4CC0A

Notch ligand, jagged-1, contains an n-terminal c2 domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
306
structure length
306
Chain Sequence
SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN JAGGED-1
publication title Structural Analysis Uncovers Lipid-Binding Properties of Notch Ligands
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc0A01
4CBZA 4CC1A 4XBMA 4CC0A
chains in the Genus database with same CATH superfamily
2EIKB 5JNYB 2I27N 3APFA 4QHLA 4FNRA 5FUCC 2GT9B 2UVFA 1CK0H 1N18A 1P7KA 1AIFA 3D0VB 5CEZL 1MJ7L 1Z3GH 2Z7ZA 4J3XA 1EK3A 3C12A 3MFGB 4NQVA 2CLRB 3EO0B 5T1DH 3TBCA 1COBA 4YGAB 1I9IL 2IEPA 4N0UA 4MVBC 4WI2A 1IAOA 3VGHA 3WAKA 4AIZB 4MQTB 1X5KA 2CBPA 1QR1B 1KGCE 3FQTB 2QBWA 3OAWA 7FABH 1QHOA 2B4CH 5JQIB 1CICC 2HFTA 5B38B 3GBNH 4Z77A 3O6MH 3JVFC 3UTSD 3VW3L 4PBDA 5ISZE 5D1XD 3QEGH 3VWKB 5GS1A 3MGOB 5C0JB 1KYOK 1BF5A 3B9KA 3BH8B 4OLXH 2UUDK 4HT1L 2PWDA 3T3PB 4HMDA 1NGWB 5H4YA 4J4PA 5J11C 2J8OA 1PMYA 3MPCA 1NBVH 3WD5H 1G7HA 3JXAA 4DCQB 1IKFH 5ANME 4KROB 5F8QC 3VFWA 4G8EA 4P0DA 1ZT4A 1DZBA 1TJMA 1ACCA 5AVXB 1JVLA 2ZCHH 3L4UA 2ZZUT 5AL0A 5LQBH 1XGQA 2BS9A 2DYPB 2IAMB 4AQAB 4LQFH 4CGUB 4YDVB 2XPYA 4NQTA 3QXAA 5T3XE 1RZJC 3ZT7A 3IJYA 1E5BA 2VRAA 4P48A 3UYPA 3FQWB 3MJ6A 4Y19E 4TUJB 4V1DB 4NC1E 1IGIH 4YHLH 4L4VB 1TXKA 3VD0A 4Z7WB 4GBXD 1K8DB 4OCYH 1EBAA 1WZLA 4UQ3B 1J8HB 4A68A 4LEXL 3HE7C 3QXUA 4W9HC 5E7FA 1GPOL 3L3JA 2IMNA 3PHSA 4DERA 4ZNEE 4JG1L 4IOFD 3NH7L 2YMTA 3VGAB 1RXLA 5KJ7E 4PCYA 4URTB 4KUZL 5F1NB 3ML9A 4M29A 3WY4A 1K2DA 2E9GA 2GSMB 2Z0UA 4K23H 4HX1A 1DO6A 2Y72A 2DQGH 4HEPG 3AREB 4MZIA 5GGSB 4M62L 5DD5H 1U3NA 2XSKA 5DZAA 1JWUA 1FIEA 2C3HA 3OG6B 3RA7L 4B96A 2HYMA 2JELL 3REVB 1PJWA 2K8MA 4K7PH 4XO4A 3K6IA 5HJBA 4XX5A 4NZRL 3E3QE 3HTLX 4MJHA 3OGCA 4N5ED 3IJHB 4PSRA 4ZUSA 2D73A 3VJ6B 1DVXA 5DMIL 5HDBB 3BUTA 2K6YA 5E6IA 2XYCA 1ZTXH 4F2MB 5ID0B 1NCBL 1QVOB 2BCKB 3ZSSA 2WXLA 1IGCL 4PJDF 4HS3A 4L05A 4F8TA 3GNML 5D7LE 3QHFH 3BP4A 5I19H 3VI4E 4B9ZA 4QLWA 4TLKA 4KHXL 2R15A 3RBSA 2F5AL 2OSXA 4X2UA 4HIXL 3QFGA 4P4KC 4QRSB 3T0EE 5AZ2H 5EC1B 1U92B 1RULH 2I5YL 3GI9H 3H4FA 2F19H 2FYYB 3CX5K 3RYMA 5AW2B 3GMMA 5AD0B 2HWZL 1U95A 1Z0MA 4OD2A 4H0GA 4PAZA 1UXWA 3SJVE 1FLTX 2FJGB 2F74B 2XN2A 1KB5L 4OV5A 5LDSA 3RVWD 2DAVA 1A1OB 3F65A 3V5DA 3F7VA 1REIA 5J56B 3IT8D 3MX0A 4W9KC 4I0PB 1NEPA 1AGFB 2WJ5A 3O45A 1UUSA 2VE6B 4TKWA 3HRZA 3FTWA 4ZUTA 4LARL 5ABAA 2VQ1B 2F61A 1E7VA 5E1IA 1FAIH 5INCB 5IW1A 4HDIA 1AMYA 5KS9F 4L0YA 4E42A 2P24B 4GIAA 3DX7A 4U6XA 3GPEA 4WQOA 2MIZA 5EEXA 25C8L 43C9B 3LNHA 5GIRB 4P59L 4AM0Q 5DVPA 1YY8B 1BXXA 3VXQA 3K5SA 2WKOA 1CDUA 2XFXB 1HWHB 2LGNA 3MRFB 4OZIA 1GCFA 1KBWA 1UWGL 2VXSL 3HCVB 5BJTB 4PI0A 1KDIA 1K3IA 4WFED 5DMJB 3ZDXB 4AT6B 1J5HA 4F7MB 2R83A 3HNTL 4XNBA 3CLWA 1E90A 4TTDC 3DX3A 1XIWA 4JFWA 1IFHH 4H8HA 4K07A 3SE6A 4B9KC 3QCTH 3SY6A 1ILUA 1YEHL 3VUAA 5J13C 2XQBL 3NFNA 3QIUD 2PO6A 4TRPH 3IDMA 1LILA 1GRWA 1ZK5A 1YJDC 4O2FB 2WUBL 4J4PC 1PNCA 2FR4A 2YWYA 1KC5H 4ZXBA 1UD4A 2VXUH 1E9OB 4HCRL 1YNLH 2J6WA 4M6OL 3GMLA 2C9VA 4BCYA 4GIOA 1JGDA 3PGFH 4Y5XC 5E08L 2D3VA 5DS8A 5F1KC 4F15B 2CR3A 2DQHL 2R29L 2ARJA 4JG5A 4PRBA 3UX9B 2J4WH 4PGJA 4MCYB 3FSZA 4R0LB 3R4DA 4AYGA 4YQXL 2XWDA 4HC1A 5CEYA 1IILE 4NBZB 5AKTA 1QHQA 2WGXA 1LO5A 2AJSH 4WHCA 5F7DB 3TN0C 1CDHA 1BJMA 4DN3L 2VITA 5FYJH 5HGDB 5MI0C 3V6ZA 3UAFA 2OMXB 4G43A 4KTEH 4ODUB 4D0BB 1I8MA 3QUXD 5CCKL 2JKRM 5ICZA 2MHAA 2GBTA 3QORC 4BZ1L 4UTAH 1BPVA 1GJUA 3HJ0A 3M07A 3FQXA 4MA3B 1UOLA 1A6VL 1TNMA 1FGVH 1H8OA 3CK0H 4NB7A 2FQGA 2CJTA 4EDWH 2HFFB 3N6YA 4DHLA 1NUNB 3HBPA 4HIPA 1X5LA 3CVIL 2OXGB 3GLZA 2NNFA 1WE5A 2XZCL 3PQYA 4GS7B 1YEEH 3FZUD 4D0DA 2DM2A 2XG4B 3BQVA 4KAQL 3QDAA 4QJ5B 2X89D 1P6FA 2MOQA 3QJSB 3TO4A 5CCGE 2LABA 4H88L 4EUPH 3FN3A 5I76B 2BHUA 4RMSA 1AXSA 1RIUH 3EBGA 3UCQA 4LLDA 1JNHB 3ARQA 4JRXB 4OU3A 3V10A 1EHLH 4UYQA 5CU5A 1A7RL 5DQ9A 3SYCA 3ZMNA 1LMIA 3K1DA 1YNTA 4LNVA 1KBGH 3FF8A 4UDTB 1D2OA 1J0JA 32C2A 3ETBJ 3CVBA 3OR7B 4EI5B 1SDDB 3MJ9L 3F6LA 5E6IC 2PW1A 3FCSA 1SPDA 2VJ0A 3MV8B 5B1JC 1FZJA 5J12C 5LLIC 1A5FL 5E8DL 4R9HA 5I82A 1E42A 5TQ2H 5E2UL 4N0RA 4E5XA 1MCJA 3ARFD 1S7RB 2V2WB 3CX2A 5J57B 4QRQB 5K1VA 3W9DA 3FUIA 4BQ9A 1QYGH 3FO2A 3X2QB 4YFDB 4EXPX 3QDMA 2UVEA 2OFQA 2F7QA 4RDQF 3DPDA 4CDGC 3F58L 4Q0XH 3MJ7A 4L3EA 3O81A 4IU3A 2QZQA 4JDZA 4X6CB 5I0YA 3GSOA 3ZE2B 5DMKB 3RUGE 1GSMA 1CLYL 2E7HA 3FOLA 2ICWJ 3EJYD 3VI3E 2MKWA 5T1KB 4XN4A 2YSTA 5LGJA 3FDWA 3LMJH 4YN3A 4NQEB 3RVUC 4FYSA 4X6DA 1BVKA 5FFGA 4Q9RH 1L7TH 1AZCA 1MH5A 1ZS2A 3EYUL 3L3GB 1SJEA 5IVXE 3ALXA 4YHIB 5FYLL 3LEYL 1ZLVK 3I6SA 4NRYA 5SX5K 2NY6C 1LQBC 2ENSA 1C9SA 4BCXA 4JZOB 1AYOA 2PYEB 1P1VA 5BZDB 4B9PA 2ESVD 4FXGA 4PJ7F 4O02A 1AE6L 1DVYA 1QACA 3II2A 4KK6D 4B0MB 4OFKA 4BIKA 1EDHA 3VFVB 1SM3L 2CQVA 3AWFA 4GAGL 3U9UA 5GS2H 4HSQA 4M1DL 1XIWC 1JE6A 1XSKA 4OVUA 5EBMB 3NN8B 5C0IB 4GUPB 3BZ5A 5L0QB 2XQ0A 4DP9X 1YECL 4R83A 3IFOB 3B2UD 2EEBA 4IIZA 5DEGB 4EOWL 3AXLA 4G42B 4ATWA 1WS7A 1TU2B 2PO6C 2PPDA 4ZFGH 1J10A 3I9GH 5HHQB 3H9YA 4DW2L 4AYFB 1YEFH 3IK2A 4PB0H 1FZKA 3HLKA 