4XPGH

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/inhibitor
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgH01
1B4JH 2J5LB 3WIIL 1JWSA 4Y5YC 3U0PA 3O8XA 4N1EA 3QRGH 3FO9A 1IEBA 5DD6A 3CD4A 4PJ8D 1TTFA 4FFVD 4LRNL 2YK1L 4PG2C 5E5MB 5K9QG 1A6VH 1ITBB 2F54B 2Z8WC 1P4LB 4GRWB 4NZRH 3HUJE 5BRZD 4DCQB 3SBWC 1U8IB 4KQ3H 1IGMH 2ZCKL 4UV7H 4HJJL 2DD8L 5T3XE 1N8ZB 4M6NL 2CUIA 3BPNB 3IB4A 4L1DA 3MXWL 4P46D 1OT2A 3L3DA 1CU4H 2GKIA 4OFIA 2EO9A 2WWMD 4XC3H 2ATPA 1GSMA 3QEUB 4LCWD 1OQXA 2P5EA 2R69H 4W70A 1QBAA 1OP3H 3SE9L 2DQJL 5C0RH 5I18L 1IMHC 2RJMA 3T8XB 3V8CA 3MV9A 3GJEA 4HC1L 3B9KB 1KLGA 1JPTL 3O6FA 2JK5A 3VFVA 4NBXB 1U8JB 5DD1L 5DJ0B 1LEGA 4ODUB 1VEOA 3RIFK 4PLJC 3UC0L 4LL9A 5J11C 3RUGA 4GKNA 1XF3A 4JFEA 4ELMF 1B3JA 4P5TA 4X6DB 3W5NA 4NP4H 1Z0MA 4KJPC 3QFDB 3QDJD 4ZO9A 2MPAL 3KHQA 1S7RA 1E6JL 1P7QD 2NW3A 1R3HA 4X7TB 2A1WH 4L8CB 1MREL 4OZFG 2CLRA 4Y5VB 5INCB 1ZSDB 4JPKL 4YPJA 2F19H 3ILQD 3I84A 1NGXA 5SV4A 4ZUUA 1MIEL 5IK3B 4EQ3A 4JG1L 1B4JL 4POZC 3UEZA 5GIRB 1MHCA 3S3PA 2Z35B 5DRNB 1S78C 3QRGL 3WHXA 3NTCH 5J56B 1IQDB 2VDPL 1CE6A 3C8KA 3SDDB 2ITDB 4HX1A 1P4IH 1A6VL 1YY9C 1X44A 1JNNL 4NZRL 3WS3B 1YUHB 4QGYA 4PV9A 3ESVF 4KQ3L 4U31A 1IGML 4UV7L 1CGSH 2A6IB 1BBJB 3L3KA 2AK4E 4XCCH 4DWHA 1CU4L 1T4KB 2X89A 2GUOA 4JFFA 2AJYH 1ZXQA 4XC3L 1P53A 3LRHA 2R69L 3DXAA 1D9KA 2Q8BH 2V2XB 1QRKA 4OCXH 3O9WC 1J10A 4PGCB 5C0RL 1UH3A 2IFGA 6CGTA 5GGRA 4UB0H 4RGMC 1IARB 3G5VA 4U3XA 2G2RA 1CD1A 3UTQB 3VH8A 43C9B 4D9QD 4JB9L 4QHKI 2OSLA 4M5ZL 1PBYA 3KPSB 1R5IB 3BFOA 4JFZL 4X4XA 2C3VA 3I6GB 3FQUA 5DUBA 1LK3H 3I3DA 1AO7D 4O2FB 4HWUA 1HSAA 3RI5K 1DVFD 2CIKB 3IDYB 4NP4L 4JDVB 1CGWA 1QBBA 5IVXB 4XNQA 4QNPE 3RTQA 3IF1B 5HDQL 2A1WL 4HD9A 1T2JA 2C3HA 4R8WL 4DVBA 3TO2A 3RL2A 2F19L 3LQZB 2Y5EA 3B3IA 3W82A 1RZFH 4PTUA 3QDHA 5EZLA 5I1IH 3VG0H 4OIIH 1FFNB 3BPCA 4WW2C 1AI1H 3NTCL 5TQ0H 3PWLA 3ROOA 2BVQB 3I9GH 3MRFA 5DDHB 3BO8B 2IADB 4N5UA 1H9VA 4NQDD 3B9DA 1P4IL 3QHTC 4NGHH 4XTRD 2IFFH 5FM4A 5JIPA 3WE6B 1CGSL 3DROA 3FMGH 1AHWB 2GY7B 1N2RA 1U2CA 5IOPA 4XCCL 1GHFH 5T33L 2AJYL 3FQTB 3C6SB 4G43B 3WFDH 3KS0H 4MNQE 1KB5H 3CZFB 1AY1H 1CWVA 4NKOA 1ZLUH 2Q8BL 1HYRC 4OCXL 4PJHF 1YA5A 4RFEB 1X5HA 2YMXL 1MCEA 5GQBA 5F7KC 3KGRA 1DEDA 3UX9B 1IBGH 4FZEH 5T3XD 3MV11 3ARBA 5IMMA 4ODTL 4K7PH 1CDHA 1IAOA 1LK3L 1I3VA 3QFJD 4RISH 1CK0H 1EH9A 1G6RB 1KT2A 3VD7A 3ROLB 1VADB 3MLSH 1LO2L 3BAEH 3DYOA 2Z0BA 3NCCB 1MVFA 3MRMA 4D94A 1JMZA 2CUMA 4HEPG 4Q74A 5D70H 5D72H 5IHZA 2ZG1A 1VFAB 2BY0A 1UJTA 1S8DA 3I02B 4AT6A 2GT9A 3EZ8A 5HVFB 3GNMH 2CH8A 1RZFL 1J8HE 4PLJD 1RK1B 5I1IL 4R97B 4OIIL 2PNDA 1QRNB 5J9PB 1AI1L 3RWFA 4KJPD 4Y2DC 3WKMH 2AXFA 3S96A 3WIHH 5BMFH 3GMRB 3QULA 3UDWC 4KKAC 1U3HC 2GJ6E 2WUCL 3MRGB 4LKXA 5TDOB 3DO3A 4I2XA 4NGHL 5IKCB 2VSCA 2IFFL 4PRBB 4U1GB 1K5NB 1Y0LB 3SE4A 3FMGL 2XXCB 4X6CE 4FS0A 4POZD 4R2GC 4CNIB 4I0PB 2O61B 2ESVE 1GHFL 1OAQH 1CGYA 1MHHA 4MGXA 5IF0A 3WFDL 1S78D 1BWWA 2AQ3A 2AEQH 3EYUH 1AY1L 5DJ2B 4ZD3L 4BUHA 2EYSA 4JO2L 1ADQA 2FO4B 1MLCA 1WAAE 3G5YA 5I19H 1KC5H 2ZUWA 2UZXB 3IDIB 2Q7YB 3DJ9A 2R2BA 1N0XH 3PE9A 1WC7A 3FOLA 3TIDB 1TZGL 1YY9D 5F7FA 3TPUA 3WIFA 4P2RB 1JN6A 4MNGB 5FFLA 1G0XA 2H6PA 1IBGL 4FZEL 1ZWIB 3D85B 3BEWA 4UNTA 4LLYB 4PJ7B 4K7PL 2AK4D 4OAWA 4MA1C 2NPLX 4RISL 3IDNB 4U2ZA 3ULSB 3K81A 4KQ4H 3O2DA 3GO1L 4JHZA 1A02N 1NSNH 3NN8B 3PIQB 4NT6B 3WSQH 3BAEL 5KSAA 4N0UA 1KSRA 3TYFB 1Z3GH 3O9WD 4L1HA 2EDHA 3H9SB 1OQOA 2F58H 5D72L 5D70L 1RU9H 4F9LC 2MKWA 3F7YB 3HB3C 3WBDA 5IMLB 5JR1H 2BOCA 1PKQE 3OKLB 2JB6A 3GNML 1FC1A 1UCTA 3SO3C 4V1DE 3O4LA 1YDPA 4OM1H 1OTTC 5I1AA 4JANA 3V6FB 3RNKB 4JFOA 1U8QA 2AW2A 1QTYT 3P9MA 1XR8B 2YC1B 2VDLH 3WNKA 2PO6C 5AG9A 1AP2B 1EZVX 4Z7VF 5BMFL 1CG9B 1AXIB 4MD4B 4RCAA 3GSRB 4BZ2L 3GBML 2C4FT 3HAEH 5EN2B 1ONQA 4RIRA 4EKXA 4XX1E 1RZKH 1R5VA 2D3VA 4RMTA 3BP4A 4LU5H 5AEAA 1OAQL 4DKDC 2F9BT 3C2AH 4S1DC 2ZSWB 1KJ2H 4HUNB 2AEQL 3EYUL 4MJID 2F8XC 1R3KB 1P1ZA 4UOW0 5IIEB 5I19L 1KC5L 4N9GB 1HHHA 4HCRA 2OL3L 3QZWB 3W2DH 1N0XL 4HH9B 3RDTB 3ZL4H 4ELMA 4PJEB 1BD2D 1Q0XH 3DGCR 4AIOA 5H2BB 2D7TH 3IFLH 1AGBA 3MYZA 2D31B 1QLFA 3WO4C 4EIGB 5JNYA 1MRDH 3C6LB 2UZYB 1BFOA 1A6TB 5JLZA 3DV4B 1F90H 4HULB 3U4EB 1NSNL 2VLJB 3HR5B 4P2OC 3GEWB 4BH8B 1D5XA 3HZKB 4RQQA 1YPZF 3HA0A 4PJGA 1Z3GL 5J1TC 2F58L 2PXYC 2VYRE 1HHGA 4Z78A 1RU9L 5JA9A 1KJMB 3PL6B 4K3JL 3CDFA 3IS1X 4WWKB 3M17A 1IEAB 1JVKA 2OZ4A 4I9WD 4EN3B 3FCTA 3UCRA 5DFTA 3NA9H 2HJFA 2ZJSH 4H1LH 4OM1L 1NCAL 4YO0A 3PGDA 2J8UE 2YEZA 4ONGH 1ERNA 2BNRA 5C0CA 3TBYA 4S1RH 3G5XB 3D39B 3CFCH 4PR5A 3NZ8A 1RZJC 1YN7A 4F7PA 3U4AA 1R5WB 4Y4KA 5ANME 3QUYC 3QG7H 5TH2A 3BIKA 3FN0H 4X6FA 5CP7B 1RZKL 1OF2A 5E7FA 3B5TA 1FG2B 4YWGH 1A7BA 5J6HA 4QHNB 3C2AL 3BPOC 2EDFA 5SWQB 2BXYA 5J3HC 4M4RA 1RZKC 1FNEB 4Y2DD 3LV3B 4GQ9H 1NBVH 1UKTA 2YPLE 2JKXA 4YBLC 2GJ6D 3MJ8A 2VTFA 3W2DL 3HTLX 3ZKMC 4KKAD 3AM8A 1SMAA 4HUXB 1U3HD 4GUPB 1Q0XL 1MFDL 1F4AA 2D7TL 2DYPD 3VGDA 3WJLC 3IFLL 4PP2B 4DGYH 2CDEB 4WW1A 1MRDL 3VA2C 4M02A 5CMAA 1A3RH 5IMOA 4EXKA 4R2GD 1CE1H 3VWKA 3QBTB 4NRXA 4OB5H 1T83A 