4CC0A

Notch ligand, jagged-1, contains an n-terminal c2 domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
306
structure length
306
Chain Sequence
SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN JAGGED-1
publication title Structural Analysis Uncovers Lipid-Binding Properties of Notch Ligands
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc0A01
4XBMA 4CC1A 4CC0A 4CBZA
chains in the Genus database with same CATH superfamily
1M4KA 4JN1H 2WQVA 2AJYH 2OCCB 4LSPL 4K3JH 5J6SA 3CVHA 3QUXD 1XMWA 1TYRA 2OK0L 1AQKH 5FB8B 4HKZA 5FEBA 5KSBB 5C0RH 3ESMA 4IU3B 3NFSL 2F5BL 3M1OA 2DD8H 3CHRA 4OCSL 5DVNA 5EOTA 1J5DA 5F1IA 1LP9E 4CC4A 3TIEA 2VDPB 1GGIL 3EBAA 3AWFA 2R51A 3IAGC 4KXZH 1MCIA 4OU3A 3LEVH 4YHZH 4CU7A 5KS9F 3MRLA 3PWVA 5BXFB 2CLVB 3D0LB 1WBYA 5L2JA 1GHFL 1SBSL 4Z7WB 3AT8A 4NQDB 3L3HB 2H0EA 4KFZC 3TN0C 1GJWA 2GBUA 2WBJD 2EDMA 1G9NC 1IE4A 1I8KA 5E9DD 5KAQG 4YSRA 1PG7H 4Z7VA 4AMXA 1C1EL 1YDPA 2OJZH 4F5CA 2ILLA 1ADQL 4ZK8A 3B3BA 4HC1A 5I17A 2Z92B 3SDYH 3DO4A 2GEQA 5F0LB 2VDML 3OQRA 1WCBB 1ZT4A 4KZDL 5ADPH 4IOSA 2OMNA 4OCXL 3T2NL 4RVBA 1NSNH 2X4QB 1G9MC 2QGBA 2LW3A 3ATEA 5IUSA 3OPZH 3AY4C 3QORB 2X4UA 4GRWF 4OJEH 2YPLE 1MI5B 3A4EA 2H2PC 3CN3A 4JQIL 4RISL 2JCCA 1L0QA 5E00A 3WKNA 1T21B 3HJEA 2BNRE 1U8OB 3BWSA 3KWXA 5F88B 1MH5B 5C0BE 3DJSA 2F53B 5TPWL 1HXMB 4MJIE 2NDGA 1OHZA 3MMEB 1PFOA 1VADB 3VD3A 5HHME 1DJYA 3VXUE 4KKBC 3CU7A 4KGJA 3FQRA 3GT6A 1NJ9B 3C8HA 2CUIA 1FFNA 3HZMA 5LGJB 5ICYA 1VACA 4JFED 1OAJA 4J1UB 4HV8A 4N2LA 2K1MA 5L4JA 2EE3A 3PDOB 5EO1A 1IBZA 5EF0A 5LAPA 1TETL 3C2SA 1ADQA 3FUKA 2JXMA 3BVUA 4XXWC 2G75A 4D3CH 3T4AA 3W3BA 2J1XA 3II3A 5FGSA 1PLBA 4XB3A 3MYZA 3BUPA 1OXYA 4ONGL 5F1IB 1FNEA 1P69B 2ERJC 4K94H 4L4VA 4JREB 3FQUA 2WQRA 4PVBA 4L8CB 2NY1B 3CZSA 3B7TA 1NLDH 3PWVB 4JQIA 3IJ8A 4LOEA 1UZ6F 1CWVA 1WBYB 4M6AA 3FQWA 4CN1A 1SXBA 1MLCA 1TQWA 5GPRA 1Z2KA 4XWOC 4DEWA 1JHKL 1NBCA 3ERXA 3W81A 1I8KB 5KOMC 4QOKA 2IBGA 4MA7L 1KLFA 4UM9D 4B9CA 5I17B 5EIVA 1D6VL 4X99A 1S9WA 4IRJA 4W93A 1YPZA 3WNIA 5IQ9A 1ZT4B 4HJGA 2P24A 2V7HA 5BRZD 2VXTL 1Z5YD 4L3CB 1CQKA 2ZE0A 3E9TA 4NJ9H 4GMTL 5CUSL 5CEXA 3IJYB 3MJ8A 3ZKQD 3ILPA 1XSJA 2Y23A 4OVUA 1IU1A 4NI3A 2YPLD 3O6ML 2BCKA 2B1HH 1X5MA 5E00B 1IIKA 2ZWZA 1MCHA 2Y5TB 4XVTL 1ML0A 1CTNA 5E0FA 5C0BD 3O2DH 5F7LB 3HIZA 2H3NB 1MF2L 1IC7H 2XVLA 2R8SH 4KKRA 2X6UA 3HRPA 3TV3L 3NDYE 5T1DL 4F7PA 4N0UE 1MCCA 2AJZA 3ZDYF 2UZPA 2VRKA 3DGGB 4LSSL 1XIWC 3FQRB 1PIGA 3LHPL 4V1DA 1AGFA 5D7JD 4GRLA 1FFNB 3HZMB 1FZKB 4Z78B 5GS1B 3ECBB 5ICYB 4GP4B 4HV8B 5CN3A 4BK5A 5EO1B 2GHZA 1LO3H 1NUNB 4O51A 3QNYA 2QPFA 1J5CA 3R4DA 5C2BH 4RFNB 2YQBA 3D85A 5AW3B 5DYOB 3FT9A 3F64A 3W2DH 4JE0A 4CSTA 3RJQB 5D2LE 1AGDA 2UXTA 3P3UA 4MJ6B 3BDYH 1BVOA 4AWJC 3P11L 3S34H 2EDEA 2QV4A 3LEXA 2YBGA 3NK4A 1MAJA 4UQBA 2CO2A 3VXSA 1FNEB 1P4UA 4BFFA 4QNPF 3CVBA 4IMKA 4L4VB 4R4FL 3FQUB 1N2RA 4GQZA 3S5LA 3TJPA 4Y19A 5DD3H 3B5HA 4G9DB 4KO9A 1A1OB 2AQPA 2W5PA 4X8CA 4PW3A 1GS7A 5IGXH 2BNQA 4CBZA 3QUYA 1WWBX 4LVNB 3GO1H 2ZOUA 1DBBL 5DD6A 1KCKA 1TCMA 4QOKB 2R0WH 1WRFA 3HA0A 4GKSA 3KLQA 2CLRB 4K5MA 1H8NA 3T8MA 1Q0EA 3Q1SH 5HHOA 1S9WB 4NO0A 4LEOA 2AQQA 4Q7DA 2IPUK 5ETUA 1JP5A 3O4OB 3OB0K 4KV5F 3VGAC 3HUJA 4Z7VF 4ZT1A 3C2AH 3MLVL 2P24B 5F9JB 2V7HB 3VVVA 3LKQA 3I6GA 1AG6A 1G1KA 2HRLA 4N28A 5CEXB 3N40F 5DD5H 3MJ8B 1BQHA 3RX8A 4PJ7E 2R4SL 3RGVC 2GK0A 3IFLL 1QVOB 4JZOA 3HMWH 3DROA 4S1SL 4OJFL 5F6IC 1S7WA 4AQAA 1GIGL 3P9MA 4DT2A 4ZRGA 5FKPA 3AACA 3SHSA 1F4WL 3T5WA 4PM1A 5J56B 5E6IB 4WK0B 5KUMA 4MNGE 4JBSA 5EZOH 2NXYC 4F7PB 5MEOA 5ADOH 4KVNH 2JCCF 2J56A 2VDLH 4JN1L 4UCFA 2AJYL 3MX0A 3WFHA 3IDYB 1OP3H 2E7LA 1C08A 2B1OA 3GMMA 4K3JL 5F72S 4PJHA 4QF1B 4XXDA 1AQKL 2BSTA 3W82A 4KI5C 5GS0H 4ZUVA 4D7PA 1A6UH 2QVMA 4H8HA 4L2YA 1QLEH 5C0RL 5LXVA 2DD8L 1IAOA 3NEOA 3QNYB 4NFBA 5ICUA 4YSSA 3D85B 2CGZA 4G82A 2V2XA 3KDPB 4QCIB 3EF4A 4YHZL 3LEVL 1KT2A 2FZ3A 2Y25A 4H8UA 2AKRB 1QUPA 3D39A 5T1LA 5DMGD 1DVFD 1I1AC 1I1RA 4HWNA 3CZKA 3I9PA 3VXSB 2ZX8A 3N43B 5EPMA 4WFFE 1RURH 5DRXA 3NCFB 3QA3B 4N9OB 4PGCA 5HI4D 3B34A 1NFDB 3TC9A 3GSOA 1PG7L 2HT4C 1N2RB 3S5LB 1LNUA 4ZJ9A 3SO3C 3BKMH 2OJZL 4O58H 1UJTA 3KPRA 2WXQA 4S1DC 3SDYL 4K07A 4OM0H 3GMRB 4Z7OF 5HDLA 1OZUA 5DD6B 4FLHA 5ADPL 3CSBA 4G1MA 4XI5D 2BWIA 3KPNA 1OAKH 2Y6SC 4KJQD 1NSNL 1AQDA 5ALBH 5I75C 1NIFA 3LD8C 4FCAA 4OFVA 4ELDA 2WP3T 2YZ8A 3OPZL 5HHOB 1MCPH 2YN5A 3K6DA 1TQBB 4YOKA 5ETUB 2VAAA 4NSKB 3CX5K 2D3NA 3A24A 1BMZA 3HUJB 1JF1A 3EJTA 2AK4B 1IBFA 3LKQB 3G6JE 3DX8A 3SE6A 1KPVA 3EGDB 3I6GB 3FO1B 4OFKA 2FT6A 4HLEA 3SGJC 2BP3A 4N8CH 5D1XD 3N2JA 1BQHB 1YPZF 2FJGA 5L7XH 2BDNH 4FHKA 2APWA 3GGWA 1W15A 5LAXA 4HJSA 3KPSE 1AOHA 2VQ4A 4LOUD 4PWHA 3DROB 3PY9A 3QZBA 1S7WB 2WQ8A 2OJEB 4WGWB 4AQAB 4YHIA 1HCVA 5FKPB 3TEWA 3MROA 2KUTA 3X14A 1H6UA 3GTVA 3GZPA 3W9EA 5DRNA 4DP8X 5MEOB 3T2PA 4YFLF 3ZKNC 3EDFA 4RDQF 3WFHB 1JDDA 2JKRM 4Y4HD 5TH2A 2D0GA 4PJHB 4XXDB 3QIWC 2BSTB 4D3CL 3FQ4A 2ZOLA 3DVNB 4JO5A 4WW2A 4ZUVB 5FWRA 5BRQA 2MCAA 2L04A 1CYGA 3NGBC 2A2QT 1OTTC 3UGEA 1JGLH 1LXMA 3RWIA 1G0YR 4LP5A 4K94L 2PPEA 1OSEA 1JPEA 