3V8OA

Human filamin c ig - like domains 4 and 5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
193
structure length
193
Chain Sequence
b'QAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-C
publication title A novel structural unit in the N-terminal region of filamins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 40
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v8oA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v8oA01
1DBAH 2B1AH 4YAQA 3PQYE 1OP3K 5LQBL 2VB5A 1QFWL 2E7CA 3BP6B 3IFNL 4PB9L 4MD5B 1JP5A 1JJUA 5EC2A 3WS6A 1AGEB 4XC3L 1V7NL 5FDYA 2F54A 1URLA 3OMZA 1RVFL 4QT5A 4PUBH 3VWJD 4JCLA 1S9YA 3B6SA 2VDKL 1BOGA 1MCOH 5FF6A 2NY7L 1NANH 1MIEH 2JLLA 5I8KH 3FN0L 5F7KC 2R56L 4O2EA 4HPOH 2AABL 1QP1A 4HKJA 3IFLH 2F53A 4FQCL 5BVJB 5C8JA 3FO0H 2UWEA 3GSWB 3AB0B 3DMMC 2X1WL 4PRHE 5EOQH 4YXKL 1OP5H 5DMIL 4ZD3H 2R0LL 2VDLH 2HVKB 1R0AL 5SWSD 4GKNB 3C60C 5GGUA 2VLKB 3VXRD 2K1MA 4Q9RL 5DSCB 4JJ5B 3HNTH 2F19H 3SDDB 5IESL 3QEGH 2OZ4H 1MCDA 3EUUA 2CO7B 1TITA 2IADB 4U31A 3IDJA 3MXVL 3O2DL 4NWUH 5FA4B 4P46D 1HI6A 4AL8L 3LKNB 1QBBA 2BNRB 4XCCH 4XC1L 4KKLC 4HK3N 4HIJB 4NC0B 2P5WE 3EYQC 4D0BA 1YYLL 2P8MA 1HH6B 1OAUH 3DMMA 1Z6JT 1KJ3L 4GT7A 2IJ0C 3OXRA 1P69B 4NOFA 1A7NL 1HKFA 2XKSA 3T2NH 5KTEL 3OHXA 4N8VB 1NFIA 4OD3H 5E08L 4TOYL 1D5ZB 5HYQB 3DUSB 2XT1B 4LHUD 4ZO9A 5GGQL 5EWIH 5CLWA 3L3GB 1WIPA 1B6DA 1ZWIB 4LVEA 2DQEL 4OB5L 1LEKA 3BPCA 1A64A 2C9AA 1S7RB 3U0WH 3OF6A 5IMOA 5TFSH 4NQXB 5JDSA 4DAGH 2X70A 4P23B 3RHWF 4L3EE 4KI5E 4U05A 2ADGB 4MAUL 4HWBA 2CXKA 1G6VK 4ZO7A 3GIVA 4QRRA 5BCAA 2XRAH 3GI8L 4YO0B 5FM5O 4I3RH 5DK2A 3ORJA 4GW1B 4YPGB 5C0GA 3QUMB 5EO0B 5C0NC 4HKZA 1N4XH 2FJFB 3BKJH 4Q9CA 3T0WA 4U1JB 4DN3H 3P0VH 5E2UL 1U3HD 5E5RB 4PLOB 4GS7C 5ISZE 2GHWB 2DLIA 4XP1L 5E6YA 5C0DA 2A9NH 4M6OL 4P3DB 3MRDA 4LAQL 4BFGA 1SY6H 3GO1L 1U95B 3H8NA 5SX4H 3DVGB 2RHEA 3O6FA 4OKVA 1YEJH 4ZNCD 3TPUA 4YDKL 1JGVH 1I1FB 4MCZA 4PJCB 1J8HB 2E27H 2OSLA 4GXUM 3WSQL 1D5XA 1RU9H 4RGNE 2BRQA 3P11H 1YYMH 1P53A 1S9XA 5JIPA 5BVPH 4BH8B 5JNYA 2XXCB 3CVHH 3T0BA 5J7CC 3L3IB 1EAJA 1B4RA 1ZVHA 3KPLB 4P49A 5AZ2H 3RAJH 4AIZB 3HE6D 2PNDA 5GS3A 3AS3A 2OX5A 4XPTL 3EFFA 3R0MA 5HHMD 5IHBA 4GG6F 3ARYA 3QSKB 5D7IE 3SO3B 3W11C 1KEML 5F72S 5E2TH 1NEZA 1IGYA 1QBLH 2D7PA 4L1DA 1DSFL 3ZT7A 2V5MA 3MUY1 1HINL 4P59H 3NA4A 1BFVL 3L3KB 3BMWA 3IDUA 4Q2ZB 3ULSB 4ZAKC 3F12B 5IBLC 1A6AA 1M05B 1NC2B 1GZPA 3DBXB 4H5SA 2I5YH 1RMFL 1ED3B 1KCSL 5CLTA 3CVIH 3BT2L 3MNWA 1FZKB 3UTSA 1XGYH 3FRPG 4X6DB 1CFQA 5C07A 3V4PH 4HS6B 5HDQH 1DN0B 5FV2A 1Y6KR 3N1GC 1P6FA 4XXDB 1BQUA 2ESVA 1DLFH 3PE9A 3IDIA 5IVOA 5FUOL 3LQMA 2LE9A 3S3JA 4HWZA 4BH7B 3PP4H 1DL7H 2IG2L 1Z3GH 1HHHA 2FJGA 3REVB 5E6IB 1T20B 4ZAKA 2GCYB 15C8H 2JELH 3HG1A 3O2VH 4XWGH 4Z7QE 4X80H 4V1DE 4XVJL 3FB5A 5MP6H 3C09C 1G7JA 3S97C 2CK2A 4JG0H 2WV3A 1CE6A 5E4EC 4XNQB 2AP2A 1KULA 3BZEA 1MUJA 4ZPTB 2ZCHH 3U7YH 5JORA 3VXMA 5I19H 2X1XR 3OXSA 4E5XB 2R9HD 4QRUA 3S96A 1G7QB 4YPJA 2WUBL 2WLYA 3QQ3B 2AJXH 5GZNC 1C08A 5F6HJ 2VWEC 3ZKND 3VGGA 5C0AB 4BK4A 4RMRA 5F1OB 3B9DA 1NLBH 1I3VA 3FO0L 4XPBH 3IJYA 4U6TA 1YMMD 4WY7L 5EOQL 1OT1A 3HUJF 2F58L 1L7TL 1F3DH 4TRPH 3V7AE 3DROB 4UTBH 2ZCKH 1AXSB 1BLNA 2DQHH 3IXAA 1W0VA 3G5YA 2UV3A 1QFWM 3VXTB 1RUQL 4KUCF 4OZGB 2NLJA 3WNPA 4XCCL 4FNLH 2CDEB 4OGAC 1FL3A 4P2RB 4EUPB 3JXAA 5BZWB 4RISH 3FQUA 5AZEH 3O41B 1JZ6A 1FZOB 4ELME 3GNMH 1U8KB 1NKOA 4PJDB 4Y2DC 2UUDH 3O4OB 3T2NL 1A6PA 3LS4L 4YEFA 4OD3L 1GGTA 3C5ZB 4A2MA 1I9JH 4JFED 4LVHC 1RZ8A 1WZLA 4U7KA 1MHPL 1FHGA 4UDUA 5F3HA 3BHBB 3RI5F 1CICC 3WUWB 2ZOLA 5DMKB 1GH7A 5TFSL 1T66C 5CZXC 4KKNA 2NY3B 3HLAA 4HUXB 3E1F1 1A1NB 4NHCH 2CO6B 3TBSA 4P9MH 4KH2A 5EU6A 4HIHB 2VR9A 4YEEA 4LHJB 1WZKA 3MV8D 3MYJA 3BKJL 4NRYA 3ZYOA 4Y2DA 5DJAA 4DN3L 3P0VL 3TH4T 2BFVH 1N5AA 4OT1L 1N8ZA 1P4IH 1PEZA 2A9NL 2X89A 2AEIT 2VR5A 3MJ7A 3DVNB 5A2IH 1UQSA 2YD2A 2AEQL 4JVWA 4OLEA 5BRZE 3OSKA 2MQCA 4PJHF 4LCWE 1GHFH 1CICA 2NY0B 2VH5L 4APQD 1YEJL 1F4HA 1JGVL 4J4PD 1IGTA 2XZCL 2E27L 3K7UA 4EBQL 1T2QL 3P11L 4NFCA 3OJDB 5TDPA 5DDHB 5BVPL 4KRPC 3FFDB 3SKUD 5E0QA 2AXGB 2N4IA 4XNUH 1NDMB 5I76B 5AZ2L 1CD9B 3VE0A 4I0PB 2GTWB 1OF2A 1JMXA 2W9EL 4Y5XC 3UTPD 4AM0B 3B9EA 3LMJL 1PAMA 4IMKC 4UAOC 3QIWC 5D4QA 3RVWD 4KDTC 5F7MC 4N5UA 4MA3B 3PJSA 5JHDA 3LEXA 2VE6B 3GMMB 2DN7A 3MFFB 4NQCD 5TE6H 1QBLL 3LEYL 2OR8A 4JE4B 1RZKH 4P59L 3O81A 4Z5RB 2DM2A 2YA2A 4P5KB 3SKJH 2GJ6D 5FOBA 4JFFD 3KDMB 2CLVA 1RIVL 2JKXA 3ULVC 3S37X 2DMKA 4CBPA 2EEBA 3IS0X 1KFAH 3WMSA 1F4YH 1Z5LB 3C8KA 5I75B 1SEQL 3EDFA 3FQXB 2WINA 4Y5XA 3QXWA 3KWWB 4IMKA 1HWHB 3QIWA 4KDTA 1IBGH 4K55A 5DQJA 4MD0B 1DANU 2BOBB 3N1FC 3BZFA 5GGTH 4OCLC 5C09E 2BDNH 4PJBA 1AFVL 4PJGE 4NN5C 3LKRA 4TN9A 4UZGA 5EULV 2QSCL 5IG7A 1NCBL 4NQEA 2HRPL 4WUUE 4OD1H 2NY1B 3PP4L 3KJ4B 2PN5A 3C6SA 3IJSB 4L4JA 2APFA 4FFZH 5ACZA 2P24B 3O2VL 3OX8A 4XWGL 1KIQA 3LAFA 3DSNA 1NGWA 4PLJC 3RGHA 2FX7H 4QWWC 2Y6SD 4Q97A 1JZ3A 3QQNA 4BSWA 4JG0L 6CGTA 4XVTL 1F58H 4RA0C 1DBJH 2YR3A 4PS4H 4U0QB 3HI1B 3E6FA 5AG9A 1ZA6A 2IH1A 5J13C 3DLQR 1FL6B 2H32B 3FO9A 2E7LC 2VXQH 2VABB 4POZD 2X4NB 5GISH 