4ZOCA 4WUUE 4ZUVA 1NC4D 5J4MA 3AREA 3DGGB 4LQFH 4ZUWB 5JW4Q 2DQTH 4U1LA 1C12B 4NQXB 2J5LC 4IRJA 4JHAH 1A64A 2R8SH 4A6YB 1FZJA 4GAJL 3NA9L 3BDXA 4QRRD 2ZJSL 4OFYD 1A1NA 1IC7H 2GFBB 3D0LA 5KS9F 4TYUA 4ONGL 3MRLA 1JGUH 3IRZA 5KN5B 3CCHA 4UTBH 4HHAB 3SKNA 3L5JA 4S1RL 3OF6A 5E03A 3CFCL 3CH1A 3BJLA 4ZSOA 3OTTA 3BSZH 3KR3H 5HVGB 1YNTB 1CXLA 2I9LB 3EYVA 3VRJA 3HB3D 1N4XL 4GRWE 3QG7L 1NBYA 1GC1H 3BPNC 3FN0L 4V1DD 4BELD 1OGAD 3EYQC 2JB5L 5ISZB 3E8UH 1S7WA 1F5WA 4PJHA 1OTTD 2EE3A 5BW7C 2X41A 3BKMH 1T03L 3ZZ1A 4HDIA 4K9EC 3AMKA 3FT2A 4RGNB 3HHRB 2PO6D 3OKOB 2CRMA 1NBVL 4GQ9L 3B9KC 4QRSA 4DVRH 4JLRA 2CLZB 4XPAH 4NHCH 2XY1A 4JN1H 4C54A 3LEVH 3JVGA 5FGBA 1V3MA 5DYOB 4ONHB 5FXCH 5C0EA 3GHBH 4DGYL 5E8EB 5D6DA 43CAA 5EULV 5JORB 1A3RL 2OTUA 4GAYA 4X6DE 1CE1L 4OF5A 5CUSH 5CJ5A 4OB5L 4S1DD 4P5KB 2ARJA 1BF2A 2FJHA 1FL3A 4Y5VC 1RUML 2WW8A 1U42A 2DQTL 4EUPB 3JTTA 2N56A 2ZKHH 4WHYG 4JHAL 1ORSB 4B0MM 3VCLA 3ARDB 1KIRA 2CKBA 3O45B 2R8SL 5FDWB 4XBPA 3MV01 1RJYB 1EAPB 2C3WA 3QNZB 4LFHG 1A3QA 1MFEH 2MQ0A 1JGUL 4QEGA 1YC7A 5EFIA 4UTBL 2V5TA 3FT3A 3SDDC 4PGDA 1QO3B 2R0ZH 2WM0A 4NO5B 4P2OD 1HDMB 4KTEH 3HC3H 5EO1A 2MFNA 5HHQA 2EC8A 1QPXA 3HUJF 2PXYD 3CSYB 4H5SA 4JZJA 5C07B 3QXUA 1A6ZA 1GC1L 2ZOKA 5HHOB 2Y4SA 2L0DA 3D18B 1PZ5B 2QADD 3E8UL 5FIEA 4WV1A 1T1XA 5ICXB 2EYRA 3O3DB 5GPRA 3LIZH 4OLXL 4EI6A 1DEEA 4HK0B 3M8OH 4HIEB 1WICA 5MEQA 2J8HA 4DVRL 1ZT7B 4EVNB 1KFAL 3P4OB 4XPAL 5H35B 4NHCL 1SYVA 4PJ5E 1OB1A 4YNYA 4OGYH 4FQPA 2GITB 2GTWA 3LEVL 3OR6B 4LLWA 5EU5A 3KPSE 1C5CH 3QUYD 1QFPA 4IRZH 2V7HA 3GHBL 1QSFA 4KMQA 4YQXH 3IDYC 4NKMB 2QHRH 3KJ4B 4H26B 2OTWB 5CUSL 1P6AB 4LVHB 4D0DA 5J3HD 3BXNA 5GRUH 5IVXE 2YPLD 4JY5H 1YEKL 1LEKB 1URLA 2OI9C 4P4RB 2X4OB 1JWMA 2ZCHH 3TT1H 5ICZA 2P8PB 2ZKHL 3ZKMD 4ZG1A 1H3PH 3KYNA 1DQDH 1B0RA 5C3LD 3DETC 1CT8B 1BGXH 4F9PA 5CBAB 3N0PB 4NO0D 2I60H 3ZDXE 2C9AA 4KK5C 4Z7VA 5D7IB 2R2EA 4TNVF 3BN9C 1MFEL 4LRIA 1PSKH 4ODSH 3GMQB 3TBWA 3QR2A 3UJJL 2R0ZL 4PRDA 4LCYA 1V7NH 4KTEL 3P4MA 4CDHA 5EUOB 3EJJX 5IW6B 5GS1B 1F3JB 3S88H 1ZK9A 4NZUH 1AHWC 3DX9B 5SWSA 2P8MA 4EOWH 4NQEA 1I4FB 1BBDH 3SGDH 5E8OA 4FZ8H 4LF3A 3WFEH 1ZGLA 5ERWA 3TA3B 4OZFH 2H8PB 1NH6A 4KZDH 5KVDH 1G6RL 1KBGH 2F54D 3BRDA 5HHPA 2APVA 1LILA 4OGYL 1HI6B 4EDXA 3O3EB 5F7UA 4Z7WB 1C5CL 4IRZL 2DM7A 3MC0A 4PJ8A 4LSVH 1QFWI 4NC2B 3EYQD 1Q9KA 3MRHA 2ED7A 2E9BA 1YPZA 4PPTA 4EDWH 5I16A 4P59H 3K2MC 1NJ9A 2BX5A 3PGCB 3ZKXB 4JVUA 3C5JB 1T7ZA 4QNPF 5BRZA 3N1MC 1PKOA 1AGEB 2YUXA 5GRUL 1V3KA 3B9KD 1MCWM 1YY8B 2MWCA 5IM7B 3RWJA 3T1FA 1MCOH 2FR4A 1CXHA 2ZCHL 3TT1L 1H3PL 3MODH 3PWNA 4G8GB 1DQDL 4PJAB 4R97C 3GMOA 4XPFH 5DGQA 1BGXL 4O5LH 5TF0A 2I60L 3HPLA 1QRNE 3CFDA 5D9SB 4P9HH 4P3DA 2HVJA 3NMEA 5GGUB 1PSKL 4ODSL 1UXSB 2CRIA 1IM3A 2X70B 4KKBC 4JZOB 1BVLA 1GL4B 5DJYB 4JRYD 1V7NL 2VR5A 3K0WA 4BQ9A 3GJFH 3S88L 4U1GC 1Y6MR 4NNYB 3T04D 4YFLI 2VZVA 4L8BA 4NZUL 3R8BB 3QNXB 4I0PC 4DOHE 4EOWL 3LZFH 1WBZA 4RWYH 1P7QA 3TIEA 1DE4B 3EO9H 1BBDL 2M8XA 3CX2A 4FZ8L 4EQ2A 2DL2A 3WFEL 1EPFA 4UINH 3SDDD 1FYHB 1M05A 1OTSC 5KVDL 1KBGL 1ORQB 5GSRA 3SCMB 1Z9SA 1YEHH 2GSIA 1WJ3A 2CRZA 3DPBA 5FKPB 4P2RE 4MNGE 5A16A 5DEFB 3MREB 4PRAB 2DQDH 2BVUA 4LSVL 4PJ7E 4I48B 3L3OB 1V05A 1W8OA 5DD5L 4OZHE 3K8LA 3MLXH 4EDWL 3O41B 4P59L 3NPZB 1I8IA 2YD1A 4YHPA 3S4SG 2M2DA 2CXKA 5ESVA 3H9SE 1E4KA 4NO2B 2P44B 2DICA 1MCOL 2J2ZA 3OV6A 3KPSD 5KS9A 3MRJB 5T1DH 4RMWA 1CICA 4N8VG 3MODL 3FAXA 3QSKB 2G60H 4XPFL 5BOPA 1X7QA 1QFOA 4O5LL 2VQ1A 1TQBB 4JRXE 1CDIA 3V0VB 3EYFA 1R3LA 2X42A 4LEXH 1FO0B 2KPNA 4LSRH 4PYGA 4OCLC 5DVNA 1I1RA 1EEZB 1UB5A 1DVFA 3L5HA 2HH0H 5TGBA 2QR0A 4MYWB 4X6CF 3OAUH 5B38A 5EOTA 4TNWF 2HFFB 3DETD 1K2DB 5I1LB 3LZFL 5IHBA 2G75A 4OI7A 4RWYL 4P0DA 2Z93B 4PBVC 5DFWH 3EO9L 3OHXB 4KK5D 1S5IH 3F58H 3MNWB 3BN9D 5BZDB 1U91A 3JV4B 5DR5H 3L6FB 1EEUA 3RDTC 3QG6B 4R0LA 3DMMA 4QTIH 3EFDH 2WANA 1YEHL 4PJEE 4AEIH 1KN2L 2XACC 3C6LC 4N8PA 2MNUA 2HLAB 5F7WC 5DEGA 3L3HA 1YN6A 2DQDL 5BS0B 5K59E 1W8NA 3UP1A 5AG8A 1S5HB 4FTVB 4P3CL 3WJJC 1WISA 4NQDA 3JZ7A 3UPCA 1T21A 1CFSA 1MQ8A 4C56B 1CLZH 2VLJE 3BISA 3UAJC 4A6YH 3MLPA 1XGQB 1ZT4B 2EDRA 3QDGA 4KJWC 3V6OC 5IBTH 3PL6C 3V6OE 4WWKC 3RHWK 3U83A 4LHUB 3SKMA 3CDGB 4EN3C 2EEBA 5DVOA 5T1DL 4ZFZB 5GGTA 4XMKH 3SJVE 3DUUA 1DQTA 2ADFH 3DECA 2MSPA 4HZLA 5FOJA 1XF5B 2WQ8A 1MHPH 5KG9B 4YBHA 3AS3A 4DQOH 2VH5H 1YQ2A 3GSQA 3HUJA 3VXME 2YSSB 4B41A 2JJSC 2C1PA 5GGSA 3D39E 4BSWB 4LEXL 2OP4H 4K7PX 3CFEB 1ACZA 4P5MB 4LSRL 4HLJA 4WRLA 1PD6A 4UDTB 1CF8H 2QKIA 4QYOB 3OAUL 4NBZB 4ELKA 1UXWB 4GW1A 4PTTA 1ZHKA 4R96B 3LKNB 2YR3A 1QRND 2P48B 3QIUB 1F00I 2B7DT 2IPUG 5FGRA 1S5IL 3VFSA 4NHUB 4L3EB 8CGTA 4QHUA 3W39B 4G9DB 1FV1B 1ETZA 5L88H 5DR5L 4AL8H 3B9AA 4KKBD 3DX8B 2HJKA 1O5DT 5I1KL 1UB6A 3JV6A 3I75A 4QTIL 3EFDL 4WU5B 5I74B 3QDME 2GTZB 2ZSVA 3FRUA 4ODVL 4QCIB 4X9HA 1HCVA 5D1XA 2DWDA 4NYLA 3X14B 4TN9A 4I0PD 2LU7A 25C8H 3FB5A 4IEFB 3LMJH 2KL6A 4OI8A 2GSGA 1CLZL 4A6YL 3INUL 2DM3A 5I1EH 1K8IA 3L5WA 5AD0A 2XY2A 5IBTL 2FIKB 2CO6B 2RQ8A 1OTSD 4BK4A 1CXIA 1FZMB 5GISH 1INQB 3MLRH 4YE4H 4BQ8A 4P2RD 