3HJ0A 2BIQA 2HRGA 3IS1X 4HAKA 4DQOH 5C0JB 1UADC 5CSZA 1NLDL 1KT2B 3L95B 2FZ3B 3OPUA 3PWLB 1I8IB 3D39B 4X5WA 5T1LB 1TQSA 3SKOA 2VZSA 2FL5A 4FJZA 5HI3C 4X4MA 5AZ2H 2J5LC 5EPMB 2QMJA 4WFFD 5FXCH 5DRXB 4PGCB 5GIRA 3GSOB 3IRZA 4K55A 3T6WA 1LNUB 1T89A 3KPRB 5CF3A 2J88H 4PIRF 5IQOA 1UD3A 5EU6D 1MIMH 2XZCH 3VB8A 3WJMB 4G1MB 3WDIA 5ERWA 3KPNB 1EJOH 4X9BA 3FCGA 5J1AB 2BO0A 2XQYK 2EUVA 4NJ9L 4X50A 5C3TA 4OLYH 4LHQB 3EJZC 4X4YB 5MENE 3RA7H 4AGOA 3M6DA 3LZOA 2VAAB 2OBGA 1QFWH 3N1FC 2B1HL 1R1CA 2P26A 1JF1B 1CS6A 3ZDXB 1KPVB 3O2DL 5CS7A 1U8LB 5FOJA 1WD9A 1IC7L 1FSKB 4FFYH 1RP9A 2R8SL 2OQJB 1DEEA 5GGSA 2QR0A 3QK0A 3GGWB 3HUJF 1SDDA 5LAXB 3MRFB 2OXHA 2PXYA 5B39A 2RIKA 2WMPA 4YHIB 4HXAH 4K7FA 3ARBB 2FEDD 1WSST 3JTSB 5AW9B 3VWJC 1I3VA 2P43B 5DRNB 3PFQA 1LO3L 2G4EA 3FMGH 5C2BL 3UJTH 3ZO0A 3WYRA 3W2DL 3H4FA 4IOIA 4X5PA 3OX8A 3QUMA 2F74A 3BDYL 2V5YA 2KH2B 3K6NA 3S34L 4WW2B 2ZOLB 4ORZC 3AB0C 3D4YA 1B0IA 1S7XA 4PWEA 2CBOA 4JJHA 1RJZA 4PJ5E 2E4TA 3NTCH 3B2UD 2KERA 3A23A 1QWHA 5F7AA 4BA8A 3BVVA 5T5FH 1EJ6A 1A9EA 4PJHF 2HG5A 4NN5B 5T1MB 1PGRB 3QDJD 2BH0A 4XNQA 5KTEH 4B9PA 4OZFH 5CSZB 1CN4A 3WTXA 4AOFA 5DD3L 4X5WB 3B37A 1FO0H 4I0PC 2HP4A 2PTVA 2FL5B 3GTNA 5IGXL 2WO3B 3APFA 3O2DA 5CD5C 3GO1L 3GS4A 4XHJC 5GIRB 3SYAA 2R0WL 3ZT6A 1USZA 4JL2A 4ZPTB 2X4RA 3HHSA 3Q1SL 1TYJA 3WKPA 2VSMB 1YEGH 4X98B 5FHBH 1U30A 4LCCC 4JM2C 2XPGA 3S7GA 3CV5A 4MZ3A 4LL1A 3C2AL 5ERWB 1E8ZA 4U1SA 5GZOA 4QHNB 1QSFB 2EDXA 4PRID 5DD5L 4ELMA 2YWYA 5MEND 5KAQF 2BXZA 3ELAT 3VRIA 2OI9C 3L5WA 1ZWIA 4ZQTA 3QRFM 1D9KC 3VB9A 3HMWL 2PYFA 1KB5H 1T0OA 5AW1B 2E27H 2OTUA 1PS3A 3Q2CA 4WWNA 4PJ9A 4NM8H 4Q6IA 1R34A 4TUUA 2MTAA 1OTUC 2MCG1 1WFOA 4P4KC 3QC6X 2QR0B 4PRPD 5EZOL 5ADOL 4KVNL 2NXZB 2VDLL 1SDDB 2O5XH 3BIKA 4NN7B 1M1XA 1IT9H 4KJPD 1WK0A 4N2GA 2OXHB 4AT6A 3EGSA 3QUZA 3ZDXF 1SOQA 2PXYB 2WMPB 3DHPA 3UZQA 4ZMXA 5B39B 2IPTH 5EMYA 3D52A 4ENED 4LU5H 2FHBA 3SE3C 4HU2A 2IFFH 4A38A 4WVRA 1C16B 1FF5A 2NZIA 5GS0L 4I3GA 2Z4QB 1A6UL 3G6DH 5EFIA 1QLEL 2ICCA 4FJYA 4CC1A 4IOIB 3FU9A 1FN4A 3OX8B 2F74B 2R39A 1ZLSH 5HGBA 2MTPA 4ZFGH 4X6DE 4HIHB 1S7XB 5FS5A 3HE6A 4PJ5D 1RJZB 3PAYA 2ENSA 2VH5H 1RZGA 1TFHA 3LZFH 3V0DA 3X13B 1RURL 1A9EB 4W9KC 3TO4C 2HG5B 4Q97A 1YNLH 5IFJB 4XNQB 5DUPH 5J12B 3OLEA 3BKML 4O58L 1QTYT 2ZF9A 3WY4A 1TVBA 4X9IA 4OM0L 4ZQKB 3NCEB 1XTMA 4Z18A 3KVQA 1OAKL 2OYLA 3RPKA 4TULH 4YLCA 2VITA 4B96A 1UD8A 2J8UE 3HN8A 4U1NA 5ALBL 4NQCA 1TDQA 3HHSB 5FO7A 5I6XB 4OIBA 4WZ9A 1MCPL 2DWEB 1NH6A 1PX4A 5EOQH 3H0TA 3WAKA 5K93A 1QEXA 1F00I 2XPGB 2YD4A 4MJ4A 1LILA 4IJTA 1EVUA 1JSYA 2BRRH 4NQSA 5JR1H 5I8CA 3UBXI 1ZGLP 3UERA 4RGMC 2QGEA 3H55A 1NOFA 4ELMB 4N8CL 4TLUA 3VRIB 5L7XL 2BDNL 3TIDA 5LNDA 4GAAA 3AG2B 3H7LA 2ZX7A 4MDIA 4GO9A 4RH4A 2PYFB 1A6VH 2WAQA 1E5CA 2OTUB 1BIIA 2W9EH 3L1EA 3QI9D 1TLMA 4PJ9B 4YS4A 5C6PB 4Q6IB 1SRDA 3VSTA 1XH2A 1WZKA 2PCXA 1Y1UA 1UACH 1BBJA 1QZNA 4KNUA 1IGIH 3O11A 3BIKB 2IDCA 1M1XB 4HUCA 4AT6B 3LNDA 1WFTA 3QUZB 2I7SA 1AQ8A 3UZQB 2D7OA 3OAYH 3WUWG 3SQOH 4LLWA 2VERN 3C6EA 3OB8A 4GG8A 2CO4A 5D7IA 5EFIB 5KVDE 3P69A 1R3HB 4GY4A 1PX8A 3IFOA 5E5MA 4NUGH 1E5BA 1ZS8B 4M4RA 4WUUD 4PJXA 1JGLL 2X89A 3BYTA 3SE4C 2X9WA 4ZAKC 5DZLA 4IRSC 2YAQA 3AU1B 1J9RA 1V54B 4DQOL 4OIIH 3X3FH 2KZWA 5DMKA 3N5AA 3EH4B 3FC8A 1CDCA 1EHKB 3QIUC 3PG2A 2HCZX 2C5DC 3O3AA 3KH4A 5BV7C 5JNYA 5I0WA 5DUMH 3ZJAA 3L08A 1QKZH 1QPXA 1VEOA 4N2NA 1UVQB 1CE6A 1VDGA 2ZSVB 3TWCH 2G3NA 2J1YA 3MO1A 2B9BA 4HUMB 4W6WB 3Q6FA 1A1NA 2FECL 2PO6A 4YEFA 1UB5A 3AADB 3HCVB 2J88L 4MMYA 1KEMH 1TVBB 3AGWA 2J71A 1MIML 2H26A 3GB7B 1SYVB 2P46B 2XZCL 3LIZH 3MV7A 4Y89A 3OBAA 1F3JA 1EJOL 2VITB 2VDLB 3C6LA 4RGNC 1JZGA 2I27N 4U1NB 3QCUL 3IAQA 1DQJA 4Y5YA 4NQCB 4OLYL 5BQ7A 5FO7B 3RA7L 1LWRA 2EDLA 5E5RB 1MCFA 1FE8H 3FFCA 4YQXH 4BYHA 2PW2B 3H0TB 4EQ3A 5FWQA 4DZ8B 1QFWL 3BUIA 3D50A 3V10A 1XBDA 5E7BA 4CU6A 4OQ1A 2FYYB 4NQSB 4JPWH 5I8CB 4M9OA 1U8IB 4Z0BH 4QRSA 3W0WA 2EDNA 4H7VA 4F2MB 1CFBA 3MRDA 4FFYL 4DPCX 4L1BA 1RERA 2XN0A 2NR6A 4XPHH 1Y6NR 3FN9A 32C2A 3OC5A 5AWNH 1U92A 2MCPH 2VLKE 3F04A 4HXAL 1BIIB 3R18A 4ELMF 4F8PA 3VFWB 1IGFH 3MTXA 2VN3A 4S1DD 4I2XE 1M3JA 3FMGL 3O11B 1BGXH 2ESVD 3LS5H 4J6RH 4O00A 3UJTL 1I7RB 2WNKA 2LE9A 3PU7A 2WLMA 2RMNA 1ZTXE 1BX2A 3ABKB 5BW7A 1YYCA 2XWRA 3MV9E 1IFHH 4LBEA 3KM1A 3T0DA 4GG8B 1DANU 1T0MA 4JRLA 1T2JA 5I8OH 3KEHA 2JTYA 3C60B 3NTCL 4JPSA 2MQCA 4WGVB 4WCYH 5E5MB 5F9DC 2YQ3A 5T5FL 4JFDA 1CDJA 5T8IA 2NY3C 1KDIA 1S7SA 2DWSA 5DHVH 4HA1A 3MODL 2IOIA 1NICA 4TLTA 4AYID 3GUTA 5KTEL 4J27A 1CG9B 1S7QA 4LLUB 4Z7NB 2G3XA 3VW3H 1FO0L 4OZGA 1TO4A 1CDIA 3O3AB 1H3WM 2ZP0T 3JWNC 5JNYB 1QR1B 1C8PA 4PJEA 3BVNB 4FA6A 4FFYA 3QNZA 3SSGA 1JV5A 2YUVA 1WS8A 1CE6B 3RG1C 2JELH 4LSVH 1ZIBA 3MO1B 3FTXA 3Q6FB 1I8AA 2ODHA 3DURA 2PO6B 5A2LH 1UB5B 4KXAA 3ME0A 4KAQH 4MMYB 1YEGL 4DPRA 5FHBL 1RZIA 2ZNWA 4L3EA 1M71A 3BWZA 1AXSA 2H26B 5C9KA 5HYJB 1CFVH 2EXYD 3FHEA 2D4DA 3MV7B 1F3JB 1T22B 4GXFA 5JQIB 2H5UA 3C6LB 4IK6A 4N0CD 3ZYZA 3ROOA 1DQJB 3QQ4B 5AW2B 1RZFH 1NGXA 3EZ8A 3B8SA 3VWKD 3AJ7A 4RRPG 1INDH 4GG6E 1SM3H 4RFEA 1KB5L 4KMQA 3V9EA 3MV8A 4APXB 3GBDA 