TL5A 2P26A 1BMWA 2X41A 4GKLA 3QWRA 3U6XA 1XH1A 2XFXB 3IGKA 3P9WB 5KYXB 4DN3H 2H32B 5EOCL 2CE6A 3KGRA 3I6SA 3G9VA 4PI0A 2JI1A 3GTVA 3MO1B 1RKRA 4HETA 3VRLF 4U3XA 2CDFB 2QR0A 2VDNB 4C56E 2V37A 2G9HB 4Z76A 4GBXC 2WZAA 3KWXA 32C2A 5INCB 4M6OL 1BP3B 3MROA 4GG6E 1Q9LB 5ISZB 2A77H 1KLGB 4LQFL 4JM0A 4H8HA 3MVSA 5T1KD 3VTAA 1X7SA 4PJAF 5FYJH 3ARFA 4NHUA 2WIMA 3OKDB 3OGCA 3RE0A 5FUCE 1BZ7B 2Z6FA 2ZUWA 2MRYA 3D33A 3GIVA 5E2VH 1Y6KR 3GPSA 3BSZA 5F1IB 4GIOA 1IFHH 2EYRA 3B9DA 2VXTL 5EZIH 4CU8A 4UIMA 2F54E 3B2MA 4F2MB 1IGTA 2LAGB 1Q1JH 1GYUA 4KVPA 3MTXA 5DD1L 2XYBA 3GTTA 1MWAL 1S9YB 2ESVE 2LHAA 4J27A 3VG9C 1XR9A 2E59A 1RD6A 1LO2L 3LKQA 4P23D 4DETA 3QJQB 1KG0A 5E5RB 1CL7H 2A9NH 1QNZH 5D4HA 1YUHB 2BP3A 3UZEC 2FB4L 3AAZB 1IAII 3OKMB 2W8CA 2TAAA 4ZFGH 4KXZH 3D09A 5C8JA 4XH2A 2VOTA 2OBGA 2V9QA 3RY5A 5A3ID 1T89C 1IMHC 1JPEA 1AOZA 1A8JH 3PCYA 1QLEL 3QUXD 2ITDB 1NIBA 3QEUA 3VI4B 1ZMYA 2A1WH 3MV7B 1S7VA 3MO1A 4PFEA 2GK0B 5E99L 1XF3B 3HKFA 1HH6B 4UF7C 3VMOA 3STZB 1QO3B 3DROA 3L54A 2P44B 4XRCB 4AG4H 1JE6A 4A2HA 2GK2A 4XMXA 3R06B 1VJSA 4JS7A 4NRZA 1OPGH 3KLAB 3BLKA 3BKCL 1DUZA 2AKRB 5IIEB 3Q2CA 2BSRB 2FGWL 2CKBB 5KVGL 4JL2A 3UTZB 2A73B 1QFHA 3IGAA 4JKKA 5JIMA 4YXKL 1U8LA 3OTTA 3OZ9L 5J56B 4J3SA 2IAND 12E8H 1XGQA 4QGYA 4KK8C 1E5ZA 1IGJA 3AG2B 4M48L 5J11C 1ZE3C 5SWZE 2FX8L 4RMBA 2BMKB 1DVSA 1GGCH 1DQML 3IS0X 5BO1L 3H2WA 4HS8H 5JUEH 1GCYA 1Z3GL 3GS0A 3SKJH 3ZTNL 2FLBT 3IB4A 2YKLH 3AG4B 1KG0B 3DUSA 4X8XA 3IDIB 3WUWG 1HL9A 3KBPA 3SBRA 1NBZB 3F5WA 4AV0A 1W72B 3QPQC 4RMTA 4AQ1B 2JVUA 4KHTH 4OLXH 2IFGA 3L2NA 1HCZA 1PL3A 4KKQA 5DMIH 5CP7A 4HZLA 3WNJA 3Q48A 4X9GA 2ZOLA 5C0FB 5KTEH 1WZLA 5E0FA 2PCPB 3SE9L 4KUCD 3PDOB 4HYTB 4KK6D 5AB1A 4A66A 1MCWW 1E2ZA 1KCSL 1MFNA 2GJ6A 3I6GB 4BZ1A 1AZZC 4HXBH 3I9IA 4F92B 4J8QA 1C5BH 3QUMB 3SZ6A 2YBRA 4JFVA 2DLGA 4GO6B 1HHGB 4NRYB 2DZEA 4HIXL 4CADB 3G5XA 5TPWH 3NZ8A 4X80H 4LCYB 4TNEA 4JGUA 5AL8A 5E1AA 1OK8A 4WEBL 1J5IA 3UERA 5ADPH 4RGND 1PCSA 3OX8A 1S7XA 3CD4A 5CR1A 2YGPA 1T7XA 4QHPA 4XN7A 3RWDB 4W4OC 2B39A 1TVHA 4G6AD 1AP2A 3L13A 1NCAH 3HRZC 1V8HA 1ECYA 4GO9A 4KGLA 4PHXA 2HJFA 1GTNA 4WO0A 1AKPA 4P9HH 5L2KA 4F57L 1AS7A 3HLAB 4OGYL 4PRHB 1E28A 1NCDH 4MA7L 5HYJB 1OZTG 1F41A 1ADQA 1ZIAA 2X1PA 2YBRB 1NEZB 1JGDA 4YE4H 4NXSA 2NY2D 3UG4A 2XTSA 2GQHA 4I88A 3ROOB 3GJEB 4ZNCD 2YARA 1CQYA 5C0RL 4HD5A 4A68A 4ZUVB 2FATL 4MZ2A 2HKFH 1HNFA 1V7ML 1ZWIB 5EZJB 1VLXA 3NIGF 1KB9J 3O6LH 4GP8B 1MCWM 4CNIA 5MERB 1U8MA 3DX6A 4XNZB 5D7IE 1SXAA 1U93A 4OIIL 3T0XA 5GJSL 1O7VA 3CJJA 3RTQA 1O5PA 4AH2A 4LSVL 1G7MA 2K3TA 4QRUB 4XWOD 5EZIL 2I9TA 3NABH 5K1JA 5ABAA 5MI0C 3IXTB 2WWMC 2YD0A 3HNVH 3PL6A 1DSYA 3BN9C 3KNBB 3P0GB 3RA7L 4GOSA 4Y4HA 2ESVD 4XNQB 3TBVA 4AW4A 5IHUL 3U0WH 3W56A 5DO2C 3FDWA 3SDDD 3OJDA 5HHPB 4WFHE 2VQ4A 5DJ6A 5E5UB 2F54D 1HSBA 3GJFH 1BD2E 3BJ91 2BIHA 4HWZA 1I3RB 4ELME 2ERJC 1NCCH 4U6VL 3MLUH 5H37H 1SYSA 1IGYA 1Q38A 3GMPA 4Z0XB 4L3EA 2JKXA 3MDJA 3QZLA 4XZUA 1TKWA 2NXYC 4G1MB 1L7TL 4IS6A 5B1CA 3UOAB 5B22A 3NFPA 3O6ML 1XCQB 2F53D 4RGNB 3GSWA 5DRWB 4LHJB 5DUPH 5IMMA 4GXVL 5T1MB 1WC7A 2IPTH 4HLZH 3B4NA 1WFNA 1MIMH 1MJ8H 1RIHH 2NY5L 4G6KL 3VX1A 1BVNP 3QG6B 2BSBA 1QNIA 1BD2D 3POCA 4O5LH 2X6UA 2F74A 3GDCA 3S6CA 2O72A 3M1BA 1PLCA 1P6FA 3GO1L 3AS3A 5K9OB 2WLYA 4ODXB 1I7UB 5FCSH 1G7LA 5DD5H 5B4MC 4ONGH 3RFZC 1SY6H 1A1OB 4OLVH 5I9QB 4ADIA 2OK0L 1A6AB 3FL7A 3EHBB 2OQJA 1KF9B 4M61B 3FNKA 1KYOK 2GSGB 3DVGA 1ZRUA 2HX9A 1I82A 4PRHD 5CSBA 5DEFB 2A0LC 2HPOA 1WGOA 3U9PH 5J57B 1E4JA 1XCQA 2A6JA 2J73A 4WNQA 2D9QB 5E2WH 1Q0YL 3CFNA 2PR9A 1YDPB 5F21B 5IROC 4M62L 2A9CA 4PTTA 2DQDH 1TO5A 1XF5A 2IGFL 3PJSB 5DUMH 3QCTH 3NJHA 2XA8L 4LSRL 3IFOB 2A9NL 3TH3T 4BZYA 4CNIB 3RUGE 4GRMA 4UBDD 3O3EA 3WO4B 1OD9A 2W9EH 4MDRA 1CE1L 5GXBB 2AJ3B 1FLRH 1UH4A 3UACA 3UTSE 1C1EL 4Y5VB 4N3UA 2V33A 4GW1B 3LIZL 3VUAA 1CDIA 1IBFA 4DVRH 2L8AA 4EOWL 3FF7A 3P0VL 3K4DA 3Q3GA 4YXLL 4AIXA 4WFFD 3V8CA 3STBA 4J4PD 1O7DC 4U6HA 3U25A 5HYJE 1MFCH 2YAMA 4Q0XH 1WAEA 1TZOA 3ASOB 4KNUA 5ANMA 1LTXA 4JLRA 1X3DA 1XV8A 3W1ZA 5IQOA 4JDVA 3UBXB 1B4TA 2OTUA 4HWZB 2IPKA 4DHLA 3S9DB 1TNNA 1ZLWK 3PGDA 4FFZH 4GKSA 4KTDL 3MCLL 3VWJD 1TTAA 4JDEB 4XPFH 4YWGH 5FYLH 5DJCB 5GS0L 1WYJA 4HCIA 4JO8A 4OCRH 4DGVH 3RFZB 3BRDA 4XZUB 4QHLB 2F8OA 4UQ2A 5LB1A 4GBXD 5GGRB 4M61A 3HC3L 3TPUB 4XVTL 1UXSA 2AXGA 2FQGA 1XF2A 2RIKA 4Z0BH 4IIQB 1QX1A 4PJHB 3CN3A 5DC0A 1MFBH 3N85L 4ZZFA 4AM0A 1LQBC 4MBOA 4R4NC 5E8PB 5L2JA 2J6EL 4KVCH 1WZ1H 3KMDA 3TBBA 1CGTA 2CXGA 2MOGA 1AXTL 4PJ9A 3NH7L 2IH3A 2X1QA 3D9AL 3OHMB 4PRHA 1D5RA 3TCLB 2RQEA 4PG9B 2GAZB 4WSKA 4IHOB 