3V8OA

Human filamin c ig - like domains 4 and 5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
193
Chain Sequence
QAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Filamin-C
publication title A novel structural unit in the N-terminal region of filamins.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v8oA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v8oA01
4LAQH 2A74B 1ZANH 2ED9A 2VO5A 3FB8A 3K7UA 4U7SA 3KXFA 5IJKC 3MV01 2ZUSA 1A7NH 5L6YL 1KEMH 3E1F1 5F89B 2FEDD 3A6CL 1KPUA 1F6FB 5JIHA 1N5AB 3T4YB 1OARL 4IRSA 4ZQKA 1YQVH 4ETQA 1NC4A 4NWUL 1QOKA 3S96A 4AL8H 2YRLA 1T83C 3BSZH 5FECA 4OCWH 4WFFD 3DUUA 4EVNA 4LSQL 1IT9L 4NNYA 4R7DA 2APBA 1OQOA 5CJQL 1CLYH 1CZ8H 1BEYH 4LHUG 5GRJH 1QKZH 4JO2L 1NSNL 5J6HA 1OPGH 5CJ8A 1IVLA 2PW1B 3BD5A 4LP4A 5FHAL 1YEKH 3MGAA 2YD4A 3C60D 3MJ8B 2FRGP 5F6HI 3SDXE 3SJVB 2P8PB 4WDIB 3QEUA 4HWBL 4IHOA 5C2BL 3VE0A 1MJ7H 2VKWA 4YC2C 3VFMA 2H41A 1DN0B 1CDYA 3TIEB 1MRDL 4MGXA 5IFJA 4JKPH 3PUCA 2WIIA 1I1RA 5JZ7D 4IDLA 4K9EC 4PYHA 4ZOCA 1IAIM 1J7VR 5FGCB 4XB8A 4R2GC 3NN8A 2XRAH 1FPTH 1HZHL 1MREH 1NEZA 4PIRF 3IFOB 3ZTJG 4MDIA 2G60L 2XZAL 4L8BB 5C7XL 2BNRA 2J4WH 2DL2A 3CSPA 5F1IA 4G6FB 4F58L 1WFOA 4TNWK 1FZJB 3QDMA 4LCWA 3B4NA 5L2KA 3ARBB 4L3ED 2VRAA 3BZFA 3QDJD 4X9HA 1JNLH 2FEEI 1MJUH 4OZHB 5EU7E 4TPRL 2I9TB 3D85B 4MAYD 2YUZA 3WIHL 3RGVD 2W92A 4KGLA 4UV7L 5D8JH 1RIUL 2DBLL 4U1NB 1LP9A 1H9VA 4XMLL 3TYFB 4YFLI 1CK0L 1ZAGA 2FX8H 5C0EA 1UM5H 3QUML 3RWFB 3P30L 4G9FE 2AJZB 2XY1A 1MCDA 1IQWH 2UY7A 5CS7A 1GRWA 3HC4H 3BPNC 3HZKA 3Q48A 4C54A 1RZJH 1G7JA 4KV5E 1U8JA 3IXAA 1MH5B 4OI9A 5KW9L 2F8VA 3SGEI 3F6LA 1SYSA 5C0IB 1G9NC 3QUKB 5EUOA 1VACA 1G9ML 1N5YH 5KVMC 3CVIH 1AQDA 2VDPH 4OFVA 4U1HB 2Q1EA 3OG4B 5B4MC 4FFYH 3FQRB 5TDOA 2JCCA 4M1CD 3JWDH 1SBSH 5HVGB 4OJFH 2R2EB 2Z31B 3GNMH 1NBVL 1HSAB 3EYQD 4KMTH 5JQ6L 4PJ5A 4ZUVA 2GAZA 4IJ3C 5IHLB 3BH9B 4U05A 1KJ2H 2F15A 3B2VL 1HHGB 4ZO6A 2EYSB 1B0GA 4JAMB 3DPBA 4MJIE 2ERJB 2F54D 3DVGA 3RZCD 3FN3A 5HI4D 4X6DB 4O2FB 5J1AA 4PJCF 1N26A 1JWUA 1XGRB 5T3ZH 2X10A 2PXYB 4M4PA 5L7XL 4ELMA 1YJDL 2MKWA 3FT2A 3G9AB 1CXKA 4GKOA 3ZT7A 2VLKA 3R1GH 3RWJA 4XBGA 1LO3H 4XT1C 4WW2C 1T21B 1QYGH 1KJ2A 3P4OB 5ICXA 3WV0A 4MQ7B 2DRUA 3IDMA 4KJWD 2CLVA 3IFNL 5E2JA 3RA7L 1XGUB 2BNQB 1YN6A 3LQZB 3HI5L 4HF5H 3OR7A 1T5XA 1V7NL 5CWSA 5GRXG 4L5FL 3TT3L 4JQIH 1CFNB 3BEWA 5CD3B 5KSBF 1RIHH 4NO3B 5E2WH 5BRZB 1E4WH 2P4AB 4MJ2A 3HZMA 3B3IA 1F4WH 3W5MA 1MIEL 5JORB 2BY2A 4M1DL 3LMJL 3D2UA 1F4YL 2DICA 3UTQA 5H35A 2KKQA 5EH1A 5C0GB 2EYRA 1W72B 1V3LA 2PYEB 1U3HD 3UPRA 4DW2H 3RDTB 1CBVL 4HUXA 4XWGH 2BVOB 1XF4B 4X6CB 3QDGB 2WQRA 1OCWL 1R5IA 1ZWIA 3FN0L 1S7TB 3PJSA 4GG8B 4F15C 3VRJA 1JGLL 2QQKH 5FA4B 4OZIA 4U0QB 3VFTB 3TFKD 3UJJL 3OKDA 1RJLA 3G6DL 2GITA 3HZVA 4MJ6B 3S5LB 2DJUA 3IJSA 1OF2A 5CD5C 3TVMD 3CC5A 5IV2B 5E94B 2WMPA 3QP3A 1O0VA 4Z95H 5A2IH 3BN9C 2PO6B 4RQQB 1ORSB 3O2WH 2QKIA 5EORL 1UWGH 1YZZA 1ZLVK 4HC1L 5T1MB 4UDUA 1YPZE 1E4KC 3GRWH 4OGXH 2YSSA 6CGTA 5FO8A 5KVEH 5DEFA 2BDNH 3O6MH 4PFEA 4U2YA 2Z91A 1A1MA 3O9WD 1NGPL 4NN6B 3MX0A 1I8LA 5F7FA 3LEVL 3SGKA 2ERJC 3A67L 1MLCA 3W39A 4PJ7E 4QXUL 2V5SA 3DRQA 1L0QA 4YWGL 3W0WB 1A22B 2P7TA 4JFPB 4TSCL 3VWJA 1VFMA 4YHKH 3BKCH 1QHOA 4O4YH 3WDHA 1AGBB 5I1HL 1CQYA 2IQAB 5IROA 1MCNA 2PXYC 3BHBA 3RWDA 3GRWA 5AAWA 4M62L 1UYWH 2XV6B 1NMBL 4K55A 3RTQB 4FTVE 1P2CB 2AXGA 4AT6A 2DKSA 1IAII 1NGZA 3GSXB 4KKCC 5LJYH 4GG6F 4Q2ZA 5C0BA 3MCLH 1QLFA 3D69B 5GGSA 3LSOA 3U36B 5GZOD 1RUQL 2QADB 4OZ4A 3BZEA 5I8KH 3OKLB 4W68A 4KK8D 2VZOA 1QSEA 1S7UB 1NQBA 2E6JA 1PKOA 1I3UA 1TZGL 3V5DA 5I74C 4ZFGL 4UQ2A 4PJCE 1J0JA 1LE5A 2GSGB 3WDJA 2AXFB 1ZLVH 4ETYA 1GOHA 4K07A 3CLEH 3GI9L 5DMGD 3GSQB 5I18H 4ZXBD 1JRHH 3HLAA 1NLDL 1Q0YH 3AS3A 3K2UL 3T8XB 4I13B 4BZ2H 4MD4A 2EZ0D 3JVGC 3U2SB 1MLBA 2EICA 3KPLB 4TUOB 1DUZA 3BRGC 3BVNB 1EAPB 4WHTA 3L95A 2NXZC 4WENB 3TCLB 1NGXA 3FFCD 3RDTC 4C83B 5IIEA 3UTPE 3FJTA 5K59F 4NOFA 1RHHB 3OWEA 4CU6A 4OT1L 4FNLL 4HIJA 4PS4H 2VQ1B 2WLYA 2D7TL 4OM0H 2BFVH 4I0PB 2BSTA 4P2QB 3VG0H 3S4SB 2X1PA 3MLZH 3C8DA 3KPSA 4Z0XB 4LDLB 4K8RD 4M3JA 4WTWA 3FO9A 4XNQB 4KQ4H 5I16B 3VXRB 1X5XA 2LTQC 2V9RA 4QO1A 4JZNB 4Y4HB 5F88A 1HOCA 4QYOB 1BVLA 3RPIB 3SDAB 4ZO9A 1F11B 2GEEA 5GQBA 3ARGD 4Q9QL 3RVXD 5FIEA 2F5AL 1DJSA 2BY1A 2G9HB 4GLRH 1AH1A 2W9EL 2V7NB 3QXVA 4JRXA 3ARYA 4GAGH 4PR5A 3RPKA 3C08H 5EOQL 2B0SH 4QRUA 4JM2D 2X4TA 3HPLA 4PJXB 5FYJL 2VR4A 1QP1A 4X8XA 4RX4A 4MVBC 3HE6A 1X44A 3IDJB 5H37G 1P5UA 4BUGA 1IC7H 3QIBA 3VXUB 2OQJB 2EDYA 3B8YA 1KULA 2C4FT 3V6ZB 3C5JA 3X13A 3WLBB 1ZK9A 4MD5B 3H9SE 4OF3A 4FA8A 4UIKL 3CGTA 3TBWB 4I3GA 1S9WA 4H1LH 4KH2A 5HDBF 1T03L 1K8DB 3ZE1F 2R0WL 1EJOH 2BC4B 3QDAA 3ORJA 4U6TA 1N59A 2Z0BA 3N0PB 3UJIH 2CDFB 5K9OB 12E8H 5HVHC 2XA3A 5E8OB 1T89C 2A9ML 2Q87A 3VXSE 1LEIB 4HXBL 2DWDA 1C5BH 4PJGA 4OLZL 5SWSE 1P1ZB 2M2DA 3QQ9C 1KV3A 1HN1A 1CGUA 2J1KA 1C5CH 3FHAA 1N6UA 1KCKA 1G7IB 1W0WB 2QADC 4M7KL 1VADA 5DRXB 2IPKB 1CDUA 1LD9B 1FG9C 3NCJL 1C1EH 5IKCB 3RHWK 5J57B 5I6XC 4Z7WA 4NC1C 3OPZH 3MJ9L 2EECA 1UCBL 5IHBA 4K23H 2W0PA 2JJTA 2X44D 3PWPD 5I1IH 3EYVB 