4CC0A

Notch ligand, jagged-1, contains an n-terminal c2 domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
306
structure length
306
Chain Sequence
SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN JAGGED-1
publication title Structural Analysis Uncovers Lipid-Binding Properties of Notch Ligands
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc0A01
4CBZA 4CC1A 4CC0A 4XBMA
chains in the Genus database with same CATH superfamily
2CSPA 3GBNH 1B2WL 2PPAA 5KSBE 3VD3A 3LKQB 5JPNA 3QRLA 1KB5B 1XHHA 5ABDE 3EYUL 4PMFA 2YPKA 3NIFE 4ILDA 3RBGA 4DESA 5L8KB 2EDDA 1PYWB 2XYBA 3KWXA 4PG9A 3VGAC 4JGNA 3VD1A 1FH5L 4HK0B 1V8HA 3U25A 2YJQA 5T5NG 4BBWA 1HXMA 4WFED 5D9SB 1W72B 2ZXWB 3TJHC 4NQVB 1JYXA 3FTUA 1DCLA 5ISZB 1PDKB 1Q0YL 5D6CB 1JN6A 3D5OF 2Z34A 3WN5C 5T3ZD 5B1AB 2Y72A 3BXNA 1T89C 2K3HA 5DZJA 3MOAL 2WINB 4OM0H 4P5KA 5D70L 5DI8B 3T6QC 3CFEB 3ISRA 4G7YL 1MN4A 2V5YA 2CHNA 3I3BA 4AZ8B 3QUML 5F7EH 3JWDC 3KJ6H 1U33A 4G6KH 1Q9LA 4XOBA 4FLOA 3TVMB 1G7HA 3AM8C 4AT6A 3IFLH 3LJ3A 5I8KH 1CK0H 1JXFA 3NSYA 4UQDA 4XWGL 3A0OA 3H0TA 1G1KA 2V6HA 2BRRH 4DSYA 1CD9B 5AW3B 3CMOH 3TBYA 3WUWG 1H6EA 3K2UL 4JFDD 1YPZF 2D4FA 5CMAB 2ZKHH 1TMQA 1SN0A 1H0DA 3B4NA 3QFGA 3EH1A 5D7EA 1AOZA 1GZPA 2EDBA 1QO3A 2ZOKA 4JREC 1ND0B 3HG1B 4NXKA 5L8LB 1OL0A 4FS0A 3VXSD 4U0QB 1A9EB 4ODXA 5FR3A 2IAND 2HXAA 3E2HC 3Q05A 5JQIB 2NPLX 4UUJA 5EUKB 2B59B 4S11A 2VJ8A 4TF4A 3MXWH 5SWZB 4JPKH 2XIDA 1C08A 1GS7A 3BWAA 1RULL 2D7NA 5D1XC 3IDJB 2NRDA 3MRIA 3CFMA 2NSXA 2WBXA 4J3OG 4OZ4A 3FT2A 2ESVD 3ERXA 4LNRB 3EYQC 4P46D 5ID1A 4ANWA 2F61A 3R06B 1PTZA 2OZ4L 4JRYA 5J6HB 2JQZA 4ZX6A 1SHWA 5KSAC 2YLKA 2JFCA 3DV6B 