2VE6B

Crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
99
structure length
99
Chain Sequence
MQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN D-B ALPHA CHAIN
publication title Discovery of Cd8+ T Cell Epitopes in Chlamydia Trachomatis Infection Through Use of Caged Class I Mhc Tetramers.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ve6B00
4X6EA 4P5TB 3WD5L 1FLTX 4XNUL 3RP1A 1YY8B 3BZFA 2WUCH 3RI5K 1MAJA 4KKLC 3V7AE 3Q5YA 4ZTPH 1F8TH 3WHXB 3QULA 3CFJA 4H5SB 1KELL 4MCYB 3QG7L 2V5YA 2DQCH 5FYJH 2VDQL 4DGVH 1RZJC 4PRIE 4F2MB 1C12B 4Z0XB 2GJZA 1A3RL 3KLSA 1KF9B 3FZUC 3KPOA 2JJVA 4KJPC 3QUXA 3U4EB 3U1SH 1Z2KA 1C16B 3MLRH 1DQLH 4PY7B 1K8DA 2CO6B 2YSSB 3LB6C 3FHAA 2QSQA 3AREA 1DQJA 3GBLA 3MRJA 4EI5C 4XNMB 4R6UA 2C1PB 2JK5B 4WO4B 2UWEA 4BQ6A 4MDIB 3QB7C 2AEIT 4N1HB 2X4OA 2Z91A 1IE5A 3QDGD 4LQFH 3N0PB 1V5JA 1OB1B 4G6MH 4KTEH 5EZIL 3MXVH 2JB6B 3VFPA 2RCSH 1CQYA 2X4UA 4O2EB 4HJ0C 2C3XA 1IGML 1YMHA 5SWSA 1J1OH 2CKBH 4GRWB 2COQA 2F8XC 2X89D 3MA9H 4P9ML 2GUOA 1KLUA 4LDEB 3MCG1 5FK9B 3CCHB 3P0VH 1FE8L 4KAQL 2HLFC 4KUCF 4XP4L 2BVPA 3OHXA 3M8OH 1CFSB 3PV6B 4R7NB 3TJEL 3UROR 1G1CA 4M5YL 3IFLL 1HINL 1LNUB 4WI3A 3D6GA 2EDYA 3DYPA 5IROC 4WVRA 2RGSA 2ICEA 4I3SH 3O81A 3DV4B 1IGIH 5GRVK 3QJHB 3U0PB 2OSLA 4FQCH 2IFGA 3QIWD 3I3EA 4YHML 4PJEE 1YDPA 3E3QC 5C0BB 3PDOA 2IQAA 3L5WB 3B2UD 2JTDA 1G84A 3QNYA 2FBOJ 2H26A 2XG4A 3KPTA 1M1SA 1WT5C 4MA1C 4QRRD 4R4ND 4FTVB 4TRPL 3QEGL 4PLJC 1KEML 1ZS8B 1HILB 4R4FH 4PREA 3K80A 1TZGL 5D7JB 3ZHKA 3PDDA 4S1QL 5DUBB 2P5EA 3KPQA 1FIGH 2Z92B 4X7FC 4F8QA 2HVKB 1N4XH 4TNWK 4JHAH 3B9EA 3ZE0E 2D0GA 5LGKA 5AAWA 5I1KH 5CIPH 3DNKA 2F58L 3GMNB 5DD5L 3WUZA 3GKWL 4DN3L 5DLML 3QXTA 1FDLH 1MCPL 3BMVA 1V3JA 2ZPKL 2BY0A 1LEGB 3GSNA 3L3IB 3QJFA 1V7MH 3PWJA 5TE4H 1AO7E 4JRWA 4M6MH 4PS4L 4CL7A 5IB3A 3MRCB 1FG2A 1GRWA 3LH2H 4UOJA 1S9YB 2Q20A 3FQRA 1J1PL 3MRGA 1I4FA 5DMKA 3HZMA 2FO4A 4PJAB 4YPGA 3QXDB 2X4RA 1AD0B 3O6MH 4LDOB 1Q72L 4ODVH 2RJMA 1OCWL 5DD1L 5FGBC 3FFCA 4L4JA 3EUUA 4EN3A 1JWMA 1YNLH 3OTTA 1OP3K 4C58B 5K9JH 1EEZB 3DPBA 3OKKA 4IDJL 4P5TD 1MCEA 1CFNA 4XHJC 3QWOA 3GGWB 4N90E 1UXWA 1NCUA 2AV7B 1MI5B 4U1SA 3SEPA 1QNZL 4BZYA 1KB5B 3PL6B 4PJ5B 3WIFA 3DXAE 5IKCB 3CVHL 3NZ8A 2YUXA 2FDBP 2GK2A 4LHUD 5BS0A 4EUPH 1PKQE 4N0YL 2K7QA 4M6NL 1HHHB 1OP3H 4QYOA 4PJ7F 1P7KA 4FZ8L 3MCKB 5FKAB 3EYFB 2EDFA 4KKNA 5CUSH 3G5YB 4FQPA 4RBPK 5BV7L 5GRZA 3EOAB 2H2PC 4F7CA 2ITCB 4WO4D 1GXEA 4R90L 5CMAA 4J3WA 2Y5TB 2BERA 3MNWB 1VKXB 4KDTC 3OR6A 2G2RB 3LAFA 2YK1L 1U8KB 1NCBL 5L6YH 3V6FA 1M7IB 1A1NA 2MQ0A 1I7ZB 5SV3A 3BW9A 3QHFH 3RBGA 4RSVA 4E41E 4AJ0A 3TZVA 1NGPH 2ID5A 4OT1L 5IB5B 3H9SE 4QEGA 4X6CB 4RBPH 5TE7H 3F7YA 3DVGA 4FFVD 3WNMA 3V4VL 3OGCA 2EIBA 5I2IB 1CTNA 4FQQA 2EE9A 5ETUA 1CT8B 1MFDH 4HLJA 1W0WA 4NQXB 5C0CE 5ESVA 5EH1A 4KKLD 4C4KT 1DBKH 2J2ZA 5B22A 4LVOC 2ADIA 4PP2B 3ELAT 3EKCA 3OKOB 4ENED 5EO9A 4PJFF 4UTBL 4UB0L 5C0BD 4DGIH 5I15L 4ALAH 3ZTNH 3DETD 5T3ZD 5ID0A 1B3JA 2W1NA 4G3YL 3FZUD 3Q6FA 5GGVL 5E03A 4KJPD 5I8EB 4L9DA 5HDBE 3SDXF 3UZQA 5IVOA 1EAPB 3LB6D 2D7QA 4ODXA 3RWJB 1U8OB 3WJLC 5ESQA 2Y25A 3UTSE 1W8NA 5IMKA 4EI5D 5FKPA 3G5XB 5D7JD 1MJ7L 4OLXH 1EEUA 4YHZL 5MENE 4XNQA 1ZGLB 3KXFB 3QNZB 5KSVB 3ME0A 4JRXB 4LKXB 2Y36L 1KT2A 4MMXC 1OM3H 3MODH 4OCLC 3OR7A 1F4XH 2A6KB 4IRZL 3NZHH 2IFFH 4NHCL 4PRHA 4ZFOA 4HJ0D 4LARL 1LO5B 4NQCE 3MJ6A 4ZFGL 1J1XH 4YE4H 2A9ML 3D69B 1BJMA 1CDHA 2BP3A 3CX5K 3S8WA 1NCAH 1KCRL 5AZEH 3VH8A 5D8JL 2HLFD 1HQRA 1C5DA 3K2MC 2BSSB 1S7QA 1SMOA 4OFDA 2AGJL 4N9GA 2G60H 1JJUA 3GMQB 4P5MA 4ZFZB 4NQEE 5ADOL 2P5WB 3SJVA 4WUUA 4YDLB 1B0RB 3FO1A 1RAMA 1BF2A 2JJTC 2VLJE 3EOTH 5DRZB 3WLBA 2ZUYA 3GZKA 1HYRC 5HVWA 3T3ME 4LSQL 5CFHA 1T21B 2CLRB 4JO1H 2FZ3B 4IHOA 3AAZB 2JELH 1MI5D 3GSNL 1HXYA 3PL6D 3MLTB 4PJ5D 1MSPA 4YWGH 3FONA 4HPOL 4OZIB 5CEZH 3RGVB 3B9KB 3HA0A 1F3RB 3BN3B 1II4E 4PLJD 3EDFA 1N64H 3BXNA 4Y4KB 2MKWA 1DBBH 1F4YH 2YKLL 1V05A 3RZWA 3WIIH 4LVHC 1A6UL 1G0DA 2BHZA 3LKSB 4LSDA 5JOPE 4XCFH 4BUGA 1UJ3C 4ZNCD 4OCRH 1CFBA 1YEDB 4WTWA 5C6TH 1U8LB 2XA8L 4GRLC 2BY1A 3TWCH 4UBDC 4OZFA 3WSQH 4HWBH 1Z9LA 1T1XB 5CD5C 4S1RH 3RWHA 3B5GA 4OIIL 2X70A 3U0TB 3D0LA 4X4YB 1S7WB 3TBYB 5E0QA 4UUJB 2A9NL 5EU6A 5EU7E 3OX8B 4YJZL 4HBQA 3DSNA 3P77B 2DQGH 3TBWA 3IDIB 3LEVH 3ULUE 3EO9L 5D7IA 4JZOA 1ZHLB 2BK8A 1OAXL 2BJMH 4Z95H 4I9WE 1IEHA 2WSKA 4NC2B 4OD2A 4FFZL 1LO3L 3GSRA 3QI9C 2AXHA 1LO4H 3RL2B 2VQ1B 1QLRA 4Q2ZA 2HT3C 4XCEA 1WEJH 5F97E 4NC1E 5FGCB 4LLQB 2NY4C 3C2SA 1F3DH 1RZ8A 4OBRA 3AMLA 5ANMA 4NZUL 3RWDB 5C0RH 2C4FT 5C0DB 4ZUSA 3WN5C 1KPVB 4GRWF 5LGJB 4R97B 4FQ1L 3LN5A 3U36B 35C8H 4KQ4L 4M7KH 4DEPC 3JXAA 1ND0B 1QBLH 4M7ZC 4YDJB 2V7HB 3OKYA 3S35H 3TFKC 4K9EC 1QOKA 5CBAA 2VABB 1KB5H 2BVEA 4JFDD 4O2FB 4GRLB 5C9KA 3QQNA 4XC1L 5CWSA 3T0WA 3BWUC 1OPGL 2I60L 1AHWB 2H2PD 3BDYH 1EEYA 1FVEB 3O41B 2AS5M 5EC1B 4P3DB 5SX4H 3OKEA 5IFJB 3KXFD 4E0RB 4PJ9C 4JRXD 5DEZA 4K3GA 1AD9A 1Q9KA 1ZANL 3DV6A 1BAFH 4YO0B 2R8SL 3QEQE 3T8XB 3LS5H 1SY6L 4DW2H 1UH4A 4XCCH 2DMKA 2J4WL 3MLYH 4M61B 4NN7C 4UNVA 4D0CA 1UWEL 2CDFA 1R5WB 3I02B 5DJDA 2OK0H 