4CC0A

Notch ligand, jagged-1, contains an n-terminal c2 domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
306
structure length
306
Chain Sequence
SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Uncovers Lipid-Binding Properties of Notch Ligands
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN JAGGED-1
total genus 63
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc0A01
4XBMA 4CBZA 4CC1A 4CC0A
chains in the Genus database with same CATH superfamily
3PHQA 1AD0A 4O2FA 1BW8A 3KEDA 2X2IA 3CC1A 3ILEA 4JRXA 3MZGB 4HH9B 2WO2B 5K59E 1KEGH 4I4WA 3GSNA 2JB6A 4I77L 4IHOA 3ML8A 1KJ3L 4HCGA 4LSDA 1EXHA 2WQAA 2ZUVA 4NNYA 2ZSWB 2HT3C 1E4XL 4NKMA 3TBSB 2AQ1A 3V95A 3VX0A 1FFPA 3UTOA 3LIZH 1UURA 2DWXA 3B7UX 3CCHA 3DV6B 3K2MC 1IBGH 1NAKL 1HE8A 3RWHA 4X4YB 5EIIA 1PZ5A 4XPFL 1SF5A 2JV6A 3TZVD 1Q0YL 2FB4L 1S3KH 4JAMA 3SHSA 4HBCL 1A9EA 2A1WH 1F4WL 4LGPB 2BSSA 3QH3B 5D96C 4JFZH 5ILTH 1LTXA 2IXQA 1OAXH 3F05A 3V4PL 1E7UA 3BZFB 1CLOL 1F3JA 5DD0L 1ECZA 4RRPG 5ETUB 1E6JL 4BSVB 7CGTA 3NGBB 3VH8A 1BM7A 4QEGA 3V52H 5F88A 3VWKB 1UOVA 1N64L 4MJ6A 3GIZH 3VWJD 4LPWA 1A7OL 2X42A 3FRUB 3KPNA 4QD2E 3C8DA 1EO5A 4TYUA 2VISA 2VLJD 4AOFA 4N2MA 3QXDB 3LRSA 4U1MB 3GSQA 4KROC 1KLUB 1G7LB 3IPBA 3U6RB 3SDXA 4XBGB 1JNJA 2PO6A 4OU3A 1EXGA 1ZHLA 2YSTA 1JYVA 1OM3L 2DL9A 1CFQA 2EYRA 2JKJA 4M7LH 2P8MB 4AYGA 4MSWA 1WTGT 3D7PA 3F62A 2A83A 4OFKA 4Z7WE 5E4IA 1RMFL 4X9GA 5MERB 1MJ7L 1FNLA 4WW2B 1QA9A 2V3EA 1Q9KA 3VI3A 1A4KB 2KPWA 1KT2B 1UACH 3EUDA 5DMJB 5F89B 5EPMB 1KB3A 1U8LB 2MOQA 3KYOA 2X4OB 3HKZA 2NW3A 5DI8A 3NRQA 1I9JH 2KZKA 2VITB 4WEMB 3ZMNA 1TJGH 2PYFA 3D5OF 4V1DB 1FNEA 4TMPA 4XTRD 3QIUC 4OIBA 2OMXA 1IMHC 4YQXH 1HXKA 3FUJA 1KPUB 3B6SA 2BWQA 2W60B 1URZA 1JGVL 3WN5A 1SPDA 4Z3HA 2N0MA 2GK0B 3ELQA 4NBZB 1C12A 4GS7C 5CBEA 1MW0A 1CXIA 5CIPA 2UWEF 3DYMA 4I0PD 5BV7B 3BPLC 2NSXA 4EDXB 1B6DA 4RLDA 5HDQL 5IJKC 4KJQC 3CFDB 1NGXA 4P3WA 4RQQA 1U8HB 1IEAA 2WK2A 4ORGB 1PJ9A 5JQ6L 1Y7VA 2APVA 2NY3B 5D2NC 2M8XA 4UTBL 3LH9A 3IDGB 2H0EA 1E9PA 3R8QA 4LFHD 2JI3A 3VYPA 2AQRA 4HF5H 4A37A 1E4KA 2C7UA 3QIWC 5AW5B 4DOHE 1UATA 4GKNB 4Z78B 1ACYH 4HIXL 5J9PB 2GJ6D 1X9QA 1G1CA 4OT1L 1C9SA 4GG6E 2VDQH 2VC2L 1A6UL 2IDTA 5FX3A 1J5OH 1L3NA 1S7UB 5D7IF 2BVUA 2R1XB 4EI6B 4PRDA 5HBBA 1JRHI 4IM8A 5E5MB 5CZKA 4KH2A 4UILL 5IEHA 3ARTA 3LVTA 4O58H 5FYJH 4Z7VA 5KS9B 4YC2B 1J0HA 2CLRA 3E6FB 4OKVB 1SN0A 1TJIL 2QADB 3LQMA 4HGMA 4ZUVA 3LNHA 1BD2A 1R3HB 3IFOB 4Y16D 1T7VA 1BJ1H 3KBEA 4WNJA 1IFHH 5IW6B 4UT6L 1KG0B 3MLPA 3FO2A 4WTZA 3RWHB 3T8VA 4OVVA 2WWMC 3LRMA 1PLBA 2F74A 1ZVSB 3CZNA 3B5HA 1PLAA 2OX5A 5AW1B 5A6IA 1OAJA 3CN4A 3N50A 4C55A 1G7JB 4H8QA 2WOBA 4DN3H 4M7ZB 3RB7A 1DJWA 4Y1AE 2P24B 3A67L 4Y1TA 3A21A 2G5BA 3OJMB 4IKKA 5TQ2L 3NCEB 3ILPB 2Q76A 3CN3A 4YHYC 2OS7A 4BK5A 3W5MA 2WV3A 4MD5A 4H8WL 3F64A 3A6CH 4QRFA 1JWMB 3P0YL 3QXDA 2V9TA 2VLRB 1ADQL 3MODH 3WIHH 4YDLB 1UB6B 5C0GA 2V5YA 4M5YH 1YN6B 1CIDA 1KDJA 2ZP9A 3NFSH 3CWGA 1IIIA 2HFTA 1M9WA 3DOIA 3QC6X 4KXZH 1GYCA 3FHEA 3DOSB 3RNKB 1DJSA 3CFBB 4P5KB 4RGOH 2GW5A 1QRNE 3HZVB 3V8OA 4G9FE 2YJLA 4ORZC 4G83A 4MCZA 1AQKL 4XBMA 3VFGL 2P5WB 5EPMA 4JLRB 1HXMB 3HC4H 1T4WA 1AE6H 3K6NA 4HX1B 4I5BB 4NQVB 4Z7VF 2ATAA 1E9QA 3IJ9A 2PYFB 4FYQA 1QRNA 3D0LA 3V4VL 2F19H 4NC1C 4TSCH 1IC4H 4XRCA 1I3RB 3V5DA 1IGMH 4KQ3L 3BUDA 4AIZA 2A9AA 3O6MH 4L23A 3TYFB 3AW5A 1GGBH 2ZX8A 3SE9L 3FQTB 3ZDZF 2JIXA 4JZOA 4AITA 3HC0A 2YD0A 1FIGL 1Y18A 2DKSA 2VN4A 3B2DC 4XMXA 1NIDA 3MYJA 3F5WA 2VM3A 3RWJB 5JTWA 3IF1B 2BSBA 5GPRA 4HUWB 5FUOL 1D6VL 4ORGA 3UOAB 1ANUA 4OLYH 4JG9A 4AVHA 1X7QB 5MENB 2Q7NA 5EORH 5FM8A 4FA7B 5AOIA 5A2JH 4AV4A 1CLYL 1AOZA 5KZCB 2UY7A 1AFVL 1YY9D 3C60B 4GP5B 4U6TA 4ZFZA 1H5BA 1PCSA 2BVPA 7FABH 4AEHL 3S5ZA 3UABA 5GGVH 1GC1H 2GFBA 2KQNA 3CUPB 1JYXA 2ZQKA 4WWKC 3MJ8A 1HYSC 1BFSA 4UBDD 3MKKA 4F7KA 4XPBH 4J27A 1OTUD 5JZ7C 3JYBA 3QDME 4M6MH 1WA2X 3OKOB 5FUCE 2HN7B 1F3DJ 1PKQA 4UIMB 3LKQA 2GI7A 1XIWB 5AYQA 5FHBL 4CVUA 3SKNA 2FTAA 2CK2A 1FL6A 1MCEA 3N85H 4PGBB 3T04D 2ESVA 5TDOA 5F7UA 1AGDA 2OLDA 5F44A 3NFSL 3QPQC 2Y07H 4I1PA 2FZ3B 2CIKA 4G80A 4M9OA 3ZDZE 3WLWD 2EDNA 4I2XE 4HPHA 3CZJA 4BRJA 2CRIA 3N1FC 1ADQH 2QTEA 4ZMNA 5IKCA 3OJVC 5D71H 4H8WH 4ZMLA 2UWEB 1KIUA 4Z6AT 3F84A 2OXGA 1K8IB 4HPOH 2F74B 4Q9CA 3QI9C 3QYMA 2Q7YA 3DA0A 2OTUA 3K4ZA 5AKSA 2R0WH 3STLA 3VH8G 4KQ0A 5J7CC 1FFRA 2I69A 3DYPA 1MCQA 1MZYA 2MPAL 3F83A 3P02A 3L3KB 4JY5L 4Z23A 2MQ3A 2X4SA 3H0TB 4OBRA 5MEOA 3KLQA 4ZUSA 4IK6A 1E8XA 2FX9L 4P2RB 1JL8A 3T5WA 4F91B 4Q9BA 4PY7B 1MG2C 2V9UA 4BQBA 5J8OA 3KAAA 4M7ZC 3SE8L 1T22B 1HZKA 1W72H 4F1ZA 1FJ1A 4ZMAT 4GIPD 4BZ1A 5C71A 1G7QB 3RUGE 1TJIH 1OAYL 1Q9LA 4L3EB 2ZP8A 3SQOL 1J0KA 3G6AA 5JPNA 2X1OA 3MA7B 1H5BC 3MBEA 2P44B 3LEYL 2H47C 2FVNA 3VXMD 4F7MB 1JHKL 3ATDA 4W9IC 4XXWC 2R8SH 4TVUA 4NFDA 3MLRH 5FCSH 3D4GA 1GGCH 2ICWB 1ED3B 2DKUA 3G7TA 1JTPA 3QO0A 4OCYL 4M1CD 1CDJA 4DFIA 1CGVA 3FCGA 3FCTA 4JG1L 5FA3B 4HIXH 2D3VA 3WY3A 3P4NA 2W1NA 1HINH 5FO2A 2GIYA 3L54A 4I48A 4NWUL 4U1GB 2O72A 5GJSL 4FP8L 4UZUA 4FLQA 2OP4H 1J8HE 4JQIA 5GSVB 3D9AH 1P4BL 1W2KT 2LE9A 4ZMPA 4URTB 