4AMWA 1MH5B 4J6RH 1WCBA 2X4PA 1CFMA 4N8CL 4X80H 2AJYH 2WW8A 3C5ZB 4DP8X 1F3RB 4L1TA 3FQ1A 5AZ2L 1F45A 4KI5F 2C1OA 3GSRB 3QQ4B 1DBJH 1N9PA 1TDQA 4TNVK 3ZDZB 3X1EA 1OZTG 5HGBB 2W80C 3CVHH 3KVPA 3EF4A 5KYUA 5BCAA 4DNLA 5HI5D 3ZTEA 3QHZH 5J9PA 2XOTA 1CE6B 4HS6B 1DJHA 2OSLB 5L88H 1CT8B 2AJSH 1JPFA 5LBSL 3NG5A 3PNRB 5DC0A 4NBYB 5F1IA 4EI6B 1U6AH 4ZUSB 3PWPB 2QSTA 3V4VA 1NMBH 3A6CL 4KY1L 4UANA 32C2B 2NNXA 2Y5QA 2GJZB 6PCYA 5J3HD 4X98A 2IEPA 3T8XA 4YDVB 2F5AL 4QF1A 3DXAD 3NQIA 4WFGD 5AL8A 1PD6A 1Y18B 1A8JH 2Y06H 1ZLSL 2WCSA 5GRJH 3WO3B 5F1NB 1IAMA 2OQJA 3HG3A 4OCYH 4G42B 5TQ0L 3MJ8A 1PY0A 2ZOLA 1OPGL 2KL6A 4XE5B 1JSYA 4UILL 2G5RA 2X2HA 4X6BA 3EOAB 2OXHB 3MLRH 4LHJB 1SDAB 5AAMA 3NPSB 3P73A 1MUJB 5AKVA 4ZMTA 4X7TB 3QH3B 1WFTA 4NQSA 2A3TA 2QKIB 3RJQB 3WOVA 4GI6A 4HIEA 4EEEA 3L95B 1Q4NX 3GKZA 3MUY1 2AANA 1N26A 1SHMA 1FDLH 2OLDA 2ZX6A 3CHOA 3FO2B 1DLFH 3RVVC 4FQ2L 3TT3H 2LLGA 2Q2EB 5E6UB 3D7PA 2R29L 1BVNP 4C56D 3UX9B 2DQCH 3HPJB 1XGRB 2B1AH 3H9ZA 4ZUTB 4ZXBB 4OGAD 3VXMD 3VXPB 4P46C 1REIA 3WY2A 4X99B 3UO1H 2QPFA 3QEQB 4OD1H 1XCQA 1WBZB 3QZWA 3AY4A 5BS0E 1WGOA 1VACB 2I5YH 3GBLA 4UTBL 3KPLB 4MS6A 3ZDWA 1HH6B 2KZKA 3CXHK 1KXTB 2HKAA 4XCYB 5L2JA 2W0FB 1UEMA 3MROA 4D8PB 3MLSH 4KRMB 1BXXA 3FNKA 5DO2C 3VGFA 2ENSA 3WENA 4GQZA 3MUJA 4ELMF 1A7RL 3B1TA 3US1A 4R0LC 3BSZH 1UXSA 1MCWW 2R7EA 3HZYB 4JPVH 4B7LA 3HC2A 3GSOB 1OSZB 4WDIA 3BUQA 4PJ8A 2GVYA 1FCCA 2VM4A 4L4TB 5AVRB 3AACA 1A14L 2HLFD 4L8SA 2FJFA 2WBJC 3BP7B 1KG0A 3MUGA 1U8HB 1TT6A 3NCCB 3UTSA 2Z0UA 3M1BA 2P80A 2FGZA 2OXGB 4P2OC 2X2JA 1YNLL 1G7IB 2XVGA 3OMZA 3V0VB 5ILTH 5EEVA 5C09A 1FQ9C 1IEBA 3VX1A 2G2NA 3PXLA 4ZYKB 4IIQA 