1Z9OA 5C70A 3T2NH 5DQDH 5D2LB 5HYJB 1R3IL 2CXGA 2NTFA 1I7RA 1IARB 2YD6A 3OXRA 4NUGH 5C0AA 1YEFL 5EB9A 4GH7B 4GKNB 2P5WD 2IQ9H 3MCLH 4PY8I 1SYVB 2NY4B 3T0BA 1NGXB 2ZJSL 3P0YL 5DJ2A 1K8IA 4U1LB 1VSCA 2MOVA 4Z7WE 5L2JB 3SKOA 4DEPB 1RJZA 2F19L 5DUML 3JWNC 3NA4A 2PXYB 4PPTA 4M7ZB 1ZTXH 3IKKA 4TULL 1IEBB 1EA9C 2J88H 4P4KA 2I5YL 1JF6A 5TH2A 5T33L 5F71A 5E4EC 2HJFA 4PJAF 3GRWL 4ZUWA 1EPFA 4Y4KD 3Q6GL 4HS6B 3GHEL 3GBMH 4WW2A 5IT2L 1OAKH 5I71C 2DWDA 4JFYA 4XBGB 1JTTA 4NZJA 5DRWB 4PJ9B 5E9DA 3CC5A 4KGLA 5ALCH 2AXGB 4J3VA 3PHSA 4M7LL 5F7HA 2DS4A 4PRDA 3WFHA 1NCNA 5C07B 1ERNA 4LPVA 3MBEB 3VXUE 1QSFA 3BKCL 1C1EH 3ZE1F 2N4IA 1OSPL 3P40A 4JPIB 3VWKC 4N0CD 4Z8FH 4RFOH 4FFYH 3ARDC 3ULVH 2F74B 5CZKA 3PWVA 4ZSOB 3GMRA 4JDVB 4MVBD 2XY2A 5B8CA 3PHOB 5DQJA 1WTLA 3VGDA 1IL1B 1QFWH 4MJ6A 1PG7X 4NRXA 4K7PX 4XB7A 3WJJA 5SWZB 4GQ9H 1RUQH 4G80A 2BSRA 5DI8A 3GO1L 1XR8B 1G7IB 4QRQB 4PY8J 3FQWA 4HJGB 3U4AA 1BP3B 1GYAA 1DUYB 1K4DB 4JHZA 2L7UA 4Y4FA 2O5YH 5CHNB 4PBWD 4C57C 1W72A 1WTGT 3CJJA 5F9JA 2R23A 1GJIA 5I66A 1BWWA 1LILA 3G9VA 1M4KA 2CLZA 4DZBB 5I71B 5F7DB 5EPMB 2A83A 4QHMB 1DUZB 3ARGC 4XZUA 1QEWA 3BH8B 4G8GA 4GRLD 1T83C 4UBDD 3QUZC 1FYTB 3NFNA 4AL8L 2IH1B 1NFKA 5AD0A 3MFFA 4FQIL 5JR1L 3HI1A 1Z9SA 1ZWIA 4EOWH 3OF6D 2EDLA 3OB0K 1JPGA 5FA3A 2XPGA 4JLRB 4XCYA 3VGFA 3NGBC 4HZAA 5D9SB 2B2XL 1AH1A 4H1LG 1CLZH 5DJYA 4JFEB 4JM4L 4AM0B 4F57L 1MFEL 3SKNB 1I7TB 4XVSH 4F33A 3FOLB 3KPLB 3EW3B 3SDYL 4P9HH 2I9TB 1PKOA 4P57B 3FHQA 5GRJL 2WANA 3EFFB 3WNKA 4BZ1H 1CE6A 3VFSB 3HB3C 1FCCA 3L3GA 5BW7C 2DLTA 3BHBA 3EZ8A 5I19H 3LSOA 4U6XB 4JANA 5HYJD 2OBGA 3JTTA 2HT3D 3L3KB 2E27L 2R4RL 1ZLSL 3U0WH 3NA9H 1IAIL 4JDTH 5GIRB 2VTFA 5KVMC 4DKAA 3SE4A 5TQ2L 3DWTA 4MNQE 5FCUH 5KSAC 3ZL4L 2NY4D 4J6RL 4M1GH 4S2SB 1JIBA 4UILH 1S7VA 3RL1A 3CU7A 1TJGL 1KTRL 4HIXL 5C09E 1DBML 3PNWB 4P5KB 3VGEA 4L8CA 5E8OB 3RPIB 1WC7B 2NW2A 1BBJA 3TBTB 3G5VA 1FN4B 2A6JB 4XMLH 2NX5E 3KR3H 4I0KA 4ODTH 5I1DB 4LGPB 3TFKD 4L3CB 1K9TA 3ARGB 3EJYC 4OFIA 4XXDB 3VI3E 3PGDA 5CJOL 2C9AA 3QUZB 3CH1A 2RFXA 3BWAB 4PJXB 5CJQH 1LDSA 1VEMA 4MXWH 1KCVH 4WNQB 2VRAA 4BK5A 4PB0L 2W9EL 5DHVH 3PP4L 1E6JL 1A9BA 5DJXA 1WV7T 1ZGLP 5EOQH 3O6FB 4PJ9D 5DC9B 3OG6B 4NM4H 1N3NB 5A3IC 1JGUL 1TTGA 4QHNA 4O02L 1GHFH 2V9TA 3D3VD 5K9QG 4X9GA 4S1SL 5C07D 2D4FA 1WIPA 3DROB 1CLYL 3KHOA 1GCFA 3MBED 4FOMA 4OZIF 2FH8A 3AM8C 3UX9B 1EBPA 4D9RD 4KVCL 1A5FL 1JUFB 1KTLA 2IGFH 4MD5A 4PGEA 1TETH 5GZOD 3HI6H 3HG1E 1AXSA 1WUNT 2XG5A 5IMLB 3VI3F 2EE6A 2G9HB 1NCCH 3IFOA 3SE3C 5F89B 1RK0B 3NCCB 1EMTL 2IH3B 3CDGB 4OF8A 5LG1A 1MWAL 1UM4H 5JQ6L 2EC9T 2HJLA 3V5KA 1NFIA 1N59A 1I9JH 1MH5A 4R26H 3PQYA 3WYRA 1GOGA 1IT9L 3MO1B 4D0BA 5ID1A 3O11A 5SWZD 4QXTB 3U2SB 1NGQH 1YMMB 3AU1B 4MA8H 3AC0A 5EBMA 4PGBA 3SGEI 5DS8A 2DQFA 3BE1L 5MEQA 4YDIH 2DJSA 3I3BA 3C5ZB 3VXQA 4BH7A 1LD9A 2OZ4H 1AJ7L 2DBLH 2XICA 3RAJL 1RZIA 3LQMA 4NYLB 3ROOB 4OD1H 4HAFA 1H3XA 4YEEA 3WFDL 2CDEB 3TYGL 2Y06L 3O2WL 3MRMB 2XTLA 4Y16A 3K4DA 4LASL 1A7QH 1FYTD 4APQA 5ESAB 3REVB 1X5ZA 5I75C 3D85B 1YC8A 2I9LA 2D31A 1T4KB 5BCAA 1VPOH 1K6QL 5DSCB 4UQ2A 1E6OL 1EJOH 3LEXB 4K3DL 4JHWL 1NAML 1JBJA 3FOMA 4HS8L 2DTML 2GJ6B 4L4VB 3RNQB 1UFUA 3VXTB 1FFNA 4X99B 2EC8A 4X7TA 1OQOA 3GMLB 1BQHB 4P99A 4Z9KB 2BFVH 1NDMB 5IB4A 3IDNB 1MJUL 5E5MB 3SDCB 4P59L 4OLUH 5HGHA 1ZA6A 4LLYA 1Z5LA 4P2YA 4GBXA 4GO6B 5DVLA 4K07A 4CADA 2MFNA 3RA7L 1DQQA 4NDMA 4TSCH 3BZDA 4YH6A 3CFDB 5J11B 5BVPH 2W59A 1NCWL 3I84A 1T20A 5IW6B 1BGXL 5F88B 3L1OL 3QFJA 1FZKB 4NO5A 4BQ9A 3BOVA 1U3ZA 4BSJA 3G08B 4OZ4B 1N7MH 4GLRH 3M17B 1H0DA 5ISZE 1KN4L 5D2LF 4HFWA 1NEZA 1Q1JH 2GITB 3ARGD 3KS0J 3TJHC 5D7LB 1X4ZA 3T4AB 5I1EH 5EZLB 2XWJB 3NACL 3QUZD 4OZHB 3WHE0 1OVZA 5IFHL 2ZCKL 4RMRA 1N26A 5IVXF 1JN6B 5GS0H 4L1HA 4QHLB 1D6VH 4A6YB 4GW1B 3P4NB 4KUZH 4ZQKA 2FJFA 3MA7A 2YD9A 2P49B 3CUPB 1BZQK 4LOUC 1MRDL 4OGAD 4OI9A 3EHBC 2D7TL 4DVBA 2AEPL 3QCVH 5F1NB 2WQ8A 1T2JA 4ZPVB 4DN4L 4MQTB 4CN4A 3QZWA 5HPMB 4GW4B 4QT5A 2R1XB 4CGTA 1NC4A 3STZB 2DLEA 1J9CT 3VDAA 8CGTA 4HUVB 1ZHBA 4X5WA 1MY5A 1WIUA 1FJ1A 4NRZA 1A1MA 2F53E 5HHMB 4LRNH 1FG9C 2X4PA 4Z76B 4KVNH 1OHQA 1NBYB 5ICZA 1WWAX 1IEAB 1N0LA 1RUML 1FLRL 1G7QB 4GS7C 3BDXA 3FRPA 1T1WA 5TPWH 2XFXA 5ECJE 3X3FH 3UZVB 3TPKA 1NBZA 2R39A 5EO1A 2B4CC 1BLNA 1YUHA 4HWNA 1GGIH 4B50A 3IXAA 4XWGH 2HWZL 1J05B 3UEZA 1YMMD 2A1WH 1DP0A 4M8QA 1EH9A 3D0VB 5D4QA 5T3XD 3FFDA 4OV5B 1BOGA 3QUKB 3IDMB 3SKUD 4OLVH 4MX7B 4P23B 3C6LC 1CDUA 3C5ZD 3D9AL 4C4KO 3ARVA 3IJSB 4OFYD 3L6FB 4NKOB 5JW4M 3ARXA 3MOQA 5H2BB 2APVA 3VMNA 4B7LA 2ZCHH 2CLVA 1KYOJ 5A3ID 4CRPA 3B5TA 3FO0H 1C5CH 4KDVA 4Y5XA 1YJDC 4PJIE 3JTSB 5EORL 1NC2A 2P1YA 4WFED 4X6DE 3D85D 4X9FA 1DQTA 4MGXA 3ECBA 5E00B 4WUKL 2DYPA 5KG9B 3D48R 1CK0L 5KVFH 1ZSDA 3U83A 1F42A 2GJ6D 1C7TA 4L4VD 4DQOH 2AJZB 2EE3A 1L4IA 4I18C 3OKLB 3NIDE 4J7RA 1OGTB 4OCYL 5E2UH 5EUOB 5DRXA 5IQ7H 3ESVF 1QKZH 5HGAA 4F9LA 3RY4A 1AE6L 3PDGA 4W68A 2VDPH 3MGTA 2A74B 1TQBC 3SDCD 3ARFC 43C9A 3IGAA 5M94B 3PWLB 5LVEA 4X5XB 2BNRB 5I8OL 4NQSB 3RVWD 3O0RH 1RURL 2XZAL 4GG6E 5IFAH 4HKXB 4JVPA 2ORBH 3PWUA 2FX7H 2VC2L 4Z7VB 