3V0VB 3J7HA 4HFUH 3CFBB 4G8GB 4I3GA 3RIFK 4X7FC 2P5EE 3WS3B 2VL5B 5F1NB 3WHXA 4XPBL 4LLQB 3G6JA 5B8CB 4MJID 4D9RE 2VSCA 3KPRE 5CBAB 4HJ0D 4UTBL 5JW3L 2PW1B 3N1MC 2MKLC 3D39B 3LIZH 2DF3A 2DQHL 1FRGH 2MTPA 2C5DC 2Z0BA 3HZKB 3K1KC 4YZFF 1E4KC 3MA7B 3FQTA 3GMNB 2ADIA 5IVXE 4Z77B 2E7LA 3FB8A 2VXUL 4QHUB 3EYVA 5CCKH 2NXYD 4FNLL 2NZ9C 1I8IA 4Y19D 5F7DB 3VDBA 3DETD 3HS0A 3JTTB 1DUYA 4MQ7A 4PY7A 1RJCA 4RSVA 2R15A 3WIHL 5IR1A 4X6EA 3HE7B 5F71A 1NL0L 5DQ9B 3ZYJA 1RK1B 3I6KB 4M48L 4JRYD 4GMSL 4JZJC 3BIKA 2Z8SA 4IBLT 1CLOH 1J12A 4GLRH 3FRPA 2DQDH 5L0QC 1E4KA 4J7RA 5IFJA 4K7PY 4OBSA 3PABA 1DTUA 4NCC1 2VIRB 3DUHA 3NA9H 4R4ND 4TUOB 4DVBA 4HBCH 5BJTA 2C3VB 1A7RH 2VDQH 3D5OF 5J9PB 1TZIA 2MHAB 4NHCL 4O9HH 5JMRA 1QSEB 1CXHA 2A2QT 4U1IB 5C08B 1C5BL 1ZHLA 2RQ8A 3FQNB 2N7BA 1FGNL 3MRBA 3LZFH 4JZJA 1L9MA 3OG6B 2BFVL 1KB9K 1P4IL 3MODL 1ZANH 4XNYL 1OGTA 1UWGL 3EHBD 4PRBA 4TULH 3FTGB 4DEPC 5EU5B 1P7KB 2APTA 5KANG 5B39B 4OLXH 1GHFL 1WICA 2BSRA 3PWPB 5EO1A 3P9LA 3MV7A 2HT3C 1UC6A 4KMTL 3CFDA 3VXUA 3TNMB 2PYFA 2Y06L 4G43A 4WU7A 5D72H 1J9CT 1I1AC 4M1GH 1LO5B 4Z7VB 5BZDA 1W0WB 2Q3ZA 2QSTA 4F3FA 3MLRL 1KCLA 2EIZA 3NCJH 3QUXD 4LLDB 1A1MB 1X5HA 4XMKH 3IRZA 5JIHA 1S7QB 1YNTB 4G7YH 5CP3A 2LVEA 3UTOA 4NZRH 4PTUB 3I6LD 1RZKL 1S5HB 3KPSA 4DZ8A 3SDAC 2X7LB 3BN9D 5D5MF 4M6AA 3BKMH 5FKPA 5KSAC 1ONQB 5C0EA 1U8HA 1I1AA 1OW0C 4ZOAA 4N0UE 3ME0A 5HDOA 1C5CH 1SBSH 3DURB 1KFAL 1QR1B 1OSZB 5D2NC 1TPXC 1MLCA 3FQWB 3GBML 4EI5D 4Y5VB 1A6VL 4HV8A 4U3XA 3GIZL 5KSVB 3FONA 4IHOA 5TPWH 2R8SL 3K8LA 4XBEH 2BDNL 3S37H 1ZVSA 4LSVH 4YR6B 4FG6C 4UOW0 4PJEE 5D1ZB 2J4WH 3ZO0A 1XCQA 3RX8A 3GMQA 2MNUA 1UH2A 1QNZL 4OLUH 5KSAA 1CN4A 3CSPA 1N64L 2P5WB 1OW0A 4Z7NF 4FFZL 1XGRA 3EIFA 3RY4A 3L1OH 2O5YL 5D6DC 5D7JC 2HKHH 1KIPA 1UA6L 4XZUA 2FX7L 3U36B 4KK8C 1XF2B 5D2NA 3DX7A 2H9GB 2YMXH 5DFVC 5IMLA 1F58L 1QA9A 1QSFE 3VDCA 4GBXB 4PD4K 4HX1B 1YC8A 2VISA 1UACH 1Q0YL 4YJZL 2R1XA 4MJ5B 1CVSC 3RUGB 3RIAF 1TETL 1NUDA 4HC1L 5JQ6H 3FB7B 3QB7C 3W2DL 4HHAB 5ICZB 3WNMA 2CK0H 4EUPG 2C1OA 4L4TD 4L3EB 2IFFL 3QWRD 1INDL 1WAAF 4LSRH 3OKEB 1VACA 3GSVA 4G9FA 4P9HH 1VEMA 4F80A 2VLLB 3VFWB 1MCNA 3STBA 4LKXB 4U1MB 2Z92B 3RA7L 5D6DA 2Z91B 5D7JA 1VERA 2MQ3A 4D2NA 2RIKA 4WJ5A 1WFTA 2Z35A 4DZBA 3PL6D 1QHOA 1FO0L 3VXSA 1SMOA 3QHZL 5ISZB 1HYSD 3VA2C 1IAII 5I1DB 2QADB 4PTTB 3WUWG 5C08D 3KHQA 5DT1L 2UY7A 4DN4H 3MO1A 3O11B 2LFGA 1RUAH 4HT1H 2P48B 5CCKL 4CVXB 2AJSH 1FCCA 1IC4L 4RGNB 2X4RB 5C92A 1LNUA 3E3QE 1EBAA 4GW5B 2I24N 2IBZY 5FOJA 4G7VL 2VAJA 3ET9F 3GMPB 3SPVA 3JWDH 3AB0C 1X4XA 4N1EA 3WUZA 2ERJB 5IJKC 4WI5A 1X3DA 3MOBL 4I3SH 3BP6A 4XP4L 4MD5A 5C7XL 1AGEA 2CR3A 3EOTL 4KTYA 3QFJE 4WTZG 5D7IB 2Y5TB 4MS8C 5I8OH 5FM5M 3SDDC 3OKYA 5T5NG 2DQDL 2H2SD 1QR4A 3SN6N 3HNSL 1EVUA 1AGCB 5BO1L 4U6XB 5L7XL 4KK5D 5FYKD 2FB4H 4TQEH 4HBCL 3CK0H 5DJYB 4DGVH 4KZEH 5HI4C 5H2BB 1A7OL 4P4RB 1TNNA 2XTJE 1G84A 5BVJA 4POUB 1P1ZB 4O9HL 4HWUA 4PGZA 4JAMB 2A6DB 4NKOB 3GSWA 3STZB 3HNVL 1FPTL 4PJIF 4WCYH 4NZTL 1H0DB 3LZFL 5ILTL 1T03H 3BJLA 4GKNA 4HUNB 4RIRB 3T09A 2VLKA 4CU6A 4U6HA 3LDBC 1ZANL 2DKUA 5DSCA 1HQRA 4JJ5A 3SDDA 3PF2A 4N0CC 4XTRD 2XZQH 2FX8H 3W81A 2GY5A 3GKZA 4RWHA 2IADA 3FQRA 4R3SB 5FA4A 1OQXA 3PP3K 4P23C 3LKNA 2BNRA 4YHKL 5KJRL 5CJBA 3UCRA 1I9EA 2XY1A 4HIJA 1TTFA 5D72L 3JV5A 4M1GL 3F6LA 3I84A 1I9RH 3NMEA 5E7FA 1HH6A 1WFNA 1FIGH 3MLTB 2VDOH 3NCJL 1J0YA 5D1XD 4XMPH 4PRPE 1TENA 1X5YA 4UV4L 4V1DB 1LO2H 4N8VA 2E6JA 4KWUA 5D7LE 5HYQA 3DUSA 3L3GA 4IDLA 3TJHD 4IDJL 1ZWIA 4KVCL 4LVNB 1LO0L 4KJPC 2W0KA 1S8DB 4IOFD 1S7RA 4G6KH 2VZ3A 4NQXA 4YFDB 4P23A 3ZE0F 2ADGA 3I9GL 1NGQL 2EXWD 3K2UH 4KRMB 1MHCB 4J12A 1JYXA 4YO0A 3AAZB 3VG0H 1E4XL 2GAZB 2AK1L 2IFGA 3S5LB 4GW1A 4YPGA 3UYRH 3QUMA 3MUHL 5EO0A 1WT5C 2FJFA 3RQ3A 3DI2B 4U1JA 2ICWB 5HVWA 1J86A 1J0JA 3SO3C 5EFIB 4O58H 5KSBA 4CVUA 4P3DA 1CVRA 2NCMA 4K94C 4OCXH 2VUYA 1U95A 3LQAC 3DVGA 3SY0B 2DQGH 2LQRA 3EAKA 3S35X 1I1FA 4PJCA 1J8HA 2DQUH 2J4WL 1ZAGA 4BH8A 5DD6B 1RZJC 4KUCD 4X7SH 3L3IA 5ISZD 1A5FL 1ZEAL 1Q94B 2BC4B 3KPLA 5F9AC 3U0TB 4AIZA 4ZNEA 1IGMH 4M1CC 4JM4H 4ELMB 5I18L 2DLTA 1WT5A 1VDGA 4FQHB 3CMGA 2Q7YB 2BXYA 2BZDA 4LCIH 4QRSB 5E2WH 5I30H 3BYYA 1UACL 4NJAH 4BSVB 5JOFB 3WL9B 3B2UD 5E00B 2H6PB 4NSKB 3C6LD 2B20A 3RWHA 1QPXA 3DGCR 1RJLB 2XKUA 1JL8A 1T0MB 2BY3A 2CK0L 2DLFH 1U6AL 4PP1D 3QEHB 1H9VA 2GKIA 5D1QD 3GJFH 1BZ7B 2CDFB 2R0KH 2R0WL 1QD0A 2OL3H 5E6IC 3ULSA 5F9JB 3F12A 1M05A 1NC2A 1U58B 1A0QL 1BJ1H 4NQVB 1ED3A 4IEFB 5IHUL 1C12B 2H1PH 1FZKA 4NFDA 5FYJD 1ZLSH 4K9EH 2GFBB 4R6UA 3HB3C 3EO0B 4X6DA 4HKBB 1LP9A 4P3WA 1V7MH 4HS6A 2EH8H 1CGVA 1DN0A 4GO6B 5BRZB 4XXDA 3O6LL 2J6EL 3BH9A 3K4AA 4LCWB 1EV2E 3CD4A 1RUAL 1NGYB 4RCAA 3L95B 4BH7A 3EJZC 4H20H 3VFMB 3REVA 5E6IA 4M5YL 3JWDL 1T20A 2GCYA 1U0QA 4KRNA 3HZVB 2PCPB 3BDYH 5CJQH 4NJ9L 4I3SL 1AXTL 1N0XL 4ONGL 4NNYB 3S7GA 5I8OL 4MA8H 4XNQA 5B39G 2HT4D 3KS0H 4R2GD 4ZPTA 3I75B 4JFOB 4S1DC 3QG7H 2M26A 5F1SA 4E5XA 1G7QA 2A83B 8CGTA 1JGEB 3QQ3A 4I5BB 4WW1B 3WEXB 2WIIB 5AUMB 3ZSSA 5C0AA 1TVBB 4RRPG 2B0SH 3WLWD 2BJMH 4MZ3A 2VXTH 2W91A 5E03A 1ZTXH 2AQ1A 4WCYL 3D2UD 3OTTA 1YC7A 