3H42H 1B4RA 2C8NA 1LD9A 3VMNA 3SDXF 3CG8A 3ULAB 3U1QA 1IV8A 3PNWB 4XPGL 1NEZB 4UOZA 1HI6B 2H41A 4EJ1C 5JXED 1Q94B 2ADIA 3FU0A 4KZEH 1GYUA 4L1HA 3ALWA 3P0GB 4NN6C 2E9JA 2WVVB 4HFWA 3DSNA 2WLIB 2VWEE 2PO6C 4ZZKA 4WTWA 4YDZA 5CGBA 3TF7C 3BH9B 2WYZA 3JTBA 4HJEA 3DX2A 4QLRA 4OF8A 1MHHB 3NJLA 1ZWIB 3CZGA 4G59C 1J8KA 2BVPB 4MJ2A 4D3CL 4PGDB 2CUIA 1HL9A 1I8LA 2EDKA 4OZ4B 4A6YL 3ZHFA 5JHDB 5SWZE 4IBUA 3W9EA 3TX4A 5DJ2B 3CX2A 3WNKA 5ALCH 1GKEA 4RA3A 3LQAL 1I4FB 2LGNA 3NYKA 4NB7A 4NRZB 2FNBA 4ZW6A 4KI5D 1SVCP 1WAAA 3WO4C 5B8CA 1QFWL 1AD0B 2WQVA 5H4YA 1MLBB 1CXLA 1UZ8B 5C07B 2HLAB 4MD0B 4JRXB 1MRDL 3UTTE 5CD5C 3MRJA 3CK0L 4YHPB 1MREL 2YD7A 1RZJH 4YSOA 3LQZA 4FNPA 1U2YA 3H7BB 4AIEA 2E7LA 3APFA 4YLBA 1DLHA 3UAJD 2CWRA 4LDOB 2XV0A 5DMGD 2B7DT 2HUHA 3GMMA 1JXKA 3JV4A 3VB9A 1ZT7A 4GXVL 1ETJA 5BZDB 2HXAA 3HLAB 2V2XA 1W9XA 4QTHB 3AG3B 3GHEL 4JJ5B 3FCBA 4H0HB 4F2EA 3LQAC 4HD9A 5IVXE 3JTSB 5I6KA 4FFVD 1MFVA 4MHHI 4A7VA 2CAKA 4HU8A 3QDMB 4F24A 2IBZX 5KVEE 1F4WH 1G9MC 3DVNB 2IEPA 2FB4H 1E4KC 2FT8A 3QIWA 4OZHA 4YSPA 3BQUC 4KU1A 1S7VB 1NAKH 2E56A 2VISB 2O6CA 2ZWYA 4R7DB 2QVTA 4E9LA 1CXFA 2IANB 1T04A 1G7LA 3U6RA 3MRNA 4LEBA 3QGVA 5KVGE 1KCWA 3WD5H 3U4AA 1CXEA 1EVTC 3GRWH 4BXSV 1C5CL 3Q7JA 2YEVB 2CA3A 4PCTA 5EBMA 1A3ZA 3G5YA 4AIXA 4JFEA 4IKJA 2OMYA 5MI0B 5I19H 4OCWH 5MERA 1T0NB 5BMFL 1S5HA 2K78A 5DUBA 4E9SA 1HNYA 2ENSA 3QRGH 3RWIB 1WAEA 5F7AA 3FZUC 3GBLA 4AQ1C 3K80A 4W9LC 2QDVA 5SX5K 5L9DL 4F58H 1DQIA 4WUKL 3PIQB 3B2XA 3FAWA 1FYTA 3FFDB 2F1BA 4FFYH 1BG9A 5BV7C 2L0DA 1ZD6A 1MXDA 1X4ZA 3Q2NA 5D1ZC 1U8PA 5KTEL 4BQ6A 1Z7JA 2DD8L 4YSAA 2OZNA 4X4XB 1MG3C 1OTUC 4YN3A 1KPUA 4X7EC 1L0QA 3QR2A 3CAFA 4X4ZA 1CT8B 3AITA 3BX7C 3KS0J 2I85A 4FQCL 5IBTL 4KKQA 4HWBL 5I73C 1MAJA 5C6PB 3SCMB 4CKVX 3GQFA 3C75A 4PBDA 4LT7A 3BP6B 1NFDB 2M83A 3QFDA 3ARFD 3W37A 3QDJE 1QWUA 1MDTA 3DI3B 3V0AC 3ARFC 4V33A 2KMWA 1OO2A 4D9QD 2K0RA 4MJ5A 2P52A 5EU3A 4GG8B 3Q48A 3V4PA 3ISWA 5GZOC 2ZUQC 1BD2D 2NOYA 2QZQA 4Y16A 6PCYA 4ZW3A 3QZMA 5AW7B 4JHAL 1GTFA 4CW1A 3DHMA 2WXFA 5DEFB 4QLWA 2G3MA 4QRSB 1J8SA 2OXHB 1CFVH 5B38B 3FUFA 1KBBA 1NC4A 2CHNA 3W9EB 1HDMA 2NXZB 5T1LA 2FSDA 3UPRB 5J9PA 1F1GA 3L1OL 4XN9A 3QXWA 1CQKA 4YZWA 5FO9A 1T5WB 4G9FA 3RZCC 4HG4K 2O6EA 3ESOA 1UA7A 1WS8A 1N8ZA 1AHKA 1XHHA 5I1HH 2A99A 3D85B 4Y2OB 4HGWB 1SF3A 3AXLA 3Q8BA 5CD3A 1UKQA 2J72A 3H6JA 3VI4B 3ULVH 1I1AA 3PGFL 2P80A 4H5SA 4M6NH 2VXQL 3ARGC 1GOHA 4AYBA 1WFNA 3FL7A 1RZ8A 1T1ZB 1XSKA 2OMWB 2J1ZA 3DBSA 3MV8B 4XMUA 5BW7C 1IGCL 4D9RD 1C8QA 4PYHA 4G6FD 3L1GA 3L45A 1USQA 3QO1B 2L3BA 2Z91B 4OM1H 1A66A 1RZ7L 1ZT7B 5HYEA 1J8RA 2IJ0C 1A02N 3U46A 4GBXC 1WC7A 4Y5VB 1R3JB 3VSUA 2PCYA 2G2RB 2KI6A 1MIMH 1Z0NA 1ZVYA 3JTSA 2APSA 1AS6A 5I17B 4YFLI 2C9SA 2B4CH 2NY1B 1AJ7H 3OLGA 2BHYA 1BG1A 2WQSA 4GFTB 3B2VH 2AJXL 3H3KA 3P2BA 4FE9A 2ENPA 3OBAA 3C8KA 3PDOA 1MUJA 4JZJA 4L3FA 2ATPB 1MPAH 4MJ4A 3WNMA 1YQ2A 2HJKB 4LP5A 4NO0D 3NIFB 5AW4B 1TNNA 4N28A 4KUCD 3D3VE 4MNGA 4PG2C 4R8WL 4N4YB 4FD0A 4ERSL 4L0YA 3GTVA 2ICWI 4NGHH 4DOHB 4ZX5A 2VDML 1R3KA 1FORL 3QWQB 3KCPB 5AW3B 3FSAA 3UGXA 3IAQA 4OD1L 1BA9A 4FFZL 2VW6A 4XO8A 5DQDL 3HZKB 2OMTA 5CLXA 3HZVA 4ADGA 5IFAH 5E99H 3UEQA 3BIKA 4EBQL 4DQAA 4HSCX 4WJKB 3WJJA 1HXMA 3VD7A 3AAZB 2BH0A 4FQJH 4OLVL 3MQIA 5JOFA 2F6AA 3BT2L 3GGWA 1LILA 3OZ9H 2P49B 2NNRA 3P69A 3VUAA 5LWYH 1DQTA 4JPQA 1YQVH 3HMXA 3IEAA 3K6SA 3KGTA 3FFOA 5DSCA 2OFQA 3CXDH 4W4NA 2RBLA 4GSUA 4PWKA 3NCFB 2AXWA 2BVOA 2AQSA 3WY4A 1BXVA 4CMMA 2EIZA 3FJTA 4GUPA 5AYUL 4Z77A 3MO1A 1JGUL 4YSRA 1ZY9A 4Y4FB 1N0LA 1VADB 1IQDA 2PR9A 4G5ZH 4TNFA 5HTSA 1M1XB 4NZFA 3RFZB 5DJ6B 3L5WB 2RA1A 5IHBA 3SBRA 2HJFA 4QY8A 3MRDA 5BS0E 5I73B 4UU9B 3MOBH 2CO1A 2RFXA 5DS8B 2F9BT 5A43C 1JUFB 1MJUH 1G84A 4XB3A 4OZIE 1JPFA 4URKA 5HYJB 1BDYA 4IOSA 3ESMA 3G9AB 2D7TH 3MR9A 4EOWL 1JV5B 4P5TD 4PRNB 4QGTA 2YD6A 2E7MA 5C2BL 4O2EB 1PDKB 3M7OA 1HSBB 3C60A 2JQMA 1NGQH 3Q5YA 4HMEA 3BEVA 1H15B 2O4EA 4FNLL 3VJ6A 1JZGA 4OM0L 4KI5E 4H20H 1F4AA 2F7OA 3CUPA 4BGDA 2YOAA 4F7TA 2BP0B 3TZVC 4PJ6A 4LO9A 1UXWB 4AZ8A 2PYEB 2HVJB 4J3SA 3PHSA 1B6UA 2D3NA 2P80D 2DQCL 4Y2OA 1V7NH 4O00A 4CUCA 2L7QA 2OQJA 3UO8B 5DVMA 3HJ0A 1I1AB 4H5SB 3VCLA 2WIMA 2R2HA 2XWXA 2BS8A 1GOGA 3HMXH 5F7WC 3BMWA 2BX5A 3QEUB 4G3YL 3MXWL 3F7KA 1I1YB 4YSUA 3NCYP 1KF9B 4JPKL 3MNMA 1TTGA 2SEBB 4F57H 4GO6B 1XO8A 3PWPB 2BNUA 2JQAA 2CMRL 2B59A 1IZKA 3GHBH 4A6YA 2FJSA 2ZOLB 3DO4A 3D4ZA 5B3NA 3FAXA 3IDIA 4YBQD 1UM6H 3QFJA 4FNUA 1FGNL 1J8HD 2WNKA 1P84J 2X4PA 2Y9RT 3ZE2F 1NMBH 1ZA6B 2G9HA 4KI1A 5HGGS 3BAXA 4WWKB 4KBPA 5E56A 1LXMA 5D2NA 4TRPL 4H44C 4OLUL 5B39B 3ZYZA 5FYLD 3IBEA 4LLVA 4WDIA 4Z76B 1QYGH 3EDDA 1O6SA 5CSGA 5KSBB 2K4AA 2J20A 3OB0H 4QAWA 5DQJA 2R4RL 3EDJA 4QKXB 3SE3A 1S9VA 4X6CF 2A6IB 2J8HA 1ZHBA 3WDHA 5E8PA 1DO6A 1M7XA 3TH4T 3UTSD 3G6AB 1JGDB 3C60C 1HNFA 1VFBB 2Q8AH 4CAGA 1PNCA 2B16A 4UYPA 1J0YA 2FIKA 3K6DA 3EBAA 4K3EL 3HVNA 4NUPA 4FMKA 1TEYA 4YSDA 4ZOBA 5FUZL 1LDPL 1XR9A 3ZTNH 4PWHA 3VFVB 3MLYL 1KYOK 3O45B 3OAUH 3MLWH 4BM7A 4YXKH 5HPOA 3ZTJH 3V6OA 1BP3B 1ZRUA 2GSMB 2J5LB 1BHGA 5IESL 4AMKL 2BHZA 4YH6A 2OK0L 1PIGA 