4XPGH

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgH01
2H8PB 1CDUA 2WUCL 1NGXA 4ONGL 2ESVE 1HSBB 1HCFX 4MXQD 1X4XA 4RNRA 1TJHH 2DKSA 3UEZA 2N1KA 5GGQL 3MV7D 4YUEH 5ADPL 3KPOB 4M8QA 3VXPA 2FHCA 2ZUSA 3ZHDA 4XXDA 3SE9L 1DBKH 4N90E 1GSMA 1YMMD 2BVEA 3T2PA 3SDDA 2AABL 2W92A 1BQSA 4PLNC 2KZWA 1B0RB 5LJYH 1I9EA 1L0YA 4RMTA 2MPAL 5F44A 4NRZA 3IF1B 4QRTA 3BH9B 4L8SC 2O5ZH 4PJ9B 3ZT7A 4WW2B 3D6GA 4GKZA 3A6CH 3V79C 1NLDL 2HWZL 3ARED 1I7UB 4K3EL 3T3MF 3VXNB 3I02A 2P1YA 4GFTB 3TBYA 5HYSB 4LL9A 5DEFB 1IGCL 1IGFH 1E4WL 4JQIL 1R5IA 1RZJL 1INEL 5TF0A 3V6ZB 5F7WC 4HUUA 5GZOD 4JKWA 4MNGA 4D9RE 5KVDL 4QHKJ 1I8LC 2P5WB 3CH1B 1NJ9B 2XN9B 3K74B 3D69A 3V5DA 1VERA 3HR5B 2X89D 5EU7E 2HTLC 2GK0B 3GMQA 4WV1B 4YAQB 1BMGA 2RGSA 3EO9L 4OZHE 4UOJA 4ZOBA 1HEZB 3FQXB 1DBBH 2LABA 3GKZA 4WNQA 5D7JB 1NH6A 1BJ8A 4P46D 2Y6SD 5BV7B 1Y6KR 4BQ6A 3BO8B 1QFUL 5F97E 5F9WB 4ZXBB 1WBZA 5CJQH 5A2JH 4HWBL 5HVGB 2FL5B 1K8DB 4KVCH 4QOKB 4PJIE 1P84K 2FX8H 4XP1L 2VTFA 1IT9L 1JGDA 5CJOL 3VWJC 4X7TA 4PJHE 4MAUL 1MHCB 3QFJA 3T2NL 1ZSDA 4K8RL 1ZWIA 4HUXB 4LHUG 2VR5A 4U1JA 2VLRB 2GCYB 4IRJB 1L9MA 3KDMA 4PREB 1YEIH 3D3VA 4XXCC 1L7IL 1S7UB 3IKKA 3RU8H 4F37K 5GS0H 1NCCH 5E8EA 1IQDA 1BZ7B 1HH6B 4LSPL 2P47B 3MLWL 3JWDL 3FOLA 3C8DA 3LN9A 5KSBB 5GS1A 2PKDA 1CDJA 5E94A 3QAZC 2HLFD 4KJWD 2ZKHL 3KXFD 3TBSA 5CJBA 3RGVA 4D9RD 2R0KL 1N64H 3WSQH 3VXUB 3FO2B 3L95A 3QBTB 4HPOH 1A3RH 4GAYB 1X6LA 4XMKH 4E41B 5CD5C 2E6QA 5IK3A 1D6EA 3CFDB 5CINL 5ESQB 4HT1L 3FFCB 1V3LA 1FYTA 5JMRA 2NW2A 3GGWB 4HFUH 1NC2B 4WO4D 2WIMA 5IJKA 2PF6A 4OZGA 4DZ8B 2UWEA 1IM9B 3O3DB 2LQRA 4OQTA 5C0DB 1X7QB 1K4DA 3O9WC 3ARBB 4NQXA 4U31A 5CP3H 2W91A 2IAMB 3SE3A 3PWJA 4XT1C 3OAYK 4XB7A 3BXNB 3REWA 5T1KB 4DOHE 1MCOL 1GGIL 2P45B 2Z0BA 4WHCA 4Y5YC 2ZG1A 4IRSB 3S8WA 4R4BB 3MOAL 3W11C 3VFNB 1RZ8A 1YPZB 3F58L 5I1KL 4UMGA 4KROD 1WZMA 4X4ZA 4LVEA 3FB8A 1I7TB 5D8JL 3UC0L 1UJ3C 1V8HA 3BZFB 1I8MA 5INDB 4LKCA 4X6BA 1W0VA 1N5YL 5HI5C 4ZTOL 3BI9X 2FX7H 2J8OA 3IFPB 5IR1B 1YN6B 4KZEL 2Z31B 2OTWA 1A6AB 1XH3A 2PTUA 5FYJL 5D9SB 1ERNA 4X99A 4EUPA 4HWZB 1OCWL 5C0AA 5HJ3A 3REVB 3G5YA 1BFVL 3OXSB 3DGCR 1VFMA 4GKNA 3IT8D 5F1OB 3MV9B 2Q8BL 2G9HA 3GFUA 3IAQA 2NR6C 3LKOB 4CVZA 2ZWLT 5BS0A 5GPRA 3IKCA 5JW4M 4ZD3L 2JJTC 3D9AH 1TQBC 4EBQH 4PJXA 3RBGA 4HK0A 4C56D 4Y4HB 4U1HA 1IMHC 3CDYA 4M7ZC 4BFIA 5DD1H 3GSRA 1H8OA 4YHLH 5DRXB 5FM5O 3JV6A 1CFTB 5JIHA 1FZKB 1HKLH 3NIDF 2XN9E 4RMWA 3Q5TA 2CIIB 1YDPA 2HT4D 1QO3B 3DYPA 2XZAH 3SJVE 4L5FH 2Z4QA 3FCTA 3IDJA 4YDVB 1E4KC 2EYSA 4LAQL 3OJMB 5ERWB 3MRBB 3RY6A 5IQ7L 2OCFD 3QXTA 2PW2A 3HCVB 5HDBE 4KKCD 1TXKA 4LLWB 1MFEL 3T09A 4OLXL 1NMAL 3IDMA 1NUFA 2VDQL 2KDGA 1DEEA 4JZJB 3QHFH 4QOKE 5HVWA 3ALPA 3WIFA 3RVUC 2ZPKH 4LEOB 5DD0H 1BBDL 2BNUA 3D48R 1XGUA 5E9DD 5GGUB 2DI7A 5L8KB 1RK1A 3SGDH 4OBRA 2VLRE 2BRRH 2FBOJ 5FYLE 4G3YH 1HQRB 4OQTL 3PWNB 5K59E 2QADB 1N0XH 1EGJL 4XP6L 1AHWB 5FGRA 1CCZA 1G0XA 5DZNA 4JJ5B 5GRVK 4KPHH 3P77B 5F88A 3BE1H 4JO1L 3J8F7 3W0WB 5I18H 1U36A 2DIAA 2JF1A 3ALWA 3UYPA 2W9DH 5KSBE 5IB5A 4W6WB 2CUIA 3C6SA 2XYCA 4YDIL 5IIEB 5KTEH 2R0ZH 3QXUA 3LPWA 4ALAL 2I25N 3AVEA 3N1GC 1XGYL 4F37F 2FHFA 3VGHA 4J8RA 2P5WD 3ULUF 1NC4A 2XN9D 5C0RH 3VXUE 1TJGH 4J4PC 4MJIB 5JLZB 4HJ0C 4NQEA 5C86A 4E41E 5DS8A 3V52H 4AT6A 1YZZA 4TNWF 3SO5A 4G9DB 4ZAKD 1CS6A 4G8FA 5DGQA 5DSCB 1U58A 1W0YT 1CLYH 5I1LA 1I7RB 1R0AL 1UADC 5IHZB 5HSFA 4YXHH 3RUGF 3IRPX 2MOVA 3AB0B 1XCTA 3BYTA 3M17B 4LRIC 3L9RB 3PL6A 4P23C 2J1KA 3RNQB 3N9GH 4ODXA 5HHVH 5E7BA 1L6XA 2QEJA 3WEXB 4D3CL 5F9JA 1A7PL 3EAKA 3BUTA 4FRWA 4GRWF 1S7RA 3GNMH 5JPNB 3SPVA 1BECA 5E2VH 2ZUUA 4IRJD 3RA7H 2X4NB 4TTDC 1YPZE 2E3VA 3WFZA 3AS2A 4M5YL 1BD2D 4KDTA 5ILTH 4NSKB 3WL9A 1BREA 5DT1L 1F6LL 1KCRH 2DBLH 5I66A 2AEPL 2JELL 4FA8A 3VWKC 3EZJB 4P5KA 3AS3A 4HUWB 5L6YH 3FRUB 5HGDA 4L1DA 1EDQA 1YEHH 5DGRA 2DLTA 4ODSH 5DLMH 1RHHB 1RZGA 3L7EA 2CLZA 2RQ8A 3IU4L 5IW1B 4PJHA 3V0AC 5E6ZA 1AQKL 32C2B 3MBEB 1NEZB 3MV9E 1JZ6A 4I48A 5M7QA 2AEIT 4OAWB 4XNMA 5TDNB 2W9LA 2EIZA 4E41D 4JFZH 4MJ5A 5IBUG 2F5BH 3FFCD 1J0HA 4LMQE 4U6XA 1NEUA 1S78C 3OPZH 5EO0B 3T08A 1KC5H 1IM9D 3B9VA 4JFPA 4ONGH 5HGBB 5IB1B 4YFEA 1AP2B 3ARBD 1IKNA 1T89A 1OSPL 2QLVB 4K3JL 5DVLA 4Z76A 2YD1A 4G8GB 3L3JB 1A7RH 5ETUB 1RULL 4QRSA 4I2XB 4X5WB 5SWQA 5H35A 1PEWA 3FT4B 4MA7L 1P5VA 1BJ1J 3KNBB 1MIMH 1XCQA 4PY8J 4OD2A 4DK3A 5J6HB 1F4XL 3EYOB 1P4BH 5C0NC 1DUZA 2ZUTA 4Q9RL 1I3GH 2EICA 2FJFA 1T2JA 4R0LB 5T1MB 4KKAC 2YA2A 5TPWL 2HWZH 2Z31D 3UXFA 2AP2A 2GT9B 1MAKA 2B1AL 4ODVL 4JKPL 1XZ0B 3CFJB 5DMIL 4JKKA 3RVVD 1IGCH 4JQIH 1JF1A 1RZJH 3BKYH 5IG7B 1J1XH 1WV7T 2DJSA 4NQDA 1FSKC 1CL7H 4Z77B 2M1KA 1V3JA 3W0WE 4KQ4H 4WFED 3BRGC 2B5IC 3L1OH 1I1AA 5L2JB 1EUTA 2HG5A 4HS3B 4XWOC 5KW9L 2IANA 1QFWH 1EHAA 3KYNB 4AL8L 1EFXB 4GRMB 1MFNA 4QLRA 1MH5A 1BF8A 3BZEA 4PJBF 1ROWA 3N1QC 4HWBH 43CAB 2R2EA 5TFSL 3OB8A 1LO2L 1MFAL 5DQJB 1ZMYA 5ESAA 1VACA 5DC9B 4MJIE 3FO0H 1IT9H 5CJOH 5F6IC 3S3SA 1YMHA 3PGDB 1RJLA 4J1UA 3PUCA 1JI2A 4ONFL 3TLRA 4MMZC 1EPFA 3ZSTA 1QVOB 5GS1C 3FHAA 2E5EA 3VXQB 3MRRB 2GSGA 3ARXA 