1MCRA 4L3EA 1IZJA 2X09A 4KHXH 4NZTL 5D1ZA 1YEGL 4MNHB 4UDTA 4DVRL 25C8L 3HE6C 1KPRB 3C08H 1H3TA 1B4RA 2Z31A 2O61B 1FZOA 1IGJA 4N0FA 3DUSA 2ESVE 2EYRB 3MV9D 1N5YL 4AG4L 2OMNA 5D7LD 3MMEB 5F9OL 3RWIB 2M8XA 3ZDXF 1KJMA 3A67L 5HVHB 1XIWB 4TPRH 1KXTB 3MV8B 2FNBA 3S34L 3UYOD 4FQXA 5E8EB 3S7GA 2D7OA 2PO6B 4IBLT 3BP4B 1G7MB 3MGOB 2GKIA 2AK4D 4HUXB 2XIDA 1RMFL 1FSKC 3MRRB 5KTEH 1NKRA 5E95B 4G42A 3NCJL 3TVMC 7CGTA 4I18B 4NWTL 5CJ5A 1QFPA 4RGOL 3BFOA 4OKVA 4FMFA 4KFZC 3MROA 4KRLB 2GFBA 3R8QA 4U7MA 5BXFA 1QSEB 3ULSA 2C3WA 2R56H 1B2WH 5HHMD 3VG0H 3WHE1 4AIXA 3OJDA 3BJ91 1F4WL 5D6CB 5J1AA 3RDTA 4NT6A 4ZFFB 2UVEA 2R0ZL 2YOCA 4OZGF 3TT3H 4UT6L 1CICA 4CMHC 3TYFA 2X4NB 4YGVB 4YEFA 1J0HA 1S7UB 2IBGA 3OPZH 4WEBH 5CBEB 1L0XA 1HH6A 2WLZA 5AYUH 5MERA 3TJHD 4HXAL 3SKMA 3KNBA 4FXGA 3V7MA 4PJEA 2CO7B 3UJTL 4MXVE 3CSYB 1KCLA 3O45A 2QQNL 2YWZA 1V3KA 3ILPB 1ZLWK 3T0EB 5LGHL 4NPYA 3FO2A 43CAB 3S98A 3KYKH 4HBCL 2X7LB 1DN0B 3SBWA 2WBJC 5IBUG 3O6KH 4WWID 3SE9H 5F3BA 1UZ6E 4K7PL 2VDNL 3MACH 4LOUD 2H3NB 4LHUG 1IAII 1FSKB 1G9EA 3TPUA 2XQYG 1TQCB 5F7YC 3DMMC 5DR5H 4LHJB 4TVPL 3T09A 3MREA 3B2VH 3P9WB 5TJWK 4A6YH 4POYA 1K4CA 4JRYB 5J12C 1Z3GL 2SEBB 1ZLWH 3KYMA 3O9WB 3R06B 1J18A 4RA3A 3DYOA 4ODHL 1U9KA 5C0NC 1DFBH 1T3FA 4K3HA 1YECH 3LS4H 4XTRC 1KSRA 3BVNB 4UI2A 3SKJH 1JPSH 3VXMD 2DL9A 3BKYH 1CI5A 3PHQA 1YEKH 1F6LL 2HT2C 2EH8H 2VLMD 3LKNB 2E7CA 4U6VL 3MYJB 1AO7A 5D71L 2XN9E 1IC5H 3RFZC 4MNGB 1UZ6F 3TO4A 4TSAL 1GOFA 1XGUB 2VZSA 4BKLB 12E8H 1YEIH 1QSVA 4O9HL 5MEOA 3Q3GA 4KI5C 5GISH 3LCYA 32C2B 1U6AH 2V7NB 1BHGA 1VHPA 2GSGA 2C7UA 3MR9B 3C6LD 4U1HA 2ATPA 1WCBB 1Q94A 2W9DL 3QEUB 4F58H 5DD6B 1AGEA 1YN7B 3RI5F 3GSXA 2DBJA 1OGAE 5IV2B 1ZHNA 1Q9LB 2WBJB 4L29B 3IDYC 3SHSA 3DXAA 1MNUH 4DUXA 5EOTB 2IPUG 4DK6A 1DANT 4I77H 4YXKL 2DIBA 5H37G 3S88H 4XVTH 1U8IA 4QHUA 4XT1C 5E1AA 1NH6A 2UZYB 2PW1A 1INDH 3H9HA 1RZKH 4ISVB 1PKQA 4UT7L 3MV8D 3VA6A 1QVOA 1QZ1A 4FABL 4V2BA 1CFQA 5J12B 4NNXA 2E7LC 2RIKA 3C8KB 3DVNB 2AXFB 2PO6D 1FL3A 2IANB 4XBEL 1HDMB 2DAVA 2EYSB 1HN1A 2F5BH 4KY1H 4N8CH 4G6KL 5HY9B 1DVFC 2VZOA 4EQ2A 2FX9L 2BVQA 1KEGH 5I1HH 2HFGL 1FFQA 5GJTL 4OZHF 3RWCB 5ADPL 1D9KC 5FV2A 4XNZB 4RFEA 2FYYA 3IF1A 2DI9A 1E27A 1QSED 1SJEA 2B7DT 3V6ZB 2HRLA 5KSBE 4L4TD 3G6JE 4ODSH 4G5ZL 5CD3A 3MRIA 1YA5A 4E41A 1S7RA 1ZT7A 2CIKA 3H9SA 1AGFA 3QDGE 4JFOA 3SQBA 4HKZA 1DLHA 4IS6B 5I8CA 4O2CB 2C3GA 1P4IH 5GRUH 5T5FH 1KBGH 4AT6A 2PCPA 4JY4A 3K7UA 2YRPA 3GJEB 5C0CA 3JWDH 1L7TH 5J6HA 5H8DA 3QDHA 3IDYB 1MHHA 1J0KA 3QUXC 4K2UL 4C54A 3R8BB 4MDJB 3TH2T 4TTDC 3QWRA 3OKMB 4LCYA 5DJAB 3SN6N 4U05A 3X14A 1DSFH 3AREC 1U36A 2OR9H 1JPTH 2CK0L 1L7IL 2W0FB 3WIHA 1YYML 4LVNC 3SE8L 4M8VA 1BX2A 1S9VA 3WS3B 4NNYA 3FKUS 2AJYL 3BUYA 4R3SA 3UTSA 1DDHA 5DT1H 3KWWA 3GJFB 2P7TB 1UACH 2VJXA 5FHBL 5KSUA 2MCG1 1DVFB 2MJWA 5MENA 3TVMD 2AVGA 1R3HA 4LGRB 3OKNB 4M48L 2FBJH 3IFPA 3HUJF 4PJHB 4Z77B 1KULA 3KYNB 3RWGB 1CZ8H 3O9WD 2IAMC 2L4OA 3SGJA 2XQBH 3BH9B 3DSFH 2BY3A 1E4WL 5BV7B 3F7PC 5DRNB 3BZFB 5AUMB 2PTTA 4B7IA 5TE6H 3LRGA 2ZSVB 1ZLVK 2IBZX 4WGVB 4UDUB 1D5MA 4G9FE 1KIQA 1A6VL 2E6JA 4GKOA 1IGCH 1PGRB 3K3QA 4R0LB 2V2XA 4G6AC 4NQEA 4RWYL 3FQXB 3RVUD 5GSRB 2VLJA 5DO2C 4Z7NF 3ABZA 1QRNE 4HWEL 3AREB 1DQJB 2R69L 3MRJB 3VFRB 1SEBB 2M1KA 5D93C 2UWEB 1ZLVH 4HXBL 2A77H 3GBNH 4TSBH 2OQJB 2H9GA 5AG9A 2WBJD 4Z78B 2X4OB 4OLWH 4JZNA 4UV4L 3HPJA 1S9XB 1NCTA 3N85L 3HRPA 5HDQL 1ES0B 2OTUA 4ZTOH 3PF2A 2DB8A 4TOYL 1FO0A 4HX1A 3BYYA 5JOFB 4Z7VF 1IC4L 5FHAL 5B39G 4LMQI 1ZK9A 1UB6A 3DMMD 4I3GA 1WBZA 3O4LA 3QSKB 3U79A 3WD5H 4XNUH 3H0TB 1WWWX 3H8NA 5ACLA 4OI7A 4HKBA 2FLRT 1PJ9A 2OR7A 1P84K 2IAMB 1QLEL 2IAND 1KELH 3QG7H 3ZHDA 1BVLA 3DVIA 2QLVB 2VDQH 2Q7YA 3MRQB 4E42A 2XWBA 2ICEB 5DMIL 2HT2D 1A3RH 3PWNB 5F1SA 1CD0A 2Z8VC 4F80A 5GGTA 4NFCA 3SY0B 1YDPB 4EN3C 1G7PA 3PDOB 3V4PL 5C6WH 5KS9E 2P24A 3K8LA 4KRPC 1E4KA 1CDJA 4KI5D 1UM6L 1BWMA 1JFQL 5JZ7C 2VR4A 3V6OE 4X0KA 1U2HA 3ZSSA 4ZYKA 1VFBA 3DLQR 4JR9L 5GS2D 2BVOB 5EZIH 1GGCL 5FO9A 5KVGL 5J13C 3V95A 1HSAA 5D93B 1RK1B 2E9WA 2IMMA 2P5EB 3KPQB 5JHLL 1IGMH 2DLFL 4GT7A 4DJMA 3K2UL 5HBBA 3VA2C 4P9MH 1BZ7A 4KK8C 5IJKA 1HQ4A 3AB0C 3E0GA 1J8HB 2OXGA 1DL7L 1FE8H 4KAQH 4XP4H 1EGJA 3TJEH 4DOHE 4M5YH 3IFLH 5MHSE 3C09C 1M05B 4HD9A 3X13A 3QA3B 3WKML 3TNNA 3WL9A 3VE0B 4P48A 4IIQC 1JWUB 5CEZE 3GSNB 1LK3L 3QDJE 1MRCL 1OY3B 1F11B 4YHMH 3UJJL 1Y6MR 1DVFD 5LXGL 3MRGB 3OAUL 4X9IA 5DMKB 1E28A 3TZVC 5IOPA 4YPGB 1LEKB 4HKJB 4TTGA 2YA2A 3UYRL 5I1GH 4KZEL 4IRSA 1CLCA 3UBXG 1R5VB 2R1YA 3S3SA 4FTVE 3QEQA 4I48B 2NYYD 1AY1L 1E4JA 4ETYA 4Y0GA 3FTGA 4TRPH 4KRPB 1KEMH 3O3DA 1CVRA 1MCCA 1REIA 3FQTA 1ZV5A 3HZVA 3WIFB 1G7HA 2BVUA 3NMEA 2W0KA 4OGZA 1GC1L 3AY4A 3DI3B 3KPRB 1UGNA 2F58H 2MNUA 4L8BA 1VFUA 4ZMAT 5DD5H 3GKWH 1KCKA 3QUXD 4DN3H 5DC4B 3VFMA 5T5NG 4TTDD 4QYOB 1P7KB 1FNLA 4U1MA 2ZPKH 3AB0B 4Z7WA 1I75A 1NFDF 3IRZA 5F7MC 5E7FA 3ARED 4KTYA 1WZLA 3MYZA 4TN9A 4PS4H 1XH3A 1EHLL 2NY1B 3C09B 3U9PH 3UTTB 2UZIL 1ZAGA 2I26N 3GJFK 5BMFL 1J1PH 4IIQB 4Z7UE 3AS3A 3QYCA 2ITDB 3GSUA 4R9HA 3GUTA 4NCC1 4PRAA 3UDWA 5DD1H 3AS2A 5EZOL 3V6FB 