2BS71 4RFOH 1XSIA 3P4NB 2JNZA 1NCCL 5F7HA 4I48B 3F3HA 4HOZA 4RGMC 1A4CA 3TM6A 1CXKA 3PXHA 3OXSA 4MZIA 1XF2B 3MGOB 3ZKNC 5GSVA 5DJ8A 1KYUA 3HLKA 3BWSA 5EBLA 4UANA 5JPMA 3DX4A 1YEHH 1JZEA 5C1MB 2CPUA 1ETZA 1A3RL 2NY6B 4DK6A 1YJDL 4GO9A 2VXVL 4KRPD 5EU7E 1KB5H 1MFDL 3HG0A 4FTVB 3RHWF 3CLFH 4QMEA 4K8RD 1YMME 3WUZA 2QDWA 2XZCH 1H3GA 1IAKB 3FQRA 4PJ8D 3X2QB 35C8L 3EHBC 4G1MA 4W93A 5HYJA 4N1HB 3SDDB 3EJCA 2WLIA 4WFGE 4P4KB 5C0BE 1W0WA 2C3HA 3VVWA 2FCBA 3MLUH 3VDCA 2EACA 3KXFE 5E9DD 5LGJB 1E67A 4XZUB 3OKEB 5GQBA 4DKFL 1YYLL 1K6QL 4OZ4A 1CTMA 1BWMA 3T4YB 3WIIH 5KVFL 1FC1A 3OR7A 5B4MC 4LIQL 1KJ2L 1HKFA 2HB0A 4HJGA 4AZ8B 1TO5A 2JCCB 3BP7A 3R19A 1ZSDA 2ENYA 2QPFA 3V0EA 1E2VA 5DUPH 3P77B 3S3JA 5B3SB 1KC5L 5DURD 1MLBA 1TNMA 1UENA 4UOJA 4E5XB 1LMKA 1A8JH 1GL4B 1WZ1L 2X0WA 4IBSA 4YE4H 2D7NA 2NTSP 4K7PL 2GUYA 1QFUL 3US1A 3ZL4H 2V2TA 2A9MH 3RL2A 3RPIA 1JTOA 5L7XL 2GVYA 2P48B 5DJXB 1RI8A 2QADC 4Q0XL 1JZ2A 1MFCL 4AQ1A 4KK5D 4PJDE 4XXDB 3RJOA 4OZFB 4LOFA 5DU7A 3BT0A 3QCVH 4N2IA 3T2NL 4XO3A 5HD8C 4JO3H 3DK0A 1CICC 4KKCC 3V0VB 3INUH 1QHPA 3BAEL 5C0FA 2NTFB 2FX8H 2HWZH 3MFFB 5J13C 5GS1A 4PRIB 5TFSL 4U1IA 3VQ2C 4AEIH 1DCLA 3Q2WA 3HZMB 1D9KC 4LKCA 4OD2B 4XC1L 1BOGA 2NSQA 3BCFA 4PAZA 5D7IA 5DLMH 2GPZA 5I2IB 5B39A 1U6AH 4GOSA 1Q0XL 1CE1H 4OZHB 1DVFB 5CKAA 4FX5A 3U9PH 4LRIC 4ZMZA 2C9RA 3M88A 4OCXH 5KN5A 1NBYA 2WSKA 1QLFA 3MCYA 4TF4A 2YWYA 3G5XB 4P2YA 3M1BA 3GBNH 3VMOA 1G9EA 2JELL 2IH1B 2BIQA 5GJTL 1KJVB 3KJ6L 3H4FA 5HP5A 3G5YB 2WYIA 3Q01A 1U8OB 4N6RB 2NW2B 2BOLA 2V37A 4HXBH 2V5SA 1DLFL 1S5HB 2WMPA 5EFIB 4JHUA 2EH7H 2EUXA 4JK0D 5GGTL 1S9XB 4NUQA 1VESA 1ZTMA 4IS6A 1XCTB 2ZCHH 4WI6A 2DJSA 1BQKA 1WHPA 4LCYA 4UAHA 1F6AB 3BPLB 4NKQB 5FYJU 5KG9B 4NQDD 1XF5A 4YDIL 4LLYA 1ZLSL 2C9UA 5IROC 2ZF9A 4LSRH 4XCCH 1DVUA 5F3BA 1Q9OB 2ZZUT 1OOWA 3QWOA 3VD3A 1SYSA 3GLEA 3U2SA 1B0RA 4MXVF 1CZ8L 2VIRA 3BP6A 3KWTA 3UAAA 4U7KA 2YK1L 2V7HA 2E7HA 3I6GA 3OAYK 4QXVA 3HN5A 1H3VA 2WLHA 1OV8A 1L9OA 4ODVH 3JV5A 5BOJA 1FGVL 3TA3B 2QQLH 4OF3A 5EA0L 3NJXA 3FQRB 3O11B 4N1EA 5KS9E 5CZXC 3DRQA 4APXB 3MBXL 4WF7A 4J8RA 3VGEA 4AMWA 5D72L 3U7YL 3PWNB 3EJSA 4WAFA 2UZXA 2CKNA 1F18A 2XFXB 3DSFH 3WSQL 2NY7L 1QI4A 4APQD 1CCZA 3L9RB 3RY5A 3DJRA 2CJUL 5JDSA 5DEGA 4JFED 5LBSL 1JK9B 4XHJD 2JTDA 4H13C 4Y5XB 2BOBA 2YC1B 5AL0A 4F1SA 3VFMB 3ULVE 5KZCD 4KMTL 5DJYB 3S35L 4JUTA 1ZIBA 4R7NB 1CE6B 4HA1A 1FZJB 1XD1A 4M43L 4G1EB 2DJUA 5J1AA 2VUKA 4PJFE 2E7DA 3OKYA 1P53A 3HG3A 4POYA 3BDYH 4BYHA 1J05B 3SGJA 2ESVD 4XWOC 4HIEA 4AGQA 4HDIB 4Z95H 3FB8B 1H8LA 4ZNEA 1A4BA 3IBOA 3GI9L 3C6LD 3NZ8B 3DRTB 4X6DA 4KJWD 1LYQA 4Y5VA 2IQAB 2LTQC 3V0JA 4XMKL 3H9SB 4PRIA 2Z7WA 3GZPA 4OZFG 3SCMC 1LE9B 3S48A 2H1XA 4E9TA 1R34A 1HKLH 1EA9C 1FV1B 3PQYA 4I0PA 1YNTF 3BPOB 4AK1A 2O61B 3LS4L 1FO0A 5GS0H 3OB8A 1RUMH 1DQDL 1ZPLA 4XNZC 4HBQA 3C8KB 3PDOB 3P3RA 3S8WA 4WK2B 4B3EA 4GQ9H 1NFAA 4X9BA 4ODXA 4JO1H 2DOCA 3VRIB 3MRRA 4LMQE 5T1KA 4RFEB 2VLME 3FT4B 3VI4F 2CLZA 3D69A 1WT5C 1A6ZB 2BXZA 1MW3A 2QHRL 1KJVA 4N90E 2Y36H 3KCPA 3R8BB 1C7TA 3QI9A 1WICA 1U8OA 2CHDA 3JWOC 9CGTA 4JRYD 1KJMB 3QQ4B 4Z7OB 3S5LG 2DDQL 2XXCB 4MCYA 4GXFA 2FO4A 4JR9H 5ICXB 5T33H 4KPHL 2QSQA 3V6BR 3CE1A 1WDAA 2HFEB 2YPKA 5L4IA 4LB8A 4YDVB 5I16A 3QUYC 5C0CD 1IKNC 1F6AA 2ICES 4GPVA 1JGLH 4PJXB 1R3IH 4ODUA 3K6SB 1GMIA 4I18B 3K2KA 2R1WA 2UZYB 4BH8B 4LLUA 1JPTH 4HULB 1EDQA 1AXIB 5BXFB 1DSFL 5I6MA 2CHXA 4U6XB 1SYSB 5L88L 2ZT9C 5ALBL 2VSCA 3UPCA 4JFYA 3N9GH 1ZHNA 4GUPB 4HAKA 3X3FL 2CH8A 2ZXBA 3LZLA 1PY0A 2RALA 3STZB 1UG9A 5AD0B 3H3BC 5L2KB 1KGYE 1UD3A 4ZO8A 3JTTA 3A23A 2P47B 5AWNH 1H6FA 1FE8L 2GUOB 1MWAL 1WBXB 4JKLA 4WGKA 1SFHA 1FF5A 5E2WL 2YRBA 3PJSB 4OSUH 4RISH 3E0GA 3NPZB 5LNGA 3NDYE 1HCFX 1SHXA 5D1QA 4QT5B 1WEJL 4ALAH 5IEKA 4XN4A 4KOCA 4M6AA 1PD0A 4NQCD 4O4YL 3S0PA 1U3YA 3BUQA 3LS5H 5E8EA 3VTAA 5GZNC 5JDSB 4R4BB 3CVCA 5F7DB 3KZ8A 4LLMA 3B1UA 1XVSA 4RGND 5ECGA 3VXUA 2E74C 3VYOA 4N2KA 1HL5A 4DGYL 1CG9A 1GZHC 2EDTA 2BRRL 4LBEB 3FB5B 3GSNL 4HCRL 3X13A 4GMTH 1BEXA 1P5VB 3LS5L 1RP8A 4O51A 3KCWA 5C09A 5CF3A 1KYDA 4Q14A 3WKYA 1L0YA 2R2HB 5LBSA 4LSQL 1BSIA 1BVNT 1LEGB 2KLTA 4K3DL 3SQBB 1PZ2A 5CKGA 2XVBA 5D7LA 1G1KA 2R1YA 4JRYB 1I1YA 3DUHA 5CCKH 2VR6A 1TZGL 4L8SB 1Y07A 4YDNA 3RWEA 2HMIC 3PWPA 2AAAA 3II2A 3GZOA 2VB5A 2Q3XA 1IL1A 4ONOA 2OSWA 5AWNL 5JIMA 1R75A 4ZUWB 5GGRA 2QVMA 5E2JA 4P57B 5LAPA 2YBGA 4FI6A 5K1VA 1BZ8A 1QTSA 3DVIA 1P7KB 4IEFA 3SDCC 43CAA 4AENA 1FAKT 2YWZA 4X6DF 4O02A 3LN4A 3QDJD 3EOYG 1OW0A 4RAUA 1QRKA 1CDYA 1S8DB 2KQMA 5DJ0B 3WFEL 2X6AA 4BCXA 2Q87A 5HYJE 1ZDSA 1XD0A 4IBZA 2G60L 5D9SB 4ZXBB 4XOCA 2ID5A 3K6FA 1EFXD 3O6FC 2Y1YA 3T8XA 3OTTA 4G2AA 3W1ZA 5CMAA 1LEIA 5C3IA 2D31A 3DLQR 3VRIA 5C2UB 2OMVA 4F7EB 3T3PB 1NCAL 3NACH 3F6IA 4PRPA 4ZI8A 1FYHB 2YUXA 5JHAA 1ZHBB 1EXUA 4JRYE 1U3JA 2PW2A 5KSAD 2EXWD 3LD8B 3PDGA 1BFTA 5CP3H 3HMWH 4W6XB 2PWHA 4DQOL 4MGXA 4N90D 3HVDA 5HYSB 1DQLH 1JVOA 1NL0H 1XSJA 1Z9MA 4UMSA 1R4XA 3U9UA 5BNXD 3ECWA 1IJ9A 3QUKA 3TBWB 3U36B 2IMNA 4JN2A 5BZXA 3H9HB 1SVBA 2YSSB 4TUJB 2MTPA 3BQUA 4FADA 5HI5C 4UDTB 1UA6H 2PP9A 3CV5A 2R1WB 2UZYA 1ZV2A 4TULL 