3FOMB 3O4OC 4KV5F 1KGCD 4LDOB 3C5ZC 3DROA 4TVSa 1CFVL 2DM4A 4X6BB 1AXSA 1OAXH 1MCPH 4BQ9A 3PHOB 2FBOJ 4LCCB 1RZFH 2XZQL 3DRQB 3UX9B 2FX8L 3EJYC 5C09B 3VXTA 4PJGB 4U2YA 4WEBH 1X5LA 5D7SH 4OZGA 1YY9C 1FAIH 3IAQA 2XY2A 2NY3C 2CDEA 3D9AH 4PJ7A 3NABH 1WZMA 4WUUB 3ULUF 2DS4A 5FUCE 4P2RA 4EUPA 2XPGB 5I1KH 3TBVB 1ZXQA 1X4YA 5BZWA 1N5YL 3KHOA 4NKDB 2HP4A 1FIGL 1FZOA 3MBED 1U8KA 4PJDA 4XMPL 3DXAA 4OQ1A 4W68A 1NDGB 4ALAH 2DMBA 1JNNH 3QEQD 3OKKB 4DWHA 3C5ZA 1BVLB 4PJ9B 2AGJH 4G6JH 4H8WH 2WBKA 5ELIA 2BY0A 1FSKB 1XF1A 3BVNB 5H8DA 3BHBA 3SKOB 5AD0B 3LKPB 2NY0C 3BRFA 4EQ3A 3WUWA 5DMKA 4QXUH 1OAKL 1TXKA 2IWGA 1B4JL 1D3CA 5GSVB 1K8IB 1MSPA 4NM8L 4M62H 1CDHA 1EUUA 4HUXA 1CGSL 1A1NA 2OTUB 2P5EB 2R29H 3SGDI 5CKAA 4G8EB 4FS0A 4HIHA 5HVGB 4I0PC 3UYRL 2UYLA 4CU8A 3LEVH 2RBLA 3WHE0 2JJTC 3KPRB 1AR2A 1UYWH 1SJXA 2CGRL 4O58L 2NY5H 3MLXH 4UOJA 3DVNA 2ICWJ 4WTZA 5F89B 1B2WH 3DO7B 2DQGL 4P5MB 4LSUL 2FJHB 5IVXB 1T5WB 2J8UF 4HCRH 4X6CF 2E9WA 3OJDA 5DDHA 3FFDA 5AYUH 2AXGA 4TUJB 3BI9X 3U79A 1NDMA 3RVVD 5I1CL 5MEND 1J05B 1BD2D 3D87B 4I0PA 5I75C 2GTWA 1KCVL 4N5ED 3RWGB 4CRPA 1WFUA 2EC8A 3N0PB 2ZG3A 4AM0A 2NW2B 2JJTA 4TYUA 3VRJB 3MRKB 4IJ3C 4MA3A 2VE6A 1NCNA 3GMMA 4WW2F 2DD8H 3MFFA 3NPZB 4NJAL 4M7JH 4ZS6D 3FT2B 4XVUC 1YA5A 5CS7A 5GS0C 5F6HI 3JWOC 2H2PC 4Z5RA 3BKYH 3NZ8B 4ONFH 1YN7B 2VZOA 1I8MB 2NY1C 2YKLH 3KJ4C 4LRNH 5ENWB 1N59B 2R0KL 4OIIH 2OL3L 2VN4A 1VHPA 4QY8B 2ED7A 5BV7H 1Z5LA 4Z7OF 1EEUA 4MMZC 2H1PL 3FQXA 4HUWB 3UJJL 3KWWA 4QTIH 1G7MB 3IAPA 4X9GA 4CMMB 2OP4L 1WWBX 4MD0A 2BOBA 4G6FB 5DMGC 5EH1A 1DLHB 4Z0XB 1SBBA 4FQ1L 3MRHB 4IRSD 4FZEL 4LSQH 3EFDH 5J1AB 5T33H 4JFHD 4JPKH 2NTSP 1E4WH 4JREC 4P2OD 4U1SB 3BH8B 3K74B 3K46A 3IJSA 4FQIH 3L5HA 3VI3F 4L8DB 5B8CC 2P24A 4OF5A 1T6VN 1BHGA 1WSST 3BDYL 5K9JL 1ZHKB 2EECA 5CJQL 2XNAB 5KSUB 1JBJA 3MUJA 4OLYL 5B21A 1FO0B 5D2LB 3HI1A 4YDIL 5C0CE 1QRND 5DUBB 1F3DJ 3KLHC 1OLZA 4KK9C 4QEGA 1FL6A 2H32A 5CEYB 3UO1L 4LSTH 3V0VA 3MGTB 1BX2B 3MUZ1 4DGYH 2OM5A 3ARRA 3MSPA 3QCTH 3ZDXF 3CFBA 4G8GA 4X7DC 4NUJB 1B9ZA 4X5XB 1JGLL 3WS3A 2VL5A 5F1NA 5DRZB 2B0SL 5EBWB 3HE7C 4N0UB 4LLQA 1EGJH 3AM8C 5B8CA 2HWZH 2P1YA 2XWBB 1ZTXL 4OFPA 5TF1H 4YWGH 5IBTL 5J3HC 4ZOCA 2PW1A 1OAXL 1F13A 3D39A 5FIEA 2J5LB 2VDNH 2BVTA 1ZLWH 1Q38A 5DC4B 3MA7A 3QIBD 1XMWA 2QQLL 3GMNA 2VAAB 1C1EL 1CT8B 2J12B 3CSBA 4Z77A 4Y5YB 1JWUB 4PJEB 4QHUA 4RX4D 3RY6A 1FAIL 2DQCH 3GSUA 1PSKL 5F7DA 3KPRD 3NPSB 5ALBH 4RBPH 3JTTA 1IAKB 5B38G 3BESR 3S5LG 4KGLA 3HE7A 2XYCA 3AM8A 4D0CB 4KMQA 2FH8A 4BZYA 5DQ9A 3V7AG 2QL1A 1I7RB 1RK1A 3I6KA 2XICA 3BD5A 1JNNL 5J11B 4K3JH 5CJ8A 1T4KA 4KKAD 2XQBH 1MI5E 1KYOJ 2BNQE 4AH2B 4CDHA 2NX5A 4U1GB 4MNHB 2FDBP 3N85L 3ZDZF 4YHIB 1OPGL 1MPAH 3X12B 2VIRA 4QXUL 1E6JH 3CX5K 3F58H 4TUOA 5K9QG 3O2DA 3INUL 4FFWD 5IUSA 2C3VA 4RMUA 4UB0H 5DRXB 4JFDD 5J9PA 2MHAA 4IOIB 1QSEA 4GH7B 4U1IA 4UDTB 1U91B 3FQNA 4FXLA 4U1KB 3LEVL 3MLSH 1LDPL 2FIKB 5DK3A 1Q0XL 4OZIF 4OCYH 1UYWL 2DL2A 2UUDK 2NY5L 1P84J 4HJJH 4ZFGL 3MLXL 5DJ0B 2NXZC 3FTGA 1BQHB 4AQ1B 1N6UA 1B2WL 5HGDB 1P2CB 5EU5A 1P7KA 5F7WC 4Y4HB 5B39A 32C2B 1MHHB 3PWPA 4HCRL 4KJYB 4WI3A 3GZKA 1AJ7L 4ZTPH 1NAMH 4X9FA 3TNMA 5C0JA 3RWCB 4MDIB 2EDKA 5FAAA 3S88L 1LO5A 4Z7VA 3T2PA 1QRKA 2P49B 3D85D 1W0WA 4RRPA 5CBEB 3PQYA 4UBDC 4LLDA 1RI8A 1A1MA 4X0KB 4DVRL 1VSCA 4Y5VC 1DDHB 2DIAA 3DTXB 3S35L 1KYOK 1S7QA 1YNTA 2P44B 3QFJB 1FL5B 2LU4A 4M7ZB 1OCWH 2DD8L 2PKDA 3HR5B 4M43L 4ZS7H 3V5KB 4M7JL 1OAQH 4YHZL 2DWEB 2HLFD 1D5IH 5DO2C 4OFYA 2MFNA 5F9OH 2HH0H 1CBVH 5E8DH 1S5HA 5D1ZC 5E8PB 3BKYL 2X7LA 5I1GH 3FFCE 4ONFL 3U7WL 1NCCH 5KVEH 4Z7UF 2YKLL 1ONQA 1R6VA 4OIIL 2XTJB 4LOUC 5EOTB 4YUEL 4TTGA 2MKWA 5MHSD 1FE8H 4PRHA 3DURA 3SCMC 4YHOL 4M7KH 2AXFB 1QR1A 1OSZA 3MCG1 1I7UB 2EDLA 1EHAA 2AS5M 3FQWA 4D8PB 4Y5VA 1JNLL 3QDJE 2D0GA 1HHKB 4GBXC 4FQ2L 1XT5A 5KSVA 4HAFA 3NFNB 3TH3T 4YR6A 3EFDL 4YBQC 5E7BA 1LO4H 5GGRB 4LLWB 5D1ZA 5IM7B 1E4WL 3IU4H 4OQTH 4KI5C 1EAPB 4KTEH 4QOKD 3EOBB 4WFGD 1KLGB 4Y0GA 4CN4A 2P5WA 3AS0A 1L0XA 2D03H 5IHLB 3DO3A 3GHEL 4OF6A 5LKNA 4PRPB 3MLUL 2ADFH 3U36A 1XF2A 3E8UL 3HC4H 2H9GA 2J3SA 2AK4E 5D7LB 2QADC 1XF5B 4GBXA 4KJQC 4HX1A 5AAMA 2CKBL 4MJ5A 4OGYH 1N6VA 3QXTA 5JZ7C 2AI0H 4XWOD 4LSTL 25C8H 3TT3H 3FB7A 4QXGH 4HHAA 5ICZA 2HFGL 2Q6WB 4L3EA 5D70L 1RIHH 5INCB 1BVKB 2IAMD 1TZHB 2VLLA 3VFWA 1EGJL 2WLZA 4LKXA 4UT9H 4U1MA 2ERJC 2Z92A 2Z91A 4LCUB 3U6RB 4TVPH 1BBDH 1QLEH 5B4MD 1S7VB 2O61B 1PG7X 2WUCL 1BWMA 3QIUD 5ISZA 1YNLH 5I1DA 2VDNL 4PTTA 5FYLH 5I66B 3RBGA 1P6AB 2EZ0C 2J1KA 1J1XL 3CXDL 4UT6H 2JIXD 3UP1A 2GT9B 4X4YB 3KXFE 3OBAA 4N1CA 4WWKD 3O11A 5EZJB 4CVXA 4JN1H 2X4RA 3B5TA 3QHFL 4QRPD 5ALBL 5JIIA 3B9AA 1RD6A 2OXGA 3K1DA 4GW5A 4MVBD 1DP0A 3VXQB 5I9QB 4WDIB 3GMPA 1WBXA 2VXVH 2IH3B 3MREB 2C7UB 2QR0B 4I0CC 1MCJA 3WIIL 5CZKA 2WBJB 4PLKD 1KBGH 5D7IA 2Y5TA 4JM2B 4LLVB 2VO5A 5L8JB 2L0DA 1AGCA 4U6XA 1IGJB 3C5SB 1DQJB 1YQVH 1ERNA 1IAIH 1VGKB 2YPKB 4N90D 5DJYA 5ID0B 4UB0L 3I50H 5H2BA 4HFWB 2VLMD 1P1ZA 3WV0A 2IQ9L 1X5JA 2A6DA 2VC2H 3IF1B 4NKOA 2YRZA 4QCIB 2ED9A 3STZA 1MFNA 1EO8H 2DDQH 3E2HB 4UOW1 4ZUTB 3MLSL 1H0DA 3BP7B 3LPFA 1IAOB 4RIRA 4CU7A 