3PHQB 1CTNA 3QZNA 1JF6A 3E2HB 1KLFA 4NQDA 1W72A 3WTSA 1ZS8B 3TIDA 2NZ9C 2IDSA 3Q8EA 5E51A 4MKTA 4XNUL 1KJVB 4YPJA 2K6WA 4EI5A 1XIWD 3MOBH 4F7MA 2CKBL 5JR1L 1WE5A 4NXKA 1AGDA 2N0MA 3ISRA 4JKPH 5PAZA 4I0PA 4PJIA 4MRCA 5DJYA 5IK3A 1ZXKA 1VRSA 2OULB 3EGSB 1P84K 1U3HB 1KTRL 3B34A 2EECA 2AK4B 5DYFA 3VWKD 3CCHA 3B9EA 5I6PA 1T3FB 4F7PA 1BQSA 4NI3A 2W88A 5CN2A 5MENE 2BHYA 3MFFB 3VFTB 3LZQA 3PFUA 5I6KA 2L7JA 3AU1A 4LCYA 5E1AB 3QYMA 3JWOH 4MFHA 1INEH 1TCRB 4PJBA 4XPGL 3WNPA 4JFDA 4FI7A 2NY4B 4DESA 3UZEA 3IMTA 2VDQB 4OM0L 2A4ZA 5F96H 3OF6A 3EO0A 3O3BA 3IPFA 4UTCA 2WBJB 4C56B 3IETB 3DO7B 4Z7NB 2BSTA 1MFBL 2Z4QA 3N85H 2XPZA 2ZYIA 3ARGC 2WGXA 4JNXA 3WIIH 4EDXA 1P5VA 4OJAA 2EO9A 3SO3C 3Q13A 3WXVH 2JSFA 1SDDB 4PRPD 4RMWA 2G4EA 4Q52A 2JIXA 5GGRY 3JUZA 2C1PB 3GSRB 1I1AB 1DQJB 1S8DA 4KMLB 3TIEA 3P9MA 2AQTA 2NRDA 4GB9A 1U8IB 1GC1C 1AQDB 2GTZB 3AQDA 3KHOA 3SYAA 3Q5OA 1T0NA 1IBBA 3P2DA 5FKAA 1UD5A 3DX7A 4KDWA 1A6ZB 2MSPA 3B2UD 1P1ZA 3PNWB 2DLFL 3M17A 4WRLA 5D9SB 3MLZL 3GB7B 2AK1H 2ZSWB 4N5UA 2Y1YA 3L3JB 5FLVA 4AVJA 4BSVB 4AL8H 3X1FA 4N2MA 2WQRA 4TLKA 3MA7A 1DVXA 3R8QA 4NZ8A 3RGVD 1KJ2B 1GGTA 3IGAB 3ISYA 2OW7A 3OXSA 4N8VB 5DLMH 3ZYIA 4K7PY 4TSBH 4G3YH 5DFAA 5JHLH 4UQDA 1RY7B 3C5SB 4LDOB 4MKMA 1SJMA 5K39A 1MCOL 1QZ1A 2EYSB 2MPAL 1XCXA 4R96B 3ZL1A 4X8CA 5ANME 4OJFL 1VFBB 4L3AA 5DVPA 1HOCA 2BDNH 5D72H 4LLVB 1H9VA 2WXMA 4HG4K 3BUYB 2NTSP 1KT2A 4Z7VE 2PWFA 1WHPA 5FV1L 1U8PA 3RRQA 4LL4A 1H8NA 4APQD 1CGWA 2UZYB 2H32A 1SEQH 2RGSA 2QMJA 3L1OH 2Z93B 4ZMTA 3VFMA 5CEYA 5ACZA 5C0IA 3W37A 4XAKE 3X13B 1JTTA 4F9PA 4KHXH 1BZ7A 1DR9A 3GIVB 2YAOA 1EZSA 2BVOB 2X4SB 3G5WA 5GZOA 4P05A 4F80A 2YIHA 3MCLH 4OM0H 3VXOB 1JZIA 4PJGA 2B2XH 5CGYC 4AQOA 3CDZB 3MRGB 4P8QA 3QQXA 4ZPVB 4HDIB 2WBJD 3RWJA 1AR1C 5HY9B 2XXMB 4HSAC 1Q72H 4OLYH 1P7KA 4CC4C 2KPWA 3QCUL 2C1PA 2ZXQA 4ORGA 5E9DB 3T1WA 3WU1A 5HHMD 2PR4H 1T0MA 5A6MA 3RPBA 1I4FA 3BE1L 1NH6A 3EFDL 4ABWA 5FLUA 2WLJA 2EIKB 3C9NB 3DXAB 4OLZH 5D1XC 3OSKA 5CLWA 1FE8L 5IW6A 1HEZB 4KQ0A 1PLAA 1U4EA 3FCSB 3HRZB 4W9JC 3SQBA 4A2MA 1I8IA 1A7BA 3M1BB 3GSXA 3V4UL 3TZVC 2CRYA 3DSNA 3TURA 3QORA 3SE9H 1SXSA 2VWEE 4XP9H 1M7DB 5EBWB 4JPWH 5C6TL 1F4AA 3T65A 1KC5H 3IGUA 4LEBA 2F7RA 3BDBA 1EX0A 2BWDA 3DMMD 3RHWK 2CRMA 3CLEL 1ED3B 3MC0A 4I3SL 3N5AA 3QUYD 1B4RA 4YXLH 4GJTB 4O02B 4NZFA 1N26A 2AKRA 5IIEA 1JRHL 4FFYA 3VG9B 2BH0A 2E7BA 4X9YA 4XTRD 3ZDXE 3DVNB 4NPKA 2DQIL 2Z1PA 1GR7A 1DQLL 4XRCA 1T7ZA 2ADGA 4QHUB 3RWIA 3GUTA 2VTFA 3BP5B 3QJFA 4LGRB 3O2WH 1FLTX 1BM3H 2GCYB 1G9EA 1LK2B 4FQCH 4KGJA 1CIUA 4M5ZH 1JNNL 5I1CL 2P45B 2W0PA 4UQ3B 1MHPL 3MRHA 4P9HC 5SWSE 3FO1A 2NOYA 4P2QB 1OAQH 2CDEA 4LBEB 1RMFH 1I85C 2JKRM 2QHRH 4KUCF 1C5CH 4L1DA 1TR7A 1SJEA 4JRYE 2X42A 5FW7A 1G5AA 4RAVB 1EWHA 4LHQB 3O41A 5AALA 3KLQA 1Z0MA 5CJQH 4MA7H 1RZFL 4GBXB 2YUWA 4TM9A 3VSTA 2DQTL 1IFRA 4KDVA 3QZWB 3GGWA 4X4ZA 3QDGE 4Y19A 2P5WD 3L7EA 1HFUA 2GEEA 3VFNA 1TCMA 2N01B 3K2IA 4QTHB 1QTSA 3EO9H 5FO2A 1AZCA 3K72A 4AG4L 4CU6A 4TQEH 4WCYH 4MQ7B 5HHOA 4IOSD 1U2HA 5FECA 3OC5A 5CEZE 5C0CA 1CFSB 3LKRA 2CO7A 4KXZI 4P23B 2VR6A 4HUXB 1FPTL 5E7BA 4PJAA 2VN5A 15C8L 4X5RA 4YLBA 3V9FA 3TC9A 5I75B 3P54A 4JFWA 1AACA 3MRCA 3MLTB 3NJNA 4E42A 3MBXL 3E8UL 4W70A 2B7DT 5ANMB 1FVEA 2J5LB 1IC7H 4Z3GA 1O75A 1AG6A 1J0ZA 2AAAA 2CPUA 2UX6A 5KZCD 1CYXA 1JI1A 3MV9E 1OXYA 3N1PC 2V2XA 1U8HB 4GP4B 3K2UH 4PBVC 4S1SH 4MCMA 4E9WA 5IHHA 1KLFB 2WVUA 3OG6B 4D0DB 1USQA 2ZP0T 1WBYB 4QTIL 2DM7A 2PXYB 3Q6GL 3AJ7A 3GBNL 4K7PL 3L45A 3CVCA 1BM7A 1FWXA 1HKLL 5DZOA 2G3ZA 1G7QA 5IQ7L 4Z7OF 2J8UE 3R18A 4UM9B 3L8QA 1BEYL 3FCGA 4PB9L 1UOLA 1W2KT 4M1DL 2FZ3A 3ESPA 4V2BA 1NDMB 3X11B 4TL4A 2FX8H 4S1DC 1J11A 5EUOF 4Y2LA 4YSDA 1GGCL 2XWJB 5JO5A 2NR6A 5KYWB 1IGIH 3LMJL 3ZR6A 1GAFL 1D3CA 1ZVHA 4X7TB 3VH8G 4KJWD 4N2NA 3KWWA 1QACA 2OMWB 5JHLA 1G7LB 4LB8A 5ESQA 3HI6L 2CM6A 5FIEA 3REWB 1T5WB 5JW4R 3O41B 1IC0A 2GSGA 3DVGB 4LL1A 1EDYA 1FIEA 4Y2NA 3O3DB 2XKSA 3UO1L 4IOSA 2DQHL 3ZE1B 4PJ5A 5FV2A 4ODHL 3TT3H 4PCKA 3TZVB 1UUNA 1QBMH 4OT1H 4QO1A 4JLRB 2M1KA 2NY0C 4M1DH 4Z7WE 4S10A 4PWFA 2CJTA 3IAGC 1ZLSL 3F3HA 3QPQD 2QADD 3VI3B 3F84A 4BQBA 1R3HB 1QFOA 4NC1E 1CU4H 2VDLB 5ECJE 3HCVB 4IGBA 1CFQB 4LRNH 5I66B 5K9JL 3U4AA 3GJFB 4XP4H 3KPLB 1CT8B 2Q2LA 1BBDL 3F7YA 5I2IA 1KCUH 1FZJB 4H8PA 5DMJB 3RGVB 4RMUA 1BCIA 2ZAHA 3FU7A 5I1GH 4MMZB 4XB7A 5TJWK 3QI9C 3WNKA 2W9DL 1GS8A 1I3RA 4KUZH 2G60L 1DZBA 5HI3D 3UMNA 2DLTA 4NRZB 5FUCC 4ODTL 3FW6A 4YHKL 2R0WH 3T2PA 5LN4A 2A9ML 3I6GA 4BRJA 2WLNA 3PWNB 1J10A 2CNYA 4XN2A 5FK9A 3ZKMC 1SVBA 1SXBA 4OZGF 2I32A 4N2IA 5EIIG 5FHBH 2AHIA 4GRWE 4NRYA 