3HA0A 4KU1A 3CFDA 3LHPL 1RD6A 1XT5A 4MB5A 5CP3A 3GSNB 2HVJB 1KCSH 3O0RL 2ZKHH 4FHBD 3KPNB 4L4VD 1A02N 4YDIH 2ZNXA 1XCTA 3WSQH 4O2CB 1U92A 1Z2KA 4ODWB 3EIFA 1T6VN 1Z9LA 2VDNH 4JDZA 3EO9H 4EUPB 4XZUA 4MJ5B 1LO2H 3T0AA 4WWKD 3GSVB 4U3HA 5J8OA 5DK2A 5T33H 3IAQA 4GOSA 3G6JE 2Z93B 3CFBB 4Y4HC 4HUVB 1BGXL 2UYLA 5B22A 4HIEB 1J0KA 3RU8H 4S1QH 3W11C 5D7SL 5I1CL 1HEZA 5DD3H 4L3CB 1BBJA 5JQHC 3BAEL 3V8OA 1DQLL 3KR3L 5BMFH 3WDIA 5CZXD 2ADJB 3NH7L 3QBTB 2Y7QA 2V7HA 1A6ZB 3S3PA 4TTGA 2E7LC 4OF0A 4QOKA 4UQ3A 1DEEB 1IEBA 3PL6A 4XP4L 2BVUA 3BPCB 3V5KA 2SEBB 1CCZA 3HPJA 2YEZA 1EEYB 1S3KH 4KC3B 5I75B 3S35L 3QHFH 5JXAL 5KOMC 4PUBH 3H0TB 1BJ1H 4ZTOL 1R3KA 4DGIL 5J13B 3ARSA 3FFDA 4JRYB 1QQDB 5D1XA 2OK0L 3GZKA 3LZFL 4NJ9H 4L9LB 4XAKD 3D1MC 4BKLB 4F80A 1FRGH 1N8ZB 1T1WB 4JFEE 4DVRL 1HHKA 3MV9E 4FMFA 3BYTA 5F21B 2Z8SA 3O81A 4DOHB 2YK1H 1UZ8A 1ZT4B 3P11H 5D1ZB 4D3CL 3GI8H 3DETC 3FCTA 4LPXA 1RU9H 3GFUA 4N1CA 1I8MA 1SMOA 5CJOH 1MOEA 2AJYL 1EBAA 3N85L 4UUJA 5C0AE 3TNMB 2G75B 3HRPA 2B8OT 3STZA 3V6OE 4Z18A 1U8LA 2EH7H 1ITCA 2CO6B 3PQYB 2DQFB 4KI5E 3H42H 4Y1AA 4RWYL 1CGVA 1OD9A 1P7QA 2KQNA 2JB6A 1NC2B 1G7QA 4O51A 3DX6B 3WE6A 4WWID 1G0YR 3ZTJH 5IJKA 4PJEB 1IZKA 2DDQH 3VU2A 2HT2C 2P49B 4NQCE 3AGVA 1MY5A 3UP1A 1UKQA 3DXAE 1OY3B 4H0GA 3GSRA 1JPSH 4K3HA 3MLSL 5IR1B 5FKPA 2NY5C 3MLVL 1CE1H 1FLRL 2XN9B 2X4OA 3KHQA 4F7CA 2VH5L 3JWOC 4YHNB 3RL1A 4Z7NE 4IRJC 3SE9L 4NO2B 4LLMA 1XGTB 2YMXL 2J3SA 3O6FA 4RGND 4S2SB 3Q1SL 3UTTB 4NN5B 4D9QE 3BZ4A 4PRBA 3G5ZB 1AKJD 1P9MC 4AEIL 4U1IA 3O3EB 2YBRA 2FECI 2FX9L 3LN5A 4K9EH 1QSFD 4C56D 5ISZD 3GMLB 4GRWB 2ICWI 3TESA 4MQTB 4DUVA 3NFNB 3KPRD 4KRPD 5IBTL 3RAJL 4NKIL 1OP3K 5FGBA 1Z6JT 1KCUL 2RHEA 3QUXA 1EO7A 2ZCHL 2JIXA 5GGTL 1S8DA 2ESVD 1UM4H 1A9EA 2FJHA 4MWFA 4BELD 1OAYL 2H2PD 1JPST 4M3KB 5L8KB 4G6MH 3UTSD 4PRPE 1OP5H 2HFTA 1J87A 3QXTA 1CT8B 3O45B 2I9LA 3VD3A 4ZUWB 4QXGL 4UAOC 4WU7A 1JGEB 1DSFL 3DYMA 1E4XL 1HH6A 5CZVH 5J13C 2NQCA 4P46D 5KS9E 5ENWB 1G9NL 2GSIA 3HMXH 4OLEA 2HJKB 5CHNB 3BP6B 2R2BA 2FGWL 4L9LC 3OZ9H 1FE8H 4M7JH 2XWJB 1UCTA 5E2VL 3MPCA 1I1CA 5DK3A 3FB6B 2XXCB 4I2XE 5IVZA 1QSVA 5D1ZC 1UJ3B 3Q3GB 4WCYH 2APVA 4J3SA 3MRPB 3VFUA 4L4TB 1E6JH 2A6KA 5DO2D 3IU3B 3I50L 4J3OC 1PD6A 5TGBB 4HUMB 1MAKA 2IFGA 3REWA 3UMTA 4DGVH 5LQBL 5T5NF 3VXPA 4L1DA 2EE3A 2BX5A 2XKNA 4HJ0C 3UO1H 3HMXA 2J88L 5K9JL 4G8EB 4LSVL 1OP3H 4PREB 4OFYD 1ZGLA 1N7MH 3T04D 2DLTA 4QLRA 5DMIL 5DJDA 1NL0L 3B9KD 3SCMD 4KJQD 1E28B 5D1QD 4LVOB 1J05B 4LMQI 3GMOB 3QNZB 5E2TH 1RUPH 5F89A 4YPJA 1NFDE 5DQDL 5D9SA 1N5AA 2F53B 3IAPA 1WBZA 3G9VA 4KTDL 1CL7L 1OAKL 1PY4A 4MD0A 4E5XB 3A0OA 1J5OL 2CIIB 2IGFL 3GMRA 3CDGB 1WIUA 4KKLD 2YHGA 4CDGC 2NY6C 1MFAH 3V4UH 3SQBA 1KJVB 3EZJB 5FFLA 3L7EB 1TJHH 3ZDXF 2EDDA 5D7LB 4RFEB 3PP4H 4X9GA 5JUEH 2OL3B 2F8XC 1C8PA 4UMGA 5A3IC 4RGOL 4EOWL 2PW1A 4N8VB 4MA8L 3VRIB 3MJ8A 5A2LH 4HK0A 1CDIA 3HE7D 3SJVA 2P8PA 3C5ZB 4WDIA 3OXSB 2X4RB 3MOQA 1JHTB 1DN0A 4G9FD 1UVQB 4QHUA 5FO9B 1J0HA 3WKNA 3HCVB 4LSSL 1FV1B 3VI3E 2XTJC 1HHJB 3FQUA 2A73B 5TF1H 1QBAA 3IFOA 1I3GH 4QRRE 1ZT1B 3O3AB 1FVEB 1S9KC 3AAZB 3MA9L 4LOUC 1FO0B 4CU8A 2Y25A 2ZOLB 5JPMA 1FZJA 4K3GA 4HKXB 3ARBA 3L3KA 4PJ8D 4RIRB 4NO0B 1BMGA 4CN6A 1F5WA 2VITB 2X4UB 2IBBA 2OYPA 4I5BB 5IEKB 3CFJB 5JLZB 2I9TA 2AK1H 2VE6B 3ZL4H 2BXZA 1EUUA 3VWKB 1Y0LA 2BVPB 3O4LD 3QCVL 4ZS6C 2V5YA 5EWIH 5CILL 3FOLB 4DCQB 4R3SB 4V2CB 4LPUA 1U8OB 3T0WA 3RWFA 2VDMH 1XAUA 5ICZB 3VFNA 2BVYA 3GHBL 3VW3L 4HEPG 1RJCA 4OZGF 3RX5A 4G7YH 4OCMC 4ZAKC 3QEGH 1EIBA 4JVUA 3KLDA 1MH5A 2H8PA 2QSCL 3ARXA 3EOBB 5E00B 1DANU 1F4XH 4S1RH 4OCRL 5DFVD 5C0IA 4LVOC 3T2NH 4B0MM 3QUKA 4PRDB 4EBQH 4J8RB 1B0RB 4U0RB 3C5SA 1NEUA 4NRXA 2CR3A 2Y6SC 4J7RA 5JDSB 3HZYB 4NQXB 2R2EA 2Z31A 3QEHB 1HSAA 4B7IA 1WUNT 2B5IB 4NUJA 2D0FA 3BH9A 1S5IL 4YX2H 1FGNH 5BV7B 2OI9C 2BZDA 1HHGA 4ODVL 2EYSA 3QCTH 4JAMA 4XP6L 3UEZA 4LSRL 3D9AL 1P7KB 3QWQB 3EJYC 4K7PX 4X6DA 4O2FA 3L5XL 2GW5A 5JPNB 3ECBA 1KTDA 3O8XC 5ADPL 4V1DE 3WN5B 1XGRA 5IK3B 1I9RH 2IPTH 1L9NA 3QJHB 3FO1B 3P0VH 4BFEA 4HS3B 1W8NA 4QNPE 2JB5L 1YEIL 3C5ZC 1T7WA 3JV4B 1T21A 2NMSA 1ADQL 4MQ7A 1IM9B 4OLVL 1FN4A 3PNWB 3MLYL 1W72H 2IANE 1XGUA 1A6AB 1H8SA 2BNQA 4QRPD 5EIIB 3LQZA 5BO1L 4QTIH 4GJTB 3MQIA 4PJIE 2DQJH 4FZEH 1HHHB 5GRVL 4PJBB 3KPMA 3KPPB 2NYYC 4RGMC 5I1GL 5D72H 1M71B 2AAVA 1RFDH 5FYJE 5DJ0B 1A6UL 4LCCB 4MAYB 4H8WH 3RGVB 4OD3L 1MELA 4YGVB 3HC3L 5GJTH 1QNZH 3MRCB 5IF0A 4MNGB 4N8VG 5C0GA 5LG1A 1W72A 3HMWH 3SDCD 3LCYA 3TNNA 1V3JA 5LBSL 5H2BB 4LLVB 3RWHB 4UIMB 3TJHD 3VGHA 5CUSL 4RA3A 4P5TA 4F9PC 3F62A 1A6VL 1XF4A 1JL8A 1XF5A 4X6CA 3QDGA 1HCVA 5C6TL 4UZGA 1S7VB 3PXJA 3U1SL 3P73B 1S7TA 4GG8A 4LK4A 3QQ3A 1V7ML 3AROA 3GBMH 3QUYB 3VFTA 5E4IA 1NFIA 1CXFA 3S5LA 1VGKB 4MJ6A 1WCBB 3T3PF 1PSKL 3N1FC 3ZT6A 4UV4L 2DAVA 4ZNCD 5IV2A 5E94A 1WZKA 3HR5A 1E6OL 1Q9KB 5IFAH 1EUTA 1WSST 2O5YL 1W0YT 1NAMB 1CLZH 2PO6A 3KYKL 3CX2A 5C0CB 3K80A 1CN4A 2ZCKH 4ERSL 1ORSA 4S0SD 5J7CC 4MA1C 3X3GH 5HHME 4LVNB 3RX8A 1PKQE 4XRCB 4KKBD 5T1MA 2ARWA 4AK1A 4NUGL 3WJLC 5BV7C 4MX7A 1TJIL 2IAMD 2PYFB 2UY6A 5IVXE 5F8RC 3QIUD 4GRLA 4MSWB 5HHOD 