4KFZC 1L7IH 3BX7C 5IB4A 1KF9B 1X5FA 4GMSL 1XR8B 1YC7A 1NBVL 4I77H 4LSPH 4N8VB 1SJXA 3HNVH 3MLWH 2A6KB 3QXWA 3Q0HA 1FRGH 5EULV 4UU9A 4X8JA 1ZLVH 3V95A 4DUWA 2ZSVA 1XGRB 1GJIA 1SJHA 1EHXA 5I1GL 4X9FA 2ZKHH 2AV1B 4RAVA 4XMPL 5IJKC 4HH8A 2JIXB 2PO6B 2EDJA 3MO1A 4LF3B 1N6UA 4U2ZA 1QHOA 1MJ8L 5I1IL 4HT1H 3L5XL 2BY3A 4MD0A 4OTXL 4RBPK 1VGEH 5MP6L 1X5AA 4WFGE 5KSAB 4M7JL 3GK8H 2BNQA 1FNGB 5ACMA 4F7CA 3FL7A 2FDBP 1T1WA 4OGAC 4OZFA 4CN1A 3VMNA 4RGNB 3LS4L 2QQKL 4LSVH 3TCLA 4CMHC 4XP5H 5I16A 4KK6D 1FFRA 3GMPB 2FEDC 4U7MA 3ZE1F 1MCOH 1B6UA 1GGIH 1LO3H 4PJ7A 3IFOB 2MHAB 3WKML 4Z6AT 3MOAH 5FOBB 3RPIA 3U6RA 3EFFA 3G6JF 1DUYA 2P48B 3GI8H 3IVKB 3T0EA 5IESL 4NO5B 5SWSA 4PRDA 1MY7A 5D8JH 4X98A 1LK2B 3SGDI 4ELMA 1SBSH 2AQ3A 3KPSB 1PGRB 1DQTA 5FA3A 4HPYH 3QIWD 3SKNB 1VFUA 4G8GE 5KVGH 4KZEH 4EI5B 5D7KD 1MUJA 1XR9B 1DLHB 1OCWH 4I2XE 3R0NA 5K9OB 1NLBL 2VZOA 3C2AH 4PPTA 5AEAA 2Y7QA 3DO7B 3GKWH 3NTCL 1BFVH 1QFWM 1TZIA 4LU5L 1C5CH 4M00A 4ZDHA 3K4ZA 4WGWB 2Q8BH 3E2HB 4Z7QF 3LKPB 3GO1L 4TSBL 2XICA 1ZGLP 5T1DH 2L7UA 1T0MA 5C0FA 4YZFF 4Z7WF 5IB2B 1WLHA 2VC2L 4G5ZL 2BMKA 5EPMA 1ZK9A 1FL5B 3BSZH 3C5JA 3UTSA 1OSZB 4F7PA 1A6VL 4OM1H 5IHBA 3VFMB 3RY6C 3MJGX 5FB8A 3MBED 3QJHB 1S7TA 4K71B 5JIIA 1QLRB 3MODL 4EDWL 5I19H 1NMCC 4QRQB 5J89A 4CVXB 2DD8L 1NFDB 3ZZ1A 2H32A 4N1HB 3DX6B 2ZCKL 4LAQH 4I18A 1S5HB 4JFEA 1NDGB 3MLSL 4NZTH 1FO0A 4NWUL 1RIVL 2VRAA 1BQHA 1G7HA 2AAVA 15C8H 3WUWA 3QDGA 2VDQH 5D2NB 4BZ1H 5E7FA 3W39A 1BZ9B 3JUZA 3FB5A 4AJ0A 4PR5B 1NFIA 1QR1B 3H7BB 5H94A 3HS0B 3O6ML 3T1FB 2EKSA 3B9KD 4CN4A 2SEBB 2ICWB 3MA7B 3SQBA 4CU7A 1MCWM 4KMTH 1J11A 4HF5H 4W6YB 3SDAB 2OL3A 4AZ8A 4F33A 2V5SA 1FGVL 4FQQB 4GKSB 4WWID 5L2KD 1G0YR 3VXSA 3U2SB 1I1YA 1R3IL 1W0WB 4XP6H 5JOFB 4JDZB 1ODAA 3EOTH 3WJJA 4E5XA 2YC1B 4MAYB 4ZSOA 3P0VH 4G80A 2R39A 4JO1H 1KTLB 1V05A 1A6TA 3CXHJ 4KRPC 4OIIL 1FAKT 3G5VA 5C0EB 3GB7A 2CKBA 2DYPA 2BHYA 5B3JE 1HHGB 3GJEA 1PD6A 3I6LE 5KVEH 5IMMB 4OFPA 4ALAH 3TIDB 1WFUA 1U8MA 1ITCA 4UIMB 2APXA 4I0PD 2PYEB 4FZ8L 1MQKH 3QEQE 3L3GA 2OBGA 3SDYL 4X7EC 3BH8A 3SE4A 3DHMA 3OR6B 4HKXB 4HH9A 4HV8B 3PL6C 3K2UL 1T3FB 2VXSL 1EFXD 2FJGA 3NPZB 4X6CB 1RZIB 1IM3A 3DX7A 1FE8H 4OI9A 4BA8A 4Z7NF 2EDNA 3TZVB 1R0AH 2Y9RT 4E0RA 4FFWC 4GOSA 3RZCB 1WTLA 4XPAL 3NIGF 4JG0H 4HDIA 2VXTL 4RGNE 1HHIA 2XZQL 1JWMB 1YNLL 2AXJA 3PG2A 7FABH 4KDTC 1VESA 2DMCA 3VI4F 4D3CH 3V7AG 1A7PH 3NIFE 3KWWA 1PYWB 1YEDA 3NABH 2BRQA 5DJ8B 5A2KH 1MCHA 3HTLX 5GS2H 5ITBL 5DUBA 3C5ZC 3V5KA 2BDNH 4L3EB 1FCCA 3QCVH 3MQIA 4M5YH 5CIPB 1HI6B 3V6OE 3U0PA 1ZAGA 5HDOA 5CZVH 2YN5A 4DGYL 3NCFB 2D4FA 2HJLA 3VRIA 2B2XL 5I74B 2ICEA 3KPSE 4LRNL 2AEPH 4ZOCA 3QJFA 4R2GC 1ZLSH 4Y2DA 1JPGB 2XRAH 2OR9L 1D5MB 1UM5L 1CL7I 1U42A 1I4FB 3LZFL 1FNEB 1P6FA 3CFIC 5FK9B 3EYVB 4NKOB 2HJKB 5EO1A 1MRCH 4M4RA 3E3QC 1AQKH 1ZS8A 1ULVA 2JIXD 2PO6D 2IBZX 1S8DA 1ORQA 1QFWI 1OLZA 3RAJL 4JREC 5BQ7A 2WBWB 4ZFZB 3FRPA 2V7NA 4P5TA 5EUKA 4G7VL 4RMSA 2WW8A 4QHLA 5CKAA 2O5XL 1T89C 1Q72H 1CF8L 4L4TB 4GH7B 4XVSL 3QWOA 4H1LB 4HIEB 1DEDA 2VABB 3QPXH 3LRSA 2OL3L 5KSAD 1ORSA 4KTDL 3SDXA 4X5XA 3VMPA 4NDMB 1GGCL 3NFPB 3BKML 1JGUL 4ZNEE 2AW2A 4ISVA 4RGND 3PABA 4XPHL 4WGVB 4LSSH 5I8EA 2WM0A 4Y16C 3VGBA 4I5BA 3HAEH 1B9ZA 1AKJB 4K3JH 3MRKB 3GBML 2CRMA 4XTRC 1IQWH 4HLZH 4PV8A 4NPYA 5JIKA 1NFDE 2KZ1B 4BSVA 1BWMA 4RZCB 2DWEB 3BD3A 3PWPB 4J6RH 3WN5B 3LD8C 5JPMB 5IKCB 1BWWA 4Q9CA 2QQLL 3HR6A 3QQ9D 1T7ZA 4Q9RH 5D2NE 3KPSD 1A9EB 5IMOB 2EDTA 2X4QA 5D93B 3WFCL 1OGAD 5I1JH 5FV2A 1CXEA 5TPWH 1KIPB 4EI5D 4MSWB 1JZ4A 2Q7YA 5JW5A 2XG4A 4IJ3C 1I1AC 4F2MA 4CL7A 2AK1L 1KXVC 4LHJB 4YXKH 3HFML 1ZT1A 4MGXA 2F15A 2DWDB 4HJGB 4L9DA 4K94L 2VZ1A 1YECH 3RNKB 5F89A 5CCKL 1QQDA 1DBML 1F13A 4XNQA 5A16B 1UZ8B 3DSNA 1U3HA 2BOCB 1MHHA 5EU6B 4Q6IA 4TUOA 5EZJA 5AYQA 4AL8H 4MQ7B 5I17A 3MGTB 3ULVL 4EDXA 3L6FA 1RMFH 4NQCB 2R9HC 3OQ3B 5GSRB 3RVXD 2O93L 5TFSH 2O61B 2PYEE 1AD0A 3OWEA 5FIEA 1JYNA 1RSFA 4U6TA 2X70B 4QYOB 1KYOJ 2H6PB 3RVWD 4HGMA 4ETYA 2Y5TA 1MCQA 1KTRL 3O3EB 3TIEB 3MFGB 2GFBA 4LEXH 4ONFH 1LO4H 3WNMA 4ZFGH 4X6CE 4U7SA 2DMKA 4MQXC 4WI2A 1IGMH 4JR9H 3ZKND 4QRPB 1OAYL 2AEQL 3GSVA 4P4RB 4UQ3A 2Q3AA 4TPRH 5F6HJ 5BVJA 1YJDC 3QQ3A 4LKXA 1NBVH 1QR4A 3UBXB 5KSUA 1I9JL 3ARWA 3PGCA 5FUOL 3CLEH 5CZKA 3S35L 1C5BL 3TN0A 3NBNA 1FCGA 4JLRA 4XP9L 3PE9A 3SDAD 1D7FA 3GSWA 4R9HA 5DRZB 2YD2A 4Z7VA 4OD1L 4FXKB 4L3EE 3QUXA 4LSUH 4L4JA 3C60B 4X4YA 2X4TA 1JCKA 3KAAA 3QI9A 4MAYD 3MRJA 4OLZL 5HYJB 3BJ91 3F62A 5B21A 1XGQA 5I1IH 4QTHA 1MHEB 4JB9L 4FQ1L 4CW1B 2IADB 3L5XH 1CXKA 4LNRA 4WW1A 4MLSA 2C1PB 4M7LH 4WRLA 3PIQA 4N5EC 4OTXH 4GW1A 1ND0A 1NUNB 1YA5A 1GZQB 3O8XB 1U93A 4NNXB 3RWFB 1ZLVK 1CYGA 3DV4B 5J12C 3OKMB 4QGTA 2WANA 4BQBA 2YZ1A 4IMKA 3MV8B 5JTWA 5IGXL 2M26A 2AJ3A 2QQKH 4FMFA 1AC6A 1K3IA 4NN6C 4EUPG 3OKEA 1JV5B 3T0EC 1X5JA 1OM3L 1F6AA 4Z0XA 3CUPB 1A47A 4AENA 4L4TE 2YOCA 4K2UL 3X12B 3HE6D 1I8KB 3TZVD 3LS5L 3ZE2F 3RZCD 1LEGA 4XAWL 3QEUA 4UIKH 1JZ8A 1KEGH 1UGNA 3S5LB 4GUPA 4UNUA 1IKFH 4ZPTB 3S96A 3MJ6A 4ODUA 2NTFA 5C9JB 4GXVL 3BZDA 3SKMB 4N0FB 4TVPL 4GXUN 