5D4JA 2VMDA 4ANWA 1OAZL 1WA0X 3OXSB 3V0IA 3UYRL 4KJPD 4O9HH 3DDGA 3BUPA 4L3ED 4QXGH 1KTBA 2BZ7A 1BAGA 4NQXA 1NZRA 3S37H 2FRGP 32C2A 1V3KA 1K5NB 3NIGF 5AD0A 3KPPB 4PR5A 1UXMA 1T6VN 3ZDYB 1XB3A 3FO9A 1TITA 5HHOB 1F6FB 3ERXA 4ZUTA 5AVXB 3BPCB 2P5EE 5D1XA 1SDYA 5E6ID 4RMSA 3RGVA 1AHWA 3H53A 3LNDA 1ZIAA 2MCPL 5GGSY 5HHPB 3BJLA 5H37G 4NWTL 4HD5A 1YAIA 1IEBB 4N2GA 3WS6C 4TQEH 4LVNB 4F3FB 5E5RB 5LGJA 4AH2A 1F3JB 5EZLA 1B3IA 1ETA1 3O3AB 4RIRA 1TCRB 3OR7B 4MDJB 2WUCH 1E5YA 4F33B 3FRUA 4KMTH 5F7DA 4JFXA 3BEWA 4NO5A 1GY1A 4AYID 3KH4A 5DQ9A 4AQEA 1KLUA 4OUUA 4GEJA 2DEYX 2FLBT 4B27A 4Z7AA 2XNAA 1AG0A 1A0QL 1CDGA 1WV7T 5HHVH 3LY6A 2IDSA 4Y9CA 4UMGA 2CJUH 4O51B 4QR7A 4JRXD 3UROR 5I75B 3OSKA 2XKNA 1M2VA 3EFFB 1CFSB 4MSWB 2KERA 2NY7H 1KJ2A 2AV7A 1YEFH 2J4WL 3BKYH 2C3WA 3O0RH 3LX9A 4H8HA 2AK4A 1JF6A 4JHBA 4YHLH 3RL2B 5C7XH 3OZKA 1NKGA 4JFPB 2IQ9L 2VR4A 4AQ1B 2VZUA 3T0EB 2OKMA 5EA0H 5FGSA 1VPOH 4XCNB 1AS8A 4JX0A 1NCBL 1FNEB 2HFGH 4V1DA 3EZJB 1QR1B 1RLWA 3ZZSA 4LNRA 3WMSA 3BMVA 3MLTA 1P7KA 4MJIE 3CH1B 3DX6A 1I1AD 3FQ1A 1IGIH 3VRLF 4TUOA 3A3YB 4HAGA 2YRZA 1JNLL 2ZUXA 2VQUA 3KEHA 5GS0C 5HVHC 3UBXA 3HRZA 2GK0A 5J11B 2HA1A 3BKJL 1U0QA 2EE9A 4PGEB 4A7TA 3LZPA 3FH7A 2CIIA 2A77H 4JPSA 4TOYL 1YEDB 1EO8H 5DWUL 1ET8A 4YFEA 1RK1A 2XN0A 3V5HB 4U3CA 4PRPB 3MI6A 4KX8A 3S5LA 3G5XA 1ID2A 4U6HB 4A39A 3EDKA 5I1DA 2XBDA 5IQ7L 5HY9A 5JA8B 1EXUB 1M05B 5H8DA 1IGYA 2BFGA 3D2UD 4YHZH 2BRQA 2J8OA 4QYAA 2ZXAA 4NZRH 4TNEA 1YA5A 4WJ5B 3E1ZA 4OR1A 4FULA 4JDTH 3HG1B 4JJOA 5EN2A 5IB3A 4TM9A 1AQ8A 3SDYL 3HE6A 2RCSL 3BVDB 2CUHA 4QHUB 3KBHE 1G6RL 4IJ3C 3B7YA 1BFOB 3C5ZA 3IDNA 1BREA 2K6ZA 2VJ0A 4MJID 4MX7B 2EIBA 4H2AA 4P5TC 1CD0A 3CVHL 1TETL 5I1EH 1Q0XH 1OAUH 3U4EA 5F3BB 3IU3A 2RQEA 4TSBL 3VXSB 4P0DA 5AW2B 1Q9OA 3DHUA 3TBVB 1MZZA 2ODIA 3WFHA 4WO0A 2J57A 3IJEA 4Z7VB 5J6GA 4ZMQA 4HKZB 3EJYC 1ZSHA 3MRKB 4BQ8A 2V7HB 5KVEL 5IMOA 2FR4B 1BAWA 3BHBB 1EJOL 2D4FA 4L1SA 4FG6C 5FM4A 2X4RB 3QORD 3WDIA 1ROCA 3ZL1A 2M2DA 4CVXB 1G43A 2IH9A 3MREA 2A6KB 4JO3L 1E5AA 3ULUL 1VEPA 3E3QE 3TCTA 1F6LL 1KCKA 2OX5B 2WAHA 4B50A 1MFCH 4M93B 3VX1A 5ESVB 3X12B 1VCAA 4DCQA 1VAHA 2V33A 4J3OD 5L7XH 3QEQD 2F8OA 2XN1A 2A9ML 4JDTL 1Q72L 1XCWA 1UH4A 5DJCA 5C9JB 3MRLB 5DRXA 4QWWD 3VXMB 2YPLE 1VJSA 3GSXB 5CJXC 4YE4L 2PPCA 1T5XB 2AVGA 1C8PA 4DHLA 3ILPA 3LEVL 4WWOA 4Q9RL 4XCEB 5IQ7H 1JK9A 4PJCA 3ARSA 4LHUB 2A9DA 4BEIA 3KNBB 2F7RA 3OC8A 2FWUA 2IADA 1AKJA 1IUZA 2CUAA 4Z7WB 3UMTA 2WGNB 2A77L 4TOYH 3RKDC 4OCRL 4TNWF 1FPTL 2R2BB 3MV11 4LASL 3VFRA 2DI7A 4ELKA 1MCJA 5LXGL 4P2RD 3VWJA 4DP9X 5I0WA 4B9ZA 1H0DA 3NCWA 4LLWB 3VSQA 2JJVA 4PRBB 4WO4D 5HXMA 1HJBC 2J25A 4JLRA 1BYOA 4JFOB 5JXAH 3W2DH 1GC1C 4EEEA 2XZCL 3US9A 4PJIF 4XCNA 5I0DA 4X8XA 1QP1A 1XCXA 1UT2A 2HRGA 3BZEA 3DRTA 2AC0A 1PNDA 4OGAC 4D8PB 2KT6A 2VLKE 1KB5L 1MFDH 5FDWB 3ZHLA 4K8RL 5E2TH 3DX6B 4DP8X 1QBAA 1WF5A 2AJSL 4P23B 1TVHA 3VTTA 3BVWA 3HEIB 2R83A 3R7RA 5J5EA 3ZE0F 2ZD0A 3L17A 1TVBB 5CU9A 2VDOH 4EI5A 3TBTA 15C8H 3GD1C 2Y72A 3EAKA 3VRJB 4FFTA 5CJQL 3W11C 2BSED 4X7SH 4MD4B 3QUXB 5LGHH 1JDCA 1R6VA 4W6YB 5T1KB 2JVUA 3FTZA 4GUOA 4LFHG 5E6RB 3MLYH 4NJ9H 3WHXB 4EQ2A 4KKAD 1IM3D 3KR3H 1NCDH 2HPOA 5F9DC 4XH2A 3VXUE 4B96A 3WNPA 3P73B 1BQUA 2UY7B 5JQHC 5FIEA 5A1AA 1XGPA 1WJ3A 1RUQH 4G9FD 4RGNB 2VT0A 1YN7B 4JM2A 2JXMA 1YUHA 1VZIA 2AEIT 2HFFA 4N87A 3FTXA 2AERT 4JY4B 5IMKB 5I15L 2JKTM 3AU1B 2R4RH 1Y0LB 3BW9A 4QHMB 4PJXA 2ZXDA 1FVEA 5AVVB 4HIJB 5EZPA 4X5LA 3PDDA 4AUUA 1YNTB 3FOMB 3BO8B 3RIAF 4MA7L 3X17A 2HYMA 4CMHC 3MA9H 4NQUA 4A1RA 2A6JA 3ATAA 1Q9WA 3OKLB 5IBUG 1KCSL 4U1SA 2GSIA 5CS7A 3S37L 4S1DC 1RUKL 3NZHH 1UWEH 3IJEB 5D8JL 4EUPG 1QPXA 1MXGA 2JB6B 4IHOB 1IIKA 1ORQA 3RRQA 2EYSB 2FJGA 1SJEA 1PZAA 1EQWA 2FZ3A 1FGNH 1KXTB 2LLNA 2ZSWA 5IMOB 1UM6L 2EVHA 4NRXB 3RFRA 2XQYK 4X5XB 1MJJB 5HYJD 4PG9B 4F7CB 3KGSA 1G5AA 2XA8L 4L8BA 1KIUB 1EUTA 3OD3A 1JHLH 4PJBE 4RWYH 3FHQA 3TESA 3X12A 3FB7A 2WLLB 2BSSB 4M1DL 3UYPA 4EPSA 4PVBA 1MCKA 3LKRB 2Q2LA 4Q6IB 5A3ID 5C9JA 1V7ML 4DGIH 4N0FB 4EZLA 5FHAH 4KUZL 2IAND 1T5XA 3NCBB 5F88B 4M62H 2BZCA 1A3LH 3LXUX 2EDFA 4MB1A 2VH5H 2TRYA 3EYVA 3O41B 3QORB 1HNGA 1KB9K 1OARH 4RSYA 3WE6A 3DV4B 2WKLA 1F58H 2QGBA 3BRGC 5FO8B 1GSKA 2R23B 4JZNB 1WRFA 1OALA 4FZ8H 2OMZA 3L5JA 1AKJB 4J3OF 4NSKB 4XBGA 2UX7A 2GITB 4KITB 2BY2A 2VLRD 3K5RA 3N40P 4XE0A 4Z7UE 1G7QA 4P04A 1CF8L 3VI3F 5TGBB 4MAZA 3ZQXA 1BBJB 1AIFA 3PFUA 4GAYA 5F3FA 3TT1H 4ES8A 3VWJB 2ITCA 3OGCB 5AOKA 4XGZA 1KXVC 2V5RA 1QQDA 3HC2A 1IU1A 2GJ6B 2CQVA 1U8LA 4X4KA 4N0YL 4Q52A 4NM4H 4CA4A 3US0A 3TEZA 1UXSA 4PRHE 2VNCA 3B9AA 3TEXA 4WV1C 5FA3A 2GBTA 4FFVC 3KPRD 4OF6A 4LEEA 2J1WA 3ARBB 1N26A 4BDVA 2P3YA 1JN6A 1SY6L 3QDGD 4TXVB 1GIGH 5EIQA 1WFOA 8PAZA 1P6WA 4O02B 3IDXL 3JUYA 5KANI 5F7YC 4K3DH 5IMLA 4HP5A 3H55A 1S8DA 4ZSOE 3F7YA 1THAA 1TQWA 2FWSA 3C6LB 3CX5K 3IGAA 4YGAB 5EZJA 2FUQA 2OJ1A 3ZHDA 1OM9A 2BCMA 4ZMOA 1A4JB 5D7SL 4MD4A 2K8QA 4X8GA 2ATKA 4EDXA 3B5TA 4TUUA 4EKJA 5F9OL 3QZOA 1YMHA 1U8HA 5IHZA 4MAYC 1MKFA 1ZVNA 3KGRA 4PGJA 1KBPA 5C0CA 4ZRGA 4EBQH 3ARPA 2WNWA 4JHWH 4B95C 3OG4B 1ES0A 2AABL 1RJLB 2D7PA 