5D7KE 3PWJB 1RFDL 2YBRB 4F57L 3TV3L 2BVOB 4HJJL 2V2WB 5FO9B 2EDOA 4FTVB 5L2JA 4LVNC 1G1YA 4GXVL 1CDIA 2JJWA 2EDQA 4R3SA 4UTAH 1HIML 5JR1H 3TCXA 4HD9A 4DGIH 2HG5A 4F58H 3IJHB 1O7VA 1NAML 1AR1D 3RTQB 2X9XA 1MCKA 4FP8H 3FO2B 5KVGH 3U30B 4TNVF 3MLTA 4ZFFB 4YHPB 3B5GA 1HOCB 1KNOB 4V1DA 1EHXA 1XGQB 3OKMB 4TVPE 3RVXC 1MEXH 1FVCB 1KXTB 4JO2H 3SJVE 5GGVH 4ZS7L 4GRWF 2X2YA 5FYLE 1OAQL 1AY1H 1NFDE 1SY6A 1D5IL 1S8DA 5F9OL 2HH0L 5SWZD 1CBVL 1JPTH 3CZFB 3MX0A 1FDLH 4IRZL 5E56A 3G5XB 1NCCL 5KVEL 1CG9B 3QUKB 1MHCA 3P30H 5L2KD 3AAZA 4ODBD 5B38A 3GUTB 3IT8D 2GAZA 3S5LA 1MAMH 3NVQA 4JANB 1I8KB 1K2DA 1FV1B 1BP3B 2ICWA 4OLWL 5EFIA 5JHLL 3W82A 4JY4B 4K2UH 4RDQG 1I7TB 5AWNH 2OI9B 3CX2A 3FJTA 3SY0A 1A6UH 4A6YL 4OGZA 3MJ9L 4N1HB 4NM4L 1N2RA 1F8TH 1I3GH 5FK9B 4OQTL 4UV7L 3H9SD 1SM3L 5DC9B 5F9WB 4KTEL 4KTDL 4LPWA 5T3XD 3NFSL 2HVJB 5HI5D 1Q94A 2OR9H 2BC4A 3IDMB 3RL2B 1PKQE 1UJ3B 1NUGA 2OL3B 3U0TA 3ULUD 3DNKA 5JXED 4ELMA 3WKML 4FQHA 4OM1H 2Q7YA 3HC4L 5SX5H 1N6QH 1VEOA 2JF1A 1FNHA 3MJGX 4QRSA 4GMTH 4Q9QH 4BSVA 5JOFA 5DLMH 3WL9A 4ZTOL 2DRUA 4B41A 4J3SA 5E00A 2H6PA 1R3HB 5E99H 4NSKA 2AI0L 1A4KB 25C8L 3ILQD 3TT3L 3UBXI 1RJLA 1T0MA 3QEHA 4HWEL 1BEYH 4XNXH 1BZ7A 3T3PE 4LEXL 2CDFA 1UVQB 4UNTA 5EOCH 4R97C 1IFHL 4MNQD 2EC9T 4QNPF 2X10A 5F9JA 3WFBH 5FDWB 1IRAY 4PY8J 2YS4A 1KJ2L 1T2XA 4NQVA 3C9NB 1C12A 3PWLB 4TVPL 3SE8H 1NSNH 1QLEL 5DJDB 3Q1SH 4JGUA 2GFBA 2R69H 2VQUA 3EO0A 3LRHA 1KG0B 1DFBL 4HKBA 1EZVX 5FYLL 4Y1AD 4BQ6A 1T0NB 5C1MB 2X4UB 1IGIH 5BRZA 4NRXB 4LCWA 3GBLA 4MXVF 3LB6D 3O3EB 1NGYA 1A3LH 1REIA 2GK2A 3L95A 4JN1L 4RFNB 1ZS8B 3HMWL 1H5BB 1QFPA 5LVEA 4MX7B 3VFMA 5L8LB 1Q72H 3IGAA 1MFBL 1PG7H 1AP2B 4FTVD 4LSDA 1N7ML 4PB0L 3HZVA 2PCPA 1FFOB 2VDML 5IT2H 2EEAA 4WFEE 4BFEA 1KBGL 2PTUA 4NNYA 2VXSH 3DIFB 4KK6D 4LCCC 3I75A 4JFOA 1TJIL 1HEZB 1U8OA 2A83A 1YQVL 2UZXB 1NAKH 1JGEA 5T5FH 5HD8D 3I50L 2Z31B 4WW1A 1KPRB 1OTUD 2WIIA 5AUMA 4WU5B 4KHXH 3TIEB 3WIHA 5CUSH 1NKRA 2XWJB 3HAEB 3AVEA 1QBMH 3FOMA 2MPAH 2Q7NA 4PJ9C 4X6BA 4P4KC 5HYJE 1MCHA 3P0GB 3F7PC 3L3DB 1FSKC 4LCCA 3QP3A 3DRQA 3FZUD 1KTRL 3RX7A 5C09A 3QDGE 4KKCC 1GIGL 4A2LA 1HH9B 4PJGA 2NY6D 3RX5A 5L88H 4DGIL 1FC2D 4KKBC 1Q9KB 2A6KB 3KAAA 3U1SL 4WUUA 4C4KO 2XPGA 3TBVA 4NKDA 5KVGL 5F96L 1A9EB 2H45A 5T3XH 2WWKT 4BQ8A 1NDGA 2EDYA 1JZ7A 1AD0B 3OKKA 2CDGB 5I8CB 3ULUH 1BVLA 4PJ9A 5D6CA 3UTTD 1B0WA 4JO2L 5TE4H 2YWZA 5GGVL 1R3IL 4HGMA 3VGAB 1IEAB 3BVNA 4NQDD 2DB8A 3SKOA 5AD0A 1VGEH 3LKPA 4E42B 4S1RH 1AE6H 2FR4B 4UQ2B 2QBWA 1RZKC 5J06A 1JPTL 2F5BH 1A14H 1FDLL 1GC1H 5IVNA 4NP4L 5TF0A 5GSVA 1K8IA 5DEFB 2OTUA 2P5EA 2GEEA 5GZOC 3LQZB 3TCLB 4XHJC 4G8EA 4LCYB 1UM5L 5IJVB 3E6HB 1QG3A 3WXWH 3KPRA 3EYFB 1ACYL 3X3GH 5FO7A 1KV3A 3MRCB 1MFDL 2ZSVB 5F89A 1WEJL 5DMYA 4AENB 4P5MA 5IVXA 2FJHA 4L8BB 1T5WA 1X5AA 3AMLA 5HHPB 3MJ6A 4HBQA 3DVIA 3FOLB 1OSPH 1JCKA 1I3GL 4ZXBC 4MJ6B 1CZ8H 4DKFH 1NANI 5HI3C 5K9KB 3HTLX 4MB5A 4TUJA 4U3HA 3QNYB 4FOMA 1J05A 1XZ0B 2XG5A 3ARFD 3BE1L 3VGFA 3MRIB 3QZWB 4R8WH 1FYTD 3RWGA 1KIRB 4GG8B 1F42A 1JHLH 2NW2A 5CSZB 5DI8B 3SGDH 2PO6D 3VRJA 1TQCB 2V2XB 4XPFH 1MI5B 4GSDH 5CP7B 4PJBF 5B3JF 1MQKH 3LKQB 2BNQB 5AEAA 4UMGA 5DYOB 4F7CB 3PUCA 4X9BA 3G6AB 3FT2A 3I3EA 1UB6B 4KV5E 3R1GH 3ULVF 1YN7A 3BFOA 4C56E 4XNXL 1I8MA 4Z7WE 5ENWA 1N59A 5EOCL 2Y23A 5DVKA 2W1NA 3L5XL 3L9RB 5JOPE 4YH6A 1BOGB 5T1MB 2DQIL 4UIKH 2YD9A 4QY8A 5FECB 2EDHA 5EN2B 3MFGB 3TPKA 4HUWA 1F4XL 1NSNL 1XGPB 4NKIH 3SE8L 3WDIA 1G7MA 1MRFH 1PZUB 2Z31D 4CMMA 3VD9A 5D9SB 2F53B 1S7TB 5MI0B 4Z0XA 1DLHA 2AKRB 4G3YH 3V9FA 3ZT5A 1S3KL 2YD7A 1KSRA 2CKBB 3MRHA 3WN5B 2E3VA 3TC9A 1H3PL 5J1AA 4HC1A 3CLEH 5KZCB 3KS0J 1FZMB 4R4BB 1G0YR 1EDQA 3MLWH 3PGFH 4L8SC 3TWCH 1J1OL 3BH8A 1UENA 1Q72L 3RWEB 1PG7L 4L8DA 2Q8AH 3NCMA 1BQLL 3OJVC 4PJ8D 3BDXA 4Q74A 3TO2B 1L6XA 3UJIH 1ZHKA 2BNUA 2XNAA 5KSUA 3M8OL 4ETYA 4NKQB 1FO0A 3TBYB 5CINH 1GGIL 1QLFB 12E8H 1V3KA 5DUBA 1UKTA 3BP5B 4YHYB 1DBKH 4M00A 5CEYA 4Y5YC 2VLRE 2YK1H 3MGTA 1BX2A 1JNHB 1IE5A 5J56B 3C60B 3FFCB 3NPSC 3G6DH 4NUJA 4X5XA 2GY7B 5DHVH 1A7PH 3B9KB 4F8QA 5I1HH 4XNZB 5DRZA 1IM3B 5EBWA 5IV2B 5C6PB 4N0UA 3A6BL 2XWBA 1LGVA 4I18B 5E2VH 5FYKU 5IROC 1RK0A 5KW9L 1QBML 3VFVB 1RPQA 4GAYB 5J11C 3B3IB 1AH1A 2MPAL 2O5ZH 2NYYD 3QDJB 3GIVB 2OMBA 2ID5A 3WNOA 4XAKD 4U1GC 1GOFA 3WDHA 3NCYP 2VAAA 3OB0H 1CT8A 4Y5YA 3V0WL 1JWUA 2YOCA 1LWRA 7FABH 4PJEA 5L88L 3H0TB 3BQUD 4M7LL 2VOTA 1IAKA 2EDTA 3P4NA 1G7LB 5TGBB 5T1KB 5E5MB 2BXZA 2VSDA 3QISA 1TCRB 1NCAH 1IAIM 3P4MB 5IROA 4K7FB 1I7RA 1MJUL 2EDNA 3VI4F 4H0HB 1AC6A 4NC2B 4JRXE 2QSQA 5J57B 1LK3H 4FQLH 2AK4B 5FCSH 4AH2A 1QSFA 1YEGH 4MNHA 5E94B 5I71B 2PYED 4Y4HC 4YHIA 3G9AB 3JBG7 3QBTB 4OZFH 3X12A 3K81A 1GOGA 4HIXH 5DRXA 4Y16C 1NAMB 2IPUK 3E3QC 5HDBF 4R0LC 4Y2OA 1M4KA 4IOIA 4UDTA 3DX8B 3H42H 3Q3GB 1MCWM 2EXYC 1U91A 4U1KA 1X6LA 2FIKA 4M5ZH 1YECH 4BQBA 4P48A 5HYEA 3P77B 4X5WB 3TN0B 1F4WH 4M7ZC 5H37G 4OFIA 4ZG1A 2F54D 1QLRB 2AJUH 3DSFL 2QQQA 3ARGB 5DJ0A 2EEDA 1BQHA 1P2CA 4C83B 3T08A 4Y4HA 4MDJB 32C2A 1MHHA 3KXFB 1KELL 5F8RC 5C6TH 1FORL 5GS1B 4KJYA 5DJ6B 2IBBA 4Y16A 4QYOB 3RWCA 2XTJC 4R0LA 4LP5A 2F53D 3L7EB 