1AFVL 5FHAL 5ICYB 1JI1A 5LXGL 1CFNA 5D1ZA 2B0SL 4JY5L 4JRWA 3UPRA 1UWXH 3PWPE 3V9FA 3DRTB 4PLKC 3V5HB 2EXYC 3NTCH 4ZO6A 3VI3E 1MEXL 5BO1L 3SCMA 3U0TB 3BEWB 3SKJL 2FCBA 3P4MB 5FFLA 4JZOA 3GSXA 3ESVF 1RZ7H 5TE4L 4FQJL 1R5VA 4YBQC 1BJMA 3S35X 3L5JA 2VC2H 2DOCA 4G5ZH 5E2WL 1Q0YH 3HN3A 3MJ7A 4KAQL 3RTQB 4YIQB 5F9OH 4AEIH 4Z18A 1A6VH 1KJ2H 3L3KB 5C2UB 2EIDA 4JPKH 4LCIL 4WU7B 2QR0A 3MODH 4EDWH 3VH8A 4FQ2L 5DR5L 2NW3A 4XAKE 4IIQA 2XNAA 1AO7A 2Z93A 2PCPB 3RWIA 3CXDL 1P69B 2ZJSH 1CDHA 2ZCKH 2FYYA 4R97C 5MI0B 5JHDA 5EU6E 1VENA 5EFIA 1YJDH 3H42H 3OJ2C 3Q3GA 4O2FA 4NQVB 5DA4A 4NWUH 3JV4B 4NQCE 1LO0L 4HIIB 5DHVA 2H1PL 4HMCA 4GO6B 1OPGH 4TOYH 3W9DA 5DFVD 5GJTL 2XZCH 1KJVA 1CG9B 1C7SA 2IALB 1O7SA 2HFGL 1HILA 1CGSL 1F3DH 1QUNA 3OJDA 4F58H 1JYXA 2VE6A 5JDJA 1VPOL 5C6WH 3MACL 3X17A 2AXFA 2PR4H 2ZCLH 2HAZA 3L3HA 3PWPD 2ZUVA 4N0CD 3MLTB 2YS4A 4X6EB 3HC3L 1DBAH 3IXAB 2AKRB 1FGVH 3BUYA 4OZFH 5JZ7D 5DI8B 8FABB 5I1DA 5JHLL 5DDHB 4QRPE 4WI8A 1WIUA 5TGBB 4PTUA 1OP3H 2Q86B 2HMIC 3VD7A 3SDCB 2OTUB 3H0TB 4FQHA 3B5HA 2VITA 4HZAA 2Y07H 3BZ4A 3SE4C 1TTUA 3L3OA 3DX8A 4NGHH 4DVBA 5BJTA 1V7NL 4I9WD 1GGUA 1QBLL 1XEDA 4R96B 3X3GH 5T3ZE 4FZ8H 4Y5XA 3QH3A 3U79A 3ZSSA 4Q74A 5HYJE 3NA9L 3LQAL 2WZPD 1F2XK 3P0YH 1IGJA 4M48H 5A40E 2R1YB 1B6DA 3K2UH 4OUOA 5ANMB 4DKFL 2VXSH 3UAJD 5K9JL 4PIRF 2ZSWB 4HFWA 4QHUA 4XC3L 4GG6A 1LD9A 3LRHA 3VFPA 1Y0LB 4XPAH 1K4CA 4B5EA 3MV8E 1NAKH 3QISA 5I2IA 3D39B 1MIEL 2XZQH 1U92B 3FMGL 3ULVC 1ZVHA 2XA8H 3BPOC 3PDOA 2H26B 5EORL 3DSFL 2F58L 1ZA6A 3MXVL 5DJCA 4G7YL 2HTKC 5ITBH 3ZTJH 3QNXB 3JTTB 3SGEH 4M93B 4DAGL 4QRPD 3T3ME 1DLFL 1A6WL 4MDJB 1MCFA 5F96H 1T1XA 3ULSB 2B2XH 2CRZA 3DMMA 2NY6C 5IUSA 1FZMA 2GUOA 1JUFA 3OKNA 2R2BA 2H32H 1KCKA 4YGVB 2OR9H 1UM5H 4P5TC 1Q94B 4G6ML 2OI9C 3LZFH 1XIWA 2B20A 1FO0H 5IFJA 3QIUC 3FT3A 1OAZL 5DFWH 5HD8C 5FV1L 3M1BB 3C60D 1UWEL 4FHBD 5T3ZD 2GEEA 5D96B 4HX1A 3HE7B 5HYJD 2Q20A 5LGHL 1KULA 5ESVB 5IW6A 5EU5B 4CAGA 1I8IB 1JWSB 3NFNB 5ALCL 1YUHB 2O5XH 4XMLL 4FMKA 4HEPG 1YY8B 1CF8H 3NZHL 4HKJB 4OZ4A 5IEKB 1XF4A 2AI0L 4LBEB 2OL3H 1QA9B 2YA1A 3A6BH 4KJQD 4I4WB 5DC0A 4QRRD 2NXZC 1JGUH 3MV8D 4XH2B 2OQJA 4FTVE 5C0BB 2DQHL 4MB5A 4YPGB 4R7DB 4O51A 5DMGC 3KGRA 3FQRA 1HYRC 3GBMH 1P7QA 1J8KA 1FVCB 4O2EA 5CP7B 3D87B 2CKBH 1J1PH 1T7YA 4ZUVA 4UNTA 3MRCB 3IDIA 4TULL 2P24A 4GMTH 1C12B 5KSVA 3MLYL 4HGWB 2CGRL 2QQLH 4PRHA 5JW4R 3VDBA 1R3LB 4RFOL 1A1OB 1G7IB 4QNPF 4JHAL 1YMMA 3CK0H 5I30H 2WIIA 3PWVA 1C1EH 2DIJA 1AQDA 2B39A 2R2HA 2A73B 2YEZA 2Q76B 3G08A 3KLSA 4NJAH 3L7FA 2EYTA 4YX2L 4MD4A 2MJWA 1QLEH 2ARJA 4KUZL 3Q5YA 1O0VA 1T4KB 5I9QC 3HFMH 4UTBL 2GTZB 1FZOB 3UDWA 4PG9B 4Q6IC 1AXSB 5F7UA 3LB6D 1EAJA 2AEWA 1KTKE 2BERA 5DEGA 1J8HA 2D9QB 3TEUA 4DVRH 4XPTH 3BAEL 5CCKH 5EBMB 3RUGB 1MJJA 2VWEC 2C1OA 1XF2A 3JTSB 3QO1A 4XBGB 4R4NC 4YWGH 1LP9A 3S88L 5DJAB 1EBAA 1BVZA 3I3BA 4OKVA 3ULVH 1WAAA 2X89A 1KIQB 4GRWB 1TJIL 4NT6B 2EXWC 4MCYA 2F8XC 2XG5A 5FHBL 3HRZB 3BN3B 5HVHB 1QLFA 4IHOB 3C9NA 3O3BB 4JGUA 3EJYC 5ANME 1TZGL 5AZEL 2LU4A 4OZGF 4TTDD 2ZNWA 3TN0C 1DCLA 3B6SA 2UWEF 3TH4T 3DUHA 1MRFL 3UJJL 1OAYH 2AEQH 4GRLB 2DQUL 4H26B 4L8DB 5CILH 1R6VA 4M6NL 3D39E 3QG6A 4DZBA 2J4WL 4PRIE 5FUOH 5JW4Q 3QI9C 1LE9A 1FH5L 1JHKL 1HXMB 3TNNA 4GAFB 2IPUK 4LCCA 4JZNB 4F7EA 4OZFG 1WT5A 2CKNA 1HHJA 1CICB 3O2WL 2DRUA 3IJSB 1V5JA 4HS8L 4MZ3A 2HRPL 3N50A 4ETQA 2P42B 3FFDA 1IC5L 1FV1A 2E9WA 3LKRA 3OG4B 4U1LA 1AGCA 4OLZH 3BFOA 1NCBL 2I9LB 4KK9C 2HFFB 4HCRA 4IMKC 5BZDA 2F74A 2G5RA 3QUKB 1NGPL 5D7LA 5C0JB 1FL6B 1R3JA 2ARWA 4F9LA 3C6LB 3KXFA 2APWA 3NIDE 5J3HD 3BKJL 1DE4A 2MKWA 1QNZL 1PW3A 3MRPB 3GM0A 4Q9QL 5T3XL 2WINB 4EKXA 4LASL 5J1AB 4XPGL 1OTSD 3V8OA 2YN3A 2ITCB 4KKBD 2BC4B 3KLAA 3H9SD 1ZTXL 5TQ0L 1OM3H 4ZO9A 1BFOB 3O4LB 1E6OH 1KOAA 5JORB 3LKQB 2EDRA 4K2UH 1IEBA 5H37G 2WNGA 3WXWL 4PJ8C 4PJXF 1F4HA 4POYA 1MPAH 3T3PF 1JZ3A 3S4SA 5EU4B 2E9JA 4XAWH 4K3GA 2OSLB 3ES6B 5C0ND 1SEQH 5C0BE 3D39D 4FQXB 4WWKB 1RU9H 2J8UA 4N9OB 1ZV5A 2FB4L 1N0LA 4JO4L 4MCZA 4R6UA 3E6HB 4CADA 2EDXA 3IJHB 5HYIA 5FF6A 1AH1A 4GXVH 4OCMC 1G7JB 3NCBB 4TVPH 5LAXB 5FHAH 4KHTL 1M05B 4UTAH 4QWWC 3MZTA 4YHKL 4JY5H 1JGVL 4KK8D 2WQ8A 2JB5L 3BN9C 5EZOL 5E08L 4UDTA 5DQ9A 3F12B 4OLYL 1FDLL 4NO2B 4X9HA 1MEXH 1MREH 1A4JB 2NY4D 1A7OL 3BKCH 3LEYL 2NY5C 5E0QA 3BDYH 3AM8A 4U6YA 4KJYB 4MX7B 5TE4H 4LHUB 1ZHBA 4APQC 3UTTD 3GIVA 4X83A 3ULUE 3AC0A 3TO4B 3IGAB 3DO3A 1A1MA 3WNPA 4IIQC 1VGKA 3MJ8B 4PTTB 1IGTA 3FO1A 4KAQH 1GRWA 5DC4B 3WUWG 1WZ1L 1ZGLA 3P30L 4WTWA 4PRAB 4U1IB 1NQBA 2YPVH 1Z9SA 3OR7B 3KYOB 1QKZL 3HE7D 2AJZA 2DLFL 2R15A 3H3BC 1PSKL 1UZ6F 5DR5H 3ARDD 4UINH 2VH5L 1RJYA 4RFEA 3RUGE 4C56A 5F7LB 4H20H 5CZXD 4JFHE 4GQPH 2MMXA 1X5LA 3BPLC 3IDGA 5DQDL 1D9KA 4RIRA 1DDHA 4HLJA 4YO0A 3RWGB 5I73C 3QUZC 1MCDA 4DQOH 43C9B 4OI8A 5C0BD 4AK1A 1LO0H 2JJUA 4GRWE 4LSDA 3WKNA 4HCRL 3ILPB 2F54B 1P2CA 2KQMA 4ZYKA 2BOBA 3BIKA 1CFQB 4JAMA 3SGEI 1QBBA 2NY1C 3SY0A 2QBWA 2HFGH 2XY1A 1CGSH 3R4DA 1S7XB 1VPOH 3MACH 2HH0L 3MRLA 3I3DA 1X4ZA 4PFEA 3HC3H 3BDBA 4HZLB 3ZLQC 3IDYC 4U49A 4O4YH 3DXAD 5CEYA 