4WI5A 1JPSH 3TVMB 4MJ2A 1YZZA 5FO9B 3D85D 4XMKL 4NRZA 2ADFL 3ALWA 2J8UF 1QYGL 4NC1C 4TPRH 4XBGB 1MHPL 3HNTH 3RQ3A 4NC1E 5HY9A 2VH5L 3VFMA 4JY4B 3TN0B 1NEUA 4XP9H 2OP4L 4JHBA 5IFHH 3CZJA 1EEQA 3UTSB 2AK4A 5TPWL 3F65A 2Z9TA 3KG5A 3HMXA 3HRZA 3MLTB 3RIFF 1L7TH 1XEDA 4DZBA 3MRNA 3DTXA 4ZPTB 5ISZE 1YNKH 4FQ2H 3BH8A 2ICWA 4DZ8B 4G42A 3QXDB 3JTSA 1QQDA 4PB0H 2DKSA 3VXSE 3AU1B 4KY1H 4M03A 3U7WH 3VH8G 5DHYA 4NCDA 3HN3A 3MJ7A 3BP5B 4RGNE 5T1LB 5L88L 4AL8L 5IMKA 3X12B 2X7LB 4NUGL 1XGPB 1BECA 3MACH 3BKCH 1I1YA 2Z4QB 3IDMA 1DBJH 1A1OA 1QFWL 4U6VH 3L9RB 3QUXB 2P8LB 1M7DA 1X4XA 3Q5TA 4Q9BA 5KTEH 4UDUA 4X6EA 1MELA 1TJGH 25C8L 1NFDB 2OR8A 3G04B 5C0AB 3LMJL 1ZA6B 4U0RC 3VRIB 2NY2C 4YAQA 1U8MB 4XVTH 3GMMB 5I1EL 2P42B 3ARFB 4U1MA 3VFNB 4P2QA 3WL9A 1UJ3B 1BIHA 4S1QH 3RDTD 5GISL 3MLRL 4JVPA 3FONB 2UV3A 3ARDC 4X0KA 4M00A 1JPSL 4QRTA 1J88A 1D6EA 2YBRA 4U7SA 1BM3H 3C6LD 3B8YA 2JE8A 4TPRL 2IALA 1RHHB 2B8OT 3WNLA 4UQ3A 3HNTL 4I3GA 2VLJD 3V7AE 3RRQA 2IMMA 5FYKE 4EI5B 1LK2B 4XP9L 4JGMA 3UAJD 5E4EC 3BESR 4KJWD 3WXWH 5IFHL 1S7VB 4GKOA 1KF9B 1JZ5A 4GRWF 1P5UA 3PL6D 4LVOC 5F9JB 2P5WB 2H32A 4WWKD 5ESQA 1ES0A 2XNAA 5C07E 3LD8B 5C0IA 5MHSD 4P4KB 4EN3D 4MNQA 2X4UB 1L7TL 5HHOE 5C86A 4POYA 1I1AB 4JFDB 3QUMH 1YNKL 3KYMA 4FQ2L 4F7TA 4G6MH 2KBGA 3RI5F 3GSNA 1LP9B 4CJ1A 3RL1A 4KY1L 5ECJE 5EC2B 3U7WL 4DW2H 2IC2A 2UY6A 2JJWA 5LBSH 5JZ7C 3Q6FA 3R06B 3T4AB 4LNRA 3SQOH 4XRCA 3H0TA 1FL6A 3MACL 3BKCL 1IEHA 4U6VL 5JDJA 4DTGH 1FVEB 4HKXB 2VE6B 5DLMH 3T2OA 1CL7I 1JWSB 5F88B 3HC4H 4X6DF 2EDQA 3O8XB 3KJ4C 1K4DB 4PV8B 4ZAKB 4NKDB 4LVHC 4HIHB 1NCCL 3RPIB 2WLYA 4TUOA 4XVTL 1SVZA 1J8HA 1AGDA 5ID1B 2R29H 2UWEB 4G80A 4S1QL 1DDHB 1H3UA 3SEPA 1GVIA 5HBBA 4J1UA 3UMTA 3BZ4B 1BM3L 2IQAB 4Y2DA 4KFZC 5JHDB 1HHJA 5D7IE 2GJ6A 1AGFA 4DN4H 3RNQB 3OJMB 4TULH 3TJEL 1U3HA 3MJGX 5GS1C 3WXWL 3MV9B 2XT1B 4X6CA 1FNGA 1FQ9C 4HJGA 1KLGB 5F7MC 2ESVA 1OW0C 3RWGB 1FIGH 3D69B 5CP3H 3QXVA 1U58B 3NIDE 3HG1B 5CJBA 2DBJA 5EBWB 1WAAA 3DIFA 1NC4A 3RUGB 1XF3B 3QUML 4ZFOL 3IRPX 1NDMA 4FP8H 4XAWH 3MO1A 3GSWA 5J6GB 1FDLH 3TA3C 5INDA 4K3DH 3KVQA 1XGTB 4MCYA 5LBSL 2NW3B 5D6CB 4BFIB 1TTUA 1T7XA 3SQOL 4WHYH 4OFYA 2VXTH 3CK0H 3LN9A 4M3JA 2DQGH 3V52H 4URTB 2W0FB 2A74B 1NGXB 4WFEE 4XB7A 4ZUUB 4FABH 4LOUC 1K3ZA 2EDJA 4DTGL 3RGVB 2A83A 1Y18A 2MCPH 3E6HB 5DLML 1MHCB 4N0YH 4CVUA 3HC4L 3W0WE 1G7LA 1DUZB 4LGRB 1CIDA 3WHXB 1FE8H 3PQYB 1PQZA 1PKQA 5IVXF 3PWUA 3C8KB 4E42A 2X1WL 4V1DA 1MJJB 4MJ4A 4ERSH 1RZ7H 4HX1B 2DB8A 3QHFH 1JGEB 4QKXB 2Y9RT 5DUML 5FB8A 1P7KB 1FO0H 1G7QA 1HILB 1U3YA 2DJ4A 4G8GE 4PJAE 5IHUH 3ZDXF 4BZ1H 2PO6A 3DI3B 5I15H 5C6TL 4JFFB 2GUOB 12E8L 2P45B 1OVZA 4OD2A 1BOGA 2ZG3A 4YDJB 4MAUH 4DN4L 4A2MA 5I76B 1MJ8H 1D9KB 3R4DA 1JHLH 1UH2A 5DRWA 1GGYA 5F8RC 4RRPA 5CIPA 4GW4A 3LPWA 2CDFA 3C5SB 5DFVD 2KDGA 4ALAH 1FIGL 1NGZB 4WDIB 3ARDD 1QKZH 5DUBB 2DDQH 3MMEA 4F7CB 1RUKH 4H0HB 4QTHA 5E8DL 1JWUA 4UT9L 5B39A 4OD3L 4QT5A 1G7JA 2BVPA 4FP8L 1HSAB 4WIQA 1FDLL 3V4VH 1OGTA 2FJFA 4K3DL 1JRHH 4HFUH 5F6HI 2X4SB 1RUQH 5E8NB 3VFTA 3REWA 1M7XA 4XNQB 4LCIH 5SX4H 1U3ZA 3SCMC 1NGQH 2DAVA 1MNUH 3H9YA 1T89C 1EHNA 2IPUK 3SDCA 4D3CL 2VXTL 2IAND 3CK0L 2OL3A 5C07D 3EIFA 3TO2B 4F8TA 2DQGL 3V52L 2RIKA 4PD4J 5DC0A 4FABL 2ZUQB 4KUCD 4OCWH 1JNJA 2MCPL 1DBAH 3GB7A 4N0YL 4P2OA 1L0XA 5DUPH 4NJAH 4ZS7H 4G9FB 3BPCB 3CSPA 1FE8L 1C08B 2VC2H 5C9JA 1CLOL 4XNMA 3MRBB 1BMGA 4JFPA 4O4YH 1ZHLA 4CMHB 1Q0YH 4ERSL 5JZ7D 1RZ7L 2J8UA 3QHFL 1EO8H 4MZ2A 5I0ZA 4X9GA 4K7FB 4HIIA 5CCKH 1FO0L 3DROB 2AS5M 1TQBC 1J05B 3CPLB 4BZ1L 4FA8A 3CFIC 5IOPB 5I15L 3SE3A 3QIWC 1IGFH 4HKZA 4M61B 3MNVA 3NCEB 4RWHA 5KVEH 4ZUTA 1ZGLM 5ANMA 3BDBA 5EU4B 2YZ1A 4MAUL 5C0DA 1LE5A 5IW1A 4LBEA 1MJ8L 1L6XA 2PW2B 1JHLL 3QUYA 1EVTC 1E4XI 4TTDC 5ABDE 2Y72A 2E6JA 3TCLB 1NEZA 4ALAL 4WI9A 4Q6YA 2HJLB 4P23B 3IXTA 1QKZL 3TF7C 2DDQL 5FECA 1RUKL 4FQCH 2FWOA 2YPLA 4Y4HB 1AJ7H 3V4VL 2FECI 1A8JH 1JRHL 4HFUL 1RUQL 3NFNA 4U6YA 4LCIL 4OTXL 1EZVY 1NBZA 4XGZA 1NGQL 1MNUL 4NO0A 5F7LB 1NC2A 2VLLA 1S8DB 5F1OB 2I27N 5EOCJ 2C5DC 3QXTA 2GT9B 4PJ7F 1IAMA 4WUUA 4IOFC 4I0KA 4OCWL 1JPFA 4OZHF 3LN5A 1DBAL 5BS0E 4NJAL 4FMKA 4DKFH 1JNLH 3RWFB 2VC2L 3TA3D 4C56E 3MA9H 4J4PA 1PY9A 5HJ3A 5T3ZE 3I3BA 3S96B 4GBXA 4J3SA 4D0BA 3OAZK 4O4YL 1EERB 5JA8B 3QEQE 1G6VK 4APQB 3G08B 1Q0YL 3IFPA 2VDML 3UTTE 1EO8L 2BNQE 5CCKL 1OWWA 4KI5E 4LOUD 5HHXH 1JK8A 4P2CG 2CIIB 1FYTB 4KU1A 4JPWH 2CSPA 2RFXB 3SDAC 1P4LA 2FHBA 3FZUC 3SKUD 5KVEL 5E8PB 3VXUB 1U8IA 2EYSB 1WK0A 1MLCB 1N8ZA 1LVEA 3D25A 3ZHLA 2FGWH 3FOLB 1WC7B 1VB9A 3TPUB 3ESUF 5BW7A 5EWIL 4Z7OE 3QEUA 4G8GD 2H6PB 4YBQC 3RY6A 1C7SA 1IM9A 3BEWB 4W4OC 2BSRA 3ORJA 4FQCL 3QIUC 3T8XA 4JKPH 3B9KA 1CVSC 5EH1A 1AJ7L 4WGVB 5DJ0A 1XF2B 3CVIL 2IAMB 4ODUA 4ZFFA 1UWXH 2D7NA 5KSAB 5GGVH 1AR2A 1OOAA 5IB5A 5ILTH 2DIAA 3F6IA 4WFHE 3PG2A 1CTNA 1DQQB 2EXYC 4ZO7A 5I74C 4PJEF 4X6DA 3LRGA 1CL7L 3ULVE 3QFDA 4JEGB 3AS2A 1MQKH 5K59F 4Q2ZA 1LO0H 4QXWA 1YDPB 2RGSA 5HDLA 5F70A 5HDBE 4X7TA 4L8CA 1WWWX 3ARRA 4NM8H 2A2QT 4Y5VA 4DKFL 1MFCH 1X6NA 1ZSDA 5IR1B 5IK3A 1YYMH 3D1MC 3G6DH 3MA9L 