1DANU 1W9XA 5CLTA 4ZXBC 3ISWA 1QUPA 4KKAD 5FX3A 4HWUA 4PSPA 4RESB 3WS3A 3GSXA 3Q8AA 4DKDC 4H40A 3APMA 3ZHLA 5KSBA 4BBWA 3LHAA 3BSZH 2RBLA 3LQAL 3QUZD 4C56E 5DHYB 1ORSB 1JXGA 1M7XA 3PXJA 4FE9A 2D7TH 2J57A 3LKPB 4PRIE 3OD3A 1W16A 5K59F 4N2FA 3QH3A 3ROLA 2GPZA 4OFYD 5C0CE 4PRPE 1NDGA 3WDIA 3QIWA 4EF3A 2K4AA 1E43A 3OV6A 4YSCA 2BNRE 1VAHA 2OR9H 5L9DL 2O6DA 1ZVSB 1BFOA 1DJIA 1OCCB 3MZTA 3JWNE 1IUZA 2PWGA 4PVNA 8FABA 4NC2B 3Q01A 1WVZA 3GRWL 3ULVD 4F7EA 2X41A 4U6HB 1HNGA 1ID5I 1MJ7H 1PJ9A 4H5SB 2ZUWA 4C83B 5CEZH 1LP9E 4EUPB 2H41A 1MEXL 1FRGL 1UB6A 2E7BA 4E41A 4AZUA 1AP2A 4PJCA 1CR9L 4F2EA 4UAHA 1RZ8B 4IBVA 1T1ZB 4WI3A 1A9EA 5EN2A 4EN3D 1IKNC 1I3VA 1KZYA 4Y9BA 4LHUD 4N3TA 1C7TA 2AZUA 1A65A 2EDKA 4MAYD 4Y8AA 3VW3H 1FA4A 3E8VA 2EXSA 3QNFA 3DX8A 1JCKA 3FSOA 3MQIA 1QAWA 3LN5A 3PREA 4MBRA 4LMQI 4G6AC 2IBGA 3DTUB 4O2EA 4AXWA 3D0AA 4YNYA 1JV5A 2EAEA 1ZT7A 1OCWL 1JS4A 4PJBA 4BQCA 3TBTA 3GTVA 3MR9B 4UOW0 2EXWC 1NBZB 1PIGA 3TH4T 4LOVA 3T3ME 2B9BA 1MUJB 3L7EB 3MCKB 3IFLL 4Z0XA 1XT5A 2WKGA 5KSUA 3AG3B 3WTXA 4ZQKB 4JUTA 2OP4L 5I30L 2P5EB 2O5NA 1HESA 1OB0A 1I7RA 2JCWA 2NXYC 3L1FA 3MLWL 2Z31D 4WI4A 5E8NA 3BWUF 2IOOA 1ZLWH 3ZE1F 5BUGA 5KVMC 2Z91A 3V4VL 1VFAA 5FW7A 3D8MA 1MAML 1PD1A 3KMDA 3KNBA 2YPKA 5T3ZD 1J0ZA 4PBWD 4UQ2A 4OCLC 4N26A 1HXYB 4J12A 4LEXH 3K2UL 4ZAKD 3SGEH 5A6LA 4HPOL 3D3VB 4EIGB 2K8QA 3UJJL 4JG1H 3NH7H 4EDXB 5IMMA 1UUNA 5LB1A 4GAJL 3WHXA 1ASPA 4KUZH 2XPGB 2XTJE 3TOPA 1NGXB 4ADIA 3H85A 5EFIB 4FOMA 1R75A 4Z7OB 2LFEA 2E7CA 2W59A 3MBEB 3PWPA 2EE3A 5L4JA 2BX5A 1E5UI 1KN4L 3O11A 3SGDI 3QPXL 3WSQH 3S5LG 1SXBA 4Q52A 4FXGC 3RA7H 4JRYE 2XIDA 1VLXA 2JELH 4DGUA 1DCLA 1JZDC 4ICWA 4LE8A 3WNIA 4JO3L 1NCCL 1AQMA 4RMWA 3U1PA 4NZRH 3B9KD 4G6KL 5FGBA 3UG4A 3KPNB 3U79A 1KCKA 1T03L 2D7PA 3NCBB 3L1OL 3G04A 2QFRA 4M93B 5ADOL 5DGRA 5DMIH 4PJXF 2XG5A 3MSPA 1VZHA 4BSVB 3GJFK 4JJ5A 4U1MB 1NCBH 3B3IB 3LKOB 3QA3B 1ML0A 3CPLA 2UZXA 1OSEA 3OLGA 3GNMH 5KANI 2C7UB 4DPCX 3NCCB 4A7UA 1HCZA 4KHXH 2IWGA 4MJID 2F5AH 1TJGL 3D09A 4B27A 1B4RA 4HIXH 1S9WB 2YOAA 4RFEA 4MDJA 1A3LL 3K1KC 2GHWB 3V6BR 2FATL 2VGLM 2I5YH 1GXEA 3R7RA 4PGDA 5TD4A 1OHZA 1RQ5A 2HWZH 3NZHL 4DUXA 4R8WL 1FFQA 3CXHK 3BYTA 3KPRE 1HH9A 3C5ZB 1CE6B 3B37A 1KB5H 3LCYA 1WD9A 3N44B 3ZYJA 2DMKA 3NPSB 1S5IL 2XKNA 4AUYA 5JOPE 3MRJA 2FUQA 4J28A 3KW7A 4ZPVB 3QIWC 1I8IB 5BUAA 5B1AB 2VM9A 2FUTA 5JW4Q 3ZL2A 3IETA 1Z5LB 4K0OA 3FKUS 5D70L 3BZDA 1RUPL 4DGIL 4URKA 4OZ4B 1I3GL 1CFTB 4DP8X 3CBRA 3L7FB 1MCFA 1MCWW 4ABUA 4CU6A 3CFDB 5AAMA 4HVBA 4ONOA 4XP1L 2X1QA 1UQSA 4P59H 1IC4L 4PW4A 4X9BA 4WO4B 2VXSH 1UWGH 3R4RA 4N9GB 1JTOA 4AZ8A 1M6UA 4HUNB 3DBXB 1NIBA 3HNTH 3KM1A 3WTTA 3DI3B 4NQDE 2NTFA 4NJAL 4LLQB 2KLSA 4LCIL 4X98B 2OMUB 3KG5A 3HZYB 3UG5A 4J23A 1YEHH 1BLNA 3UO1L 1FAKT 3ZOAA 2XQBH 3G5WA 3IDYB 4JCMA 1NDMB 3OJVC 2WUBH 3G6DH 5MERB 4G72B 4EN2A 4UZUA 5E94B 4QHKJ 4M02A 1L0XA 1WQVT 4HCRH 3AT9A 5AW6B 3BUDA 4MNHA 3TVMB 3HPLA 5I1LA 1WBXA 4RA3A 2PR4L 5E08H 1I82A 2G5BA 2HLAB 3CAFA 1PG7W 2HJFB 3EHBC 3MRKB 3D2UA 3IS1X 2WXNA 2R29H 5I5RA 3OHXA 3WMQA 1RP9A 2VT0A 2D7NA 3OMAB 3O9WA 5K69A 4YQXH 4DN4L 1QI4A 3PDGA 1M2OA 1PKQE 1OQXA 1DQIA 2R27A 5AUMB 4LB8A 2W9EL 1RJLB 1XR8A 3LXCA 3OJDB 4R26L 4G8GE 4DN3H 2UYLB 5L4MA 2Q86A 4OZGF 2H6PB 2PWEA 5CCKH 1AOZA 3VXUE 2Q76A 4BZ1H 4N6RA 4H8PA 4HKXB 4FJYA 1QRNA 5MEOA 3NA4A 4F9LC 4ZZKA 1SNRA 3PPSA 4JAMB 1XZ0A 4GW1A 5ID1A 2F54A 3QRGL 4G9FB 4ADGA 1I4FA 3H56A 5DJ8A 5JIQA 2RMNA 2X9XA 2X0UA 2QTVA 1IRAY 1RJYA 3CVIH 1E3XA 1OAYL 1U42A 2XZCH 4ODVL 1GHFL 5BMFL 1EXHA 2K0RA 4KAQH 3BVTA 2JE8A 4LL1A 4E9VA 3RPBA 3RDTB 4F7TA 2WQXA 3A24A 5FO8A 3WNMA 5T1LA 1E4KA 2YD2A 3BP6A 1H6UA 3HS0B 5IQ7L 1LWJA 1H8SA 5LO7A 4ZPTA 1KB9K 1DSWA 2VDQL 2ZF9A 3MUY1 3GI8L 1BHGA 3NJIA 2CD0A 4JDEB 4QAMB 1OO2A 2QJDA 4JQIA 4FMFA 5K33A 4PJGF 2CBTA 3IE4A 4LSQL 3BPLC 3MJ9H 1DSYA 3VRLE 5H2BA 3JTTB 1A5FH 5E8DH 1DDTA 1DVUA 2Y6SC 4DEPC 1FCGA 3DO7A 2GJZB 2VW6A 1OP3K 3F6IA 3ZHDA 2ZUUA 5ECGA 3HC2A 3UEZA 3OAYK 1GZPB 1HC1A 3PWVB 5J89A 4U2ZA 2WVVB 1EDYA 2BH0A 2IBZX 4W9JC 4ZTOH 5JDJA 3DURB 1KB5B 4NDMB 2YEZB 2KZKA 5D1QE 1J9SA 1NMAL 2W88A 3F58H 3N9GL 4FKEA 4NGHL 1FVCA 4RDBA 3P2DA 2C3WA 4FNSA 3K72B 4K71B 4R96A 3DETD 5CGYD 3HN3A 2C4XA 3MLZL 4GXVL 3HC3L 2FNWA 3VG9C 1CLYH 2NQCA 3Q6GL 4BRJA 5AW9B 5I8EB 3QFJD 3QG7L 4PYGA 3EJZC 4H0IA 1LEKA 3VWJA 3QRLA 1H6EA 4LCYB 4I18B 2P7TB 2VZOA 3DO3A 2B77A 3P0YH 2CCLA 4G9DB 2GJJA 4OCSL 1C7SA 5IB3B 4G8IA 3AQDA 3KPQA 2HG5B 1YEGL 4G80A 3EYUH 1UH2A 5HVHB 4WAFA 2Z0BA 3PDDA 4IMLB 1WCBB 4GAYB 5AAMC 5FYLH 3BDBA 3LEYH 3TO4D 3E6HA 4TM9A 2AJ3A 3LZRA 2PCYA 1X5IA 1AE6H 4OUOA 2IQ9L 4Y2DB 3J2PA 3RVTD 1SM3H 2AV7B 5D7JD 4FQXD 4GAGH 1S7XB 2Y2TA 4M1DH 3BLKA 1TVBA 5IB4B 4IU2B 3T4YA 4XVTL 4GKZA 1FYTB 4HIHB 1WIPA 3P73B 5D7SL 1YECH 4D3CL 1THCA 4EOWH 3CMGA 1H3GA 4K3HA 3VXRD 4DP2X 3ZL4H 4NYLB 5CILH 2Y2WA 3LYRA 4DW2H 4J3OF 1OPOA 1Q9WA 4OF6A 1ZLUH 1IX2A 2IQAB 3BI9X 1ES0B 3M17A 3I6LD 3MU3A 4LK4A 3S35L 3FUNA 2QPUA 2FJUB 2YC1B 2MH4A 3IU4L 2L3BA 1U41A 3NCEB 4PJ8A 3Q2VA 3V0HA 3QDMD 3UZEA 3DMMA 3OHXC 5DFVD 3LQAH 4ABWA 5C9KA 5T5NF 3O9WC 1NEUA 4L3ED 4BGDA 