3RVUD 2HMIC 5CBEA 4R8WL 3UZQA 3RI5K 4HMCA 4NGHL 2YA1A 4AYFA 4X0KA 1JHLL 3DYPA 5J1TC 2X4QB 5TH2B 1DDHA 5CJXC 3DTXA 4BZ1H 4XCNB 3QFJA 5DQDH 2GJZB 1FL5A 4ODTH 1LO3L 2Y7QB 4OIBA 2JJSC 1TLKA 3HR5A 3V5KA 1HE7A 4RFEA 5IB1B 5DFTA 2DWEA 3HI6L 4R7NA 2N1KA 1GPOL 3UDWC 1NMBL 1D9KC 4A6YB 2DLEA 5E8PA 3B9VA 5DD3L 1VKXB 1RZIB 1OGAE 1CE6B 5EOTA 4P9HC 4OLZL 3N9GH 2K3TA 4LF3B 3RZWA 4M6MH 1JI1A 1U9KA 2IQAB 3C8DA 4M9PA 3DMMD 4K3GA 5EZIL 2AXFA 5DA0B 1I7UA 4NPYB 4D8PA 1OAZH 3C60D 3FFCD 4J3TA 4UILL 3VH8G 3ZHKA 5CJXA 2FZ3B 1HHKA 1MJ7H 3H9YA 1SHMA 2A9MH 5IEHB 2JJSA 1CFTB 3QAZB 1FNEB 4G3YL 3NFNA 1WTGT 3TNNB 4LPXA 2IPUG 5LCVH 1FBIH 3UDWA 3BGAA 5GGRA 4LLWA 3OF6D 4G8IB 5IM7A 5FYJU 4RA3A 3MLWL 5LXGL 1EAPA 2K7PA 4JVPA 4DTGH 3PGFL 2XOTA 4KKLD 1EEQA 2FHFA 1A2YB 3EOBA 4LDEB 4QRRD 1KLGA 3ALXA 1WTLA 3ARVA 4B0MM 3HAEG 3KLAA 2Q8AL 1HN1A 3EYQD 3JWDC 4G80B 3MPCA 2RR3A 2B2XH 4IRJB 1CU4L 4X7TB 3CCHB 1KJ2B 3H6JA 4PRPA 3KVQA 3RKDC 5ETUB 5D7LA 4DUWA 1XF5A 4MQXC 5CINL 3SJVB 4NZJA 5GHWH 5LBSL 1NFDB 5J8OA 1DBKL 1WJ3A 5C0RL 3MCLH 2J6EA 2WM0A 2YK1L 1JRHI 4OZIE 3N06B 4PGDB 5ICYB 2Q6WA 1S9KC 4CN1A 2Q8BL 3H3BC 5INCA 1A7PL 5I1HL 1Q9OA 2IGFL 5I9QC 1U36A 1TZHA 4HK3J 4WO4B 1ZGLM 2VITB 4O5LL 3ARSA 1BZQK 5E2VL 4XBGB 4R4FH 4M4RA 4LCUA 3RWFB 3U6RA 5C0ND 4Z8FH 2WBJC 1S7VA 1F2QA 4OAWB 2O61A 1YEIH 2GITB 4JM2C 4ZO8A 3RDTB 1CLYL 1KOAA 1DANT 5DR5L 5I66A 3UXFA 4JHWH 4LP4A 2GT9A 4X4YA 5E24E 3O6KH 4YBLB 5EZJA 7FABL 4QTHB 5GRYA 3QXAB 3WJJC 3OKDB 4Z18A 4NO0B 2WANA 1U8IB 3VXQA 4BELD 5DWUH 1W8NA 4WDIA 4XHQA 3G04B 1PKQB 1Y6MR 1NCAL 2IH3A 4NQSB 4FQJL 3LS5H 2IPKB 3E2HC 3MREA 4QKXB 2C7UA 2QR0A 4JHZA 2WBJA 3UTSD 4RGOL 3BZDA 1LK3L 3TFKC 3VWKB 4G6MH 4JM2A 3BP4B 5C07D 3W11D 4LLVA 3S8WA 5TDOB 5CD3B 1HHIB 4XB7A 1IGJA 4M8VA 2ESVD 2EDJA 1ZLWK 1DQJA 3CFKA 1I1CA 1DQDH 1VGKA 3OKNB 5ID0A 2IANE 3WJJA 4NNPL 3RTQC 1JF5A 4HFWA 1VFBB 3KYNB 1T3FB 1M71A 1E6OH 4CMHB 3IF1A 4RBPK 4QCIA 1A6WL 1FGVL 3U30C 3VRLE 4ZAKD 5IBLD 3HG1D 1VPOH 2QHRH 4ZUTA 1CF8H 4NNXB 1YECL 3BP7A 1IAOA 1UM6H 1JWSB 2K9UA 1RHFA 4L4VE 4OV6F 1NLDH 3PWJA 4LRIC 2YBRA 4UUJB 2BVOA 3OJ2C 1S78C 2AJ3B 2V2WA 5FO9A 2BK8A 1IVLA 3T0EE 3VXMD 1Q1JH 3VXPB 2CMRH 2RCSH 3DX9B 3CSGA 4JPVH 5DEZA 4Y5XB 3IJHA 4B5EA 3M17B 2C26A 4UAOB 1CI5A 1NUFA 3T2OA 4MGXA 4C54A 5D7KD 1W2KT 5IGXL 3RTQA 4I77L 5EPMB 3M45A 3LCYA 3FO2A 4HWBH 1KJMB 3QO0B 4ZFFA 4YHPA 2P7TB 1INQA 4JY5H 1HOCA 1KNOA 3LKRB 3SE9H 4L9DA 1XGQA 3TO4B 3OKMA 2HN7B 1FVCA 4F7EB 2FEDC 1NCWL 1WC7B 4Q58C 4LRIA 4ODTL 1PFCA 2XXMB 5DEGB 1G7PB 1WLHA 2OI9C 4PJCF 2QLVB 1LE5B 1TCMA 5ECJE 5IW1B 4K23L 3CZFA 4NUGL 2BVQB 4HG4J 1MCLA 2R4RH 3G5XA 1T89C 1CG9A 1RZ7L 5F9WC 5GZND 3QUKA 3O4LE 5FUCC 5J1SC 3HHRB 3ESUF 1ZA6B 1PY9A 3RVTC 4JANA 5F6IB 1AIFB 4J6RL 1I8KA 2QQNH 3GM0A 1FV1A 3GBNL 2VR4A 5ACLA 4LFHG 2NMSA 4RQQB 4MAYB 1OAZL 2EKSB 1CQYA 5GRJL 4K9EC 2OJZH 5HYJB 2A9ML 1I7TA 1Z9MA 3G6JB 4N0FB 5JQHC 3RIFF 3QDME 3QDGB 5LCVL 1FBIL 4YHNB 2YXFA 4M8QB 4KY1H 2DWDA 5FK9A 5I17B 1HSBB 1KTKE 1O5DT 3GI9H 4MLSA 1OARL 3KR3H 5INDB 4F9LC 2HVJA 1DZBA 4OGAD 3IDMA 1P4BH 3F7VB 3ZKMC 2OL3A 1M7DB 5EU6D 4LPVA 1QSVA 3HMXL 2NY2B 4YHLL 4P2QE 4ZOBA 4OCRL 4X6DF 1AQDB 3LH2H 4Y2DD 1NGPH 1U8MB 2FL5B 1ADQH 2GUOB 5KVDH 4UT7H 1JGDB 1SQ2N 2AJYL 2NY4B 2V7NB 3STLB 2X89D 1VFAB 3TA3B 1YEFH 1R3HA 1MRCH 4ODHH 5FO8B 3MCLL 4HG4K 1CICD 3B43A 1ZGLB 4RFNC 2FATH 1CXLA 1T66D 5CZXD 3RZCC 4ERSH 1UVQA 5DD5H 2V5RA 5GRZA 5BQ7B 4F9LA 4J3OC 2AEWA 5FDWA 3RP1A 3BEVB 2XACC 5I1EH 3C9NA 3PWLA 2E9JA 5GJSH 4Z8FL 2B4CL 3M1BA 2HJLB 5DJDA 5IVZB 1EIBA 2IPTH 4AY0A 2PTTB 2YXMA 4K8RH 1KG0A 5IB2B 5JHDD 2ZKHH 1MVUB 3HKFA 1QOKA 3B2VH 1DQLL 1T0NA 3EDJA 1XF3B 4JHWL 1RAMA 1IM9B 2FD6L 1RUMH 2HT2C 3EW3B 4CJ0A 4JZJB 3O3EA 1CFNB 5CZVL 1ZS8A 2D7TH 1H5BA 2BOCB 4MX7A 4KRPD 5HHOE 2VJXA 1Y6NR 3RZCA 1CFSB 5GGVY 3BSZH 1AP2A 1EA9C 1XGTB 5DA4A 1S7XB 2F15A 3JV4B 3MLYH 4DCQB 1OM3H 3LS5L 3VFSB 1BM3H 1FFOA 3RIAK 4P99A 5EO1B 3PGCB 3MV7B 3FO1B 4Z76B 3PDOB 3L5WB 1FLRH 3ZDYF 3QIWD 5DD0H 3PDGA 3NIDE 4GQPH 4L9LB 3GGWB 3DIFA 4G6ML 4MXWH 4WU7B 4X4XA 1JPSL 1BPVA 4OZHE 4WUKH 3VH8A 3PXJA 3MCKB 1EJOL 2R0ZL 4OZGF 1HEZA 2XG4A 3OPZL 2YRPA 2X9YA 1DQDL 4HZAA 3CLFH 1YUHB 2WP3O 5CILH 4NQED 2N7AA 4C56B 2G60H 1KPRA 4LPUA 4Z7WB 3ARBB 1DBBL 4P3CH 2VYRE 4WU5A 1II4E 3ULVD 3TIEA 4D9QE 5HYIA 3ZLQC 4DEPB 5FCUH 3OV6A 1VPOL 2XA8H 2XWJA 3EDKA 3HAEA 1CF8L 3HC3H 1AKJA 1JN6B 4PYGA 4ZOEA 1F90L 1NLDL 2Y72A 3O45B 5ESAB 1UEMA 2NY5C 3L3DA 1U8JB 3Q5YA 3VGAC 1VB9A 1U3JA 3CC5B 2ZNXA 1WWAX 1HH9A 2B1HH 4O02L 1IQWL 4JFXB 3V4UH 3BRDA 3OKOB 2RCSL 1MJ8L 3THMH 1Q9KA 2A6KA 1MLCB 4FQPA 4PJAF 4P57B 4HV8B 5L9DL 1N3NB 4JG1L 3X14B 2CJUH 2JJUA 3FONB 3MBXL 1A9EA 1XIWC 3T3ME 3VW3H 2ZCLH 4JY5L 2A77H 4OCSL 3O6MH 4PLJD 1AD0A 3SDAB 2CDGA 6FABH 4QWWD 1K6QH 5I8CA 2EDXA 2D4DA 4OF8A 1CGTA 2A6IB 4Z78B 1UM4H 5T5NF 4YFEA 5CMAB 5C0CA 1IEAA 5HHNB 4H25A 4E42A 4K3DH 3QH3B 2FR4A 4UQ2A 3ARDC 1EUTA 3BPLB 4V2CB 1GXEA 2VLRB 2Q1EA 2R4RL 4HCRA 2R2CA 1U3YA 3TGXA 4RMQA 3T0VA 2BVPB 3NH7L 2YPLE 5MEQB 1ODAA 4U0RB 4GW4B 1F97A 1VFMA 3PWNB 5J12B 2KZWA 5DEFA 2YZ8A 4P2CG 1NC4B 1N0LA 4PY8I 3LQZA 1G9MH 3TCLA 4OUUB 1FC1A 3MV9E 