5DJZA 4OV5A 4PGZA 1GPOH 1FNHA 1OPGH 3LVEA 2O5YH 3SCMD 4JFXB 4PJXE 3TVMC 3EHBC 1Z6JT 4KRPB 1ONQB 5JTWA 3TZVB 5EBMA 3U0WH 1R5VB 5HHXL 2FX8H 5E94B 4XVSH 3STBA 2AVGA 3BP4B 4JPWL 3IDUA 4K3EH 3TN0C 1YMHA 3WS3A 1YUHA 3F8UB 4I4WA 5AZEH 4LFHD 5I2IB 4K3GA 2A6IA 4RMQA 2EEAA 1HHHB 3UTSE 3T65B 1BBJA 3DURB 3K2UH 1T4KA 2FGWL 4P57B 3AAZB 2E7CA 1WTLA 2EKJA 2V2XA 4PGCA 5JNYB 5JLZB 3S35X 3P77B 4JKPL 1I85A 4PJ5A 3UTQA 3QIWD 4LAQL 4TVPE 5DJCB 43C9A 2HTLC 3KPSA 5DA0B 1JF6A 1D5XB 4XAKE 5GGVL 1MF2L 5ILTL 2X1PA 4PJGB 3SDXE 1QOKA 4TTDD 4O2FA 5CSZB 3J7HA 4YC2B 1E0OB 4IIQB 4YGVB 4ZXBC 1BZ9B 4K71C 1MQKL 3GFUA 4NBYB 5IVXA 5DEZA 3RX7A 1LO0L 3KPLB 1XFPA 4YO0B 1LEIB 5MI0B 1NFDE 1BFTA 4NM8L 2OMBA 5C0AE 1PGRB 4YIQB 3I2CH 3WNMA 3ARFC 1YYML 3G6DL 3S36X 1KV3A 1UJ3C 5HYSB 1GPOL 1OPGL 3NZ8B 2O5YL 5DQ9B 1FFNA 3OJ2C 2VXSH 2D7MA 4XWOC 1RMFH 3BIKB 4UOJA 4KV5E 2LVCA 2BVQA 4NNXB 5BS0D 2EDLA 1OF2B 2IADA 3BD5A 4IOFD 5F9OH 3U0WL 3JSSA 4FTVD 4W6WB 4XVSL 3WDIA 1VKXA 1EMTH 5FO7A 1OY3B 3QP3A 4EI5C 5J6HB 4K3EL 4M48H 4JFHD 4NN7B 5T3ZD 3D9AH 4WHTB 1S9VB 1UZ6E 5FO8B 3HI6H 5AZEL 3VMPA 4ODWB 1KG0A 1AHWA 3IFOB 1JYWA 1NMBH 3K2UL 3LD8C 3MJ8B 4L3CB 1HSBB 3ARUA 3FQTA 3C6SA 4U05A 1I1AC 3CZFA 1NCTA 3MUJA 3SKOA 2P49B 4RFEA 1GGBH 2DMKA 1IZKA 5CMAB 2OK0L 1LP9E 3VDBA 3SDAD 4NRXB 4JJ5A 3FZUD 4M4PA 5D2NB 5HGDA 1WZMA 1JZ3A 4KDVA 3V9FA 3AREB 3LKOB 1I3RA 4NN6B 1MJUH 3LDBB 3W9EB 3ROLA 3KPNA 3IXAB 2A0LC 3L3GA 1B4RA 2BOBA 4YBQD 3O8XC 4X5LA 4ZAKC 1PZUB 4BSJA 3AFLA 4F15B 4I5BB 4OQTA 3QIUD 1VFAA 3MRLB 3ARWA 4L3ED 1KIUA 3QNYB 3CH1B 1N0LA 2K9UA 3K4ZA 1ACYH 1RK1A 2EXYD 3B43A 2NXYB 2UWEE 1NUDA 3EYVB 1QRNA 1TFHA 2VXSL 4JCMA 3VRJB 4RX4A 1RMFL 3EYSH 1EAJA 4ZPVB 4IMKC 3BKYH 2XG4A 3SPVB 1INDH 5JHDE 4NQCE 5HYFA 5EA0L 5EZOL 4BSVB 1EMTL 1FN4B 4M48L 5FGCB 3LPFA 4R90L 5IKCA 3O2VH 3OB0H 4PRBA 1BZ7B 2FRGP 4QRSB 3HI6L 1UQSB 1K5NA 3BN3B 4JLRB 4CNIA 1NMBL 2O61A 2XKNA 3TVMD 3IT8D 5E0QA 5C0EB 5DJ2A 5J12B 3HG1E 4CN1A 5ADOH 2FO4A 2D7PA 3NCJH 4Q9CA 3H8NA 4NO3A 4P5TC 3UTPE 1GGBL 2AKRB 5KVGH 43CAB 2FECL 4YFLF 2OTUB 3IDIA 2Q7YA 1K85A 4U1JB 1C5BH 3QWQB 2E5EA 1CGTA 3MBEA 3TN0D 4P2RA 4MNGA 2CD0A 4XZUA 2ARJB 3UZQA 3D85A 1V7MH 2W1NA 4LLYA 4PJ7A 3WLWC 1MJUL 1ZGLP 2XN9B 3IDNA 4OZHA 3ULSA 4NUJB 3QT2A 3BW9A 2HKHH 3RGVC 3KLAA 2R0KH 2AI0H 1CDCA 4NT6A 3ARZA 3VCLB 2CKBB 4XBPB 3K46A 1L7IH 4XCEB 3LRSB 3H9SA 3RU8H 3F7YA 3FKUS 5IMLA 3PQYE 3OKLA 4PGDB 2HTLD 1WWAX 5T1LD 3LHPH 4WFFE 5EO1B 3G9AB 3VFUA 4JRXA 1I9EA 5HI4C 1BVZA 3RNKA 4JZJB 3EKCA 3QUXD 2YC1A 5CJQH 2J12B 5T5NG 4ZXBD 1ZT1B 3VXNA 5L6YH 4RAUB 1AP2A 3BKYL 3EOBA 5D7IF 1CG9A 1INDL 1UACH 4LDLB 2EYRB 3GSRA 1D9KC 4YHML 5EN2A 5CGYC 4YXLH 5K9OA 3O2VL 4L29B 3ARFD 5MEQB 4CUCA 3RBGA 5B38G 3KPMA 3MOAH 1OB1B 3SY0A 4X7FC 4XPTH 4LLWB 1SBBA 2GTWB 3NIDF 4OGXH 1TQCB 3X11B 3O6KH 4KDTA 5FA3B 4XWOD 1QFHA 1R3KA 5ADOL 5IIEA 4PY8I 4N9GA 1X9QA 1ZANL 1J87A 2D0FA 5CEZE 3QZWA 4WY7H 4HH9A 1DBMH 4JO3H 1VGKB 3RDTA 1C5BL 4PJEA 2J8OA 4EI5D 5H2BA 3K1DA 3P0YH 2QSQA 3T4YA 1V7ML 2EDNA 4OFPA 2P5WD 3DV4A 3TM6A 4Z7WF 2ZUQC 1B2WH 5JO5A 3L7FB 3U4EA 2AI0L 1IAKB 2VLJA 6FABH 4M62L 3HR5A 5E24E 4BH8A 1I1AD 1U8LB 4JFDD 1EVUA 1L7IL 2XZQH 4MA3A 4DAGL 1XAUA 4OFVA 3Q48A 3PWPE 3RU8L 3V6OA 4G3YH 2BRRH 1RIUH 4G9FE 1KJMA 3PL6A 4OZ4B 1YMME 4DFIA 4WWKA 2AJZA 3TBWB 1IEAA 4CMHC 4NM4H 3L1OH 3SJVA 4EN3A 3LEYH 4PRDB 3FFDA 4LCYB 2LV4A 3LHPL 4OF8A 3HC0A 5HTSA 1R3IH 4PJAF 5D7KE 3VXMA 1ADQH 3G5XA 4PD4K 5CJQL 2A0LD 1N6VA 3RKDC 4CBPA 5KANI 3D39A 4F58H 2P8MB 5L6YL 2NY1B 5DD3H 1OAKL 4X98A 3O8XD 2JJSA 1IC4H 4ZAKD 1UACL 3KPRB 4XWGL 3MJ9A 1ZEAH 3KPTA 3S3JA 4U1SB 3P4NA 1MWAB 3MUZ1 1JE6A 4Y2OA 3TBSA 4YXLL 1B0WA 3H2WA 4WU7A 3ILPA 2K7PA 2XG5A 5IG7B 3P0GB 1EXUB 4K23H 5I17B 2FZ3A 3O2DH 1BWMA 4NWTH 4ACPA 4XPTL 4P23C 4EDXB 1T22B 4WI8A 5SWQA 4AMKH 1MH5A 3O6KL 3RWEA 2V5RA 5TDNA 4YHNB 1SJHB 1EUUA 4Y8DC 1OWRM 1MVUB 1T20A 3LV3A 4Y4HC 5C0BB 5JHDD 1YPZB 3IVKB 1DQJB 2FATH 5KSUB 4HBCH 2NY4C 1QFUL 4WY7L 3QDMA 1DBML 3X3GL 4HUXA 3O6MH 4GUPA 1AQDB 2C3GA 5F3HB 3P0YL 3MV9D 3RHWF 4HGWA 5EU6E 1W0YT 4LLVB 5HGAB 1E28A 1MIML 3JWOL 3PDOB 1B2WL 3PWNB 2DQFA 3HG1D 6FABL 5GS0C 3GMOB 4L9LB 1T5WB 3DGGA 2XZQL 4ZUWA 4P5TD 3IKKA 3JWOC 1DUYB 3CFDB 2BRRL 1V8HA 1RIUL 2HVJB 2BSSA 5I8EB 1AE6H 4NQXA 4HKBA 4HQQH 4NM4L 3L1OL 3GRWA 3LEYL 4OLZH 4APQC 5CAYB 3WFHB 5TQ2H 3CFBB 2A77H 2BC4B 2D0HA 3WLWD 2KQNA 3SN6N 1H3WM 1AXSB 1U93A 1R3IL 4HHAA 1ADQL 3RGVD 4PRIE 3SE4C 4XCNB 5GGQH 5I1CH 1IGYB 4F58L 4HCRH 2DQIH 5DD3L 2GY5A 1IC4L 5T1MB 4E41E 5EC1A 1FYTE 4ZTOH 4OD1H 2Z91B 3H3PL 1CFNB 2FYYB 1YNTA 3PQYD 4X5WA 3O81A 3VXUE 1FNFA 3UYPA 2E3VA 1RPQA 4AH2B 5EZJB 4WFFD 5ISZA 1UWEH 4R4FL 5J06A 3EDFA 4K23L 1RZIB 3V6ZB 3QQ4B 3O2DL 3VXSA 4NWTL 3MQIA 5HI4D 4AMKL 4UILH 2D03H 1TVBA 1U41A 4XXCA 4JFFD 2CLZA 2FATL 4HBCL 2VNCA 2OZ4H 4M9OA 2IAMC 3MGTB 5KSAC 4F7MB 1BOYA 5JOPD 1KOAA 1EGJA 3DXAD 3O6ML 1D9KD 2NXZC 4IOIB 4ONHA 5CGYD 1MI5B 4MWFA 3S34L 4K7PY 5ESVB 4X7SH 3KPOB 2PETA 2VZUA 5E8EA 1D5ZB 3KDMA 1CICB 1YEDB 5C3TA 2HT2C 4P5KA 5KOMC 4W6YB 4PLKC 4PY7A 4GKSA 3GI8H 2VQ1B 1VENA 4PRPB 5CEZD 4EUPA 