3VFUB 3A0OA 3WIHH 4AITA 1EUTA 4UU9B 3IMWA 1I7UA 5J9PB 1LO4L 2GJ6D 3AS2A 5D1XE 1GTFA 5F7DA 1E3ZA 3OJ2C 2KQNA 4AJ0A 1RIVH 4F58H 1FL6B 4BH7A 4BWUA 3KE0A 1MREH 5AAPA 3ARGD 4G80B 1QFWL 1MLCB 3MV11 3CZNA 1SXNA 1URIA 4JRYD 2CBMA 4F37K 3ARDC 4HMCA 1S9KC 1R19A 1G9NC 1D9KC 4HJSA 3U7WL 2HN7A 4PLKC 3QE5A 4PBDA 2B2XL 2DQHH 2QGEA 4WENB 3UX9B 3EDEA 1HCVA 3QJRB 5ICZB 5I73B 2NY1C 1TDQA 1OOAA 4WUKL 4M6NH 5JPMB 1T4WA 3UAJA 4DN4H 2JWYA 4WI0B 1FV1B 1ZLVH 5F9WC 5E99H 1ADWA 4OAWB 5EUOE 2F1BA 3V6FB 4CDHA 1AD9A 1X7TA 4FXKA 1L0PA 5F93C 5CWSB 4E9LA 4K3EL 2X4NB 2IBBA 4PV9B 4FYTA 1C5BL 2YWYA 3HI6H 3NSYA 1UVQB 4I0KA 3TEUA 4WDIA 4LSUH 3TN0B 3F8UB 4HXBL 2Z31D 4XXCA 4MHHG 3EJZD 3KBHE 1D5XA 3LQAH 2FB4H 1QFWI 3NCJL 4XC3H 3DHPA 3KPOA 4C56A 4NP4H 2HFEA 4EZJA 4D9LH 5F3BA 3CHQA 4O4YL 5IFAH 3FUHA 2ZNXA 5T3ZE 2FVNA 3WTVA 2BY2A 3NPSC 2YBGA 1CDGA 3TBSA 3V95A 2VW4A 2YC1B 4YUEL 1ID5I 2EEDA 4I3SH 3U2SA 3HHRB 3SDXB 3I9GL 4FXKB 2JTDA 3QRFM 1BSIA 3KW7A 2ZXBA 3IMRA 3N43F 3OKKB 3L95A 1UB6A 5BS0E 3P1VA 3K81A 3QRBA 5HYIA 1U58A 1X5ZA 2P8MB 3H9SE 4NYLB 3VXSA 1HXMA 1MIEH 2F0CA 2VCOA 1T21B 4R9HA 3D0LA 3D30A 4LCIH 3A3YB 1H3PH 5FKAB 4OZFB 3BKYL 2A77L 1SM3H 3NN8B 1TEFA 3V0FA 2V8LA 1IVLA 3PRZA 2G30A 3EJCA 4DP5X 5IVNA 1JWUA 2R83A 1KENL 2HPTA 4UU9A 2YN5A 3MGOB 4HJJH 4ZFOL 4KZEH 3MRMB 4PJ9C 1AD9B 2LLLA 3O2VL 3APMA 3D85A 4AL8L 4UINH 5LBVA 2KZ1B 4KRPC 3I02A 5I19L 1MAMH 1NA8A 3FTXA 4AM0B 1HQRB 3T4YA 5TDOB 3MV01 1GCFA 3ZTJH 1CFTB 1WK0A 3MJ9L 1S7WB 1NLDL 5FM5M 1G7JA 4GUPB 3SOTA 2CH8A 4MNGE 2VN3A 3CHXA 2WXHA 2A6IA 3NJVA 1J1PH 1TQBC 5DR5L 5AZUA 2EIEA 3T3ME 4AQEA 3BPNB 2A0LD 2AXWA 1IAIL 5DS8A 4MAYC 3VO0A 1V10A 5B3SB 4Y1AD 3E2HC 1D5MB 3F12B 4M02A 3DJZA 3CFUA 5GGUB 1TEYA 5J3HC 1DANT 1AQKL 4FQXD 1GYVA 3UFIA 1CG9A 1BLIA 4QCIA 2PCFA 1KWKA 2I9LA 3ESOA 4XPAH 5D7IB 5BZDB 1E50A 2CLZB 2EH7H 1HXMB 3HMWH 3LQAC 3OVUB 4F20A 4R8WL 3FTWA 1WEJL 3MMEB 3LX9A 2F19L 4BQ6A 4NQCE 1S7RA 4OB5L 5JPNC 1KCRH 5C8JB 4HISA 3QQDB 5I0XA 4FN0A 1MCDA 1OCZB 2YD3A 3T6WA 5F1KC 4RZCA 3FPYA 2Z35A 2ZF9A 3VYPA 4HOXA 1UC6A 1GW6A 2N0KA 3J27A 1JHKL 1JPST 1KLUA 3TCXA 4K23L 1XSIA 5C6TH 1JV5A 1FZOB 1HSAB 3TNNB 1LE9B 1W91A 2BSTB 3LS5H 1NJ9B 2GT9B 4UILH 1FE8H 2X4TA 4FD0A 4Z23A 2CSPA 5AOKA 3LVEA 3HMWL 2WQSA 1Z3RA 2VZ1A 5TTRA 4DQOL 4I3RL 4KK6C 5ITFB 5HYSB 2IEPA 2C26A 2A73A 4FKKA 4RGNE 1GA2A 5IBUG 4Y8AA 5KJ7E 3D0AA 1HHKB 4Y7MA 3MGAA 1MQKL 2AXGB 1XF2B 1N19A 2YSTA 5JMRA 3LRLA 3MXWH 3K7UA 2I25N 5LCVL 3U7YL 3GRBA 4QRPE 2AW2A 2ZXDA 1UFUA 3IJSB 4NNYB 1MCSA 2ZJSL 3W3BA 2N56A 1ASPA 2B3IA 2Y2WA 5IVXE 2W07B 3FT9A 1LJMA 4H26A 2MOVA 2BS71 3S3CB 2Q8AH 5D2LE 3Q0HA 3FOLB 3LQMA 3BP6A 4PM1A 1JF1A 4KXAA 3VXUD 2IG2H 1UM5L 3CH1A 2AQSA 4Y7OC 3BWUF 4BDVA 1S7QB 2XX1A 4PJ9D 2ADIA 3RIAK 5CFAA 2J8OA 2PF6A 4Q9QL 5I1IH 2X2YA 5IESL 1YAZA 4U49A 2P80A 3H56A 7FABL 5GS0H 3EG9B 4UT7H 4LCWD 1KN2H 5IKCB 1JL8A 2NQCA 4NUGL 3P4MA 4KJYA 5T3ZH 2VZSA 3MFGB 5MEQA 1HL4A 1BWMA 1UB5A 2NQDA 5GJTH 1FFNB 4MQXC 1YNTF 2OXHB 1M6OA 1J86A 3PPEA 2H47C 1U8OA 1JXFA 5C0BD 2QVMA 4MXQD 3WEBA 3V4LA 4KRMB 3QXVA 1CFQA 5FYJU 1Z9PA 1ZVSA 4WWKD 1WTLA 3QQ3B 2UZIL 4J1UB 4IJ3C 2H6UA 2HLFD 4QXTB 1CLVA 1L9MA 3BEWB 4K3HA 4AUUA 1FAIL 1HAWA 4HPYH 1XZ0B 2YD9A 1T03H 5EOQH 1HHKA 2LQRA 5L8LB 1UCTA 3NAAL 4JRXA 3QXTA 1C1EH 4TL5A 1AYRA 1MN4A 2H0EA 3KW8A 3VSVA 5KSAC 2BRQA 2W9LA 4E41D 4LCCA 3CX5K 2DJMA 4CVXB 3AXLB 4XB8A 2G5BB 1CI5A 3DIFB 2CDFA 3MRGA 4Y19B 5DZPA 1I3GH 2A83A 2ALWA 2EDFA 1S4IA 3EXLA 4WV1B 2DQEL 2OKMA 3C09C 2YZ1A 1KCLA 4P2YA 5L8JB 4HALA 5LHDA 2HVKA 1ET5A 4JFDE 4PJCF 1KIPB 5BXFA 1JCVA 4H1LB 3GJEA 1TZIA 2ENQA 2DMGA 4JVWA 4TOYL 3B2DC 3QJZA 1EHKB 1VEOA 1KGWA 1ZSDA 2NXYD 2VT0A 2WXKA 3GSVA 4NKDB 3KVPA 4LVNB 1L3WA 4OCRL 4OVUA 5F89A 2Y24A 1H19A 2X88A 3HI1A 2DQCL 2JCCE 1OSZA 3PDGA 1F1DA 1EEQA 1VZIA 4DSYA 2EINB 1NCCL 1R3LA 4HX1B 1D5IH 1RZ7H 2AJSL 3FC8A 3W82A 1A6TB 3BWAB 2VDML 1P4IL 2VXUL 4U0RC 5CGTA 1NCWH 3IJ9A 1RL1A 2ZF8A 3C87A 2WXQA 3ZRCC 3LZLA 2GIMA 3EZ8A 5FA4B 3D1MC 4G6ML 1X9LA 3TBVB 5KJRH 3FQRB 2FLMA 2G2RA 3CHSA 5CIPA 5ITBH 4ALAC 5AW6B 4POZD 4ZMYA 1MFEH 1J5HA 4HZLB 3AWGA 4MJIE 3BMWA 4FE9A 5SWSD 4LCIL 4HJEA 3AGWA 1F58H 3GRWL 3W81A 2ZG1A 2BFVL 3T3PB 1KPUA 2UXGA 1SLXA 4M29A 2OMXB 3FUNA 2HB0A 2VRKA 3EYFA 4HS3A 1WT5C 3TEZA 1YEEL 4EIZC 1JTPA 2EC8A 3KR3H 3L4WA 3PABB 5E7FA 1PD6A 2Q5BA 3U0PB 2AEWA 3O11B 4XN8A 5CWSA 2HKHL 3BAEL 5IHZB 3TO4C 2C7UB 1HTYA 4LRNL 3EAKA 4EUPA 4P9MH 3JV6B 4XVJH 2A38A 1HHHA 3FN9A 3LDBB 4JPVH 4F3FA 2OAAA 2O6CA 2WXRA 4Z7NE 2KL6A 1ACYH 2BSSA 2F53E 1OB0A 4ERSH 2Y1VA 2I5YL 5KUMA 5I1HH 4ETQA 1X9RA 3HMXA 5MHSE 1T2QH 2WYZA 4RVBA 