4UBDC 5IB3A 1XFPA 3G9AB 4WHDA 1DQDH 5DRNA 2C3GA 2JE8A 1DVFA 4Y4KD 1H0DB 5C3TA 4YHPA 5E9DA 4Y5XC 3DROA 3ULUD 3QA3A 3EYQC 4NQUA 1RZKL 3MZGB 4FTVA 1MFCL 3FN3A 4S1DC 4JY4B 4ZS6C 1NANH 5F1IB 5AYUH 1GGTA 5C0IB 4RFNB 4H25B 1AE6H 3EKCA 3AY4A 2DJ4A 3VXMB 4TRPH 5AD0B 5J9PA 4P2OA 1OT2A 1A0QH 3QCUL 4U0RC 1I7UA 4JN1H 3CSYA 3TV3L 4XI5C 2C7UB 3QUYC 2V6HA 1L4IA 3G6JB 1CDIA 2FEDD 3C08H 3EOBB 1BVKB 3S34L 3V4PL 4ONHA 3MUGB 3PWLB 3VMOA 4ORGB 3QSKB 4RGOL 4DKFH 4S1RL 2YD7A 3GMMA 3OX8A 1F4YH 5CGYD 2P5WA 5DVMA 3QQNA 4QCIB 4Y1AB 1NCAH 1B4JL 2FATL 4O02L 4PJHF 2GK0A 2ICWJ 4FFZL 2ZOLA 1HXYB 2XQBH 3DTXB 4XBPA 1K6QL 1MIEH 4PRBA 5CEZD 3ARFB 3FMGH 3QXDA 3LKSB 4ZAKA 4LLQB 1WBYA 2G75A 4Y5VA 3O4LE 5EORH 3DMMC 5J11B 5DJYB 5F1KC 4MD5A 2F58H 3MXVH 5CAYB 4G7YH 3ROLA 3IDNA 2FL5A 2HVKB 3OV6A 4KI5C 4AIXA 5DJ2B 4Z7WB 3FRPG 1JNNL 4DAGH 2PUQT 1UWGH 1A6WH 1XIWC 3BD5A 3O6FA 4QXUL 2R0WL 2FZ3B 3D2UD 1TNMA 5F9AC 1FPTL 1OTTD 2H41A 1MCBA 3JV5A 4HUXA 4C4KT 1BOYA 3QUMA 5LWYH 4YHYB 4IRJA 1GIGL 2ZCHL 4TQEL 1CQYA 3CC5B 2MQCA 3SGKC 3TJHC 1QSVA 1JHTA 1BD2A 1CICD 1MCEA 3SOBH 4UILH 1P7HL 1OAZH 1MFDL 5DHVH 1QSFB 2V9RA 3FT2B 3LAFA 3L3DB 1DQJB 1MCIA 5DURB 4LARL 4U1MA 4HWEL 2IPKB 4M4PA 4PJBE 4H88L 1OW0C 2Q8AL 3C6LD 1D5ZA 2AI0H 2FR4A 1JGEA 4NZRH 1XF5B 2UY7A 1A7NL 5FUZL 3U9UB 4C83A 2AJYL 2DQEH 2YD5A 1F58L 1MI5B 3QNZA 1NBYB 1SEBA 4JO3H 4MXQC 2VR9A 1WJ3A 5ESQA 3U9PL 1U8NB 4M02A 2FX9L 2B1HL 1MCSA 1RUKL 2RR3A 4G6AD 3HC0A 2VZVA 4W6XB 2X4UB 1NBZB 1CT8B 3CGTA 3QFDA 2Q6WA 3QG7L 2V2WA 4OGZA 2V9QA 4KZDL 1U2CA 3B4NA 1T2XA 3C09B 3CMGA 2GY7B 3MNVB 3MLYH 2CGRH 4DKDC 4FZEH 4NO0A 3UTZB 1PKQE 3LN4B 3VXTA 4I3SL 4LSRL 4RFOH 5FO7A 2AK4B 3WO4C 4WWKD 1TNNA 3RJQB 4JHAH 5GGVH 3TP4A 3I75A 4P5MB 4RISL 5JQHC 2F54E 3LEVL 3AREC 1FL3B 1YYLL 2ITDB 2XXCB 1PEZA 4WIQA 1G9NC 4QF1A 1JWUB 2D7MA 4YX2H 2EDWA 4WEBL 5HYQB 2A83A 2VISA 2P8PA 4PGEB 3BP6B 4PGDA 5I76A 4LDLB 1HE7A 4GS7C 4MLIA 1TFHA 4UTBH 1OVZA 1KN4H 2CUMA 5GZOC 4YFDB 4OLVL 4X6FA 2NNAB 1XF3A 4G42A 4ZOAA 1Y6MR 2QHRL 3EYFB 3HI6L 3O3AA 3H2WA 3JWOL 3N1FC 2ZUYA 4PBXA 1XMWA 4FQLL 2VR4A 3TO4D 3DVNA 2VN4A 4O2CA 4V1DB 3B8SA 4P46C 2Y6SC 1HH9B 3OF6A 4NCC2 1OTUC 3KYKH 2D7PA 4RCAA 3ZE1E 2VXVL 3VXME 3BHBB 3BPCB 2NLJA 3MROB 5C0CA 1ZA3A 1U8IA 2ILLA 3G6JE 3QUML 3QDMB 4N0UA 1A3LL 2YD4A 3SE8L 2ZUQC 2OZ4A 1UH3A 3GHEL 4P4KD 4QXTB 3ESUF 5C07A 4IOIB 5EZLA 1TZGH 4KY1H 4P2QB 4YBLC 2P46B 2IEPA 4Y1AE 3PP3K 1MRFH 1TVDA 1WT5C 3SKOA 4NCC1 1Z3GL 5IBUB 2F54D 4F80A 1UXSB 3LKNA 3MRBA 1MCPH 2VLKD 3BISA 1HSAA 1P4LB 1ITBB 3CZFA 2R0LH 2BNRD 2JKXA 1JHKH 5F9DC 3HI1A 1LE5B 3K4DA 5BCAA 4PJ7F 2VLJB 3X14A 4Z7QE 5DD3H 3O4OC 2HLFC 4HS8H 3MOBH 3PV7A 4F9LC 3O6KL 4KJWC 2HRPH 2LAAA 4YZFE 4Z7WE 5IOPA 4LPUA 5E8NA 3V4UL 1VKXA 1IC5H 3CU1A 5C08A 1D5BA 2GAZA 1RURL 4ELMF 4LLVA 5DK0B 2EYRB 3BMVA 1S7VA 1CD1A 1J0IA 1SYVA 1NGPH 1E28B 2IBZY 3MA9H 3ZT6A 4WO4C 3P11H 5MEPB 2FGZA 4FABL 1B4RA 2CLRB 2IQAA 3VXMD 2OX5A 4G9FE 3WLBB 1AD9B 1QSFE 1ZANH 3O2DA 1E4XL 2WSKA 1A4KB 4XPGH 4WU5B 4BFEA 1NDMA 3C5SA 3TBTA 1ZTXH 1NGZA 5TQ0H 1LO5A 4WHYH 1OGTB 4YDJB 1BOGB 5I1CH 1EEQA 5D5MA 4V2CB 5SV4A 2EEDA 5FYKL 3L5WB 3BPNC 4NUGL 4WUUD 3VE0B 3THML 4A2MA 4JFYA 3QIBD 3EYSL 3ABZA 5GZND 1JN6B 3DIFB 1QRNA 4KROC 3WFHA 1F45A 2N7AA 1MI5E 1TVHB 1G9NH 5JOPE 2XWBA 3MRHA 2FB4H 3SKUD 5C1MB 1ZHKA 5DJZB 5DSCA 5AZ2H 5K9QG 1S9WB 1RUAL 4NHCH 4KHTH 1C8PA 1I7RA 4YHKH 5H2BA 5LKNA 2XWTB 1J87A 5KVFH 1B0GA 3AAZB 4KRMB 2Z8VC 3X11B 4BUHA 3VH8G 3P4OB 4ZFFB 4QY8A 3ARGB 3FB7B 4ENED 2JJVA 3LEYH 1KENL 4S2SB 1NANI 3QIWA 1W72A 5HHOB 5GIRA 4QHMA 1FC2D 4KI1A 3ILQD 4ACPA 1KPVA 5JPNA 4U1KA 2OZ4L 5FDWB 2OJZL 3RY4A 4PB0L 5M95B 4NNYA 5E1AB 5C92A 3FN0H 1WWBX 3CJJA 2X4OB 5EBWB 1CVRA 4DTGH 1F11B 2DL9A 3PP4H 2X05A 3WV0A 3BW9B 5DJXB 1DSFH 1I85C 1QKZH 3K2MC 3LHPH 4ZUSA 1FLRL 2FH8A 4Z7NE 1H5BA 5IVNA 1KIRA 2HT4C 1TENA 5IVZB 4EOWL 2VH5H 3EO1A 3NIGE 3IXTA 1WCBA 3VCLB 1RHHA 3MBXL 4S10A 4V1DE 1J10A 5KAQF 1C7TA 5DQDH 5IW1A 3MBEA 2FLBT 3BP5B 4KKCC 2OLDA 3VI4E 1MI5D 1HINH 4JM4L 5JOPD 4NKMB 3VXRB 5K9QI 3O9WB 2P8MB 1G7PB 1A9BB 3MXWH 1Q9OB 2HLAA 4OB5H 3HMWL 4C54A 3QDME 2C4XA 2GK2A 5ITFB 4JFDB 4ZS7L 4PY8I 5TDOB 3U4BH 2RB8A 4UAOB 1DQQB 2NMSA 4I3RL 4M1DL 1EEYB 4P2QE 3C8KB 4PJBA 3O2DL 1CZ8L 4NRYA 2AK4D 2JJWA 4JCMA 5FGSA 1WFTA 1RK0B 4X4XB 4FFYH 3EBAA 4OF5A 3VFVB 2QSVA 1UJ3B 5JUEH 4WW2C 3B9KA 4QTIL 4NO3B 5HY9A 4PLOB 5CHNB 1A14L 2VAAA 4WJ5B 3B2VL 3FONA 1EHLH 1CE1H 4OFYD 3W2DL 1IFHL 3VG9C 5L2KA 2VLJE 1G0DA 4I3GA 1KLUA 2AQ2A 3AS1A 1WF5A 3D18A 3SQOH 4G6KL 3PXHA 3GJFA 4KUCD 1JPTL 3ULVF 5EOCJ 3STZB 3TV3H 1JP5A 1U8HB 1HQ4A 4MNQE 2CDFA 4FFVD 3WNNA 3TJEL 4HEME 1LEIA 4WI5A 4RGOH 1FFNA 3BP4A 5CD3A 4ZAKC 2ATKA 5BV7C 2R1XB 3ARRA 4I0PA 3KPQB 1FNSL 1Q9WA 4X7FC 1B4JH 2FATH 4Z77A 3UYOD 1I1CA 1VADB 4LSQH 3MJ9A 3EGSA 3HLAB 1W72L 1K6QH 2X4SA 4N8CL 1T83C 3BGMA 5D7SL 2F53A 3QDMD 5CJ8A 2BP3A 1J05B 1D3CA 1UC6A 4LQ1A 3E6FA 5IJVA 4MDIB 1VFAA 1BQLL 3SDXF 4P2QD 1OF2A 5TH2B 2D31B 4IRJC 3PHQB 4OKDA 5D6CB 1JNNH 4N9GB 3NCJL 4QXUH 2VB5A 5GISL 4NQSA 1FPTH 3QDAA 2IPTL 2EO1A 4D9QE 4DKEH 5JDSB 1LDPH 