4LCYA 1SVCP 5IJVA 1G9EA 3KLSA 3F6IA 3QJHA 3UC0L 1XIWA 2DTSA 4JHAH 2QQNL 2BX5A 3E6HA 4QHNB 2QKIB 2C1OB 4LGRB 1WWWX 1SYSB 1TQCC 3S9DB 2DIJA 3EYFA 4WHCA 5EA0H 3ALPA 4F7TB 2FSEB 3MRCA 3S36L 2XQYG 4JO3L 3PXHA 1D5MB 2ZSVA 3TVMB 2APXA 1PQZB 2J2ZA 4AENA 3GSRB 4L8BA 1UXSB 3ARDA 4NN7B 5HHPA 3BUYB 4DKDC 4ZO6A 4KPHH 3FOLA 1CXKA 1BWWA 3TJEH 4KY1L 2KDGA 3LHPH 4MJ6A 4WFFE 3GI9L 3WCYA 2NZ9D 5K9KA 1MWAH 2EDFA 3O3BB 2DQJH 3QNYA 4GQ9H 4LLYB 2Y9RT 4Z6AT 1XZ0A 2CIIB 3MRIA 3TZVB 5BS0E 3OAYK 2Y1VA 2JCCE 1KIRA 5FB8B 2A73B 3LH2L 4GG8A 4AMKL 5KVFL 1NGPL 5CSZA 5DI8A 2BRRH 1ZT7B 1CLZH 1MCWW 2ZJSL 3I02B 2V2XA 4JRXB 1IGFL 1MI5A 5CP7A 4Z95H 3LKQA 2BNQA 5MI0C 4F7CA 1ZVYA 3G6AA 1YEFL 3WN5C 1U42A 4MD4B 4ODHL 3QQ9C 1UB6A 4UQ3B 3B83A 4Q0XH 3B8YA 5E9DE 4F37K 2P46B 4JR9L 3MV7D 3WFCH 4AEHL 2VMFA 4KXZH 3VXUD 1KN2L 2R2BB 2YD1A 4ZQKB 4GAJH 3L9RA 3TEUA 3PWVB 5T1MA 5FECA 5EN2A 1QKZH 2XN9E 3LD8C 5I1EL 1YNKL 1OP3H 1XGPA 1QUNA 2IPTL 3SDYL 4YE4H 5D9SA 2VLJE 1S7TA 2ZKHL 2F5AL 5SX5K 2AKRA 3B2VL 3H2WA 4YHYC 2CKBA 3HZMB 5T1LB 3WN5A 1XGUB 2D0HA 1HDMB 3O3AB 1YEHL 3DYOA 3W0WE 4XCYB 5CEZD 3KPSD 1FZMA 5EO9A 4R4BA 3K8MA 2YD4A 2HT3D 2FHCA 1CR9H 1BJ8A 4U6HB 1KB5L 3B9KC 4JFZH 4EI6B 1HQRB 4XNZC 2MCPL 1MCEA 3MACH 3E0GA 4R90H 5DD1H 3RWEA 1PD6A 3BSZL 1I1AD 4ENEC 1I3UA 1GAFH 3MLYL 1EGJA 4I18C 4WTWA 3TO2A 4BFIB 3W9DB 1NCDL 5A2FA 4NBZB 3FQRB 1V5JA 1FLRL 3CJJA 3NZHH 5DD0L 1RUPH 4J1UB 3TBYA 1OB1B 1QLFA 4DUVA 4WUKL 2ORBL 4YDVB 5H94B 3BP5A 1INEH 3OZ9L 1F5WA 4HWNA 3UJTH 3WLBB 2R4SH 1JNHA 3C60A 3FFCA 5CILL 3SDAD 4U6YB 4RWYH 3LDBB 1OGAB 3B9KA 4XX1E 5KSAD 3L6FB 5ALCL 1OQOA 1IM3A 1CD1B 5IV2A 3AREB 3TH2T 2BP3A 4I18A 2XA8L 4R7DB 4P5TB 5DURD 3RU8L 3VFVA 4GAYA 3B3IA 1K3IA 3KJ6L 2NNAB 2ZPKH 2MMXA 3QDJA 1OOAA 2VRAA 1R5IB 5MEOB 4XMLL 5FHBH 1MREH 1QYGL 3PWUB 5I71C 4YDLB 1RJYB 2B1HL 4MQTB 4FN0A 3V4UL 1RY7B 4FG6D 4OZFB 3EDDA 1B88A 5EB9A 3H0TA 2AQ3A 4X4ME 4XPAL 2PR4H 1G7LA 5TGBA 5T1KA 5KSBB 2BSED 1QACA 5E5MA 5JUEH 2D9CA 4G9FD 3W39B 3GHBL 1TCRA 3P4MA 4E41E 3MYZA 4K7FA 5D7JD 4QRTB 2ZUXA 3O6ML 1Z2KA 1K8DB 2WQ8A 1HWGB 4KK8D 4DK3A 3TN0C 1DBML 3VXSD 2AK4A 5DFVD 5KOMC 4FFYH 1JHKH 3ARGC 3CDCA 1UM4L 3UPRB 4M6NL 5E94A 1PEWA 1PG7W 4GKSB 1U8PB 2VTFA 4XPGH 1IKFH 2WW8A 2YZ1A 3U7AA 5GS1C 5T3ZD 5AAWA 3O2WH 4OZIB 1PZ5B 1QZ1A 4Z7VF 3PHQB 1L0QA 2FECI 2Z8RA 1NAMA 3GSNL 2OLDA 4NYLB 1CFBA 2DQTH 3CFEB 3DX8A 1JTOA 3KYKH 1G9ML 3Q3GA 4FABH 3QPXL 4JHAL 1W72L 3RWHB 5LWYH 1CXFA 2KZ1B 3A67H 3O9WB 3P77A 4X5WA 4YLQT 3TN0A 5CGYC 5EA0L 1E28B 5F97E 1QLRA 3ARGA 5GRUL 1CS6A 5T1DH 2UZIL 4C83A 4JDTH 4MLIA 4MDJA 1V3MA 3KXFA 1FQ9C 1RIUL 2IBGA 5GS1A 4HXAH 5DJ6A 1LMKA 1Q9LB 3LHPL 1I4FB 4DW2H 1G9NH 1Q8MA 4QYOA 3HPLB 4KVNH 1MWAL 1MRDH 1LP9B 2CRZA 3L7EA 5DUPH 3KPPB 4WTXA 4HPYL 1G6RH 1ZK9A 3BH9B 5T1LD 3Q5TA 1QVOB 5JA8B 3T1FB 3ETBF 5GRWA 3JWNC 2BRRL 2X4QA 5TH2A 2A74B 2VLKD 4LSSH 4XCNA 3CMOH 2GJZA 1UCTA 4CADB 1IMHC 2Y7QA 5DJ8B 4LDLB 5BMFL 4MS8D 3QAZC 2RB8A 4OM0H 3SDDD 4G5ZH 4I8DA 2E7HA 5IB1A 1DBAL 2B1AL 2Q3AA 4A6YA 1J18A 1J0HA 3MJ9A 4M1DH 3GFUA 4JB9H 2IANB 1KUMA 1ZSDB 2BNRD 1VKXA 1RZIA 4OQTA 1CXEA 1ETZB 3F5WB 5HI4D 3IS1X 4OJFH 3ZTNH 4PUBL 4OCWH 4LF3A 1HNFA 1EK3A 1A6ZB 3P4LA 5D8JH 2IQAA 4IRJC 1J1PH 1MCOL 3RJDA 4YGVB 1MIEL 5I8KL 4NPYA 4HPOL 4L4VB 4F9PC 4ZUSB 4JFYA 2FZ3A 1UZ6E 3RUGF 3IFLL 5IEHA 4D9LH 1CFTA 3GB7B 1FNEA 4N0CD 3TNNA 1WF5A 2I9LB 3T0EB 4ZD3L 4QHKJ 2VDLL 3VI4E 5IQ7H 4KFZC 4G8IA 4JJHA 3QFDB 3BGFB 4P23D 4OFKA 3J8F7 1R3LB 1A2YA 3MACL 3HNTL 2F19L 2H8PB 4WO4C 3QEGL 2OZ4L 1GAFL 1KTLB 4G80A 4KZDH 4X6FA 4IRJA 2W9DH 3ISWA 1MELA 4X7TA 3CCHA 3WNLA 1KJ2A 4NWUL 2CXGA 1IL1B 4NFBA 5HHVH 3UZEA 4PGJA 5C70A 4PJ7B 5ETUA 5F1IB 3NZHL 5TE7H 4F9PA 4LASH 5KS9E 3RDTC 1BBJB 2VDPH 3SJVA 1F00I 2CR6A 1OAUL 5HPMB 1NFDA 1X4ZA 4KJPD 5F7LB 3I3DA 4XB8A 3UJTL 4YBLC 3DXAB 4OSUH 5DJXB 3NTCH 1NUNB 2R4SL 4PRNB 3MLZH 1ORQB 4PGDA 1J8HD 5E1AB 5ICYA 4RMVA 5ITBH 4LIQH 4F15B 1FP5A 4RWYL 3O4LB 5EWIL 5A1AA 5SWSE 4WO4A 3U46B 3VXRE 1T7WA 5C3TA 2VITA 3ZKXB 4JPWH 4XBGA 4HIIB 3RWFA 3U0WL 5D7IF 4DAGL 1QFUH 4OAWA 1I75A 2GITA 1R3JB 4ORGB 3VWKC 2EDWA 5I8EB 1AXIB 1BAFH 2KQNA 2XRAL 5FHBL 5TQ2H 1MREL 3RDTA 4I3RL 5JPNB 4J23A 2UYLB 3MRMB 1N4XL 4QTHA 1TTGA 2A0LC 3QXAA 2B7DT 3K3QA 3OKDA 4NO0A 1U8IA 4NHUB 1CE1H 2ATPB 2HA1A 5JUEL 3G04A 4CMHC 2L4OA 3HRZB 1PKQA 1SY6L 4YNYB 1JRHH 1A8JH 1TVHB 4NQSA 1NC2D 3CU7A 4ZFZB 2IPKA 3UPCA 4P2QB 1DN2A 4M1CD 4OKDA 4WRLA 4X5LA 2P45B 1RU9L 3EZ8A 3NAAH 1YYML 3CVHL 3VWKA 5E8OA 3BP4A 1JHKL 1UKQA 3LPWA 5TDOA 5CD3A 1HXYB 3RAJL 2DTMH 3PDDA 1HHIA 1A1OB 3OKNA 3LV3B 3QUYB 3OB0K 1MF2H 1SYVB 4Z7QF 1VFBA 3KYNA 5E2TL 1LD9B 1T3FA 5IMKB 3DI3B 2Y07H 5E6ID 3ZE2E 4FABL 3VA6A 1QSZA 1BQSA 4NNXA 3TO4C 3QI9B 3H3KA 1JWSA 3X11A 4UUJA 5GSRB 3KYMB 3HB3D 1G7IB 2AJ3A 1WBYB 3FL7A 3WYRA 2UVFA 3SDCB 5T1DL 3BKCH 4MJ2A 3VXPA 2I5YL 1UT9A 1A6TB 3DX9A 4HXAL 4XI5C 1EHNA 3CVIL 2PXYC 3M17A 1XGYL 1G9NL 4IJ3B 2NZIA 3V4PL 1MRDL 5HHOB 5HHME 3EJZD 5C0AD 5HDQL 5EPMA 5DUPL 4AEEA 3ZTJG 2E6QA 3MRLA 1KJMA 2SEBB 1G6RL 5F6IC 3QO0A 1EO7A 1DLFL 2P7TA 1T22B 4MNGE 3TO4A 4MMXC 2HN7A 4MAYC 4F7EA 4FMFA 3EOYG 1WC7A 1DL7L 4WHTB 1Z3GL 