5DJ8B 5KG9A 2W95A 4Z78B 2R69L 4XPHH 1L6ZA 4XVUD 1ADQL 1BQHA 2X4QB 3N2JA 3D05A 1FZMB 2VLMD 4UZSA 4MWFA 1NBVH 3R06A 2Q87A 2VR7A 3BIBX 1AGFA 1B4JL 5MEPB 1FBIL 1DSFH 3CG8A 3MV8A 4QOKB 3U1PA 4BSWB 3WO3B 2X10A 4ZUWA 4QRQB 4RFOH 3WD5L 3VD0A 4JCLA 2JJSA 3TVMB 5KVEE 3Q2VA 4ES9A 5H94A 1QSEB 2CO6A 1FGNH 3O45B 4GKZB 1O5DT 4OFKA 3QWRD 4Z5RB 2CUMA 5LUMA 3LZFH 2XZAH 1QFWH 2CLZA 2CHXA 4HEPA 4ZD3L 5DHDA 4ODVL 3JWNG 3OB0K 2LGNA 4TUOA 2C9RA 3F7KA 4XXWC 3IPEA 1BGXH 1J48A 2O1AA 4L8CB 4R5XA 1KPRA 3ML9A 3WFZA 2GJZB 3L2MA 4KKPA 2VO5A 4B96A 3MUHL 1OGAE 1Z9MA 2EDJA 3CHRA 2AQNA 1ODUA 4HULB 3MYJA 3P0VH 4PJ8A 1QPXA 4JFQA 4XX1G 2FH8A 4YUEH 2X1WL 4D3CH 1A7RL 4NZDA 1N59B 3Q5YA 4G8IA 2FX9L 4GRLD 3NCFB 5IR1A 4HCRL 3RWGA 2XA8H 5DHMC 4MVBC 3QISA 1T83C 2NZIA 5BRZB 3K6SA 1KYFA 1T20A 2I26N 5BV7L 2YEZB 1I75A 1RV6X 2R9HC 2Y1AA 1RH8A 2NCMA 1WZMA 3FBQA 3QDJE 1JFQH 4XC3L 4E41E 5ISZD 3WEOA 4XC1L 1OTTC 2R56H 2H1LM 4JG0H 5EBLB 1P5UC 4L8CA 4OGAC 4POYA 7PCYA 1A9BA 4N1EA 2DLIA 2IDTA 4YXKH 5JW4Q 2XNAB 1FG2B 1J9SA 3CZFB 4XNAA 1ND0B 4TNVK 1YY9C 2Y36L 1FORL 4IGBB 1G9NH 1SY6L 1GYWA 3FSZA 3DV4B 5I1LB 1OT4A 1UA7A 1YECL 4OU3A 4P9HL 1I53A 3O9WA 3N91A 1MCEA 1NMBL 3CZLA 3SO3B 2RJMA 3X1NA 4CVZB 3MJ9H 2O5ZL 4I18B 5ERWA 4HJ0D 2IH8A 5J3HD 4WU7A 3S37L 2V9UA 1VPOL 1ZS8A 1UACH 2GUYA 3MNWA 4X4MA 3VXRB 3V52L 2FGWH 2WW8A 1MVFA 1UASA 4LLYA 5IQNA 4EN3C 1YMME 4U6VH 5KBLA 1C5CL 5I6MA 5GRUL 1OOWA 3TYGL 5AB2A 3GBEA 5EH1A 3KPQB 4GO8A 2X4RA 3I85A 4P4RA 1T04B 3OLEA 4R4FL 5DJYB 1UUSA 2HFFB 4YDJA 5BS0B 2Y3AA 3NRPA 1IILE 1I1FA 2TSBA 1MAJA 4YQXL 2CRZA 3WFCH 3CXHJ 1LEGB 1LO5B 3MRNB 4KX9A 4OZHF 5AZ2H 3VD1A 4HWNA 4IK7A 1RFDL 1S2EA 3UPAA 4GLRH 1L9QA 2HAZA 5I74B 4U6XB 1O9ZA 2J56A 3U0WL 3ARDA 5DJ0B 2BPBA 4LIQE 4QF1B 5FYKE 2FQFA 2W81C 4WI0A 1CLZL 3ZYOA 3UJJL 4QXGL 5EWIH 4KI5D 5KVFH 2A6DB 4JPWL 1JYXA 1NGXA 2VDNL 2VSMB 3Q8FA 4Y89A 3RUGB 4Y2OA 3VRJB 1JWSA 1TJHL 2HN7B 4P2RD 4ODTH 4PR5A 3AXLA 2G60H 3FH7A 3OB8A 2MMXA 1EJOL 4W9HC 1DBML 5DXWA 3ZDYF 5BO1H 4FLRA 1ILUA 1XCWA 3IDGA 3F6IA 1AZBA 2C1OB 1F13A 4FLHA 4H25B 5EIVA 3ZTEA 4JDZB 3K6NA 2OMWA 1PIGA 1MNUL 3NCMA 4YBLC 5GSVB 4YDKH 5CJOL 1U3JA 4PGBB 5C07B 3ZL2A 1HINL 5DUJA 3ZE1F 1RPKA 1ES0A 3KJ4C 2OYLA 4Z7WF 4PWKA 4J3XA 1B9ZA 1DHKA 2YPKA 1T66C 1MSPA 4QO1B 4BH8A 1SBBA 2XVGA 3BO8B 4GSQA 3CMOL 1BQRA 4GKNB 3ATFA 4BSJA 4UTBH 2OR7A 2OJEB 4K5MA 3DTUB 1DBBH 3PWJB 5HDBF 2X12A 3FRUA 4JUTA 4PJ5D 1OCOB 4YFEA 3S35X 3IDUA 4L0PB 4N68A 3DURB 4Y2DA 3OSVA 5EC2A 4P46D 3HCVA 5I66A 1FDLH 4MNQB 3SYPA 3HG1A 3LB6D 4XCEA 5C7ZA 1FGVL 2R56L 5AOJA 2R15A 4MQXD 1A6AA 4GAFB 5F7YC 4RIRA 3UTOA 2QHLA 4HEME 3PAYA 1UWGH 1PG7H 1IAKA 1GMIA 4G5AA 3K2UL 3MJGX 4S1SL 3UAFA 4Y19E 4OKVA 5KVFL 2ARWA 2YQ2A 5CBEB 4JDVB 2LU7A 1YC7A 2DKMA 3ABKB 2OMNA 4OZGB 1HKLH 4ZTPL 1WIUA 4PCTA 5JA8B 3UJIL 4KH9A 2GJRA 1UM4H 1HI6A 3JWDH 2IH1A 3BDYL 4JFYA 4R5VA 4NQEE 1A4JA 3QZPA 4ODVH 3LN4A 1NEZA 3NT0A 4KKBC 3LD8B 4MZIA 4E5XB 2B20A 1PLGL 1EVTC 1C08B 4J4PC 4JY5L 2EIDA 2WQ8A 1ZANH 3ZXAC 5CP3A 5EPMB 5GRUH 1Q94B 1FYTA 4JE0A 4D9RD 4EIGB 1M2VA 4X6CB 1EEYA 2WN3A 3OKOA 4PI2A 3SODB 1XFPA 4NM4L 5FKPA 4LU5L 4TUJB 3QEGL 2FWOB 3VFWA 1A7PH 1MFVA 4BKLB 3VFVB 1UM6H 5LVEA 1N4XL 5HD8D 4X4KA 4G42A 2XY2A 1EBPA 4AENA 1ED3A 5EO0A 3UAJD 2FX7H 4GEJA 3Q2NA 4CVXA 4X99B 3ZE1E 2ZP9A 1DQIA 4FQCL 2R1WA 3BCDA 2H0FA 4OF5A 3KPOB 4U2YA 1RJLB 2YD4A 3EBGA 5F96L 2CLVA 1A5FH 3LZNA 4U05A 3VM7A 2CU9A 3I2CH 4GS7C 2V5MA 4L8BB 2J1ZA 5GZOC 3NESA 4M6AA 4JFOB 3NAAH 1Z32X 3DVFA 3KXFA 4QRBA 4H0IA 5HDLA 3IWVA 3EFOB 2CIIB 2GY5A 4WVRA 3N44B 3EW3B 1UVQA 2X09A 4J3OG 3TN0A 4PN6A 4D0BB 1PJ9A 4LBEA 2BDNL 4YK4B 1PKQE 1F02I 1CGSH 3CLEH 4HWEL 3VQ1C 4P5TA 3CFQA 2IAMA 4P2RB 2FQDA 5AD0A 5C09B 1R47A 1T66D 2WAHA 3JVGA 4HCRH 2X70B 5DT1L 4B0MB 3D39B 3QULB 3CSTA 3BSGA 1KJ3H 3MLXH 4LEXH 3SJVE 3KD4A 1FNAA 2W1NA 3ARXA 2IPUG 4NS0A 5DEZA 1DQTA 1S78C 3FRPB 1AIFA 1I7TB 2ICEC 4ECNA 1K9TA 5C07A 1E2VA 2ZCKH 3WL9A 1IZKA 4N2HA 1ONQB 3AT0A 2AK1L 2VQ1A 2Z93A 1SDDA 4L9DA 5BJTB 3QORC 1YVLA 2IBGA 2AERT 4ZFZB 3U9UB 1YQ2A 1H6EA 3CFJA 2YSSA 3HNSL 2VDMH 4N0YL 4APXB 4RBPH 4OZFA 2BVOA 3C8KB 4NERA 5CMAB 4O9HH 2FUTA 3ZR5A 2R8SL 1AXTH 2BNRB 2ICWB 1ZGLM 3D85D 3KYAA 3LIUA 5C0DB 3U1SH 3LEVH 2LAAA 4JQXA 1A7QH 3L6FA 2GPZA 3QNXB 1A9BB 1TMCB 4L9LC 4XWOC 3DA0A 4KRLB 1MQKH 4G5ZL 1FH5L 2KLTA 1ZDSA 3UC0H 4PMFA 1J5CA 3RWCB 2DOCA 3OAYK 3QEQB 1JVOA 4PBXA 4ZMOA 5DU7A 3QPKA 1J8HD 1Y6NR 1UCBH 1QSFE 1RURL 2ADFL 2CR3A 3NSXA 4JPVL 5FUOH 5BVPL 3HJEA 3RILA 4EZMA 1KGCE 4UILL 4XBGB 4AK1A 2VABB 1B0WA 2NY5C 2JB6B 2NDFA 3MRDB 4PIBA 5LQBL 5CD3B 2A4EA 2Q76A 3LZPA 4FERA 