4NHUB 3PV6A 5C8JA 1GIGH 2ZCHH 4B0MM 3MRNB 5JW3L 4X0KB 1Q0XH 4YDKL 1JK8A 1WC7A 4JFFB 2DLEA 2EIBA 2UY6A 5IMKA 1HDMB 4PJAA 2F8OA 2FJHB 1XR8A 4XNZB 1IL1B 5D1QD 5HPOA 3RL2B 3MUY1 3QP3A 4C4KO 4XRCB 5HHOE 3MV11 5MENB 3TBWB 1PQZB 4LARH 3RWDA 3VXOB 4OSUL 1QSEB 2LAGB 3TA3B 2HN7B 3H7LA 3CLFL 3QULA 4MNHA 5IF0B 1U8JB 2ADFL 3D25B 2NY2B 2PN5A 1Y18A 4ODTL 1A7NH 1VB9A 2YPLB 2DTSA 4GBXA 3CFCL 4PP2B 1S9KC 2AJYH 2HA1A 2NY0D 3ARBC 4XC1L 4NKDA 2D4DA 3PJSA 2VXUL 4JRXA 4WHYG 3U9PH 4LCWB 5I1EL 1XGPA 3T65B 3WFDH 2P4AB 2PXYB 3A67H 2WBJB 3QG7H 3T77A 5ICZB 1F42A 1MVUA 1VFBB 3VJ6A 2O5YL 5L7XL 4TUJA 5E5UB 3DI2B 3GMPA 5HXMA 3VXRE 4YHMH 2WAHA 5HGHA 4OV5B 3KPTA 3U0WL 1YYLH 4JFDE 2Z31C 1SJVA 3LQMA 1QEWB 3I6KA 4MJ6B 3PWUB 3RIAK 4XNUH 4HJJL 4FXGA 1QBMH 5JO5B 1MCWW 5MEQB 4RWYL 5BXFB 3RVVC 3FTGB 1U6AH 2KPNA 3MJ9L 3ARGD 4WTZA 1OGAA 1T04B 3U36B 2VDOL 5EWIH 1U8QB 2A9NL 1YQVL 4LLMA 5BV7H 1XR9A 1DLHA 1M71A 4M6OL 2QHRH 4O9HL 2ADIB 4TSCL 4X9GA 3JWOH 4OCWH 4QT5A 5CBEA 3VWKB 1H3PH 4G8IB 5BRZB 5GGSA 1JPSL 4BYHA 5E4EB 1BVLB 1TIUA 4JPIA 1NGYA 4Z7VF 3M07A 5DXWA 2OJEA 4M1GL 3IJYB 4Y7MA 5C2BL 5DRWB 5DJ6A 1JBJA 3LKPA 2W65B 2Z35B 1SMOA 1WITA 2VL5A 3TWCL 1NGXB 3QUMH 2RCSL 3ZE2E 1A3LH 1KFAL 4MXVF 4U1GC 5B3NA 4RNRB 2IFFL 3TYFA 5EA0L 3GHEH 4Q9BA 3VFMA 1RZFL 4M8QB 1D5IH 3VXPB 1A5FH 3QJHA 4XXDB 3NZ8A 1QLRA 2D7OA 1U41A 4F9PA 4LLUA 3SDDB 1ONQA 1YEFL 1DFBH 1Z3GH 2ZOKA 4RAUB 4NRZB 5ALBL 3GHBH 1J5OH 1BAFL 4ZPVA 4QRTB 4CKVX 2A6IA 4Z78B 3TNMA 5HHQB 3LOWA 3KLHC 1F8TL 3IU3A 1ADQA 4GKZB 1E4JA 2FO4A 5GS3A 1S5IL 3JV0A 3O6KH 2W38A 3V4UH 4RRPA 2G2RA 3UYRL 2CK2A 3TBYB 1J86A 3T1WA 3RY5A 4U6HA 3CMOL 1KIUA 1R5IB 3WD5L 4CDGC 4OCSL 4HUUB 3DI3B 4MNGB 3V5DB 3S4SG 5D1XD 1KN2H 3KJ6L 3U2SA 3BMWA 3GMQB 4LLDA 4JFFE 9CGTA 4K55A 4FABH 1JTOA 2YC1A 4WUKH 5E2UH 4MAYA 4BZYA 2NZIA 4WNQB 1TJHL 4ELKA 1HOCA 4N1CA 1F6FB 3OKLB 3CSBA 2CDGA 5C0EA 1FSKB 4KK6C 5MENE 2BVYA 1DBKL 1WBZB 1QTYT 2VUOA 3G6DH 5I1AA 2KKQA 4F8TA 1QSEE 3RDTD 1AGDA 2B5IB 1RD6A 4O00A 4K7FA 1K9TA 5FYKH 4NUGH 3THMH 4W4OC 3VD3A 1VEOA 2YPLE 1MCKA 1JGDB 1NL0H 2HFEA 3WHE1 4X7TB 1U95A 4PRNB 5A1AA 3QFJB 1ZSDB 1ZWIB 1WZKA 3CU7A 2O5ZL 4U1JB 3HPJA 3OR6A 4HKXA 3MYJA 4WI6A 3A6CL 1EMTH 4LCWE 4OLWH 4OT1H 3GM8A 3LPGA 2JCCA 2X4RA 3HE6A 3QIWC 1JGLH 4GQ9H 3GBNL 5F6IB 3JZ7A 5E8EB 1IQDB 1CGVA 4Z8FH 3VW3H 4P48A 4L8SA 3FOLB 4KC3B 2CMRH 1JWMA 4RSVA 2ED7A 5GS1B 4GW5A 5I6XB 1UACH 4X5LA 5FO8A 4OM0H 4IEFB 3TC9A 3ZYZA 1OAQH 4BQ9A 1PYWA 3TBSB 2J6EA 1LWRA 3RGVB 5E5RB 3ZDXF 2OZ4H 1DBBL 3IAGC 3L95B 5IP4A 4P3DA 1BLNA 2FGWL 3P4LA 4LPYA 1VHPA 1I8LA 5IK3B 1D6EB 2V5TA 4RX4D 2APTA 3QWQB 2E6PA 4TNVK 1FYTB 2NW2B 1FJ1A 2D7TL 5M94B 4MVBD 1SM3L 1FN4A 3MBEC 2VXQH 2R29H 4JPWH 1NGWA 4OZGB 2FX8L 1D5MA 5GRZA 2UWEB 2X1WL 4HXBH 4X9BA 3V7AE 4JGMA 1QSED 4EOWH 2DS4A 3RIAF 1K4DB 3TA3D 4NQXB 2XQYG 4JO2H 5GQBA 2NY2D 4DCQA 1ZLUH 3AFLA 4HIXH 5BRZE 1G9EA 2BXZA 3REWB 3CXHK 4JM4H 4PRPD 4ZFZA 1OT1A 2ID5A 3EOAA 4FNLH 5GS0L 3P4NA 3VWJA 4LIQL 1X3DA 3AS0A 5CSBA 1RZ8B 4H1LA 3HMWH 2OR7A 2J8HA 1L6ZA 2PXYD 1F02I 2WBJD 3B9KC 4XXCA 3UTQB 2QQNL 3KPLA 4K3HA 1I8MB 4LKCB 4X6BB 1W0VB 4GG6F 5DYOA 2OTWB 1XH3B 1CZ8H 4X99B 4EUPB 3WSQL 1JPFA 1BM3L 5C0AB 5HJ3B 4E42A 4HPOL 1A3RL 4QTIH 1R3KA 3G5YB 4R0LC 4XMKL 1LEKA 2NXYD 3B2VH 4JVWA 1JYWA 1IGYA 4GKNB 3VFWA 2G9HB 4HKZA 4HFUL 1IFHH 1CDYA 4JANA 1V7ML 2AV7A 3TT3H 1R24A 1T1YA 4Y19D 4CVZB 1FZJA 4W70A 5ISZD 3T0BA 3IKCB 4G6KH 5EOQH 1A9EA 2MQ3A 4K8RD 4PJXB 4I0PC 4HK0B 2VN7A 2D9CA 4XCFH 2Y06L 2WBKA 4U1HB 4BFIB 4OZIA 4WFFE 6CGTA 3JV6B 4Y88A 3IAPA 4MNGE 5DZOA 2IG2H 5HHMB 3OAUL 3VU2A 3WDJA 1PX4A 1YDPB 4DFHA 1ED3A 1N6QL 2Z4QB 3C8HA 3GMOA 3TGXA 2ZP0T 3FCTB 4KTEH 3IDJB 5J6GA 3IS0X 2EYSB 5FYJE 3G04A 1RUQH 1X9QA 4RMQA 2OXGA 2PW2B 4N8CH 5IHUH 5JQ6L 1HZHH 2J6EL 3LN5A 4Y5YA 5D7SH 1UZ8A 2FX7L 3IDMB 5J1SC 4ODWA 4QNPE 2H45A 1DEEB 4K23H 3BN9D 2OMNA 4JKMA 5F6HI 3WIFB 3S9DB 2YR3A 4LGRB 5MHSE 4NC0B 5C09D 4LCUA 3SDDD 1J12A 3NCJH 2BSED 3QFJE 1WBXA 2BNUB 3E8UL 1XGUB 1RK1B 5GISH 1MAML 2IPTH 2XXMB 3D3VE 1J18A 5BZWA 4JFXA 3NCYP 3FO9A 5F88B 5J06A 3WDIA 4YHLL 2CO6B 3OZ9H 2ENSA 5IB5B 3C6SB 5FEBA 1IC7H 2PO6C 2V5RA 1HKLL 3DUUA 4X7DC 4L5FL 4RAHA 4OSUH 1T0NA 2YBRA 3EHBD 1NC4B 3ARYA 4BQ8A 5SX5H 2ADFH 4NQEB 4LCYB 5KSAC 4IDJL 4BH7A 4M3KB 4CDHA 4PYGA 4AT6B 1Z2KA 4XNXH 5I75B 4PJGA 2A6JB 1FYTE 5FYJD 5HHPB 4UOW0 2J5LC 4EXKA 2F8VA 4RGNC 3IFNH 2VXUH 1U58B 4UUJB 2BXYA 4ODBD 3QHFL 1FG2A 2A77H 4OZGE 2E7MA 2LE9A 5I1EH 2ZPKL 2UWEE 2DQJH 1XCTB 5DD0L 1SMAA 1UCBL 4BM7A 1RQ5A 3F7YA 4KV5F 4QRRA 1LP9F 4ODXB 5MHSD 4UT7L 1QP1A 2BRRL 4CJ0A 5FKPA 2O5YH 4XPBH 3MRIA 1WAAF 3QFJD 4JHBA 5F9JB 1UA6H 1MJUH 3V6OC 1N0XL 1S7RB 2XQYK 1MOEA 4OF6A 1B88A 3QQ9C 4ERSH 1H15A 3MUJA 4KPHL 3BE1L 1AR1D 2EDOA 3FQUA 2FECI 1K5NA 1M6OA 3D0LA 2W9DL 1I8KA 1G7MA 3WL9B 4EI5C 2Z8RA 5I66B 3BWAA 2R0ZL 25C8H 4RWYH 4JM2B 4P5KB 3MOQA 5IM7A 3CPLA 4GT7A 5HGDB 4D2NA 4PYHA 4LP5A 2VDOH 5C0AE 4B41A 1JNHA 3U1SH 3O11A 3E2HC 1RZGB 3L7EB 3MCLH 3MNWA 3RGVD 4O9HH 1CN4A 4M6OH 4PJHB 5EIIB 4R2GB 2BVPA 4I48B 2F5AH 5E95B 3TH2T 4XNMB 4GSDH 2EIZB 