4OZHE 3GJFA 4BQ6A 1IGTA 1CFSA 5JO5B 1RIUH 2DQFA 2XTJB 3DJ9A 2EC9T 1I9EA 3C08L 4KHXL 4NZRH 4MCZA 3ZVVA 4GUPB 1KN2H 4MD0B 1XTLA 4AE1A 3Q9PA 1W9XA 5J6SA 3FTXA 5A16B 3CVBA 2GBVA 1IGCH 2EDQA 4NQCE 2WKOF 1VZIA 1ZVHA 4QLRA 5JTWA 1YEWA 2Z31B 3FU9A 1A3LH 4M6MH 4O02H 3PFUA 3QDHA 5E9AA 4QRQA 3VWKB 25C8L 4RMVA 3FC8A 3ECQA 3TBVB 3VFVA 1L7IH 2C7UB 4RGMC 4O4YL 2R8SH 1VFBA 1Y7VA 3DYMA 4NSKB 1FJ1A 4ZS6C 5A6MA 2VERA 3Q8FA 2UWEB 3DDFA 4FFYL 2Y3NA 1XZ0A 3QDJB 1JGDB 5CLYA 4AWJC 1M6OB 1CIUA 1HXYB 3ZGHA 4GQ9L 4ZMQA 2PR4H 4PV9A 2L7UA 3BH8B 4OH2A 4MLSA 1FO0B 1X5GA 4E9TA 1H8SA 3L4YA 4AL8H 5HDBE 3LPGA 3MRHA 5KJ7E 3FN0H 5E03A 1NMAL 3HKFA 3QRBA 3OKNA 5I19H 3BHBA 4KO9A 1QVOA 3F6IA 4M7LH 1BD2E 2ZAGA 3Q9QA 3F7LA 1BIIA 1BLNA 2XVBA 4UQ2B 2ZXBA 3JV6A 4HH9B 5K59E 1NCIA 1ZDSA 5I16B 4UU9B 3GM0A 3LRSA 2NX5D 3LCYA 4XNQA 2ERJB 3MVSA 5L2KA 4YWGH 4UZUA 1I7RB 3V0GA 5FX3A 4B27A 2YAOA 4L37B 3FZUD 1ORSA 2VQTA 5IIEA 1FIGL 4AYDC 1N0LB 1ROWA 4FXLA 4HKBB 3VFUA 3P11L 1U8CB 4N20A 4L9DA 1XFPA 2UXVA 3ASOB 4L3AA 5J8OA 4M5ZL 4HBQA 4MAYB 1GGIL 2YBRA 4KQ3H 1TZGH 5DFAA 1HZHH 2ZNXA 3OLIA 2IH1B 5IHZA 4YHYB 2A9NL 3QDMD 6CGTA 3N9GH 3GSWB 4M6NL 5BRPA 2OW6A 4M8VA 5B7FA 4L23A 2Y9RT 4HXBH 2VZSA 1TCRB 1QNZL 5JA9A 1GGTA 3P0VH 4EZMA 2P47B 5IVXF 3FRUB 4HUVA 2DQGH 2XXGA 4LMQI 1KELH 2YUXA 1MI5B 4OGYL 5FYJL 3CFIC 3H85A 4OZIE 2J6EL 4MDIA 3O6KH 2E9BA 3W11C 4KKLD 4UWQB 4LASH 3CU1A 1CQKA 1NAMB 1NAKL 5ACLA 2CKNA 1AHWA 3RFZA 4OQTL 3UDWA 2YKLH 4QHNB 3LIZH 2AC0A 4YXLL 4R7LA 4AGMA 2ISDA 1H9VA 4WHYG 3RNKB 3JWOL 4ZFFA 7PAZA 2GITB 3TEUA 2HG0A 2Y2YA 5KYNA 4X8JA 1G0XA 3VSVA 3TA4D 4N0CC 4GEIA 2FQEA 3AB0C 1MG2C 3D51A 4F7TA 3Q8BA 2V9QA 5JDSA 