2E27L 4JHAH 3MRGA 1OF2B 1ZLEA 5GRJH 3P2BA 1KTKE 1T5KA 1XCTA 4NM8L 1E4KA 4KK8D 1G1OA 5T5FA 3G5YA 4BSJA 1O7VA 1KPRB 1CI3M 3VDCA 4MXVF 2O5XL 1UURA 2XU9A 1IT9L 3LOWA 4DKFH 3T0EA 1FO0A 1JZEA 4AGPA 2IPTL 2WANA 4HWBH 4PS7A 3LSOB 1RI8A 4LU5L 2NDFA 4UT9H 4ILDA 2IFFL 1M3IA 4ZTOH 2XXFA 4KXBA 5I19H 3VD1A 3G6DL 4EIGB 5I9QB 1LWJA 4YAQA 5IFHH 4JRFA 1JN6A 1GMEA 1BX2B 4UYPA 3FTGA 1J0IA 3TL5A 4WV1A 3MV9D 3GPSA 4NHCH 1ZE3C 5ALCH 4JQXA 1ZLSL 3RDJA 4ZFGL 3D2UA 3S6CA 1T0MB 3SDDA 4PV9B 1J7VR 4XCCH 2DMHA 3IEAA 2UZYA 2XFXA 4N3TA 5F3HA 2IQAA 2VH5L 4AIOA 4P23D 4JFDB 3ZQWA 1B4TA 1S7SB 3L54A 4PVMA 3ZHLA 1YNLL 3DDGA 1VFUA 5D7IF 5DUPL 3GUTB 3C09B 1CR9H 1F58H 4MHHI 4W9ZA 1KB5A 1V27A 3WY3A 5I0VA 4U05A 4OZGB 1MFNA 3BUQA 3O8XA 4PJXF 2FK9A 5E8NA 4PJEB 4S0TD 3QNZB 2AQRA 3F6IA 1JV5B 5DI8A 2PNDA 2YKKA 4TULL 4MVBC 2RAMA 4BEIA 4MLIA 1BD2B 3L5XH 5T3XH 2YFOA 2EH7H 2FR4A 3ME0B 1FFPB 1RZIB 1U2HA 3RPIA 5EOQL 4L3EB 1M71B 1AXSB 4WI8A 4YXHL 5B1CA 1WG3A 4Z23A 4N2IA 2BRRL 2ZUSA 1RSYA 4ZTPH 1BQ5A 5JR1L 5F3BA 5JW5A 3L4YA 1UT2A 3SCMA 4HUXB 1HE8A 3T3PB 1G7QA 4MZRA 1DHKA 1SXCA 2FRGP 3SKMA 5HI5C 2X6VA 2EADA 3OHMB 3V4UH 5LQBH 4B7IA 4RFEB 1A6VL 3RDTA 5TE4H 3AS0A 2HRPH 3MRGB 4MNQD 4B53A 3VXOB 3APCA 1NC4A 2WZPA 1IBGH 3OAZH 4X4KA 1TCRA 4PJFE 4OFPA 4B3VA 3G5YB 1CGSH 1UACL 4XBEH 2EIKB 5E5UB 5JHAA 1IGIL 4OZFB 3SBWA 2AP2A 3T0EB 3IMVA 3RIFK 3ZYIA 1FO0B 3DXAD 2A6DA 4CMMB 3L9RA 3OKOA 4N6RA 4RWYH 1ACZA 5EBMA 4JDVA 3SQOL 2QFPA 4HWZA 3T6VA 4F27A 4E9YA 2JLLA 3BUDA 4G6FB 4NUGL 3WUWA 3NJXA 4YAQB 1HQRA 3OMNB 1Z3RA 5JPNC 1XF1A 4FTVA 3OTTA 1JN6B 4NQUA 3FTGB 3IDNA 1SXSA 3MRIA 4I0KA 1UEMA 2W1NA 3T9WA 4GH7B 4OIIL 3X3FL 5JXAH 3PYCA 4F15B 3WO3B 2NZ9D 3D2UB 4XMTA 3IJSB 4EN3A 3TCXA 4DH2A 1S6NA 2PN5A 3ASOB 3ZYJA 5I76A 3K91A 2UZYB 4BV1A 1ANUA 1QHPA 3MRNA 5DUML 2IQAB 5F3HB 3PL6A 1QKZL 3TWCL 4GSUA 1WICA 1HJCA 2YD3A 1M7DA 4LCVA 1KB5B 3I85A 4D9QD 3QDHA 1B2YA 1KEML 2PUQT 5AVQB 5FKAA 4CKVX 3QFJA 4NQDD 3LIZL 4O2EA 2NSQA 1P1ZA 1MREH 2YGNA 3E1F1 3OKNB 3PJLA 4HLZH 5DI8B 3RZWA 5JMOC 1QOKA 2DTSA 4PYGA 1G9NH 2DJ4A 1S8DA 4OZGF 3KJ4C 2YWZA 4LXFA 1E7VA 4OD3H 4G6KH 1H3PH 2PR4H 4GT7A 3R7RA 1FE8L 4YQXL 3KYOA 5IBUB 1RJYA 3U46A 1XCXA 2Q87A 1B3JA 2HVJA 1F4XH 3UBGA 4JPWL 2D3LA 1U8JA 5JW5B 5F97E 4Z0BL 3HS9A 1QATA 1WITA 3BQUC 2X2UA 3GXTA 2IAAC 2Y2TA 1G7QB 3MLUH 5GHWH 3ZQXA 4G3YH 3SKMB 4DJMA 1G9MH 4BFEA 1M53A 4DVRH 2WNXA 2VIRA 4Q6YA 4XPHL 4UM8A 4WFEE 3QORD 3OVUB 5E6RB 3RDTB 5A1AA 3CXFA 1SJXA 1MI5D 5AWNL 3BP7A 2MCPL 1PSKH 5D7JC 2V37A 5F44A 5EZJA 1TZHB 1TCRB 4D9LH 2UWEF 1IGFL 1N8ZA 3DVGA 4YDVA 3S3SA 1BGXL 3LS5L 2YD6A 4J6RL 4JHZA 3LXBA 3OJMB 4HLZG 3S8FB 1G94A 3STZB 2YMOA 3IGKA 4U6TA 2VLRA 5F93C 3OKOB 3V6OE 2ENJA 5EBMB 1IFHL 4ENZA 5E1GA 1DJXA 3LIZA 4U7KA 4JZJC 2GSMB 4GB9A 4B5ZA 5I8OL 3IXAB 4V33A 4DN4H 2JKIS 3NOIA 3R06A 1HQRB 1FRGH 3O6FB 4WCYL 2EDWA 1P5UA 2EIEA 4FTVB 1F6AA 3ZXAC 3NZUA 3IDNB 3BUYA 5J6HA 3D05A 3MRIB 2DIJA 2HWZH 4LPUA 4MJJA 3X17A 3VW3L 1CC3A 2C9QA 1D5ZB 4EN3B 5I76B 1QABA 4ZW6A 3BCFA 3SE8H 1AHKA 3MRNB 5ID0B 4AGNA 3PL6B 2UXVA 1S7VA 3LZPA 2XETA 1K72A 2JELL 4LSVL 1U3YA 2CDFB 1M7DB 2NY1D 1WZMA 3TH2T 3ZU8A 3Q6GH 4KAQL 4LPWA 4YHLH 1QFWM 1WDAA 2I9TA 4YZWA 2UY7B 3QFJB 2DLTA 1OM9A 1RZ7H 2NMSA 3K0WA 4FMKA 4OCNC 1CFVL 3BHBA 5DC4B 3RU8H 1P1ZB 2CMRH 3GMOA 4P2YA 1P7QD 5F2FA 1K5WA 4ZFFA 2B4CC 3W5NA 2UV3A 4OTXH 2RQ8A 2X4PA 4KKCC 4CVZA 4D8PA 1RZFL 4NERA 4GFTB 2E7DA 3T1FA 5FAAA 2D2CC 3NFNA 1INDL 1BG1A 2DWXA 1RJYB 4TQIA 3CH8A 5IG7A 3A4DA 1SM3L 4CGTA 4FQXD 2Y2YA 3F83A 4QHMA 2O5ZH 2HVJB 3H9ZA 3IDXH 4JHAL 3WS6C 3B9EA 4NZDA 5GRJL 1U8JB 1OP9A 4ZFZB 4JRYA 2P45B 3QHFL 5DHVA 5E99H 5KZCB 4HOXA 4W9DC 3TESA 3JT0A 3ZKMC 2VIRB 4WFED 3AQYA 4DKFL 1R9FA 4IKJA 3ZHDA 3D34A 3R1GH 3BP7B 4HWBL 1N6VA 2VMEA 2F54A 4UT9L 2EDFA 5EZJB 5I8KH 3T4YA 3BX7C 4ZTOL 5CKAA 5I19L 4JFWA 2KQMA 4YDVB 1NQBA 2GJ6A 5IFHL 5JIMA 3OGOE 1KCBA 3ABZA 2VLRB 4FKKA 5DMIH 5F9AC 2X9YA 2F7RA 3C5ZD 1EAJA 4NHCL 3EUUA 4PJBA 2A6IB 5ALCL 4BKLB 5KYYA 3QJFA 2AFNA 3AAZA 3V7AE 5C0FA 1ICTA 1NANI 5DMGC 1ZVSB 1IGYB 1W8EA 2DLFH 1T5XB 3N3EA 3OSKA 4PAZA 4XCCL 3B2MA 3R06B 4YHMH 3V6ZB 4FYQA 2EKSA 2V9QA 1P5UB 2DJSA 1E4XH 3KCWA 1F6AB 4ONFH 1X5JA 5HI4C 5SV4A 2X6BA 4KJWC 2LVCA 4KTDH 4L8BA 3M8OH 3QEQB 4YJZL 1CR9L 1F58L 3H2PA 1SOSA 3QW9A 3M46A 4LDOB 1E28A 5I1GH 5TK4A 4P3DA 6PCYA 4QJ4B 4PU2A 4U1IB 2WWKO 4XI5C 4J3WA 1S7VB 1GS8A 1BAWA 5CMAA 4ZMLA 1G5GA 2OMZA 2EUXA 4WI2A 1XGPA 1NFDE 1HWHB 3L5XL 4OZIF 5T3XL 5JIKA 2AEPH 2EH7L 4GP5B 4XP6H 4HWBA 2HSIA 2W8CA 3BOVA 4FTDA 4EIUA 3CSTA 3SJVA 3U2IA 2MFNA 4B9YA 3H9YA 2DMGA 2OZNA 1SN2A 3BHBB 4G7YH 1X9RA 3GMOB 3F12B 4ZTPL 1E8YA 4QOKD 1C7SA 2X4PB 4CVZB 4G6JH 4D8PB 2BINA 4JFUA 2H41A 1RP8A 3V4UL 5LQBL 3LVEA 1E67A 4FHBD 1K2DA 3EHBB 5M95B 2NNAB 3FFOA 4M5SA 2HRPL 2VZVA 6PAZA 4Q0XH 4WWKA 1S7UA 1IBGL 1R4XA 3LTVA 3QRGH 4QXVA 2AK4E 3NFPA 4JRYB 2BHFA 4W70A 3VI3F 4PSRA 1CGSL 4QWWD 4MJ2A 3CPLB 3QCVH 5HGAA 4XBEL 1RLBA 1P84K 2FSEA 4MA3A 3MA9H 4RWYL 4V2BA 4FL4C 5D55A 3ESOA 3WELA 4GI9A 4LPCA 3HZ3A 2F54B 3PRZA 1LMKA 3GBMH 2NNFA 3TBBA 5DUJA 2Y2WA 5D6CA 4HSAC 5E6ID 2EE6A 2GJ6B 1RZKC 4A7UA 