1DVFD 2VSDA 1E6OH 1FNAA 3VMPA 3X1EA 3QG6B 4V1DD 3QT2A 1N0XL 4XVUC 4JO8A 4OVUA 2GCYB 4QDGA 4X6FB 2HFFB 3LRHA 1PZUB 2KDYA 1NM9A 4BJLA 2BHFA 4GAGL 1VF5C 4RFNC 1FVEB 1P9MA 2H26A 1DFBL 2BY1A 4DGWC 2UVFA 3HI5L 3FOMA 3FN9A 4R84A 4BSWA 4ZX6A 2R1XA 1U8NB 2F53D 3BPOC 3MRJB 1G7HA 3VVVA 3X3FH 1JZDC 3IJHB 1TENA 4J6RL 4MNGE 4NQXB 3WTTA 1OGAE 2CUMA 5GGQH 2H32B 4JDVB 1TJHH 3H7BA 2CLVA 2N59A 1MI5A 4HJSA 2Q8BL 3LMJL 1E27B 4O2CB 3ZE0B 3KVPA 3Q1EA 1AOHA 5LBGA 5G55A 2VAAA 5BZDA 4GKSA 3LB6D 4ZMVA 2VR7A 2HG0A 3L3GB 4KHTH 2Y7MA 1DJGA 4OLXL 3D25A 5AYTA 1BPLB 2EDEA 3F7QA 4JJ5A 4WU5B 2YFOA 3H3PL 2GC7C 2OYMA 4HC1L 2X89A 1NINA 1U58A 2V0AA 4Z9KB 3LRLA 3QEGL 2DWEA 2WXRA 5F9WC 2H45A 5IVZB 4IDJH 3LKRA 5I6LA 1WIOA 4J3TA 1AGFA 5D1XD 2OCJA 4M6NL 4W9FC 1V10A 2G5BB 4TVPH 3DARA 2VMEA 4Y2DD 3O3AA 4RIRB 2QHRH 3BFQG 2G0KA 2H0JA 2R56H 4K5PA 4JFXB 4PVNA 4YX2L 3K91A 2ESVE 3VI4E 1WWBX 2C5DC 4NPJA 4OUUB 1KY6A 3PWLB 1DBBL 3TN0B 3CN0A 2LU7A 1T80A 1ZV9A 4HALA 1CGSL 4AYMC 3I02A 3NIGB 3GT6A 1OQOA 2PXYB 2YLHA 4JDEB 4UT7L 4N0CC 3R1GH 2BSTA 2NY5H 2H0PA 3ZDYF 1QQDB 3MRQB 4MWFA 1SY6H 4JPIB 4FA6A 4MCZB 1WE5A 4D9QE 4E41E 1SRDA 1P9MC 3ZE1F 4WO4C 1OB1A 3HFML 5EOTB 4NN5C 1EEQA 3BWAB 1QSFD 4OGYL 5K9KA 3OAZH 4N0YH 1QR1A 3EFOB 4HWNA 4FG2A 4K8RC 2DB8A 2Y7NA 5BVJA 2F53E 4AIZB 3WO4B 2XZQH 1XT5A 3SDAC 3E2HC 3BDYL 1SJHB 3PUCA 4BFBD 1BX2A 3OJDB 5KSAB 1E40A 3N06B 5I6NA 1HAWA 3V0HA 5DDHB 2DWDA 2P5PA 4JZOB 1TEGA 4AZUA 2NQCA 1JMZA 5C8JB 3V0FA 5AENA 2QPUA 1BXUA 3BESR 2EILB 1YEEH 3W11D 3KYMA 5FUCC 1HHKB 3QUML 4MJ5B 4NI3A 5LBSH 4E36A 2X7LA 2XI9A 3WHE0 1P7QD 3QJSB 3RHWK 4BZ2A 3DKHA 3N41B 3NQIA 3QRGL 2YA2A 5L2KE 4TVPE 4L29B 1GTNA 3CIAA 4TNVK 5MEND 3WS3A 3AS1A 1NFIA 4UB0L 3V4VA 4NHUA 3U7YH 1HEJC 5DHYB 4AGOA 2ZWSA 3GRWL 4ZX3A 5KW9L 3WD5L 3BGFC 3IDMA 4GI6A 1K5WA 4JW3A 1F97A 4FXKB 2F53B 4WEBH 3SYQA 1JK8A 2BDNH 1AYRA 1I75A 3LJ3A 4OZHF 1OP5H 1VKXA 1E42A 3OKOA 4N5UA 3DNKA 4QO1A 2E0PA 5D5MA 1ZLDA 2C4XA 2E7LC 3GLAA 4R4ND 3AXLB 1NGZA 1U8NA 2CO2A 2WLKA 1FA4A 5F3HB 4A2LA 1BQSA 4I4WB 4WTZG 1RZ8B 1T1ZA 2MMXA 2F8IA 3MV8A 3OJ2C 3VWJC 1BQLH 1GA2A 1XAUA 1U8IA 2GG1A 3NOIA 2YXFA 2PPEA 2B8OT 3OVUB 1CDCA 1UUNA 1ZANL 3P54A 2LU4A 4FTVD 4AT6A 4HOWA 3MRGB 1WUNT 1P1VA 5DK0A 5GS2D 4L8CB 3IFLH 4GMSH 4GXVH 3DHPA 3ABMB 5EIIB 7PAZA 1WC7B 2QFPA 1HCZA 4LKXB 4RETB 2Q7YB 5EF2A 3O6FA 2E27L 2G2RA 1SXSA 5HJBA 1XBRA 3EDEA 3H85A 4B53A 2E8YA 3DIFA 1DLFH 3CDZA 4HXBL 1F8TH 3SGDI 4WEUD 1RZJL 1UOLA 4PS7A 3WNIA 4AC4A 1AGFB 5IMMA 4GW5B 5MEOB 1NCDL 3FW6A 5CM1A 2PKDA 1SLVA 5ETUA 4K7FB 1EJ6A 5D6CB 1G7MA 2CHZA 2COVD 4YXLL 3IMWA 5C0BD 1QFWH 1MCPL 1A6AB 2DQJH 2YKKA 3K2IA 3M8OL 3UZEA 1WZLA 4ETYA 3QVAA 4IRJA 2XWJB 2VM4A 3UTTB 3IS1X 4C47A 5CGYC 3QNFA 4P8QA 1NGPH 1L6ZA 1NMCB 3MV7B 5KAQG 3QC5X 2OJEB 4LOUC 4A6YH 2ENQA 2GQHA 4WSJA 3TYGH 2A83B 1V54B 3AWEA 3PWVA 4RBPH 5ESAA 3EF7A 5E2TL 4K8RH 4DUXA 1T0MA 3GYRA 2OSLB 1F4YH 5EU6D 4JFOA 5LHDA 2X4OA 4RMRA 3C8HA 1OKEA 5SX5H 3GIVB 5C0BA 3QUYA 1D5MA 3DMMB 3L3OB 3CZKA 3TT3H 3LKOA 4A67A 1N7ML 1M7DA 3LRKA 3CVDA 4XPGH 3EFOA 3S3CB 5JXAL 3CN1A 4UQIM 5CR1A 5FDWA 4AY0A 5DSCB 4WWPA 3PV7A 4GG6F 3JT0A 1KIRA 4S1SH 5CSBA 5CN3A 1JZ8A 3AG4B 4CMMB 5LXGH 1RURL 4KRPC 1LP9B 4K7PX 4PWGA 1OHZA 1FPTH 5C0ND 4L3EE 1ZHKB 1N0LB 3GMLB 2C3XA 3L5IA 4LF3B 3ZDXB 3RGHA 4JFSA 4S1QH 2VTFA 4XX5A 2VDKL 5GZOA 2CO7B 1YEWA 2EDYA 3L4XA 4FJYA 5HHNA 1YECH 3LZQA 3PNWA 3NSJA 2NR6A 3RAJH 3RAJL 1P1ZA 1H6TA 2C1OB 2HKFL 4JUSA 3RNQA 1N6UA 1KPRA 4EI5D 1MCLA 3GXTA 5ID1A 2VDKH 4AK2A 5F70A 1UT9A 3L3HA 1KJ2H 5F7NC 1P4UA 5D7JD 3ARDC 1M2OA 4BUGA 4HFWB 4S10A 4JB9H 3MLRL 4EZKA 3MRMA 3PV6A 4ODWB 4DKFH 4XN2A 3KPLB 1Q72H 1TZHA 3D39A 3NPSB 4QOKE 2E6QA 4XXCA 2EE2A 5J3HD 3LEYH 3Q6GL 3ZY7A 2Y25A 3T0EC 4DP0X 1FG2B 3KDMA 3HBPA 3ULUH 5B1CA 4Z78A 3U4BL 4F7TB 1N7MH 3IWUA 3TGXA 4ZUUB 3TT3L 2VXSH 5E6IC 1JCVA 5DTFB 2ZAGA 1W72L 2ETWA 3GSVB 3RX8A 3X3GH 2CDFA 1F4YL 1S7UA 3TNMA 2IFFL 4ZG1A 2JJTC 3O9WA 5DHVB 3S35X 2HLAA 2E75C 3HG5A 1Q1PA 4OTXH 3TO4A 1YEHL 3VCLB 2VLKD 4XP4H 3TIDA 1KTLA 1LK2B 4KO5A 4DK3A 2W88A 2AV1A 2W07B 2CLRB 4OKVA 4QXWA 2MNUA 1OXYA 3WE1A 5JW5B 5F7EL 4WFED 2ALWA 4UQ2B 3SDXE 4ZUVB 3S88H 3K71A 4YFLF 3G6DH 1UKSA 1S7XB 3D12B 3MJWA 4RFOL 4HPOL 1A1MA 2OK0H 5D71L 1KG0A 2R69L 3M8OH 4PGZA 5KYNA 2DQJL 4APQA 2QR0A 4HKJA 4IGBB 3VO0A 1KMGA 1L7IL 3FTGB 5IQOA 3HPLA 2EE0A 4MRBA 2AS5M 3TFKD 3IDIB 3PAYA 4PTUA 4YDLC 1RU9H 3FQWB 4UI2A 5CCHE 2WQ8A 4HUMB 3I6LD 3FYEB 1UCTA 4N0FA 2E7BA 1OT1A 4YHZL 2H3NA 2IANE 1NM4A 3HR5B 3MVSA 2LW3A 1NCGA 4OIAA 3HBQA 1U8KA 5ITFB 1S3RA 4M6ML 3O41A 3QORA 1NCNA 3IFLL 3P4OB 4I13B 5CHNA 3DV4A 3VD0A 3UTTA 3VXOB 1U3HA 2NX5D 2IANA 1AGBA 1ZANH 4DPRA 3MPCA 1CR9H 2A6IA 4GH7B 4OLZH 3V0DA 5C0DB 3MV7A 2GEEA 4L3CB 1W8NA 3BWZA 4OLUH 1JGDA 3QEQB 4DUVA 2DQEL 4KV5E 3WGVB 4JM4L 3CFBA 4P5KA 2ADFL 5FAAA 2APFA 3M1OA 3U4KA 2V7NA 3JVFC 3BUYB 1FNSH 4MFHA 3WTXA 4IYKA 2Z7ZA 4OLYL 4X7TB 1IB5A 3LXCA 3IFPA 1NJ9B 4PJAE 2BDNL 1AIZA 4FQQA 3HE6D 1T7ZA 4NJAH 4NAMA 4Y2LA 2DTMH 3GXPA 5KW9H 5CLTA 1E5UI 1X5YA 4JPKH 5GIRA 1A7NL 1YY8B 2B9BA 3GKWL 3O0RL 4YHLL 2X40A 4YNYB 2O93L 3BSHA 1IJNA 2FSEA 2NY0B 