1JPSH 4MJ5B 1CLYL 5BS0E 4J4PA 2ZZUT 4YXHL 3U4AA 4U6XB 5DHYA 2EECA 3RVXC 2VLLA 3GUTA 4PJXE 2NYYD 1C08A 1KBGL 4F9PC 4HKBA 4JREB 3N9GL 4JFPB 3T3PE 2RCSH 3RVWC 1MNUH 1KFAH 4WTXA 3B43A 5EA0H 5HHME 3GNML 1WEJH 4LRIA 2GJ6A 4Z76B 3FOMB 4P23A 2XKUA 3DUSB 4QRSB 4HK3N 5H35B 2H3NA 2PCPA 2Y4SA 4FXLA 1I3RA 5D2NC 1KCRL 1XCQB 5ALBH 3SEPA 4OD2B 1CLOH 3QZWA 1TQCC 5L6YL 5T5NG 4LMQI 4Z95H 2CRIA 1MHPH 1F8TH 1PZ5A 5GJSH 2FJFB 1OP5H 1TETH 1U91A 1A7QH 4ODSL 3SDAC 5DLML 5E1HB 1XGTA 3LD8B 3BJLA 1CGUA 3PDGA 3ROOA 2CIKA 1AY1L 2VL4A 2J8UF 2J3SA 4GW4A 4MAYC 4KHXL 4JFZL 1OWRM 1JF1B 3WD5H 3B8YA 2F5BL 5KZCB 2EZ0D 2CSPA 4X6EA 4NQDB 4R4FL 2AKRA 4R7NB 3KJ6H 4KQ3H 3MLUL 5L8JB 1UZ6E 1KC5L 1ETZA 4IJ3B 1I1AB 3D85A 2IANB 3O41A 1WUNT 3VA2C 1YNTA 4YJZL 1MH5B 2XWJA 1MWAA 3BZEB 4CN6A 1XT5A 4JE4B 5GSVA 3WIIH 1A7RL 2R2EB 5HHMD 3QDJA 3I9GL 5EUOA 1OOAA 2FNBA 1PZUB 2P7TA 3VDAA 4JEGB 1PKOA 5ESAB 1VACB 5HVFB 3WNLA 4NQEE 1MIML 3HE6C 4MS8D 5T5FH 2WLZA 3TZVC 3RGHA 2MFNA 1RJLB 3GSQA 3VFTA 3RZCC 1ES0A 4J1UB 1P4BL 3H9SA 3LMJH 3UTPE 1HNGA 1I3GL 3VRJA 3C2SA 3RWEA 1W8OA 4LPXA 1CE6A 2V2TA 2GSGB 5TE7H 1UFUA 2UYLA 5EG6C 3FQWB 2EIEA 5IB4B 3GBNH 4ZUTA 4ZO8A 3ARPA 5JXED 3BKYL 1TLKA 4ODHH 4X8JB 5CMAA 1J1XL 4R8WH 1DANT 2ZSVB 2DN7A 1CL7L 1HHHA 1QOKA 1SJHB 1CLZH 5I74C 3DARA 3SJVB 4KQ4L 3L1OL 1IAIM 1CU4L 1FYHB 4RAVB 2CUHA 3K8MA 1BP3B 5DWUH 3MO1B 3KYMA 3QO0A 1QFWL 1OTUD 2FGWH 1KJMA 3WCYA 2ESVD 2XY2A 3WNOA 4LSTL 2D7TH 1P5UA 1AIFA 3IS1X 4O58H 4MD0B 1SM3H 3WLWD 1DTUA 4F3FB 3UTTA 4CJ1A 4N90D 3FO0L 4F7CB 4IRZH 1T1WB 4OZFB 3TBVA 1ADQH 3TCLB 5IROA 2Y72A 4NQED 5I16B 1T21A 3OHXA 2ERJB 3HE7A 1ZVYA 3NFSH 4HXAL 4PJ7B 1A1NA 4P9MH 2C4FT 3ARDA 4LIQH 3E3QE 4HKJA 4I77L 3RPIB 5DFVC 3HNVL 3CX5J 4NN6B 3T0EB 1HYSD 3S97C 1FNLA 1FRGL 4PRDB 2CJUL 3WJLC 2VDRL 4TNWK 4X98B 1G1YA 1PG7W 2QQNH 3GMRA 4BJLA 3TPUB 4J3VA 1AXTH 3WN5C 4N0CC 5FA3B 2A0LD 1ZLUK 5JZ7C 1CGYA 3EYUH 1MUJB 1BM3H 3OKOA 3QQ4A 1MWAL 4CGTA 4U6VL 3I2CH 1NUDA 2Y7QB 3GEWB 1TZIB 1K2DA 4ZDHB 2DTML 2HT3D 2VQ1B 1FBIH 4J3WA 5BOPA 1V7MH 1VGEL 3BQUD 3DXAA 1G7IA 4JM2D 3GK8L 1T0MB 2WUBL 5C0FB 1A3QA 4NKIH 1T22A 4C58B 2BMKB 4Y4KA 5EPMB 3EUUA 4KKLD 4LSVL 2R69H 1Z5LA 3C5JB 4XP5L 3UTSB 2WWMD 2Y06H 1S7WB 4Z9KB 1M7DA 1T5XA 4F7PB 1OARH 5CGMA 4ESKA 5FB8B 2X10A 3W9EA 3HG1A 1LO3L 1S7TB 3OAUH 4NQDE 1OAUL 1FZOA 3UAJC 2A9MH 1N6QH 4UDUA 3GI8L 1T7XA 2H32B 2UVFA 4I18B 2IANE 3U83A 3GDBA 2VDPL 1LK3H 3KR3H 1SBSL 5JQ6H 4JFEB 3JTSA 2J6EH 1A6ZB 4M62L 1N6VA 4HPYL 1G7HB 5KVGL 3I3EA 2I07B 4M61B 3WUWB 3QDGB 1PDKA 3OKDA 5EN2B 2C9AA 3FQNA 3C2AL 5HHXL 1NFIB 4L8BA 5H94B 3GKWL 1UXWA 3VGAC 4NC1E 2EKSB 1U3ZA 4PY7A 1C5CL 3DGGA 3E8UH 3NA4A 5EOTA 1AXIB 2JB6A 5FM5M 1G6RA 2OL3B 3R06A 4TSAH 3O3BA 4F33B 1MAMH 1X5KA 5T1DL 5EC2A 5E24E 3IYLW 1GHFL 3Q6GH 3VXSB 1I1YB 2GITA 4E5XB 2OR8A 3WXVH 4U0QB 4ZSOB 4JN2A 4G80B 3DVGA 3BSZL 5JMOC 3EOYG 4OM1L 1A6TB 4OFDA 3D2UA 1P9MA 3R8BB 1V3MA 3C60C 3GB7B 2CKBB 3DPBA 2X2YA 4JY6B 4H1LH 3P3YA 4HHAA 5I19L 5E6IB 4L3CA 1U8MB 2DM4A 1U8OA 2DKUA 2N4IA 1YY9D 3VGDA 2KQNA 4NQDD 4Q7DA 1D6VH 1H3UA 3L3GB 1CVSC 1RUPH 4IDJH 4JGJA 4AEHH 3BH8B 4KJQC 4NZTL 4URTB 4HH9B 3OMZA 3ME0A 2I9LA 1J1OL 2IAND 15C8L 2HKHL 2V17H 2P5EA 4BZ1L 2FJGB 5F3HB 1IM3B 3DX7B 4XCCL 5L88L 4J7RA 4E0RB 2BNQE 3VG0L 5KS9A 1QACA 3G5XA 1RFDH 3AMKA 4HDIB 1L0QA 3MRPA 1UCBH 5F7FA 1HHIB 4KMTL 4HF5L 3ARTA 4UT7H 4QHNA 5IEHA 1T1ZA 3D1MC 3KWWB 1YEDB 4PJ7E 3VRLF 3EOTL 4PJ9D 4Z7OF 5DUBB 3P0VL 3V5KB 5JORA 2XA3A 1WWCA 3MREA 3HAEA 4HD9A 3T0EE 5SWSE 2VDLH 3U0PB 4LGSB 3BPOB 3DHJA 2HJLB 4JFOA 2DQIH 2YK1L 2VSDA 3VRIB 1N26A 3HNTH 3V0VA 3FJTA 2ICEB 1UENA 4ELME 3ES6A 4GKOA 5KVEL 5DVNA 4WWKA 2PW1A 3QJFB 4Y2DB 1WTGT 4PGJA 1BX2B 1MQKL 3GJFK 3CDGA 5F71A 4YDLB 3LB6C 4HC1H 1PY4A 1JE6A 3SJVD 5EO1B 2NY6B 5B8CA 5D7JD 1S8DB 1ORQB 5BQ7B 1F5WA 5IT2L 2V7NB 4P5TB 5EUKB 5DUPL 1FE8L 1RIHL 2NQCA 3O6LH 2OI9B 5CEZL 4ZXBD 2HJFA 5DA0B 5DJ0A 3QWOB 4JG0L 1G6RL 3LRSB 1ORSB 3WBDA 3SDXB 4QOKD 4X5XB 3UTSE 3ARQA 1KBGH 3TO4A 7FABL 4NFBA 3TO2B 4MA8H 4ISVB 3QXAA 3NABL 4YPJA 3PABB 2D7QA 5I8EB 4I5BB 4RRPG 2VLRD 5FYLD 2BDNL 3G9VA 3MLZL 3QCVL 5T5NF 3RWHA 4H5SA 4OD3H 4PV8B 4NPYB 3DLQR 2W0LA 1R3HA 3NPSB 4BSVB 5C0GB 5CZVL 4U7KA 3L3IA 4U1SA 1UM6L 3MLVH 4JFEE 5C70A 3WS3A 4P4KA 1ZLSL 3C5ZA 2W0FA 2XRAL 5D5MF 1RHFA 4NN7C 4XGZA 3QDGE 4EI6A 4K3DL 1ZT4A 4KTYA 3DETD 4BKLA 1NPUA 4MMXC 1MRCL 1TTGA 4YQXL 2Q7YB 5JW5B 2Z92A 3VXUD 2VLKA 1AY1H 1WGOA 4ZUUA 3CDFA 4XBEL 3SGJA 4M03A 2BNRA 3M8OL 1MCCA 1S7XA 4KHXH 1ZT1B 1UH2A 2HYMA 2UZYB 1Q72L 5IV2A 2RFXA 3VXSE 4UQ2A 1NC2D 1X5IA 4R4FH 3QPXL 3HC4H 4ZSOE 1IVLA 3MLUH 5J3HC 5F89B 1H3VA 1QQDB 3VFSA 1OP5K 4XNQB 5F8RC 5ICXA 1U3HB 2Z91A 1MHHB 2IAMD 4Q6IB 4LSSL 3UTSD 1NKRA 3VD5A 1OTSC 2IGFL 1G7LA 3JXAA 2WP3T 4KKBC 3BIAX 5I17B 1I7ZA 4EDXB 5E5MA 5GGRA 5T1KD 4AY0A 3L6FB 1IQWL 2VDKL 5CJXC 3MNZA 5F70A 3I9GH 3U7AA 1AD0B 4IRSD 3O3UN 1IAOA 5AD0A 1XAUA 4I13B 4J6RL 5DK2A 1K3ZA 2EDEA 2Y5TB 4KDWA 4Y16A 4YH6A 3RX5A 1A6UH 1BFSA 4FP8H 3LV3A 2GFBB 1GZPA 2X4PA 5B22A 1IGIH 1JJUA 2K3TA 5I1JL 1KLFA 4WUUA 1H3XA 2QTEA 5LCVH 4UQ3B 3QIBA 