1U3HA 2H8PA 4ZMTA 3EIFA 4KC3B 4PJBB 2FEEI 4YL4A 3V4LA 5KYYB 3QJFB 1J9SA 5G5DB 5C0FB 1GRWA 3UPRA 1S9XA 3G04A 3G5WA 3VFSA 2W94A 2EIJB 3I6LD 2A99A 5D5MA 1CI5A 1NMBH 1HEHC 1DZ0A 2Q0ZX 2EKSB 4NUMA 2PLTA 4PWIA 1J5HA 1SHWA 3HFFA 5EG6C 2D9QB 3FULA 5GRXG 2D7NA 5CLYA 3FRPB 5AVTB 2OYMA 4PG2C 3IMBA 4YHYB 2B20A 2BVUA 1MREL 4K7PH 4X6CE 4MWFA 5AKTA 4G1EB 1S78C 1G9NL 1V7MH 1XGPB 2Y1ZA 2B8OT 3BSGA 4OD3L 4G6KL 1H3PL 2IV9A 4FFVD 4CNIA 2WKOA 2PR4L 1DL7H 1O6SB 4K8RD 5GS2H 2COVD 1X7QA 5I24A 2B77A 4NUJA 4XZUA 1NIBA 1F4XL 3LJ3A 4FXKC 4PHZA 4ABVA 1JZ7A 1Z0MA 3GSQA 4WO4A 4L1HA 5E6UB 3MLUL 1R3IH 5GHWL 4G3YL 1NGYA 1G9ML 5JDJA 4DVRL 1AR1D 5HHOD 1E90A 3DK0A 4PP1D 1JZFA 2G5UA 1LEGA 3PV6B 4ETYA 2QADB 3X12A 3QYNA 1ETA1 1NFIB 1PSKL 4WWKB 1S7UB 5LG6A 2AK4D 4NPKA 2XIBA 3ZTJH 4D9LL 3A21A 5HGAB 2YMXH 4C58B 2BOCA 4NCC1 3WXVH 2FSEB 2B5IC 3FTUA 4KNSA 3A67H 4MA3B 5FUZH 5L2KE 2XTLA 1OE3A 4QR7A 4PVNA 2HMIC 1MPAH 3RVVC 1I82A 1MCOH 3HB3B 4P99A 2J8HA 5D6CB 3BD3A 3RKPA 3PWPE 4DN4L 4ZO7A 1FRGL 2AJUH 1W16A 3FSVA 1NEUA 2N7AA 3G5XA 4OF8A 2H8PB 4PRNA 4B60A 2HWZL 3QEUA 2UZXA 1S9XB 3G04B 3UPRB 4JFVA 4TL5A 3MRJA 3SE8L 3DTXB 5L8LB 2EC9T 3B5GA 4PJGE 2XN9A 4PJBF 3FT1A 3VRLF 3EZJB 5I26A 5D93B 1K4DA 3L4VA 4UOZA 3ZTJG 1BA9A 3AY4A 4JO1H 5C07B 1GY1A 4XXCC 3RIAF 3Q6GL 4YHLL 4PJ6A 5KVFE 3OB0H 2ITDA 2CCVA 1FVDA 1J86A 1RZ7L 2ZYRA 3RU8L 2CMRL 4MB5A 4F80A 4MWFB 4OTXL 4EI5D 3N44B 3KHOA 4GIPD 3MCYA 1JXKA 2IWKA 4UDUA 1ZS2A 1H6EA 5HYQB 1X7QB 2G0KA 5H4ZA 3RWFA 1AGCA 2Y7MA 4TSAH 3OQ3B 1OEZW 4HOWA 2O5ZL 3CXDH 4MDJB 4XZUB 1JWMA 3IDXL 2AS5M 4BINA 4ELKA 4FZ8H 3D2TA 1OVZA 3GSQB 1IX2A 4M6MH 5IVZA 2RR3A 5E99L 1SHMA 3HN3A 2TRHA 3L7EB 2B7DT 5FYLD 4NKIH 3CFBA 4KJPC 4XXWA 5IQ7H 5IF0B 1LEGB 4FRWA 3R1GL 4OF5A 3X12B 4EF3A 1M6OB 4ENEC 4ZFQA 1M9WA 5I8KL 1CLOH 4A2FA 2J12B 3QHTC 4GBXD 4FA7B 2HJLA 1E4WH 5IHBA 2E9WA 3U0PB 4X9FA 1ZT7A 5L2KD 3K0YA 3OZLA 3QWRA 3WTTA 2IH3A 4JCMA 4XNYH 2G0LA 1I7TA 1YYMH 5KSVA 1FLRH 3QB7C 5JW4Q 3EBGA 3TTSA 1X5GA 4HD9A 4I1RA 3ARBD 4MCMA 5AAMA 4LLVA 3UBHA 3TN0B 2AK1H 3UOAB 1OWWA 2DLFL 1VAHA 3WHE1 4XPBH 4YHML 1GW0A 4J5VA 1DSWA 4L48A 1E4XL 4MCZB 4A55A 4ONFL 5B8CC 4N2KA 1QNZH 4W4OC 2P5EA 2RACA 4KTDL 2ZX6A 3M8OL 2VDQH 4M1GH 3QEUB 2UZXB 3CCHA 2DLHA 3GJFK 3MAWA 2F2HA 4UBDD 1UUNA 2G9KA 5I1GL 5JPMC 4CAGA 4AENA 3QGVA 4XC3H 3M1BA 3BKJH 1WWCA 1K4DB 2ZSWA 4XMLH 3W11D 1EO8H 3KXFE 4X9HA 2HLFD 1TZAA 2NT1A 2PCYA 2E3VA 5I1DA 5C6WH 1SUHA 3AROA 2AEPL 4XP6L 5D5MF 3N42F 1GGTA 4CDHA 1I1FA 1X5ZA 2ITDB 3QDAA 1S2EA 1FVDB 3OF6A 4HZAA 5I1EH 5F7WC 3PGCA 4G7YL 4BQCA 1PVHA 1CGXA 3DX9A 1CIUA 3Q2VA 4G6JL 1D7DA 1YEFH 1MW2A 2HPTA 1UT9A 1TR7A 3CMOH 4AMWA 1A02N 1XIWA 2XTSA 1UFUA 4ZZKA 5HXMA 4OI7A 3BH8A 1AGCB 2X70A 5AB9A 2WBKA 1HYSD 5F6HI 1JWMB 2ADIA 3ZO9A 4Q0XL 4FADA 3QI9C 4MA1C 1XGRA 3QRGL 2X40A 3WFBH 5FCUH 4HSCX 1QSFD 1HSAA 1S5HA 2VQUA 3QCVL 4H8VA 3ARTA 4LAJH 2TSAA 4NPYA 4C83A 2WVVB 4G9FA 4QRAA 1YJDC 3CFBB 5H8DA 4X6FB 1PZAA 4U1MA 2I9LA 3MUHL 3V7MA 4PFEA 4OCLC 3GBML 2PYEA 5BNXD 2HJLB 1DQLH 4WU7A 2ERJB 3WUZA 1ZT7B 1TEGA 4I0CC 4PW4A 4PEEA 4PJDA 3NIGF 2IH3B 1I7TB 5EA0H 5TDNA 5KSVB 3WNLA 4XOAA 2FVNA 4H0GA 4K15A 1O0VA 4TF4A 4F33B 4OV6F 1NMBL 3KGSA 5ISZE 4FDWA 2CUHA 2QVTA 3EOAA 5D1ZD 1RSFA 1ETZB 3MCG1 4ATTA 2MNWA 5I18H 2IH9A 3AU0A 3CCHB 3IFPA 3QR0A 1OLLA 1U8KB 4M5ZH 4Y1TA 2MQGA 4AENB 2VCOA 3M1BB 3ALPA 3MNVA 3EYQC 4K7PL 5K1JA 3JWOC 3KXFD 1U91B 1XGUB 1V7ML 4ZODA 5HYFA 3NIFB 2DH2A 2CO1A 3RGVA 1JWUA 1DL7L 3CE1A 4FXGC 4W4NA 2ICWJ 2NQ3A 1UC6A 2ZUTA 1MHHB 4P49A 4EKJA 1WGOA 3OGCA 3PGCB 4BJLA 3W5MA 2BWDA 1YNTF 5MHSD 3NCYP 2HUEA 4QXUH 7PAZA 3DX9B 1CU4H 3LXCA 4Y8AA 1R3IL 1WZ1H 1J0HA 1XIWB 3K46A 4Q9BA 4U33A 2Q8BH 2N3JA 5GZNA 4MCNA 3PHOA 5LN4A 3RUGE 2PP8A 1QZ1A 3K8LA 2ADIB 4FYSA 1XGRB 2E56A 2EDOA 3VXMA 4CN6A 3CHSA 1HSAB 1MELA 2YMXL 2WXLA 4JVUA 1MFUA 2GITA 2ZX9A 3WXVL 4G9FB 5FUZL 5KYXA 2A74A 3VA2C 2C3VA 3A67L 3WV0A 5I16B 4N8VA 1A9BA 3VQ2C 2XQYG 2WYHA 2YHGA 2BX5A 1FAKT 4IJ3C 5J13C 4HF5H 1I1AA 2B9AA 1MPAL 3UIZA 1MCOL 2PYEB 4N9GA 2CRMA 2NTSP 4WU7B 2HFEA 4N25A 3KLAA 3RURA 3ZE1E 2AJUL 1T2QH 3CU1A 2E86A 3MUGA 4HKJB 5CNHA 1DBKH 5C71A 4PJDB 3NG5A 1RJLA 3QUZD 2YEVB 5TDNB 2YSTA 3UTZB 5C0CA 1XSIA 3X1FA 3DHJA 4YMPA 2HLEB 5I6PA 3R4RA 1I75A 5EC1B 4AMKL 4BGDA 5I6LA 3LRMA 2J55A 3D0AA 3U1PA 5E94A 5SX4I 5I82A 2E5EA 1ZXQA 3EOAB 1RUPH 3TVMD 2W07A 4KKAD 4JO1L 2VR5A 1TPXC 1R47A 3ELQA 3WO4C 5CCGE 3IFPB 5BOZG 3VGAB 1DLHB 3AQXA 4Z7NE 4ZXBC 3RHWK 4UAOB 3SZKC 1FL6A 1TTCA 4R4BA 3FONA 5BV7H 2EXYC 3MNVB 3RWDA 3CFDA 5I1HH 3WCYA 4N0CC 1SXZA 4PRHA 1JUFB 5DQ9A 3RGVB 1JWUB 4E9VA 5F6IB 5AYTA 4OFYA 2ZF8A 3MQIA 3RB7A 1UENA 4F3FA 4HEPG 4HYTB 3CWGA 2X44D 4DOHE 4WIQA 3T3MB 3ALXA 1BF5A 4F37K 4TVPH 1EFXA 2NXYB 5DS8A 4FZ8L 4JRXE 4M6ML 5E8PB 5FFGA 4MQTB 3TA3C 4H25A 3WXWH 1S3KH 2RGSA 4NKIL 3PHOB 5IQ7L 3CBRA 3QIWA 4OZHE 4YUEH 1B6DA 5JYMA 1CLOL 2WXNA 4PJ8D 3VXMB 4AXWB 2DI7A 2XVGA 5E1AA 5FUCC 3VGFA 3STBA 4H2AA 5FLVA 1E4WL 3H9SE 4YPJA 2GITB 4L9DA 4TXVB 2C3VB 1QBAA 4IBZA 2YEZA 3PDDA 4N8VB 1WEJH 2I07A 1CICC 1UWGH 2WN3A 3L3KA 3MRCA 4JDEA 4XNYL 1YYML 1I1AB 1FLRL 2YJQA 3IMSA 2WSPA 