3LRSB 1B6DA 2EXYD 4JFPA 5T3XH 3ES6B 3WNPA 1AGBA 3WN5C 3WNNA 5FKAA 2IQAA 3ULSB 4TQEH 4DQOL 5KVFH 4AG4H 3O6KL 4ZUTB 5EFIB 3TLRA 5BXFA 4WJ5A 3ELAT 3UTPD 3TH4T 2AV7A 5HHXL 1I1FB 1T89A 5CJBA 3RTQA 3D3VE 1P2CA 5F1OB 3OTTA 4X6EA 1MHPH 1DN2A 3WNMA 3GSXA 2AEPL 3ETBF 4LGPB 5HDQH 1GGBH 3D69A 4KVCH 3U36A 3EFDH 4ZD3H 2HN7B 5AZEL 3QSKB 3OKLA 3ZDZE 4GXVL 4JPWH 4PJAB 3T3MF 4R26L 1S7UA 5F96H 3WIFB 4F37K 1JWMB 3LS5H 1OQXA 4XVTL 5L0QC 1AQKH 4LCCC 2CMRH 3R0NA 2GSGA 4IOFD 2AXFA 4XPBL 3DURB 4AL8L 4KUZL 4Q97A 3GSQA 1N6QL 4Q9RH 3RWGB 1K8IB 5DDHB 2P5WB 3LEYL 2CRMA 3W2DH 1SY6L 4ZNEA 4R8WL 1MFCL 3U2SA 3FQXB 4TUOA 3SKOA 3BVNA 2R29H 1XF3B 1EAPA 3MUGB 3TCLA 3TJEH 5D2NC 4J6RL 5CJXC 2YD7A 5I0ZA 1CFVL 3V7MA 4Z78B 4HW6A 3RVWC 1RHHA 5DJCB 1FYTD 1AXIB 1HKLL 1QLEH 2VQ1A 1PBYA 4I0PA 4Y8AA 1E4JA 3S4SA 5JA8B 1JYNA 3IJHB 3K0WA 3P4LA 3S37L 1QRNA 4Z0XA 4XNQA 5I16A 4MXQD 3GB7B 3MXVH 1I9IH 2ZCLL 3MRIB 4JZNA 2EIBA 4QYOA 2VZVA 4FRWA 3MBED 3SDAA 5KSUA 3STLB 1F11A 1YMMD 3SDYL 3QPQD 2G9HA 4LVNC 4PLKD 5D7JD 3QULB 4TNVK 1N0XL 1NCDL 3C9NA 4DZBB 1FNEB 4PJHB 3K81A 4XBEH 4UTBL 1M6OB 2DBJA 4PJXA 4M7LH 3FRUB 3EO1A 3OXRB 4R90L 3BO8A 4Z0BH 4DN4L 4ODTH 3S98A 4LSUL 3IDJA 4XPAL 4BSWB 2E8YA 4WGVB 5TPWL 3VXUA 2OQJA 4Q6IB 5I1DA 5GHWL 1K5NB 3WLBA 2DJ4A 2R4RL 5BQ7B 3KXFD 4MD5A 3ULVL 3IXTA 3N1PC 3TBWA 2QQLH 1K8DA 2YOCA 2ITCB 2BC4A 1YUHB 4HXAL 2ZUUA 3IRZA 1MNUH 1CGXA 4HG4J 4IRSD 5K9OA 1NC4D 1A7QH 3S88L 5E8OA 4PLJC 3VG9C 1SYVB 3JWOL 5FYJU 1RK0B 1DFBL 1DP0A 2Q3ZA 5TE7L 5HYSB 1QBML 1G7IA 4KTEH 4N1EA 1YEGL 4O58L 3GSNH 1X5KA 4M7LT 4O2EB 1MI5E 1SJEA 3ARDD 2I26N 1MAJA 2UUDK 3OAYK 2IPKA 5DRXA 2NY5H 1KB9J 4PJDB 4J23A 1LD9A 4JFHD 1IL1B 5IOPB 5IKCA 2YC1B 1AJ7L 3M1BB 4PRIB 1D9KB 4WV1C 1DUYB 2ZG2A 4PY8I 4ZSOA 4EUPH 1AY1L 4GBXD 4OZFB 1OGAA 4K7PY 4CMMB 3EYVA 3U7WH 4BH8B 1CF8L 3NOIA 1PG7X 4Z7VB 1TCMA 3BN3B 4JG0H 3GSNA 5BS0D 2HVJA 1BQSA 3MRDB 5I66B 3PHOA 5TH2B 3ZSTA 4U1SB 4LRNH 5ILTH 4XBPA 4O2CA 1VCAA 1OAZL 3IU4L 3U0WL 1DBBH 3Q6GH 1GAFL 4EUPA 2B4CC 4MJ5A 4W70A 2BNRD 3GSVA 4JREB 4ALAH 2LV4A 1P4BH 1OB1B 3NCYS 2R56L 3SEPA 1T1ZB 3BE1L 4LCWD 4HUVA 5L2KD 2WUCL 5JW3H 3MV9D 3NAAL 3VMNA 2AS5M 1CR9H 3QCUL 3V5HB 4L3CA 4NKMB 4MLSA 1Q94A 2UUDH 3OAYH 3MLTB 4LU5L 4KMQA 2ADJA 2D7PA 4ONFL 4XVJH 3DLQR 4YLQT 1A6ZA 3QHZH 1KCVH 2KH2B 3NABH 1DEEA 3D48R 3H3PH 4XTRD 3C6SB 3MRJB 3BPCA 2G5BA 4WO4D 3CLFL 3SQOL 2SEBA 3BWUC 1RMFH 4UTAL 3FO0H 4HV8B 4WFGD 4G3YL 5I15L 5FGCE 4WI2A 4OGAC 1RZFL 4Q6IC 2NY3D 5HXMA 1PG7W 4XB7A 1NBYB 3LN9A 3CVHL 5ID0B 4OI8A 4JRYA 3VGDA 1QQDA 3DROB 1RUAH 1EO8L 3W82A 2XFXA 5B39B 4L9LA 4BKLA 1N8ZA 2P8LB 2OR9L 1T1WA 1KCLA 1KF9B 2AXHA 2R1YB 3SE4C 5J3HD 4PJ9D 4POZC 1ZT4A 4YZFF 4RRPA 4PJ5D 4DVBB 5EBMB 4WI8A 5DEZA 1YYLH 4D9QD 1X6LA 1IAIL 2I25N 3VFRB 2A6DB 2E9BA 4TSAH 3TNMA 2G75A 3MYJB 4HIHA 3G5YA 5C8JA 2DM2A 3KDMA 2R0KH 4XPHH 3PQYA 2DQFA 5KBNC 3T0EA 3VFWB 2DIAA 5GGVL 3DX6A 4QHMB 3U6RB 1IC4H 4L29A 1A3LL 2R8SH 3ZKMC 1TQCB 4M9OA 1Q72H 3SE8L 1SEBB 3MRMB 2ICCA 15C8H 3EJJX 4AIZB 3ZDYE 5GS1A 2EDBA 4K2UH 1T0PB 4GRWH 1EAJA 2WUBL 4JY5H 4FQIL 1T1XB 4KK5C 2XN9A 2P24B 2NY2B 4U6VH 1B2WL 4YHNA 5INCA 4NO2A 5T3ZD 2UWEB 5JR1H 3JUZA 4S2SA 2VN4A 4JDTH 4W4NA 3TGXA 2KPNA 4JREC 4EZMA 1WAAA 4TSBL 4G8IA 4KGJA 4LCIH 5IFHH 4DUWA 5CINL 3NFNA 3U30C 5HVFB 5I0DA 4P4KC 4IDJH 3WKMH 5IB5B 5ESVA 1MCWM 4HUWA 3OB0K 4BQCA 4X5XA 4I77H 4M43H 2Y5EA 3DI3B 2AI0H 2AK4B 4R9HA 2O93L 3OGCB 3CXDL 4UINH 1CT8A 3O45A 3GBNH 4ZUWA 3HS0B 2DM3A 3N1MC 1BM3L 4JG1L 1JGEA 5F44A 5ENWA 4NQTA 1JTPA 2HJKA 2OR7A 3C8KB 5CHNA 1IC5H 3PGCA 3BQUD 1HILB 2XWJA 4EDWL 1DVFB 1ZT7B 3MCG1 4NZTH 3FB6A 4J4PA 3ZKSD 3CFCH 5FYLL 3EAKA 3QEQD 2R2HB 1UJ3A 2ZJSH 3Q3GA 4JB9L 3RX7A 1CD1A 3MRPA 5E99H 4L4TA 1CS6A 3IU3A 4HIXL 5TGBA 4UT6H 5C92A 1ED3A 3NPZB 4MNQE 4KKAC 4LLAA 1WFNA 4G8EA 1M7IB 3PABB 3ZKXB 5FDWA 3D6GA 3VWJD 1RJZB 4O02L 3NCEB 4XCNB 3OB0H 2BOCB 3PGDA 3MOAL 4LDOB 2VLJB 3TV3H 5FA3A 4C57C 2MWCA 4M5YH 4YFLF 1TQCC 1J05A 1KXQE 3QNZA 5ELIA 4QEGA 5BZDB 4UBDD 4G7VH 4GS7B 2OL3H 4JLRB 4AENB 2F53A 1MCBA 4JQXA 1BQHG 1GGCH 4ZYKB 4E5XA 3I9GL 5C0BD 2FO4B 1C08B 2GJJA 2NY2C 4KAQL 5L9DL 2NR6D 2CIIA 1QSFB 2HH0H 4LLWB 5ISZB 2KUTA 3CDGA 3GO1H 1REIA 5I1EH 3EYUL 1AO7B 5GS0C 2MOVA 4NHCH 4K94C 1LP9F 4G5ZL 4PRHB 3PGFH 1KJVA 4XCCL 3DX8B 1FSKC 3K1KC 3LKSA 2F58H 4QKXB 2Y36L 1IJ9A 3VXTA 4CNIB 5D7LA 4RFEA 3N1QC 2OL3A 2FATH 5IG7B 4ZTPL 2MQ3A 1EGJH 1UEMA 4NZUH 1QR1B 2F5BL 2W0LA 5EBGA 4WFHD 1YEHH 1P4LB 4HPYL 2J12B 3VRIA 1HINH 1VEOA 4QHKI 1KB5L 1AIFB 4WI7A 2H2SD 1BVZA 1FO0H 3BGAA 4CGTA 3OXSA 5EUOF 2X4RA 2F8OA 3ULVF 2NY4D 1JHTA 4JQVA 3MRKB 4ZO8A 2VSCA 3ARWA 5DHYB 2OJZH 2JCCF 3HCVA 3JBG7 1FV1A 3EDDA 4HWEL 1EGJA 3IFLH 5E8NB 4M03A 5JHLL 1HHJA 2A73A 3I6LD 5AWNL 4GFTB 5E8DH 4MB3A 1AHWC 4PTTB 2IPUK 1ZT1A 4KHTH 1LILA 1FVEA 2V9QA 1T5WB 3AAZA 3LKOA 3FQWB 1U3ZA 2ZOLA 4NC1E 2XYCA 5IWLC 2AJVH 4HKXA 3AREA 4RIRA 4NO0A 4S1DC 3T77B 2VITA 2X4UA 1DVFC 4I5BA 5IEKA 3CFJA 5CCKL 5JLZA 4FQ1H 2HFFB 1KYOJ 1JI2A 4BZ1L 4ELMF 3VWKA 4APQB 2BVPA 1K6QH 2DL9A 2FB4L 4NM8L 3FOLA 4TNWF 5FM5M 3WJJC 4M5ZH 4R3SA 4AYFA 4DCQA 5F97E 1U8OA 5E5MB 3SCMB 5C09E 3SDXB 