2FJGA 3NFSL 5DVNA 5JW4N 3MNVA 2ED8A 1A7NL 4WHYG 3HC0A 5FUCC 1Q0XL 2E9JA 1QNZH 1CGUA 3C87A 1RUAL 3BT2L 2QV2A 3P30L 5L7XH 2IAMD 4HUKB 1QFHA 3CVHH 5DVOA 3VXUA 3GJFH 4ETQA 4EI6B 3VXPA 2AJVL 2I07A 4QCIA 1L6XA 5I18L 2XNAB 4U4BA 2QSCL 5C9JA 2AJXL 2R0WL 3IDXL 3QPQC 4HFUH 4N0YH 3GIZL 5GGSA 2C4FU 2HG5B 3DI2B 2RHEA 4IOFC 5ACMA 2W07A 4FZ8H 2Z8WC 4LSPH 3ARRA 4GOSA 3VD5A 4J4PA 1RZFH 1MIEL 4G6AD 5DGRA 5BV7H 1ED3A 2CDGA 4OAWA 1P5VA 4KKCC 4TUOA 5DO2D 3BESR 4OGYL 4ODXB 1GAFL 5ESQB 3M07A 1F58L 2OCFD 1BECA 1S7SB 2YK1H 3AUVA 2QEJA 1NCBH 4XNQB 2VLKE 5CLWA 3IAGC 2P5ED 1G9ML 4F9PA 4FG6C 2X40A 4MSWA 4X6CE 5HGBA 4WHDA 1BIHA 3OR7B 2H45A 4Y5YA 2WUBL 2X1PA 4K7FB 5K9QI 1RZGA 1RFDL 4KI5F 3V4VH 4JFFB 3QDAA 3DBXB 3ZDYF 3ULUL 1S5HB 2AXJA 1UT9A 2Z93A 1KLFA 2EDBA 4OQTL 1J7VR 4JVUA 4UZGA 4PLKC 1C5DB 4M93B 3TH3T 3GHBL 2F9BT 1I9RL 5I73B 3BZEB 1U58A 4N9GB 1RZJL 1INQA 1I85A 4F7TA 1MFCL 4IDLA 5DDHB 4P5MB 1UC6A 4WI8A 4S1DD 5T3ZL 4UB0H 4XP1L 5TF0A 3SJVB 3G04A 4BFBD 3FO1B 3PGFH 2OL3L 4G3YH 1A6AB 4IRJA 4WI7A 3NOIA 2X1OA 4R96A 4PJCB 5HYSA 3H7BB 1EGJL 1RIUL 1XCTB 1HCFX 3BQUB 3SGDI 4N1EA 1X44A 2AI0H 3KPSE 3QH3A 4KRPD 4ORGB 4JZJB 1MJ7H 4YHZH 4RMWA 4ELMB 4F15B 3FMGL 2BRRL 1YNKL 2R2EB 1LE9A 2GY7B 3ULVE 2Y36H 5GS1A 1LMKA 3ZTJG 1CIDA 4NCDA 5D2NB 1RHFA 5BS0D 3SGEH 1LEIA 2W65A 4IRZH 3KPRD 3LKOA 4NHCH 4PJHF 4XI5C 1DZBA 4MNQA 1SEQL 4PG9B 3IKCA 4O4YL 4ZFGH 3P73A 3CXHJ 2A9MH 5C09A 4KK8D 5DA4A 2K1MA 1KCRH 4FRWA 1A7RL 5C0GA 3TBVA 4MQXD 3LKPA 4YHLL 2OYPA 5F8RC 2V2TA 5F7WC 3X11B 2NX5A 5I74C 2V2WA 4ZUVA 1HEZB 2AGJH 3OZ9L 1ZHKA 4YAQB 2P8PA 2X70B 3IVKA 5IB1B 2ZNWA 3CXDL 1JWSB 4HQQL 3HKFA 4N8VG 3D18B 1YPZA 1ITBB 1FZJA 4LSQH 3X3GL 3QUYA 4M7JL 5HHOE 4LBEA 2HRPL 3U9UA 4MLIA 3B4NA 2UWEF 2BOBA 4BA8A 5MP6L 4HPOH 5GGSY 4HUWB 4KGJA 4Q2ZB 4HGWA 5FA4A 3RVTC 1U8QA 4MHHG 1QYGL 2X4TA 3VFUA 1HOCA 5E24E 2YKLH 5IBLC 2EXYC 3HG1A 1A6UH 5CILH 4MMZC 1KYOK 2R2BB 1ONQB 1JGDA 4YHIB 3ARWA 3EGSA 5DK3A 4L5FL 5CBAB 4XRCA 4OIIH 3IJHA 4NGHL 4E5XA 3RZCA 3SGKA 2XKUA 2VKWA 4OCSL 1P2CB 4F37K 2DL2A 4LP5A 1YEEL 1ADQH 2A9NH 4WW2C 3UO1H 5C08A 1U0QA 3ZKMD 1HHJB 4DKFH 5EFIB 2Q8BH 5JHDA 1OAXH 3EYOB 4YK4B 1U93A 3P11L 3JV4A 4PRHD 1NLBL 4FFZH 1LO3H 3MJGX 4JFFD 2EDTA 5DMJB 4ZO9A 1NGZA 1EFXA 3HRZB 4Z18A 3F12A 3ZKXC 1B6UA 1S7TB 5FGCE 2EIEA 5GJSL 5FF6B 4NM8H 3JV6B 4H8WL 4JDZB 2E5EA 2DQTL 2IPKA 4NZUH 3VD4A 4LLVA 4WY7L 2NTFB 5T1MA 1I7RB 3OXRB 2YPLE 3BGMB 3FFCE 4XWOC 2VLRB 3V4UL 5DEFA 5C0AB 2Q87A 1MCSA 4KQ4H 2IMNA 2YD8A 3H42L 3SJVD 5B8CC 4IMKA 4WUUD 1A1OA 4C56E 5EG6C 5DJ2B 3QPQD 1K8IB 4NN6C 1NANI 3WJJC 3WO4C 2NZ9C 3DX8A 1NKOA 1X5XA 1MCJA 3BQUD 5ERWA 1U8MA 3ZKSD 4QF1B 2ADJA 1OPGH 2I60H 2BOCB 5K93A 3KVQA 1P7QB 3LEYH 4WI6A 3H6JA 5TH2B 1KJ2A 4Y4FC 1NUGA 2HJFB 1VCAA 3MLVL 2CMRL 4ZUWB 5E6IA 1F5WA 4X4ZA 4XP5L 5KOMC 2Q76B 5CEXA 2R8SH 1MWAB 4JFYB 1SY6H 3KG5A 1YY9D 4X8JB 4FG6D 1XGYL 2J4WH 2MHAA 3KDMB 4ZOEA 2ICWA 4XXCA 4RRPG 4X9BA 5HHXL 3P4MA 3HMWL 4WI4A 4PBXA 5ISZA 3SO5A 4X7CC 1S78D 1CGYA 3ZKXB 2ZUSA 1YEFH 5E7BA 4MJIB 4XH2B 2DM3A 2ZJSH 1M6OA 4GRMA 2PYEB 3SPVA 3RWEA 3BIKB 4BH8A 4EJ1C 2X1WL 3KPNA 2F19H 2EC9U 3VXSB 5DUMH 1R3LB 5GRXG 3CLEH 2IC2A 1MJ8L 4ZXBA 3W9DA 5DFVC 4TULH 4NN6B 3WO4B 4Y5VB 4HLZG 2WINA 2X5PA 2I5YH 4H26A 4M4RA 3MLPA 2P44B 4WW1B 1F6FB 3GRWH 4UMGA 3SE4C 2H32A 4MA3A 5GGRA 2OP4H 3Q6GH 3HLAB 3GHEH 5IT2H 4POUB 2P4AB 5DJ0B 3FJTA 4QOKB 3BI9X 2F53A 2R23B 3WNLA 4M7LH 5EO0A 5I66B 5LCVL 4XI5D 4LSRH 2QADC 2XA3A 3GK8L 5F1IA 2MPAL 1HXMB 1D5ZA 1MFBL 1OSPH 1S7XB 5E8NB 4ZSOE 3CSBA 3PGCB 3UTOA 3RKDC 3BKMH 4JQXA 3VXNA 1ZWIB 4NIKB 3MRFA 1JPGB 4GQPH 5F1KC 5FA3B 2MQ3A 2XPGB 4XCYB 1FAIL 5DJYB 1V3MA 1VFOA 5SWZE 4F7PA 8FABA 4F33B 3M1BA 5IBTL 1F4HA 2VITA 3VI4F 3GO1H 3NABL 5I17A 2E9BA 4PR5A 3WS6A 3LQAC 2C1OA 4GMTH 2CUIA 4RMSA 5I1AB 3LSOB 3CPLA 1KN2H 1N8ZA 4MD0A 4PJIA 5GHWL 3JTTB 5B4MC 4X6DA 3RVTD 5TFSL 2VLRD 4X6BA 5C0AD 1IM9A 3N1QC 5H35A 1NAKL 2EXYD 1S7VB 1P69B 3LMJL 2GT9B 1S9KC 3PJSB 5EOCL 1KACB 1FYTE 2ZOKB 1EHXA 1BBJB 3RBSA 3W0WE 3KPMA 4NO0B 4AL8H 3V8OA 2W38A 1MCOL 1IJ9A 4FQIH 3QP3A 5JR1H 3NAAL 4XAKD 3PGDB 1GZPA 4P46A 4D0DA 5EN2A 1KJ3H 4L8SC 4KTDL 3PV7A 2DD8L 3CH1B 3T3PF 4PD4J 4JFEE 4YPJA 3O3BB 3N50A 2B2XH 3NCEB 4ONGL 4GG6A 1CDBA 4F57H 3IDJA 1MFEH 5KVDL 2GYSA 1A9BB 1UCTA 3RU8L 4NKMB 2APFA 4YXLL 3SDYH 3UAJC 5CP3H 5E9DD 5GRJH 3RIAK 5KW9L 4RAUB 1KENL 3VD9A 1KNOA 4Y16C 1JK8A 5FM8A 4I0PA 4AQ1B 1OW0A 1VACB 1W0VA 1YEHH 2ESVA 4GG8A 4RISL 1ZLSH 3TA3A 2E27H 5EU6E 2D03H 1KTLB 4MD5B 1IAIH 4XP9H 1BQLL 1EFQA 4PTUB 2B0SL 3ZMRA 1AXSB 4WI2A 5DZNA 2H1PL 5A1AA 4HWZB 4J6RH 4A2MA 3IFOB 1I8MA 1TJGH 3NIGF 4HIXH 1X5GA 1DBMH 1HHIB 5ENWA 4XWOD 4JAMB 1CDCA 3VGBA 2VO5A 2YXFA 1NUNB 3FN0L 2XTJE 4FQLL 1ZMYA 4K9EL 2DN7A 2CR6A 3VMPA 1RV6X 5DHYA 1UWGL 4GBXC 3V0WL 1S8DB 3O11B 2ZG3A 2NZ9D 4PJXE 5J1TC 4XAWH 5D1XA 2CIIA 4NHUB 4RZCA 4PGBB 4PB0H 5BVJA 1ZT1A 3PP4H 1E6JH 1RU9L 2DQFB 4EBQH 1UYWL 4RQQA 2VDRH 3QQ9C 4L8SB 5ITFA 5IQ9B 4Y4FD 4BH7B 1CGVA 5K9KB 3FQUB 1Z9MA 2NY3B 3MJ7A 4JB9L 1JGUH 5D7IF 1GIGH 4O02H 3OBAA 4I5BA 1H3UA 4S1SH 1RJYB 2QKIA 2X6MA 5GZNC 3BEWB 2JJUA 1HHKB 4K3EL 4ZAKA 