1IE4A 2ENPA 5IBLD 3BZEA 4YBLC 3PG2A 2WSPA 3TONA 4L1HA 1E4XI 2H6OA 9PCYA 5HYJE 5SWQB 3OWRA 3ZYIA 5FWQA 3ZW3A 1K8IA 3MA7B 1N4XH 5F6HI 1INEH 5DQDL 3GHBL 1KEML 2UX6A 3LEYL 4PPTA 4WI0B 5CJ8A 2X2IA 3NEXA 4OSUH 5AD0B 2J8UE 4NNXB 2C4XA 2YGNA 4AMXA 1JNLL 1I1AC 1W2KT 2MRYA 1KPVB 4YHKL 1JZ8A 2NZIA 1OK0A 4JRLA 4P2QB 4MKTA 4BZ2L 3KDMA 1YC7A 2XN9B 3EGDB 3FCTA 3QZPA 1YY9C 2AK1L 3X3FH 3NAAL 1IM3A 4IRZL 3RVWC 4I1PA 2MPVA 1QEWA 1SOSA 2O6PA 2VDLH 1E8WA 5E5MA 3TTYA 2DQIL 2DD8L 3PWJA 3MSPA 5I9QC 3O2WL 1R5WA 3D48R 2VDRL 3S8WA 4PJBF 1O6TA 2JK5A 1EAJA 2OMXA 4CSPA 4Z95H 1QLRA 2OJZL 5EFIB 3FRPA 5J4MA 3DROA 3IDNA 4JRWA 3UTTD 2Y6TE 2GBTA 1KTDA 4JFZH 3SYQA 4G9FD 4GKLA 3MV7A 1N5YH 3KXFA 4KDTC 2PPFA 1OCZB 1ZWIB 3REWA 3X14A 4DPAX 2EXYC 3QORC 2DLFH 2YIHA 1G7JA 4JM0A 4K7PY 3CIAA 3FUJA 3ULUF 1YY8A 4FABL 1HN1A 3CC1A 3EUDA 4KKLC 5I1AA 1BPLB 3N44B 4ZRGA 3UACA 1A0QL 2XPYA 4K94H 5GRVK 5KTEH 3WTWA 1RPQA 1ZV2A 4NWTL 4TNWF 4APQB 3FQWB 5EIVA 2WLKA 1JJUA 5GQBA 4HJGA 4NQXB 3OAYH 3NN8B 5BXFB 4WENB 3RTLA 1G7QB 4LLDA 4Z7OF 5KVFH 1MCPH 3ARED 2BRQA 1PD1A 4FJYA 3JVFC 1JZ4A 4AM0B 4E41E 5FM5M 4KMTH 3ARWA 4JANB 5MEPB 5KG9A 1K4DA 1SRDA 4L8BB 5DMGC 1JERA 4U3HA 5EU4A 3T4AA 4AYEC 1RP9A 1NINA 2HJLB 5EIIB 1MFEH 1ZA6B 3D9AH 4XXWC 3ILPA 5DU7A 5FO7B 5JOPD 2YR3A 3QIUC 1K8DA 2ZUUA 3DJRA 3FBQA 3JBG7 3ULSB 3MLXH 4RQQB 4CJ0A 4R7NB 1S46A 4RFOH 4OF5A 4DZBB 3DVGA 1ZPUA 3K81A 4DTGH 2XTSA 4Z7WA 4EI5D 3JTSA 5DK2A 5C6WH 1KBBA 2NTSP 4ICWA 4M43L 3T0EB 1HHJB 3U2SA 2KMWA 2EVHA 1CC3A 4W9GC 1CDYA 5T1LA 2M26A 5D7LE 1UVQA 1ILUA 1E2ZA 1S7QB 2W88A 2YMTA 3K8LA 3VA2C 5BUAA 3JWOC 3R7RA 1KIQA 3NESA 1TETH 4MA1C 4PJ9A 1GW0A 1KJMB 4KI5E 3HLKA 