1OCWH 2KYIA 5DEJA 4N9GB 2AK1L 4XPBL 1Y0LA 5KWYC 1R3KA 1EPFA 4P23C 3SO3B 3D4CA 2V5TA 3UMTA 1QNZL 1UUSA 2K7QA 4JW3A 4UQ2A 1NDGB 4Z7UE 2VDQL 3JWDC 4M1GL 3VUAA 3BP4B 4X0KA 4IIQA 5C0CB 1I3UA 3QYCA 4W9CC 5F9WC 1JF6A 4PBVC 4WWPA 4AQ1C 3NCWA 3C60D 4XC3L 4HP5A 3BKJL 5I75B 5E94B 4XMLL 1LK3H 2N01B 3LD8B 1EO8L 2ZD0A 3X1NA 3DSFH 4XMZA 3VDAA 5BS0E 5EF3A 5B7EA 4L18A 2XYCA 5HDBE 1EEYB 4V2CB 1OB0A 1U8QA 1OCZB 2AAAA 4KX9A 3ZE2B 4DFIA 1FL6B 4XB8A 5BPPA 4R4BB 2EACA 5I1EL 1N18A 3MGAA 3PS6A 3JWNH 3S2CA 1CGYA 3NQKA 1E30A 3KAAA 2VZTA 4CN4A 3T6XA 1G6RH 1PD1A 1W72H 4PRHB 1YEFL 3MKGA 5DQ9B 5JHDA 3L45A 3CMOL 3US0A 5F7MC 4J7RA 3QXTA 3UAEA 1ULVA 2C9UA 4XC1H 1G5AA 8CGTA 3RE0A 5E8DH 4QT5A 5HYJD 2E9IA 2V0AA 1EGJA 3VWJA 1LEKA 4QRPB 3WFBL 4JRXD 5DS8B 5FCUL 2ATAA 3P3YA 2XV0A 3MRBB 1NINA 4H25B 2WVUA 2ZXDA 1JJUA 2NYYD 1TEFA 2WUBL 3QIWB 2EDTA 3E7JA 2YS4A 1QPPA 3RJDA 4DK5A 3NJHA 1NCTA 4GSRA 2CHWA 3VE0B 3NGBB 3QQXA 5E1AB 2K6YA 4MAZA 2LFEA 1PBYA 3IDJA 4U2ZA 5I5IA 4KK5D 1DQLL 5KBNC 4N24A 2ICES 3F7VB 2QKIC 3JWNG 3MZTA 2CHNA 4F57H 4I9WD 4R84A 2CBQA 3CVDA 2XOTA 2YEZB 4KI5F 2I07B 2XWZA 4DTGH 1OTSD 2CD0A 3GFUA 4KUCF 2VLJA 1MG3C 4I0PA 4FQ1L 1EUTA 5EA0L 1HC1A 5DO2D 4N2DA 1OAXH 2J5LB 4NFCA 4OGQC 2GC4C 3JV5A 5B3JE 4LO9A 1K3ZA 1Y0LB 3VD9A 1F97A 2F08A 1R3KB 3PJSA 1NMCC 1PDKB 2N1TE 3RLSA 4BH7A 4UQ2B 2WB1A 2VXQH 2WO2B 1ZE3H 3D33A 3QH3A 4X0KB 5I18L 4JM2A 4M5ZL 7FABL 3JTTA 4Z7IA 4PS8A 2APBA 2ZUYA 1TZOA 3QJZA 4WWID 4KZEH 2D3VA 1II4E 3BVXA 1E6JH 1JHTA 3BPOC 3DPDA 3C8KA 1GZPA 1D9KA 3BKCH 4NXKA 2DS4A 1VA9A 3Q0HA 3NCXA 1H8SA 4KDVA 1BZ9A 3UBXG 5IREA 1QUNB 2Y7OA 1UOVA 4GAYA 1VEMA 5DFAA 2DQTH 3MJ7A 1KULA 4QHLA 4HETA 2XA3A 4P4KA 4QXUL 4MD4A 1CU4L 3U9PH 3LMJH 5FC9A 1TQTA 5JHDB 1WZ1L 1F4YH 3O41B 1BD2D 1TJIH 3WIAA 1SFDA 1SJVA 2Q8BL 3T2QA 5CBAA 1HHHA 5ITFB 1VERA 3SPIA 5EU4A 2FATH 3X1EA 3A6BL 2YLKA 3QORC 4JFHD 3ZN6A 4P46D 1OAZH 5DFWH 4WI3A 3BGMA 5EULV 4X83A 3VWJB 2KHAA 1HCFX 2D7MA 3IPBA 4FNTA 3NRFA 4H88H 4U2YA 1IKOP 5E8EA 5C0AB 1J9QA 3UC0H 2QT6A 5J6GA 4KJYA 3L5HA 4RAVA 4QGYA 4L4TE 4BZ2H 3AB0B 4QRRE 4WSJA 2FJHA 5DO8A 3HC0A 3IDJB 2V9UA 3SDXE 3B6SA 4TYUA 4OF6A 4AW4A 5ESVA 4L8SA 4AJVA 2VUOA 1UB6B 3B7SA 3TO4A 2C1OA 2XQYA 4KQ3H 3F85A 4RMQA 1CFNB 1T2QL 2XTJB 3Q3GA 3PIQA 1DBKL 4WO0A 3U25A 1DEDA 2Z1KA 1AO7E 2VLJB 4I0PB 2CHZA 3HZKA 1AOZA 3BP5A 5HVHC 3WTUA 2L7UA 2CH8A 4G6FD 1USQA 4G8EA 4E9QA 3S96A 4M62H 1X9QA 3VI4F 1RUPL 4BH7B 1VSCA 5ILTH 2VDKH 2D2OA 1YMMA 3QH3B 4LCCB 3FH7A 2R23A 4JM2B 4H40A 4X42A 2DYRB 1Q90A 3JTTB 5B1AB 3HVDA 4ZMAT 1OCRB 2Q2LA 4P05A 4HG4K 5BV7L 3HW7A 4PRDA 2XFGB 2IF7A 2R27A 2ZIDA 1PZ2A 5I1HL 4GOSA 3BH9A 2OI9B 3ZTCC 4PRBA 1NDTA 4W1TA 1AE6H 3UP6A 4P0DA 4E2OA 1ZV9A 4HIEA 1WA0X 3C8KB 1D9KB 5AW6B 1G87A 2ISDA 3P3TA 4NQEB 1ID2A 3ZSTA 2DDQH 1BZ9B 4FQXC 1F41A 3MJ7B 4WHTB 3COOA 2ZP9A 2N7SA 4TVPL 4MD4B 2CBTA 3KL3A 2Q3ZA 1RHHB 1S7RA 2WWMD 1HHHB 1QHQA 1MFVA 4PD4K 1S3KL 3WXWL 5T1KA 3TNNA 3H3PH 3PE9A 4YUEL 2GW5A 3BGMB 4GSQA 6TAAA 4APQD 2X7LB 1BAGA 5E8EB 4F91B 3SE4A 4ZAKA 4IRSA 1NAMH 1ZEAH 1WEJL 5J6GB 4HH8A 4KJYB 2XUWA 1UWGL 4L4TD 3L1OH 3V6OC 4QRRD 3C5ZC 4OB5H 4XO4A 4ODHH 2FJHB 3QIUA 4JFXA 1OCWL 3CHXA 4N1EA 4O4YH 2FQGA 2IGFH 4W6YB 3B6SB 5ELIA 5ESVB 1QW8A 4Y16C 3H53A 3BPCA 3TO4B 1L6XA 1CF8H 3Q3GB 2JI2A 3KBFA 3PIQB 2VABA 3UGXA 1AO7D 2YC1A 3IYLW 4L9LC 5JZ7C 4MJ5A 5LVEA 1C12A 1ND0A 1HHIB 3PPEA 3NIDF 1F18A 1JYXA 1C8QA 1EH9A 2ZXWB 3O6FD 3OKMB 4G8EB 3S96B 4HXBH 1LK3L 1NFAA 3TBSB 5KVEE 1BW8A 4NNYB 1D7BA 1N6QH 3ZZLA 2R23B 4Z7QE 3PCYA 2D8KA 3OJ2C 4LCWE 1PZDA 4RGMB 5D4QA 2WLKA 4B9GA 5KS9E 3LPGA 1G0XA 4Y5VC 1J87A 1NCAH 4PRBB 4AUJA 1G6RL 1W72L 3EYVA 3ZRSA 2DM3A 2C3WA 2VISA 3LKOA 3HN5A 2YBRA 5IW6B 1K8DA 1OCCB 3CZNA 1TSHA 4XC1L 5AKSA 4A04A 3QFJD 2W0KA 4HPYH 1A3RH 5E8DL 1REIA 4KXZI 4OJAA 4JJ5A 2B4CH 2E9JA 3DETC 4QWWC 3OMIB 1FG2B 5EU3A 2JJWA 3B9KD 3HZYB 1S7RB 4AGLA 2CGYA 3B5TA 2VT0A 5T1KB 3TNNB 3I74A 4K7PX 3G5ZB 1CLYH 2IANE 1U93A 2MRYA 4L5FE 3QWNA 4UNVA 3L4CA 3MPCA 1ONQB 2CDGA 2NNRA 3AWEA 5CN2A 5FYKE 4K7PY 2QSTA 3V0EA 5E6IC 1XGQA 2DWDA 5A3IC 4F57L 4IRSB 4NPJA 3VNYA 1R19A 5C7ZA 1BZQK 2WK2A 3ESPA 3RY6C 2ZKXA 4DTGL 4BCXA 1TZIB 3QIUB 5D1QE 3RWCA 4JFXB 2PABA 4P2QE 3CLEH 2Q7YA 1OAXL 2XI9A 3H4HA 3IU4H 2A9CA 2WSDA 3FPXA 4OVVA 3MREA 4LVOC 4UT7H 4HK0A 1G6RA 1W72A 5C08A 2F61A 2VABB 4DSYA 3DOIA 4MHHG 2E7HA 4YLBA 3ZL2A 5E6YA 2YC1B 3SKJH 2VXQL 5HDRA 2XDHA 4MJ5B 3GSXB 4ZMWA 3K6FA 1C12B 1ND0B 2DQDH 1EEUA 1WTGT 2CNZA 2D0FA 3WFZA 4G43B 3EO0A 5IB4A 3QIBD 1RHFA 2R15A 5HHPA 5DU7A 1A0QH 2XZQH 1I3RA 3QULB 4KZEL 1N0LA 2IJ0C 4E9RA 2IOOA 1U8MA 1E6JL 4FFVC 3QEQD 3BKCL 3U79A 4M1CD 4K8RC 4POUB 2ETWA 1DUYA 4J8RA 1AZZC 4KROC 4LCWD 5J11C 1OSPH 5CU5A 1X5FA 2O6DA 1AHWC 2QTEA 1UZ6E 5B22A 3VQ1C 5D4JA 4KRPD 3U9PL 4KX8A 3LMJL 3EYVB 1F4YL 1TJIL 3UBXA 1WFIA 5AOMA 3LKOB 3S0PA 1DCEA 3KDMA 1AR1C 1NCOA 2FATL 2EC9U 3QUXA 1OAZL 4H8WC 5DHMC 3T6ZA 2Z91A 4LIQH 5CJBA 1MCLA 4WDIA 1H3UA 2X4SA 4GUQA 1KOAA 4H88L 2VGLM 1ECYA 3IS0X 3SKNB 2BVOA 4IBLT 3G9VA 3N1MC 3K4AA 5EU3B 5LB1A 2VXQA 4G5ZH 1AHMA 3UC0L 4RWHA 3LKNA 3EHBD 1MY5A 4BZ2L 1U93B 3OG6B 1FL3A 3VD5A 