1AGEA 3VQ1C 4MD4B 4HKBA 2QQQA 4K8RC 3IB4A 3OR6B 2F58L 3G5VA 1JWSA 3U2IA 1G6RA 1PY4A 3PNWB 2MEJB 3ZT5A 4BD4A 3S96A 2Q3ZA 3CZEA 2BVTA 2FQFA 1ZCRA 1OSZA 5L9DH 4BHUI 4ENED 2K9UA 5EIQA 3Q6FB 5L2KB 1DVFA 3GRWH 2FHFA 4R5TA 4HIJB 4FYQA 1HILA 1SUJA 3BZ4A 3FQRB 1G9NL 2ZG2A 5F88A 3VU1A 5H4ZA 2PTTA 3HHSB 5DJXB 4ZT1A 5TGBA 1Y07A 4DOHB 5JPMB 4D8PB 1MEXH 5LNEA 3CDGB 4UCFA 5HY9B 1WWWX 2P8MB 1U8CA 5IFJB 2Y07L 4G7RB 1U93B 4F7KA 4P9HC 1GOHA 3RWIA 1V55B 2BP8B 5FA3B 5FYKE 5L7XH 2MCPL 1P6AB 4XP5H 4NN7C 2A9DA 4MRCA 3ZYZA 4LVEA 4WUUD 3TJHD 2UV3A 4LLUA 5B8CA 1JGEB 2M8XA 2VN6A 4GSUA 4MYPA 3MVSA 3QZPA 4JREB 1IGTA 1CF1A 1OCWH 1TMQA 1WWBX 4UUJB 1A14L 4UM8B 4JM2D 3N42F 1K5WA 3GFUA 5DJ0A 4XMPL 4FP8L 4JFEA 4Y5VA 1Q9OB 2VSCA 3IFLH 4Q6YA 1VERA 3P4NA 1L4IA 5IKCA 2W0PA 2OP4H 1CCZA 1MCLA 3VFNA 1CGXA 2CDGB 1FV1B 1PSKL 4ONHB 5CHNA 3ZE0F 5HDRA 4G6FD 3TLRA 3C5SA 4RAUB 5E4AA 3MLWH 2GY5A 5JQ6L 5KSVB 2GQHA 3KPSD 1S9VA 3IDNB 3FO9A 4RWYL 2PPCA 3NESA 3S5YA 2PP8A 3F12B 4JGJA 3ULAB 2A5UA 2MPAH 1R9FA 1EHXA 3V4VH 3ZQ9A 3W0WB 5CWSA 1FLRL 4P5TA 3O2DA 5DZPA 3VD3A 3OAZK 2WXGA 4Z7QE 2OMWA 1R3JA 3UXFA 3K2UH 3VWJC 4HPOH 4P46A 4JZNB 3V5HB 3UJJH 5FKPA 3PGDB 3Q5TA 4UTBL 4FADA 3GHEL 1W8NA 1DJSA 5HHXL 4GAJH 1OGPA 4YBLB 1CPUA 1QFWM 3WTUA 1DHKA 4NAMA 3P2BA 3IPFA 3FUKA 5A2KH 5DJ2A 5JTWA 1XSJA 1KJ3L 5F7EL 4QTFA 3RIFK 1KN4H 3S97C 1VGKB 4PGBB 4QRTB 4OQTL 3QPKA 2JLPA 3SDXA 5M94B 4K5PA 4PP2B 3T1FB 1GOFA 1XFPA 4WNSA 3QJRB 2B15A 1W91A 3FTGB 3ESVF 1ORQA 5E6ZA 5EUKA 3D18B 4NFCA 4PGEB 4M1CC 4JO3H 1NCCH 2WSDA 4GMSL 5D7KE 5JNYA 4IIQA 1MI5A 4G6KH 4MNQD 3TT1L 2AEQL 3ZDZE 1BQLL 2J8UE 2Z1KA 3RB7A 4HUXA 3QO1B 4ZFFA 1SBSL 3P77B 12E8L 1R47A 4QRAA 2V3FA 3D0VA 3L1OH 5ADOH 2EKSB 4YHKL 4RNRB 4M48L 4KMTL 2YEQA 3FW6A 3INUL 4IK6A 4O9HL 4AM0A 3TNNA 5C0DB 4AIZA 4I89A 4LCCB 3VB8A 3VDBA 2OL3L 3DKHA 5KYYA 3SYPA 4BKLB 1QR1A 4AGNA 3O6LH 3HLAA 5IFHH 3OKEB 4PJ8C 1HKFA 4N90E 3UZEC 3DMMC 1A3LH 4XPBL 5DEZA 2XWJB 2FATH 4HUMB 5C0JA 4PJDB 4FFVC 3NZHH 4R8WH 4WDIB 2NXZD 4DTGL 1MVUB 3ZQXA 2A9BA 5BVPL 1BD2E 1MVYA 5C0ND 5EO1B 4WWKC 4RMRA 1S5IH 2DM3A 1Y1UA 4M1GL 3UTTE 5GZNC 4NN5C 3AC0A 2AQPA 2X4PB 4LVHC 4DCQA 2K7PA 2NNAB 1O7VA 5IFAH 5D7EA 3EOBB 5D70H 1DVFC 1RUPH 1F5WA 3FUJA 4OQ1A 4DGIH 4EIZC 1BFVL 4BA8A 2DYPA 1I3GH 2IAMA 3QDJD 4AQAA 3PWPD 2VLMD 4PJ5A 2IDFA 4XP1H 3CSBA 1ZD6A 4Y4KC 4YIQB 1IC4H 3FQWA 3K8LA 1RZKC 3O4LB 3B2XA 4L4VA 5IEKA 2YK1H 5IZ7A 4HISA 3DOIA 1RFDL 3STLB 1K8DA 4P4RB 5EO0B 5KS9B 2GG1A 3KLAB 1J8HA 3VNYA 2QLYA 1KELL 4IKJA 3ZX1A 1BF8A 4NJAH 4XBGB 4LCIH 3NVQA 4LESA 3UO1H 4NPYB 3ILDA 4DT2A 4KKQA 4YDJA 2CUHA 2GCYB 4GG6A 4J2XA 2AXFB 4MWFA 3B7RL 2YBRA 3QVAA 4M3JA 1M05A 3QHZL 3DV4A 4OZHB 4YBQC 2WN2A 2P5WE 5HI3D 1HZKA 3PJSB 3OB0H 2ALAA 5BXFB 2PR4H 4NKDA 3AREA 4Y5VC 1YPZF 4XPFH 5FK9B 3EGSA 2WLZA 2X10A 4FQ2L 2AXGB 3BEVB 3V4VB 2WNXA 1P2CB 4L1HA 4NUGL 4DN4H 1JHKL 4LEOB 3H8NA 1N0LA 1J9QA 4YO0A 1T1XB 2W9EH 3IJHA 4R26H 1XBRA 1HEJC 4Y1SA 1U8LA 3MGTB 3BIKB 5TE4L 4HJGB 1E50A 4KK5D 4P5TC 4JGNA 1A9BB 1NGYB 4HS6B 2WP3O 1PEWA 5FS5A 4YXHL 3HE6B 2VLJB 5C0FB 3ULUL 2XETA 3CFKB 1VFOA 3DGDA 2R0ZL 2X4TB 1T4KB 3QEQB 2ZONA 3FQNB 3KWXA 1II4E 3P69A 1KBVA 4P46C 1MCRA 3LRKA 2CDFB 4RGND 1SVBA 1E9QB 3QRGH 3UADA 5MENB 1BAWA 3I74A 1EJ8A 2QGCA 4H20L 4QRSA 4QRUB 5EC1A 3CFEA 4ZMXA 1U92A 1OAYH 1NLBL 3GXNA 2IADA 1GHFH 3MODL 4HUUA 4ODVH 1KTLB 3A4FA 4PEEA 5BMFH 4HWBL 5AD0A 1XTLA 4APQA 3FT4B 1KUMA 3HS8A 3ATBA 3VD1A 3HR5A 2F74A 4WK0B 5J1SC 3EBHA 3HUJA 4ZW6A 1PZUB 1JWMB 5CSBA 4D9LL 5IQ7H 2VSMB 4I0PA 1AGFA 2VDQH 2NUTA 2R59A 4BKTC 5E8OA 4K5NA 2IH9A 3GI8H 4ABQA 1XAKA 5I15H 2X87A 5GGVY 2MCAA 1IEBB 5C07A 5GJTL 4YSEA 2RFXB 1BPLB 4LSQH 1AD9B 4A6YA 1XB3A 2P24A 1ZPLA 43C9A 1P1ZA 4CMMB 1YY8A 5I0XA 5DJZB 2XFXA 3MRFA 3QEUB 1UZ8A 5BJTA 2VR5A 4HUVB 1CFQB 3HCVA 4NQCE 5LGYA 4Q56A 2XICA 4UANA 2OZ4A 5SWSB 2VB5A 4FJ6A 1T0OA 4A2MA 4AT6A 4F7MA 5JIIA 2EO1A 5ILTL 3CFQA 2FH8A 3DHJA 4HD5A 3ILQC 2IAND 1AI1L 1NMAH 1F56A 2QELA 1Q90A 3N9GH 3OXSB 4N8VB 4NGHH 3ZY7A 3VWKC 3MNWB 4P2OB 1D6VL 2X5PA 5E70A 3CVCA 4FLSA 3MLZH 4GXVH 1OF2B 3HC3H 1JRHI 1GL4B 1AGDB 3PIQB 1Y6KR 1A7BA 1FHNA 1JAEA 1QRND 1E9OA 2DICA 3QG7H 2G2RB 4XBMA 4AMKH 5FDYA 5BOZG 2Y5EA 4YHML 1DN0A 2Z64C 4MNGE 4M9OA 2F54D 3T2OA 3UP6A 1VEMA 1L0QA 1B4JL 3MA7B 4OCSH 5KVDL 1QEWB 1QFUL 2FQEA 1O6TA 1WGVA 4HFUL 4R0LA 4KPHL 1YEGH 1T1WB 1UXSA 1J0IA 2AQ1A 2IAMC 3M7FB 3EGDA 5JW3L 5KJRL 1JNNL 1F90H 5ERWB 3R0NA 4OBRA 1XMEB 1XTMA 1DSFL 2R4RH 2VH5L 4KX8A 2Q6WB 1MFDL 1NBQA 1AO7E 4JM0A 5C1MB 2WSPA 1Z9SB 3NJHA 4D0BA 1PLAA 3TEUA 4JKPL 1CIUA 4W9EC 2IQ9H 4WFHE 3ZTNL 1M57B 3H55A 3JWDL 5DJYB 4MA3A 4ZTEA 2DQUL 2N59A 3ZUCA 4YK4B 4DJMA 5JHMA 4JK0D 4XVTH 1TYJA 4H2AA 4RA0C 3FT2B 5D7SH 4DK6A 3DX1A 4HWEL 3VGAC 4KMLB 4PJ7B 3BKML 2VQ4A 5EB9A 1OPGL 2JI3A 4IRZA 3SEPA 2NY1B 2J56A 3GBEA 1GGIL 4GUOA 4JLRB 2XNAA 3RX9A 3S35H 5EN3A 1JZ8A 1R3HA 3AREC 4QMEA 3T2LA 2QMKA 5I76A 2P8LA 3IU4H 2FWLB 5K93A 4OJEH 1R1CA 3NFSL 1QBML 3LN4A 4MMZB 5JIKA 3SDAB 1ZOXA 3U7YL 3PL6B 3HAEH 1QHPA 4Z95L 3R8QA 3L5WA 4D0CB 4WSJA 3PHQA 1SDDA 3KDMB 5HI4C 3SE9H 5GXBB 3ZKQD 5I1IL 3CU7A 1S7TB 3LQMA 