4XBPA 3E80A 4HKZB 4LSUH 4FKHA 4L8DA 1R75A 3HZMA 4WJ5B 3TYGH 3NFSL 5BMFH 3RWIA 5F3HB 4N2EA 3MRNA 1S8DA 4JO8A 2DJUA 4D7BA 4AGQA 1AGEB 3VXQA 3WLWD 3GUTA 4NKQB 4Z76B 1YNTF 5BOZG 5DDHB 3RL2A 5FO9A 3WNOA 2JJTC 3BJ91 1G6RA 3N42F 1SJEA 5DGRA 1CGTA 1EHLH 1PKQB 3X17A 5DHEA 2Q10A 1B0WA 4OLEA 2YRLA 3AZUA 4LSVL 2OMBA 5BO0D 1K6QL 1E4XL 3RWJB 1CICA 1W0VB 4OCWH 3KBPA 1D5ZA 1YYMH 3W0WA 5CILH 1EAPB 5D7SH 3HOGA 1AYRA 2P5EB 1QNIA 2E5EA 1M7XA 4M93B 4YDKL 3FUMA 5EU5A 4LHQB 2CO2A 4FYQA 1F4YL 1PSKL 4HHGA 3ARFC 3I74A 4UQBA 3VD9A 4FFVD 1ET7A 5IJVA 1DFBH 3NJVA 4AYFA 5BRQA 5CM1A 1RJZA 2UY7A 4HJJL 5DD0H 3BFWA 5C08D 3C75A 4DGIL 2DQUH 4Y5VB 4FTDA 4MNQE 2Q3ZA 3FU7A 2CAKA 8FABA 1NL0L 3VFMA 3EOBA 4XMZA 4AGPA 3ARGA 2N1KA 4KUZL 5CJOL 1J9TA 3C8KB 3EFOA 3NSDA 2MNWA 2PPDA 2Q87A 5MEQA 3BAKA 1BZOA 2EEBA 1WFUA 1S9WA 4UT7H 2FX9L 1AGFA 4IOIB 5AB1A 4RRPG 2PW2A 4N26A 5DRZA 5T3ZH 3QEGL 1QKZH 1NC4B 2P7TA 5TPWH 1M1XB 2G60L 2OTUB 4P57B 2J2ZB 4YE0A 1TQBB 3EBHA 5ITFB 2EEFA 4OFVA 4G59C 4EI5C 2V2TA 3BEVB 5H94A 2JI2A 4ZFZA 5C07E 1AQHA 1B2WH 3E6FA 5EUOA 4IRJC 2DBLL 5DS2A 2WYIA 3QUYB 3CDZA 1RUML 3EYUH 5JZ7C 2UUDH 1B6UA 3CC5B 4XNMA 3M7FB 4LQ1A 3MR9A 1TOXA 4D94A 1N12A 4PJDF 3TIEB 1FH5H 1H6UA 4JAMB 3S3PA 2CJTA 2N4IA 4MD4A 1R3HB 4MGXA 4X6DA 2CJSA 1UM5L 3LDBB 5DJ8A 1Q0YH 1U8LA 4WI4A 5K39B 5LKNA 1NA8A 1XF1A 3IBEA 2GYSA 2DKSA 2F8IA 4UZSA 2CO6A 3WLWC 1UGNA 3ARRA 1RJCA 1J1OL 3MOAH 4MXVE 1I8MA 5D70H 4KMQA 4G7YH 5I1GL 2IQAB 2OMTB 5GHWL 1SOQA 1OPOA 3QUMH 2NY1B 2EAEA 4H40A 3O0RL 3SDDA 1WD8A 3D08A 2DQEL 1NIBA 2WWOA 3QUHA 3UAJA 1AVAA 2WXRA 4HX1A 5ACZB 5DHYA 5I6LA 3I9GL 1WAPA 4CUCA 2AQSA 1W80A 1OALA 4HIJA 4ZW6A 4XWGH 1T4KA 5ICZB 