4X6BB 5HPMA 4PS4L 5B22A 1AE6L 5BO1H 1FP5A 3EYFB 5J7CC 4HQQL 3ARDA 3O45A 3TWCH 4OLZL 5FDWA 3UBXB 5TQ2L 2A77L 4KRPC 1RJYA 1EAPA 1IKFH 1UB5B 1QSZA 3OKNB 4KI5F 1EBPA 5TGBB 3RBSA 4POUB 4CMMA 1QO3A 5GGQL 5I1CL 3B9EA 4NO5A 4HCRL 2DQIL 3HPJB 2X44D 3OGOE 4G9FD 3P3YA 3RZWA 4ZTOL 4OD1L 3IDJA 4LGSB 5C07A 1S9XB 4XP1H 2J6EL 2BVEA 5HHOA 1CVRA 3CX5J 3N1QC 3D18A 3FN9A 1UWEL 1B88A 5M7QA 1A6WL 3SGKA 5ICXA 2XTJC 3BQUB 2K3TA 4Z7OF 1A4KB 3QJFB 4AIZB 5F44A 4OLWH 4UILL 4ENEC 2D03L 4YDIH 1UC6A 1J12A 4HIEA 3RKDD 1YN6B 3VE0A 2VZTA 1ZT7A 4EVNA 3P4OA 5E70A 5H35A 3D3VE 2VOTA 1GJIA 1LQSR 2GITA 2NZ9C 1CFSB 4XCFH 4RAVB 1JJUA 5FHBH 2YUWA 1JUFA 2Q8AL 4X7SL 2ZZUT 4YC2C 5FK9B 3ULVF 1TJIH 4CN4A 4IIQC 2A6KA 1FVCB 4JO4H 4NKMA 2AJ3B 2OTWA 4P23D 2X9XA 1AIFB 2JJTA 5JQ6H 4FQ1H 2UYLB 5HDBF 5MI0C 3SE8H 3CVHB 3GI8L 4Y4HD 4YFEA 1LEKA 3SHSA 4P4RA 3V0WH 2D9CA 2X4OA 2NY4D 3HUJB 2P8PA 5DMYA 5BO1L 5I1GH 4KH2A 5F7EH 2M1KA 5DA4A 2DMCA 3TWCL 1SHMA 4PJXF 4NQTA 1H15B 5ALBH 3BZDA 5CBAA 4PJIE 4JG0H 1LE9B 1IKFL 1SJVA 5D7IA 2QKIB 1R24B 3EYOB 1HWHB 2E8ZA 4LCCB 3ARVA 5FYLH 4ZQKB 1SQ2N 4PTTB 4OI9A 2E7BA 5GS0D 3ZDZE 3UJIH 2DQHH 4NNPH 5GS1A 2OTPA 4NN7C 5CJOH 2I5YL 5IW6A 3VFSB 3I50H 1NLBH 4XP1L 1H3GA 1OW0A 1ZVSB 2Q76A 2FX7L 4PLOB 3DX9A 2HJKB 2PCPB 1LO5B 4APQD 3MRDB 4TQEH 2EDEA 3I75B 5B8CB 1I4FA 1TIUA 3RVXC 3OJDB 1R6VA 1HWGB 2VQUA 2ZSVB 2VXQH 3TA3A 5D1XB 3MNZB 5K33A 2W9DH 1FYTD 3LQAH 3S6CA 1OT1A 4J3TA 1F13A 5F8QC 1T83C 5D2NC 5TDPB 4OLUH 5C08B 2MJWA 3VXUD 1P5VA 2NX5B 4XCFL 3O3EA 2ZNWA 3AREC 4WI4A 5D2NE 4NN6C 4Q0XH 4S2SB 3VFGH 3LDBC 5FHBL 1K8IB 1MAMH 2W38A 3SDYH 5FYJH 3W0WA 3LSOB 1ODAA 1HXMB 1TJIL 5CLWA 4JO4L 7CGTA 2NLJA 3PGCA 5IFAH 1T5XB 5C2UB 3C5JA 3TP4A 5JQ6L 4FQ1L 1KYOJ 4F15C 1NFDF 3SE8L 1YY8A 4U7MA 4CAGA 1OSPH 3UBXI 2DI8A 1CXKA 5KSAD 2IAMD 1S7QB 1WEJL 4I3RH 3VGAB 4G8GA 5I1GL 2R9HC 3RWDB 2NXZD 4PJAA 4HUUB 4U1NB 4Y89A 3MCLH 1VFMA 5F7EL 1JNHB 2CQVA 5ALBL 4KXZI 4Z0XA 4MNHB 1NGPH 4L3AA 4OIBA 4JG0L 4KV5F 5D9SA 1HN1A 5GGUA 2DLFL 1UXSA 3GMNA 4LPUA 2X70A 3P30H 1FPTH 1LMKA 2HT2D 2J3SA 5DJYA 4YXKH 4PLKD 3BH8B 4G42B 3JTSB 3B6SB 4XX1G 2VDQH 2DQHL 4NNPL 5CJOL 4RRPG 5DHYB 2WINB 5FGCE 1UZ6F 3MJ7B 3I50L 1NLBL 2APWA 4NNYA 4AEFA 4OM0H 5CZXC 2X1XR 3QNXA 1NFIA 4M6MH 2ZUTA 1MPAH 1XGUA 4TQEL 2XZAH 1I1YB 4KRPD 1DE4A 5B39G 4U7KA 4H8WH 3TZVD 1A4JB 1G7MA 1VPOL 4UDUB 5D6DC 3VMNA 2FGZA 2W9DL 1SMOA 5C0JA 1UEMA 1LP9F 5DJAB 1ORQA 2W9EH 2W0PA 5M94B 4P2YA 1T89A 2X2YA 5FKPA 2J1KA 2YUZA 4M6OH 2CKBL 2IG2L 2B39A 3QJHB 3DNKA 4RFOH 4C57C 3ARGA 1MAML 4P2QB 3QCTL 2FHCA 3SDYL 2XN9E 5AUMB 1RZ8A 3LPGA 3QEHB 3V95A 3DLQR 2XTJD 3O41A 5EG6C 1DBKH 4O02L 1Q1JH 1INEH 2D7OA 5IFAL 4OSUL 1D6EB 5CEXB 2QBWA 4ENED 1I7UB 5SWZE 3U7YH 3MRJA 2NZ9D 4I3RL 2UWEF 4JZJC 4P48A 1NGPL 1RIVH 3S37H 1ES0B 2XNAB 5C0IB 1H8NA 4MNQB 2WQRA 3V0VA 3WFBH 3P30L 1FPTL 1N64H 3KYMB 5JXEC 5C0CD 5LGHL 5FDYA 2Y6SC 3GSNB 2VDQL 4YDLB 4JREB 1JZ7A 3OPZH 2V2WB 3C8DA 1NEZG 1A1MB 1Q9LA 3FOMA 3FQNB 1S7SB 4OM0L 1LGVA 3VD3A 1XT5A 2GK0B 1ZHBA 4LPVA 2HFFA 3Q6FB 4M6ML 1K2DA 2OQJA 3M07A 1JYXA 3MBXL 1MPAL 4GLRI 1X5JA 1IRAY 2XZAL 2Z93A 1KACB 3MNWA 1RQ5A 3EAKA 5BZDA 4JKKA 4UMGA 1HHKB 1QNZL 2YA2A 1NQBA 4Q6IB 2MCG1 4KAQH 1N3NB 1X5LA 1J11A 1P69B 5A40E 3RIAF 1J0ZA 5E9DB 5JW4M 4M6OL 1CBVH 1FFQA 3ES6B 2Q20A 4OIAA 4TUOB 4RFOL 1J8HB 1AGDB 2HLAA 5BS0A 4KUZH 3RVXD 1RURH 3WD5H 3WDJA 1DBKL 2IBZX 1Q1JL 1IQWH 1INEL 4C56A 1QBLL 4F9PC 2LAAA 3M45A 4CVZB 1KCVH 1XGQA 1UGNA 1Q9WB 1ZT4A 2Y07L 2YD9A 2FBOJ 2Y25A 3QEQA 3HZYB 3L3JA 2FLBT 1I7TA 4UNVA 4LHUA 3MRPB 4QHMB 3U7YL 1MCCA 3M1BB 3UTTA 3CDGA 1JV5B 3BX7C 3ZHDA 5C92A 1QPPA 4ZFZA 2BNQA 3ARED 3Q3GB 1F4YH 4LPCA 4F8QA 1OTUC 3MLVL 1BEYH 1XF5A 5BXFA 4IHOA 5FUZH 2ESVB 3U2SA 1RIVL 5D8JH 1MWAL 3S37L 3U79A 2H3NB 2L7UA 4WI3A 4BSWA 3DIFB 5EO9A 3WHE0 1DBBH 1N64L 3CFEA 1UEYA 4P5MA 5J1SC 1GH7A 1H8SA 5IB1A 3KPRE 2HMID 5INDB 4QYOA 5DMGC 3OPZL 5FV2A 4Q9QH 4XP5H 3TFKC 3I6LE 2R9HD 3QWOA 4HEME 4J3XA 4P49A 4O58H 3LKNA 4OQ1A 4CN6A 1HQ4A 8FABB 1CQKA 3SKJL 4QHLA 3EZJB 4NHUA 5FF6B 5H94A 3W39A 4G9DA 2X1OA 3O11B 3DX8A 1H8OA 1N5YH 1KPRB 1G7LB 4WTZA 5C0BE 4K55A 4WWID 5GRJH 4KAQL 1WFNA 4WU5A 3JWDC 4PIRF 1T1YB 2GTZA 4BKLB 1PQZB 1CBVL 4QCIA 4LQ1A 3HI5L 4E42B 3FB6B 5CZXD 1NKRA 3S98A 5CINH 5HGBB 3X14A 4Z0BH 1CXEA 5DSCB 4KUZL 3TLRA 3WD5L 4Z8FH 2D0GA 4OCMC 4L9LC 3V5HA 1IQWL 4HSQA 4LCUB 1KCVL 3TO4B 1TZIB 2DTSA 3NCYS 3O3UN 5E2JA 2FIKA 2R0WH 3TBTB 4K3HA 4PJXA 1FZMA 1INQA 3NFPB 4OD2B 2AXGB 3TVMA 2E7MA 5FO9A 3QHZH 4KROB 1F4YL 2XTLA 2D9QB 1T1ZA 2XN9D 5DRWB 1F45A 1QG3A 4GW4B 2CDFB 5FUZL 4WENB 5AZ2L 4RNRB 5D8JL 4JN2A 4LSDA 3OXSB 3A6OA 1OAZL 4TUJA 4JY4A 3RX8A 3BVNB 3TN0A 1X4YA 5DC4B 3MMEB 3WS6A 4HPOH 1DBBL 3DBXB 5CD5C 1JWUB 3UTSA 1TITA 4QT5B 4JKWA 3OR7B 4P3WA 3T0WA 1F11B 1OGTB 2FJFB 3TCXA 3BWUC 4LPTA 4R4NC 3VFTB 3HZVB 3R1GH 4Q9QL 1F97A 3TNMA 5TE7H 1KCSH 4TNWK 4YUEH 2LE9A 4FQXB 3QRFM 2OJZH 3AU1A 4PJFB 4DJMA 3TEUA 1R0AH 4HWZB 4HWEH 1G1YA 3BP5A 3EFFA 5T1LA 4XPHH 4G7VH 2X7LA 1N5YL 3SDXA 5JXED 2IEPA 2Z4QA 2Y6SD 5GGTH 2E6PA 5JXAH 5K9KB 3L9RA 3CSBA 3QUXA 2P8LA 3LEXB 