5GHWL 1J5OL 1E2WA 2DS4A 3AVEA 3GB7A 2DYSB 4EOWH 4MXVE 3ZRSA 5LGHL 3V0EA 3DTXA 3FB7A 2NW2B 5D93C 2EADA 1P4UA 5FM4A 4IBUA 4LOVA 2XWBB 4HCFA 4BXSV 3HPJB 3C5ZC 2BIPA 2VJ8A 5LBGA 1JZ7A 2XBZA 4Z5RA 3T2OA 4ZG1A 5HGGS 5KYWA 3ZSTA 5IB4B 5CMAA 3L3OB 4KNQA 4OLZL 3GXIA 1IGMH 4XGZB 3UDWA 3RVTD 4L37B 4W93A 2NTFB 1GY1A 3CX5J 4ATWA 1PQZA 2J6WA 2O26U 4I2XA 3Q05A 1GGIH 3L7FB 2K6YA 5GZND 3MODH 3OG4B 5KUKA 2YPLD 3QIWB 1GYAA 4AYDC 1BXXA 1VADB 3VA2C 4AQ1A 1UT1A 4DQAA 3NBNA 4YDLB 2OK0H 4IKIA 2MIZA 1D7CA 4RCAA 3KPLA 4FZEH 1NFDA 4C47A 4I77L 3L9RB 3UROR 2BNRA 2ZTBA 4LLAA 2XWTA 4U1GC 1S5IH 3EH4B 3VI3A 1EO8H 1H5BB 3FQUA 2HTLC 4D8PB 5F6HJ 1BXAA 4HFUL 5JNYB 2MCPH 1RZGB 1JD9A 2H0PA 3H9ZA 4EPSA 3G6DL 5F9JB 4K3JH 1E5CA 3ECBB 3QUMA 4OCXH 4D0BA 3OR6B 3L9BA 2AK4A 5AYTA 3WI9A 3UDWC 2OL3L 3HLAA 5L88L 2A2QT 4CN4A 2X6VA 3Q1SH 3TBTB 4BKSC 4Z7QB 5HYEA 1FNEA 3VXUA 2X3BA 2VXSH 2MHAA 2Y06H 1NFKA 2JIXD 1CBVL 1I31A 2AV1B 1C9SA 2NXZD 5H2BA 4LLUB 1VEMA 2VAJA 3A4FA 1OL0A 3RPIB 2BWQA 4R6UA 4HIHA 4W9IC 4A55A 1VFMA 1MH5B 3HNVL 1BQKA 5I1EH 5I17B 4XNYL 1JZGA 1UM4L 2ZWKA 4F9LA 3OGCB 4MWFB 3MR9B 2FBJH 1SMOA 3IE4A 3VFSA 3K46A 4JFEA 2NY2B 4HUVB 5C0EA 1OT2A 1J9CT 1C8PA 1JHLH 2HA1A 3LRSB 2LLNA 5FYKH 5C86A 3DOSB 5FUZL 3S36H 3MV9B 1IIKA 3HN3A 3NZHH 2J1KA 1NDMA 2Z0BA 4O2CB 3KLLA 1V7MH 4JFFE 3RIFF 5F7WC 1GRWA 2GBTA 3N0AA 4OFYD 5E1QA 1EV2E 5CZKA 3ML8A 3RGBA 5EZOH 4XNUH 1MY7A 1YJDL 1KBVA 1KBGH 3RAJH 1PZ2A 4BWWA 5SWQB 1KIPA 4EZLA 3WXVL 1FZKA 3V5KA 4RWYL 2NZ9D 1HNYA 1SQMA 2Y22A 2Y7LA 5A43C 1LEIA 4N0CD 4NOBA 2HJLA 3ORJA 4JFPA 3F62A 3CUPA 4TLTA 4F57H 3ZMEA 4LOUD 5CXPA 5CZRA 4YHPB 2NPLX 5EPMA 5H4YA 4EEEA 4NJAH 1NKRA 2APWA 4KTDH 4Y1SA 5K1VA 4FZEL 4Q6IC 2LFGA 3AB0C 4GW5B 2EDWA 3WMQA 3QWOA 3NACH 1WG3A 2F61A 3T1FB 4GINA 4QTHA 1NDGA 2DQJH 3MLPA 2BNQE 4J1UA 4QXTA 1KENH 3PAZA 4Y5VA 3PXJA 1XQ4A 1TTRA 1QI5A 3G6JF 1PNDA 1CFSA 3LKRB 3QIBB 4PMEA 4XB3A 4QT5B 4UOZA 3RL2B 5GGSA 4IRZA 4X99A 2E4FA 4M8QB 4X5WB 5AD0B 2DBLL 2I7OA 3ARED 4JJHA 3ESVF 3T3PE 4NZUL 1CICD 4HIEA 3D12B 4H20L 3JVFC 5CR8A 3ZE2E 4GW5A 3X11A 1MW3A 5F71A 5E6ZA 1X5JA 4AY0A 2C3VA 3HJ0A 4B9KC 3VYOA 3CDGA 3V5HB 3WTTA 2OL3B 4XMLL 3RJDA 2H1XA 2R39A 2H41A 1ZLEA 3WL9B 3VNYA 5CEYB 5HVGB 5GSVA 3NA9L 1J8SA 1MCLA 1PX8A 2NYZA 4N0UE 2CUAA 4CMMB 2DQFB 1RP9A 1UXMA 4ZOAA 1JI2A 4QWWD 4CBZA 3KLDA 3CFKB 3SYQA 1BYPA 5T5FH 4M7KL 4DEWA 1G4MA 5LNGA 3HE6A 4Q8BA 2FT6A 5F6HI 1ZHLA 2MNWA 5CF3A 5ERWB 2G5RA 4YSRA 3QHZH 4ENED 1E0OB 3GBML 3LEXA 5IROA 4LSUL 1N64H 2CO2A 4JM2C 1G5GA 3F64A 1JHTB 1TITA 1P4LB 1RIHL 3FUEA 2C9XA 1SDAB 2OR9H 5I16B 3VX0A 1U8KB 2GAZA 2ZONA 2DRUA 5EUOA 1O6SB 1CFMA 1DBBL 1TVBA 3O81A 2DTMH 3IE9A 4ZW8A 3PHSA 1MVUA 3R1GH 5DI8B 3CFEB 4WNJA 1CI3M 3RVXC 5DUBA 2X2HA 4MNGB 3ARBC 1L6PA 3M8OL 4J3OC 1EJOH 2UY7A 3GSXB 3FT3B 4FQ2L 4HHAA 1EHLH 1PEZA 2VH5L 4BM7A 2Y4SA 1HILA 1LK3L 5FA3B 1A3ZA 2QR0B 1DJZA 1OAUL 3WUWB 2NY5H 2PTTB 4HUUB 4NP9A 3FAXA 5EFIB 1ZT7B 2RD0A 4OUUA 3CZSA 4UUJB 5ALBL 4AT6A 2GT9A 2KERA 4YDKL 2QZQA 4HIXH 4LHUA 4H5SA 4APQC 1FO0L 2WYIA 3E9TA 4OTXL 2BJMH 1UQSA 4Z7OB 5D1QC 2NSXA 2FIKA 3Q6GH 4I85A 3UMTA 1CDJA 2QPFA 3QO1A 4YE0A 2DICA 3U46B 4BKTC 1JZEA 3OR7A 1SOSA 4JZOA 2WTPA 4YDZA 3DMMB 4O2CA 1CUOA 3QDMA 1V27A 3PYCA 3MUGB 4J28A 5H37G 4NFBA 2VDRL 2MNJB 2QQLL 2OLDA 1NOAA 4NZRH 4R26L 1GOHA 3BGAA 2OL3A 2X5PA 4R2GC 1MUJB 4UNUA 3BN3B 3BQVA 3JV0A 3ELQA 1OP5H 4GXUN 3DRTA 5EZLA 5E2VL 4GMTL 4ONHA 2DWTA 1PY0A 2MJWA 3ABMB 4NX0A 2WWKO 4RBPK 1RUMH 1IJ9A 5FF6A 5C0AB 2H45A 2UVEA 4P5MB 1NOFA 1ZWIA 5EZJA 3TT1H 4XGZA 4M48H 4OZIA 3UTTB 1E9PA 1E4WL 4PJIB 1ZPLA 2CBQA 3WJLA 1X5HA 1YEIL 3HG1B 2R2BA 4GMSH 5C0ND 3S37H 4NO3A 4DIXA 4WV1C 3W11C 4OQTH 1EAQA 1U8CB 3FFCA 2ADJA 2AAVA 2FD6H 4K5NA 4XCYA 2WXPA 3T08A 4DVBA 2UWEF 3K6SB 3QHFH 3TEYA 3I6LE 1KDJA 2IV9A 3L48A 3SE4A 4OZHB 1Z0NA 3BX7C 3HC4H 3WJJC 2UV3A 4F15B 3RG1C 1JYWA 3VWJC 2V5TA 1CDHA 3O8XD 2B9BA 2B4CH 4K71B 3GMPB 1WPCA 3CFMA 4Z0XA 1CXLA 2VLRE 4M9PA 2B59B 5DZ9A 2FBRA 2XQYG 4LVHB 5D2NE 3CZFA 5D96B 3VXMB 1IM3D 4M93B 1SUJA 1OSPL 4KKCC 4NAQA 5SX4I 4PJDA 3FHAA 4N9GA 4R26H 4K73A 4HUVA 4B5ZA 4XP9L 4DP8X 4ZDHA 1JK9B 2WQXA 5ACLA 1JZJA 2P5ED 5I1GL 1RJZB 5F9OL 3AM8C 4P5MA 3VGAB 5DQDH 4W9EC 5EBGA 2H2SC 2YA0A 4AK2A 1SLVA 3EOBB 3H55A 2DEXX 3FJTA 3UEZA 1ID2A 3SSGA 4PVNA 4QF1A 3AMLA 3VFVA 2DMBA 2Z8VC 3HZVB 3QIUC 2QMKA 2JJWA 4G6MH 1NFDE 4R0LB 4HA1A 1NBQA 3B1UA 3RTQD 4OF7A 3IFPB 1KXVA 1L9NA 2HUEA 1XIWC 2MHAB 3MHZA 2E7CA 3EHBC 4JHAL 3TO4D 4NDMA 4XMTA 1TQWA 4HZAA 3MUJA 3PL6D 4L4VB 4ODHH 1O9WA 3PDOA 1RJLA 3MRRA 2H3NB 4CL7A 5D6CA 3O3EB 4OJEH 2VDRB 3GS7A 1AE6L 2ICES 3AUVA 