5DJAA 2XXCB 2J43A 3VYPA 1BQSA 4P23D 4NIKB 2OCCB 2Q20A 5T5FA 4ERSL 2AEQL 3GSNL 3EJSA 3K2UH 4G9DA 3IF1B 3B5HA 4AIOA 3OG6B 2BVPB 2VGLM 5E1QA 2VSCA 3O2DL 1SBBA 4LLQA 4NFDA 4PHZA 2NLJA 1KFAL 4WU7A 1QI5A 1TEFA 3K0WA 4GW4B 5E9DB 3WL9A 1DBKL 3MNVB 1DQDL 2E75C 1S3KL 1S5HA 1ASQA 3DJZA 4KUCF 4OIAA 4XVOA 1BVLA 1BJMA 3O45A 4QRRE 5C0CB 3SKMA 2PW1B 1UXMA 5EF2A 4L48A 3GMLA 4XO5A 2NY6D 4PVLA 1XB3A 3V6ZB 1RULH 3I2CL 5C6PB 4OJYA 1UURA 3QZNA 3IMVA 4H0IA 2OMYB 3SDCD 3D12B 3ORJA 4LLMB 3FH7A 1W15A 5CF3A 3EJJX 1Z32X 4NQUA 4OLUL 2PXYC 4XB8A 4XP9L 2OZ4H 3KNBB 2ZIDA 1WFNA 2XVKA 3MNDA 4MAUL 5D93B 3KL0A 5GGUB 5C0AE 5B1JC 3WELA 4WWKC 4R4FL 1JF1A 3VD5A 3FSAA 3STBA 3DHMA 4YSDA 4P5TD 5CIPB 2E7DA 4N8CH 3D39A 4Z3JA 3MMEB 5D1ZI 4TLUA 1ZOXA 3QUZB 5BZXA 5AZ2H 4GBXC 5MI0C 1BEXA 15C8L 2F53D 2OTWB 1DVXA 5FDWB 3NCWA 2BPBA 3H9SA 4ADJA 4DIXA 4LAJH 2C9RA 4GG6A 5IW6B 5F7FA 4PSPA 5IMKB 1UT1A 1E3ZA 4Z7NE 4MJID 5F70A 2PWDA 1IEAA 1FFRA 3BP4B 1VAHA 4AW7A 5LBSH 1NEZB 3O8XD 1ADQA 1CIDA 5DZLA 1DN0A 3W39A 3TO4A 1J0KA 5FF6A 4L4VE 3A6CH 4KY1H 3VXRD 1L9QA 3NGBC 4QT5B 3UP6A 5JW4R 3TA3A 4M5SA 1BZ7A 1KPUA 2F5AH 3U9WA 1N5AB 1ZEAL 3CX5K 2OYKA 4QOKD 5IHBA 4JRYD 1ZLSH 3FSVA 3PDOB 4NYLA 3VI4B 2QSCL 3D4CA 2G9HB 2AQPA 4RMWA 1BZ9A 5TQ2L 3SB3A 4FNUA 4K71B 4L3EE 5TQ0H 1ETZA 4P23C 5GSVB 1Z9NA 3F12A 3T5WA 4GQRA 1OPGH 3L3IB 3NZ8B 3QHTC 5CNHA 1JS4A 4UILH 1ZT4A 1I9RL 3MV11 3KPSD 4CJ1A 1LP9E 1OD7A 3EXJA 4Y19D 3U30C 5A7EA 4JFFD 3QNYA 4Y88A 3V6OE 4LHUB 2VXTL 2SODB 4WWOA 2CUMA 3ECVA 3VWJD 1JYVA 4PRBB 1CI3M 2EC9U 3QISA 1Q8MA 3IMSA 4FQ2H 5D1QB 1U3HC 1CI5A 2NNCA 2CM5A 2R29H 4M29A 3VH8A 1BECA 1YEGL 2BVTA 5D7JC 4WCYL 1TO4A 2Z92A 3TASA 