4KDVA 1EEUA 5T1LB 1VSCA 5BVJB 1WIPA 3QQ3B 4LKXB 2ARJQ 1BGXL 4KK8C 5KSUB 4LQFH 4YXKL 3PGCB 3S98A 5AG8A 4M93C 1W2KT 3TN0B 2GJJA 3B5GA 3TCXA 3MV9D 2NY4C 4JLRB 3GSWB 4BH8A 1YECL 5GRUH 1YN7A 3F6LA 4Z7VB 1Z9OA 3QUXB 4X7SL 1A02N 2EH7L 1CU4H 4X4YB 5I71B 3ULVE 2X4TB 2NTSP 2AXGA 3MRJB 3MUHL 5B39G 4Y4HD 2VZUA 1FFPA 1XGQB 4PGCA 4QTHB 2VLME 5D72L 5IROC 2L4OA 3K4AA 3QEHA 4LNRB 5JNYA 1RMFL 3KHQA 3F7VA 4LSTH 1MRDL 3MRFA 4PG2A 1U8PA 3PIQB 5D7IA 1V3KA 2NZ9D 4GW1B 1ND0B 4JRYA 2A6DA 5C7XH 3HE7C 1U93B 2H9GA 5E6ID 2X7LA 2M2DA 3ARDC 1WK0A 1KLGA 4XVJH 3BGAA 3JVGC 2AJ3B 3LQZA 5CZXC 4LEXL 4BFBD 4POZD 2ED8A 1LO4L 3OKEB 5HI3D 4ZFGL 4M8VA 2LU3A 1FLTX 4S11A 1F6AB 4Z0XB 3MYZA 4AEEA 1IGML 4JR9L 4AENB 4YC2C 4H8WC 1KJ2A 4HXAH 3LIZL 4TPRL 4Y2OA 5DK3A 3SDXE 3QNYA 5B38G 2BSSB 4OF0A 3SN6N 2KH2B 1LEGB 2A2QT 3CLEL 3GMNA 3QEUB 3KLHD 2VKXA 4GUPB 2WWKO 2CJUH 2VDRH 3S96B 4ODUB 1AGEA 2NTFB 1CIDA 4LSUL 1CFNB 5D1ZB 2QADD 4YR6A 1JFQL 1NCNA 3QEQB 5E8OA 1BIIA 4J3UA 1CT8A 2XOTA 3UPRB 1Q8MA 1MWAH 4U6VH 3W0WD 3KJ4B 4Y4KC 3MRDA 3X13A 3TF7C 3SCMB 2DTMH 3DBXA 5K33A 3ULUC 3NN8A 4M7LL 3KPPA 4JZOB 1KGCE 5FECA 4XVTL 3GSXB 3E0GA 3IETA 3ARZA 4H0IA 5DEZA 4WI7A 1LVEA 1R5VB 2ADGA 4Y2DD 5TE6L 2WUBH 4YNYA 1XF1A 1JF5A 5DMKA 3MJ7B 4MJID 2AERT 3UO1L 1CXIA 1T20A 5D71H 4OCYH 3V7MA 2JJSA 2CD0A 1T6VN 2NX5A 4BQCA 2GY5A 4EIGB 4HW6A 4DK6A 1C5DA 2QR0B 3EDDA 1OAUH 3K8KA 3BP7A 3VH8B 4UOW1 2NW3B 1KG0A 4IIQB 2XNAB 1UKQA 1AO7B 2Z93B 3PHOA 3RWIB 5CGYC 4PJAF 4UIKL 1KB5A 4TVPE 1KEGL 2GKIA 4M5ZH 1N3NA 2FYYB 3DV6A 3DURA 5GRWA 5KG9A 4BSWA 1IKFL 5JHDB 2VDPH 1TCRA 5EFIB 3MCKA 4PS4H 4D0DA 4LVNC 3Q3GB 4M62H 4NZJA 4O2FB 3MGAA 5LG1A 3K80A 4WFHE 5HVHC 5MEOA 4YHZH 2H2PD 3RFZC 5DHVB 2UUDH 2VIRA 5TJWK 2DI9A 2YSSA 3W9DB 1R5WA 5AUMA 4OCLC 4F15B 3BPLB 5HHXH 1C16A 4DFIA 3MROA 3TT1L 3B9DA 1HILB 3OJDB 5I73B 2VE6B 4XCEA 1P4IH 3MRGB 3ZE0F 4FQIL 2AXFB 3L3HB 4GXUM 1GGBH 1PLGH 1P9MC 1IZJA 1OTTC 3TVMB 1RZ7L 3BUYB 4NUJB 4TUKH 3RBSA 5I1DB 2CK0H 1GHFH 2NY1B 4IDLA 3ZMRA 3VGGA 4WFGD 3FB6A 1Q0YL 4ONOA 5IWLA 5F9OL 4DGIL 4AEIL 1CICC 3A6OA 3VA6A 1KJ2L 4FQHB 3IDYB 2VITB 4JPKL 3BZ4B 2QSCH 3UJTL 3L3OB 2AJUH 3DX8B 4XHQA 4DVBB 5BJTB 4Z7VE 5EIQA 2ZG3A 4ZFOA 2P43B 1O7VA 1KEMH 3RWCA 2YD6A 2ZJSL 4Y5XB 3QH3B 3UCRA 3C6LC 4H8WH 5C6TH 5D1QA 1YJDL 1ZEAH 2MQ0A 3H42L 4MXVE 3H6JA 4PJFA 2E8ZA 1IGJB 2W59A 4TVPD 2W0PA 4MXWL 3HZYA 1J1OH 1VFOA 1U3HD 4PJCA 2HKHH 4OF8A 1JHLL 1OPGL 4TOYL 4HFWB 1JPST 4U0RB 4UV4L 4QHUB 4XCCH 4GG6B 2D0FA 1LD9B 2XZCL 3G5ZA 3CFEA 4XCYA 5L88H 3UBXI 3RVTD 4G6AC 5EBGA 3VFPB 3VG0H 4G8GD 4F58L 1K4CB 3U4EA 1EVTC 2QKIA 5I2IB 5MEPA 1UQSA 5DUMH 4HUVA 1EO8L 4FN0A 3B3IA 3D5OF 2IJ0C 2PR4L 3F8UB 2ZCLL 4P59L 2C3XA 4EIZC 1DBAL 3PDOB 4CNIA 35C8H 3MUZ1 1CFVL 4Q2ZA 1ZA6B 4WWKC 5EBLA 5FKAA 5CUSL 3FHQA 2K9UA 4JDVA 5T1LD 2DB8A 2CDEA 1T1XB 4H0GA 2YK1H 4MHHG 1JN6A 4DKAA 3DMMB 2Y07L 5F1NA 3Q2CA 4HIJA 1M7IB 4NGHL 5E8PA 5B8CC 2PYFA 1FZMB 3UZEA 2GUOB 1JUFB 3OKNB 2R2BB 2DAVA 3GRWH 3X3GL 1IAKA 2B4CC 4GAJL 4LHQB 2RJMA 5GGSY 4L29A 1XIWB 2OTPA 3I6GA 2V7HA 3FT3B 3QUXD 3P0YL 4HAFA 4M48L 4HX1B 2VZ3A 3EO0A 3TO4C 5JIPA 4WEMB 5IT2H 5IW6B 5DUPH 1RIHH 3NCMA 4S2SA 5CEZH 5DFTA 1WWWX 1AR2A 2APFA 1OY3B 3HZVA 3QZWG 1XF4B 1NAKL 4X80L 2DIBA 5FYJU 1G6RH 1FNFA 4QO1A 1FIGL 1E0OB 3MLRL 3Q1SL 2XA8L 3F7QA 3ZL4L 4ZUWA 4D0CA 2OQJB 1EZVY 2YMXH 3CFBA 2DQTH 4O51B 4P4KC 1KCLA 3FQRB 1P7QB 1UB6A 4O2EB 3MLZH 1AO7E 2AGJH 4ZUVB 2RBLA 3EDFA 3IDIB 4Z5RA 5F96L 1UM6H 2P24B 5JHDE 5KSVB 2ATPA 4AG4H 4ZFOL 4DGVH 1PG7L 1N5AA 1VA9A 2KUTA 4MHHI 1MFBH 4NBZB 3O45A 5IFAL 4PRHB 5B4MD 3SGJC 1JTTA 4K3DH 3I6LD 4YHNA 2WIIB 3PWVB 1FO0L 2R2HB 3VFOA 3ZDXE 2YEZB 1A9BA 4F7MA 2DQFA 3G08B 4YQXH 3BRDA 3L7FB 3QEQD 2I5YH 4MD4B 4YGAB 2R1WA 5LGJA 5ITFA 4XBEH 3M8OH 3WO3B 4NOFA 5FA4A 4PJEA 5JOEA 1SJEA 2JCCF 3SCMD 1H8SA 3PNWB 3QIUA 5EU3A 5DEGB 1E27A 1J8HB 3A6BL 4R90H 1MJJB 1X6NA 2C1OB 3TFKD 4F7TA 1XF2B 3QO1B 1ZVSA 4PGZA 5CHNA 4M6AA 1LP9B 3MRQA 5FO9A 2IGFH 5KANG 4OKVB 4OGYH 5D1XA 2VDKH 5K9KA 2CKBL 5F7EL 1J1PL 4MCYB 5T33H 4OGXH 4YK4B 1FVEA 4OLUH 1QD0A 1RJCA 5SX4H 1MELA 1RVFL 2Q7NA 4GMTL 1AO7D 5C3LD 1G7QA 3QIBC 4J3XA 1QLFB 3ZKQD 2AVGA 3K46A 5GZNC 3AROA 3MRMA 1OB1A 2WP3O 4YE4H 3CK0L 4YLQT 1F00I 3RKDD 3AGVA 3QR2A 3RDTA 1Q9KA 3U82B 5I30L 4GG6E 4CUCA 1C1EL 1I9IL 1AJ7L 3AU1A 4NJAL 3HZMA 2BX5A 1S7SB 5J11C 1OD9A 3WHXB 2ZUQB 1DN0A 1I1RA 1QLEL 3QG6B 4DZBB 1BGXH 3BT2H 2BZDA 2NY3B 1LE9B 4XZUA 4YBLB 3RHWK 3KPNA 1SYSA 3MMEB 3TNNB 4LCCB 4F7EB 4LVOC 5I8OL 4ENEC 1EXUA 1HHJB 4DVRL 3TVMD 4XPTL 1PG7X 4NN5B 2GW5A 3ILQC 4PG2C 4X7SH 4ETQB 4EEEA 1IEHA 2EH7H 3W81A 3FFDB 3H9ZA 2VZSA 1S9VA 1FV1B 2X1OA 3LKRB 4U1LB 1AGCB 3CVHA 5D2LA 4YWGL 1AI1H 1WIOA 4HBCH 5BZDB 2F74B 1KTDA 5D72H 5TDPA 5D7LB 5KANI 1MRDH 5HHNB 3KXFB 1DE4B 2LTQB 4KH2A 3PQYA 2BCKA 1Q9LA 1Z9MA 3Q6FA 4Z7UA 3KLDA 3P9MB 3HZKB 4IOFD 5F7YC 3WNKA 2BVQA 2R23B 5I8CA 2Z8WC 5CILL 1T03L 1IEBB 3LIZH 3VXOA 4JG1L 3S37L 2BSRA 2RIKA 4OZIF 2X1QA 3LSOA 3S4SB 2A74A 1MF2H 2DQCH 2J8UB 1TMCB 4MCZB 3NCCB 2YD3A 4CADB 4PRPA 5FF6B 3BPNB 3C09C 3K8LA 4IMLA 4XCNA 5F7KC 3ZKSD 