3MNVB 3MV8A 4RAVA 3QXDA 5KYXB 4PMFA 3LRMA 5C09E 1S7RA 4DPBX 2NCEA 2EVJA 1RUML 4PD4J 5DMGD 1G9NH 2A9MH 3EDEA 3TCTA 3LVEA 4YZWA 5FHBL 1QPKA 3B2PA 4FKHA 3U0TB 1IVLA 4MB3A 1WAAE 2H5UA 5EU6D 1WHPA 4X6CA 2DS4A 2E76C 4APQC 4M61A 2OCJA 2Y07H 2VDQB 3X14B 5DQJB 4N9OB 2MNJB 3CFJB 2MCPH 2JJTC 3QBTB 4L8CB 2EEDA 1JF1A 1UM6L 3A3YB 3FFCE 3F64A 2V2TB 2YAOA 4I0PC 1XGUB 1D2PA 1IBGH 5IV2B 4ZJ9A 4QYOB 4C4UA 3CQFA 2OCCB 2WOYA 2CLZB 4EBQL 3FTVA 1XQ4A 4KK8D 3L3GA 5EIIG 3BD5A 3GZKA 3MMEA 1IAII 3N43F 2B4CC 2G75B 4FP8H 4XMPH 4POYA 4M03A 2H6UA 3L45A 1MCOL 4FCAA 3WHE1 1G9ML 1JZJA 4P05A 4LAJH 4MX7B 4RX4A 5DWPA 1IL1A 3EG9B 4L1SA 3H7LA 2RACA 4CILA 5JQ6H 3OXRB 5EBMA 1ZTMA 1HHKB 4RWYH 1MLBA 1SYSA 5GRZA 3H9SE 4N86A 3IFOA 3MFFA 5CKAA 3I85A 3BT2H 1FLRH 1TU2A 4LRIA 4R4NC 3O2WL 2A4ZA 2X44D 5ACZB 5EULV 2P8PA 3RY6A 4KFMA 2XV0A 2GSIB 1UYWL 2ODHA 4G2AA 3EOAB 1ED3B 5F96L 4LIQE 1YMMD 4KNUA 3HA0A 4WV1B 4XI5C 4UTBH 1I53A 3ULVF 4F92B 3GHEH 3CLFL 5G4OA 1LVEA 1XEUA 5AAWC 4IJTA 5HHXH 3QB7C 3KBPA 4HLZG 1K5NB 4R0LC 4XMLL 4ZODA 3W11D 4CNIB 4CSSA 2FWOB 2B5IC 2PXYA 3FRUA 1NFKA 3VFOA 5DHMC 1KJ3H 4UTAA 5F7EH 4S10A 4G6ML 3II3A 5D2LF 1SHMA 2PABA 3BLPX 2ICWI 4OQTH 2HJLA 4ANWA 2CKBL 4YMPA 1UACL 2EDDA 3VFUA 1CGTA 5IEHA 1KDJA 1WTLA 4GMSH 3VRIA 3DK2A 1MOEA 3F83A 2H0JA 3TT1H 4X7DC 2AEQH 3UBFA 1BQLH 4NO0B 1SBSH 12E8H 1NBYB 2VC2L 1VB9A 1F02I 5EEWA 4C83A 1KBKA 1M3JA 4QGYA 4M48H 4KMTH 5DC9B 3NFPB 3INUH 2E4TA 4O9HH 4ORGA 1WJ3A 2LU5A 4GS7C 5DEJA 1LQSR 2HX7A 1E4HA 2OL3H 5KANG 2KPWA 3IMTA 3IKKA 4XE0A 1N59A 4JY6B 1RZ8A 4ZNCD 3DGGB 4ZTPL 3HAEB 3HMXH 2CDEB 4YL4A 4PJXB 4PRHB 4B9FA 2EH8L 2XXFA 1R17A 3RVXD 4XPBH 2CRYA 2F6AA 4JO1L 3TZVD 3U30C 4PG2A 4ZUUB 3VXPA 1G5AA 3U9PL 3WCYA 4TNGA 2V5TA 5IJVB 2IFFL 4KRNA 4P2QB 3DX6B 4DTGH 5BS0E 1MLCB 5BVPH 1O5DT 4EI5C 2NDFA 3HZVB 3TP4A 1NBZA 3WFHB 2JKLA 1HHIB 4R2GD 4V33A 3L7EA 2YQ3A 3AITA 3MCKA 4XCYA 2CIKB 4OF5A 2ZXAA 3CLEL 3CNKA 4ZQKA 1W6LA 4ZDHA 4X5XA 3PV7A 2Z4QB 3GSVB 1BFVH 4NERA 3WMSA 4PJFE 2LVCA 2DQJH 3X3FL 4RGOL 4AVHA 4PJHF 2UX7A 1A4AA 4GG8B 2ZOTA 1ZSHA 4Z78A 2VLKE 3WFCL 4YVUA 1YLBB 4KKCC 5IG7A 4ONFL 3QISA 3R19A 4AVJA 2EXYC 1MW2A 1I1YA 2DIAA 2I60L 3P3UA 4P9ML 3BAEL 3NACL 3VGEA 1PFOA 3MHZA 4HG4K 1KELH 3B7TA 3MRHB 4KZ0A 2HTKC 4FNLH 5EOTB 1TQSA 3EFFA 5F7AA 4MDIB 4KKNA 4F24A 5JIHA 4EDXA 5E2VH 5TK2A 4ERSL 1OVZA 1AGBA 3MI6A 1PU0A 4FG4A 3KS0H 2GITB 1P5VB 4OAWB 2BW5A 2G30A 3QHZH 5ALCL 1QASA 3MRBB 3MBEA 4ISVA 3D1MC 2F1AA 1Z7JA 3UIYA 1NFAA 2A6KB 1D5MA 3CIQA 4JBSA 1H3XA 2BSBA 1DEEB 3OKNB 2IH8A 4POZD 4F2FA 3UAEA 5ITBL 4QHUB 4FQ2H 3WEMA 5CD5D 3MV7B 1UOVA 4FZEL 4CUCA 3L3HB 1N9PA 5JW4R 1ADQL 3N55A 4NUGH 3X11A 4KZDL 4QOKB 3BUPA 1R24A 4KJYA 5CNHA 1ODAA 5E4OA 4EZKA 3RY5A 2Y7QB 3FK3A 1B0GB 3UP1A 1NCIA 5TE4H 3ASOB 2WQ8A 3HG1E 4J3OH 4PRNA 1QFOA 1BZ7A 3V9CA 2QGBA 1MJUL 1DE4B 2YPVL 4U1MA 3RY6C 4YXHH 3I75B 1I1AB 3ULUH 3LKOA 2R0ZH 1PEZA 3BSZA 3FU7A 3QA3A 4Y2OB 1JGLH 5EIVA 4MCZB 1OTSC 2R2CA 2C7UA 4PLJC 3CMOL 3P0VL 2DEWX 3FFDB 4X9IA 3J07A 5F89A 1QSEA 1K85A 1RK1B 3U48A 4H20H 4OZGB 4PJ5D 1S9WA 4K73A 1BXAA 3QR0A 1HCYA 3PAUA 3MODH 1NLBH 1UWXH 1Q4NX 2PP7A 3KLLA 4RQQA 4HWBH 3ZTCC 4JHWL 2ZXQA 1A21A 1CGVA 1JGVL 4NLAA 3L3KA 2FGWL 1O0VA 2WJ7A 2EDEA 1KPUB 5C0GA 4AJ0A 4PCSA 3ZTJH 3FUMA 4D9LH 3QQ3A 2B14A 5LAXB 1VFUA 3MREB 1R5IA 2EIBA 1I8IA 2ZXBA 1A4JA 4WKZA 5KAQG 2WBJB 3AUWB 4LNRB 3U2SA 5HGAB 2AVFA 1ZA6A 5C0AE 1Z5LA 1ZV5A 1N67A 5FO9B 3M7OA 5T1MB 1G7PB 2ZOKB 4RMUA 2YKKA 4PMEA 1YVLA 2OL3B 1CFTA 5ESAA 2OK0H 3SY0B 2PNDA 1HWWA 3B1UA 5E8PA 5EUOF 2VDML 5E0FA 4LZKA 1D5XB 4APXB 4I1PA 3FU3A 2X9YA 3NK3A 3HJEA 3SDYL 1EEYB 4HBCH 4EMZA 3B9VA 4N9GA 5CIPH 1GGCL 1NCTA 1TJHL 1ZAGA 4MXWL 3SO3B 2VO8A 4PJGB 1U8PA 2HVKA 5D7IA 4QHNB 4KJPC 1FVEB 2VMEA 4LLQA 2BS8A 4OB5L 4X98A 2OMUA 3HZYA 5KVFL 4GKSB 4PG2C 3FU0A 5F70A 1QWHA 2BDNL 2HVBA 1UEMA 1MXGA 1XR9B 5E94A 4EZMA 3RKDC 3PCYA 1KN2L 4Y4HB 3V5KB 2OMVA 1BLIA 1TZIB 4YHMH 3SYOA 2HLAA 5A16A 1S78C 1NKOA 3MRKA 3CC5B 1FQ9C 2OMNA 1B4JH 1T80A 5IMLB 5KVDH 4RBPH 5HGBB 1N64L 1QFUH 1ACZA 1CT8B 4HFUH 4P3DB 1U8NB 4OLYL 4QRRD 4KPHH 5C0BD 1G7IB 2C1OA 4L23A 1PX3A 1JNNH 5JW3H 1L6PA 5KJRH 1SF3A 2DIJA 2R1XB 1ZLWK 1DSFH 2WKOF 3SDDD 1RJLA 2VH5H 2R0KL 2E9JA 1MFDH 3LX9A 5IROC 2UYLA 3ELQA 4YSPA 2IV8A 4JKPH 1Z9NA 3LIUA 4V2CB 3V7AE 3ZTNH 5I6OA 2K7QA 3JWDH 3NIGF 1VFBA 1PKOA 2W60A 1D5BA 2DQUH 3ULVL 4JAMA 1OTTC 1FN4B 2FO4B 2NCMA 2EIEA 5ANMA 3VFPB 3WKNA 1UURA 2KZ1B 4G9FA 4HWEH 2X6UA 1GKOA 5AENA 3BKMH 3ELAT 4U05A 3QZLA 1WFMA 4HHWA 3B9EA 1U8IB 1OPGH 1RV6X 3MBEC 1NFDF 2VUOA 3SCMD 4JKMA 2CUIA 2W8CA 3PXHA 2NYZA 3O6FA 3KL0A 3A6OA 5E5MB 3IRPX 4LF3B 2ZX5A 4MHHI 4Y19A 2EIZB 3SKJL 1JV2A 1QBMH 3L95B 3NFSH 1F11B 3NZUA 2ROYA 3QUML 1TTFA 1W0VB 3U7YH 1XGRA 3C8DA 4WI9A 5KUKA 2JI2A 1T66D 2JQMA 3QFDB 4JDEA 2OW6A 3AVEA 4ORZC 4Z95H 4HUWB 5ESVA 1Q72L 4LSDA 4W81A 2DEXX 5E9DE 5KBDA 4QHKI 4WHYG 5AWNL 2XACC 4M93C 3OKYA 4KMQA 5FGRA 5I1IH 1UKQA 4HSCX 4PU2A 5FC9A 1JUFB 3SE3A 3B9AA 1E4XI 4R4FL 5LNGA 4HKZB 2WMPA 1ZLEA 3MC0A 3V6OA 2Q87A 1VRSA 1RUMH 4OM1L 4BK8A 2BXZA 2I9LB 4HOWA 3PWVA 1FIGL 4KI5E 2WVVA 1ZV2A 2ED6A 