4F15C 5C3TA 1U92A 1N8ZA 3ALWA 3CZEA 4NOFA 5T1MA 4XN9A 2IWFA 1DYZA 5LG1A 1T1XB 1JYNA 3VFWA 1IRAY 4WW2A 2DMHA 1ZLEA 1ZS8B 4WHYH 3QUXB 4UTBH 1RHHA 2LQRA 3WEOA 5C8JB 4Q2ZA 2NDGA 3GTTA 3AW5A 5F71A 2DWDA 5DJZA 2YK1L 4Y4KD 3BVVA 2EKSB 1TR7A 4OJFL 5E7BA 5LAXA 4FA8A 1FWXA 4XCCL 4PJCB 1KYOK 4K3DL 4EZLA 3RHWF 3HE7A 1EZLA 1OHZA 2XUWA 4PJBE 3ZO0A 4XXCC 1ZHKB 2XPZA 4FMFA 3AXIA 3ZK0A 5EEWA 1A6WL 1MF2L 3IGAB 1A7RH 5DD6A 2G2RA 1IIKA 5E6ID 2E47A 5I75B 1VFOA 3CFNA 4LCWA 3DUHA 1RXLA 4KOBA 4QXTB 2Q8BL 3L4VA 4UAHA 4WO4A 1DHKA 3T09A 4PLOB 4XBMA 4ETQB 1BLIA 1WBYB 3QJQB 3IJEB 4V1DD 1QTSA 1A14H 1U8QB 2A6IA 4WFHE 5IB5A 1X5JA 1YUHB 3GMMB 5DZ9A 4RCAA 2EVIA 4A2DA 2GUOA 1P7KB 5IY5B 5GGSA 1LXMA 3FU0A 1YNLH 4I1RA 3EUUA 4JM2A 1NGQH 3ULUE 3SE3C 2D3VA 2CJUL 5IMMA 4G1MB 5MENA 1T20B 2BP8A 3C08H 4KHXH 5B39B 3DO7B 4OZFG 1S7TB 1X5LA 2WZPA 2WUCL 4JQIA 1PZCA 4P3DB 3CTTA 5AVVB 5IB3A 1R9FA 3MODL 3O3DB 4UM9D 4FF9A 5F9WC 4MZ3A 4ODVL 1IEHA 4EN3A 4FNQA 1EAQA 2HSIA 4NRZA 4Z7OE 1Q9OA 4IRSA 1C5DB 3CHXA 4OBRA 2HPTA 2DYRB 4NC1E 3X11B 5J6GA 4UZGA 25C8H 4I9XA 4X6CA 1OP5K 4OT1L 5CZVL 1C1EL 4O4YH 4FTVA 3U83A 2CKBA 4UMGA 2FWOA 4AKPA 1R4XA 1DQJB 3U0PB 4IDJL 4FFYH 1CXHA 5I1IL 2I25N 1KDJA 1QBLL 2E8YA 3BVDB 5F0LB 5FW7A 2XYCA 4G7SB 4M3KB 1JMXA 4GQ9H 3U4EB 4B5ZA 1IAIM 1QEXA 4HIIB 3B83A 3SE4C 2HRGA 5D2NA 3BPLC 3SCMB 4H0GA 4I77L 4CN6A 1NMAH 4GT7A 2X4QB 1IC5L 3CN0A 1PLCA 4U6XA 3CX5J 3L7EA 1JD7A 2BDNL 2Z4QB 2ZWLT 4BUGA 4ZZFA 2WLLB 1CS6A 2LVCA 1MHHA 2XA8L 4AXWB 4XMPL 2W95A 4YNYB 2GPZA 3JV4A 5D8JL 1TJMA 1TTBA 1VLXA 3VGEA 3ZKSD 3L4CA 3UEZA 1Z3RA 5EOTA 3S3SA 3OKMB 1PNCA 4Y4KC 3GMPB 3VRIA 4XMKL 4GAFB 5E8EB 1FIGH 2Z35B 1XF5A 