1ZSDB 2ADFL 5D1QB 4Z7OF 3ARQA 3KLAB 3CX5J 1G0XA 3QIBD 4AZ8A 3ZKXC 4HJJL 2RFXB 2AJSH 4Y89A 2NY0D 1T22A 4XMPL 1CU4L 5BV7H 1ZTXL 3LKQB 3EOBA 1GVIA 5E00A 4OB5H 3LPGA 1FIGL 1JE6A 3MTRA 4PRDA 1M1SA 3S36H 4J8RA 1AC0A 3LQAL 4P9MH 4Z8FH 1I7UB 3D39E 1I1AB 4M6NL 5ICYB 2D03L 5JDSA 1C5DB 5A40E 3HZYA 4NQXA 1ZA3B 5HYJB 4EKXA 1JHLH 3QEHA 2P44B 5EG6C 3IFPB 4NN7C 1KNOB 1MCPL 4RFNC 2A9NH 4F33B 3C60A 4NZRL 4FZ8L 1H0DB 1BIIB 1P7KA 1FBIL 3KPOB 4OZIF 4XPTH 1LO5B 2ATKB 5JPNA 1AR2A 5E6IC 5JNYB 4G9FB 2VDKL 1PDKA 3C6LB 2FECL 3BD3A 3QJHA 3WS6A 3QDME 1BWMA 4V2BA 4P2OC 4HS3A 3PDOA 3JTTB 5E2UL 4XHQA 3JV4A 5F71A 1PEZA 3QXWA 5F7EH 5C0NC 2DQHL 2EIEA 1IM9A 2A83B 4YHIB 3WHE1 1A6AA 4GMSH 5EIIA 4BQ8A 5B8CB 5CMAB 1HHHA 3HFML 3P9LA 4M8QB 3NA9H 4PJBA 4W6XB 1DQQA 3KPPA 4L8SC 4L3EA 4FFWC 5DLMH 3RBGA 2HRPL 2Z92A 5DUBB 5DJ0A 3STBA 1MFBH 4MAYA 3HNVH 5GZND 3MV8E 3HI6H 1T2XA 3RGVA 4Y5XA 4CDHA 1Q9OB 4TOYL 2LU7A 4TUJA 4X6BB 1OT1A 2AJ3B 4YGVA 5GGUB 3BP4B 4MJIB 1H3VA 3MRCA 4HUKB 5IBLD 4XWOC 3V0AC 3QFDB 4KK9C 4AJ0A 4DJMA 2J5LB 4P5MB 5EUOE 2VDRH 5HD8C 5H2BA 4Y16C 1XIWC 2W9LA 3LIZL 4PGEB 3RWHA 3LDBB 4UIMA 1KJMB 3RFZC 1CTOA 4HT1H 1IQDB 3QUZD 1NAMH 4D9LH 4UDTB 1KXTB 3ZKNC 2G2RB 3GGWB 1S7VA 3P73A 2HT3C 4NRYB 4XP9L 4Z6AT 1ZHBA 2MQCA 3QUYA 1LMKA 1VGKA 2AKRB 2EXWC 1WWAX 1KENL 5FV2A 1MEXH 1RHFA 2V2XB 4WI3A 3S3SA 5IUSA 5D1XD 3T1WA 5I8EB 3BIAX 4NFDA 4JKWA 5IJVB 4FQCH 1P84J 4YHPB 1JPGA 2RAMA 3NACH 1PLGL 5DRWB 5MENE 4BM7A 2P5EE 3SN6N 1NAMA 3D3VD 1JYXA 4LFHG 3AM8A 2XG4A 3RZCA 4XRCA 2A77H 2N7AA 4LL9A 1ZEAL 4G6JH 5KTEL 2CKNA 2FX7L 5F7DB 4M61A 3HNTH 3UTZB 5EU7C 2PYFA 3P9WB 3JV6B 4MSWA 4NWTL 3DMMC 5B38A 4Y1AD 1HK6A 4GXUN 1YEEH 4NP4H 1J10A 4MZ2A 2ZUWA 2W0KA 4BFGA 3ABZA 3LN4B 4P59H 3REVA 2DM7A 1U58B 4ZUTA 5EFIA 1N4XH 3MZGB 3SOBH 1I85C 25C8H 1I1FA 3NFPB 3CCHB 3VFGL 3QI9C 5DHVB 1KTRL 5JXEC 4UILH 2X40A 5M7QA 5I9QB 4PGCB 4LBEA 1RZIB 3U46B 3V7AG 2B4CL 1UACH 1BFSA 5CSBA 4PJAA 4CMHB 2EDFA 5ETUB 3WIFA 4OZIE 1HDMB 1JWMA 2F19H 1TCRA 3FT4B 4XNYH 1HKFA 5F8QC 2W60B 2EC9U 5F9AC 4OCYL 2MCG1 2H1PL 1T7YA 4NM4H 3RWGA 4U1LB 1K8IA 4HKJB 5DDHA 2VWEE 3L5IA 5J12B 2P5WA 4PJ7B 2AVGA 3MGOB 3UYOD 3FQXA 2J5LC 5IHUL 3O3BB 4HFUL 1FFOA 1XF3A 1DL7H 2JIXD 4GW1B 3WO3B 1U8QB 2D2OA 4P23B 3ILQC 3FTGB 4X99B 2AP2A 2HVKB 4Z78A 2MPAL 5IQ7H 5DJCA 4RMRA 2GFBB 1U8NB 2FLRT 4NCC1 2WIMA 5E5RB 4PJGF 3MLUH 4R2GD 1HHIB 3T0DA 3F7YB 1MWAL 4FTVB 1P53A 1IAOB 3IJHA 4QXWA 2DB8A 4N8CH 3IVKB 3PHSA 4P5KA 3RRQA 1AXTL 1LDPH 1SEQH 5FB8B 3S34H 3RIAF 2HTKC 3GB7A 4KDTA 3MRIA 3BOVA 4Z7WF 2BERA 4QHNB 2VZ1A 3STLA 1BOGB 4NOBA 1QFUL 5DUML 4PJCB 2VISB 4PB0L 1D5XA 1XR8B 1ZHKB 4I48A 4U3CA 3QULA 4MLIA 4DZBA 5IP4A 1GC1H 1P4IH 4PJHA 1BFTA 5CLTA 3WFDH 1JP5A 5A2JH 4YHYC 1M6OA 3FRUA 3OXRA 3MCKB 3RZWA 5DQJB 4DUXA 4GKSB 1PVHA 4MS8C 4BSWA 4QWWC 5KJRL 2XTJE 4Q6IA 1K5NA 4LEOB 4I18A 4TRPH 4PG9B 5BQ7A 3F12B 3NCYP 1WJ3A 1I7TB 2ITCA 2BK8A 1YUHA 2DI9A 2X4QB 5T1LD 1QUNA 1R3IL 5B4MD 4KFZC 1P7HL 5JIKA 4HLZG 1HNFA 1NANI 1SYVA 3QRGH 2MFNA 4OZFH 4TVPH 1L7IH 5C0RL 1RK0A 3OJ2C 5D70L 1MCOL 2E27H 4OD1H 5HYSA 4JPIA 4NKQB 5GISL 2C3WA 4O2EA 3BDXA 4CMHC 4PJDA 4XP1H 1RI8A 2YC1A 1UH3A 3NFSH 1D9KA 4YFEA 1DUYA 2DI7A 4Y4FC 1ZA6B 4YQXH 1FDLL 4OZFA 4AIOA 4CMMA 5DFTA 3ARFB 3GMMB 4OFIA 5D7KD 3OL2A 5E95B 5EOTB 4BH8A 2NXYB 2JJUA 1DLFH 5E03A 5LAXB 1KPVA 1UT9A 1ULVA 3H9SB 4DN3H 1MIML 1Z5LB 4NQVB 4PP2A 1BQUA 3MRDA 3H8NA 4U1SA 1FYHB 4YXHL 3SE3C 4NO5B 1UJTA 4XP5H 5SX4I 5FYLE 3MBEB 3AY4A 3VXSB 4Z76B 3MROA 4MA3B 1R5WB 2IMMA 4LAJH 1H3PL 5SWSB 1EA9C 4G6FD 1OB1A 4LARL 4ZUUA 5HHVH 1RZKL 1T1ZA 3VFOB 4O9HH 1WZMA 1QO3B 4YHML 3A6BH 5ALCL 2HTLC 4IIQC 4DFIA 3D85D 3BDYL 3X11B 4HG4K 4X7DC 4H20H 4RMUA 3HTLX 2VDQH 1CWVA 1T0MB 5JHDE 2MJWA 4M6ML 4Y8DC 4D94A 4PJGE 3U83A 3IYLW 4NSKB 5GRUH 2R0ZH 4LLYB 4WHYH 3T4AB 3ZKQD 5J89A 1DLHA 3B5TA 3I6GA 3MRJA 1B6UA 5LGHH 3GKWH 1J18A 3NIDE 4HV8A 3K74B 5CD5D 5AYUH 5ANME 4F7EB 5I8CB 2XICA 2YD2A 1NBYA 1Q0XH 4ORZC 1JMXA 5CEZH 5ID0A 2L0DA 2XKUA 3DROA 2OP4L 3MOBL 1QBLL 3BN9D 2AEQL 5B39A 3O3DB 4NYLB 2P8LA 2QSQA 4H88H 2R1YA 3MJ6A 2UZIL 3I3BA 4XPGH 3NZHL 2J8HA 1I7ZB 1OT2A 2HFGH 2R1XB 2Z31D 2VLMD 3G6JB 4WY7L 2VZUA 5E8EB 2XNAB 4DVBA 5EBMA 1JNNH 4BFIB 1GJIA 4K94L 2C3XA 4UNTA 1GOFA 5KVGL 1R3JB 3GMQB 4OLXH 3DBXB 1INEL 5BVPL 3VFRA 2A6DA 2WM0A 3MYJA 1GPOH 5LWYL 1CICB 3LD8C 1OSPH 5C3TA 4N68A 3D25B 5GS0H 3BKJH 1LO4L 1VFAA 2PXYD 1BOYA 4QHMA 4LSTL 1V05A 2LQRA 1KIPB 4FXGB 4IMKA 1TVDA 2NXYC 2ZNWA 1BIHA 1T6WA 2CJUH 3KJ4B 4AIZA 4JO1H 1YEFH 4N9OB 5IEHB 2BNQD 2P24A 3I84A 3QQNA 4QOKE 4XVUD 2IFFL 4JFEB 3LKRB 3MV9B 2BSRA 5EU3B 5HHPB 5DZNA 2X41A 4J3XA 3RVTD 4JJ5B 2E9JA 4XCFL 1G6RL 4JHBA 3V52H 5BRZD 1PW3A 3SKNB 4YEFA 5DSCB 4N0CC 1U2HA 1Z3GH 4AMKH 3PP3K 1GZQB 3AU1A 3K4ZA 4FQLH 5C0AB 4NQUA 3DECA 1F3RB 1NAKL 5JZ7C 2PYED 1CXEA 3U4BH 2OCFD 4WO4B 2NXZD 4HGMA 4KROB 3RDTD 1NGQL 1DZBA 2VLRE 1AQKL 1KLGB 2WK2A 5SWZB 1EEQA 2DQUH 3TO4C 3QDGD 2NTFB 3E6FB 4XC3L 4RAHA 4MNQD 4P9HC 3OGCA 1OW0A 4NQCB 4ZS7L 3BMVA 3IS1X 3V4PL 5EO9B 3L9RA 1JZ3A 2Q76A 1KG0B 3DXAB 2YD6A 3BEVA 1QFWM 3HS0A 4X8JB 1VPOH 1JHKH 1JZ7A 3F5WA 4Y5YA 5D5ME 5I1LB 