4D0CA 4DJMA 1TU2A 2F54A 1NGWB 4GXUM 3B7YA 3KPRD 4P4KA 4UDUA 43C9B 4HU8A 2FIKB 2NUTB 2CJUL 3DDFA 4QDGA 5C70A 1U8PB 2CNZA 4LCVA 2Q76B 5E08L 3KEHA 1TZGH 3PABA 5AVQB 3NIGE 1HVXA 3CVIL 1OALA 1A64A 1W0WB 3GSQB 2DW5A 4Y5YA 4J3VA 5D8JL 1OB1B 3HZ3A 4Y2DD 5ID1B 2X4PA 3T04D 4S1DD 5FGSA 1DEEA 1JZHA 5AKVA 1JDAA 4M5TA 3QJHB 4JFHD 3S3JA 4NCC1 3PQYA 3VMPA 4ANKA 3GI9L 4HT1H 4PU2A 5KVDH 5LG1A 4MJ5B 2NTFA 3BKMH 1IFGA 1GIGL 3SDDC 4Y9GA 2P5EA 1WFJA 2VXTH 3GMMB 2WV3A 3NDZE 4ILDA 1MXGA 2AEIT 1CF8L 2ORBL 3J8F7 2ZOWA 1YCSA 3QXDA 3VU1A 4QTFA 1GHFH 4JFFA 1XD1A 2CK0L 3V4VL 1WWAX 5LAXA 2AEQH 3QFJE 2ICWA 2WZ6A 4FZ8L 2IGLA 2VXSL 3HE6B 5DYOA 3WMSA 5J89A 2G5BA 2DQCH 2XG4B 2EACA 4ZD3H 3QPXL 4NNPL 3JTSB 4PB0H 1ZGLP 4FNLH 4G9DA 4GRLC 4XR8C 4BEIA 3GINA 1PG7W 3H9SB 1MJ7H 3AZUA 3BWUC 3E1F1 5E8NB 2VXQH 1AGFB 4NO5A 4D0CB 2J55A 2QDWA 4L1SA 5J7CC 3WKNA 4Z7AA 1V5JA 1FIGL 4JO5A 3TA3A 2F58L 1J1OH 4H1LA 4PJXB 1AZUA 4KPHH 2CJ3A 4WO4D 4BK5C 3OKLA 2FHCA 3OZKA 3WDJA 4I3GA 4PJAB 5I71B 2FUQA 5C0GB 5DC2A 2I07A 1CFBA 1NBVL 3G6DH 4ZMPA 3V5DB 3GXFA 3OB0H 4LOFA 3HHSA 4ISVB 2K45A 1YY8B 4XO9A 4KRPB 1WSST 4F7TB 1NUGA 1IEAA 3WGUB 1QRNE 4MA1B 4N4YB 5D7KD 1N0LA 1Q9KA 4EF3A 3TNMB 1ZD6A 1HS6A 1VAHA 1OTSD 1RLBA 4GAAA 4XI5D 3NG5A 4FQJH 5JORB 3V9EA 3KLHC 1JXJA 3AUWB 2VDKH 1YJDH 2XTJC 4GFTB 5TQ2H 4GAGL 3GEFA 2BC4B 4M4RB 4KBPA 1A1OA 4KH2A 1NGYB 2HT4C 1OP4A 4MS6A 3BGMA 1A3QA 1KUMA 4HGMA 1YN7B 4M5YL 4E9VA 1DBKH 3RDTA 5TE4L 4E42B 4HUNB 4OJCA 4D3CL 3CZJA 4HOWA 3LV3B 1JHLL 5FYKL 1GZPB 4I48A 2CM5A 2LE9A 3KPMA 3ARQA 1UQSB 2X2UA 1GGBL 1QFUH 3AAZA 3KPSD 2ZX8A 5IM7B 3WSQL 5ANHA 1KC5L 1X5KA 4N6RA 4JPKL 2CZNA 3CH1B 3MNZA 2XIIA 3LPGA 5CJ8A 5EEXA 3OR7B 2H2PC 3BDXA 4UOW1 3UAEA 5KBMA 1H6FA 3LZOA 3EJZC 1SUHA 4IOIA 2P5EE 4ZQTA 4NQDD 5D1QA 1UKQA 4PTTB 4DH2A 4HG4J 4OIBA 1TNMA 4MDIB 3MRLA 3S34H 3TN0C 1FGNL 1REIA 4LSPH 4MXWL 4AQEB 4BHUI 5I6XC 3WELA 1GMEA 5GS2H 1M6OB 2ADFH 3ECUA 1FFOB 2DIEA 4HF5L 4OUUB 3WD5H 2KDYA 4AT6B 3VI4E 4YDJB 5CP3H 2M8XA 3GKWH 4CKQA 5I76B 1BJ8A 2IG2L 3PAVA 3MREA 4NN7B 1NGPH 2XWJA 4OLUH 3PAUA 4JY4B 5JO5B 4ZSOA 5AVUB 1G1CA 1V3MA 2VITB 3C6LA 4LIQL 2OMBA 3ATDA 1P7BA 2E8ZA 2F53B 2NLJB 3X3FH 2EUVA 2PWDA 1Q0XH 1EFXD 3ARDB 1BF5A 4OW6A 3T6QC 5JOFB 4ZAKD 3CMGA 4LSSL 4OCYL 2APBA 2F5BL 3SCMC 4XVJL 2OSXA 5F89B 5TE7L 1YHPA 3C6EA 1JV5B 1Z5YD 3CFTA 3GC3A 4DCQA 2AJZA 4OZFG 5FDYA 3MRJA 3WFEL 2XQBL 3BP5A 5E70A 1P2CA 1XCTA 3CN4A 1R46A 2QTVA 4XWGH 3VXRE 1F1GA 3S8FB 4JY6B 3RWEB 4P2CG 3A67H 4N1HB 1IGFL 1NFIA 1T80A 3MRFA 3QXDB 4I1NB 3LKNB 2QFPA 1K5NB 1A9VA 4K07A 1KJ3L 1X5LA 3MLXL 3LIZH 1Z9OA 1ZLWH 4AJWA 5JOFA 4WJ5B 3HN8A 1CBVH 1XGYH 3D7PA 4HSCX 5I28A 1IBYA 3CFDA 5EN2A 2YEZA 1YMMD 2ODHA 1U95A 2ISDA 2EEFA 1I8IB 4NUGH 1OF2B 3LNEA 2L4OA 5I1EL 4JCWA 1LEKB 1JGVL 5AVYB 3VG0H 5IUSA 5J0BA 2H5UA 3L3GB 1J8RA 2VUYA 5HHOB 4HJ1A 1NWOA 4LPYA 2AEPL 4NPJA 4NZTH 1X5AA 2ZG2A 1MKFA 5CHNB 5LQBH 3OV6A 4XP6H 2WQVA 4NEHB 3JWNE 1OEZW 4HXAL 2Y6SC 5EU3A 3N55A 2DLEA 4AMXA 5JOPD 4KKZA 1HZHH 4PVMA 3QQ9D 3RWIB 5EMYA 3DX7B 3X3FL 1MW0A 4Z0BL 1XL6A 1FQ9C 4OF8A 1A14H 4BXVA 1FVCB 1T6WA 3A47A 2HRHA 1WISA 3P3SA 2XWCA 3L3KA 4UQ3A 3O4OB 4Q58C 3FT4A 3CU1A 4YGAB 4RGOL 2EXTA 2AVGA 4BELD 2YC1A 1G7PB 2GTQA 4PTUB 3HAEA 1BIIB 3PF2A 1A7QL 3GZOA 6FABL 3KCWA 4PY8I 2HFTA 1H5BA 2HFFA 1CB4A 1NPNA 3EH3B 3FCSA 1BFVL 1RJCA 2A74B 2A7BA 2J12B 2CQVA 5JW5A 3SBWA 1II4E 3S5ZA 4FAAB 1YMHB 4XBPA 1I8KA 5KYYA 3PQYB 1M7DA 2C3GA 3JV5A 1OLZA 2VZTA 4FA7B 4YEFA 1KCVH 1KN4H 3L3JA 5KS9F 3S96B 4Q56A 1L6XA 3MV8B 3QAZB 1R75A 4QOKA 4KZ0A 4ZMNA 1MY5A 1YMMA 4GP5B 4JM2A 3VJ6B 4FZ8H 5CEZL 2AV1A 1NGXB 3RUGA 4A6YL 2IBZX 4HJIA 4L0ZA 5FGBA 5GS1B 2H3NA 2F19H 3AT9A 4PIRF 4OKDA 5CP7B 3QUZB 3F7VB 3Q2WA 5I75C 2K1MA 3DJTA 5EU3B 5I1LA 3QB7C 2W9DH 3KBFA 3QIUD 1N59A 3HZYB 4OBRA 4GNKB 5CIPH 5LGHH 1KZYA 2ENJA 4RISH 5CLZA 2F7PA 3RVWC 1BYNA 1K8IA 4P23C 1X7QA 2F9BT 4YOKA 2XYCA 1UTDA 3SGJC 1JN6A 1U8NB 4WHYG 2E3VA 4DO6A 3QJUB 4MASA 4JDTH 3GXPA 5AOIA 3ZGHA 4O4YH 1WBXA 1S78D 2KI6A 3LRHA 5BV7B 4N22A 3KXFE 1S6NA 3K0YA 3ZKXB 2XY1A 5ALCL 5HJBA 3GT6A 4JG1L 3EOTL 1X5YA 2FLRT 4G6JL 2HJLB 4JFPB 2FEEL 4OF6A 3E6HA 2ZX7A 4NSKA 2JKTM 3K4ZA 5TDOA 4M9OA 3TM6A 4P48A 4UAOB 1MREL 3QH3A 3BIKA 2X38A 2FX7L 1JK8A 5FWRA 4K9JA 4RAUA 2HRGA 2QDVA 3ZKMD 4Q9CA 3S3BB 2WXFA 3MV7D 2Z64C 3HNTL 4G72B 4DGVL 2DI8A 2G2RB 2R29H 5CIPB 4BFBD 3ETSA 2QPDB 3ALPA 4M6NL 2OX5A 2WWNA 4U1MB 1MF2H 3RVVD 4EQ2A 4K0OA 3P4NA 4KZEL 1L7IL 4X4XB 5DQDL 1S46A 4N5EC 4KX7A 3LMJH 3AG3B 3LOWA 3T71A 3CFDB 3M1OA 3MRIA 4N0RA 4Y9FA 2OMUB 4BGDA 4U4IA 4D9QD 1G7JB 3GLEA 4GUPA 4EKXA 4WUUE 2O5XH 2MQ3A 