2VXVL 4UIKL 4KVCH 1A5FH 4WV1B 5ICXB 4G8GD 5CAYB 4Y16B 1JVKA 2WV3A 3NVQA 3QISA 1KIPB 5EZJA 3B3IA 2H8PA 5D5ME 4XPFL 1CE1L 4RIRB 1B90A 1EMTH 4LNRA 1MWAH 3GKZA 1U3HB 4Y1AB 5JQ6H 3I6GB 1UA6L 4Q7DA 1SYSA 4UQ2B 1K5NB 4MWFB 4QTIL 4F7MB 1HZHL 4I3RL 3IJYA 1FFNB 2HT4C 3RUGB 3FCTB 5L88L 4POZD 5BOPA 2E7MA 5IF0A 3MRDA 1S5IL 3F5WA 2F5AL 3EIFA 2XZCH 2N7AA 5DFVD 4PGDA 3VJ6A 1ZA6B 5TQ0L 5BZDB 2GI7A 1N6UA 1Z0NA 3O4OC 4LLYB 3BE1H 3ES6A 2G5BB 1A02N 5JO5B 1U8HB 1XF3A 1TENA 4CADB 2FR4A 3IU4H 1DQQB 4NDMB 5JQHC 3VW3H 1BMGA 2C3VA 1U91A 1RULL 1AJ7H 3TF7C 3RAJH 2NY6C 2QBWA 2YD3A 5GSVB 2JCCE 1JNHA 2FIRT 2NZIA 1SJHB 2B5IC 3WFDH 1XGTB 4H20L 3TYGH 1HE7A 2CQVA 2Y06H 4OV6F 4YC2C 1LP9B 3FB8A 4XVJL 1XZ0A 1E0OB 4WU7B 5JDSA 2X1QA 1OTTD 1B4JL 2QADD 1NEZB 3MRPA 1A3LL 1OL0A 2XN9A 2MCPL 4FXKA 4KROC 5DYOB 3GFUA 1DQML 2CKBA 4NO3A 1E6OH 1CXFA 4K3DH 3MQIA 4JHWH 1NAMH 4H1LB 2F54E 3U48A 3BPCB 5B3JF 1ORQA 3O2DL 3FT2A 3H9ZA 5INCA 1BBDL 2WMPA 3MA7B 1KB9J 1V7NL 5D1QA 1MJUH 1R3KB 4P59H 2IEPA 4OUUB 4Y5XC 1T03L 1IGYB 4NCC2 1OGAA 5EWIH 4NQTA 2WM0A 1KFAL 3KLAB 3RA7H 4MD4A 4QT5B 1NC4B 4JREB 1U92B 4NQDA 3WXWH 2J3SA 4EXKA 1MJJB 3HMXL 4WW2F 3BD5A 1AKJB 1BGXH 1AP2B 3L1OH 5B4MD 1FZMA 4FQ2L 5HGDA 6CGTA 2X4PB 1UQSA 4PP1C 3BYTA 5IB2B 1TCRA 1U3JA 5ALBL 2NY6B 1J88A 4F9LC 2DLIA 5F6HI 3ISWA 1MLCB 1Q9OB 2BSTA 2XFXB 2VAAA 1KN4H 4BFGA 4OIBA 4DZ8A 2CUHA 1L6ZA 4G9DA 2AEQL 4MQSB 3IXAB 4QXUL 4OTXH 1FVCA 3QIBB 3D39B 4M8QB 4M00A 1N5AA 5IFHH 1OWRM 1IBGH 3GNML 3FFDB 4PJDB 2Z4QB 3LKQB 1JV5A 2VWEE 5D1ZC 2H2SC 3ZE2E 4Z0BL 5CIPA 5E2WL 1OP5K 5JW3L 4KROB 4GAJL 5KSBA 4D9QE 3G6JA 2FEDD 1MRDH 1UADC 2D7TH 4HWUA 2Z31C 2AEPH 4Q6IB 3QDGA 1A4KB 3HC3L 1CR9L 4ELKA 4JG1H 5EBLA 4LCCB 2BX5A 2OX5A 3STLA 3O3AB 4Y16D 2WZPD 1U8NA 3MV7B 2A6IB 2XXMB 1PAMA 1KXVC 2IPTL 2YC1B 4WFGE 2DQDH 1OP5H 4FQXC 4KMTL 4QWWC 3OXSB 3LN9A 4LPCA 1U3HD 2ZSWA 3F58L 5DMGC 2HVJA 1WBYB 1RUMH 1XGPB 1FLRH 4ZODA 1UM5L 5MEPB 4WHTA 4CW1A 4N1CA 1Z0MA 2A73B 3JV5A 4YR6B 2GJJA 5HGAB 4KV5F 4WTZA 2HWZH 4L8DB 3PE9A 2HN7B 5J06A 3MGTB 3QIWA 4TYUA 3BO8A 3S96A 2EIZA 2G75A 3IGAB 5GGUB 3HTLX 3RX5A 4GBXD 1ZVSB 4GAYA 3QCUL 4K3JH 4EUPA 5LAXB 1BIIA 2ADFL 4U3HA 3D9AH 1R5IA 4W6XB 1IQDB 3RDTC 5I1IH 4LP4A 4BSWA 4J8RB 5D1ZB 3QQ9D 1CICC 4R8WH 4DKDC 5IP4A 1X5YA 3QFJD 2FIKB 2WUCL 1BVKA 4BSVB 1HHGA 1UVQA 4HT1L 4ZTPL 3L5XL 3WLWC 4BJLA 1WWBX 5EORH 1J12A 2DQCL 4NRYA 1AQKL 1GVIA 2Y07L 3L3HB 1FAKT 4DGVL 5GZND 3DGGB 4RNRA 1C08A 1DANU 1FFOB 3WFCL 1R0AH 5B38A 4WUKH 4PRIB 1CK0H 4JFHE 3MJ9H 5HI5C 5ICYA 3VRLF 1X9QA 2IWGA 3I6LD 1DQLL 3VGAC 5F9WB 5EUOE 4U6YA 3SBWC 2EDQA 4OCYH 3DRQA 1AE6H 2BNUA 3IDGA 3IETA 1K2DB 2BNRE 1LWRA 4L1DA 4G6ML 3FT3A 1VADB 4KTEL 4XP6H 4DWHA 2PW2A 1RURH 2XZAH 4OKVB 1NC4D 3MROB 3UBXI 3LV3B 2GFBB 2J8UE 3JV0A 4XPAH 3P2TA 4UAOB 4HCRL 2CKBL 4NZTH 2GTZB 3ULSB 4DVRH 25C8H 3QHZH 1AKJD 4S11A 3WDIA 4B53A 1XR9B 1YY8A 3OJDB 4NKQB 2NY6D 4J12A 1BD2E 5J1AB 4X5LA 1A6WL 2FECL 4H5SA 5EU4B 1XAUA 4MCYA 5JPMA 4XCNB 3TYFB 3ARSA 1QLFB 3TO4C 3REWA 4AG4H 1WIOA 4WFFD 4RA0C 5F9OH 4F2MA 1A6TB 5M7QA 1C12A 4Z0XA 1CXKA 3D39D 2Q86A 3U4EA 4TVPD 3A67H 2X10A 1PDKA 5MERB 2F8OA 2YSSA 3GMMB 3I6KA 3EDEA 3S34H 3QO1A 4FXGB 4M5ZL 3SKMB 4YHNB 4KROD 2QSVA 4NFDA 2VDKH 5DC0A 4LLWB 4WO4A 5KS9A 4NPYB 2GAZB 1RMFH 4MDIA 3BN9C 5EDXA 3NCJH 3VFTB 4NWTH 4LVEA 3V6OA 3QDMB 4RGOH 2JB6A 3UYPA 3TV3L 4R4FL 1KLGB 1KCUL 5FOBB 2K9UA 4O2EA 4ZOBA 3TPUB 1CF8L 3MV7D 4O5LL 1MIML 4RGNB 4WGWB 4GKZA 3D25B 1JZ7A 5DFTA 1NGWB 5F96L 4H1LH 1XGQB 3MREB 1B6DA 4B41A 5A16B 5FK9A 3CCHA 1BOYA 1F4WH 4Y2OA 2R0ZH 5BZWB 3WUWB 4UT6H 1LNUA 2V5SA 5T1KB 2BVTA 4ORZC 3ARQA 4UIMB 4PP1D 5C86A 3DV4A 5E56A 3U0PA 1KIRB 1UZ8B 1MCLA 3ARBB 4HXAH 5C0BA 2YS4A 3L5WA 3THML 2D3VA 4U0QB 3T0EE 5BOZG 2QQNH 2JLLA 1T5XB 5LGHH 4PJGE 5MEOB 3HR5B 4HBCH 4LIQE 1VGKA 1FH5L 5D1ZD 2H2SD 4P2RE 1T80A 4HWBA 1PG7H 2VXUH 5FO7B 4FTVA 4HIHA 1D5XB 1Q94B 3LD8C 1ZS8A 4K7PH 4G8FA 5D7JA 4YNYA 1F90L 2Z31D 1QFUL 5DUBA 1CDIA 1ZHNB 3EYVB 2Z92A 1W8OA 2HVKA 5JNYA 3VG9B 3EAKA 3DXAB 4TVPH 4MYWB 4JRYE 4UQ3A 3BGAA 3K81A 4QHUB 5E1AB 1Z3GH 1MQ8A 5FYKH 3GMNA 4PRID 3ZYIA 5HJ3B 1X5KA 1A21A 1T1YB 2DLGA 5J0BA 3B8SA 3N06B 1BJ1H 1A22B 1QVOB 2YUVA 1X5LA 2ICWI 4QWWD 3L3IA 1U42A 5DMGD 3TN0B 1GGBL 1ETZB 4U6VH 3MRCA 4BFEA 4CVZB 5D71H 1JI1A 2B4CL 1S9YA 3MOBH 3RTQB 5HPOA 4N0RA 3F7VB 5BQ7A 4Z7UA 2CRYA 3CFEB 4O9HH 5L6YL 3PABB 5IR1B 2FYYB 2OS7A 1UB5B 4PJBE 1E27B 4XPHL 3SGJC 2X4QA 3OJ2C 3QHFL 3IU3B 5D6DA 4Z5RA 4FQHB 3GGWA 5CKAA 3SDXB 2AV7A 1KB5A 1T2XA 1AGFB 3PL6A 4CBPA 4PJ5A 4HKZB 1DLHB 2OI9B 5IKCA 3SGDH 1CICD 3S36X 4KC3B 4YXKH 1YJDL 1XF4A 2D7PA 4PBVC 3WLWD 4CNIB 1K85A 1MHHB 3WFEL 2DDQH 1WLHA 4UT7H 3Q0HA 2BNQE 4TNVF 1QPPA 3EYFA 5E2VL 3G5YA 3B9DA 1JPFB 3EOAA 2DMCA 3QR2A 5HI5D 4Y2DA 2ITCA 1F3JA 4XBEH 1MHEA 2VL5B 1EO5A 1QUNA 2Y5TA 3MBXL 2VZUA 4G6KH 2NMSA 1XGRB 2EDEA 2FX9H 2G2RA 3NCMA 4HC1H 1XFPA 4BK4A 1LHZA 2HFGH 3TO2A 5GJTH 4C83B 3BUYB 5I6XB 1A8JH 1MELA 5BO1H 4OLXL 1M7IA 3NTCH 5ADPH 3V0VB 1I7ZA 4DFIA 1IILE 5KSUB 1JF5A 4RGND 5MENB 2VLKA 3LHPL 3SDDA 2ICWJ 4LEOB 3T65A 1SVCP 4G5ZH 1I3UA 3ARTA 1R3HB 3LKRB 4AZ8A 