3V4VH 4M6AA 2YA0A 1YA5A 4PJ9B 4XPFH 3V9FA 1J88A 5ITBH 1IBGH 4KZEL 3G5XB 3PWNB 4HWUA 3RUGF 3C8KA 4K3DH 2PO6D 2XZQH 5IWLA 1AXSB 1KLFA 4PD4J 4JZOB 3QUMB 4RFOL 4NGHH 1DVFA 4RMWA 3TBVA 3MLWL 4Z7UE 1BVKA 2XPGA 5DD0L 5L88L 3VFVB 5F9OH 3DOSA 3UC0L 2R2HA 3UYRL 5DWUL 1TQBB 5D2NE 3FZUD 1MCQA 3LVEA 3CFKB 3PP3H 5GJSH 4OLYL 3L3DB 1NCAH 3PV7A 3W0WD 5D6DA 2I60L 3ZE0F 4OV5B 5EOCL 2C1PB 1M7IA 3PABA 2BHYA 2EH8H 1HXYB 1RJZA 1RZGB 4TUKH 3WFHB 4XCNA 3BKYH 4PRPB 4LASH 1FZKA 1IKFL 3ULUH 3P2TA 1I9JH 1IKNA 2VLJA 1J12A 2XQYK 2CKBL 3BISA 4KUCD 4ZUSB 4CAGA 5ABDE 5ITFB 1JZ4A 1JUFB 4GAFB 5SV4A 2VXQH 2XWTB 1FVDB 4K71B 1Q1JL 3RTQD 3CDYA 4JLRA 3MRHB 4AENA 3P4MB 4PPTA 5ADOH 4HIIB 3BWAB 1AKJA 3EW3B 3QQ9D 4ZYKA 1M4KA 2FO4A 3WFBL 1JZ8A 1C08A 5T3XD 2BSED 3N50A 4K7FB 1FORH 2QADD 1QSFA 5C07E 4LLWA 5ISZA 3VGBA 1J0ZA 5F7YC 4FQPA 3RY6A 4PB9L 1AO7A 4P57B 1A1OB 2AJUL 4DEPB 4PRHA 4JM4H 3RVVC 1MHHB 2C5DC 4LPCA 1FNSH 2EEAA 4ODSH 2YPLE 1FC1A 2DQCH 4CNIA 4EN3B 2EDHA 5IG7A 5SWQB 43CAB 4Y4KB 1QR1A 1ITBB 1OM3L 1P4LA 3UBXI 3EKCA 4YUEL 1AIFA 2CK0H 3NVQA 4ZOEA 1QSZA 4WW1B 4EXPX 5DJYB 2A6JA 5F9WB 3B9AA 1A6WH 2BNUB 4I3SL 4P46A 3MRKA 1QACA 4HBCL 4Q6YA 2NX5E 3WUWB 5FCUL 4P3DB 5IB3B 4JFDE 2DYPB 1CG9B 3O6LH 3QWOB 1U2CA 4I0PD 4LMQE 2Z4QB 4P2QD 1NFDB 3MGTB 2YKLL 5E8NA 1MJ8H 1U3HC 4M8VA 4JFFE 1D6VL 1UC6A 3VXRD 5FYKL 3V6FB 1A0QL 4M6OL 4WI6A 4Y4HD 1T5WA 4DKEL 3B5GA 3FQWA 35C8L 3SDAD 3WFEL 2GY5A 4MMXC 4FQJH 3E8UH 3H3BC 4ZFOA 1ZLSH 3T77A 2NNAB 3VD5A 3TFKC 1A9BA 2HRLA 2PKDA 4TULL 5DD1L 3T2QA 2HFFA 2VXTH 1A7RL 2D4DA 2E8ZA 4APQA 3TVMC 5C70A 3FMGL 3GM8A 4JZJC 1BAFH 2XA8L 4ONOA 5E5MA 3SCMA 3SDXA 4OQTA 4NNPL 1ZSDA 4WFEE 5D1QA 1VHPA 1T2QH 3KLAA 3MR9A 1AE6H 3MBXH 1WTGT 3VFPB 2RFXA 1V8HA 4Z77A 1MHCB 4MA7L 3U9UB 3QJFB 3RUGE 1MCRA 4JFZH 3LKQA 5MHSD 1I8KB 4P2RE 2IMNA 3QXAA 5FHBH 4G6KL 3CXHK 2ENYA 1N2RB 4DTGH 4WI5A 5B3NA 2AQ1A 3O9WC 1SJHA 1VFBB 3G5VA 2A38A 1EHLH 1DBAH 3BPOC 4QRRB 5IGXH 5DURB 1I1AA 4PV9A 5I1JL 4UT7L 1WZ1L 2R39A 3GHEH 1C5DA 5DJXB 5D7IF 1I75A 3IFPA 5JW5B 3ZE0E 1KNOA 5BZWB 2VR5A 5F7LB 4YBQC 4X6CF 1OHQA 3FOMA 1A14L 4BFBD 1H0DA 3HE7A 1BIIA 3OAUL 2Y4SA 2VDLL 1LO5A 1A21A 2ATKA 5DZOA 1JGDB 4EN3C 1H5BC 5JNYA 2N56A 4G9FA 5ACZB 3EDEA 3DNKA 4Y4KC 3C6LA 2B1HL 4OGYL 5SX5K 1WGOA 5M94B 2HYMA 4FXLA 1J11A 4KK8C 2FHBA 4CVUA 1WIPA 2WWKT 3ROOB 1R3HA 3TBTA 1EHAA 5F9WC 1UM6H 4M1GH 2O26U 1WT5A 2A83A 4YHIA 3PWLB 4ZXBC 1QFWI 5DJ8B 2FR4B 2CUMA 5B8CA 2W38A 2RJMA 3SDDB 4M8QA 2OSLA 3CX5K 4PTUB 15C8L 3F58H 4JJHA 1BJ1J 2Z35B 3WD5H 1Q8MA 4QRTB 2EC8A 2IH3B 3HAEG 5MEND 1NCWH 2C7UB 4CRPA 4PRIE 4PP1C 5GSVB 1UB5B 1WFTA 4MJIA 1NLBH 4KY1H 2ZOKB 3QZWB 1RUKH 3QFDA 5IESL 3B5HA 4P5MA 4JO3L 3ZSSA 5L8JB 2VAJA 4RBPK 4PRAA 4LF3B 1A5FL 4Z7VE 1W0VB 4KUCF 4PGEA 3MO1A 1KJMA 4V1DB 2NY0B 4WEBH 1U6AH 4YAQB 1FCGA 1CFBA 4ONGH 4UDTA 2G2RA 3V0WH 3GGWA 3C09B 3WUWG 1FC2D 1EHXA 1FZOA 1MCIA 1GCFA 2A2QT 4OLUH 5SX5H 3ARGC 4WI9A 2OTWB 4CN1A 4CW1B 1QEWB 4D9RE 2NY7L 2IANB 3BUTA 2J8UE 4Q0XL 4GSDH 3RIFF 2BSSB 5I8EA 3NCBB 3MUZ1 3KJ6H 3U9PL 1DQMH 5IJVA 4YHPA 5DGRA 1BPVA 5DRWA 5J11C 5HGHB 5C86A 3QG7H 4HGWB 1UXWA 2XQBH 4MCZB 3IDYC 5D1ZD 3VJ6B 3FONB 4FP8H 3AFLA 1KFAH 4NQEE 3THMH 5F6IB 1NBZA 3L3IB 1TPXB 2B20A 5F7DA 1JPTH 2DQGH 2FSEA 3UTZA 4HJ0D 2MQ0A 5DHVH 4IMLB 2CH8A 1BBDH 3BKMH 2Q20A 3J7HA 1LK3H 3PQYD 3JV6A 1CFSB 4RBPH 4G8GE 1ES0B 2JELL 4JY6B 4I9WD 1NC2D 1T4KA 4Y7MA 1ZLWK 4ZG1A 1OAUH 3O41A 3FO2B 1H15B 4KQ3L 1GGIH 4LLUB 4LSPL 1MAMH 4YDKL 1BWWA 2AABH 1LK2B 2FJGB 2EDXA 1U58A 2NCMA 4MDJA 4FABL 3HKFA 1A6TB 2CXGA 2DM4A 3HG1E 3LEXB 4PBXA 5D7IE 3CCHA 4N5UA 5DHVA 1VEPA 3K46A 3SGJC 5DD5H 3MXWH 4A6YA 3UYPA 2X7LA 3OMZA 1RZIA 3U46A 5DS8A 1KLUB 3UTTD 1KTLB 3IDXL 1V3KA 3DIFB 5HHMB 3DO3A 1PKQB 3NPSB 5CEZE 4PJXF 1PYWB 1HDMA 3SDCA 3C87A 1AI1H 1YPZA 5C0JB 3DHJA 3FT4A 3TA3B 4GMTH 1PX3A 4GQ9H 2W60A 4MQSB 4KPHH 4OD2B 3ARUA 5A3ID 2B2XL 1BQLL 1A7OH 2Q8AL 4RA0C 4U1LA 4HKJA 1CXLA 4Y2DB 1A3RL 5IVXB 2ORBL 3GSWB 4PJ7A 3LS4H 3MGOA 2DKUA 1I8IB 3O3BA 1NMCB 4GW1A 1U8QA 4P23A 3FTGA 2F58L 1MHEB 1UA6L 3WIIL 4WWKC 3MODH 4WTZG 4A2LA 5TQ0L 2HVKA 4XCYB 1ZLWH 3GSOA 2F74B 3P77B 1MFDL 5FUOH 3BFOA 2GFBA 1U8NA 5C08E 1SBBA 2XTJD 1HHIA 3F7YA 2UWEE 3D3VB 4FTVA 4HCRH 1H3UA 4KRLB 4LQFL 4BH7B 5GIRB 2FNBA 3IVKA 3H9ZA 5CZXC 4LOUD 2Y07L 4OCXL 3MNZB 2ENSA 5FB8A 5F3HB 1U8MB 1CFTB 5FK9B 1IGFH 1WWWX 3UTOA 3P3YA 4QHNA 1BOGA 4O00A 5I30L 1J1XH 1S7QB 2VISA 3OJMB 4J4PD 5IQ9B 4KZDL 1ZHKA 2VLLB 3QIUA 4LHUB 2VUOA 1TDQA 3MLRH 5IMOB 4L4TD 2ZG3A 4E0RB 4HCRA 1NCBL 5F6IC 1AC6A 5GPRA 2HKFH 1QFOA 4KXZH 3TWCL 1EMTL 1TZIA 3MCKA 4E41E 1S9YB 4ODUB 3UDWC 2HKHH 5DR5L 1ACYH 4GKSA 3S35X 4HDIB 7FABH 4FFVD 2J6EH 4ISVB 4EI5B 3K8LA 3IJYA 5JO5B 5JIPA 4PG9A 3F12A 1WVZA 4JN1H 3CH8A 1IGIL 1I7TA 3KNBB 3VXME 2UVFA 4JANB 1UXSA 2Y6SD 2F53D 2XZCH 4OSUH 3CK0L 5E9DE 4JHWH 4K7PL 2JJVA 5MP6L 1RULH 3MRFA 4P3CL 3DI2B 1Q9WB 2OZ4A 1XGYL 3DTXB 1WBYB 2FBJH 3FT3A 2IH1A 2J6EA 1MRFL 4YHOH 4AEHH 5HGAA 1AGDB 3CSGA 3L3HB 5ID1B 1UZ6E 4YE4L 1YYML 5FUZL 4MCYB 3EJYD 2R0LH 5IT2L 1BFOB 3I02B 5D7LD 3TA3C 4YC2B 3LB6C 2PR4L 1ZA6A 4Y2DC 2LVEA 1FYTA 4FQ2L 5HHQB 5HGBB 