1MI5E 4JFPB 1E4KC 1MCDA 5CINL 2J8UB 2X9YA 3V5KA 1CICC 1NFDA 3NIFE 3G04A 5C0AA 1ZA6A 4Z8FL 5T3XH 1RD6A 2YXMA 4LNVA 4O9HL 1GZQA 1U8MA 3C60B 4ZNCD 3ARFA 3TJHD 2EDWA 1T3FA 3VFNA 1UJ3A 2R0WL 4PRPE 4HKZB 3TGXA 3IGAA 3D0VB 3FONA 3OKMB 1CI5A 1EUTA 3RY5A 1YEJL 1A7QH 5IW1B 5C0DB 4HJJH 3UTOA 3BP6B 3QHZL 3C5ZA 1SM3H 3CXHJ 4UU9B 1RHHA 3L3IB 2R39A 1NEZB 2ZP0T 4EI5A 1V3JA 2VO5A 4FQIL 4HPOL 2WK2A 1S7VA 4QOKB 2W92A 3NH7H 2YD5A 4N90E 1AGCA 1JPTH 2AK1H 2KQMA 1PEZA 2RBLA 3EOTH 1EFXB 3J8F7 5DD1H 4AZ8A 5A2FA 4P4KA 2X4UA 4JM4H 5IFJA 3BIAX 2KUTA 4R0LC 3DMMC 3R1GL 4MLIA 3UTZA 1I1AA 1HOCB 5GZOC 3BQUC 1OTUD 1S9YB 5TE7L 1KCSL 3D2UA 1P7HL 1F4HA 2OJZL 1NC2B 1LP9A 1OARL 4QRUB 2FJGB 1NANH 1R0AL 4WHDA 4WUUB 2JTDA 3IDGA 1NBQA 2YD4A 4G7VL 4RAHA 1C7TA 4AYFA 3KPRD 5HPOA 3ZLQC 4L8DB 4JPKH 2NTFA 2QSVA 5JXAL 1MIEH 1XGYL 5DMGD 4M1GH 1FVEA 5HJ3B 4Y5XA 4GBXB 3I6LD 4D0BB 2VE6A 3BRFA 1QVOB 3KXFB 5F88A 3TFKD 2OYPA 5IB2A 3IFPB 3ZSSA 1K4DA 4PV8A 4YZFE 4ZAKA 4NKDA 4HIHA 2VDPH 4GW5B 5T3XL 2C1OB 2VZOA 3RPIA 1X5GA 3PHQB 1WWBX 5C0BD 1JK8B 2G5BA 5ID1A 5HVWA 3BUYB 2X4TB 3HMXH 2UWEA 2C3XA 1DDHA 1JNNH 2GAZB 3VFPA 1FNSH 1A7QL 2DIJA 3D25B 3BZ4A 1SM3L 2IQAA 1FG9C 5JHDA 4NQCA 4IMKA 4CRPA 4LCCC 5C8JB 3BZEB 1CD8A 4C4KO 1I1FB 2F5BH 3RNQA 1EX0A 3VXQB 1IM9B 4LLUA 3DI2B 2IPKA 2BSRB 2COQA 4MHHI 3RVUC 3NH7L 4Z95L 1W0VA 2AK1L 2F53B 3RWGA 4JB9H 3EOTL 4M5ZH 2UZIL 3D69A 1AC6A 4ZFFB 4JFZH 4JM4L 1U58A 1TCMA 5IB5B 1JGDA 3AUVA 3HG1A 5EBWA 1CGVA 4MQTB 1GGCH 3HE6B 1QUNA 5J6GA 1ED3B 3MR9A 5D1XC 1QFWM 3P9LB 1XGTA 2Z31B 4Q2ZB 1SEBB 1KEMH 2FIRT 3QB7C 4KHXH 5D6CA 5HDQH 3T2PA 4PUBL 4BFIA 5CD5D 1MCLA 2ICES 4I1NB 1ZS8B 4R8WH 5C08E 3CDCA 1U36A 2A74A 2NX5E 2W0FA 3F7PC 5DMKA 4UI2A 5DJZB 5E4IA 4OV5B 2YD2A 4PJGF 1G7PB 4GOSA 4M1GL 4R4ND 3RGVA 1JBJA 3NCMA 2FEDC 3E6HA 1X6LA 3MTRA 3QISA 1DUZA 1X5AA 1AKJA 3PQYA 5I73B 5GS3A 4FMFA 1JGLH 5EBMB 4PYHA 3T2NH 4K8RC 1MJJA 2H32H 3QAZB 1JGEA 3HMXL 2IQ9L 4YDVA 4NRYB 3VGAC 1YMHB 4I18B 1FNSL 1MI5D 1W2KT 1P7KA 1HILA 4I4WB 4PJIF 4WI6A 1QLRB 3TT3L 4KZEH 1WZLA 3GSNH 3UXFA 5BZWA 2J7LA 5T33H 1RJLB 2H9GB 1CICD 4YDJA 2VKWA 4E0RB 1ZMYA 2BCKA 2F5BL 1DLHA 1MFNA 5I76A 4W68A 3ZDZF 3E2HB 1HE7A 1KYOK 4PRPD 2YMXH 4PJ5B 3V5DA 5EU7E 3C5SA 4WJ5B 2WBKA 3OKDA 5LAXB 1NGZA 4WDIA 4NDMB 5ALCH 3ZYOA 1AD9B 4ODTH 2E6QA 3BE1L 2CK2A 1QSEB 4JO1H 4F7CA 4X99B 4OCRH 1GGCL 2VL5A 5BVPH 1LO2H 1XF4B 1A14H 3QZWG 3I3EA 3QDAA 1T1WA 3BGFB 3UYRH 3BRGC 2M26A 2X4SA 5E8NA 4YHLL 1KEML 4ZUSA 5IVZB 4KHXL 2ZOLB 4HT1L 2W65A 5C71A 3U9UA 1WBYB 4M7KH 1BLNA 4B53A 1Z5LB 3VA6A 2BZDA 2VLME 3DMMD 4P2QE 4YJZL 5GZOD 3BQUD 3MYJB 3PWPA 5JOFB 2DL9A 3F6LA 4G9FA 1FZOA 1DQLH 1YMMA 2DQUH 4GRLA 3WNNA 1C08A 3ZO0A 4NJ9L 3MRBA 2VERN 4O2EB 1JGLL 4G8EB 3T2NL 5LGJA 1VKXB 3RX5A 5FO7B 2WUCH 4ZOEA 3DUSB 2CDGA 1B90A 4K7FA 3QDGD 2YPKA 1JPST 3PNWB 4XHQA 5C0FB 3BT2H 1H5BA 3FQXA 1KG0B 1J05A 3CPLA 4KZEL 3GSNL 2VAAA 2I24N 5EIIB 2ZUXA 4JQIH 4HLZG 3B83A 4M61A 3ZDYE 1U0QA 5D1ZB 3NZHH 2B0SH 1UM5H 5EU4A 5FM5O 1A9BA 4ZD3H 4JO2H 2PW2A 3SKOB 4OT1H 3ARQA 4J7RA 4U1IB 4YDLC 4JREC 4GS7B 3VI3E 5FCUH 5I1HL 1TZGH 3TCLA 4JJ5B 1N7ML 5HGDB 5ALCL 3K74B 2HJLA 4P23A 4TVSa 1I3RB 4JO1L 2O5XH 2MHAB 4OCRL 4AEHH 4AK1A 5EOQH 1QBML 4Y4HA 3KPNB 3GO1H 5BVPL 3PGFL 4HUVA 1A14L 3L3GB 3UYRL 2KH2B 3VXTB 5K93A 3ULUC 2BOBB 4Q6IC 5SX5K 1MHEB 4NFBA 3ULUE 5EU6A 4LIQL 2DQCL 5L2KE 1CLYH 3RVUD 4G6FB 1RUAH 3IJHB 4UBDC 5E9DE 4M7KL 2DLGA 2IBGA 3VD5A 1MLBA 2F8VA 3IS0X 2BP3A 4LIQE 5F3BB 1DANT 3JXAA 1DQLL 1DJSA 5EO0A 2DQUL 1OM3H 5D1XD 3IAPA 5FA4B 2NYYC 3O4OB 2UVEA 3PF2A 3U9PH 2MKLC 1L4IA 1IAII 5CIPH 3RFZC 4X8JB 4APQA 3G08A 4MA8H 5C08D 3V4UL 2DMBA 4BZ2H 3GBMH 2NX5D 2J88H 5C0GA 3S3SA 2E27H 4PRIA 3BT2L 5JPMB 4DOHB 2FEDD 2H26B 5IESL 4E41A 2CIIA 1FYTA 2XKNB 2RFXA 2C7UB 4XBEH 4JQIL 1IGTA 1WQVT 3NZHL 2B0SL 1UM5L 5E8PA 3VXUA 2VDRH 2ORBL 4OT1L 4NO3B 2OL3H 3ZT5A 3PP4L 4K8RD 1KCUH 4FQLH 2IWGA 4MQSB 5FCUL 2EO1A 3MBEB 4X7DC 4QXGH 4HV8B 4XZUB 4KMTL 2I07B 3EDJA 5JIIA 2O5XL 4AEHL 5EOQL 4OZHB 4EEEA 3BW9B 1FCCA 3DVGB 3U0TB 3KLAB 4KKCC 3AS1A 1CXFA 4UOW1 2IAMA 1XF2A 5JUEH 2PN5A 1DQQA 1L6ZA 1CIUA 1CLYL 4HFWB 4FNLH 4K3JH 5FUOL 1RUAL 1FFPB 4XP4H 3QO1A 2PKDA 3QPQC 4Y8AA 1NCBL 3U36B 1QZ1A 1NCAH 3FN3A 3VFUB 4JRXB 2VSDA 1RZJH 4OFDA 4EUPG 1KTKE 5C09B 1OM3L 5IB4A 3TO4C 2A9ML 5IR1A 2FH6A 3VXNB 4LCWB 2H41A 4JQVA 3WO3B 3U9PL 1KENH 3EOBB 3V0AC 3BKJL 4JFXA 4MA8L 4LP4A 2J88L 1RZGA 4KROC 5K9OB 4CDGC 1XZ0B 2E27L 3TZVA 2VDKH 2WBWB 3V7AG 2Y06H 4FXLA 2VLMD 4P2QD 3GZKA 3KPMB 4GG6B 2EIDA 4HS8H 5E94A 1T80A 3U30B 5ESAB 3SY0B 4CW1A 4XBEL 3LS4L 4J3VA 1S7UB 1CN4A 4NPYA 2OBGA 2XWJB 1YEEH 4M7JL 2Y1VA 3QDJB 2VDRL 5KW9H 5I2IA 1FIEA 4J23A 1T66C 4MDIB 3T65A 4F3FB 2ADJB 3DURA 4P57A 3O2WH 1KCUL 4FQLL 4LDOB 3AAZA 2V2TB 3GBNH 2GJZA 1WFOA 2X5PA 3KS0J 1MFDH 4QXGL 1OAXL 1TPXB 2J6EA 5HDOA 3T4YB 3SDCC 4FQXC 4U3HA 3KNBA 2ICEB 3D3VA 3P77A 4MVBC 4OUUA 4PJFE 5DJCA 4MNQD 5JO5B 5DI8B 1FRGH 4H0IA 4HBQA 4M3KB 2R0LH 1RJZA 4MA3B 5JUEL 2BHYA 1VFUA 1T0PB 3GUTB 1RUPL 4GXVH 5CSZA 3S37X 4FNLL 2B2XL 4XP4L 2AJZB 5F7HA 4IIQA 3G9VA 4YGVA 1BZ9A 