3MODL 5IB5A 5CJXA 5I1JL 4OJFH 3IFPB 1F4XL 4X6CA 3NZHL 1JYNA 3NFPB 3BX7C 1J1XL 5D7KE 1CT8A 4NQCB 1VEPA 4HG4J 5T1KD 4KK6D 4NQXA 2PTTB 3L7FB 3PUCA 1NCAL 5FGRA 1EUUA 1XF5A 4HUMB 2XZQL 4DCQB 3ET9F 1YYLL 4G8EB 1DR9A 4K2UH 2AKRB 1D5MB 4PP2A 1AO7D 4YBLB 4AMKL 3ARBD 4L3EE 3TO4D 5EU7C 2HH0L 1EXUB 4JHBA 2EEAA 4U0RC 3LN4B 1T22B 1E4KC 3UJIL 2O5XH 3EOTL 3ULUC 2CK0H 5EUKB 5I8EA 1L7IH 1MCDA 4G6FB 2LE9A 1YYMH 1EAPA 5IEKB 3SE8H 3RWJA 5IBUB 4JO1L 4DFHA 2AJYH 3T2QA 3G5XA 1G6RL 3KPSA 4LHUB 4N90D 4AEEA 2AJ3B 1ZGLA 3MFGB 3CDYA 2JJSA 3O8XA 4NC1C 5FHBH 2H9GB 3QNZA 4X7DC 5CEZL 1MHCA 4JZNB 1F6AA 4PRNB 3DXAD 3MRLB 4M62L 4M48H 2Q3AA 5A40E 5IJKC 3NIFF 4HX1B 5L0QB 1LO5A 1P4LB 3PP3K 4OCRL 1KTDB 4U1NA 1G6VK 3BRGC 3GI9L 4JFQB 4V1DB 5FYLL 1U2CA 3TN0D 2QHRH 2BSSA 1JHLH 1NJ9B 1BVLB 1A3QA 1A6VH 3GMQA 2Q7YB 7FABL 3RTQD 1Y18B 2LVCA 1MCQA 4HIEB 3HZYA 2UY7A 1B0RA 3R4DA 2VH5L 4RWYH 5E08H 5J9PB 4IRSC 1I3GL 3VXOA 3PP3H 1GGTA 3UPRB 3PG2A 2DQGL 1G7PB 1T21A 5HDLA 3HNTL 4HWEH 4U0RB 2FZ3A 3QG6A 4E41D 5HHOA 5FEBA 2FHCA 3H9SD 4XGZB 1VESA 5IJVA 3RGVA 3B9KA 3VH8G 3EOBB 4UV4H 4D9LL 1VFBB 1BFVH 1T89A 4NWUL 4LPTA 3N85H 3AY4C 5HDQH 2VXTH 4B5EA 3ARZA 2DJUA 4Y4KA 4LCIL 2JB5L 4TOYH 2Y4SA 1IC4H 3GMPB 3EYQD 2R4SH 4F3FB 1JHKH 1YEDA 4J1UB 3DX7B 1BZ7B 2OL3B 3DHJA 2A2QT 1T1XA 2HLAB 1QLEH 4IJ3C 1H15B 4EI5B 3TNNB 2ZUXA 1I9IH 3HCVB 5DMIH 2AK1L 3ROLB 3O3EB 4X4YA 1MRFL 1S7WA 3TBYA 3UDWC 3KYOA 5MEND 3P77A 3KJ4C 3V4PH 4PJEF 4KH2A 4YFEA 1CU4H 4FZEL 1UM6H 1I1CA 1JFQH 1I8LA 4OZFG 3MNZB 2Q8AL 4LLAA 3QEQB 1BFTA 2I27N 4JR9H 4NQCD 1J87A 3MLYL 1GGCH 2YA1A 3QO0B 3BEVB 2OK0L 4YUEH 1FPTL 5JHLH 3CIQA 3RWDA 2DLFH 2V9RA 5C0DA 1IAOA 2HJKB 1KPVA 3K2UH 4P49A 5LGJA 2KH2B 1J8HE 5L2KB 3QUMH 5DHVA 2YPLA 3TNMA 1NMCC 2IQ9L 4GW5B 4J4PC 1MREH 1ND0A 1LO2L 3ZE0F 4OM1L 3GSOA 4M03A 2V7HA 2J6EL 2LU4A 2YEZA 3VFMB 4C56A 4G6FD 3LRSA 5IESL 4O2FA 3GDBA 4GAGL 4H8WC 1GGYA 1LK3H 5CGYC 4MA1B 3WEXA 1AHWA 1JGVL 1MRCH 1QR4A 4CU6A 5EC1A 4IJ3B 4P3DA 4EZMA 4LL9A 5IFJA 3UJJH 4F9PC 4E0RA 2VDMH 5LXGH 1G1YA 1INEL 3OAUH 2UV3A 2BC4A 1L9NA 3OAZK 4KZEH 4Y5YC 1JL8A 3GUTB 4PRAB 4YO0A 3GBML 3EO1A 3OKDA 4RDQF 2FJGB 3UTQB 5IIEB 4K94L 3T8XA 4BQBA 3ILQC 1EO8H 2LVEA 1XF2B 3G6AB 2DMBA 5JXAL 1AY1H 3HC0B 5JOPD 3F8UB 1C5BL 1T2QL 5DEGB 2IBZY 3I02A 1R5WA 1UKSA 4V1DD 1ZA3B 2EIDA 4ONHB 2QTEA 5TDOB 2AERT 1OAZL 1TZIB 1EERB 3P9LA 4JKPL 4N0UB 1P4BL 2UYLB 3VXUB 3U7WL 1FFPB 1AC0A 1I85C 1GC1H 4DK3A 4ETQB 3VXPB 4GKNA 4QCIB 3CSPA 1SYVA 3OAZH 1Q38A 1NGXA 5C9JB 3RY5A 4WWKC 2H6PA 3ULVL 4MAUH 1WSST 4U1LA 4IRJC 2OZ4A 4Y4HA 1CD9B 3A6BL 2VISB 1Q8MA 5F7FA 1FQ9C 1WZMA 4IMLB 1QFWL 2PXYA 4CJ0A 3UTTE 3ULUD 2FGWL 3BPOC 1EHLH 2DQJL 3L3JA 3MOAL 4WRLA 1IEBA 2UZIH 4GQ9L 4I9WD 5A43C 3KHQA 3MLSH 3CMOH 3VFOB 3QEHA 2XQYK 5GS1C 5JIHA 4AY0A 1KIUA 2DF3A 4EVNA 5JPNA 3E8UL 5EZOH 1PVHA 3CDFA 3NFSH 4XBGA 1N6QL 5DRWA 1MY7A 5B39B 2O5YL 4MSWB 2AXGA 1A7NH 5H94B 4E9LA 2HA1A 1Q0XH 1XCQB 1UH2A 2AW2A 3VRJB 5F7LB 4JFDB 4LSSL 3P30H 3BT2H 5E8DH 3MBEA 4NJAL 3CZJA 2DWEB 3HNVL 1NDGA 5C1MB 2AJVH 5I18H 4ZNEE 4UINL 2AJXH 2R0WH 2F74A 3IDXH 3KPPB 4U7SA 1JZ3A 1TVHB 4NSKA 4ZSOA 4F37F 3GIZH 2E3VA 1SJVA 2HAZA 4P2CG 5EA0H 1N0XL 3PHOA 5C0EA 3QUYC 1MIEH 3UTZB 4GSDL 2NW3A 4F7EB 1BZ9B 4WWKB 3CZFB 1K3IA 2ICCA 3O2VL 5HYSB 1YC7A 4ZUTA 5SWZA 4YHYC 5F3HA 5HDBF 3QEQD 1T0MB 4KXZI 4XNXH 4BZ1L 1XR8A 1G7IA 1GAFH 5I0ZA 4G7YL 4HJGA 4XBPB 3R0MA 1NMBL 3BPOB 2IPUK 1DUYA 1K4DA 1G9MH 3S5LA 4GRWH 5TDPB 3U82B 4LDLB 3MPCA 1QA9B 3KJ6L 4LVOB 5L2KD 3T0XA 1LEIB 4XNYL 4PB9H 2YZ1A 4JFFE 2WUBH 4JKLA 3LKOB 1RFDH 5F7DA 5EPMA 4UILL 4QHMA 3HNSH 3GMOB 3P73B 4P2QE 2K3TA 1ORSA 3BH8A 1P9MA 3LZFL 5C09B 4JPVL 4OLYH 3S3JA 1FYTA 4XPTL 3RZCC 4CAGA 5FUOL 3SGKC 4OQTH 3LKPB 3W0WA 1G7LA 4QO1A 1FVDB 2NX5B 2GSIA 3GHBH 2V2WB 2FB4H 4ZUVB 5H37H 5J4MA 4LEXL 1RZJH 4MJ2A 1FFRA 5M95B 1MFCH 3SDAA 4JQIL 3I50L 3IVKB 5T3ZH 2VYRE 4XP1H 5D9SA 5FYKU 3O4LE 4MXWL 1KCVL 4JFEA 4PJCE 2OL3H 3V52H 4J2XA 3SKNA 1OAYL 3UPAA 1WICA 3KPLA 3UBXB 5K9OB 2I9TA 1RIUH 3OJVC 1NGYB 4P57A 2X9YA 3EFFA 3QUYB 3T3MF 2OTWB 2YPKB 4LBEB 3VFSA 4U2YA 5AEAA 3I9GL 3TT1L 4YLQT 3BP6B 4CVWA 5F44A 1J0JA 1GHFL 1FNAA 4GAFB 4NNPL 5DQ9B 3T4YA 4NZDA 2EYTA 2VZ3A 3FMGH 4U6XA 2BRRH 4YHYB 1YNKH 1A7PL 5D2NE 5DJ8B 5FECB 3BRDA 3VXUD 1TETL 5DJ6A 1E4XL 3UTPE 1RVFL 3HI6L 3QFDB 2X4TB 5KZCB 1HOCB 4IMKC 1QO3A 5ILTL 4S2SA 1SEQH 3HG1B 2DQUL 4O4YH 4P5KA 5E8OA 1WC7A 2OMBA 1JTPA 2NY5C 2EECA 1A7RH 4YHLH 1HI6A 1I9JL 5CSBA 3LIZL 3GIVB 3DIFB 4KQ3L 4L3CA 4HZLB 5BRZB 4XHJD 5HD8C 2D7NA 1A6ZB 3H3KA 3OZ9H 3TCXA 4XMKL 4E5XB 3BWAA 4PJXA 1AGBB 4HQQH 5E6IC 4WNQA 3UMTA 5I76A 3DECA 3K8KA 4DKEL 3O6FA 3X3GH 4AEHL 5HYFA 3HZKA 1N3NA 3K74B 4LVHB 4M7JH 4L3AA 1UJ3B 2HRPH 3ULUF 4OD1L 4EDWL 4XXCC 3MV11 3ILQD 5MP6H 2Q1EA 3R1GH 3RJQB 1EFXB 1MPAH 3AS1A 3F12B 4MJ4A 5HI3C 1O0VA 4LLMB 1Q9WA 1AGCB 4WFHE 2ARJB 1OTSC 1GPOL 2WP3T 3S36L 5FAAA 3TIDB 4PV8A 5IMLA 1VB9A 2G9HA 2LFGA 3Q1SL 1TVDA 4FP8H 2IPKB 2KL6A 3U46A 5F89A 1Z6JT 5D5MA 1JZ4A 1JP5A 3ZLQC 1VPOL 5DEFB 3LDBC 4W81A 3GSQA 3EDKA 1VEOA 3KGRA 5HHNB 1A1OB 4HAGA 4XPGL 4ZXBC 3OQ3B 4WWKD 4L5FH 5HHPB 3HC4L 