3WIHA 3K1KC 2X42A 5HGAA 1JFQH 3VFUB 4KROB 4UT6H 4HSQA 3CSPA 1ZKAA 1IAMA 1NAMA 5IMLA 4UDTB 5DQ9B 4X6DA 2X9WA 1CDCA 1NCDL 5SWZA 4PRHE 3KS0J 4P3WA 5T3XE 1YMME 2JJSC 3H3KA 4XVTH 1EHNA 4U6YB 4QGYA 4OJFH 4RQQA 3T8XA 1E6JH 5TE6H 1IEAA 1ZHBB 4FQCL 1OQXA 3GIVB 3MX0A 2PYED 2Q87A 1A1MB 3ZHLA 1U2HA 4N0YH 4CVWA 5CEXA 1IGTB 3FO1B 1ZGLB 1UVQA 3UO1H 5IQ9A 5L9DL 4HIHA 2DM7A 4FFVC 1E6OL 4Y19A 2AJZB 1F2QA 5ISZA 5FGCB 1BBJA 1QFOA 1J8HE 3AXLB 1T04A 4PLJD 1MPAL 2QHLA 3LDBB 4RFEB 1RJYB 4C56B 4EJ1C 2RHEA 1JZ7A 1SEQL 4KV5E 1RU9L 1YQ2A 3IDGB 1D9KB 4RIRB 1DDHB 1LP9E 4P57A 2VZTA 3CVIH 4LNVA 2H2SC 4PJ8A 3STBA 1WAAE 4D8PA 3CVHL 1CD8A 4UTAL 3KPRA 1P2CB 4KVNL 2BOBB 2HP4A 3BIKB 1A8JH 4JAMB 4L3ED 1P7QD 3SY0B 5BVPL 3CCHA 4YHIA 3TT1H 1BQUA 4PJGF 1HHKA 1MREL 5IWLC 1BZQK 3OXRA 3BKCL 4FQIH 3MRLB 3S37X 4PJDA 5E00A 4JDTH 3BDYL 3HPLA 4PRHD 1II4E 3BVNA 1YEEL 3BEVA 5T3XD 5CEYB 5IB3B 5C09A 5DRNB 2ENYA 3T4AB 1T66D 1DVFB 1RJZA 5IBLD 4DGIH 3KPMA 2UUDK 4YHPB 4WDIA 5E9DB 2OXHA 5J56B 1INQA 4NYLA 4RAUA 2YPVL 3DROB 3WE6A 3QA3B 4FTVB 5D1QC 5F7MC 1CFSA 4PJ5A 4Z78A 1EO7A 4APQA 3UJTH 3DX9A 3NCEB 2OK0H 5HHQA 3QEGL 2I9TA 3WFEL 1JL8A 3LEXA 4UINL 3K0WA 4MA3A 4P2OB 4ZQKA 5J9PB 1UM4L 4L4TD 4H20L 1P1ZA 4MA1B 3E1F1 3CSYB 1J8HD 3T0XA 4F57H 5DJDA 2E7CA 3VG9B 1DL7H 1OP9A 3RHWF 1S3KL 1EUUA 1KCSH 3WIHL 4DQOL 1UYWL 5KJRH 2LFGA 4ONHB 3UP1A 4AM0A 4MXWH 5D7LE 4AH2A 5E99L 3HAEG 3F5WA 3KXFE 1NAML 2NY0C 3NAAH 3P9LA 1JHLH 3CFKA 4DW2H 3GMMB 4HLZG 3OX8B 4UV4H 2GSIA 4LK4A 1AKJD 1OLLA 1D5XA 2ZOLB 3QUZA 4XBPB 1EO8H 3D0VA 4PRBB 2G5BA 2BVOA 3QXDB 4P59H 3RIFF 2XKSA 5INCA 4ZAKB 5AWNH 3OKLA 1CWVA 1WBYB 2G75B 4Y5VB 5CSZA 4O4YL 1CFVH 4MD5B 1EV2E 1DQDL 3ROLB 3IDNB 3RRQA 4N5UA 3K1DA 4JHWH 5CUSH 1ZHLA 3O6FB 2FSEA 3KVQA 2J8UE 4PRNA 5AYUL 4MWFA 1AE6L 2NY3D 3MR9A 3QUMB 1KB5H 4TRPL 1KB9J 4XHJD 4L4VA 6FABH 1A0QL 4GAJH 3ARGC 4JN1L 5SV3A 3U46A 1JHTB 1ACYH 1BD2B 4NIKB 4P3CL 4XAKD 5DD6A 3C08L 3EIFA 4FOMA 2X09A 3ZDYF 4RMRA 2E9IA 4RBPH 4OBSA 1MLCA 5EU6D 4QRUA 3H9YA 1J0KA 1F4YL 3RL1A 1NBQA 4U1MB 3FN9A 1N4XH 5D7LD 1NCAL 3QUYA 3MFFA 4NQCD 2XQBL 2YPKA 1D5ZB 2IPUG 4X80H 2FR4B 3QDHA 1JGEB 1FIGH 5SX4I 5LQBH 3MLRH 4C83B 1B2WH 4PRIB 3Q1SH 3NOIA 1FVDA 3QNZB 3TH3T 3ZL4H 1SEBB 3HUJA 4JFQA 3ZKMD 1CTNA 3GIZH 5DD5H 5FGCE 2EDQA 3HC0B 2NY5L 5F1SA 4AIZA 4P2RA 3QFDB 3UPAA 2Q6WB 4C56E 3C87A 4CU8A 1AC0A 2V2WB 1UWGL 5ID0B 3P40A 2XZZA 5ACZA 4RMUA 2FD6H 1TZHA 2A1WL 3P73A 4PGBA 1PG7H 2PETA 1QRKA 1EGJA 1MCJA 5IFAH 2R56L 4NO0B 2HRLA 3VXTB 2NY7H 3GSUA 5LWYL 2D2OA 5FO7B 5EUOF 5FDYA 4UAOC 5HGGS 3I75B 1K8IA 1OAKH 3SOBL 2JK5A 4MQSB 4PV9A 2ADJA 4UILL 3HB3D 1FGNH 3OAZH 4QF1B 2MCPL 1LMKA 3BGFB 5E2TL 5F3BA 2A83B 2VISB 2P8PB 3JUYA 4NFCA 1N8ZA 4O5LL 1T5WA 4G8EA 4PGDB 5EIVA 5I76B 3UTQA 3SGKA 2GJZA 1RIUL 2BK8A 1UB5A 2APVA 5AAWA 1FG9C 4LPTA 3V6FA 4X6FB 4NZRL 4PD4K 1XF3B 5D1XC 5D6DC 4G42B 3GSNA 3K81A 3O8XD 4XNYH 2FBJH 3O3AB 4WVRA 2CLVA 2FH6A 1HIMH 2DQEL 5E9DE 4D9LH 1F3JA 1T7VA 5K93A 3DVNB 4O2CB 1TVBB 3ECBA 3OJVC 4JO3L 1OW0A 4R3SA 1S9YA 1ZHNA 1MJ7L 1MLBA 1GVIA 4D0BB 1J0YA 5F7EH 3RDTC 2NLJB 1HNFA 5C0CB 1ZA3B 1U8IB 4L8CB 1S7QA 1RVFH 3OGCA 4N0UB 1FFOA 5ECJE 4A6YA 3QCTH 4FZEL 4POUB 3LCYA 4BELD 4JCLA 3MV7A 4EVNA 4MB4A 2XACC 1D9KD 5C07B 5EZLB 5GGVL 4MJ4A 2P5WE 4XP4L 3EJJX 1I9IH 4HS6A 1CI5A 3HA0A 1AJ7H 4Y4FB 1YYMH 3SKOB 4NM8L 5CLWA 4U1GB 2VAJA 5HI4D 1KPRA 1FC1A 3H9HA 3LKNB 5BOZG 1HSAB 3G6AA 5JR1L 3CZFB 4KKNA 3HI1B 1KN4L 3AREA 1MAJA 3X14B 3STLA 5I8OH 1NKOA 3OKKA 2E6JA 5IOPB 5E8NB 5KN5A 1VKXB 3ARVA 1AGFA 1N2RA 1F3RB 5C08B 1D5BB 5JXEA 2GAZB 2EC9T 3T4YA 1DVFD 3RTQD 4LLVB 3KYKL 5F93C 1JZ5A 1S7VB 1CD1B 1SYVB 5DTFA 4FTVD 4IS6A 4XNZC 1SY6A 3SO3C 2HT2D 4MVBC 2FEEL 5DVOA 3OB0H 1BD2E 5IVXA 2P8LB 3ZKXB 2IQAB 4WI4A 1TPXB 4P46A 4P2OD 4C55A 1O5DT 4NOBA 3TA3C 4NRXA 3B5TA 2ESVA 4U2YA 4EN3B 1NDMB 3C5SB 4LOUD 4IM8A 2NY2C 3TBTB 4KY1L 1NGZB 1LO5B 1CXLA 5D5MB 2BSTA 5FGBC 1NGQH 5CBAA 1T03H 4JG1H 3S37H 4JFYB 2V2XA 2VNCA 1MCPL 3DECA 1QRNB 1EK3A 3WFHB 4LCYA 2R0LL 3K3QA 1RZJC 2PXYC 2PTTA 5HPMA 2WBJC 2XWBB 3MRHB 5MERA 3GSNL 2FWOB 3FFCE 5DD3L 2A6JA 1ZHKB 1KT2A 1GOGA 2VERN 5HHPA 3MOBL 4W4NA 4UUJA 3NH7L 4N8PA 3OKYA 4M7KH 5H2BB 3MGOA 2QV2A 1Q38A 5EO9A 5EB9A 1B0GB 3GMLB 2KL6A 2D3VA 4I8DA 1NCDH 3HNSL 3NCYS 2NXYC 3SDCD 4QY8B 4CMMA 3O6FD 2ED9A 3MA9L 1JNLH 3ZHKA 3QIWB 3EJZD 1W72B 2IH3A 5GIRB 4QHMB 4A6YL 4G6FB 1KPVB 3P11L 3H3PH 5ACLA 4U1KB 3FQTA 4FQCH 3INUL 4OZHA 4BUGA 1ZANL 1MCRA 4NNYB 1AGBA 2AJXH 4K8RC 5FYKE 3R1GL 3GSOA 5L9DH 4WO4A 5IHLB 3BQUA 5I1CL 4JM2A 4ZUSB 2G60H 3OGOE 3ZTNL 1EEZA 3ZT5A 1SQ2N 1H5BB 5E4EC 1KIRB 4PJIA 3TYGH 3EO1B 3IXTB 3JWDC 1WCBB 2XTJB 3NGBB 5E56A 1G9NL 5HDQL 5EIIA 1NCWH 2XPGA 4PRID 1RI8A 2CH8A 5AZ2L 1QYGH 4HG4J 1ZT7A 4NHCL 4MYWB 3U7WH 3CVHH 3VRLE 2EDLA 3ZTJG 4WFEE 5C0CE 1KACB 4Z7OE 1GOFA 5EZIH 1G9ML 2HLAB 4NM4L 4KVNH 5KVFL 5BVPH 2OM5A 2DBJA 4N0UE 1SY6L 5HBBA 1PFCA 4Y8AA 3SDDC 2WUCH 2X1XR 5FAAA 5C07E 3VFRA 5GGQH 4NO0D 4PJBB 2C3VA 5ADPH 5KS9F 4NRYB 1P7KA 1YEEH 2I24N 4W81A 3SE9H 3FOMA 1EAPA 3FN0L 1BQHG 5F21B 3B9KB 1U8LA 3DUSA 2AABH <