5FYKD 1NLBH 2J8OA 3GJEB 4GKNA 3VX1A 5D1ZI 2NY3B 1GZQA 3ML8A 1XGQB 1YCSA 4KQ3L 4YGAB 5DWUH 5E9DA 4B0MB 4ZI8A 2F7IA 2WCPA 4HJEA 3P3SA 5E9NA 5I71C 3CUPA 4W9JC 1OE2A 3ES6A 3VDBA 4FMVA 5D1QD 3D69A 2EDYA 1CO1A 4LDCA 1MRDH 4P2QD 3GBLA 5DYFA 4AL8C 3ZDYE 1SMOA 1BLNA 1G6RB 1RZJC 1W72B 4J3OC 3HLAA 5C08B 1ZLUK 1RZKH 3I6KA 2CA3A 2AXFA 4M62L 1TTBA 3RY4A 1ASOA 4RA3A 4ZS6D 1HNFA 4IBQA 5ILTL 2VDKL 5ANME 5E4EC 4DEPC 2UUDK 3S3BB 3LHAA 3DUUB 4FAAB 3NZSA 3ZL4H 4ABWA 5HHPB 1NBQA 1I3RB 5AALA 1N0LB 4HCRH 4EI5C 4D0CA 2XXGA 1AE6L 1RXLA 2R1YB 4CADA 5E1QA 3RGBA 3QQ9D 3MU3A 4BZ2A 4DHLA 4AKOA 2ZCHH 4QNPE 4XX1G 2LLNA 1DUYB 2DDQL 3ZW3A 5EB9A 4H2CA 4J8RB 1IGCH 3MCLH 1M2OA 4S11A 3VTTA 3ARDD 3FQNA 3CH1A 4AE1A 3HI1A 2WVSA 5EUOB 3DI3B 1Q9KA 2FX8H 2JKXA 5BUPA 4I3RH 2OMUA 1T3FB 3KDMB 1J0YA 3I50H 4XE5B 1R5VA 4F2FA 3K5RA 3MV01 2Q7NA 3N6YA 4X7TA 5KW9H 3H3PL 1JK8A 1FV1A 4NQXA 4PY7A 1D3CA 2H0JA 4ZO9A 4AH2A 3GZQA 4WDIB 2X4SB 1JYVA 4GBXC 4Q14A 1LP9A 5A2AA 5I0ZA 5JPNA 3GRGA 4KV5E 4OUUA 4NAMA 3FFDA 2YSSA 2LU3A 1NAML 1KBGH 1ZEAL 5H94A 3L1OL 3LKNB 4Y2LA 4OB5L 4ODHL 2CHXA 5EZIH 1YY8A 4CW1A 1FL3B 4F8QA 3ARBC 2IGFL 4O4YL 4Y4KD 3U48A 4GKNB 1NGZB 3CZEA 1GZQB 1JMXA 1NIDA 2YAEA 1SEQH 3AWGA 4H1LG 1CF8L 4QPEA 3KR3H 3A6CH 1RK7A 5GXBB 2ENYA 3T0BA 2CZNA 1RIUH 3CUPB 3ES6B 3D69B 2AZAA 1KYAA 3FB7A 3GSRA 3ARQA 1IM3B 1ZK5A 1H9DA 5DHEA 2JCCE 3VMPA 4UBDC 4WWOA 4RZCA 3EDEA 3GMNA 1T2XA 2JJTC 2AXFB 3GSUA 4HXBL 4OJYA 3V0WH 3W11C 1KBBA 2HLFC 3BPLC 3MZGB 2WM0A 2K45A 3KYAA 2ITFA 1N6QL 2YPLA 4B3EA 1FYHB 1IVLA 3B2PA 4YC2C 3ECWA 2BNRA 1L9MA 5DF0A 5C0BA 4ODXA 2ZUQC 3HNTL 1H19A 4PY8I 1MCEA 3BQUA 3O0LA 1KIRB 1UHVA 1NCAL 3AXLB 5LBSH 2QLYA 2LU7A 1NAMA 2G9HB 2VLME 2PPCA 4HZ1A 3WHE0 4D0CB 1OAUH 4J2XA 3K6IA 4HMEA 5C07D 3VXUA 2X6CA 3QAZC 4EUPB 1BAFH 2FHFA 3MR9A 1S7TB 2ZAIA 5D7JA 1HYSC 3CH1B 4ES8A 3HI1B 4HPYL 1A3RL 2Q1EA 2ENPA 3IXTA 3MRQA 1Q9KB 2WQSA 3EAKA 2B4CL 2CR6A 2OMUB 1ITBB 2UX7A 5B1JC 4Z7OE 1CGUA 1TQVA 1CXFA 1VFBA 1R5VB 3BLPX 1HKFA 4P07A 4AVHA 3U83A 1CLYL 4JZJA 1FV1B 4AH2B 4Z3FA 2FE0A 1NBYB 3VVWA 1LP9B 2O6EA 3OD3A 3A3YB 4MYPA 5JPNB 3NQIA 4OUUB 5DJDA 3FFDB 1PKQA 2YSSB 3FPYA 3VXTB 3WKQA 3EH3B 3ZKXC 3VFPA 2VDKB 3R8QA 3PPSA 4J8QA 3IDGA 3UP1A 1OCOB 3ILDA 5IJCC 2SEBB 4BZ1A 1YY8B 1YPZE 3CLEL 3HHMA 1IE5A 4MRBA 3IU4L 3JZ7A 2A9ML 4NQVB 5ENWA 5TF1H 4XVOA 2H0FA 3BWUF 1KY7A 4KK9D 4UT7L 3D87B 1PG7W 1D5BA 4B0MM 1YUHA 5D1ZC 3SKJL 3FB7B 3GSRB 5FM8A 3ZE0E 1R5WA 2HFGH 1E2ZA 2DQDL 1VGEH 2J57A 3TN0D 4RZCB 5T3ZE 3I02A 3GMNB 4PUBH 3APDA 4B9KC 4XP5H 1KG0B 3RVWD 2X0WA 3KJ4B 1A0QL 1JDAA 3GSUB 2XZQL 3DIFA 3B3IA 3T65B 2G5BA 2I26N 2YPLB 3AG1B 2VXSH 3MLRH 1UCBH 2DKUA 2BNRB 4V1DE 3SDAD 4G7SB 1LE9A 2PWHA 3ROLA 5C0BB 3BRFA 1OSPL 3BQUB 4MJIB 1TUPA 4AQZA 2GIYA 4IHOA 5E4OA 4N0UA 1NAMB 2W60A 4RMBA 3NCYS 5HHMB 3QBTB 4XH2B 4HISA 5BRPA 1XEUA 1JI2A 2FB4H 3VXUB 3FAWA 3IDUA 3APMA 5E1IA 3MR9B 1EUUA 1PNDA 4IBTA 3VFNA 4ZSOA 1RQ5A 5D7JB 1QSEB 4ES9A 2H47C 1HZLA 3IXTB 3KBEA 3MRQB 4LIQL 8FABB 4NIKB 3BXNB 1E2WA 5AB0A 5JA8B 4BXVA 4DZBA 1GC1C 2CHDA 2DH3A 3O2WH 1GAFH 3UTSE 1JCKA 1VFBB 3F65A 3KGTA 5D2LA 4E9LA 4G5ZL 5ESQA 1FPTH 4X7EC 2GI0A 4U6VL 3MUJA 4Y19E 2ZOWA 1OD9A 4JZJB 1D7CA 2OMTA 2BNQE 2G5RA 2PCFB 3LH9A 5CR8A 3SYPA 2KZKA 4XN5A 5EZLB 1CD9B 1NLBL 3E8VA 3EJRA 1ZJAA 1OP5K 3QZWG 4LHUD 2H1LM 4AIZA 5DWUL 3SYCA 2FWSA 2NY5C 3EJSA 3VFPB 1UCTA 4LSQH 3MRPA 4I1NB 3U6XS 1YJDH 2UX6A 2X1PA 4NRXA 1J5IA 1MRDL 1PLGH 1QO3A 2H0PA 5AEAA 2Y1VA 3VACA 4X5LA 2VDNH 1TVHA 1BF8A 4RESB 2XKNA 1KXQE 4UDTA 4ZS7H 2GUYA 4PWJA 3GDBA 4OGZA 3W1ZA 3AS3A 3TLRA 3NK3A 2GBTA 1RZKL 3UAFA 4NRZA 2YKLH 3D4GA 1A6TA 3RTQC 3TVMC 4KKAC 3D5OF 3H3KA 4YPGB 2HT3C 4ZNCD 1CDGA 1QR4A 5T3ZD 3I02B 3JV6A 4LNRA 3UAJD 2XT1B 3T08A 3V9FA 1DJZA 4DK3A 3ZL4L 5AKRA 4UTAH 1KTDA 3OG4B 2R1WA 5TTRA 5AFAA 3DIFB 5D1XA 1INQB 4HCRL 4PJ7A 5AOKA 2G5BB 3UG4A 1YN7A 3DJRA 1JIBA 1WAAE 4AZ8A 4I89A 1MCBA 4JKPH 2ZCHL 4NKMA 1JV2A 2AJ3B 4RMWA 3WGVB 4DP9X 1LE9B 3ROLB 1IGCL 3MCLL 5DEZA 3OR7B 4U7MA 4XHQA 1UXMA 4TL4A 2Z8RA 4TNGA 5DJAB 1PKOA 1BYPA 1NEZA 2FX8L 4IHOB 1Q9LB 4N0UB 3JWOH 2W60B 2OXGB 3GZOA 4HD5A 4NCC2 4F7KA 1EHXA 3X1BA 3I50L 3SD5A 3HG0A 3VFNB 3U9WA 4OGAD 5KW9L 1WQVT 1CDUA 3EOBA 4PCTA 4M03A 5H35A 4A39A 1HL5A 1RFDH 5MP6H 1UM5L 3DECA 3QQDB 2ZKHH 1NDMA 4PJ8C 3QT2A 4ZUWA 2FT8A 4FE9A 5LGKA 3MRHB 1IL1A 4KFMA 4DZBB 1UXSA 3X1GA 1B6UA 4FKHA 4WFHE 4BK8A 3X11A 5D2LB 1I31A 5ESQB 3ARSA 1KBGL 3KJ6H 1VFOA 2K0RA 4BUQA 1DN2A 1F8TH 2V33A 3GMLA 3I3EA 3UJIH 1FQ9C 3UTOA 4XCNA 2OMTB 4H5SA 5EZIL 1YY9C 1A3LH 1SNRA 5KBPA 2DKMA 3MRKA 1F3DJ 2YA2A 2XV6B 3N85H 4JFFE 1SEQL 2MQ0A 4HCRA 3KR3L 3A6CL 4ZUTB 3SIKA 4HOMA 3MRPB 1RIUL 2EINB 1UT1A 1BZ7A 1CFMA 1NCIA 3P54A 3ARRA 3BEVA 4WTWA 2QHRH 4G8IA 4NZRH 5EU6A 4EOWH 4LSUH 1TVHB 3GJFH 2XKNB 2VDOH 3EDKA 2ICEC 4LPXA 4N20A 5KVDH 3TM6A 5B38G 3DX7A 2YAHA 3FUIA 1PAZA 2WCSA 2OTWA 3NEEA 3TEZA 35C8H 2VYRE 3V0WL 4CGUB 4N86A 1A6TB 4ORGA 2F8XC 2GQHA 1VRSA 2DWYA 4EPSA 4LFHD 2H32H 2FIRT 3QXAA 4GI6A 4WY7L 3IE9A 4I7ZC 1FHGA 3D30A 1UASA 4EDXA 3G6JA 4LNRB 4L1DA 1MHEB 2W0FB 1KTDB 2R1WB 3JUYA 4NAQA 5I66A 2QJDA 5GGTH 