3ARFA 5EOTA 3C5ZD 4RGNC 3ISWA 1NMAH 5LAXA 4JO4L 4P9HL 3VGGA 2Q86A 3H9SA 4WU5A 4NQVA 1Z5LA 3O2VL 1IGML 3NCFB 2DTML 4MAUL 2NY1B 2BJMH 4N90D 2CQVA 4NO5A 3MLPA 3QWRD 2WBWB 3K8KA 5JOFA 3VH8G 1FAIH 1KUMA 1BZ7A 2NYYD 3D0VB 4F9LA 3EGSB 3MBEA 4KRPC 3TF7C 3DSFH 3VXSA 4Z76A 4MA3A 3HHRB 5SWSA 1MF2H 2HLAB 3JUYA 4Y88A 4GQPH 2BVEA 2H2PC 5T5FL 3KS0J 3VFOA 1MUJB 3UJTL 4OTXH 4NO0D 1MI5B 2X1QA 1QO3A 4NQDE 1F8TL 2EO1A 4E42B 3L7FB 3QQ4B 4O5LL 4MXVF 1FGVL 2ITDB 1JFQL 2B1AH 1X7QB 3VWKD 1D7FA 1OAXH 1KPRA 5DC9B 3I3EA 1D5BB 4JFOA 4G43A 3BP7B 3VXQB 4RAUB 3BZDA 3I2CH 5B3JF 2BP3A 4NSKA 4MXWL 4LLYA 3UBXG 1UB6B 3T4AA 5EZIH 3BMWA 1RZ7H 4R4FL 1JBJA 1KELH 4NJAL 1NUFA 2R4SL 3HUJE 1DBKH 1YECH 3P40A 5TE4H 3WS3B 4UT9H 2E9IA 5T1LB 4YXKH 1INDH 6FABL 4F7EA 5EZOH 4EI5C 1NKRA 4QRSA 1LO0H 1QFPA 4Y2OA 4C59B 1MPAL 5TFSL 1TVHB 5T1DL 4IJ3B 1WAAF 5L2JB 1YC7A 4ZSOE 5L6YH 4RAVB 3O3DA 4NYLA 3A6CH 5LCVL 1RURL 4GRWF 1OARH 3ARDA 4NWUH 1I7ZA 2R1XA 3G6JA 2CLZB 2VC2L 3CH1B 4BFIA 4LIQL 3B9VA 3UZQA 3B9KC 1R3JA 4LSQH 1CGSL 3ARPA 3DBXA 4GBXA 1IT9H 1S9VA 3TT1L 4WW2B 5CJQH 1U8HA 3Q0HA 1CICA 3KG5A 4CJ1A 3D25A 2HJLA 4X7SL 2BVQB 4JO2H 5BS0A 1NSNH 1KCRL 5AZ2H 2ZUYA 4OF5A 4JR9L 4HX1B 5FHAH 1I3RB 1NGWB 3WHXB 1JV5A 1KIPA 4FXGA 2VL5B 4HWBH 5C2BH 1IM9D 2NTSP 1EV2E 5HJ3B 5CSZA 4HHAA 4KI1A 5IEHA 1MRDH 5JOPE 4I3RL 2NY1C 5HYJE 1JNHB 3EJZD 5DT1L 2VZ3A 3V7AE 3MV9A 4L1HA 5EU3A 5HHPA 4WIQA 1L7TL 1HZHH 4JJ5A 1BZQK 1ZS8A 4M9PA 3OKOB 1CGYA 2XZAH 5DSCA 3SKNA 3QFJE 5C7XH 2W0FB 3U0PB 4F58H 4HWBA 1S7XB 5HGDB 3KYOB 5KVDL 1X4ZA 4F15B 4QXTB 5C0AA 5EC2A 2I07B 3V6OA 4WO4A 4TPRH 3NGBC 5DJ2B 3WIHH 5DRNA 1VA9A 1RIUH 2DBLH 2EO9A 2NTFA 2VJXA 4YDVB 1VGEL 4XMLH 1CK0H 4U1JB 2GIYA 3QUMH 5FGSA 4JPKL 3P30H 2C3VB 3EOAB 3IETA 4NQCA 3QUYD 5EO9A 1U8KA 4YIQB 2DD8L 3DXAA 3Q6FB 5HPMB 1AFVL 2RCSL 3RBSA 4X8JA 2P46B 1DL7L 3U0TA 2X1WL 3GJFB 5C0FA 4YR6B 2O5ZL 1FP5A 4PJ9A 3T1FB 2GJ6E 5KW9H 2BY3A 3T0EE 3U4AA 3WIHA 1NCNA 3G5XA 3C2AL 2X4NA 2AJXL 2VQTA 4GKNA 5C0CD 1MQKL 3TBYB 1G9MH 3N9GL 5CBAB 4DAGH 1DANT 3QUMA 1J1OL 4TTDC 1T1YB 1SVCP 5B3JE 1U0QA 5MERA 4D0BB 1R3LA 2YD1A 4G9DA 2E7BA 2Z8WC 4UOW0 1NBVH 5JQ6H 2Z8VC 5BCAA 4D0CA 5EU4A 3CFKA 2ZZUT 1CD8A 3B2VH 5EUKA 2IBZX 4F57L 5HSFA 4J3UA 1YDPA 4OV5A 2C1PA 1U3JA 1HXYA 5F6HJ 1RZGA 3L3GB 4QCIA 3WFHA 4D8PB 4PRPA 1F90L 4JN2B 1DBML 1LE9B 5D4QA 2K7PA 1BD2E 1UWXK 4ZUSA 3Q5OA 5ITFA 5L7XH 3F7VB 1JUFA 1YJDH 2XWTA 3HRZA 4LEXL 4R7NB 2FBOJ 4M7ZB 1FVDA 3EHBC 1JGUL 5KS9A 5I74B 1WF5A 3MRHA 5JW4N 3P4MA 2R9HD 4HIIA 3BWAA 5A2FA 1FNFA 1KT2B 3IFNH 1JGVL 4XHJD 3RA7H 5HI3D 2NZ9C 1UWEL 1BJ8A 1HIML 1X5LA 4K7FA 3HI5H 3QIWC 1FNAA 5E1HB 4DGYL 4P57A 4L5FH 1PG7L 2W9DL 1WEJL 1HQRA 4I2XA 3TT3H 1LEKA 2WLZA 3BT2L 2NXZB 1MHHA 3BH8B 1QLRB 4F3FA 4FQXB 1TETL 3GIVA 4Y19E 2ZWLT 3DV6B 8FABB 1RVFL 4XAWL 4XNXL 4EN3A 1MIEH 2P5WD 2OX5A 5IB1B 1R0AL 4XNZB 2BRRL 4M1DH 3LMJH 1F4YH 43CAA 4MNQB 2AGJL 2WWMC 1N3NA 4WEUD 4Y4KA 3DUSB 3AVEA 4PD4K 1JJUA 3QPXL 5E08L 2WINB 5BW7A 1KIQA 3VI4F 4K8RL 4J12A 4WW1A 1T3FB 4X80L 1CBVH 3D0LA 2BNUA 4WFED 2LTQB 1OCWH 2GTZB 4P3DA 3FN0H 2DYPA 1D5IL 3QWOA 1JGLH 1UWXH 3MRRA 5CGYC 1HYSD 3QB7C 2Z4QA 1NFDA 3MGTA 3UJJH 3LV3B 4YPGB 3G6DH 3BQUA 4U7MA 4HKZB 3D18B 4YDJB 3SKJL 3QXDB 5CIPB 2RR3A 3TJHC 3QEQA 5GS2H 3MV7E 4JHAL 4OM1L 2A0LC 4YK4C 1R24B 3O2DL 5EORH 2NNAA 3MNVB 1KBGL 3K2MC 1L6XA 4HC1H 5EB9A 1Q38A 4U1MB 4PGBB 2JK5B 3QH3B 3VDCA 1G6VK 1VSCA 1EFXB 3CD4A 3GK8L 4OCSL 4NQSB 5DJAB 1NGPH 3RNQB 3LEVH 2BMKB 3A67H 5EU6B 4QXUH 2FHFA 4X4ME 2FWOB 4P2YA 4NZDA 3AXLB 5HVHB 4YWGH 1JVKA 1YMHB 5E1AB 5FYKU 3VFPA 2GK0B 3WLWD 3WEXB 1I3VA 3DGGB 1MHCA 1V5JA 4TSCH 3ALPA 3U9UA 4PJBF 4HS6B 3QJFA 3SGDH 2QQQA 4OF7A 1I8KA 5I1HH 3GIZL 2QHRL 1N2RA 3MLXL 3OGOE 4M62H 1VFBA 4M7ZC 2IAMC 3DX7B 1CD0A 4LLDB 4QRRA 1NMBH 1S9XB 5I6XB 2NLJB 5DJXA 3OKNB 4PJFF 3GUTB 3WBDA 2FO1A 2YPVL 2FIKA 5IB4B 5JW5A 1RUQH 2EIZB 5C6PB 4OUOA 5BZWA 1CVSC 1GIGL 2IG2L 1TZGH 4ZFGH 3UX9B 4ZQKB 3LH2L 4FQXC 5ERWB 4PRID 1D9KD 3GI9H 1FNGA 2YXFA 3TYGL 1NLDH 5C09B 4TVPD 3K2UH 4HAFA 4XNZC 1YNKL 3DUUB 3ZE2F 5T1KB 3VXNA 5ACZA 2ICEB 3BI9X 2G5RA 5DZLA 5KSBE 5FOBA 4NNYB 4LNVA 5JOEA 3EYFB 4JPVL 3G04B 3ROOA 4KK5D 2EDNA 5B21A 4X0KA 4L3AA 4OT1H 4FNLH 5DJ8A 3NIFF 2MMXA 2D7TH 5I8OL 3SDDA 1WV7T 3D39B 4D9RD 4PTUA 1WISA 1KGCD 1G7LB 1JRHI 3MRQA 2Z35A 3VE0B 2DLFL 1KOAA 3H2WA 5KSAB 1ZVYA 3U4EB 4NPYB 4LKXA 4ODHL 2C7UA 3MJGX 1KC5L 2H9GB 3ZO0A 5GSVA 1UB5A 3X3FL 5J9PA 4Q9QH 1KN4L 5EZLA 3QZWA 3CUPA 2F5AH 3T65B 1BREA 1FJ1A 2W9EH 1OTSC 1Z0NA 4LF3A 1MRCL 4XX1G 5EOQH 1W0VA 2IEPA 4QTHB 4V1DA 4YAQA 2Q3AA 1LQSR 5FYJH 1IGCL 3QDMB 3T2OA 4UB0L 3PHQA 5D2LF 4XI5D 5MEPA 1A4KA 1JF5A 1WFUA 3QT2A 5I1KL 4YGAB 2AEIT 4CW1A 5D7JC 1QEWA 3TH2T 2NPLX 2IANA 4PJAF 1IFHL 2QHLA 4UIKH 4XXCC 1TNNA 1HE7A 4PJIA 2V17L 1T0NB 1OTTD 2R0WH 2YWYA 3CSYB 4RDQF 2DS4A 5MEQA 3CU7A 2HWZL 3FRPA 5HGHA 1YY9C 5TE6L 4H1LA 1DDHB 2A9MH 4MCZA 3ZMRA 3MV8B 4HXBH 2HP4A 4WVRA 3FONA 1G7JB 4GUPB 4OLZH 2R2CA 4HPOL 3SBWC 3LAFA 2IQ9L 4MNHB 4NBXB 2Q8BL 3L3IA 1BECA 5CEZD 2YWZA 5EUOB 5JMOC 4M7KH 3ZT5A 1VACB 1A7PL 4KKAD 4RWHA 2DQDL 3P0YL 4H26A 3NCJH 4IRSC 1KSRA 4GG6E 