1Z5LB 3CFCH 4YJZL 1JV2A 4WTQA 5E2UH 2Y69B 1BVLB 2EABA 1NCUA 2K9UA 3BDYH 4HLZG 3DI2B 4QXUH 1ZV2A 3G04A 5FYLE 4PRAB 2P8LA 1MIEL 1QR1B 2WGNB 4P4KB 4UDUB 1JDCA 2IADA 4PVBA 1QKZL 3WDIA 2A9AA 4OVVA 2GIXA 2V0AA 2J7LA 1QI4A 3PUCA 4L9LB 4U2ZA 4I1PA 4AJVA 1P6WA 2FECI 4JFXB 1DVZA 3KS0H 4NQDB 1JJUA 3SPJA 1JBJA 3GI9H 2YMXH 2M26A 4HT1L 1MQ8A 1UGKA 2IDCA 3TJHC 4OZIB 1C08A 2JE8A 2XN1A 4UNIA 1K85A 1XR9B 4KROD 4G1EB 4XAKD 3FU5A 4IOFC 2VWEC 4GRLA 1AQ8A 3FT4B 4UT6H 4IIZA 3FQWA 3FQYA 3NSCA 2PN5A 3QUZD 4FQQA 3BT2L 4XP4L 2HRPL 2H9GA 3ETBF 1VPOH 4BRVA 5CS7A 2DQ6A 5I16A 1ZKAA 4HMDA 3UPCA 2J88H 2PW2A 5ESQB 2AV7B 2W60A 5FHAH 3CZUB 1AE6H 1CXIA 1ERNA 1NL0H 5HDQH 4A2LA 1DL7L 4NGHH 5EORH 5F7EL 1J0KA 3OPZL 2WSPA 1HQ4A 4OZIF 3V10A 2WB7A 4FQXB 2P4AB 4IKKA 4WEEA 1NJ9A 1TQSA 1IAKB 3GMOB 5IEKB 4AV5A 4Z77B 4UCFA 5DK2A 4J2XA 1A7PL 3H6JA 4PREA 3PWPB 4QAMB 3H42L 4JZJA 4J3UA 4AXWB 3EYOB 4WY7L 1VFUA 4GMSL 3ULUD 4ODWA 5EIQA 1P53A 5J1SC 5AKRA 5AOLA 4JAMB 4ZXBC 3MRPB 2BNQB 3GSNL 4G1MA 1XDTT 1M05B 3LRKA 3QC5X 1H6UA 1NCHA 4LAQH 4PB0L 5D2LF 5KVGE 3SDCB 1CGVA 4EIUA 2NY7H 4MRBA 1NPJA 4H8VA 4MX7B 1V3JA 3HFML 7PAZA 5B3JF 5DFWH 2PCYA 4PGCA 2VLRD 5FEBA 3QUKB 1WIPA 3FPXA 2JJVA 4LL9A 1A7NL 4CW1B 4AQAA 3W9EB 3WLWC 4QRPB 3K8KA 3BESR 4FXGA 5F6IC 4X98A 2G75B 4AYID 3EYOA 3EYQC 3QDMD 1O6SA 1OSPH 4PJ7F 3L3GA 4X7TA 2WLIA 5BUGA 1M71B 1RFDH 2R69A 5DEFA 5D2LB 3PHOA 3QDJA 1K4DB 4EUPH 3GMQB 2WWMD 2Q6WA 5MENB 4LP5A 4B95C 5FF6B 4UDTA 4DTGH 1OT1A 3P2TA 3I3EA 4TRPL 3ZUNC 1UKTA 5J6GB 3P4MB 5SWZA 1EXUA 3W0WD 3QIBD 2QLVB 4LEOA 4TNFA 2XV2A 5M95B 3QDHA 5CJQL 1QBML 3TASA 3DARA 2DD8H 5HI4C 5E95B 4EBQL 3WN5A 5DMGC 3U36A 2EIBA 3VDBA 2ALAA 4JY6A 1TKWB 3Q8CA 4IRSC 2RCSL 4HS6A 5L7XL 4NKQB 4MJ2A 1Y6MR 6CGTA 1ET7A 4Q9BA 3TP4A 2J43A 5IJCC 4RZCB 2R69H 4GG6F 4HK3N 5DK0B 1DVFB 1RK0A 2P8PB 4AUYA 4BKLA 5IUCA 2YRLA 4A7GF 3NFNA 2YJQA 2DI9A 2PPFA 2OTPA 4YSAA 1KDIA 1MW1A 4X7EC 3QNYB 4GQ9H 2BP8A 4DGYH 3RWDA 1R0AH 4Q4IA 4Y16D 1UD3A 3KAAA 1FYTB 2A1WL 2CGZA 4KI5F 4UM8A 1OLLA 2ZD0A 3SO5A 3HVDA 2KC0A 5I17A 1QLEH 1CR9L 1B3JA 4M43H 3GMMA 1H3TA 3KPMB 4OLWL 4UT9L 2DD8L 4PJ7A 3W2DL 2XPYA 3U2SB 3NZ8B 1CTOA 3K4AA 3MQIA 4O02H 2AJXL 2NNRA 4BFOA 1RUAL 1AS6A 1JFQL 4EE2A 5HYSA 4MD4A 3RY6A 1MPAL 1F58L 3LN5A 3QQ4A 2KH2B 1K4DA 1KB5H 1FNSL 3KM1A 1NC4D 2P1YA 2A6IB 3IJHB 3QNZA 4AYFB 2X0VA 1BQHG 5IJDC 5IVXA 1F4WH 1UH3A 2H6PB 1W80A 2PW2B 2QELA 3QWOB 2E6JA 2WYHA 4XNYH 4P3CH 1P4IH 3HUJA 3P11L 3MRMA 3ROOA 1IKFH 1VFAA 1BAFH 4GSRA 4K9EC 4KX8A 4H8UA 4PLKD 3W5NA 4Q97A 1T5XA 1CDCA 5DRXB 4AKPA 4ELDA 2H6OA 2WBWB 4IIQC 3P2BA 4AL8C 1E8XA 4L4VA 4QRRA 4QWWC 4X7SH 5E1HB 4ZW7A 4ZW3A 3LH9A 3MJ9A 2QPEB 2ARJB 2XZQL 3DHJA 3IMUA 3OAZK 3QK0A 4ODWB 3I50H 2BP8B 4OIAA 2I69A 3EYVB 4HSQA 4AMKL 1DSFL 3S48A 5HPMA 3NIFE 1DVFC 1OP5K 4A1RA 1DO5A 1X5FA 3KPPA 3T5WA 3VTMA 1EBAA 4ZX6A 3SDXA 4ZAKB 2F7IA 2APXA 1NGQH 4IRSB 5KSAD 4Y16A 3B8YA 3FT0A 4MB1A 1R24A 3MRBA 4MB4A 4JZNA 3MRIB 1T4KA 2P8MA 3VXSB 5BZDA 2EVGA 1BPVA 1CD1A 3BAIA 1Q4NX 4P9ML 2EYSA 4G7YH 1FNHA 3UZVA 4TQIA 2G9KA 3QZOA 4WW2C 3SD2A 4LMQE 4P3DB 2WSKA 2WWKT 4EN3B 2MCMA 4CN6A 3FU8A 4M8RA 2RALA 4NC1C 1DP0A 2VMFA 3H85A 1MWAA 5G2NA 2XCMC 5BMFH 1NQBA 5CGMA 1OE2A 1PD1A 2Y6TE 1PY4A 5JXEC 1RCYA 2Z0UA 3TEWA 2VIRA 3MLZH 5HYFA 5D2NB 4WNSA 4AYEC 4PWEA 5ID1A 3KXFD 1A7OL 2XKUA 1DFBH 2VZUA 3KVDD 1D5XB 1IAOA 4JFQB 2WKOA 3GK8L 3FTUA 4BFNA 3GUTB 3ZMRA 2PXYD 2NSQA 1NKGA 2DWEB 3ARBB 1BA9A 3H9SD 4LGPB 4EO5A 5IR1B 1S7TB 2MTAA 3D4CA 5CZVH 3DOHA 4R96A 4Q9QH 3Q06A 1CGXA 4JFFD 1N5AB 3BVUA 4MNQE 4WJG3 2NUTA 2D7TH 4PRDA 4DGUA 3B6SA 3II3A 2D3JA 2IWEA 2YFOA 3TOPA 2DQJL 2ZOTA 5CUSL 1IV8A 3G3LA 3VWKC 4MJID 1QLRA 5H35A 2N1TE 2PKDA 5JW4M 4AGOA 35C8H 4I9XA 3GFUA 1TO4A 4LLYB 3X3GH 1BOGA 2RMNA 5DHYB 4YSCA 1CG9B 1FHGA 1GGUA 5LXGH 1S5HA 4OSUH 5FUOL 3M8OH 5BVPH 1EANA 5SV4A 1OTSC 4XI5C 5FB8A 5GRXG 5IW6B 3ABLB 3EOTH 3G5ZA 4RFOL 4FTDA 2XTJD 5AEAA 4GI6A 3UBXA 5EG6C 1IL1A 3U30C 1LP9B 4NENA 4PRDB 3PJNA 4N5ED 1H9DA 1QI3A 1AH1A 1NIFA 4P3DA 5EOTB 2IFFH 3BAXA 4U3SA 4IRJC 3FB6A 3H3PH 4FMKA 5IB5B 4LLWA 3DLQR 1JYVA 1CC3A 1UWEL 3FYEB 4WHTB 3EBAA 1KIQB 3N41B 4WTZG 3T77A 3IFLL 1ETJA 4G6JH 3QI9A 2AXJA 5TD4A 5AOZA 5T5FL 5F0PB 4GYBA 2VM9A 1G87A 3GQFA 5B39G 2A9DA 2ZXAA 2BSSB 3BLBA 5MI0B 2IQ9L 3OMNB 4LESA 3RX5A 1JVKA 1N2RA 3UH8A 4YDNA 5DRZA 1GGIL 2FBJL 2W59A 1CZ8L 2C4XA 4MHHI 5CD5D 1FVCA 2WB1A 2PXYA 2PETA 5D2NA 5T1DH 5GGVL 5IJVA 4PJ8C 4MLSA 2B5IB 4Y5XC 1UD2A 2Q9OA 5ETUA 1SGKA 3BKJL 1K2DA 1MXDA 4ZXBA 3RGVC 1MHHB 1P4BH 3VDCA 32C2B 5INCA 3U48A 3RWCA 3BN9D 2BIMA 1U3YA 4JB9L 2DLFH 3QZBA 4MMZA 1OARH 1IVTA 