3SJVB 2PW1B 3FFDB 1YECH 4GAJH 2QADC 1IZJA 2FX9H 2PTUA 3KPLA 3HC0B 1LEIA 1PX4A 3ZTJH 2UVFA 2A9NH 4GRWH 5ENWB 3R8QA 1FGVL 1RZJL 5E5RB 1TNMA 4GJTB 1FLTX 3C60C 4YIQA 3VXMB 3I6KB 2XA8L 5DZNA 3ULUD 4OF0A 3SE3C 5HYSA 4X98B 1KENL 3T09A 4PJIA 3VI4E 4X7CC 5DQ9A 1N4XH 3P4NB 4Y4FA 3TBSB 4K9EH 4UBDD 1J8HD 2R4SH 2VDKL 3ILPB 4WU7B 1NUGA 2Y06L 4NNXA 4Z6AT 2HRLA 2JB5H 1NFKA 5DQJA 4HS8L 2FZ3B 3PABB 3VFWB 3EJYC 1AO7B 4JPIB 1T03H 3NACH 1UKSA 1LD9A 5LXGH 1K4CA 2PYEE 4GG8B 3C87A 1MH5B 3RWEB 5TDNB 4X4ZA 4WHTA 1YEEL 1T20B 1S9VA 5FO8A 5KW9L 4ORGB 2NYYD 4ODWA 1U92B 1L9NA 4QOKE 3NOIA 3IFOA 4G8IA 4OJFH 1KTLB 4HIXH 3FT4B 4L3CA 3H9HB 3O2WL 4UZGA 4X8XA 3QDMB 1HSBA 3GBNL 3K4AA 5DJ8A 2IJ0C 4QRPB 5D5MB 1C5DA 4HGWB 1HKFA 2ESVD 3CXHK 1A7NH 1E28B 2O93L 1PVHA 4KRLB 1ZE3C 1CYGA 1IL1A 2DQFB 5D2NA 3P4LA 1FRGL 1DN0A 5IEKA 1EHLH 5CJXC 2R0LL 3LKOA 1BX2B 2Z8RA 5F9AC 1RUMH 3W9EA 4GXVL 5HHMB 2BSSB 4J4PC 1A3LH 4GBXC 3IXAA 3AY4A 4HKBB 1HINL 4M8QB 1V3LA 4YX2H 3FTGA 1YECL 5HHNB 3KXFE 2FX9L 3T0EE 3NIFF 4I5BA 2A9NL 1U93B 2HWZH 4NQVB 4P9MH 3UO1L 4N8CH 3G5ZB 1BREA 4KKCD 3QNYA 5TJWK 1JF5A 5EC1B 5T5NF 4X5WB 2XA3A 3MV8B 3EBAA 3T77B 1LWRA 4BQCA 4K9EL 1WUNT 2MQCA 3QPQD 2YOCA 2R4SL 2SEBB 4ZPVA 3SPVA 3VXSB 4DKEH 4BSVA 3NACL 1FN4A 3RY6C 5LXGL 4OLXH 1EA9C 1TVBB 3TO4D 1BZ7A 1HH9A 3A6BL 5DRXB 1UQSA 4MSWB 1KFAH 3F7RA 5ETUB 4OJFL 2R4RH 2FH8A 2EDXA 4HIXL 2F53E 4QF1B 3VG9B 3GKWH 4H20H 1DLFL 4KROD 3V4PH 4MWFB 3HE6C 2AKRA 2EDBA 3BWAB 4Z76B 1A7NL 2JJUA 4JY6A 3KDMB 4U1JA 2Z31C 3K1KC 4YDKH 2ICCA 4IJ3B 1TXKA 1EHLL 5D71H 3Q5OA 4PY7B 4GKSB 1YEKH 4X4ME 1T66D 3IKCB 4DUXA 1O7SA 1CGUA 2XN9A 4JDTH 5LWYH 3OQ3B 5HPMB 3E3QE 4NUJA 1A3LL 4TSAH 2DLEA 1CFTB 1M71B 4YX2L 4IS6A 4CGTA 4NN5B 4OKVB 5SWZA 1FAKT 1AD0A 4YZFF 3SDCD 4FQXD 4XCEA 4YXHH 3LRSA 5KBNC 1RK0B 5I73C 2XZZA 4S0SD 2FEEI 4XPBH 2HWZL 4MVBD 4P9ML 4N8CL 1RIHH 3KYKH 5IWLA 3C9NB 3UJJH 4CMMB 3EOAB 3QAZC 4GRMB 4F33A 4I18C 3IDJB 4W81A 5AYQA 4ZOAA 2FHFA 1ZT1A 3MV7B 4RAUA 1QA9A 2XWTB 2E7LA 1VSCA 3MUY1 3BZFB 3GSVB 2CRYA 1WIUA 4DKEL 4KVCH 5JXEA 1EK3A 3E2HC 3ARPA 1MCIA 1YEIH 4RA3A 2A6JA 3C60D 4XXDB 4IOSD 4L29A 1LNUA 3VE0B 4X7EC 1I85C 2CXGA 1G6RH 3S9DB 2O26U 3O9WB 4IDLA 4U6XA 1WGOA 2R4RL 5EUKB 1VFOA 1JI1A 5FV1L 3X11A 3GKWL 4H20L 5FA3A 3IJSA 3V4PL 1X5KA 5FYLE 1QSEE 1JUFB 4DFHA 4OQTH 4LLMB 2A6KB 3BGFC 2VR4A 3UROR 4L4TB 3EJYD 1VGKA 5ADPH 4B50A 1D5IH 4YDKL 4ONOA 5GGVY 5D71L 2VLRE 4QOKD 2B4CC 4DGVH 1FORH 2NNAB 1KELH 5FCSH 4X9FA 3MFFB 4JDTL 5LWYL 1EFXD 2DQEL 1D7FA 4TSAL 3L7FA 4OZGB 1N5AB 2VR9A 3LN4B 3WNOA 3MRRA 1IAKA 2QQLL 1U8LA 5F1NA 4YXHL 1NC2D 1QHPA 3P40A 1U95B 1RI8A 4AENB 4OZ4A 4XPBL 4LHUG 4WUUD 1BAFL 3CH8A 3T0AA 1RIHL 3KYKL 5FGSA 3NBNA 4HUWB 1BQHB 1N6QH 5CSGA 4RMVA 2AJSH 4Z5RB 1REIA 4J4PD 5CILH 1MCQA 4GBXD 2Q76B 2XI9A 3KXFD 1JTTA 2Q6WA 1A7PL 1F4XH 5D1ZC 4DKAA 2OXHA 4Z7QE 3KPRA 1FNLA 1TLKA 4KVCL 4U1SA 4G8FB 1MWAA 4K2UH 3SGEI 1YEIL 1KJVB 3VJ6B 5IG7A 1NUFA 1EXUA 5I17A 3O0RL 1OL0A 5F6HJ 3V6BR 1KLUB 1T22A 5D2LB 1HKLH 2AV1B 3MROA 4YHNA 3VXPB 1SJHA 1MVUA 1BJ1H 3HAEG 5I1DA 4OQTL 5DD5H 3W0WB 5C0BA 4PRHB 4X83A 3IVKA 1DQJA 1RSFA 2HG5A 3PWJB 4WTZG 5KSUA 2NLJB 5EPMB 1U8PA 3RVTC 5ADPL 4PJ9A 1D5IL 1JP5A 4OF3A 1AQDA 1IM9D 5JW4R 1KTDB 5F3HA 1P2CB 2H2PC 1RULL 4UIKL 4DGVL 1FORL 1KELL 2F53D 5HGAA 4LLVA 3PDOA 3UZVB 5J0BA 5HYIA 2OLDA 4Q9RH 3VGGA 4PREB 5L8LB 4L9LA 3HE6D 4JDZB 1T5WA 5F71A 4Z0XB 2BMKA 1DUYA 5I8EA 5JIKA 3GMNB 3O4OC 2DTMH 2Z31D 3VFRA 4F80A 4PBXA 4J12A 1RHFA 3WFHA 3CFBA 2BC4A 1N6QL 3ZE2E 1JF1A 2AJSL 4LP5A 1AXSA 4K94H 4LPWA 5CILL 2QJDA 1U8OB 1WCBB 1MCKA 2YA1A 3NFSH 4XCNA 1IGYA 1NFIB 1KPUB 1U3JA 3ZDYF 1XGUB 5T1MA 3KPQB 1F4XL 1PYWB 2Z91A 1CFNA 2FYYA 3S5LA 3KLSA 1G7MB 4K2UL 3VI3F 4AH2A 5C0JB 5EZJA 2VUOA 3GIZH 4HGKC 2QEJA 3MBEC 1RZIA 5J8OA 3V6ZA 3QQ4A 4NFDA 2QTEA 3NIGE 2W0KA 3QUKB 1E27B 1KN2H 1HKLL 1YYLH 1KB5B 2D7QA 3ARGB 2BY2A 2IBBA 4J8RA 2VQTA 4WEMB 4P3CH 4QRRB 4PP1C 1RZ8B 3MGTA 5E6IB 4F7MA 1MFBH 3BD3A 3ULUF 4IOIA 5IP4A 2DIBA 1MI5A 2E9IA 2EE2A 3KPOA 4PJ5D 3B2UC 1D5ZA 4MQ7B 5J13B 4KJYB 5IVNA 1G9NC 1HXYA 1UVQB 1YEDA 5EIVA 3OKKB 5D7JA 4Q9RL 1QSED 2JIXB 2A73B 2IH3B 2XWBA 4HLZH 4LSUL 4PRPA 3MJ9H 2EDTA 4YH6A 2CLVB 2NY3B 1N59A 5C2BH 3H42L 4X6BA 5F96H 5C09E 3H7LA 2DTML 3EDKA 4LCWE 2V5SA 3QYCA 3UBXA 4M7LT 2P43B 3WKNA 2WWKO 1BIIA 3KHOA 4K94L 1M6OB 3OKNA 1MSPA 1Q9LB 3FOMB 3NFSL 2W9LA 1ZHBB 1ZKAA 5GGRY 3U30C 2OQJB 3BGAA 4GG6E 3HPJA 4PJDB 3STLA 1GZPB 5F93C 2R1YA 4KDTC 4K94C 3BGMA 3ZYIA 1S9XA 1WAAF 4UIMA 3QDJE 2AJUH 15C8H 2YS4A 4QO1A 3CMOH 3PXHA 1XIWB 5I1KH 5FAAA 3GIZL 5I9QB 3BQUA 3WYRA 1A4KA 4ODVH 3MXVH 1TPXC 3BP7B 2Q86A 3QJFA 4AIZA 1CDYA 4Q58C 1YYLL 3OGCB 2ZUYA 1IC5H 4U3CA 5D1ZD 3GRWH 4RAVA 1XCTB 1MFBL 2H1PH 3HNSL 3INUH 3I85A 4PGBB 2DKMA 2R15A 1MCPH 3QEQB 2VJXA 5FK9A 3L3JB 1I7TB 2ADIA 1JFQH 1FVCA 2AV7A 3UTTB 4HS6A 5C6WH 5CSBA 2AJ3A 3N1PC 3MCKB 1AIFA 2BNQB 2R1WB 3OX8B 4QLRA 2UYLA 1I7ZA 5JW4N 1QYGH 4JM2B 1ZLUK 5BXFB 3CVHA 4IHOB 1MUJA 3MJ9L 4D9RE 3U2SB 1QACA 3DSNA 4HIJA 5A1AA 2OS7A 5C2BL 2VZ1A 1G84A 5F96L 3ZKSD 3RVTD 2CK0L 2HN7B 3PV6B 5EO9B 1SEQH 