1CFSA 4X7CC 3CSBA 3QDJE 5TDOB 5IW6B 1ES0A 2IBZY 4NKOB 4OIBA 2N4IA 1RJYA 2A1WL 4JY6A 4ACPA 2GAZB 3MJ9H 1I7RB 3EOYG 4X5LA 3FO2A 1H15A 1UCBH 5EC1A 4IOIB 4LLUA 3GBLA 4IRJB 1ZGLM 3JWNC 3F7QA 5GS3A 1LK2A 2FJGA 3LHPH 4PJFE 2I5YL 2WBKA 2EH8L 3LEXA 4X9FA 3O0RH 4PG2C 5LXGL 2ILLA 3M8OL 4HMCA 2NY2D 5C08D 5EA0L 3RWCB 1JWUB 5J6GB 5MENB 2P5EB 5GS0D 1FFPA 5I71B 1KLUA 1TTGA 3F6IA 1KTLA 3FT2B 5HDLA 2VLKB 1KACB 1PKQA 3VDAA 4HS8L 1PYWA 2CLRB 5K59E 4IM8A 5C0JA 1J1PL 5KSAC 1QVOB 4IRZL 3IDMB 2OTUB 4RMVA 4QRQA 3NZ8A 4KK6D 1BGXH 3QUZA 3KAAA 4HULB 1MJJB 3OR7B 4Y2DA 1T5XB 5IVXA 5D7SH 5I1CH 1IM3B 1VEMA 2GJZB 4A2MA 2YZ8A 5DK0B 2FH6A 1I8IA 3BAEH 4OBSA 1DQLH 3KR3H 4UAOB 5GGQL 4OKDA 3BEWB 3GDBA 4GAYB 5CKGA 3QG6B 4KDWA 3NH7H 2WWKO 4KVNL 2F54E 1MHEA 1Z9SA 4YO0A 2AK4D 3HZMB 1NJ9B 1U42A 1K3IA 4XCYA 4E41D 3P77A 3W9EB 5IMLA 3D2UB 4XP4H 5H35B 2X9XA 3VMPA 2EYRB 2X4SB 4OLWL 3TO2B 1FVCA 3S35H 3D3VA 5DJ6B 5JXAH 3EYSL 4ZTOH 2VXUL 5GIRA 3C8HA 4DGIH 4HUXB 3FN9A 4H0IA 3W5NA 2W1NA 4K3JL 1J8HE 3MNZA 4ZFOL 4GT7A 1R5IB 5F3HA 5F7MC 4WUUE 2OK0H 1U8MA 3LZFH 4WUKL 3MACL 1J9CT 5E9DD 4XTRC 1RY7B 4OZIB 3BPLC 1DVFD 3B2UC 4UNVA 4DVRH 1S7RB 1RJLB 1S7QA 4W4OA 2FZ3A 5IQ9A 5DFWH 1NEZG 1OF2B 2VLLA 2DWEB 4LHUA 5HDBE 5DHXB 5IMOA 3ZE1E 4OQTL 4D3CH 5SWZE 4E0RA 5D2LE 4KJYB 2APWA 2WSKA 3CVHB 2AJYH 3WXVL 3ULVC 1JYWA 3N85H 3OR6A 2JE8A 4XVSL 1NCCL 4JDVB 1FG2B 2LVCA 4OCNC 4HH8A 4HDIA 3BGMA 4Q9BA 4EI5A 1CLOL 3L1OL 1CGTA 3U82B 4UDUB 3AS1A 4RWYH 1MVUB 2VLJD 4WHDA 5FO8B 5JO5A 1T83A 1RZJC 4RMTA 2OM5A 2ZPKL 3TBSB 2X42A 2NY6B 1MLCB 3DGCR 2JLLA 3DRQB 3MREB 4JM2F 2ZUQC 1RIVL 5KZCD 3LOWA 3MLSH 4L9DA 1U8IB 4EI6B 3MLVH 1EVUA 1FLRH 1Q9WA 2N7BA 3DTXA 1WBYA 2VH5H 4N0UE 1AO7D 3SE9H 3RWDB 3JWDC 2LFGA 3ULUD 5I71C 4PRHD 2YMXH 4XCEB 1AGDA 4PY7A 3Q1SH 3L3HA 2ZUVA 5ID1A 1QFWL 3X17A 1SVZA 2CGRL 2HT4D 2UZYB 4AEIH 1BFOA 3I02A 5HYQB 5ALBL 4AT6B 2FX9H 5E6ID 4JKLA 3MYZA 4F7PA 4NQDD 4HWZB 1GL4B 1F58L 4CN4A 5GGSB 3LSOB 3BZEB 4OZ4B 4P2OD 5IBTH 1U95B 3H9YA 1MFEL 2EE2A 3RAJH 5HHQA 5HGBA 1QSEB 4NKIH 1OSZB 5CEYB 1KCUH 2XTJB 2ZCHH 4HKBA 5GGTH 5C0ND 4OUUB 5JA9A 1OAYH 1FNHA 5EULV 1MLBB 1RUML 3D0VA 4DFHA 3EGSA 4QXGH 1LWRA 1KEGL 4J3TA 3INUL 1DSFH 1E4XH 1FHGA 3FAXA 1G9NH 1G7PA 3OV6A 2E7CA 5AAMA 3TP4A 2E7MA 4GW5B 4ZOAA 2GT9A 2FGWH 4XWOD 4HZAA 4M93B 1FFNB 4LCUB 1MI5A 1JN6B 4E42A 5E2VH 1IARB 3L7FA 4FN0A 5AEAA 1HSBA 1X7QA 3KPSB 4APQD 3PDGA 4ZAKB 3WCYA 1D5BA 5EO1B 4XC1L 3WL9B 3BP7A 1BZ9A 2Q6WB 2VWEC 4RISL 3VXQA 2DQIL 3MV11 2A74A 3I50H 5F88B 1X5ZA 5D71L 4KHXL 2BY0A 3GJEB 5LQBH 1K2DB 4OIAA 4GAJH 2J88H 1OAQL 5K9JH 4LSVH 1I9EA 3WS3A 1VKXB 3T4YA 5T1LA 2OXGA 1HWHB 2C4XA 5FM4A 5HYIA 5DMIH 3BDBA 1NL0H 2VXVL 3FFCE 4C4KT 1TVHA 3S6CA 4OGZA 2MCPL 4RAVA 2OI9B 3HE6B 3IKKA 3SGKC 2Y06L 1I1AD 1TJGL 1T80A 1KIRB 5DQDH 3V8CA 5HYJD 1K85A 4KTDH 3VWJC 1CL7H 1OAKH 1Z9MA 1CE6B 1NUDA 2CLZA 3O8XB 1J5OH 1S9WB 2IGFH 5DTFB 5IROC 4ZMAT 3TN0B 3RP1A 3WHE0 3GJFK 3QDHA 2ICWJ 4HQQL 1A7BA 1X5YA 2DKMA 4WW2A 3MUHL 5JHDB 4XNUL 4PJGB 3TIEA 4LVEA 3IDGB 2C26A 3C6LD 1ZXQA 4RGOH 4EOWH 2LU4A 4HX1A 2YS4A 4MA8H 1VADB 1I3RA 4AH2B 4LPWA 3WHXA 5ANMB 3T08A 2VL5A 4RGMB 4A6YL 3QAZB 5JXED 1M7XA 4L8BA 1DBJL 5HJ3A 1XZ0B 2WAHA 4B50A 4N0FB 4LSSH 1JNHA 4S1SL 1YNLL 4K3EL 3CFDB 1WBXB 1IEAB 5IB2B 4OZHA 1AGEB 3D85A 3ZYZA 2H2SC 1OTUC 3EDKA 3OKOA 1JI1A 1KB5B 3QISA 4U1NA 3MA9H 2NY4C 3U0PA 3TYFA 4MJID 3QRFM 1S7XA 4WGWB 4M93C 3KYOA 4NNXB 3DO7B 2AJZA 3GJFH 2I07A 2DQEL 2FD6L 3UZEA 2IADB 3ILQD 4BSVB 5DJ2A 2QQNL 4C58B 5D93B 3QCVH 3R0MA 5LGKA 4YDVA 5CILH 4N0YL 1A7OL 5EBLB 2DQTL 3CNKA 3KLHD 3KS0H 3EOAA 3ZTNL 3GHBH 3D87B 4YIQA 3WFCL 3VW3H 3UROR 3Q6FA 1SMAA 5HPMA 4MA1B 4U1HA 4Z9KB 3PWPE 5DUPL 3FQRA 3GJFA 3ULUF 3T1FA 1E4KA 2QSCH 4QOKB 4UQ3B 1IEBB 4FFZL 5KG9B 2EDQA 1CLCA 4OCRH 1Z9OA 1W2KT 5GRVK 5E5UB 4L4VE 3HE6C 3TBYA 1O7SA 1YEJL 2YEZB 5CBAA 2V9TA 1G1YA 3MUY1 1T1YA 1R3KB 2OR8A 4D0BA 4PGJA 4GKZB 1YY8B 1NFKA 1NUNB 3ESVF 1JIBA 3QO0B 4ORGB 2DLGA 1WWBX 2VXSL 3TN0C 4YXLL 1JF1B 1F3JB 1S5IH 2PXYA 4ODVH 1N64L 3S36X 1BFVL 4XP6H 1HHKB 2VLRB 4LSRH 2VDOH 4QWWD 3V0VB 2O5XL 1IMHC 3D9AH 1TVBB 1L6ZA 3P4OA 3L5XH 3L3GA 4W6YB 4D8PA 5ADPH 5HGGS 3NCMA 3FCTB 4JN2A 1LE9A 4X98B 1IILE 1VERA 3F7VA 4AIXA 2JB5H 2OZ4L 1U8PB 1YEIH 5D5MB 3ZDXE 3QAZC 1CFNA 2YN5A 5CD3A 5L0QB 3HB3C 4FQHB 1MCKA 4NO3A 1ADQH 5BRZA 4OLVH 1KT2A 2B39A 3KYAA 3MLYH 1CIDA 3JV5A 4YDLC 5JORA 5H37H 3EUUA 5C1MB 5BO1H 1MY7A 2JJTC 4YHZL 5F9DC 5TQ2L 3JVGA 5I19L 4Z7UB 5I1GH 3RQ3A 4S10A 2PYEA 4XAKE 5DVOA 5F72S 3GSRB 1A6UH 1FH5L 3BH8A 4N0RA 4R4BB 1QLRA 5D2NB 3RDTA 2ICWB 2APFA 4X7FC 8FABA 2BVOA 3VDBA 4OD3H 3FQNB 2BCKB 4XMKL 2PTUA 4FG6C 5IB1A 3HC3H 2C9AA 4LLMB 1ADQA 4M48L 4MNQA 2OBGA 5CIPH 5AUMB 2ICES 5FA4A 3DUSA 2GY7B 4P23D 4XH2B 5LBSH 4PRBB 1IGTB 4NC2B 1T3FA 4U1IB 5D93C 5CUSH 1XR9B 3LN5B 4AQOA 1A6VH 1B4JL 4DKFL 5C6TH 5GZNC 4N5ED 2GTZA 4JRWA 3U1SH 1Y6NR 1V7MH 1L0YA 4FTVD 5IBLC 1ZMYA 4RQQA 1KJ3L 3EYOB 1A3QA 3NTCL 4YPGA 4YDJA 4HKZA 3D18A 3WXWL 3IB4A 1PSKH 1S8DB 4UV4H 5I73C 1EX0A 5C07B 4KKNA 4Q7DA 3OSKA 4OIIL 1E6OH 3PL6C 4OZGE 3CJJA 1UENA 3HNSL 2O5YH 3IRPX 2I9LB 3KYKH 2P42B 4ERSH 