5LBSL 5HHQA 4PJ7B 3KLLA 4PJIE 1AP2A 1OAUL 1YN7B 2D7QA 3LYRA 4JO8A 1PD0A 1EEQA 1A7NH 4WNSA 4GT0A 4N6QA 4ANKA 3BEWB 1JV2B 1BAFL 1FFOB 3FO0H 4NKMB 4G72B 5EIIG 3U2SA 9CGTA 3RX9A 5HDOA 3QXDA 4PVLA 4FOMA 5CZKA 1ESOA 3RIFF 1YSOA 1DJSA 1DVZA 1NEZB 4MNGB 3VMNA 3GIVB 4TVSa 3KYMA 3BIBX 3EF7A 4R3SB 5INCB 4YWGL 4N26A 3SPHA 1XR9A 3RGVD 1B0GB 1E4HA 3B56A 4R7XA 12E8H 3HZVB 4FL4B 4OGYL 2NYYC 3EOBB 4XVSH 5H35B 1KPUB 2XICA 4X4ME 1IL1B 4WTZG 3TO2A 4FABH 3X11B 1F13A 3B1UA 3GZKA 4LRNH 3QDJA 1HTYA 1J0ZA 5SWZE 3GMLB 7CGTA 3MBEC 1T6WA 4U1GC 4XCNB 3OR6B 2X3AA 4H5SB 1OTSC 1XH3A 5DO2C 2A0LD 3MRKB 4DUVA 4UV4H 4EZJA 5TF1L 3RIKA 4U4BA 5CCKH 2XY2A 4AK2A 4TTGA 3KWTA 4R0LC 2OFQA 4DN3H 2WOBA 3QEGH 3I9GH 3EKCA 5TDOA 4R5TA 1BZ7B 2IAMB 1ZTXH 3JVFC 4XXCA 5TD4A 3VCLB 2OR8A 3BEVB 2CRYA 4G8IB 3TX4A 4MB4A 4N0YH 1OZTG 2HFGL 3VXQA 3IDMA 1VGEL 2Q9OA 4PUBL 1SJHB 4XP5L 2J2ZA 2HT4D 2UY6A 3L5IA 3MRMB 2A73A 2DF3A 4PRIA 5MENA 2W81C 4XO3A 2AABL 4ORGB 3CDGA 5F21B 1RIVH 1KN4H 2VR9A 3JWDH 2VXSL 5C0CD 3MLRL 1UCBL 4PW9A 4EDXB 3G6JB 5INDB 2HTKD 3L8QA 1RU9H 4FXKB 4Z7AA 1NZRA 5TDPA 4HHAB 5I66B 5LCVH 5HHQB 3ARYA 1WS7A 4PRPA 1AP2B 4AEIH 5IFAH 4WEBH 3KPSB 3FF7A 4OIFA 2EKJA 1ZLDA 2ZKWA 2FB4L 1CXKA 2HVKB 1EXUA 3F6LA 2WLIA 1LO2H 4P46C 2EIZA 3ZMNA 4AYMC 5HYSG 4G5AA 2OMBA 3SBPA 3P30H 3VGDA 2CR0A 4AIEA 5IW1B 4U6YB 3KYMB 3L17A 1M1SA 3TFKD 1XR9B 3O2WL 3MUZ1 1GAFL 4LF3A 2FGWH 3HRZC 3UYPB 1G7MA 1FPTL 2GSIB 2NY2C 3LV3A 1JMZA 4RSVA 4TUKH 2NT0A 2Y22A 4M56A 5AQ0A 4PJ5A 3VQMA 5GS3A 5I15H 1OT1A 3GM0A 4QRPD 1N64H 2WZ6A 3TO2B 1XF2A 3ZKND 2ZWKA 4J3XA 5TQ0H 3K8KA 5B8CA 1IGJA 4W4OA 1KYOJ 5F7UA 3EDDA 4LSQL 1TTRA 4DGIH 1T1WA 1YJDL 3F7KA 3TH4T 2ADJA 1XH3B 3IFNH 5JPMA 1PLGL 3QZWA 2VQTA 4EJ1C 1KZYA 1ZK9A 2VDNL 1ZDSA 4OQTH 1TTGA 5FM5O 4M7LH 4ZS7L 2ALAA 2KQNA 1XB6A 2X1WL 3K8MA 2OJ1A 1JWSA 1P6FA 2XN1A 4GAJH 3TEUA 3MCKA 3DOSA 5TDOB 4YXLL 4ZOEA 1HE7A 4M4PA 4AIXA 3B83A 1KBPA 4UOW0 3VXQB 3IDMB 4WI0A 2OMXA 3L6FA 4HG4J 3QISA 2QFRA 1HU8A 1DVXA 1TQUA 2J2ZB 4UTAL 2A73B 3KM2A 2WKLA 2XKSA 3O3DA 2RH0A 3C6SA 4JL1A 3A4FA 4AJWA 4M7KH 4JKPL 2R1XB 2KDYA 3O6KH 5JIQA 2PTTA 2BSSB 3QI9A 2G3ZA 3IPEA 4MQXD 4XPAH 5TDPB 1KB3A 1BVLA 3FU3A 3NAAH 4XNBA 3UTQA 2OM5A 1SDYA 2VE6A 3MUUA 4HCIA 3JWOL 3GC3A 3LEYH 4TV3A 5DC0A 4F24A 3Q8EA 1SDAB 4WF7A 3P9LA 1UWXK 5EDSA 2WWMC 2W59A 1JZ5A 1EXUB 4PP2A 4OH2A 3MXWH 2WLIB 4NQEE 5SX4H 4FQCH 3O3BA 4IQHA 1SVZA 4L8DA 1RFDL 5MP6L 4IK7A 5LN8A 2BIMA 2ZKHL 3P4MA 1N10A 1HVXA 1JZJA 1P6WA 2K78A 4H0IA 4XN9A 4APQC 4NENB 1XT5A 4WUUA 4GXUM 4NOFA 5C3LD 3X3GH 3QO1B 2CU9A 4OCRH 4HIQA 3E38A 1G7MB 1AH1A 1F8TL 5G4NA 5J89A 3LV3B 4FCHA 3UJIL 4ZUSA 3T1WA 2NY6C 2VDRH 4X6DA 4NI6A 2IBZY 1A3LL 4PJ5B 4JG0H 4TMPA 2XBZA 4UTAA 3D25A 4L3FA 1Q94A 1XF2B 3N85L 2QSCH 2XJLA 5B8CB 1IGJB 5C0AD 4XMWA 4WEEA 1T1WB 2TAAA 4DW2H 2ADJB 2WGXA 1MCRA 5JPMB 4C47A 2QHRL 3QZWB 4NZRL 4EOWL 4Y4FC 4GJTB 4LSUL 2XZZA 5BVPH 4MXVE 5AW5B 1DFBH 2VDOL 5DR5H 4Y0GA 4LZKA 1PZUB 5CZVH 5KVDL 5F0JB 4WJ5B 2J8UA 4R26H 3DOSB 2XTJD 4F92B 35C8L 2CK2A 4IBVA 1CMOA 4A2GA 1NCJA 4FXGA 5GRUH 5B38A 3EW3B 5HJGA 4WI0B 2CG9X 2OMXB 3L6FB 1XF5A 5DQJA 5FCSH 4XHJD 2BMKA 4NWTH 2X3BA 4UB0L 2CDEB 2X4TA 1MCKA 5GGTL 1EHLH 5IOKA 2EDHA 2IMNA 4L1SA 3O3DB 4GO6B 2F19H 3QUGA 5DK2B 4M48H 3C6SB 3OLDA 1A7NL 3ZTNL 1NGQH 1VF5C 2FQFA 2GIXA 4BUHA 4ZO8A 2JJVA 3FO0L 1ZLWK 2PTTB 5F0PB 3QI9B 4MA1B 5HJBA 2LFGA 5D7IE 1KNOB 2AQNA 2YPVH 3EDJA 1BVLB 3H2QA 4ONHA 3UTQB 2Q86B 4JY4B 1N8OE 1EZUA 5IM7B 3Q8FA 4PJXE 2ESVA 1M9SA 1UD4A 5KJ4A 1DE4B 3B9KC 1OM3H 4PP2B 4Q58C 12E8L 4NQED 1BVNP 1PCXA 2VDNB 3GJFA 1L5GA 4XVSL 2VJ0A 5AL8A 1OTUD 2FX9H 5T5NG 3P4MB 3D07A 1FORH 4WAFA 4RNRA 4WK4B 3REVA 2WLJA 4JY6A 4FABL 3P4NA 1J1PH 2HPOA 3FN0H 4PMFA 4LRNL 2DV6A 2X4NB 4YSQA 3BI9X 5CJQH 2H32A 2VO8A 4W9FC 2CGRH 4AEEA 4X6DB 4PR5A 4WTZA 3QWQB 3ALWA 4I87A 3BWAA 3S3DB 1AKPA 2PWEA 4KOBA 4U0QB 4GSDH 4UV4L 3D25B 4ZMYA 1Q94B 1HDMB 1JGEA 2GBVA 5GGTA 5CCKL 1NBZA 1OPOA 4DN3L 2QQKH 5C97A 3QEGL 3I9GL 4FXTA 3K4ZA 4GIOA 5AAPA 2HX8A 1JGDA 1ZTXL 3FFCE 1GOHA 1KBVA 2XV3A 1JG9A 3BSZH 3W9DA 1JTTA 4N0YL 4LDLB 4F93B 1U8NA 4KY1H 1XXDC 3CFEA 3W0WE 2BY0A 2J8UB 3QIBC 3DUSB 5A16A 1LDSA 4FXGB 1RIVL 3VWKA 1KN4L 3W38A 2GYSA 2P42B 3DKHA 3JWDL 2BIHA 1FH5H 4Q8BA 3PXLA 4M1CC 4QO1A 2W92A 4BRVA 3OSVA 1XF5B 3CLWA 5DQJB 1WYJA 5IIEA 5KSUA 1RU9L 3UDWC 5E4AA 2IC2A 2FIKA 1IO4C 4BHUI 5LCVL 1X4YA 4KRPC 3BVDB 4XVUC 5IFAL 4AEIL 1WP6A 4WEBL 3FXIC 3W56A 5CGMA 2DLIA 1CL7I 4XRCA 4AEFA 1IAII 2OW7A 1LO2L 2FNBA 4PGBB 5AYUH 5DZAA 4P9HL 4ONHB 1T66D 3P30L 4R83A 2VERA 4I2XA 2O6CA 4LSDA 1O5DT 3D51A 2XVBA 1YC7A 3WTWA 3EG9A 1Y1DA 2XBTA 3U6RB 5HYSA 1KBKA 2FGWL 3MV9A 3GXNA 1MHCA 4IJ3B 4Z95H 4LLQA 3NDZE 5J13B 1L5GB 4N0FA 1T6VN 2VDOB 3EHBC 3GNMH 4TUKL 4OJCA 1ZV5A 3KYNB 3ZDZF 5I15L 2Z35A 4J2QA 4ZD3H 4RNRB 1N64L 3REVB 4P23A 5EO9A 2JKJA 3P4NB 3QQ3A 3E2HC 4FG4A 5TQ0L 2H32B 3D08A 2OV0A 1H0DA 1FGNH 4FERA 4DGIL 4A7QA 1BG9A 4PR5B 5D1QC 3IFNL 3BWAB 2D31A 3G7TA 3Q1EA 4N87A 4AQ1A 4OQTL 1A8JH 1AANA 4M7LL 5LCVA 1NBZB 3ARPA 3S4SA 4GAJL 5E2TH 3WO4B 1JGDB 3BT0A 3UMNA 4ZS6C 2UWEE 3TBYA 3V0JA 2EVIA 4QAWA 4S1QH 