1H15A 2H2PD 2YWZA 3K7UA 5TPWH 3QUZA 4G6FD 5IB1B 1MCNA 1LE9A 5GS2D 2EDOA 1R24A 3EYOA 3WFCL 4D9QE 4LCCA 1A2YA 3QWOB 4ZQKA 2GEEA 3OXRB 1KB9J 1HQ4B 3QI9B 1AO7E 4RX4D 1EGJH 4QHLB 4M9PA 3HAEB 1ZVSA 5H94B 2AJUL 3QIBA 4NUGH 15C8L 1FGNL 2PCPA 4OBSA 1LO5A 3CMOL 3CLFH 2VITB 3MRDA 3GMPB 5B8CA 5JOEA 5LJYH 3OJDA 1QFWH 5M95B 4JFQB 3MXVL 3R0NA 1QP1A 4QRPE 5D5ME 3K3QA 1KJ2B 3MNZA 4EUPH 4PJFF 1IC5L 4YPGB 5TDPA 3LS5H 5C08A 3WUWA 4LLDA 5MEOB 5HSFA 2NX5A 5L0QB 3V5HB 3GRWL 4R4BB 2H1PL 3MRCA 2LABA 4S2SA 2J4WH 4NQSB 3W9DB 4DGIH 2F8OA 1A6AA 1MCPL 3LSOA 1HXMA 1S9WB 4PJXB 5HHME 3MBED 1JFQL 5FYKH 2V5MA 4LKCA 1T5XA 2PYFB 1T1ZB 5JPNB 4LLQB 4QY8A 1JYVA 4GKZA 1KPVA 2EIZB 1P6FA 1Z0NA 4CVWA 1A0QL 2Q3ZA 4JN2B 4PP1D 3LKPB 1FBIL 5DC9B 4TUJB 1BPVA 4XB8A 1S7QA 4PG9A 3RWDA 3H7BA 4U1NA 4HUUA 3VI4F 3C08H 1JNHA 3H9SD 4YK4B 1WBXB 1SEQL 2GW5A 1X5FA 4MNHA 4YGAB 4H1LB 3MV8E 3B2UD 4CU7A 5IQ9B 1JZ6A 4JQXC 4FN0A 3Q2CA 5I6XB 5EU3B 3TNMB 2ILLA 4NZTH 1YNLH 1CZ8H 1F02I 4JRXD 3B6SA 1KJ3H 3QFJE 1RY7B 4F37K 2Y5TB 1EGJL 5C09D 2X4RA 4RGNC 2WINA 3DSFH 4XCYB 4XXCC 4OCYH 3CNKA 3EFFB 1DP0A 5EBLB 3DWTA 1JHTB 3SDXB 5A3IC 5CBEB 3CLFL 4TUKH 1LO3H 3VG9C 1TMCB 3DYPA 3RWIA 2Z8SA 1A4JA 1YEFH 5LKNA 2LVEA 4U1KA 4L8SB 1J9CT 3HCVA 2BERA 2LFGA 2W60B 3F5WB 5J89A 3V5KB 5DJAA 1BQSA 3D48R 4IJ3C 3LS5L 2ENYA 1NCCH 4PJBB 3N1FC 1GZQB 3QJHA 5F9WB 2J4WL 3STZA 5IJVB 4DGIL 3MFGB 2WIIB 1T3FB 4JRYB 1I7RA 2R1XA 1FFOA 5DFVC 3OKEB 1NPUA 5AUMA 3QEHA 3IGAB 3THMH 5GRVK 4NN5C 5FYKL 4CU8A 2P46B 2JJVA 3CJJA 4WCYL 5CEXA 3C5ZB 1I7UA 1ULVA 1T6VN 1B0GB 2VZSA 4ZYKB 1SJEB 2Q7NA 1Q94A 1D3CA 3JUYA 1VESA 3TJEH 4M43H 3QQ3B 4G6AC 2VLKB 1QEWA 3C08L 1U2HA 1AGCB 1KIQB 3HZMB 3SJVD 5GRWA 2R23B 1XF1A 5IFJB 1T7YA 5C9KA 3MV7E 5IJKC 3SGKC 3UTZB 3FO1A 2YN5A 4NZTL 1YNLL 3D2UB 1CZ8L 3U48A 4D9RD 2YXFA 1KJ3L 1J0YA 2ATKB 3LY6A 1JPGB 3VXMD 3MCG1 1NAMA 5CHNB 3ETBF 3HE7B 5MENB 3DRQB 4W6XB 3DSFL 3OBAA 2V2WA 3D39D 2AGJH 4OCYL 1A1MA 3IDGB 3VFOB 3FQNA 1S7SA 1NMCB 2XZCH 4DUVA 2GK0A 1MCWW 1PG7H 4TUKL 1LO3L 2A6DB 4G6JH 2NTFB 1ZOXA 1Q9OB 1YEFL 3O3BB 4Y5XB 1TCRA 2VKXA 32C2B 3NCFB 1HHKA 2AAVA 1HK6A 1X5IA 4LDEB 1DR9A 4Q6IA 1VGEH 1JTPA 5KAQF 5IB2B 5DRZB 5L2KA 3WEXB 1N3NA 1T04B 2JJTC 4L4TE 5E9DA 5KVMC 1YEGH 2E9WA 1Y6KR 3ES6A 3PWVB 2P24B 4R7NA 2G5BB 4WTXA 4BH7B 4UV4H 3QDMD 4XPGH 5DUMH 3THML 3VFPB 2OI9B 4OZGE 4QRPD 5CLTA 3WN5B 1EJOH 4MJ6A 4CVZA 3HLAA 4CADA 1Q9WA 1YJDH 2WP3T 4OUOA 5HYJB 5C6TH 1Z9LA 3U7AA 1UWGH 3HZYA 3DX6B 4NQCB 1FZKB 12E8H 1P9MC 3MRPA 4QHMA 3M1BA 1JV5A 3BHBB 1UM4H 4Z77B 1JIBA 4MZ3A 4JCLA 4M43L 3QCUH 3Q3GA 4LLUB 4MJIE 2IPKB 5HHMD 3DHMA 1W0VB 3X13B 1KNOA 1G7HB 4N0FA 1OSZA 3EO0B 5F89B 1B6UA 1KXQE 1BD2E 1FAIH 5HI5C 1JGDB 2H3NA 4BYHA 2X4PA 5E8DH 2I9TB 4UT9H 4OD3H 4C59B 3MR9B 1UKQA 4PY8J 2P1YA 2AGJL 3K8KA 2XZCL 2F5AH 4OBRA 1PG7L 2RR3A 4D3CH 2DOCA 3MV8D 4UB0L 4G6JL 8FABA 2AQ2A 3RJQB 4RBPK 2MQ3A 5DS8B 5DMKB 2VXUH 5D2LE 3N9GH 5FF6A 5DURB 4FFZH 5ISZD 4I9WE 3O11A 4KRMB 4C4KT 1KCKA 3VGFA 1KPRA 4PRHE 3VXSD 1VGEL 3ZKXC 1K8DA 2DI9A 1AKJB 1T1YA 4BKLA 3GIVA 1CLOH 4RGND 1YEGL 4ZOBA 5A2LH 4OZIE 2AABH 3FB6A 4ORZC 5HGBA 2EECA 5A3ID 1G7IB 2WSKA 4UV4L 4YDVB 5DSCA 4DN3H 3VD9A 4XPGL 1EHAA 2NY5H 5E1AB 3FQWA 1YC8A 1AFVH 1EJOL 4LCUA 3TO4A 3GSXA 1TZIA 1YJDL 2BY3A 5BZWB 2EE6A 1UWGL 4HGMA 1X5ZA 3TBTA 3VG0L 3NFPA 3SOBH 4TOYH 1MY5A 2OCFD 1T0MA 3KAAA 2BCKB 1DLHB 1UM4L 2AXGA 5TQ0L 5I75B 5FYKU 1U8HA 1G9MH 3AB0B 1YJDC 3QCUL 3I9GL 5KOVC 3T1WA 3V5DB 4RNRA 3OKDB 3HRPA 3OXSA 2D4DA 4JZNA 1FAIL 3BVNA 4MCZA 2R2CA 5CD3A 1SY6A 5T1KA 3DBXA 2BSTA 2VL5B 4Z7QF 2X4NB 4BFBD 3OR7A 1F11A 1T1WB 5FYKD 2FD6H 5TE6H 1KB5L 2Q3AA 4LASH 3HZVA 4OTXH 4ZUSB 4G6AD 2F5AL 5E56A 3QO0B 1TENA 5FM5M 4GSDH 2W65B 4FQXA 3U9UB 4ZO8A 2V17H 3VXOA 4PJFA 5E1HB 1BLNB 2VXUL 2EICA 3ARGC 4HWZA 5HHOD 5T3ZH 4TRPH 2BSED 3MV7D 3N9GL 4Q7DA 4FFZL 4OZFB 1VFBA 1FLRH 3PWPB 4QRRE 5E6IC 3L7EB 1CK0L 4HKJA 5IQ7H 1FZOB 2PTVA 1YMMB 4GRLB 5DVMA 2PUQT 3MLSL 4LHJB 5K9KA 3RIAK 3LEXA 2YD7A 4O51B 4HS3B 3ME0A 1A6UH 2AABL 1HEZB 3MUGB 5J13C 3C2SA 5LGJB 1VEPA 1JZ8A 3CFKB 2VDMH 4JKLA 3CC5B 4DN3L 2V9QA 1DANU 2NY5L 2CDGB 3FO0H 2YPKB 1I75A 5KSBB 2XQYG 1H5BB 2P4AB 1AFVL 3C60A 1VEMA 3FQXB 4YR6B 2VIRA 4UAOB 2NY3C 1ROWA 4JRWA 1OGAE 2VAAB 5F7DB 5HYSG 1OLZA 4L4TD 2NY5C 3SOBL 4TOYL 3D0VA 3OKMA 4OLYH 1A9BB 2OJEB 3U46A 1Z2KA 1G9ML 3WKML 3RY4A 3ZE2F 3BP6A 1A22B 3WIHL 1QSVA 4RGOH 2OR7A 4UU9A 4HUMB 3L3IA 2WBJA 1S7TA 5EWIH 3IYLW 2PYEA 4FXGB 1SJXA 1G9MC 2RB8A 3TNNA 4PJDE 4QOKA 4Y1AB 4R9HA 2JCCB 5DJXB 4ZDHB 3ULVH 1EFXA 3GJFB 4HUVB 1C8PA 3CVIH 2FD6L 5TE6L 1NGYB 1XIWC 5I71B 3FFCB 4LASL 5I9QC 5A2IH 1HOCA 3AVEA 5EU6B 1S9YA 3NIGF 4KGLA 2IMNA 3GSUB 4GSDL 2HA1A 4FOMA 1CL7H 2V17L 4QRUA 2FJGA 1TNNA 4HAGA 5T3ZL 3ARTA 4TRPL 1SYSB 5HI5D 1MLBB 4PGEA 1FLRL 5CJXA 1GYAA 4IM8A 5IQ7L 4L8DA 5EO0B 4KQ4L 5D7LB 5EB9A 1A21A 5HYEA 2BHZA 3WSQL 2DI7A 5I66B 1A6UL 4LSQH 1QVOA 3KXFA 3T0EA 2NQCA 1GOFA 2VISB 4UQ2A 2EH8H 5K9QI 2GJJA 5C0GB 4WFED 5E2WH 1EO7A 4KI5C 5JR1L 5IB3B 3FO0L 4PRIB 4GW5A 2C1OA 3L95B 4JM2C 3PHQA 3W0WD 2Z92B 4PRHD 5GSVB 3LH2H 2ERJB 3BUYA