3HMXL 2XU9A 5DJ8B 1UHVA 4GINA 3FQTA 4OW6A 5EULV 3VM5A 5JPMB 4BFJA 3VFPB 3EO0B 5KOMC 4GG6A 5F97E 2NNXA 4PIBA 3ZIMA 5ISZD 4JKPL 4RESB 2A4CA 2DQCH 5K9JL 3OX8A 2VDOB 2FLMA 2ITFA 2F19L 4TSCL 1EGJL 2SODB 1P1ZB 3CU1A 3KPMB 3RNQB 3SGKC 4PWEA 3STBA 1DSYA 2G4GA 2Z65C 1AE6L 4I2XA 5K1NA 1ODUA 4U31A 1AQKH 3IJ7A 4YVUA 1MNUL 2B3IA 4HUXB 4WI4A 4K9EL 4RGOL 3G3LA 3RE0A 3W0WA 1R5WB 3IGKA 4QRSA 4HK0A 5T1KD 4PI0A 2AJZB 1HSAB 3T4YA 1QEWA 2WHVA 1ILSA 2DIBA 5TDPA 2W8CA 5EUKA 4D0CB 1X5AA 1IQWL 3AMLA 5DJZB 3WIHL 1B0WA 1MJUL 1UD4A 1Y1DA 1K8DA 3MODL 1U42A 3B7SA 4DPBX 5CINH 5B39G 3L4WA 5KS9F 3OXRA 3LZNA 4E5XA 3T4AB 3SKUD 2NY1C 3FO1A 5F6IC 1Q4NX 2I25N 4R0LA 4F7PA 3HI6L 1FCGA 4PGBA 5GRJL 3VU2A 1N3NA 1OAZH 3W56A 2V2TB 2AV1B 3JBG7 2CLVB 2WJ7A 4TULH 4UQ2A 3M45A 2ZXCA 3DXAD 1KTDA 3DK2A 3B3IA 5IW1A 2WLMA 5J6SA 1U36A 3UIYA 4LP4A 5BOZG 3OLIA 4UT6H 2R56L 5IB2A 5C0FB 1K4CA 3GRWA 5EO0A 2OXGB 5GRUL 2ILLA 1R3JA 2IALB 1DR9A 1RJYB 1RFDL 2BSRB 1HQRB 3GDBA 4LBAA 2WO3B 1EFXA 4DQOH 5CUSL 4IDJL 3DI2B 1BZEA 4N2EA 4JKMA 1F00I 2X1PA 3T77A 3LV3B 4S1RL 3NGBC 4JZJB 3FCSB 3LKPB 2ATPA 2QELA 1HZHH 4LVHB 5I76B 1Y1UA 3NIGE 3QWNA 3WNJA 3QQ3B 2VDQL 1YDPB 1KENL 3BISA 1E0OB 1AZRA 3X1FA 3VXRB 4JM2C 2D0HA 2DLHA 4YE0A 4YHYB 4AUYA 2XUWA 3N1MC 5IROA 3FULA 1AGCB 2AQNA 4AX3A 1IC7L 3D05A 3QEQA 5IR1A 3LPWA 3QNYA 4G8EA 3PGDB 4X99B 1DN0A 5E9AA 5TDNA 1AJ7L 2OMTB 3MRFB 4LVHC 2IWFA 4QCIA 5IUCA 4Z7NB 3HI5H 1SYVA 3CZFA 4PFEA 5AB1A 1DFBH 5I1GL 1XCTA 4QHNA 3H8NA 1XGZA 5JQIB 2EINB 3VGGA 4NQED 2BW5A 1BEYH 4UDUA 1O5DT 2D9QB 4IMKA 1RZ7H 3POHA 4CJ1A 3SDAB 2D0GA 1HHGA 3WIFA 1D2PA 1YY8A 3P2DA 4WFFD 3DX7A 5GGSB 4B9JA 4JFDA 3UTSE 3MO1B 3KVDD 1UWXK 2DWDB 4HCRH 3ULVL 3LDBB 2F7QA 3UGUA 3BLPX 5C8JA 3C5ZD 2KKQA 3NFPB 4YLQT 2IAMD 5C09E 4YQXL 3O3BA 3T0VA 2ZP0T 4GT0A 5E7FA 3QUGA 3BSZA 4NQDE 2OA9A 2PR4L 3HG1D 4Y2DA 4PJBF 3W57A 4CU8A 2X7LB 3WAKA 1QFWM 1UEYA 2GAZA 2IIJA 3L08A 2VR5A 3EYUL 5GRYA 2FJFB 3P4MB 4PJ7B 2RB8A 3RWCB 4O2EA 1PDKA 1B4JH 1GIGL 4EDWL 1T83A 3TEUA 1GS8A 1KTRL 2O5YH 1JZJA 1EJ8A 4HKBA 5DZAA 4ZS6D 3VW3H 2PCXA 4MQTB 1JFHA 2VZ1A 5CJ8A 2J1KA 1JWUB 5EUKB 4D0CA 4FMFA 4ODHL 1F45A 5DS1A 4EN2A 1EEZA 3LPGA 3QFJD 2YC1A 4UV4H 5IOPB 1I3UA 2Z7UA 4YGVB 2EYTB 3CD4A 1VKXB 1WGOA 3ZTJG 4ABVA 4N24A 3C6EA 4PLNC 4XNBA 1IM9D 4V2CB 4GUCA 4RGNE 4NLHA 1XF3A 4N0UB 4YHPA 3FOLA 1KGWA 1PW3A 2JKRM 5IK3A 3ME0B 3NJMA 4R0LB 4AI7A 4YSSA 5C0JB 4ODTL 4FQCH 5IBTH 5K9QI 5FKAB 2XBTA 4W9CC 5HDLA 2AZUA 1N59B 2FL5A 3T09A 2YKLH 3CXHK 1J12A 2A6DA 4X9FA 4KK9D 5KTEH 4G43A 4F15C 2F7PA 1RPKA 3H54A 2Y1AA 1F58L 1OGTB 4JRXE 1IBGL 4DAGL 2IWEA 4Z7OE 1I8MA 1IGJB 1I1CA 1TOXA 1K4CB 4F58L 4M62L 2EICA 4WFHE 4LKXA 5T33L 1DJZA 3D52A 4GJTB 5HJ3A 3ZUCA 3AACA 1FYTE 3IPFA 3NN8B 1FHNA 1EFXB 1I1RA 4TLKA 2XV6B 2I60H 1YEJH 4IU2A 5FO7B 3SY0B 1FO0B 2VJ8A 3T77B 5D6CA 1GW0A 2FQEA 5AOMA 4RWYL 5M94B 2N1TE 4PD4J 5HI4C 1NIFA 2XN9B 2CO6B 1NKOA 4XT1C 1HIML 2J6WA 4PJ5E 3RU8L 2XA8H 2RACA 2HLFC 3PU7A 4FKEA 1RK0B 3ESPA 3VGAB 2H2SC 1N70A 1UJ3C 5E9DA 5LXVA 1EMTH 4I3RL 4NO3B 3U7WH 1A6ZA 3TV3H 3VFUA 5KSUB 3GMNB 4UV7L 2AJ3A 3OKKB 3L3IA 3NP4A 4HEPG 5T3ZH 4G8EB 2Z0BA 3G5VA 3TXAA 4MMZC 1HKLL 3MFGB 2XYCA 3RVVC 4QCIB 2YN5A 1OCWH 1AKJD 3JWOH 4MA7H 2OSLA 2Y2TA 4LEXL 4B6ZA 4OGXL 3QYNA 3BAJA 3GHEH 5HI5D 4QHNB 3IKCB 1IM9A 4JQXA 3EFDH 3QUYB 2H1LM 5I16B 3CDFA 5E08L 4LOUD 4NP4L 4W9KC 25C8H 1M7DB 3GJEA 3JXAA 1OB0A 1QSFB 3L13A 4AG4H 4LHJB 4CVZA 1RUQL 3QFGA 2UZIL 4NQTA 2FWLB 2XTJE 2JKLA 2R29H 3MGOA 1ZHNB 4M43H 1MREH 3TJHD 4NJ9L 1O7DE 3JVGC 5BQ7A 4UQ9A 3OAYH 4KX9A 1NCJA 3NFPA 5I71C 3T6VA 3DXAA 12E8H 2A3TA 2O6FA 1BM3L 2V9QA 4Z3GA 4X7SL 4YDMA 1XAKA 4XP5H 3AB0C 4TPRH 4FXGB 1UFUA 2AEQL 2AHIA 4C8XA 3MOAH 4TV3A 4NZDA 1GH7A 3WAJA 1SUJA 3RA7L 4PBVC 5D1QB 5TF1L 3NTCH 4NIYE 2AI0L 2P9RA 4ZFFA 1K3IA 3D2TA 1RK7A 3M17B 3C09C 2AJSH 3J7HA 4YDJB 1MRCH 2A4EA 4KXCA 4OLEA 3WFZA 1LM8V 4XPTH 3MBXH 4A7GF 3MSPA 5EOCH 4FHBD 1WGVA 5C86A 5I8CA 4W9DC 5JUEL 5A2BA 1CGTA 4HCFA 1EEZB 4N0UE 2Y3AA 4HZAA 4JL2A 1NSNL 4Q74A 4Z7NF 4Y1AD 1AXSA 2HMID 1JMXA 4ZOEA 2K7QA 1H6UA 4HUKB 1AHMA 3GXFA 3NCCB 2ZWKA 2OR8A 3OC5A 1D6EA 4F9PA 5I6XC 5KSBE 3BRDA 3H1ZA 3MLVL 1NEZG 1ZMYA 1LK2A 1SM3H 1LEGA 3ESNA 4ANUA 1BYNA 3RPIB 1C1EL 2WVTA 5JW5A 5GJSH 1NLBH 4OCRH 5ESQA 1CL7L 2W65B 2C4FU 1UZGA 1S7XA 3ETBJ 1FSKC 3UCRA 4E42A 4WI5A 1DL7H 2VDNL 4EIZC 4NC1E 5CCJA 4K3GA 4FKKA 3K5SA 4PWFA 5E0FA 3U46B 2JH2A 1LO2H 3G5ZB 3FUDA 2EH7L 3QS3A 1OSZB 4NZTH 1AGEB 3V9CA 4AENB 3EZ8A 3K8KA 3ZVVA 1ITCA 1XGYH 3DUUA 1BD2E 2WQWA 2BW4A 3NAAH 4RAUB 1L9TA 4JFFE 4KKAC 5FS5A 1Z3GH 5I8KH 2XTJC 3QQXA 2D3JA 4J7RA 1XR8B 5CWSA 3U48A 4ZMTA 3H9YA 2JELH 3ARQA 4DGVH 1OAYH 2V17H 2W95A 4G9DB 5SV4A 1I7UB 5AVWB 3HHRB 3HCVA 1EDYA 4XP1L 1IO4C 1KGCD 4ZFGH 5DUML 2ZOKA 3GK8L 2R27A 1U3HB 1MCRA 2EDBA 1WISA 1FZKB 3J07A 2F61A 5C0DA 4L3CA 2WZ0A 3GXIA 2PW2B 3MAWA 4XN7A 3L3IB 1SOQA 4EZMA 4IKNA 3ASOB 4U1LB 2MCAA 3GEFA 4DF9A 5D1QD 4WJG3 5SX4I 4FXTA 2VDPB 4WUUE 1QUNA 4JY5H 4AEIL 3ZW3A 4KDTC 2DM4A 1OPOA 3U30C 1OAUL 4OZGB 3BWUC 2Z93A 1DBMH 3S4SG 2GHWB 3AAZA 5L4FA 4JN2B 5H37A 3ULVF 5I82A 3C9NB 5ERWB 3MUGA 4UDTA 