2YD0A 4R7LA 1HK6A 4NDMA 4NXKA 2YEZA 1AG6A 1IC7L 3WUZA 1DQQA 1F2QA 4FGMA 4OLEA 4RRPM 5EORH 1UD6A 1QFWL 2WIIA 4UNTA 1B90A 1KLUB 5FXCH 4Y89A 5T3ZL 2F53B 3UO8B 4OZHE 3C5ZC 4ACTA 1ZHKB 3NPSC 3P4MB 2ENQA 4E68A 1BVLA 3ZZSA 1UM6H 2EEAA 2C9RA 2NX5B 2P7TA 4N28A 2LAGB 3FPYA 1OD7A 2NZIA 4ZRGA 3TBSA 2Q5BA 4G9DA 4P23B 3RWEB 4AVKA 1BA9A 3H7BB 4ZW5A 3BUBA 3VI4A 2LAAA 1QSFB 1Y6MR 4XP6L 1IM3D 3X3GH 4EBQH 5CIPB 4JFVA 3NIDE 4PREB 4IMLA 1OOAA 4PFEA 4GAYA 5KYWB 3C60B 5E5RB 5JUEH 2IOMA 1F00I 3T0EA 1ETZB 2G0LA 3DC0A 1MCOH 2APXA 4PTTB 3IVKA 1G9MH 2AJYL 3WIFB 4M6ML 4WO4C 4BFEA 1FNEB 1HS6A 1MNUL 2YGQA 1A7NL 2V8MA 2GJ6D 1G1KA 1QEXA 1YJDL 2C1PA 3D12B 3N42B 4NKOB 4IU2A 2X6BA 4MZRA 4AQOA 4DEWA 4GRLB 4HIHA 1E9PA 3PAZA 2GI7A 2YO3A 4LPYA 4NYLA 3O2WH 3IDYC 2R69A 4ZS6D 3BT0A 1OY3B 1Q9KA 1L6ZA 3WO4B 5GGTL 3NJJA 2O26U 5F96H 1LNUA 4MRBA 3TVMC 3FT0A 2IQAA 4P8QA 5IBLD 1G87A 2CAKA 1GSKA 3BD3A 4X6DF 4KO7A 5D8JL 4LKCB 3CLFH 4GQZA 1SJHA 3U4EA 5KSAA 2V5MA 1XCXA 1HTYA 2ZXGA 1HWGB 4XMLH 3MYZA 1ICTA 5B4MD 3MRQA 5CJQL 4LLMB 3UOAB 4PWGA 3S8FB 4IRJB 2CXKA 3ARRA 4G6MH 2NSQA 4ZMOA 4B53A 5HHNA 4JO4L 4KRMB 3PNWA 3L1GA 2CKBH 3RQ3A 1UACH 2J72A 1L6XA 4YHNB 1B6UA 3QUHA 3L4XA 5CZRA 3LZPA 5B1CA 3CG8A 4OGXL 4JHAL 4XB8A 3BGAA 4YHYB 4PWEA 1AMXA 3L3IB 3FQRA 3HHSA 3VYPA 3IWUA 4DVBA 4OF8A 4GXUM 4YDLB 4B5EA 2TSBA 1B0RB 1G9HA 3KXFE 1R4XA 3UTSB 5BOPA 1BZ8A 2O5XL 3S3PA 3ECBA 3ASNB 3S2CA 2ALWA 3GHPA 2FHBA 5D1XB 5IFJA 5C0RL 2FGZA 2X4NA 1FWXA 1J0KA 4GPVA 4ZTPH 2BP8A 4WGVB 5FA3A 3RDTC 3S5ZA 2Z7UA 3ISYA 3LKQB 4ODSL 2EH8H 3VXME 3E9UA 3MJ9A 4LPTA 3HKZA 3U6RB 4JO1H 4I4WB 4PHXA 3V6FA 2X40A 4IOIB 2RB8A 3OLEA 3U9PH 3UTZB 5JDSA 4ODHL 2IFFH 3QQ9D 1IEHA 1FNSL 3QWOB 4RISL 5A2FA 4XBPA 4OF0A 3AB0B 3BKJL 3ZRFC 1G1OA 5IW6B 4JRWA 3QZNA 5A2CA 3KH3A 3PWLB 3Q44A 2W65A 4N1EA 1SN0A 3BEWB 2K4WA 3CLEH 3D39B 4HPYL 3V6OC 3D9AL 1BAFL 3QORD 4A2EA 4FQHB 2CDGA 1FV1A 2QDWA 5TDPA 1BP3B 1EBPA 3EJUA 4CADB 2DLEA 1WBZA 4RAUA 2PXYD 5KSVA 4GBXB 4RGOH 3ZL1A 1YC8A 2OYPA 1XCTA 3IDNA 2W0FB 1DUYA 5I1GL 1ROWA 4PJCF 1R0AL 5D7HA 2FEEI 2GY7B 1AXIB 3QULA 3WFCH 3IJ7A 1AZUA 4ONFH 5D9SB 2YQBA 3TYFB 2I60H 2GTZB 4P9MH 3BAEH 4LPVA 2OJEA 2V7NB 3NACH 2XIIA 1NAKL 4O58L 1WWAX 3KW8A 1H15A 5SWQA 4UOQA 1E27B 3HKFA 5EHFA 4I18C 4JZNA 4L37A 3IU3B 4X6FB 3V5HA 1CFSB 3PGDA 3QYNA 1GC1L 4ERSH 2X4OB 2ZSVA 1S9XA 3WIAA 3S37L 2DJUA 1SN2A 4PV1C 4F8OA 5A40E 5C2BL 1E8WA 5HVHC 2EZ0D 1B3IA 5ALCH 1UA7A 1F4WL 5FGSA 2BVQA 1GJIA 2V4LA 4LSUL 4BFFA 2ZUQB 2EDLA 2HRGA 4QRTA 5ITBH 4PP2A 4JPIA 1J05B 4HIEB 1ERNA 2FL5B 3FTGA 4FZEH 5HBBA 1RZQA 2CGYA 1BX2B 1ADQH 2V9QA 3BP5A 5CR8A 4KZDH 3S4SB 5FDWB 4RGMC 3VI3A 1CTMA 2GVYA 3TBWB 3QO1A 2KZWA 3P77A 4KUCD 1YPZB 3BUYB 3PAVA 4V2BA 3L16A 4J6RL 5CU9A 4AKOA 3IJ8A 4K7PX 2AK4E 2E9IA 2EKSA 4ZMPA 3M86A 4RNRA 1CFVL 1MJUH 4C47A 2YPVH 1BQHB 3W3BA 5D4HA 1WTGT 4YC2B 4EZLA 2D3NA 2OYLA 2C8NA 1ONQA 4TUUA 5CBEA 4LCCA 1QA9B 3GWJA 5IVXA 1T5XB 3G6JF 4CSPA 4PWJA 3CMOH 3P0VH 1CJYA 3GSUB 3OKEA 3CZFB 3FQYA 3BN3B 5DGQA 1HL9A 4J8QA 2CKBB 1K8IB 2Y24A 3WEXB 3DHUA 4JHWH 2DI7A 2E56A 4W9DC 3VXRE 3GXFA 1JGVH 5GGUB 1AIZA 1MVUA 4ANVA 2FGWH 4Q14A 1CG9A 1EEUA 5EO1A 3EJQA 4B9IA 3BGMB 1UD5A 4LGPB 4YHZL 3Q3GB 5JIDA 1NANH 4FQJL 3DECA 1EWHA 3OX8B 1U8MA 1UOKA 2PCXA 3SPGA 1CLZL 2XC8A 1T21B 4M56A 4X4YB 1YQVH 2VDMH 5E23A 5AW0B 3NZSA 3LEXB 3R1GL 4Y1AE 3SDYH 4TF4A 2QR0B 2ARWA 4WJKB 4FI7A 1GTFA 4JDVB 1GGCH 1TJHH 4MXWH 4PRIA 2WXJA 5BRQA 5EO0A 1X5JA 3KLAA 4U7MA 5KS9A 1AR1B 3UZVB 5DU7A 5EU4B 4PRPA 4XBGA 3GUTB 1F3RB 1HFUA 1YN7B 2BNQD 4JPSA 4OB5H 2BNRA 5KVFH 5JYMA 4NPYA 3G7TA 4CW1A 2BDNH 3QZBA 1WG3A 5GISL 5D4QA 1CD1B 3HR6A 4ODWA 3PJSA 4X6BA 2ICWA 4QCIA 1T7ZA 3CHPA 3DXAE 4I1NB 3JZ7A 3W9EB 3NT0A 1QSED 4NQSB 1IM9D 5FK9A 4PJEF 5KZCD 2A4CA 1N64H 1FNGB 3BEVA 4FG2A 4L9LB 3IMVA 2QGEA 3O8XD 4OLYH 5F3BA 3NRFA 3QUXB 3WDHA 5LXGL 2Z35A 1CLOH 4LSPH 4N0CC 1IC0A 2WNGA 1T1XA 5EBLB 3GRGA 5INDB 2R0KH 3DPBB 3WGVB 4BXSV 3BIKA 1A25A 3CN4A 4YZFE 4HJGA 4FLHA 4K3DL 5IOKA 3TURA 2JSFA 1NGYA 2ZSWB 3F8UB 3SPCA 4K7PY 3KZ8A 4IKKA 3NABL 2X4TA 3ZU8A 3QEQA 3FQNA 2HPOA 1WLHA 3ULVH 1BBJB 4KGJA 5DEFB 5KVEL 2YXWA 2AMUA 3WE1A 1CXIA 2CDFA 1E9QA 4N1HB 1F6AB 2JTDA 3Q8CA 2XXMB 5MENA 5MEQA 1U4FA 3RIAK 4YBLC 1DBJL 1N8ZB 2JXMA 5SV3A 1RZIB 4HZ1A 2VIRB 1P6WA 3W37A 1T5WB 1KTLA 1MKFA 3B1TA 3HB3B 2ATAA 4LBEB 5K1NA 2R9HD 3L2MA 2H3NB 2QL1A 2FHCA 2YRBA 3BSGA 4OIIL 2WQVA 4N0FB 3UERA 3MDJA 5GS0D 4MXQC 3LKSB 1BOYA 3SKJH 3QUMH 1BJ8A 3DLQR 5CP7B 4Z8FL 2UWEE 3MJGX 4ICXA 5C97A 5FF6A 2OAAA 4F1SA 2F8VA 1C5DB 4XNAA 2DRUA 4QF1B 4XXDB 5I75B 1Q72H 3ARFB 2R8SL 1OAZL 4Z18A 2RFXA 2E86A 3W5NA 1AD9A 1JCVA 1S7VB 3ECUA 3EYFB 1OP5H 5HI5D 5H37H 5FO7A 2VJXA 2DJMA 3QQDA 4N2DA 3PU7A 2C4FT 4FQQB 3FB5B 1NCGA 3LQAC 2R51A 4LCCC 3T0XA 2ATKA 1BSIA 4JUSA 4OM1H 1KGCD 3IFNL 4HCGA 4X5LA 2PCFB 1FL3B 2BP0B 2ZXEB 4FCHA 1FIGH 1IQDB 3CZJA 2EDJA 1UEYA 1F1GA 2TRHA 4UU9A 4JDTL 4JRYA 4MNQE 3FTSA 5EA0L 4B6ZA 4CC0A 2FO1A 4WTQA 4N8VA 5ISZD 1TTUA 4X9YA 3VXNA 1QFWH 5JZ7D 3MNWA 4P2OA 9PCYA 2G9HB 2J5LB 3NIFE 5T3ZH 2FX9L 1CDIA 4X0KB 2WWMC 2OMYB 2EYSB 1CDYA 4FNTA 3NTCL 3UL4A 5D6CA 