1SM3L 4WU7B 1ZLUK 3MNVA 2YPLB 3W0WA 3VD7A 2R69L 4RGNE 4U4BA 1WTLA 1WWCA 4U1MA 4PGBA 2JK5A 5JW4Q 3QH3A 1CDCA 4NUGH 3U7YL 1U36A 1AR1C 4KV5F 4J3WA 1EFXA 3WNLA 3GSUB 3RKDD 5DJAA 1TJIH 4C56E 3RY4A 2BMKA 2FWOA 4UOW1 3AXLA 1YMHA 3KPRE 5E1AA 5DRZB 2GK0A 3VG9B 3WEXA 3DGGA 2QEJA 1GHFL 3LQAC 2NX5B 3EDJA 3OJVC 4EIZC 1KN2L 4JFDB 3VFUB 2A6KB 4LAQL 1ZANL 4F7MB 3UAJD 2ESVE 5FM5O 2VR9A 4DQOH 2LAGB 1A7NL 1KEML 1IC1A 3O6KH 3UTSE 2XKNB 3TC9A 3DX7A 4JFFB 2DMCA 1T04B 5HHXH 2FL5B 1S9XA 2R23B 4LRIC 4KJPC 1YQVL 1VFUA 1A8JH 2FYYB 2NLJA 3OKNA 2IJ0C 2AEPH 3BSZL 5DJDB 4WV1B 4OCWL 2AQ2A 3T8XA 5IB4A 2EIZA 5AZEH 2HFEB 3KPLA 1NDGB 4GXVH 4R26H 3HC0B 3IF1B 5D9SB 1ZLUH 4XVTH 1WBZB 1CLYL 1Q9LB 4C83A 1CZ8L 3WNKA 4XPBH 5ERWA 1BEYL 3CDCA 4MD0B 4KUZH 5GRJL 5GRWA 1QKZL 2QR0B 3HN3A 1N6QH 5C09A 1OPGL 3GMRB 5T1KA 3LEYH 1SY6H 3ARFD 2ICEA 1YEKL 1MFCH 4R8WH 3O6FC 2NXYD 2EC9T 3DJ9A 1MSPA 4P2QA 5CKAA 5DA4A 3H9SD 5IW3A 3RUGB 3EYFA 4J6RH 1MJ7L 4P2RB 2E6PA 3G04A 2H3NB 4PG2A 1CFVH 4ENEC 3VXRA 2L7JA 5AZ2L 4JKPL 3MRGB 4Y4HA 3RPIA 1HKLH 2Y9RT 3VXSD 4HK0B 2YXMA 5FGBC 3D39A 2XRAL 3QUXC 1FPTL 5SWSD 1MREL 2V7NA 1SY6A 1LVEA 1G7LA 4N0CD 1URLA 2X70B 3S37H 2H6PB 4LP5A 1ZOXA 5KSAA 4QHUB 3F7RA 1SHMA 3U4EA 2J4WL 4NPYA 3S3JA 1JZ5A 2E7LA 2ZCLH 2IALB 2H9GA 2AV1B 1H8OA 3PDDA 3T3PE 3SDYH 3SGEH 1QTYT 2IWGA 2JKXA 1JNLL 1XGQB 3T65A 1MJUL 3TPUB 3FQUB 2L7UA 4TVSa 3TO4D 1N0XH 1NCDH 3V6ZA 1MWAB 4QTHA 5D8JL 2L4OA 3SPVB 1R5VB 4U7KA 2VB5A 2K7QA 4UTBH 5JPMB 2FX8L 1UM5L 1EO5A 5F1NB 3L3KB 1IQWL 4R90H 4DN4H 3O4OC 4LSUH 4XPAH 2CDFA 3HC4L 5TPWH 4NT6B 1NGYB 1RZJL 2ADGB 3LQMA 5GHWH 5HTSA 1LEIA 1Y0LB 2X5PA 4NDMB 2R4RH 3ULVH 1P1ZA 4PLNC 2P48B 1YPZF 1T0NA 3CSYA 3ZHDA 1ORQB 2H26B 5E7BA 1W0WA 3VFNB 4HXAH 1OL0A 1T2JA 2QJDA 1N5YL 3CVIL 4RSVA 1DDHA 3AB0C 3S88H 2VDPL 5K9QI 3KPTA 3MV8A 3JWOH 2BVTA 4FFYL 4P2CG 4PJ7F 3JWDL 4GUPA 1SBSL 1DFBH 5TE7H 4OJFL 2X6MA 1XF2B 3GNML 4CADB 2H8PB 4KMTL 4MNHA 5KAQF 5C9JB 1QBMH 1KJ2L 1WK0A 1YEGH 4O58H 1GOGA 5GGRB 4DAGL 2V2TB 1CICD 2IC2A 3C5SB 5EDXA 3VRLF 4NRXB 3K3QA 3ZZ1A 4MB4A 3T0BA 1AJ7H 5IW6A 4X6FB 1EEZB 3KPNA 4NKOA 5F1SA 3LRGA 5T3ZL 4NUJB 1I7RA 1S7WB 1AY1H 1OGTB 3T3ME 4IOIA 3O4LE 4X7TB 4IRJA 4ODWA 1CF8H 2P1YA 1B9ZA 3R1GL 1LO3L 1QYGL 2J8UB 1P9MA 3ECBB 1KTDB 3DWTA 3RWCA 2Z93A 1F42A 3CFBA 5D6CB 5MENA 5J6GA 4HIEA 4JFED 2P5EA 3RI5F 1OAZH 4X4YB 3IU4H 4HF5L 3U0WH 3MMEB 3U30B 4P4KB 5BOZG 3RVVD 1GAFH 4RZCB 4JQIL 1T66D 1J8HD 2CLRA 1IAKB 5J1SC 4WUUD 1RIHL 5E2WL 1D5ZB 1E4WL 1QVOA 4NQEB 1ACZA 1EEUA 2OTUA 1FN4B 1F4WL 2R56H 3BE1H 3PXHA 4Z5RB 1IEHA 2WUCH 5C0AD 3NAAH 4QGYA 3QCUH 1MJJA 4QF1B 1JZ2A 1IM3A 3KPMB 4KROD 4KI5D 2GJZA 2H45A 2ZSVB 5DK0A 1EEYA 4LU5H 5SWZD 3UPCA 4G8GB 4DW2L 1EK3A 4GAYA 3QG6A 3H0TA 5MI0B 3RWEB 2HLFC 4ONFH 4XWGL 1RPQA 1I4FB 2KDGA 1A2YB 1NJ9A 1X5AA 4NQCD 2I27N 2DLEA 2DN7A 2EDJA 3RY5A 3W9EA 3DXAD 3ARBC 5IF0B 5J06A 1HQ4B 2QQKL 3SQOH 3CLFH 4UTAH 4G3YH 3UPAA 3TNNB 2X4SA 3HG1B 5I15H 5D7IB 3TO2A 5DJ6A 5IMKB 2DLHA 1BQHB 1RZFH 2E9WA 3CVHH 4P5TB 2PW2B 3ARVA 3FB5B 5D1ZA 1XF5B 2DMKA 7CGTA 1EO8H 4Z95L 3QQ3B 2ARJQ 2OR9H 2D7NA 2V5TA 1NFIB 5EOCJ 4QRPE 1S7RA 3O2WL 2V2WB 4P0DA 1TXKA 1UWGL 2DWEA 3U48A 4DKAA 3GRWL 2XY2A 4OGXL 2OXHA 3PIQB 4JCLA 5KVEL 3HR5B 4KJYA 1NC2A 2BDNL 3O6ML 4PJEA 1IAIH 3CVHA 5ACLA 5C71A 4PY8J 2O61B 4JDVA 1FG2A 1RV6X 2FJFB 3MSPA 4PRPD 3BJLA 3DARA 1RQ5A 2FCBA 4YHKL 5IR1A 3BKCL 2Z31C 1IGJB 1MVUA 4O4YL 5C08B 4KWUA 5GGVH 1A3LH 4MX7B 1XGTA 3TBSA 3SE8H 2ATPB 3UTTA 1INQB 4GRLB 1UYWL 1FSKB 5FOJA 3EFFB 5AD0B 3MREA 3G5ZA 2WUBH 5A16B 3O3EA 4FQIH 5EZJB 1U8IA 4EI6A 1HCFX 1BP3B 3QA3B 3GMLA 3MCLL 5FKAB 1B2WH 1LEGB 5BVJB 3VRLE 4YBQD 4XCEA 5I8KL 3OHXB 5BXFB 4WJ5B 2AV7B 3TM6A 3G6AB 4TSBH 1VB9A 4EN3D 3OJDB 4NKDB 4BK4A 5HYQA 4X6EB 3CLEL 5I18L 2K1MA 2GK2A 5FDYA 1JRHL 4HWZA 4Y4KD 1Q0YL 1CXIA 2EKSB 4E41B 1B4RA 5CINH 1MCHA 4BZ2L 4XVUC 1U95A 3LKPB 1OSZA 1VFOA 5CEYA 3RVTC 5MI0C 1AHWB 1GXEA 1GGYA 4XGZB 2GYSA 4OUUA 1G6RB 5HHOE 2DYPD 3TZVB 3CXDH 5IHZB 3VXMB 3W9DB 2VKXA 3BP6A 3L6FB 4PS4L 3G6JF 4OM0L 1RZKC 3SKOB 4YHLH 5E9DB 1CDJA 2BFVL 3EBAA 3VG0L 1EFQA 1YQ2A 1BM3H 3JV0A 4JG1H 2AW2A 3MLZL 1ZVSB 2XG5A 4QY8B 1BX2B 3MRLB 3DX9B 4P5TC 2YPKB 4GRMB 5FGRA 4KQ4L 1FQ9C 1BF8A 1L9MA 4PP1D 3RIAK 4GW5A 2VAAB 4OV6F 1EDQA 4U6HB 4Q74A 4H8WC 1FFNA 4LCUA 5E24E 3MFFB 2GI7A 1JN6A 4EDWH 4PREA 4LPTA 4CKVX 3CZFB 4GAGL 1QRNB 4G8FB 3C08L 2YD3A 2M26A 2B0SL 4ZAKA 5FYLH 3ROLB 4XX1E 3BJ91 5EO1A 4JB9H 3WL9A 2Q6WA 1MCLA 2KQMA 1T7VA 4HIXH 3GJEA 1E28A 1K2DA 5KSUB 5GS2D 2PO6C 1U3YA 3GMOA 2A6IB 3AUVA 4YZFE 3BX7C 1ZKAA 3PWJB 1VKXA 1IC7L 4O02H 3C9NB 3LPFA 3DVNB 2WBJB 3OG6B 5KZCB 5DJZB 3MOAH 4X4ZA 2RB8A 4Y5VB 1CD9B 3VD9A 3FZUC 3EO1B 4LQ1A 5F7HA 3IKCB 4NN7B 1EJOL 4NN6C 3BO8B 4QRRD 4RFNB 1FYTE 3UJIL 5DURD 4GRLC 2PTTB 2X89A 12E8L 1KIRA 1WICA 3S5LG 5I1DB 1JWSB 1C5BL 3I9GH 3L7EA 3O8XA 1CE6A 2YUWA 4KAQH 3IXTB 5I76B 5E6IB 5L9DH 4KI5F 3CXHJ 5DTFA 4NQDB 1C5CL 3TN0A 3EYUH 4N8VA 4AM0B 5DVLA 4G5ZH 4P2OB 4XCCH 2CKBB 3C5ZA 2YZ1A 1C1EL 1YMME 5EU6E 3RTQC 3V2AR 5JHDA 3MJ7B 5J4MA 2LU3A 2Y36H 1UVQA 3OPZL 4ZTPH 4PYGA 5FO9A 3IDGA 5JW4R 2VERN 2F5BH 4K23L 4URTB