1QSFA 4B0MB 3OHMB 5HGHA 2B9AA 1OAQL 2W0PA 4QRTA 1NDMB 2ZX7A 3IMVA 1A25A 4GXUM 2EIZB 4GRWB 3ZSSA 5B3JE 1A5FL 1A6PA 2AP2A 4NENB 1BZOA 2F0CA 5BRPA 1K5NA 4KAQH 2XQYA 3W0WD 5TE7H 3H56A 2X4QA 3I6GB 3GF8A 3Q8EA 1B4LA 4U4IA 1OSPH 3O3EA 3L5WA 4HZLA 2IG2H 1RV6X 1I53A 4JMNA 4PR5B 4UINH 3GJFA 2VZVA 1WZKA 3BPCA 2IAMC 5BRQA 1JUFA 4HUVB 4N6QA 1OD7A 3O11A 4FI7A 1NANH 2L7EA 4LCIL 2B39A 4M00A 1TZIB 3RGVB 1AHWB 1MVUA 3QJTB 4JVUA 4OF0A 3K3QA 7FABL 3NJFA 1GPOH 1RUAL 2X87A 5E8NB 1ZAGA 4JANB 2DYPA 4PBXA 2C34A 3FUEA 1CPUA 3MV01 3BEVB 4EF3A 5DT1H 3DJZA 5EORL 2K8MA 35C8H 4U6YB 2FLRT 2R69A 2QHLA 4F33A 3U30B 1I82A 4N8VG 5I8CB 4DN4L 3GPEA 1CICA 1K8DB 1Q38A 1VPOL 1M7IB 5HHMD 4LPCA 4TTDC 4PJEF 3ZYJA 1CLVA 1L6XA 3F12B 3B9KD 3P30L 4I3SL 5C7XL 5C3LD 1JI2A 1G87A 1VGEH 3QCTH 3FBQA 3T4AA 5J1AB 1YEFL 2J4WH 3BKYL 1CFSA 5J12C 3GBMH 5FKPB 3UAJA 2DM2A 1T0OA 1N3NB 2FYYA 1ZE3H 3CFIC 3QEUA 3MNZA 3AY2A 3D3VA 1PZCA 3O6ML 4HDIA 4JO2H 3ULUD 1A0QH 1X44A 3SDCA 3F8UB 1IC4L 4E42B 3TWCL 1T89C 3P0VL 4G8FA 3L6FB 5ANHA 1WBZA 2Q3ZA 4PJ9B 1ET7A 3LN5A 4FQ2H 4Y4KC 2VAJA 3MRPA 2CXGA 3V6OE 1AGEA 4MA8H 3S3SA 1FNGB 2X6BA 4F27A 1HQRA 3HUJE 3BQVA 2X4PB 2X09A 5IB1A 4FG0A 2Q8AL 3ZR6A 2WN3A 4IRZH 5I6OA 2A5UA 1U8QA 2IOIA 3G04B 5E8DL 4EXPX 1XR8A 4Q58C 3HS0A 1AZUA 1PAZA 1NBVL 4R4FH 3MRHA 1WFUA 3HCVB 4NQSA 4I1NB 5B22A 4ODXB 5DD1L 1SOXA 3GXNA 3SPVA 1QYGL 3FU6A 1RK1B 3V5HA 3RB5A 3RZWA 3DGDA 1E4HA 1BVOA 1S9VB 5CFHA 5HY9B 4OCSL 1SVZA 1X5HA 1DQMH 4GY4A 4EZJA 2CDEA 1XGRA 2DMHA 5E4OA 1ND0A 4PJFF 4AC2A 5JIDA 3UYRH 3S2AA 4DN3L 3WI9A 3K4AA 3BGAA 3HG1A 5EN2B 4MCYB 1U3NA 3FRPG 5LVEA 5ICXA 3WNNA 3U0WH 1W0YT 4PY8J 4OZIA 1GSMA 4M4RB 4X50A 3T65A 4MMXC 5I18L 5I1CL 2XIIA 3NZUA 2OSXA 3C5ZB 3IDNB 1LO5A 2BFVL 5FGCE 1XL4A 1RLBA 2PW1B 2PP7A 3HG1E 3KPSA 3GXDA 4U7SA 4DTGL 3BZ5A 2VR3A 3BN9C 1WBYB 2MKLC 2NXYB 2WXJA 2F58H 4U6VL 3UC0L 1INDH 2H6UA 1DQLL 1NL0L 1REIA 4P06A 4G3YH 4IBVA 5ICYA 4Z7UF 1XF2A 1KEML 4O58L 5FYJL 4DW2H 3SOBH 2DW5A 3LZFH 4NPKA 3IDUA 2XHNA 2DQHL 3QPXL 2YPVH 4P59L 4QXTB 2MSPA 2N0KA 3NCXA 1FNHA 1TQVA 4YBLB 1B3JA 2BP3A 4IRZA 4GSXA 2UXTA 3D39E 4R2GC 1JRHH 1S2EA 5MP6H 4UIKH 4OT1H 3IMUA 4Y2DB 2N7AA 1VHPA 1WBXA 1KB5A 2GSGB 4FFZA 3MJ9A 4R7VA 4XCYA 3P4LA 5JIPA 4OZGE 3PJSA 5A3IC 4XO4A 2NNAA 3VXSD 2R0ZH 3CQPA 3TL5A 3DUSB 1DE4A 4PRHA 4F8LA 4PV8A 5HHQB 3N04A 3GRGA 3HE7D 1JXGA 2VDQB 2VXUH 3VXNA 3PRZA 5E8EB 4FLHA 3QWRD 1HEZB 4X5PA 5K1JA 4OI7A 3RVXC 2RIKA 4OV5B 1QMUA 4KROB 4HXAH 5ECJE 3EYOB 4QRQB 1OCCB 5JYMA 5TK4A 1TZGH 4LBEA 4FA8A 3FB5A 5EF3A 4G6JH 1JGUH 3VFRB 4AM0A 2ISDA 2W9DH 4I0KA 1Y6KR 2Y7QA 3E3QC 2BERA 2XX1A 5IK3B 1O6VA 1MHEB 4NAJA 3AREB 4GMTL 3FT2B 3CXDL 4BK5C 1N59A 2FL5B 3QDMD 2HLFD 1CBJA 1BAFL 4GAJH 5T1JA 4GRWH 2NLJA 1CYWA 2CG9X 4PJBB 1HYRC 3FUNA 5EF1A 4PJ9C 1U92B 2QSTA 2WCPA 1PL3A 5IJDC 4IOIA 5HGAA 1U93B 3GWJA 1EEUA 1I7TA 1IGJA 4XAWL 3D33A 4F8NA 2MKWA 4FFYA 2ZX5A 3LN5B 1SHMA 4ZFOA 4WW2F 1UJ3B 2W59A 3VGAC 1UACL 1O7DC 4U1IB 4DEWA 5HHME 1WFTA 3U0PA 1KSRA 3NN8A 2XG4B 1MCDA 4ALAL 1U8QB 3G04A 1BF5A 3ABKB 5KVGL 2BK8A 3TO4C 4YSTA 2Z31B 2CALA 1BZQK 2WVSA 4RISL 2VDMH 2AJUL 1OSEA 3TBTB 4N22A 2CO6A 2HLEB 3BDXA 3SPVB 5I1IH 1OGAA 4Y7OC 1RK0A 3C5SA 4HJ0C 4GRLD 3PGCA 5LCVL 3UZVB 2J2ZB 3VFUB 3GS0A 2EEAA 2E9IA 4WLCA 4DP7X 4AQ8A 1XGRB 4JN1L 5BUGA 2H2PC 5EBWB 5ALBH 3G5VB 1OAXL 4OZHE 2B4CL 4XVUD 4N6RA 4ZXBD 4M7LT 5MHSD 2F54E 5C97A 4B9IA 5E9NA 1P4IH 1XX9C 1QSEE 3OF6A 4ALAC 1RZGA 1XMEB 1J0ZA 5MENE 2YUZA 3IXAA 4R0LC 3QZWB 4BFIB 1AR2A 4HG4J 3EBHA 4GP4B 4OM1L 2HX7A 3FRPB 3HE7A 4ONHA 3MNVB 1ZGLA 2WWMD 2PF6A 3V2AR 2YZ8A 3S36X 3HAEA 5G5DA 3O4LA 1AANA 4OFYA 4U1SB 2GSIB 5HHOE 3PGFH 3EYFA 3KPQA 4PJGB 4A2MA 4XVOA 1AR1C 4PD4K 32C2B 5A2FA 2Y36L 4AGLA 2Q2EB 2J73A 4ZK8A 1LJMA 4ODSL 1NGYB 3KPPA 1OVZA 3EGSA 1RL1A 4XTRC 2WTPA 5LUMA 4WI9A 4FQLL 5F0MB 5FGRA 1KLFA 3FO9B 5HHOA 4ZUTB 3AU0A 2WNGA 1T66C 2VGLM 2GSGA 4LSSL 4Y19E 5CJOL 1K85A 5D1XB 3MDJA 5JO5B 5MEQB 4Y1AA 5L4MA 5DVLA 2W0FB 4S11A 4GB9A 2NNAB 1DBAL 1G4RA 1QKZH 4R26L 4PJDA 3SDCD 4PV8B 2VL5A 4R4NC 1D2OA 1NUFA 1HEHC 4F3FA 1FAIL 3L9RA 1NGWA 3KHOA 1MWAA 3CFEB 1TCRA 3RTLA 1H9DA 1CTOA 4NKMB 3TBSA 4F5CA 4H8UA 1K3ZA 2O5XH 2KC0A 1ECYA 4KJWC 4NO0B 3NJNA 4QJ3B 4OV5A 3N1PC 4JY6A 4P99A 3NSDA 1FIEA 1CLZL 2NZ9C 3EYOA 1HOCA 4NSKA 4OFPA 1S7QA 1QBLH 1WFJA 2Y6SD 3QB7C 4UTCA 1GR7A 5AG8A 4HCRA 3A5VA 5I0YA 3BSGA 2Q1EA 1EVUA 1WPCA 3RTQC 4GAYB 4YEEA 5JW4R 2IXQB 3B5GA 1D9KA 5F1OB 3A6OA 1KCLA 3VH8B 2DLFL 3ALXA 4JNXA 2EXYC 3FB8A 5AKRA 2CKBL 4LSUL 5AKTA 4ZFOL 2EXSA 3ULVD 4U0RB 2EC8A 4DKEH 4FQLH 2A74B 1PZDA 2X4UA 3RIFK 5T3XE 2H9GB 3HTLX 3DSFL 1AR1B 2YAEA 4JREC 1FV1A 2XG4A 4L5FH 5I19L 4H26A 5I24A 2ERJC 1RUPL 3PWUB 4K23L 3UXFA 1R17A 4ZO9A 2MNWA 1E4JA 4ELMA 3QFJE 3IGAB 5EZJB 4PGEA 1EERB 3LOWA 3VXSE 4G9DA 2QQLL 4JFUA 4R2GB 4OFIA 4EUPB 1MSPA 4WSGA 1IILE 4IU3A 5JHLL 5HDRA 1B0GB 1NBQA 4X6CE 4XMTA 5BZWA 2GK2A 3B7TA 3SJVD 5BS0D 1OWRM 3KWVA 1EHLL 1PQZB 2VDLB 4QGYA 4Y5YC 2G3ZA 4G6FB 4ZD3H 1QUNB 2AZAA 3N42B 5C0IB 4V1DE 4JN1H 2QVKA 5HHMB 1S78D 1CUOA 4B41A 1IGFH 1V5JA 1Z9LA 2VDKB 2VLKB 1UA3A 3P9MA 4M5ZH 4UZGA 4XNUH 4H0IA 