2G2RA 5ACMA 1U58B 3ZK0A 4DQOL 3ZQWA 3NRPA 4XVSL 1HHGA 1X7QB 3AG4B 3RPIB 2EICA 4NWTL 2VDMB 5CUSH 5SWZD 3MA7A 3A21A 1QEWA 2E9BA 3U25A 4U1LA 2ESVB 4JRLA 2Y7SA 4XP6H 1AQHA 2AQ3A 5EWIL 4RMTA 5DZ9A 5IJCC 1XF4B 4YSUA 2KL6A 5ERWA 3FB8A 3I6GB 1CB4A 1KZQA 4JFZH 2VR6A 5T3XD 3O6FD 1R3IL 5GGQL 1B3JA 5J11B 2AJYH 4M6MH 2OQJB 4XO3A 5A2JH 4Y19D 5ACLA 3N85L 1F4XL 2BSSB 5E9AA 5GQBA 1TSRA 1EAPB 1MNUH 3UBGA 4HUCA 1A7NH 5J3HC 3BISA 5DJYA 2LOEA 2ZOOA 3N43B 1NCOA 2WTRB 2X70B 4NBYB 4TVPE 2DW5A 3FT2A 4HU8A 2V3DA 4W6YB 3O2VL 5ESQA 1N70A 4JGUA 4IHOA 3KS0J 1FZOB 1D7DA 4AQEB 5AOJA 3ZMEA 4G1EB 5AW1B 3WDJA 2VLME 4AMXA 4JB9L 2FLMA 1TKWB 2DIBA 5GGTH 4ZG1A 2DMBA 1PDKB 1KCRL 2Z6FA 5LGHL 4JANB 4J8RB 5IVZB 1F4YL 5E0QA 1PAZA 5D8JH 1HT6A 4KKLC 4N4YB 1ETJA 2AERT 2VOTA 4XWGL 4N85A 3JWNG 5HYJE 3EJRA 2GUOB 3SDAA 5DVLA 4QRPE 5CJQH 2V9UA 3PRZA 4NQDA 4J5VA 5FA4B 2IJ0C 4Z7UF 4D0CA 4DVRL 1FNLA 4X8CA 3GSRB 3WIHA 5IHZB 3VXOA 3W2DL 3B2DC 3FXIC 2GIXA 3FOMB 3PAYA 1S7TA 4L8DA 1T83A 1QUNB 1T2JA 5IB2B 3AMKA 5FEBA 3JBG7 3HE6C 5AYUL 1S7SB 1CD9B 4XN8A 5KYXA 4OGXH 4JHAH 4G7VL 3EF4A 1YDPA 3FQUB 4FF9A 5D7LD 5D2LB 3QNZA 2F18A 3I84A 3IMWA 3MOBL 3EYVA 3WUWA 3ZT6A 2DQEL 4JFXB 3KM2A 5J6HB 3T0ED 4DKAA 1BZQK 2O5XH 1WV7T 4KY1L 4HV8A 3QUMB 3CHSA 3X14A 5BZZA 1L7IL 2B20A 1WBYB 2XZQL 4AYID 5C0RH 5DQJA 3D07A 3SJVD 4G8GA 2GTWB 2HJKB 4L8CA 2OSWA 4EI0A 3QI9A 4ODSH 3UROR 3GMOA 1XGUA 4L5FL 1NJ9B 1AR2A 2Y1YA 4OJYA 3UPRB 4L3FA 4S2SA 5TTRA 3S8GB 1WIUA 3KBFA 5F9OL 5CGBA 3WEBA 4HEME 1FNSH 4JFFD 2CLZA 1DVSA 5JHDE 2F7IA 4J3VA 3W1ZA 4RISH 3KWTA 2DEYX 3BKJH 2V7HB 3CHQA 3DNKA 3GS7A 2IDCA 3FQ2A 2DBLL 2G75A 2WXMA 4YE0A 4GLRH 2XTJC 3GZPA 5J8OA 1FJ1B 2OLDA 2Z31B 1G4MA 4WW1B 3HG0A 4UQDA 4JMXA 2DTML 4HPYH 4JZJA 5KSAD 3D9AH 1BAFH 4OGAD 4MX7A 1DCEA 5K39A 4EKXA 3BP7B 4PLKC 2CRZA 2JMRA 3E6FA 1BBDL 3AFLA 2OX5A 3DUHA 2R7EB 5I1GH 4ZAKB 1RPUA 3QQXA 3ZZQA 1BAGA 4P2OC 2AQNA 1AIFB 2XQYA 2QV2A 4NX0A 1L9PA 5ACZA 4E9SA 3ARDA 4O58H 2KI6A 4PY8J 1NAKH 3EOAA 4PJHB 2F8OA 1P4UA 1G7JA 4N0UB 4WI8A 2AZAA 1GC1H 3PABB 4XMKH 2VWEE 3AQXA 1FZMB 3SKOB 4Z7NE 4OUUA 2AFNA 4GP4B 1JVOA 5F7FA 3S37H 2G9KA 1HIML 1K5NA 3QHTC 3C9NB 5C2BH 4GQPH 1QR4A 2FWOA 3ULUE 4P2AA 5HYSG 1F4WH 1HCVA 3WHE0 3OBAA 2J2ZA 4NNXB 4FN0A 3MUHL 4TMPA 5GS1B 3B9KB 4LSUH 5SX4I 2PYFB 1YNKL 1DVQA 1Y7VA 4F91B 4LPXA 4N8CL 5HHOE 3RU8L 4OFQA 2X28A 2A9AA 4XWOD 2F0CA 3H3BC 2ZIDA 4N0YL 3BRGC 3N40F 5AYQA 4E9YA 2G5RA 1PQZB 2DH2A 2E7LA 4FNUA 3MRLB 4YK4C 3M46A 1ZT4B 3UPCA 1NBYA 3FHAA 3D33A 4CSTA 1XGQB 1CFVH 4X6EB 4MJIB 3BXNA 1G0DA 2YD5A 2Y6TE 3BVNA 3FJTA 2OA9A 2NY1C 3QXAB 2JQAA 4JCWA 4KXCA 1E67A 3VXSE 2VLRE 3IJYB 4NENA 2Z8RA 5AVWB 1AFVL 3T5WA 5A3ID 3UYPB 3DGGA 5BO1L 3H3PL 2CDEA 2XWTB 2ZCKL 2MRYA 4HXBL 2X05A 4JS7A 4B97A 1VPOL 2H2SC 4MMZC 5D1ZI 5DK0B 3SDAC 4I0KA 3H4HA 2HAZA 3PL6C 1FFPA 3LNDA 3V52H 4B3EA 8CGTA 5IJVA 1J1OL 3FT3A 3SDXF 2CZNA 3N41F 2ZWYA 4Q2ZA 1MLCA 4UQBA 3T08A 5GZOA 5C08E 4Y8DC 1UA3A 2ZUVA 3N3EA 4YHZH 3DA0A 3HZMA 1DBML 3RTQD 1MHCA 4HX1B 3BH9B 4FQJH 4YHPA 2CIKA 1S4IA 2CLVA 1CLZH 4QLRA 3TPKA 1CLVA 1JWUB 1IBYA 2Z4TA 4KJQC 1JDAA 4E9TA 4Q89A 4NCC1 3QS3A 3QC5X 4JFPA 5CZXC 3X12A 4BE5A 5CAYB 1LDSA 3QRBA 4GG8A 3P3RA 3BQUA 3OGCB 3R1GH 3CDCA 1T1YA 3VAEA 4YOKA 4ZX3A 5MEPA 2NT1A 5E6IB 4WTWA 4FULA 1CFMA 2DWSA 2EDMA 4KQ3H 2YA2A 3KHOA 5LWYL 2YARA 4BH7B 3WUWG 4JQIL 5BRZE 4MDIA 2FBOJ 3NAAL 4HS3B 2RH0A 4GXUN 4KDVA 1GVIA 3JZYA 1H3UA 5GISH 2GITA 1P5VA 4OAWA 4WGWB 1U2YA 3A6BL 2YD7A 3BO8B 2GSGB 4I8DA 4OGZA 1N6VA 4K8RD 3PV6B 1XGPB 2E9WA 2SODB 4XPTL 5F6HJ 1ZXKA 4WWID 4OD2B 1RPQA 4A7QA 1IV8A 1DEEA 3RRQA 3JVGA 4OV5B 3P54A 3PYCA 4MZ2A 4DSYA 3MV7A 1UH4A 3V5DB 1KYUA 3L3HA 1WH0A 4A37A 3F7VB 3V8OA 1CGUA 3OMZA 5JPNB 5LXGH 3LXAA 2F7RA 3L4TA 3O45B 4W6XB 4ZYKB 3HRZB 4FTDA 1IAKB 1YA5A 5EZJB 1E5YA 4XNZB 4OFVA 1HH6B 1NM9A 4K3DH 3OSKA 5IW1B 5T1JA 1PTZA 4UTBA 3CUPB 4N2LA 3I75A 4BFRA 1I1AA 3CFMA 3DX7B 3ERXA 4Y2OA 3NABH 4W4OA 3CDZA 5GRYA 2W0KA 4MCZA 3VXQB 1FUNA 3BWUC 5KVEH 4GIPD 3FFDA 4KH2A 3WNKA 4WV1C 5HD8C 1WA2X 4GG6F 1G7QA 4OZGA 3LKNB 2XQYG 4C56D 2A4EA 2IDTA 3NIGB 2UX6A 2YA0A 1DN2A 5CN3A 1A3QA 4JVUA 3NFNB 2I26N 4PRID 5K9QI 1XV8A 4OIIH 1CLCA 4BA0A 4MHHG 3UZQA 3ZRSA 4KWUA 5C0CD 2NY0C 4PRPD 5C6PB 5K5YA 4ZXBB 3MREA 4L8BB 4Z8FH 3D39E 2BNRD 1I9RH 2CNYA 3GMLB 2L04A 4LNRA 5HGAA 5BZXA 1NFDB 3FO1B 4A7TA 5DS8B 5FO9A 5T1MA 4ELME 2WN3A 4WK2B 1HJCA 3CFIC 4JR9L 1C12B 3QIBD 3EUUA 4XAWL 4L48A 2L7UA 2R8SH 2ARJB 3MV9E 4PRBB 2H3KA 2IG2L 3TEWA 2VZ3A 4TXVB 1GZHC 4U1JA 5CEYB 3HMXA 3ZKMD 1ZHBA 2NYYC 1KF9B 1HSAA 3LH2L 3MRRB 3TT3L 3CU1A 1LO5B 2C3GA 1JZ4A 1TNNA 3UEQA 3V9EA 1HDMB 2WLMA 4K7FB 5DRZA 1N6QL 3IFNH 3V6ZB 1I8MB 3IGLA 4IGBA 5ICZB 5D5MF 3BPNB 1JZ7A 4FTVE 3I3DA 2IPKB 3QFJB 4JDTH 5EA0H 5I6PA 2KYIA 2VYRE 3FQXB 3T0AA 4D7BA 1VSCA 1G6RL 2GBVA 2K6WA 4UBDD 4H25A 5L2JB 2HT3D 1TTAA 3FUEA 1LK3L 3K8KA 4JFYA 3T2PA 2MOVA 2BIHA 2FX9H 2XFGB 1KTRL 2LU7A 4LSVL 5BZWA 5GZOC 3DRQB 3FTYA 4G3YL 3NTCH 4Y4HA 3V5KA 2CO3A 3PQYB 4DQOH 2X4RA 4I5BB 3JYCA 4XVSH 1G9NC 1ZHLA 3QUYD 1A47A 4NWTH 1QPPA 3TO4B 4YEEA 5HGBA 4KKRA 2HPTA 1CT8A 1NIFA 1U8NA 4P3DA 1AXSB 