5DEGA 4OZHB 5TJWK 1G7PA 3REWB 5IHZB 5F7FA 1LE5A 15C8L 2JELL 3SQOH 4S1DD 3MOQA 4X80L 5IW1A 4K7PX 5MP6L 4PJXE 2BVQA 2E7BA 4R96B 3IDYC 4M1DL 4AEIH 4HJGB 4JFPB 4ZYKB 4P2RD 4ELMF 3ZTNL 2ZCHL 3U7YL 4MSWB 5EBGA 5I19L 5EBMB 1J1PL 2NY2C 4GRLB 3RNKB 1AIFA 2GSGB 5EC1B 3DXAD 3AY4C 3CDFA 4I9WD 2AJXL 4RQQA 4MCYB 4MAYA 2EKSA 3ZE1E 3C5ZD 3QQ4A 2DQFB 1S9VB 4JREB 4B50A 4NKMB 3A6CH 2NY4C 3HZYB 3VFTB 4EIGB 5HYJA 1UWXH 1F4AA 1NLBL 4PGCB 3TA3C 4N0FA 5H35B 3QDGA 3EJYD 2RAMA 3OAUH 4YHNA 3QXDB 3TLRA 3N1QC 4LK4A 1GGUA 1IJ9A 1ZLVH 4M8QA 4TRPL 5I17A 1HSBA 1YY9D 2ZCKL 2NY3D 1YEEH 1WCBB 1P7QB 2DL9A 5INDA 1UG9A 4YXHH 2DBJA 3Q6GH 3F7VA 4X8XA 1M7DA 1U92B 2YUVA 2W9DL 1PY4A 1ITBB 4WGVB 5HHVL 1AQDA 3AY4A 1U8MA 2FL5A 3MNVB 2QEJA 3GSUB 5TE7L 2GUOA 3CZJA 4LASL 3MRPB 1JGDA 4OF0A 2V7NA 2VDPL 3D18A 3STLA 4RISL 1VFAA 4TPRH 5AZEL 3W9EB 4IIQB 4OZFG 3TA3A 3R06B 3EOAB 3GNML 5FO8A 2ARJB 2NY0D 2YA0A 1OAYH 3NTCL 3D0VB 3DECA 1ZGLA 1YMME 2Y5EA 4Y4FB 4NZUH 1T4KB 2C4XA 2YPLB 1I9JL 1KB5B 5BQ7A 2NX5B 3VG9B 4PGEB 1T1YB 2D3VA 1AC0A 3MV9B 4JPWL 1IC1A 2EYSB 3UBXB 3BEVA 4I0PD 4ETQB 5ABDE 2YEZB 2YHGA 3EYUH 2HJLA 3F62A 5IVZA 5I2IB 3EKCA 4L9LC 2PTTA 5IB2A 4MXQC 1MVUA 5C0IB 4P9ML 3CPLB 2GK0B 4OV5A 1XF3A 5K59F 4TSCH 5JTWA 1KN4H 1IM9A 4OIAA 1CFNA 3D48R 4PV8B 4PJFE 2BOCA 1UXWA 3ARBC 1CE1L 1JV5B 1CFSA 2IF7A 1XGTA 3V79C 1GRWA 1S7XA 3BD3A 3JV4A 4WFHD 4DCQA 3FKUS 4HUKB 4JFEE 3SOBH 4CVWA 5BS0B 3VFSA 2JCCB 3PGCA 5DJCB 1BFTA 3UTZB 3FO1A 4Z76A 3PDOA 4D3CH 1PLGH 4OI7A 3JSSA 1NEUA 3L5WA 1PX4A 3KPNB 5C0JB 4O2CB 3SGKC 4L9LA 3GGWA 4PJGF 4U7MA 1R24B 4NRZB 3MCKA 4XNUL 1XR9B 1CDBA 4LU5H 3PQYB 1YDPB 4XVUD 3OJMB 1BF2A 5GS0D 1YUHA 3R8QA 2H2PD 4FQXB 4PR5B 4C56A 2ZUQB 3MV8E 1UH3A 4JQIH 3ARBA 4Z7WA 2NY1D 4YX2H 2NXZB 5TE6L 3AGVA 2Y07L 1JMZA 2BVEA 2D7QA 2LVCA 4KROB 5CIPB 4EUPH 3X3FH 3RFZC 5F9DC 1JN6A 1PDKA 4PV9B 4C57C 4DK6A 3SKJL 1FNGB 3O45A 5ESAA 3SGKA 3RY5A 2VLJB 1U8JA 2ZUYA 1H3WM 1WZ1H 5MERB 4WI4A 3MUGB 5DMGD 5DJZB 3BKCL 3CC5A 4PRHB 1QHPA 1JE6A 4CNIB 1F4YL 1FFNB 4JFXA 3BPLC 3OKOA 4ODSH 3W0WB 2FEEI 4U0RC 4JQXC 4G8GD 5J12C 4P57A 1IBGL 3BDBA 1N3NA 3GSNB 3X14A 3UTPE 5GGTL 2IBZX 4M3JA 4TTDC 1KCRH 3VJ6B 4WV1B 1W72B 4NQCE 3UYOD 1A3QA 3OL2A 2DKSA 1T1XB 3SDAA 3KPMB 3SO5A 4BZ2H 1SJVA 4OD1L 5GXBB 3D39D 2A6IA 4BUGA 4Z78A 3QHTC 5IVXF 5CMAA 4AG4H 3TVMC 1H3GA 2GJ6E 2UY6A 5HHNA 4JFFE 5CD5C 3KLHD 3QH3A 3SCMB 4O2FB 3PG2A 4KK9D 4NN7C 3RGVB 2VLRA 3RRQA 5HXMA 4KHTH 4ZUWB 1MCFA 2BVPA 4KRLB 5MEQA 4GW4A 3CAFA 4JQXA 3PWNA 4OD2B 1DBJL 1NC4A 4PS4L 1MWAB 5FHAH 3EGSB 4OUUA 5IIEA 3HE7D 2X1QA 3TZVC 4HULB 5LGJB 2VXQL 5GISL 4QHNA 2QKIA 4HFUL 1U3ZA 1SYSA 5J3HD 4K7PH 1NMAH 1X5FA 3JV0A 1CD8A 4F7TA 2FSEA 3UEZA 4CVZB 2NX5D 1D5MA 1F6AA 4XAWH 3TVMA 1PQZA 1TQBC 3VFPB 1SJHB 1YQ2A 3GSRA 1UXSA 5LGKA 3BUYA 2DAVA 1YEEL 2V6HA 1YPZE 3LIZL 4L3AA 1FRGL 3O3BA 2MOVA 1QSED 1E27B 4LLYA 4NN6C 5ERWB 3AC0A 4F8TA 2CIIA 1BGXH 5F8QC 3TZVA 4E41B 4Z0BH 5I1LB 5FB8A 3MOAH 2A73A 4XVSH 3I2CH 1ZT7A 2KKQA 3I02A 4JRXA 2A1WH 1CQKA 1CDUA 1CTNA 2LAAA 3SDXE 1WBXB 4MD4A 1GVIA 1NBVH 4UQ3A 4RMWA 3PWPD 4MJIE 4NZUL 3NIGE 1MCCA 1X6NA 1YJDH 3RL1B 1CLOL 2R2BA 5A2JH 3JWOH 4ZQKA 3O8XB 4DOHE 5DVMA 1X7QB 3PWVA 2VDRH 5EORH 3NA9L 3PQYD 3MXWH 5D2LF 4X7EC 4PJAE 2PTVA 1A7RL 2VDQL 1ND0B 1MY5A 4WI7A 4ZSOE 1NBQA 3QULB 2DBLH 2HJKB 3P2TA 4Y19E 2NXZD 4N8CH 3HZMA 4KC3B 5T1LA 1XGUA 1YEKH 1HDMA 5IJKA 2WWMC 1KN4L 3O3AA 4OFYD 1HHGB 4XCYA 4EVNB 3U4AA 2FBJH 4H26A 4JRYE 4EI6A 3CFIC 4TULL 3IFOB 3TIDA 4XXCC 3TBWB 5L2JB 3AREC 4U1NB 5DTFB 3FT4B 1YEDB 2CSPA 3PGDB 2YD6A 4BFIA 3SOBL 4OLXL 4PRHD 3W9DA 4RNRB 4P5TC 3RBSA 1ZE3C 4TSAH 2EICA 3WJLC 3BIBX 2HG5B 4UBDD 1V3JA 4J1UA 1OB1A 4FFVC 4YDVA 1DVFB 3IFNH 4PB9H 5H94A 4HKXB 4YDLC 4DFHA 1K5NB 1V7NH 1OTTC 1RVFH 1HQ4B 4ONHB 5DO2D 3WLBA 4KQ3H 2BERA 4EN3B 5D1ZD 5IK3B 2WQRA 4XMKL 1M7XA 2VDKH 4U6YA 3WIFA 2DYPA 4G7YL 1OGAA 4OCMC 4YX2L 3GRWH 3L6FA 3FN0H 5ADPH 1CD1A 2R56H 3UYPA 4LOUD 4XXCA 2P5WD 3AREA 4NZRL 3HPJB 2AABH 4R7DA 2VKWA 4P5TA 3WJLA 3X3FL 1TJGH 2NNAA 4Y7MA 5IQ9B 3BKML 4YXKH 1T04B 2R0LH 5MEOA 1R5IA 3CVHB 4Y4KB 3VRIB 3G5ZB 4GBXD 3PWUA 5B38B 1C5CL 1SBSL 3TF7C 1RJYA 4JY6B 4ODSL 1K2DB 4OZFA 4YBQD 5IESH 4XBPB 2KBGA 4L3ED 4KI5D 2J88H 3DPBA 3O2DH 2I25N 3W39A 4WI9A 5TPWL 4XBEL 4XC1H 3S37L 4LSVL 3GSXB 2HTKC 4QRTA 3VWJB 2R2HB 1N2RB 1YYLH 1K8DA 3O9WC 4EDXB 1EBPA 3VGEA 3I6LE 4BZ2L 3U2SB 4JGJA 1KJ3H 4OLUL 5KS9B 4B53A 2QADD 3UPRA 1KJVB 1A7NH 1UEYA 4KJQD 2ARWA 5KTEH 2DM3A 5E08H 4TOYH 3L1OL 4GKSA 1U8PA 2HKHL 5GGQH 2HYMA 5AG8A 5JZ7D 2LABA 5CGMA 4OZIA 1PZ5A 3PHQA 1P9MC 3UPAA 4RGND 2YMXL 3ZKQD 5FGCE 4NYLA 3EZJB 3HA0A 1BREA 3CFEA 5SWSB 4DUXA 4TSBH 5KN5B 1P5VA 4UNVA 3V4VH 4MAUH 1GZQB 4LEOB 1G6RB 5JQ6L 5TDNB 3GI8H 3ROOB 4L5FH 3QEUB 3O9WA 4S1QH 3MROB 4K7PL 5FYKH 1NMAL 4LSRL 2ZUSA 1E28A 4P46B 2G2RB 4NQUA 4P9HL 4HF5H 1F11B 2EZ0D 4M6OH 4LAQH 2ADJB 1Q9LA 3CSYB 2OTPA 4XP9H 3GO1H 1I4FA 1P9MA 1V8HA 3HPLA 4MHHI 1GYAA 5DHYB 3UBXG 4YDKH 4LKCB 4LPTA 3GDBA 3KPPA 4DN4L 1QVOA 3MOAL 3T1FA 4HT1L 2NR6C 2AJSL 3I2CL 2DLGA 2A74A 5EIIB 4CADA 5DJ8A 3IGAB 4R97B 1RJZB 3OGOE 4RMTA 4L4TE 3T0EC 4WENB 1TNMA 1UZ8B 3BGFC 