3GGWB 5GGTA 5DSCA 4U3HA 3MTRA 2OSLB 2XN9D 5A2JH 1VKXA 5A16B 3WYRA 4X5LA 1WCQA 4DP0X 3FXIC 4L5FE 4Z8FL 3P30L 3U7AA 4R7LA 4LCWE 3NK3A 3DURA 4Y2DB 5EC2B 4LCCC 3K5SA 5EEZA 1NCOA 3SCMD 3JXAA 4XPTL 4XPBL 2HLEB 4Y9CA 3MRLB 3B5HA 1S3RA 1KOAA 3PPSA 2J4WL 4LSSH 3V6ZB 4PJIE 1HHHB 1OGSA 2NW2A 2DQUH 1R3LB 1HILB 5FA3A 2DJSA 2EXSA 3L7EB 2EO1A 5IJBC 1WF5A 3V0AC 4CC1A 4H5SB 1IKNC 1RUPH 4K3DL 2MQ0A 1OM3H 4N2LA 2VE6A 4KK9D 1UD4A 1O0VA 1SDYA 3CDYA 3LHPL 3MJ7A 2L7QA 2F15A 4A2DA 1YY9D 3PY9A 1DBAH 5DVMA 3S5LG 1FO0A 3WG7B 4OF3A 3II1A 4J6IA 4PJFF 2F2HA 5B7EA 4LXFA 1QAWA 3ZW3A 4F7MB 3SQBB 3V4PH 2BZCA 5KS9A 3R7RA 1CDYA 1OCCB 2FEDC 4HGKC 4W9GC 1ZHLB 2YAEA 3QNZB 4JO4L 5T3XL 2XQ0A 4NBXB 3BISA 3QYCA 3PWNA 5E8DH 1BJ1H 2CO7B 1RJYB 3INOA 3L5XL 4MB3A 4OCSH 4YHOL 4DPAX 1DQVA 1OAYH 3QFDA 1A3RH 5D7EA 2DY2A 2XQBH 3C6SB 3NEOA 3Q43A 4G8EB 4HP5A 3L1EA 4LDEB 1B6DA 2EXWD 2X7LB 3QQ3A 2VDPB 4PP1C 1NSNH 1AXIB 4ZMXA 4H8WC 4OGZA 1S7VB 2W80C 4P2AA 1WTGT 3DX1A 5DUBB 3QFJA 3K1KC 4CSSA 5T5FA 3RWHB 2HKFL 2YEQA 2VM4A 1DLFH 4HIEB 4ZFOB 1ROCA 4Z7UF 1BZOA 4P4RB 4XVSL 5BS0A 2QVTA 3BUIA 3HPLB 5EU4B 1SRDA 3KH3A 1HAUA 2JELH 3V5HA 3L16A 4X98B 3MLRL 4OLVL 4Z95L 1FDLL 4D0DA 2JK5A 4LHUB 2Z92B 1BZ8A 1MAKA 2P8LB 2Q86A 2BP0A 3FB8A 3NVQA 4H8QA 4PTUA 3G5XB 2JB5L 2WMPA 2VAAA 2AZUA 3BSZL 1E9OA 4G43A 4N2DA 4OSUL 4PYGA 1KB5A 1A4JB 2F8VA 1DJXA 3SPGA 2VL4A 5F97E 3U1SL 3VFNB 4RRPG 1AHKA 1PLGH 4LO9A 3QBTB 4UQCA 5GRYA 2R4SL 4ZNEE 1WZKA 3BAJA 3SBPA 3QUMH 3EH2A 3C2SA 1J05A 4MA3B 4PJEE 5EO9B 1PSKH 3VRLE 4AIOA 2F58H 2X9XA 5E6SB 3RX9A 5JPNA 3RU8H 1SHSA 5JHBA 4WW2B 4WFGD 4YHIA 2AJYL 3LXCA 3NJLA 4E2OA 2XKNB 5T3XE 1J1OL 5D7SL 3SEPA 2YAFA 1U3ZA 4Q2ZA 5LO7A 3GM0A 2VKXA 4OJYA 2WVTA 5IMLB 4PS4H 5SWQA 1KCBA 2V3EA 4UQEA 2P7TA 2NY4D 3PJSA 4PSPA 1TFHA 2I7SA 3VD3A 3DK0A 3C9NA 4FX5A 5LWYH 1LEIB 3NCEB 5LLIC 2JLLA 1MPAH 5BRZA 2DWSA 3V5DA 3VXQA 1KCUL 3GYRA 4AQZA 4BHUA 1YZZA 3QCTL 4JFZL 3ZDWA 2DBJA 1CZ8H 1B2WL 4GAGH 1OGTB 2B15A 3ZX1A 3CV5A 3BKML 2R59A 4P46C 2IDQA 1JGDB 1GIGH 1XGZA 5LGJA 3KWVA 2DWDA 4PREB 3VE0A 4Y0GA 3PGFL 1EGJL 4L3EE 1JG9A 1U8QB 3JV4B 4PWJA 4KY1H 4PEEA 3T0BA 2A3TA 1TJIH 2BNQA 1KPVA 4BIKA 1F86A 3HRZA 2UXFA 1NZRA 3US0A 4M1CC 5T1LB 2ZG3A 2NNAA 4PUBH 2EDQA 3QRGL 5IB1A 3UJTH 3OAZH 4PS8A 4BA0A 4JZJB 1LWJA 5HHNB 4CVZA 2FWSA 2VRAA 3AITA 1WAAE 4G6KH 4JMNA 2O6DA 5JORA 5IVZB 3U4EA 3MLSL 2F6AA 5F70A 2X05A 3M7OA 4AE1A 2EC9U 3SPVA 1KACB 1AR1B 1INQA 4X80L 1G7MB 3BP4B 4QRUA 3F85A 3DBSA 5C08D 4R4BA 4F24A 1MCCA 2DL9A 3VI4F 1F6AB 1D5MA 3F12A 3KDMA 4WK0B 5C3IA 3AADB 5DC9B 3K1DA 4KK5C 3R7QA 3WEXA 3WNNA 1VGKA 3DETC 1QMUA 1E67A 4CA4A 3OJDB 2HVJA 1VA9A 5EF3A 1TPXC 5KVEL 3F00A 4FXGB 4WLCA 5AOMA 4EI5B 4OI8A 4B9CA 2BVQB 1J1XH 4N90D 2XUWA 1M3JA 4PH8A 4TLSA 4IRZH 4DEPB 1ZLDA 4JVUA 1UOVA 3WLBA 4KAQH 3ZQWA 3NYKA 1EXHA 3RJOA 1KIUB 1JTOA 3GSNB 5D4JA 5IF0A 2GJJA 5LNDA 5BQ7A 1MG2C 1BX2B 5INDA 3DSFL 1PZAA 5HGHA 3HFMH 2VO8A 4N8CH 3F7LA 4XCYB 3RGHA 3SQOL 4QRSB 2A4CA 3QJSB 5I8OL 4A63A 1A25A 4YNYA 5BUPA 4MMXA 4PRAA 5IMOA 3AQZA 3ZTCC 3D0LB 4FOMA 4WWPA 3REVB 2AQ2A 1JF1B 1UJ3A 4K5LA 4AW7A 1FO0H 3WBDA 4I18A 5A16A 1F90L 4F8PA 4U6YA 1R4XA 1YPZF 5CCGE 5L2KB 4WY7H 5K9JH 2APVA 4AUJA 2AK4E 1CF1A 2AXFB 1I1RA 4OD2B 4GEIA 2JQZA 5BQ7B 4RETB 3HPJA 1MCPH 1RERA 1XF4B 2PYEB 3HZMA 1J5DA 3X14A 1E9QB 4ZUVA 2CG9X 1CE6B 2Y36H 1O9VA 1U8IA 1ZJBA 3Q44A 3Q01A 3ARYA 3GHEH 2ZWLT 2BMKA 2XVKA 1PAZA 1RZKL 3KWTA 1UJ3B 1HL8A 4DT2A 1NCBL 5I8EA 1JIBA 5TFSL 5AYUH 1K8DB 1UJTA 4RFNC 5DD6B 3D0VB 4YLCA 1ZOXA 1OPGL 1I7TA 1J87A 5E1GA 4DZ8A 5JIDA 1I1CA 3PV6A 2Y72A 1DVYA 2DWXA 1J9RA 3CHOA 4ONOA 3QDMB 4NCC2 3IU3A 3BZEA 3CSYA 2LTQB 1G6RB 2WBKA 5K9QG 1R5IA 2N7BA 5FYKD 1A6ZA 2KS0A 2X53A 4IBVA 2Y25A 3CSBA 1H3XA 1Z6JT 4C57C 2WLHA 3GZQA 3UGEA 4HIJA 3BOVA 3BPCA 2M83A 5D1ZA 3BH9B 1A2YA 3JTSA 3MNVB 4G7RB 1ZT1A 3ZZQA 4KITB 3F5WB 3I6KB 1IL1B 2VYRE 1U3HC 4H13C 1DJIA 1WV7T 1JRHH 4LSVH 3PU7A 4NN5B 1VFBA 2B16A 2RFXB 4K15A 4F7KA 1SMAA 2HH0L 4JFOA 5D7IF 1JAEA 3BW9B 2Y7OA 4CRPA 2Z91B 1JZ4A 4KK5D 4MCNA 4WI5A 4ZSOE 3SDDB 4ACPA 3CLFL 3GMLA 3EGXB 2R0ZH 3C5JA 3FCUB 1FNSH 4J3OD 3LXAA 1YNLL 2YLKA 4QRSA 4AWJC 4TLUA 3CXHK 4MDIA 5DC4B 1QQDA 3QEQA 3QUXA 3V0VA 1D5ZA 2CBOA 2BZDA 5HPMB 3LKSB 4TVUA 1G43A 2G0LA 1KXTA 3TTYA 4RDBA 5JDJA 4ZMQA 4Z3JA 4U1JB 4NKMA 4OLYL 4UTBA 2GYSA 1UT9A 1NCDL 1EEZA 2ATPB 3NQKA 3ZE0E 1MNNA 1ZLSH 3B2PA 5I1AA 5C0CE 1FP5A 2CHZA 5ALBH 1YPZE 3WHXA 1CFTA 4YPGA 5L2KD 1M1XA 2OJZH 1OE3A 1PPIA 4B9YA 5C09A 4NO0A 5JTWA 3U9UA 4Z6AT 1ZTXE 1YLBB 2ZWNA 4G80A 4JN2A 4KHXL 5I0YA 5CGBA 3O4LA 1Q9OB 1R3IL 5IQ7H 3IFOA 3O3AB 2DTML 1AKJA