3K4AA 4HA1A 2MFNA 2WTOA 3WFBL 4LLDB 1RZPA 5EWIH 1RZKL 4BE6A 4QJ4B 3ZKND 5DQ9B 5D7JB 4FQXB 2X7LB 3BQUC 5GGQH 1R3IH 1YEDB 2G3MA 2BVOB 3LB6D 4C8XA 4L2YA 32C2B 3CFTA 3SIKA 3N85H 2BZ7A 5E2TL 4GP8B 2JV6A 2PW1B 1BD2A 1FZJB 5GGRB 5HYQA 3WJLA 1D9KD 3VFPA 3K2MC 2O6CA 4ES9A 1NMCB 1EO8L 4MB4A 5B3SB 3O2VH 3GZOA 2YXFA 2NY4C 4I3RL 4Z9KB 4Z76B 3FO2B 3T2NL 1FC2D 1V10A 3APNA 4KXBA 5ALBL 1U8IA 1Y0LA 3QDMB 4IBSA 2OKMA 4JB9H 5AYTA 4ZUWA 1Z9PA 1KCRH 2IIJA 1ETA1 1HVXA 2WXRA 4IU3B 4L3EB 4OLVL 1F3JB 4JDZB 4WWKD 3NBNA 3KLHC 4OH2A 1F4YH 1WAEA 1U30A 2DQTH 4GQQA 3VA2C 1OAJA 2EADA 4OTXL 3SBWA 3FOLB 2EIZA 4IOSA 3RZCD 1WITA 3L95A 2Y7LA 1W0VA 3S5LB 4RWHA 1X4YA 3TPUB 3EH1A 3O2DL 3QFDA 2IAAC 4JFHE 4HUWA 4I9WD 4X6DB 4DVRH 1BVKB 2WLJA 3W2DH 1PZBA 5IY5B 5HHMB 1JUFA 5K1JA 1SJEB 1AAJA 1HZLA 4JFDD 3F00A 1I1AC 4FHBD 3KD4A 4HKZA 5AYUH 4NRYB 4W4OC 1MW1A 4G7VH 4PRAA 2NSMA 5AB0A 4FXGB 2I9LA 1T22B 1NLDL 2J6EL 3MOBH 3KVPA 3L08A 2DQEH 1QLRB 1ZV9A 2F5BL 4GO9A 3U9UB 1W72A 1UWXK 4BINA 2HRLA 2IALA 4NIYE 1U0QA 3GC3A 4WUUB 1RURL 4KY1H 1KLUA 1BMGA 1MAJA 2YUWA 3B5TA 1L7IH 3AXLB 3ZW3A 4Z3TA 3KPRD 2HT4D 3OKKB 1N2RA 1ZHKA 3P4MA 3UBXI 2KBGA 3UBHA 5JOPD 3QDGE 1E8ZA 1FZKB 4LDOB 1CIDA 2GIMA 1A6PA 2NX5A 2HLFD 4L5FH 2WBJC 3RWEA 3UABA 1Z1WA 5A2IH 1N4XL 2ZAHA 5IJBC 2B2XL 3H7BA 4PR5A 4LQ1A 5F9OH 5K9JL 2QPEB 3F05A 4LXFA 4N68A 3L4CA 5CIPA 3TV8A 2DQ6A 4HGMA 4G6FB 2DBLH 5AW5B 3U4BL 3KPSB 4YUEL 2FX8L 4OLWL 4B60A 3BW9A 1SLXA 2DTMH 1F13A 2WINB 2PF6A 3KVDD 1MRFL 3DYOA 5JHLA 2I07B 3SO3C 1MRCL 1NDGB 1X7TA 1XH3A 4AGQA 4FQIH 1USZA 4NQDD 4GW5A 1KG0B 2J1ZA 1BFOB 2O6FA 2EO9A 4GRLA 3DVGA 8FABB 4PJAF 1OALA 3O4OB 4U1SA 4BQ6A 5E2JA 2FZ3B 4F7EB 1TVDA 1QABA 1HHHB 4FFZA 3BVWA 1UA6L 3OG4B 5CGTA 1IT9L 3NGBB 3AS0A 4LP8A 1HL8A 1JVKA 4FG6C 3H54A 4Y4HC 1UB6B 3HNVH 4PJCB 3TTSA 3LPFA 3CZNA 3FUFA 4CC4A 2ZXWB 1SQMA 2CMRH 5AZUA 3TA3D 1KCSH 5EN2B 4NQCA 1HIMH 2GBAA 3NJGA 1KIPA 3PY9A 4W9FC 2DB8A 2Z65C 2D4DA 3DVNA 1TZHA 4H26B 5I1AA 2LV4A 3ATEA 4OKVB 2DPKA 4AXWB 3AACA 4N1CA 4BQBA 1YNKH 1JV5B 1XF3A 3BFOA 5JO5B 4G8GD 4LGSB 2XRAL 1FP5A 4N8CH 3BESR 2P42B 3HG5A 3HOGA 3DV6B 3QI9D 3RU8H 3SKNB 3TBTB 2QQNL 3KPMB 3W57A 4N0YH 3ARZA 3VXUD 2JKJA 1IGFL 5D2NB 5GPRA 1SMDA 2IGTA 4CKQA 5KSUB 3WJLC 4GRWF 4I87A 3L3IA 4HCFA 1FG9C 1UC6A 1WP6A 4J1UB 4H13C 4MNGA 3LH8A 3R7QA 5DRWB 2YZ1A 3VO0A 4AE1A 1I7RB 2NMSA 3BCFA 5FUCE 2FH6A 5E8NB 1OTUC 3DX0A 3UTSA 1XCWA 2BVUA 2LW3A 1NSNL 2Z91B 5D1XA 1VFAB 1GYVA 5F93C 1OT1A 5BO1H 2ITCA 3KNBB 2YPKB 4H44C 4GKLA 1Q8MA 1MCWM 2NXZB 3DRTB 2ZCKH 4UQ2B 5KAQF 2X1XR 4HXBH 1MFCL 4KROD 4WY7L 4KXZI 4BWTA 1VPOH 4J3OC 3U6RA 4I4WA 1KULA 2CA4A 4X5QA 1FVDB 2IH3B 1MAKA 2W81C 3G6JB 4OCMC 1KT2A 3SPJA 1VACA 5DJAA 5IMMB 3KLKA 2QTEA 3ARDD 3QWOA 1IVTA 4P3CL 1CTOA 5IHHA 2JIXD 3QDJB 4JG0L 1JZ6A 1DBMH 3PWLA 3PWPB 1RHHA 2W94A 3SN6N 2D8KA 2VISA 4PY7B 3VFRB 1J8RA 4MAZA 1YY9D 5B21A 4FQHA 3U7WL 2EC9T 3FAWA 1SXSA 4GBXA 1KWGA 1LD9A 1KTBA 3VVVA 1KXHA 2W0FA 3GIZL 2ENJA 3L4ZA 3NUKA 3W38A 4TNEA 2C9XA 2XVGA 5D1QD 4KNQA 4FS0A 4UILL 2ADIA 3HVNA 4W4NA 4XVUC 1YCSA 3H6AA 5FM5M 2WXIA 3P3TA 4P2RE 4Y2NA 3TYFA 2XG5B 4Y9EA 5CCHE 4CSZA 4JJ5B 4LVNB 5LWYH 2X0WA 1E27A 3NSFA 5FYJU 4WEMB 3CPLB 1IC1A 1AKJD 2UZXB 4X6FA 1CFSA 2ATPA 3NAAH 5EBWB 5AVSB 4A6YL 1SYVB 1ZS8A 2ENPA 2OTUA 4LBAA 3ZR6A 2JCCE 4KUCF 4P23C 2X4OA 5C09A 4FHKA 2FE0A 3OAYH 3ALPA 1SHWA 1GYWA 1I7TA 3RWFA 5H35A 2PW2B 5TJWK 3A6BH 3REWB 1QQDA 4M4PA 4MDJB 5CJXA 2MTPA 2P47B 1NCJA 2P9RA 2OZ4L 3TFKC 4XPTH 4PGDB 1KYOJ 1E6JL 2UY7A 1AZZC 1DJWA 4X99B 1HH9B 3N1GC 1EERB 4U1HA 1IEAB 1BX2A 1XVSA 2JB5L 3LRSA 3MRJB 3ECWA 4LCVA 5FOBA 1O7SA 1MJJA 1AACA 5EBGA 5FDWA 2N56A 2GB2A 4WTZA 3TBWA 4FLRA 1M71A 5D72L 3BUYA 4GRLC 3WN5B 2VZUA 5CLYA 5BRPA 1UFGA 5HDWA 2OMZB 4LCWE 4I3SL 4PJEB 1ZGLM 2NQDA 4RGNB 5DVNA 1MCQA 2CKNA 1Q38A 4ZO7A 3FU5A 3P9MB 1NIAA 3WO4C 4AGMA 1ASOA 1UQSB 3IAGC 2WBKA 4JRFA 1TCRB 1KENL 5T33L 5EEZA 2V5RA 2YN3A 4FLQA 1AYRA 2WLLA 1IGIL 4AOFA 4CC4C 4J27A 3L8QA 1IAIM 4KJWC 4J2QA 4IDJL 2NY3D 4PRDB 2NTFB 3QS2A 1WCQA 2CKBA 4ZD3L 3TEYA 4PV8A 1SLUA 1K4DB 4IRJC 1BLNB 2J3SA 1I9EA 3JWDC 2IGFH 2X9WA 1D7BA 5GGUA 1CN4A 3D6GA 1AZBA 1DFBH 3LQZB 5IR1A 2CO7A 3Q48A 3EDDA 4RZKA 2JF1A 3ALWA 3CZLA 4W68A 4MNHB 5I1LB 1WBXB 4B41A 3MNMA 3ETSA 3HC0A 1PD0A 5L88L 2HVJB 4A2LA 4YHYC 1BXUA 4JR9H 4IJ3B 4IRZL 1L9NA 4O5LL 4I85A 4JFOA 1T21A 2EYTB 3PPEA 2IG2H 4X4YA 2G3XA 3BGFB 4YDLC 5FGCE 5F8RC 3QGVA 3LH2H 4UIKL 3TT3H 2R0LL 4JL2A 5C3IA 3GKZA 1RHFA 1XR8B 2IANB 3BAIA 1TEYA 5D1XC 1GIGL 4JDVA 3F2LA 3QIUA 2BY0A 1N6QH 3HFFA 4AWJC 4NRXB 5FYKD 3TWYA 4UOZA 3WKPA 2Q76B 5EU4A 4EQ3A 2D4FA 4Q6IA 1TETL 3GUTA 4GB9A 1QRNB 5I19L 3T4AA 1G6RH 4GW1B 2KH2B 1LK3H 1A4KB 2NSXA 2F54B 4NO3B 3DUUA 1E4JA 2FECI 5K9OA 3H0TA 5DJ8B 1SHXA 1CD1A 4LSVH 2A1WL 2VM4A 5IT2L 4G3YH 1G43A 2LU3A 3AB0C 4WRLA 2XXGA 3IPEA 2D3LA 2NLJA 4YH6A 2O5ZH 4XAKE 3CX5J 3W9EA 3CQPA 5LKNA 4KU1A 4Y7OC 5JXAL 3ZDYF 1I7ZB 1RUKL 4F27A 4NN7B 4L9LA 1AQDA 2BJML 3BP6B 3WFBH 2WNKA 3MLYL 1RZKH 4HWZA 4XGZB 2VQTA 4GBXC 4JFQA 1F4HA 1DEDA 1ZJAA 2JVUA 5EBLA 1MXDA 5INDA 1VKXA 2MKLC 1OAKL 4WTXA 3EYQD 2Z9TA 2XLLA 3DIVA 