4PLOB 2EDRA 3MO1A 3S4SB 3B9VA 4QXTA 3TESA 4FNLL 4NGHH 4K23H 5I0DA 1YMMA 2CJUH 3MZGB 3AU1A 5IM7B 2OJZL 3QI9B 5ERWB 1JGEA 2EKSA 1HSBB 3UZEA 4OB5L 1YEEH 1ZVHA 5C2UB 5FCSH 2VL4A 2HFTA 2ATKB 3C5ZA 2MMXA 4PRPE 4OFYA 5IVXB 1O7SA 1YNTB 3F62A 3WN5B 4NYLA 5E6IB 5BVPL 3ROOA 3B43A 1JPST 5CLTA 4GUPB 4ZFOL 5DMYA 5EU5B 1QR1B 1NLBH 2CDEA 4MNQD 4JCLA 2JCCA 3VCLB 1AC6A 1B0GB 4K8RC 5HYIA 1D6EA 4LSVL 1TVBA 2MHAB 2QQQA 5C09D 3MRMA 2XACC 1DE4A 5DD0L 5FYJU 5GJSH 1G9NC 2ICWB 4RMTA 4H8WH 5ESAA 3REVA 2DQTH 3D85A 5IK3A 2NX5D 5ISZB 1QSZA 1M71B 4WY7H 4PYGA 4GXUM 4JQXC 5FM4A 1T4KA 1X5FA 3V4UH 3QWQB 5DSCA 3H42H 1MF2L 3LEXA 1RI8A 1DLFH 1M6OB 1EHNA 3RNQA 1V8HA 1BM3L 3VXTA 1UWXK 2F54A 4X7EC 4X99A 2EEDA 1IGFL 3KPNB 1QFWM 3GMLA 3D3VB 1BQHA 4Z7OE 4JFZL 5E94A 4Z7WF 3QUYD 3JWOC 1Y0LA 4YX2L 4G8IA 3QCVL 4ZXBB 3SDCA 3W9DB 1MHPH 4QRPB 3WS6C 3WDHA 5KN5A 5JW5A 4NN7B 5HGGS 2BXYA 3QAZC 3TCLA 3QXAB 2WINB 4U33A 4KJWC 5DK2A 2KZWA 3CFDA 1JI2A 4LPWA 3MLVH 2CMRH 3CX5J 1WFUA 4XP5H 5KZCD 1JCKA 5GGRB 4HHAB 4ZUUB 3ZKNC 2YRLA 3T77B 3HG1D 5CP7B 5IW6A 1UWXH 2V17L 4UV7H 5EU3B 5C0FA 1FZKA 2F8VA 1FGNH 1XGYH 2YBRB 2F53B 1T1ZB 3CFKB 3G08A 1OAUL 3M17A 4V2CB 1T7XA 5HHXH 5B3NA 3HMWH 5BRZD 5IW3A 3VFNB 5F1IB 4MJIE 1D5ZB 4P46C 1GGIL 1I8KB 2R15A 3RZCD 2A6DB 2PYEE 1U8JA 3VFVB 1I1YB 5E4EB 1I8IA 1JN6A 4N8VB 2BCKA 4QHLA 1PSKL 1U8PB 4GKSB 5J7CC 1BJ8A 3VXSE 4PGCA 3FB5B 3CUPA 2VNCA 3GSWB 4FS0A 1VGEL 3DTXB 5HHVL 1MJ8H 5F1NA 1TNNA 4F7PB 4ZPVA 3L7EA 4I0PC 1OW0C 1XEDA 3RHWF 3VFWA 5HPMA 4GW4A 4J23A 2W0PA 1J86A 3C2AH 3DO3A 4DTGL 1EFXD 2R1XA 5CD5D 4B0MM 3TA3C 5I17B 1H3PH 4NKDA 1NEZG 2J5LC 5EULV 3MRHB 1L0YA 4LPYA 4HUVA 1U95B 3VWKB 4JQVA 3CPLB 3M45A 4QOKE 2XZZA 4NO2B 2DRUA 2PETA 4KZDL 4Z76A 3ARDB 3PIQB 4X6BB 1A2YA 2R2HA 4MB5A 5DD3L 4HJJL 5H35B 5LCVH 4CVUA 3EOYG 1ZXQA 2WQRA 2O5ZH 1F3DJ 1KGCE 4U1GC 1WQVT 3GK8H 2D4DA 2MPAH 5E2UL 1MFBH 5IMOA 5D1XC 1J05A 2OM5A 3QZWG 3QI9D 4W6YB 2VDPL 2CRIA 2V5MA 3A6CL 3V6BR 1P5UA 4HMDA 2EKJA 5JW4Q 3GB7A 5HD8D 5JDJA 3QUKA 4MX7A 4P23A 4D0DB 4P2OC 3T2PA 1JHTB 4JFPB 3IJSA 1FAIH 4NKOA 4GG6B 5E6ID 3IDJB 5IBTH 4JY6B 2PYFA 2X2YA 1G7JA 3FRPG 3RIFF 1GGUA 4ZAKC 3NABH 2W60B 3C08L 2AJSH 1JK8B 2EDDA 5HVFB 1CCZA 3JTSA 4I0PB 4YQXH 1W0VB 3OV6A 5AZ2H 1TMCB 5GHWH 5C7XL 2ESVB 5ISZD 4W4NA 3A0OA 5HI3D 5E00A 1YPZE 2J5LB 5TFSH 4QKXB 5KG9A 5D70L 4ZG1A 3P4OB 4WHYH 3LY6A 1I8MB 3NGBB 3LMJH 3NH7L 2AJZA 3HAEB 5EOCH 5EUOA 1CIUA 4OZGB 1UXSB 4Y7MA 1WAAE 3T08A 2A74A 4ZXBD 4QRPD 3Q48A 4HK3J 4U1GB 3TM6A 2X4SA 3NAAH 2BNRA 4NQSA 4KKAC 3MUGB 4KTDH 4U1KB 2DD8H 2CR3A 2CIIB 1QQDB 4HKXA 4ONGH 4RZCB 4MLSA 1LVEA 2J8UA 1ZT1B 4JFXB 5KVDH 1CVSC 4MNHA 3RU8H 4YXLH 4RQQB 1YPZF 4LMQE 2FSEA 2R56L 4P2OB 5KSAB 2VB5A 5C8JA 3C9NB 1J5OL 3VG0L 3ZO0A 3HS0B 1KPRA 3I75A 2VDOL 5E1HB 4EXPX 5ELIA 5KW9H 1RIHH 1RIVH 1KENH 2F53D 5FV1L 4I4WA 3VMOA 2FHBA 2DKUA 4I5BB 5ACZB 2XYCA 3TT3L 1BD2A 4LAJH 1QHOA 2EYRA 4D8PA 2QKIB 3MRBB 4RISH 4QNPE 3MMEA 3RWIA 5C08E 4RCAA 3EO0B 1BQLH 2B0SH 5LKNA 1B0WA 1HH9B 3U6RB 4KKBC 5EZJB 1GL4B 3B3IB 2RB8A 5AYUL 5JHDE 1XIWA 4LLDA 1BEYL 4MCZB 5E8EA 4LNRB 3ARUA 4OI8A 2EDKA 2PO6A 3BP4A 1G7MA 3FN0H 3MGOA 5D1QC 5HTSA 4FQLH 3MRRA 1D5BB 4K9EH 3PXJA 4I18A 1EVTC 1UWGH 4U3XA 3V0WH 3O6KL 3E6FA 1R3JA 3V7AG 3SE9L 5HYQB 2DI8A 1ODAA 3ZDZE 1MCIA 4QTHB 4PGDB 1QHPA 2QR0B 2E6QA 1RU9H 1DEEA 1UYWH 3VWKD 3B2VL 2IALA 1W72L 2FJHA 3ARDD 5INDA 4JB9H 3WFBL 1IM9D 3FN9A 4HIIB 4ZFFA 3ZKND 4HV8A 4Z7QE 4YGVA 1S7UA 2VXVH 4UIKH 5FM5O 2EH8L 4EEEA 3VRIA 4JPWL 4GMSL 5CBEA 3ZTJH 4XPFH 4TUKL 4Y1AE 3MRPB 3VDCA 1N2RA 1IAKA 2GK0B 5FFLA 3ZDZF 5DFWH 5KVEL 3CSYA 1JYWA 1YEIL 4G7VL 1UA6H 2CKBB 4NO3B 3ILPA 2LTQC 3UC0H 4QTIH 3T0EA 1HZHH 43CAA 1A9EA 3RUGE 2X7LA 1DN0A 4PJGA 3P3YA 2Q6WA 1ORQB 5L88H 5INCB 1JF1B 2LQRA 1T0NB 4P2RA 1S5IH 4Y19B 5DTFB 2H3NA 5D1QB 4NUJA 3MV9B 1UEMA 4PTTB 1E4XI 3W2DL 3BIAX 5TQ0H 3W9EB 4I0PD 1MNUL 1UH3A 2B8OT 2MSPA 2ESVD 3RNKB 4I77L 4MD4B 4PRBB 5I75B 1SM3L 1P53A 4JRYA 4HH9B 2NR6C 1FORL 2EXWC 2SEBA 5LBSL 3O9WA 3R06A 3VXRE 1QBML 2XKSA 3BVNA 4OF3A 4NP4L 1FZMB 2AK4B 1LP9E 1HCVA 3B6SB 4H20H 4CU7A 4QRTB 1UQSB 4ZPTB 1TCRB 3LKNA 4OSUL 1DJSA 3QIWC 2F5BL 2HFEB 3K46A 3OAYK 4U6TA 1B4JH 4M02A 3DRTA 1A3LH 4DZ8B 3HB3D 2MCPH 1XGUA 1PBYA 4M9PA 3B2UC 4JY5L 4BKLA 1UCBL 1S3KL 1DQMH 1W2KT 1AGDB 3RX8A 4HUNB 32C2A 2NLJA 5FB8A 3ZKQD 2V7NA 3L95A 1JV5B 4NN5C 3O2DH 4ODSL 4PJBA 5IW1A 4P2OD 1BBDH 2ZKHL 5KSAD 3UPCA 3WUWG 3QEUA 5KSBB 3G6JB 1I3RB 4AH2B 1V7NH 1YN7A 4DAGH 5IV2A 5I9QC 5JXEA 4RX4A 4L29A 5ITBL 1T03H 3OAYH 3CFBA 4ZD3L 4Q6YA 2OR8A 1CGSH 1KFAH 4QRSB 4BFIB 1FV1A 4ELKB 2FH6A 4ZAKD 3LQAL 3JWDL 4MZ3A 3EJYD 3NN8B 4ONFH 4PV9A 5K59E 3V0AC 4AEIL 3V2AR 3C6SA 3HMXH 2Z8SA 4ISVA 2YUWA 1FBIL 2AEWA 3HUJB 4FQ2H 4RDQG 1ZEAL 4UT9L 2BNQA 4QHKJ 3C8KA 5ALBH 4A2LA 1CG9A 3BP5B 3DVNA 2ZOLB 1O7VA 1IQWL 2YN5A 1HDMA 2EYSA 5DJZB 4LSTL 5F8QC 4KDWA 2VR9A 1BFSA 5JORB 3INUH 4KHTL 1QP1A 2AEQH 5E2TL 3I85A 4QXUH 4TVPE 3RWCA 3TLRA 1CL7L 2DLHA 1RD6A 1WCQA 4PJDE 3DOSA 3S96B 3GNMH 2G75B 5FYKE 3V6ZA 1ZVYA 4Z0BH 3F65A 5E2WH 4KKAD 3G5ZB 4WDIB 4EUPB 1BIIB 5JW3H 3EYSH 2FBJL 5EBWA 5K59F 5E8PB 3HAEH 