1I1YB 3V6OE 5CFHA 2ATKB 2AEPH 2IANA 1ZSDA 1DSFH 1ETZA 3F5WA 2BVUA 5JW4Q 5DUMH 1HINH 1K4DB 4XRCB 1IZJA 1MNUH 1U3HB 1BFVH 1A6ZA 1SVZA 1U8OB 4K3EH 4YGVA 2VDRL 3HMXA 5EORL 4D0DB 2FB4L 4TQEL 5C08E 3CK0L 4V1DD 5JW4N 4DGVL 2B4CC 4KZEL 2IALB 5GRVK 1T2JA 4L4VA 4ZUSA 4ACPA 2IMMA 1LHZA 3GB7A 3WS6C 2I9LA 3DUUB 4N8CL 4U2ZA 3T0EA 1YEKL 4CJ1A 1XEDA 2XV6B 1MFEH 5D71H 5B3NA 1T03L 3SE4C 3QFDA 5HBBA 3NIFF 3LN5B 1MFCH 3NFPA 4F15C 3HE6B 1R3LA 3G5VB 4HMDA 2H8PA 5HHMB 5FUOH 4NCC2 3ZKXC 1KTLA 4I2XE 4XH2B 1JUFB 5IOPB 4KMLB 1U8QB 4TSAL 4MNGB 1IL1A 4GG6E 2V2TB 2YSSB 3QT2A 4OTXH 4BUHA 3RVXD 5F1IA 3MRGB 2AV1B 5FYKE 2PETA 1AGDB 1BBJA 4XVJH 3GMLB 5CKGA 1I9RL 5HPMA 2GIYA 2VDOL 1IC5H 4FZ8H 5DJXA 4ZDHB 4KQ3L 3SHSA 3QO1B 1LO2L 4PRNA 1ORQA 4PJXB 1OP5K 5E1AA 3SE4A 3B8SA 2OCFD 3T65A 5ICXB 3QRFM 5D6CB 2I9TB 4P4KB 3O4LA 2V5TA 3GRWL 4WIQA 1ZKAA 2WUBH 5ADPL 3BEWB 3GJEB 1LE9B 3U46A 2YUZA 35C8H 4HIIA 4G6KL 4JM2F 4C59B 1TJGL 3OR6B 5AYQA 4WY7H 5EU7E 1KXQE 1R3JA 3K2UL 4H1LH 4ORGA 5HGAA 5I8EA 2F58H 2F8VA 4BKLB 3VG0L 1L7TH 5JPNA 3IETB 3QDMA 3TYFA 5E70A 3MRMA 3PV6B 2Q76B 1R5WB 3T4AB 3QUYC 2W0LA 4XX1G 1QO3B 1LILA 1RUQH 2C3XA 2J88L 4NHUA 4QXTA 1T6WA 2ATPA 5FO7B 1K85A 3NBNA 5FYJH 3HRZA 4OCXL 1EPFA 2OK0H 4YNYA 1NCUA 1TVHA 4ZFZA 1KACB 3WE6A 4P2QA 3AUVA 1GGBH 3QI9C 2DQUL 3CIQA 1TZGH 2L7JA 4X7SL 4MWFB 3SDCC 3LS4H 1HXYA 4CDGC 4UU9B 2D9QB 1IGML 5BRZD 4CW1B 4JM4L 5DJ2B 4LCWD 1A1OA 3U0PB 3HN3A 5CJOH 1MHPH 1K4CB 3LV3A 1YMMB 5A43C 3QUYA 4ESKA 3RUGE 2FCBA 5HTSA 3O6FC 1SYVA 4LCIL 5HY9B 1LD9A 1QPPA 1FIEA 5E2WL 5I30L 5IMKA 4TSBL 3HUJE 4PRIA 2E5EA 3V4VL 3WBDA 5HDLA 4QXWA 3IFPB 2HTLC 3QI9A 4L5FL 1ITCA 2DLFL 4ZXBB 4JO1H 4S1QL 3DGGA 1Q9WB 5FYKL 5GSRA 1MAKA 3KYMA 1G7IA 1WBYA 4S11A 4QHKI 3SDCA 4HF5L 4OT1H 5IB3B 4LLUB 4RAUB 1A6TA 3QPQC 2EYTB 3BO8B 2AEQH 1X5XA 2IMNA 4XP9L 1ZLSL 1BFOB 2ZUVA 4K9EL 4PJFB 2VH5H 1JYNA 5HHOA 1V7ML 2EH8L 2XZCH 4EBQH 1T2QH 1J0KA 3HC0B 1UB5B 2Q20A 2SEBA 4GRLC 3MRFB 4JFEB 2BMKB 3BUTA 3MZTA 5KOVC 5SV3A 1T22A 2FECL 3U9PH 1XH3B 2GJJA 4PRDB 2EE2A 3AS2A 1ORSB 4WI8A 3MTRA 4WHTA 4H20L 3MV11 4OZHA 2W9EH 3REWA 5IHZA 2R23B 3LMJH 4ZPVA 2D2OA 3EO1B 5C09D 4Y8AA 5FGBC 1HSAB 5A3IC 2BNUB 4R96A 1I8LC 2AEPL 3MC0A 3LEYH 4HJGA 4JFPA 3MV8B 2GI7A 3IXTB 4WUUD 2FLRT 5DUML 4ZYKA 4MA8L 1EXUA 1GSMA 3AXLB 4WGWB 1MNUL 5FYJE 4MSWA 5EBMA 2HFFB 3QG7L 4GRLA 4NC1E 3RNKA 4K3EL 1RIVH 2FHBA 2GSGA 5EC1A 3V5DB 4MCYA 1ADQA 2DQFA 1S9VA 4APQB 1OTSC 4L8SB 4PJ9D 4NKMA 4P4KD 4K8RC 3HZYA 3VFTA 1SEQH 3L3OB 4PJHE 2DIBA 4IIQC 4PGCA 4L8CB 2BJML 2VXTL 5H35A 4KJWC 1RK0B 4KKCD 3QXDA 1MFEL 5D71L 5FGBA 1BIHA 2XKNB 4Y4FC 1I8LA 1MFCL 3QNZB 4OUOA 1PKOA 4KKBD 1AFVH 1MCPL 1WCBA 3ZYIA 1P7QA 4AIXA 3CFCH 3VG9C 5ITFB 2Z8VC 2P5ED 2QSCH 1NCBH 1RZFL 3RNQB 3S98A 2HRPH 1U92A 5I0DA 2W65B 4OF3A 1D6EB 4WEBL 1OT2A 4D9RD 2G5RA 5D7SL 2GSIB 4NQCB 3MNVA 4OTXL 4HGWB 5JOEA 3D9AL 3NABL 4PJ5E 1VEPA 2WP3T 3MRPA 3P4NB 1EFQA 1GGCH 5I1KL 2BHYA 1LQSR 3W9EA 2YUXA 4IIQA 2GJ6B 5HSFA 3R06A 3EOAA 4JFFB 4ODWB 1IC5L 4HLZH 4FZ8L 2ARJA 4XVTH 5C3LD 2DMCA 4ALAL 3D0VA 5GIRB 1ZV5A 4Y4FA 2YPLA 2AGJL 4G6JL 4H8WL 5C86A 4JQVC 4F2MB 1KB5A 1KGCE 1QSFB 2P4AB 5GZOD 3U82B 4PGEA 3EO9H 1T1YA 3MV9A 2EYSA 3LVEA 4XHJD 3UBXA 3AU1B 1NBYB 3L3HB 35C8L 4HZLA 2GYSA 3KPQB 4PPTA 4ETQA 2YEZA 5I2IA 4G6AC 1U8NB 4M62L 5BOZG 2R29L 5C0IA 5C71A 4N0RA 3CPLA 4P2YA 2GK0A 2BSSB 5JW3H 2W9LA 3OKLB 2CQVA 3QCUH 4MB4A 3NN8B 4QGYA 2VQTA 2Q86B 5IB5B 4FQXC 1FZJB 4PV8A 4ZXBD 2ZUQC 4YHMH 5HHQB 3X13A 1YPZB 5HI3D 4JQVA 1JV5A 3QEQE 2VXUH 5FYJL 2OK0L 4OLVH 2P8LB 2GW5A 4ODXB 3K4ZA 5BS0A 4KROC 4L1HA 3V8OA 1A7BA 1GGBL 2JCCA 5DJCA 3UTZA 4G9DB 3WIHH 1KEGH 1TZGL 5JW5B 3UAJC 1IAMA 1NL0H 3KPNA 4O2CA 4Y16B 2OXHA 4OFDA 1CD0A 2R2EA 2AV7B 4JHBA 4KI1A 4M48H 4R0LB 4GMSH 5AYUL 1R24A 5MEPB 4NRZA 3SDXB 3P9MA 1XR9A 4G6FD 1TTUA 4BSJA 5ANME 4YQXH 1YDPA 5CJOL 5E9DA 2FO1A 1OHQA 4MJIB 4FQXA 4PR5A 5IWLC 4L3CB 4LHUG 43CAA 2HJFA 1G9MC 4DOHB 2FYYA 4RFEB 3HCVB 4R7NB 5CIPA 4MZ2A 3FCTB 2XN9A 4WV1C 1I3RB 2NPLX 3DWTA 2OTWB 1C5BH 1I85C 4PJAB 4PV9A 2D31B 4JO1L 1E0OB 1FNGA 1JZ2A 4HLJA 4ZSOB 3BMVA 2FGWH 3D69B 1U8LA 4LRNL 3MRNB 5EU4B 1LEIB 2VLJA 1FGNH 4YZFE 2IC2A 2NXYB 5MERA 3FT3B 4Y19B 3MUGA 5DJZA 4CNIA 1FFNA 3MODH 5EUOF 4XNYH 5BV7L 1UWGH 4PGBB 3RGVC 3W0WA 5MENE 1BD2E 4CAGA 2I07B 4QTIL 1P84K 4ODUB 4NO2B 3BWUC 3QUZC 5IWLA 4JRYB 3GSNA 1WIOA 2A6JA 1RZGB 4KMTH 1HCVA 4LSQL 4PP2B 4HS3B 2Y06H 3VJ6A 5T33L 3U9PL 1D9KB 4LNVA 1W72A 4JPKL 4WV1A 3S34H 5HGHB 1T1XA 4NWTH 1I85A 3W5NA 3KPMA 2I26N 1NH6A 3MLRH 1MFAH 3SEPA 3IDGB 2EDEA 4FQIL 4RZCB 3KLAB 4LL9A 4WI6A 2D7OA 3ARPA 3SCMA 4O2FA 1DEDA 3RGVA 2W07A 8FABB 1UADC 2WWKO 4ZUWA 2DI9A 4OD2A 3KNBA 3QUZA 4S0SD 1MWAA 3EGSA 1MVFA 5K59E 3RPIA 2YPVH 5LGJA 1WBZB 3H9ZA 5EUKB 2D7MA 4DGYL 3QCTL 5CJ5A 3HR6A 4AT6A 3D3VE 4JFHE 5IB4B 1Q9OB 1OLLA 1L9NA 3D1MC 1QSFD 4CVZA 2X41A 1AQKH 2HWZL 4EEEA 3GBMH 3VFPA 5TF1L 1A6VH 1SJHA 4YWGL 3GIZH 3C8HA 2F8OA 4X99B 4PBWD 3WO4B 2R8SH 4X4MA 3QUXB 4S1SH 3CFCL 4B7IA 3O8XC 1GGYA 5F88B 3FHAA 1E27A 5ERWA 4E41A 1QNZH 5I1LA 1QRNE 1N64H 4X8JB 1LEGA 4FMKA 2HFEB 2DQCL 1CTOA 5HVFB 2O5YH 2UWEF 3ELAT 1AO7E 1DE4B