4ODUB 4ZXBB 1ZVNA 3FB8A 4C56E 5SWSE 1A21A 2F8IA 2EDQA 2W80C 3HKFA 1U8NB 3MV8E 4PS4H 4EVNA 3SOTA 5C8JA 3NUKA 4NKDB 1E3XA 2WW8A 3CFEB 4HJTA 4JB9H 4KX7A 3IF1A 2IXQA 4X4XB 1DUZA 2ZCLH 2NY0B 1GOFA 3ARVA 2YLHA 2NY7H 3TBCA 2KPWA 2PWDA 2WIMA 4WI5A 7TAAA 4WFGD 4S0HA 4GG6A 3WNPA 1RVFH 3KVDD 2DYPB 1OF0A 1KJMA 3P77B 4M7KL 4LSTH 4QO1B 2Y5EA 3S3CB 2X38A 3O6KL 4XB7A 4MNQA 5IIEB 1T20B 4XPAL 3ARDC 1UD2A 4XMUA 5KSUB 3ECVA 3GLAA 3NAAL 4TNWF 2FIKB 1QWNA 4UTBH 4JHBA 1IARB 4ZYKB 3TA3B 4GO8A 3UG5A 2I60H 3LEYL 3QZNA 4UNIA 4OLWH 1HHJB 1NCHA 3DXAA 4CDGC 1RK0B 2VLKB 4XRCB 5LBVA 4K8RH 2L8AA 4FQCL 3BD5A 3L81A 4UQEA 4OQTA 3CFJA 4HAGA 3FRUA 4I2XB 2EDBA 3SGDI 1JOIA 2QKIA 1BEXA 3EG9B 3X3GL 5HYSB 1CICB 4OCRL 3IWUA 5IMOA 3MV9B 3N41B 1MHCB 2AJVH 4LLQB 2AJSH 1J0KA 4N0FB 2VDRL 1T83C 3L2LA 4GMSH 2ZPKH 3H3BC 1PU0A 2APSA 1CBJA 3K1DA 3QS3A 4H8WH 5FB8A 4JG0L 2AEWA 4PLKC 5KSBA 2Z35B 4K71C 4IU3A 4Y4KC 5HHNA 4P23B 5EO9B 2DWTA 2QSVA 3GKWH 1TZGH 2QSCL 3ZX1A 3QQ3B 3G5VA 4YFLI 3F3HA 4PN6A 1H0DB 2QL1A 1A6PA 3JVGC 3QR2A 4DW2L 5BXFA 2F0CA 5F9WB 3D0LA 2D31B 4RMSA 4Z7WA 2APXA 1U4EA 2B08A 4WI9A 4NQDA 4AQ1B 5BVPL 3L3HA 1DFBL 1FJ1A 2YJLA 5CJ8A 3ESUF 3IPFA 5DR5L 3TCTA 5L8KB 3F58H 3DYMA 4QDGA 5CZVL 5KANI 2TRYA 1QW9A 3S4SB 5IMLB 4R26L 3M86A 1J1OH 1KFAH 1TYEB 5HDQH 3TBYB 4GPVA 3O3EB 5GRUL 3WIFB 1V8HA 3FUJA 3P4LA 3FCSA 2VAJA 3B9VA 4P2OD 4BBWA 1I7ZA 1JZ3A 4AL8H 4FI8A 4NX0A 2C34A 4U31A 5JHMA 2IXQB 5F89A 4NWTL 1DUZB 1RZJH 5JA9A 1IC1A 4ZZFA 1EHLL 2NX5E 3GK8H 1KTCA 1H3VA 2F19L 1OHQA 4M48L 4L0YA 2WBWB 1KJMB 3QORA 1NGQL 2VWEE 5DEFA 4G7RB 3REWB 4F9PA 2GCYB 4DKTA 1BQHG 3RPBA 1YZZA 3IJHA 1XV8A 1MJ8H 1HS6A 2YPVL 4PJFA 1U8OA 4JFZH 4YLQT 1F56A 1X9LA 4EZKA 5K69A 4HPHA 1HXMA 3BZ4B 4FHJA 3KBPA 3QR1A 3E3QE 1HZKA 1OM3L 3S3JA 2JQZA 5DVOA 1ORSA 2FJSA 3ETBJ 1ZJBA 5CINH 3AZUA 5CGBA 4OZIE 5LHDA 5LGJA 1NGPH 2FX9L 4LPVA 3FRUB 1AY1H 2P8PB 2MKWA 1FORL 3I9AA 1IEAA 4WNJA 2QKIB 1CFQA 3PDOA 2P8MA 1OD7A 2Z8WC 2QV2A 3OJDA 3D0VB 3SY6A 4D0DB 1J1PL 3FN0L 5IMOB 4PY8J 1BZ8A 2RD0A 4FQJH 5CJQL 3TYGH 5C6TH 1FG9C 2CGRL 2ZTBA 4HCFA 4NLHA 5FYLH 2VC2H 3HAEB 1MZYA 5I1KH 2FO8A 4AQ8A 4NC1E 3BAIA 4GSDL 5HHNB 1I8LC 4NO5B 1NMCB 1YEEH 3OMAB 3G5VB 4KK9C 2QQKL 2DMCA 2KMWA 3B9DA 4L8CA 3VI3E 3RQ3A 3GS7A 3FT4A 3HE7D 3BSZL 2ZICA 4C8XA 2YPVA 1FJ1B 2ZX5A 4KY1L 2TSBA 1P7QA 2BSED 5DJCA 3BLKA 3BPNC 3VFRB 2E7MA 2ORBH 3D3VE 3RVWC 3BPOB 3DBSA 5CJXC 5DC9B 3HS0B 5DZOA 1WFMA 4CILA 2YFNA 3FCSB 2VB5A 4JFPA 4A68A 4NRYA 1IM3D 1FH5L 1I7ZB 1KYUA 3WL9A 2YRZA 4FQXA 2CIIB 5K39B 3SDAC 4GYBA 4WKXA 2IV8A 4LDEB 4DF9A 4YVUA 4KTEH 5F89B 3FTVA 4LL9A 4MVBD 4L3CA 3JXAA 5GGUA 2P44B 3VFVA 3IJYA 2VM9A 4HKXA 1CD8A 4B95C 1BQSA 4TUJA 5FGBA 2VDRB 5DEFB 1DO5A 2PW1A 1XF3A 2MOGA 3IJHB 1KN2H 5AYUL 5KVFH 2Y5TA 4R7NB 4PJFB 3N1GC 4QY8A 4Q52A 2H3NA 4GG6F 1FHNA 2Z0UA 3EYUH 5HI5D 4YR6A 3F7YA 4OLVH 4AJ0A 3T8VA 3V6OA 3KZ8A 5HTSA 3C5ZA 3DGGA 3BSZA 1ORSB 3ULUF 4Z95L 5AW4B 2R2EB 2HFFA 4Z78A 1FZKA 5GS1A 1IC0A 1W0WB 1QSEE 1B4JH 3ECBA 3TH3T 3GI9H 1M42A 4Y16A 1IEAB 2ZUVA 1CFQB 4ZD3L 2P8MB 4NXSA 3OJDB 1L7IH 4X5RA 4LGSB 2I7OA 1KV3A 5DYOA 4CKQA 5IJKC 1A47A 1A4KA 4L9LA 1G0DA 1MKFA 1FGNL 4XR8C 2EXSA 4RIRA 4QLWA 3DGDA 5AVWB 4MJ6A 5J1TC 4IRJC 4HT1H 5HVHB 3QG6B 1OV8A 1SYSA 4YSTA 2ZQKA 5A2KH 1T0PB 2R59A 3SE9H 2YN3A 3ATAA 1EJFA 1D5XB 2E9GA 4WU5B 1ZLUH 1QPKA 4BCZA 5E2TL 1U0QA 2KDGA 3WFDH 3FT4B 5KSBF 2Q7AA 3DJZA 5CHNA 1BZEA 4S1QL 4UU9B 4G9DA 4LLAA 3TJHD 1A1OA 2K8QA 2Y5QA 4A67A 4PS4L 2UUDH 5B21A 4TNVF 3TPKA 1C5CH 4CBPA 4P5KA 4MMZC 1P7QB 5BZZA 4JB9L 3E8UH 4WLCA 5DJCB 3UAJC 1JXJA 4A6YH 5IWLC 3D3VD 1XCWA 3OWRA 2ZCLL 1NOLA 2JF1A 5EORH 2CLRA 2NY7L 4Z7WF 1HNGA 3NT0A 3F00A 3VGBA 2J25A 4IU2B 1R17A 1RVFL 1EDQA 4JFPB 4Q89A 4NRYB 2P52A 3WL9B 4FQXB 4LSTL 2WLZA 4MB3A 4YSEA 4GRLC 5F9JA 5DVKA 1XR8A 3OM3B 5GGUB 4G83A 4GP8B 4AQOA 4EBQL 4UTBL 2OX5B 1WE5A 2YXWA 3VFVB 2I60L 2ENQA 4HKXB 3THMH 4TUJB 4OLWL 3DGCR 3FBQA 3LNFA 4Q2ZA 2PW1B 1QVOA 1XF3B 1L9PA 3RAJH 3VRLE 1G9EA 2EEFA 1ACXA 2QQQA 4OGAC 1TT6A 2BNRD 4K8RL 4ICXA 1DBAH 4QY8B 3OC8A 3BQUD 5B39G 2B59B 5E6IA 4MJID 4W81A 4IMKC 4YR6B 3F7YB 3UGUA 4HZLB 5GRZA 5HHMD 2APFA 3RY6A 4QXGH 4PJFF 3C5ZB 3VXUD 2P7TA 5SWQA 2AJVL 2AJSL 1Z9LA 2A3TA 4GXUN 2HFFB 3FUMA 5TQ2H 4GMSL 1SHXA 4QF1A 2ZPKL 4H8WL 1QSED 3QUYC 4Y16B 1OGTA 5FW6A 1GYUA 3DIVA 1OB1B 2MJWA 3SDCD 4LLMA 3GKWL 1TZGL 5FDYA 4BELD 5AVYB 2J21A 3FUNA 1HH9A 2QZQA 1GC1H 5LKNA 3PUCA 4PV8A 1A4KB 4QCIA 4L9LB 1VLXA 4IBUA 4RIRB 4DP4X 1XTLA 2J1ZA 2AKRA 3NEXA 3TP4A 1DQVA 1SYSB 3SJVE 5BMFH 4Q6KA 3LN5A 1LE5A 5T5NF 2R69H 3RVTC 1Z3GH 5CLZA 1QHOA 2XWBB 3QA3A 2KLSA 1NFDA 4ANWA 1J1OL 2NY5H 4CRPA 1MY7A 3KPQA 1KFAL 5HDQL 1BVNT 2I69A 5CHNB 5CKGA 3K2MC 2QLVB 1IAKA 1IFRA 4HLJA 3GMRA 1ZSHA 5GISH 5IB2B 4P5KB 1K8IB 5ICXA 4Y5VB 5HSFA 1AHWA 3BMWA 1BZOA 2F7QA 5EBLB 2A77H 4EDWH 1RZJL 3MYJA 2Q2EB 3HG3A 5CEZE 1CD0A 5E5LA 3GK8L 5D8JH 4EKXA 3TF7C 2EDRA 1I1CA 2RTTA 1JPSH 1RMFH 2E75C 4NSKA 4U3XA 3MNWB 2HZHA 2X05A 1GSMA 5LXGH 4UAOC 1MJ8L 2AK4A 3DA0A 4NC0B 1A7OH 1XR8B 3BDXA 4JFZL 4X4ZA 1KACB 1KENH 1TIUA 3EGDA 1KUMA 3FO1A 1B90A 3IETA 4KKCD 4KVCH 4UMSA 1PIFA</