3F6JA 2J6EH 1EAOA 2UVEA 2Y7OA 4X0KB 2Y6TE 1JXJA 2AJYL 4G8GD 4X6BB 4RQQB 3G5WA 1M3JA 3R18A 4WCYL 3BFOA 3O2DA 3PHQB 4RDQG 3QHTC 3QIBD 1CF1A 4QRTB 4TL4A 5CR8A 4UQCA 2J56A 1MVYA 4YK4B 3RGBA 2GJZB 2UZPA 3QJOA 4RA0C 1YPZA 3IRZA 3CK0H 3GSNB 2QQKH 1MRDH 1AAJA 1NDGB 4JDVA 1HOEA 3C2SA 4XNAA 1BVKB 4CC0A 2X4QB 1XV8A 4WI2A 1AVAA 3UCQA 2J1XA 4FFWC 4ELMF 4HZ1A 5ALCL 5E4EB 3B2UC 3GJFB 1QOKA 2VAAB 3U9PL 3B1TA 3N43F 3EXJA 4H1LB 1X5MA 4A7SA 4OD3L 4Y1AB 5I30H 1JF5A 4LPXA 3RDJA 1FDLL 3TVMC 3L3DB 4ZMXA 4OZGF 4PJXE 5C08D 3RVTC 3V9EA 5IEHB 4X5WB 2WLJA 2V2WA 3REVB 4C56B 4Y4FD 3FU7B 1QD0A 4NQDB 4G6JL 1G7PB 3GBDA 3VFOB 2HWZL 4JDZB 3CSFA 4EMZA 4D7PA 4TNVF 3BAEH 3PL6D 1WFMA 4H0LC 4KZEL 3TLRA 1M6UA 1HH9B 4Q6YA 5B7EA 3QCVL 2ZOOA 5A2AA 3UTZB 5CN1A 3UPAA 1CG9B 1TZAA 4ZW7A 3JZ7A 3T2OA 4LOVA 1CFQB 2EYRB 3MCLL 4HJ0D 4ETQB 2VXUL 1G7JA 4MXWH 1QFUH 2OP4L 4UUJB 1BVLB 1AZNA 1A4KA 1KCBA 1E28A 3CHRA 4FXLA 3SGKA 4DP5X 1SJMA 4ZOAA 2HKAA 3MV7D 3EKCA 2E6JA 1VERA 3ARVA 4PI2A 4KVCH 1GGCL 2FEEL 4K3HA 2X70A 1YYLH 1FNGA 1W72B 4P2OA 4MNQB 3BC9A 3HNSL 4MYWB 3WN5B 1UCBL 3J27A 1GGTA 4FABL 5F1KC 3KXFD 2RQ8A 5E9DE 1TVBA 3I6LE 3EOTL 3HS0B 2NPLX 1JVLA 4PJEB 1HHIB 1Z0MA 1R19A 3RWGA 4KK8D 4U3HA 3FTUA 3PP4L 1NCHA 4M3HA 2BFVH 3HOGA 3KLSA 3CLFL 1GCFA 2EDMA 1YEGH 2PTTB 4MMXB 2NNCA 1HHKA 4K3JH 4PP2A 1YJDH 5I18H 2X1QA 2H4EA 1E8ZA 4YPJA 4M8QA 2DKMA 4F37K 1CO1A 5SWZA 1P7QA 2YD3A 1UOWA 4TQIA 3WS3B 2VMFA 1D5IL 2X0VA 2NY2D 2JIXB 1DJIA 1TU2A 1NCCH 3GTNA 5CJBA 5GRZA 4PJXF 3B56A 4Y7MA 4XE5B 3D2UA 1MY7A 2D2OA 1QLEL 4M4RA 1A1NB 3X11A 1WWAX 1Z9PA 3H9HA 5IESH 1MFEL 3DROB 5GZND 1G94A 4UQEA 5E2UL 4HUWA 4WI7A 1S7WB 5DD1H 3OAUL 2VDPL 4GRLB 3NMEA 3BO8A 1KZQA 3VQMA 2A38A 2Q86B 1U30A 4P49A 3O3DB 2H6OA 1AD9B 2O26U 2HPTA 1EV2E 4Q4EA 1H5BB 3I6SA 1XWVA 4XHJC 3V10A 4K94H 1MFBH 3V6ZA 3NJGA 3N3EA 1BD2B 1R3HA 1P69B 2BC4A 1XZ0A 1IM3A 4HWEL 4BFKA 1NEUA 3D1MC 3QQ9C 4TUKL 3NFNB 4XMLH 4PG9A 4F7CA 3U82B 3P0VH 4C56E 2NY6D 1ORSB 3TWCH 4RAHA 5A6LA 3DWTA 5GGVL 5B38G 1V8HA 2YBRA 3L3DA 2RTTA 5IQLA 3UYPB 1PX4A 5BVPL 4PRHB 3M07A 1CLYH 4B60A 1OF0A 1NMBL 4X5WA 1SEQH 4C56A 3TBYA 3P11H 1HWWA 5HVFB 2P24A 3QZPA 3KLDA 4H1LG 4EAEA 4E9QA 4K7FA 4PV1C 5DR5L 5HYQA 1G7PA 3GSUA 2CIKB 3QUYD 4G80B 4HWUA 4K5OA 4J3BA 4XI5D 3MYZA 3P30H 1U41A 4NXKA 2CMRH 3VD9A 1VACA 5FO8A 5DQ9B 4HU2A 1DQVA 3ARZA 1FRGH 1IAOB 2GITA 4KXZI 1T1YB 1YN6A 3TEWA 2OJEA 3MXWH 4JFHD 1JPGB 2MJWA 5DMIH 1CJYA 1JXFA 1MDAA 4WO4A 2ITCB 2EXWC 2QV2A 3FH8A 3IYLW 1IE5A 2NT0A 1IBFA 3Q13A 1ODAA 1BWWA 1TKWB 4NNPH 4F37F 3BVXA 4OJFL 5AZEL 3T0EA 3ZSTA 2YMTA 1CFNB 2ZSVB 4MA3B 4KMLB 2NR6C 4YL4A 3AUVA 4IOIB 4GKLA 3W81A 3OAZK 3AY4A 3FBKA 3OSVA 2AANA 4UOW0 3MLTB 1U91A 2B15A 3WKNA 1NGQL 1KN2H 1P84K 5JPNB 3J8F7 1T83C 3FF7A 3N43B 2IAMA 4LEOB 1A5FH 3DDFA 3FUIA 4F7MA 4WKZA 2D7TL 5AVUB 3JT2A 2EO1A 3S7GA 3EH3B 1HH6B 3QO0B 1OAQH 4M5YL 4JVPA 3QP3A 4HIHB 3MRBB 2VRKA 3RUGB 3MOBL 2HTKD 5KJ4A 3IF1A 1KGIA 1A1OB 2KZ1B 1OGAB 2Z31D 5AOZA 5I8EA 2P5WE 1N5AA 2BWDA 2XA3A 4FN0A 2JIXD 2WY3B 1FVCA 2ZKXA 4M8QB 3FMGH 3A67H 3K6OA 5K39B 2OL3H 4Z0XA 5HHXH 1BFVH 4ZNCD 1P7QB 3WJLC 2X5PA 3QRFM 2XWZA 3KHQA 5E2VL 4NC2B 2WB7A 4NZUH 1H6EA 2GFBB 1SJXA 2WXNA 4X4MA 4YIQA 3UP1A 3SE4C 4L4VA 3EOBA 1A1NA 4GRLC 5SWQA 1B9KA 1AXTH 4LLQA 5DTFA 3CSYA 4MX7A 5T1LD 5FK9B 4PRPD 2YXVA 4XP1H 1F41A 1JWSA 1OP5K 4KNUA 5D6DC 1TF4A 1VZGA 3TNMB 3MBWB 5E99L 3LKQB 3NG5A 4CSSA 1DBJL 2NUPA 3O3DA 3TONA 4EO5A 3SGEH 2CSPA 5C0AB 1MHHA 3E80A 5I5IA 3W5NA 4J4PA 5FV1L 2FUTA 4Y0GA 1BGXL 2DBLH 2FR4A 1H8SA 1AQMA 2BC4B 4KDTA 1Z9OA 3BH4A 2WKGA 1PLCA 1KLFB 4H88L 4CADB 4KDVA 3I84A 3TNNB 5I1AA 2Q5BA 4PJ9D 1V55B 1BBDL 3BD4A 2AK4E 4U0QB 2XKSA 2W0FA 5E51A 3HC3H 5EUOB 3JV6A 5FB8A 1NLBL 5EDXA 2LVEA 3FQWA 4ZW8A 3QH3A 3BE1H 4A2HA 4JBSA 1ZTXH 4UNUA 3D34A 4DNLA 5IF0A 2VL5B 4LARL 4XNXL 3UZEC 1CDHA 5CLWA 2H3NB 2IBBA 1MIML 2B08A 5SX4H 3MLVH 3SPHA 5D1QE 1MWAB 2EDHA 4Y9BA 5JQ6H 2EUWA 1IC1A 3UYOD 3TH2T 2YHGA 3QNZA 1NH6A 2ZCKH 2G5UA 1TTRA 4JY6B 2W91A 2FT6A 4G7YH 3DO3A 3LRSB 3KNBA 1NSNH 3I3DA 1TTUA 4PHZA 4Y88A 4Z3TA 5J89A 1GZQA 2FAUA 2ZOWA 1ZHLB 5H2BA 5EOCL 2Q20A 4OJEH 4MAUL 3CLEL 1U8MB 3S3DB 4HS6A 1JVKA 2NUTB 1LO3L 4F2FA 5EOCJ 1DJXA 1IAII 4RBPK 4WFEE 1E3ZA 4WW2A 1MN4A 2N7BA 3MRQA 1FSKB 2XWTA 2LLLA 3G08B 2Z4QA 1RIHH 4Z3FA 3TJHC 1N68A 1Y6MR 2FX7H 4ACPA 5JW4M 3MRIA 5DVKA 1Z5YD 1SBBA 3BRFA 1MCIA 4L2LA 4MYPA 4WWKD 5A2KH 2A0LC 12E8L 3GMOA 3ZMEA 3MU3A 4M8RA 1SFDA 2GI0A 4HAFA 4PLJC 1PCXA 4B5EA 1SJHA 4JE4B 4H26B 4JHAH 1Q1JH 5EU6A 1R24B 1DQQA 3DURA 3SODB 4WKZB 4NOFA 1CYGA 4NKOB 1TPXB 5AVTB 2IWGA 2ZPKL 3RP1A 3RVVD 4HIHA 4AG4L 1SGKA 1I85C 1WLHA 2VMCA 2YUWA 3KYNB 3QUXA 4DKDC 1UEMA 2PPDA 4JM2D 4NN7B 1E5CA 4NP4H 1M53A 4LDEB 4W9ZA 4DVRL 4F93B 3ARYA 4NKIH 3CDGA 3K4DA 5JIQA 1O9WA 1K2DB 4CNIB 1Q8MA 1MRFL 3WTUA 4M7JL 2C7FA 2AQ3A 4MA1B 3BH9A 1VRSA 1YMMB 2X12A 3D06A 3P73A 3F7PC 3V9FA 5BCAA 3LKSB 2ADYA 1F90L 2WUBH 5EO1A 1GJIA 1D3CA 1GW6A 1NAMH 4PGDA 4HBCH 3VXUD 1I8KA 3CDYA 4UV7H 3SKMB 1BIHA 3U7WL 2YMXH 4LP8A 4RRPM 4N20A 5ITBL 1W0VA 1R1CA 1UZ6F 4J3OH 4LLQB 4LRNL 4LU5H 3C08H 4NXSA 1H3WM 2J6EA 1DDTA 4OQ1A