3K4DA 3CSGA 4PJIF 1JNJA 4IOFC 3P1VA 1A7OL 5AALA 5D7IF 3ZYOA 4DF9A 5E2TH 4A1RA 5H2BB 3VRJA 5BS0A 1KBPA 3QARA 4XR8C 4O4YL 3N2JA 1XD0A 2HN7B 3P30L 5FB8B 3D06A 1JYWA 1ODUA 1RIHL 5D96C 5DEFA 3DO7B 3UC2A 1UWFA 4OKDA 1EO8H 3FB7B 3PNRB 1YAZA 2X89A 3D85D 2YXVA 2DWXA 4I3RH 1NUGA 5F0MB 5D1ZA 5F7WC 3T2NH 4Z3GA 1MFEL 2VAJA 1G9MC 1RZIA 5ALBH 3MOAL 1UCTA 3GMPA 2YZ8A 1HU8A 1XL4A 1FVCB 3BE1L 4LBEA 1ADQA 4OLVH 43CAA 4R96B 2ZUQC 1BDYA 3RGVA 1CXKA 3MXWH 4N5EC 4OTXH 1NTDA 3OAZH 2W9DL 2EDQA 5CJBA 2Z7YA 3VWJB 4LT7A 1ZHNB 2ADJA 4GT7A 4YDNA 3KAAA 1XZWA 4LASL 5D7KD 2DYRB 3ARFA 4HXAL 1QFHA 3LD8B 1IB5A 3D30A 1BREA 4LLVA 1DJGA 2J4WL 4IBZA 2Z34A 4G80B 2BVPA 1ZSDB 1IAMA 4X5PA 4PN6A 2XN9E 4YC2C 3FB5A 4NRZB 2BWDA 1UXMA 3WY1A 2AJ3B 4M00A 4Z7UB 2ITEA 5EU6B 4WTZG 3NP4A 1FL3A 3WOVA 2B9AA 1NLDH 2J6EH 5T1KD 5CN2A 3ESNA 4UTAL 1Z2KA 2WIMA 2F5BH 3MBWB 4GJTB 4BEIA 5IQMA 3RVWC 3QQ4A 1TVBB 4KFZC 1EEZA 1KLFA 3RJOA 3T4YB 4KO6A 1RURH 2EYRB 5DC2A 4U7SA 2G9HA 1JNLL 3TF4A 4X0KA 1OANA 4QO1A 2OMYA 1J18A 1BD2D 1J1PL 1T04B 4F93B 3M1CA 3HG1A 3UTTD 2IPUG 5KBKA 3FN0L 4HP5A 2PYED 1CWVA 4LLWB 1F3DH 3RB5A 1QZNA 5JHAA 1N4XH 1ZVYA 2B2XH 1V3MA 2JKIS 5K9JH 3EAKA 4BFOA 4J7RA 2LFGA 5DHXB 3DMMB 1P69B 2LT9A 1KCVL 3AM8A 1A4CA 2FT8A 4ZFQA 1VENA 5DUJA 4AK2A 3BHBA 3U4BH 4HKBB 2DKMA 4YUEH 2V33A 3DYPA 2FX8H 4OLWH 4PGCA 3G5VB 3ZN6A 1MRFH 3HG2A 1G6RB 4YR6B 3QIUC 1T5KA 1MRCH 3IXAA 4NN5B 4DZBB 1OSZB 1PZ3A 1T7XA 4OZIE 3VD4A 3VM5A 2Z93B 2X70A 1IGYB 1YMMB 1H3VA 4YDZA 5I1KL 1BVNP 4PBVC 1FZOA 1CYGA 5F88B 2I69A 4HJJL 3N40P 3C09C 1IT9H 1TKWA 1YHPA 5TGBB 3QUZA 4XN1A 3OC8A 2DMCA 5DHEA 2P5WD 5KVGE 1ZIAA 2B39A 3QCUL 3PE9A 3P2TA 1F0LA 1KCWA 1J9RA 3VI4F 3RWIB 4KGLA 4YPGA 4MXVE 4C4KT 4OFYA 4L9LC 4ZOCA 1GZQA 3MUJA 1L0YA 3QUXC 4Z7VE 2LR4A 3HIZA 4XNMB 4U7KA 3E1ZA 4DAGL 4F57L 5FA4A 5B8CB 3EJJX 3GMNB 2HZHA 3TWCL 3GSRA 2WWOA 3EOTL 1IGTB 1KXTA 2XRAH 1U3JA 1BF2A 2O61B 1SGKA 4DP5X 2NW3A 5IB2A 1QUNA 2QQNH 3ATFA 1LXMA 3WLBA 2P26A 2WAQA 1BWWA 3IBEA 3V0DA 1IGFH 4JFEB 2E0PA 5DVMA 5E03A 3FZUC 5C7ZA 5D2LA 5IKCB 4N5UA 2IV9A 3WY2A 2QT6A 1WD8A 3SGKA 4M7LL 4EN3A 3KJ4B 1AANA 1SJVA 5AEAA 4XMTA 5J6HA 4LHUA 2RIKA 3FO9B 4MAYA 3GSNA 2WD0A 2BSRB 5DO2D 1NSNH 3QUMA 4XNXL 1Q9LB 2YGVA 1P7BA 1YEKL 2OPCA 4GSXA 3TZVB 5CWSB 1WBYA 4AYMC 4DP1X 3VFGL 2M1KA 2Y1AA 1R3JB 1MFCH 4WY7H 1DJZA 3LS5L 1HXMA 3MLSH 1LE5B 4HKJA 1DZ0A 3CPUA 5H37A 1CVSC 4FFWD 2WPGA 1NJ9A 5FKPB 5I75C 5KYUA 2WHVA 3ARFC 1OP5K 4I2XB 3BSZL 4P3CH 1T7VA 2EE9A 4HJTA 3ZBMA 5CEXB 1ADWA 4M8QA 4JG0H 4U1NA 2I7OA 2Z31A 1U3HD 1L3WA 5DJ2B 4XZ4A 5KJ4A 3ZLQC 3LVTA 1G84A 2BNUA 2QVKA 4KY2A 4NNYB 2G60L 5L4FA 1RCYA 3P3SA 2IDSA 4DK5A 3SDXB 4QKTA 3N41B 3HZKA 3BP7A 3O3AB 5FECA 1O5PA 1Q0EA 1BVZA 4GI6A 3KYMA 1ORQB 4LKXB 4LLAA 5EUKB 4WW2A 5I26A 5I5MA 3GIZH 3C5JA 3EJYC 1MI5B 1PZDA 4IIQB 4W9LC 4ZAKA 2QEJA 5G5DA 1SOSA 3C6LA 4UILH 4HUXB 4ZFFB 3CH8A 2R2EB 2BOBA 2DH3A 2J5LC 4UM9A 5E9DA 4N2OA 1NDTA 3WGUB 4PJHA 5GS2D 3ARBD 1CGSL 3TNNB 4XXCA 5KYYB 3FO0L 4A6YH 3PABA 1FZMA 3SKOA 3HLAB 2ZX8A 1THAA 3FQ1A 3C9NA 3OC5A 2CBOA 3GLDA 3SZ6A 4KK6C 2CHNA 4WU7A 2G3NA 1UVQA 2QADD 4NNXA 2OZ4H 2DIEA 2PYFA 1E6JH 4XO8A 2BP3A 4NO2A 3X13A 5CLWA 1AO7D 5F7KC 4FQ1L 1XB8A 1ZLDA 5GS0L 4XX1E 5IJKC 1A6WH 4U4BA 2CJSA 2PUQT 3B2UC 1P84K 2O30A 2JB5H 4XHJD 4WFHD 4BUQA 4Y1TA 4HLZH 5E4EB 2XT1B 2D7QA 1PQZA 4JE4B 2JTYA 3MRLA 5GGTA 5SWZE 4UAOB 5D72H 3EBAA 2YPLE 4KKAC 3WMPA 2H47C 4NNPL 3EXJA 4XT1C 4I3SH 3BKYH 3SGDH 5AW3B 2AMGA 3LZQA 3QZMA 4NM4H 4X6EA 2QDVA 2YWZA 4MJIA 2EO7A 5CD3A 4LPUA 1T89A 1WWCA 3ETTA 4PJ5B 3U6XS 1ET7A 3P02A 1KGUA 1X5YA 3QUZC 2X2JA 3VTMA 1KENH 5T33H 3UBXA 1RZ7L 3HI1B 3KGUA 3N0PB 5IEKB 3Q2LA 1OT2A 2XWTA 2X6MA 2O5YH 5J0BA 2OM5A 3GHBL 1DO5A 1DFXA 3ZPDA 4IDJH 3IDGB 4KVCL 5DK0A 3FB6A 3US1A 4ZD3H 1I31A 3JV4A 4TYUA 5KSBE 3ILPA 2F9BT 2R23B 1R5VA 2D2OA 3PWNA 4YDJB 3QO0A 4POUB 4DESA 5K9QG 4GG6B 3EIFA 4PY8I 3ULVC 2XPZA 1Z3RA 4MWFB 2YBRB 3RUGF 3OSVA 4MKMA 1M05B 3AGVA 3DV4B 1SEBA 1E5ZA 1AG0A 3OAUH 3VI3F 3BH9A 5ETUA 2OI9B 4NKDB 4BZ2L 3K6NA 5C09D 5L88H 3WSQL 4O00A 2Q2LA 1XMWA 3RWDA 3EGSB 4IRZH 4O5LH 2WZ0A 5KG9B 3P40A 3CWGA 4JJHA 3SGKC 2FJFA 1G7MB 5T3XL 4UIKH 5IVXF 2R0LH 1N0LB 2ZX9A 5JW5B 4MAYC 4YO0B 1OT4A 3ZHFA 2UY6B 4PW9A 1P53A 1GIGH 1U8LB 4WEBL 1KWKA 3C2AL 4I48A 1KY6A 5FUOL 1SOQA 4E41E 1MY7A 2WYTA 4WGKA 3IEAA 5EUOA 4BH7A 1TETH 1P7QA 4JEGB 5J1AA 4HGWB 1DVZA 3FFCD 1NINA 1R6VA 1AJ7L 6TAAA 4UIMA 1U8QA 3MRCA 1TO4A 3QJOA 4LHUG 2WLIA 1HZHL 1NGPL 1NUDA 1E28B 3QJTB 3BO8A 2A1WH 2GSGA 5D5MB 3AS1A 5C0BB 3CFEB 4QRRB 2L7JA 1U2HA 5IT2H 2IADB 3PV6A 1XGPA 4HUUB 4KKBD 1HKLL 5F9DC 2Z31C 4PJBE 2ZP0T 2D7OA 3KXFA 4APQB 4I88A 5TPWL 1SN5A 2AI0L 5LCVL 5EIIB 3SDDB 2YQGA 3CXHJ 3HR5B 4H8VA 1BJ1J 5H37G 5JXAH 1RUKH 1KEML 1AH1A 4KV5E 3HUJB 4YPJA 2BJMH 1OWRM 4GO6B 5LBSL 1SUHA 3MLYH 5JPNA 3IWVA 2X3CA 1NQBA 2NUTB 3MGAA 4ZYKA 1SXCA 5E8OB 1UOWA 1IAKA 3DVFA 4ZAKC 1OAKH 1J8SA 3H9SD 5EZJA 3PXLA 5DRNB 1FL5A 4JFFE 1HH6A 5C07B 1A7OH 4A6YB 3RWCA 3CUPA 2NR6A 2QSQA 2ZOLA 4N2EA 4Y7MA 4O4YH 1P1ZB 2XWEA 3P30H 3MCYA 4FG0A 1RIHH 4NZJA 3WKML 2P43B 1UZ8B 1OSPL 4P5KA 2QHRL 5JXEA </