1V3LA 2JF1A 2VQTA 3VXMB 3NCBB 1CZ8L 1EV2E 4BSWB 4XVUC 3BSZH 1I1FB 3DSFL 4WEMB 4M43H 5A2FA 4GS7B 1RUKH 1CR9H 3HC3H 3UCRA 5TE6L 3MV7E 3GJEA 1FHGA 1LE5B 1FNFA 3K4ZA 1HHGB 1UVQB 1I3VA 5I9QB 1X4YA 5EC2B 5AAMA 4LAQL 3X12A 4NRYB 2IPTH 2HYMA 1LDPL 3GEWB 4YHOL 1HWHB 5FIEA 4PJIF 3OKMA 1IGCL 4G9FB 4X6DF 3ARPA 1F2QA 2RR3A 5ICYB 1UM5H 2PR4L 2W0FA 3C6LB 4WO4C 3WS3A 3V6OC 4O51B 1OF2B 4OGXL 1MAKA 4S0TD 2WWMC 2J8HA 4Y19D 2ZG1A 1RJLA 3NIDF 1QRNB 2BNUB 5T3XH 5D1QD 3IDGB 3CVHA 3T1WA 3GJFA 2P7TA 2A77L 3HE7A 3MRNB 4FQJL 1FNGA 4YIQB 1OGAD 5HYEA 1PZ5A 3QCUH 1X5IA 1AIFB 2PF6A 2ADFH 3OKNA 5TGBB 1NBVH 3BISA 3W39A 4Z77A 3KYNA 4MAYA 5TF1L 4GG6F 4TVSa 1VERA 3BH9A 2ADGB 5I1LA 1SMAA 2VIRB 3DO7B 2YHGA 3JZ7A 3HHRB 5DRNA 5C2BL 5AUMA 1OAQH 4H25B 4LIQL 3PXHA 3RWFB 3BAEH 4HLZH 4HT1H 5CEYB 3L5XH 2ZSVA 2EDWA 1QD0A 4UDUA 5JPMB 1CFVL 1AQKH 4HS3B 2Y07H 4LCWB 4ENEC 3REWB 1TQBB 3ARFB 1VFAB 4R0LA 3WFCH 3DETC 1RPQA 3H9YA 3FQXA 4L4TB 2Q86B 5GSRA 1PX4A 4HK3N 4AIZB 1FNEA 2ERJC 5SWQB 1QTYT 3I6KB 3QO1B 2KQNA 1ZE3C 2R2CA 2BHUA 1UKTA 4XPBL 3VFRA 1SEBA 2KDGA 5KS9B 5D7JC 2QQLL 1TFHA 3MUJA 1BFOA 1PLGH 3HE6B 2OQJA 4CMMB 1MLBA 4Z78A 2E7HA 3DARA 4YDVA 1S9XA 3WFZA 3OGOE 4HUUB 1ES0A 2IF7A 1A47A 4JKMA 5JOFA 2DQIL 2AJUL 3MLUL 3N9GL 2F15A 4HCRH 4GKZB 5I1CL 2KBGA 3BPLC 3GM8A 2A0LC 1AQDB 5AYQA 3H0TA 5EIIB 2IG2L 2Y23A 2NR6D 2EXWD 4CN1A 1DN2A 4QY8B 3S37X 1A6WH 5KJRL 2DICA 2IAMA 4LLUA 3FQNB 5FYJE 4DOHB 4RAVA 3EHBD 4YBHA 3MRQA 1G6RB 3T2OA 5GS3A 3TVMB 4GXVL 4GXUN 2XKNB 3PWNA 1VENA 3QDJB 1GZQB 2V9QA 2EDNA 5DJCA 4Q97A 4YXHH 5IMMB 4JEGB 3SY0A 3V79C 4O58L 4M5ZH 2WP3O 5D6DC 3C8HA 4K71C 3TBSA 5I1GL 1YEJL 4MB4A 4MXVF 3PL6C 3FB6B 1VGKB 2ERJB 1NFDB 3QDME 5IEHB 1HKFA 2BVOA 4HIHB 3TV3H 1DQDH 3I2CL 4CMHB 4G8FB 1KCUH 2LAAA 2XOTA 4YNYB 1RK1A 3MJ8B 4RGNE 2CGRL 3BGFC 1EAJA 1CF8H 4O5LH 1C8PA 1MIMH 4XC3L 3E6HA 1R24B 4JO2H 5JNYB 4ODWA 4M3KB 2Y6SC 5F96H 5DK0B 1U41A 4UQ3B 4G9FD 1J8HA 2FO1A 3PWPE 1CGTA 3T04D 1X7QA 4J3TA 3ZYOA 3QIUA 3SCMA 3BPLB 4Y2DC 1LK2B 3C5SB 3HFML 5GXBB 3QQ4A 1M05A 3QA3A 2J8OA 3MSPA 2GCYB 4ZOAA 3VE0A 1JWUA 1VA9A 5DUPL 4LRIA 3UXFA 4M1DL 4PLNC 1QRND 5D7SL 3U9PL 4NQDE 1F11A 2LAGB 3SDDC 1KPUA 5FO8B 3THMH 1LEKA 4D3CH 3DMMB 4PJ7E 4HKJA 5CJXC 5BQ7B 4Z7UB 3QQ3A 1DBJH 4KU1A 4UU9B 1R5VA 5CS7A 4G6JL 1FH5H 2X4QB 5HHQA 2AABH 4I48A 3QRGH 3DVFA 5JOEA 4Z5RB 4G43B 4K71B 4LKCA 4U1JA 5HVGB 1RHHA 1RY7B 3B8YA 3FO9A 1F90H 1A0QL 4MQ7B 1QFUH 5AWNH 5L7XL 3WMSA 1T04B 2D9QB 1MQKL 4XVUD 1F45A 4KXZH 2E8YA 3HN3A 4P4RB 3WE6B 4LCWD 1RUPH 4I2XB 3JBG7 3ARFD 3KPRA 1ADQA 3BGFB 4K94C 1KG0A 2GTWB 1XF4B 4HFUL 1DBAL 2CUMA 15C8L 4HDIB 2B1AL 3GSVB 2NQCA 2VXQL 4LSPL 3IAPA 2WIIB 1RZFL 3MC0A 4BELD 1KC5L 1GGBH 2JJWA 2XRAL 5F7EL 3FT4A 2DQHL 3MZTA 1F3JB 4Y2DB 5IHZB 1MHEB 4TUJB 4MJ5B 3UTTA 3BP7B 2B4CH 1EO7A 3HE6D 4EDXA 2JJSC 3O8XC 2Y7QB 1QBBA 5IG7A 5SX5K 4IIQA 1TITA 1JYXA 5GGVY 2WWMD 2ITDA 3TO2B 3ULVC 4PJFE 4X98B 4M7LT 4XPHH 2VLKB 5F7NC 2X9WA 3SDDB 3T65B 5CGMA 3SDXE 4PGJA 5DF0A 5KSBF 1TXKA 4ODUB 4Y89A 4QGTA 3G6JF 1IC7L 1PQZA 4ZS6C 1FNSL 1BPVA 4NQVA 5SX5H 5MHSD 4EI6A 2EE2A 5LQBL 1XF5B 2XNAA 1YJDH 4YDLC 4XX1G 5CEZD 4TNWF 3QDJD 4FA8A 4ZNEA 3WFEH 1NL0H 4UTAL 2HG5A 2AV1A 3QNXA 4MA7L 2HKFL 1D9KB 3WXVL 4QRRE 5E2VH 1SY6A 3PGFL 3D1MC 1WFTA 4X6EB 3MRKA 1CXHA 3ZT7A 3MBXH 1DCLA 3RGVC 3B9KC 3AXLA 5FYLD 1I7UA 1T89C 1ACYL 3CFJB 3QULB 2AI0L 4FTVD 1IKNA 1S7SA 4JM2A 4Y4KC 3T1FA 3KPSB 3DUUA 5GRWA 4I1NB 4PG2A 3O8XB 1EBAA 1MHCB 3LHPH 4WEUD 1F6AB 2GJZB 2OJEA 3KPOB 5JIPA 3QUXB 5I1JH 1L0QA 2G5RA 4K7FA 4ERSL 1PY9A 2C5DC 1K8DB 4P9HC 4JFFA 3DBXA 2A0LD 1S5HA 5TDNA 3P9MA 5CJBA 4U1NB 4P2QA 4N0CC 4LVNB 2XZQH 2Z91B 4Q58C 1UEYA 1MVFA 3BZEA 1YYLH 3VFPB 5IVZA 3GRWA 4MVBC 2DIAA 4AMKH 5DDHA 3U4BL 1FRGL 4WTXA 2IADA 3MLXL 2X4UB 2HH0H 1FIEA 3HZYB 5SWSB 1YMHB 4KMLB 3FAXA 1BF8A 3UJIH 4CUCA 3IS0X 1A6AA 1MEXL 3VXOB 3ZYZA 4HPYL 2GUOB 4PJCA 5GPRA 3H7BA 1I8LC 1KLUB 1XCTA 2DI7A 3BQUA 2BVPB 3OHXB 2HTKC 1HNGA 1PYWA 3L3DA 3F6IA 3QG6B 5C0ND 5HHOB 3NBNA 4ORGA 4JZJA 1G6RH 4QRUA 4XTRD 4ELMA 3BD4A 5IJVB 2R2EA 3WKNA 4R97C 4M62H 3LPGA 5D2NA 2OSLB 1Y6NR 2BDNL 5BJTA 1T7VA 4PG9A 5CILL 2IQAB 1J11A 1H3VA 3HPLA 3QNYB 2Y6SD 4N5EC 4V1DE 2H26B 2ENYA 5HYSG 3GI9H 5FYLH 2L7JA 1AHWC 3X11A 1CL7I 3FRUA 3OJMB 4KRMB 4Y2DD 1HEZA 4PREB 4YAQA 1AFVL 7FABH 5IB1A 3IB4A 3KLDA 4GRWE 1DEDA 4WJ5A 1JWSA 2VH5H 4U31A 4QGYA 3D18A 2ZZUT 3BKJL 1I3GH 3KYOB 1ADQL 3UO1L 5GGQL 1IKFL 4DKFL 4U2ZA 2VLKD 3SDDD 2Q8BL 5F72S 2OLDA 3HNTH 1MVUA 1HINH 1SQ2N 3DUHA 5IHUL 5KS9F 3CH8A 3TC9A 1D5IL 4HUWA 1JZ6A 5CINL 4OLEA 4D9LH 3QJFB 5KBNC 3PWJB 4NWUH 5IB3B 1ZOXA 1IVLA 1FG2B 4NM8L 5C0BE 4LCIH 1AR1C 2JB5H 3K1KC 3ALPA 5T3ZE 3FQRB 1I4FB 3HZMB 2FO4B 3WNNA 1IAOB 2R2BA 4Y4HC 2X4RB 5FUZL 4KJYA 1ONQA 4YHIA 5DHVB 1D9KD 2YPLB 3FFCB 3TNMB 1FL6A 2ZUWA 4F8TA 4EN3B 1JWMB 1A7OL 2PXYC 3GSOB 5CP3A 3OKKB 3WIHL 2YEZB 4C56B 1CFNB 3QWOB 4LPUA 5JLZA 3QEGH 4TQEL 3LRSB 1UXWB 4U1SB 1TZGH 2NPLX 4S1QH 2V5TA 2AK1H 1OWWA 3WEXB 1MRFH 3NZ8B 1P2CA 3KPSD 3LEYL 3V5DA 5BS0B 5J13B 1EZVY 1HHJA 3O8XD 4HMCA 5EFIA 4X4XA 3C5JA 2BC4B 4PRPA 2LABA 3ULVD 5DLMH 3EYOA 4FZEH