4JJOA 2HT2D 3P11H 1SEBB 4L5FL 2QADB 5HHQA 4YQXL 1H15B 2ZONA 2E6QA 4OY9A 2NW2A 4M5ZH 1P5UC 1GGIH 4H25A 5AALA 4H7VA 5E95B 2DRUA 3DX8A 2A9NH 5FA4A 1IX2A 1GZQB 4M6NH 3P4NB 3MCKA 4HGMA 3PIQA 4OZGA 1DLHA 8PAZA 1JXGA 1QNZH 1PQZA 2A6KB 3BVNA 5H2BA 3GXTA 1DBML 1UM6L 4JO2L 4QRUB 4Z7UF 4YSPA 4OGYH 5ANMA 5FYJH 2XNAB 2BNRE 5L6YL 1GH7A 2J6EH 3MDJA 2BVQA 5D2LE 3EYOB 2PTVA 1AG6A 2QLVB 4KNTA 3QJFA 1NAKH 2RFXB 2B39A 4WK4B 1ASPA 1F0LA 3II2A 3GMNB 4OQTH 5GGTA 1PZSA 1F1GA 5F1KC 3FFCE 2HX9A 4UTAL 5DF0A 2EO1A 1KIPB 3JWOH 3VFSA 1KYOJ 3DSNA 4X5XB 3VMNA 4F58L 5KUKA 4AQ1A 2Z91A 4GO6B 1RZ8A 2JV6A 4PY7B 3ZE2F 1O5DT 3FH8A 3TZVD 2GEEA 1FNHA 3ULVF 1QFPA 1F11B 3AGWA 4IHOB 4X9GA 2R1YA 4JDZA 4Z5RB 1SXBA 2PP9A 5IFJA 2FR4A 1CMOA 4IOSD 43CAB 2JB6A 3L45A 5D7IA 4CSTA 1PPIA 4P06A 4APXB 4X5RA 3U48A 4Y2DD 5DJYA 4KNUA 1E8YA 3GJEB 3MRGB 4LPYA 4BSVA 5DQDH 2PO6A 3GHBH 4HWEL 1KEMH 3LEYH 4XP6L 5E70A 5LDUA 1R5IB 4KOCA 4X9HA 3ULVD 5ESVA 3OSVA 4HXAL 3K2MC 4KK5D 3KJ4C 1Q0XL 1JNLH 1HOCA 2P8LB 3DDGA 4J27A 4NM4L 3NZUA 4YHKH 1BWMA 2CLVB 4Z7UB 4BZ2H 3P9MA 2W60A 3ILEA 5K1JA 1WUZA 1HWGB 4PGEA 2AK1H 3ABMB 1J0HA 3NAAH 4PJDE 3TO2B 3F6JA 4IRZH 4G6FD 5D1ZC 1URZA 4M6OL 1P4LB 2DQIH 2DD8H 3FAXA 5EUKA 3O2WH 2NW3B 2HA1A 1UH4A 2GJ6E 2VDRH 2X89A 3HZKB 3RG1C 4TMPA 5JW5A 1QBBA 2ZUSA 4LEOB 1KXQA 3C2SA 1F3JB 3EDFA 2X4SB 5EU6D 4L0ZA 1D5BB 1SN2A 1UQSB 2OJZH 3AADB 1ILSA 5I1LB 2PN5A 3C6LA 3SIKA 1MNUL 3ILQD 4KVNL 4TNVF 2DEWX 4IBYA 4EQ2A 2IALB 5JW4Q 3IJYA 4LKXB 1JVLA 2YPVA 2W91A 4K8RL 1MEXL 2AMUA 4NRXB 4FZ8L 4RA0C 1OW0C 4ABVA 3T2NL 5CWSB 5FGCE 4JLRB 5FK9A 5LGKA 4FABH 1D6VL 2WLIA 4RFNC 1JWSB 1QR1A 3LEXA 1A0QH 2FBOJ 3OGOE 3JUYA 4NWTH 3GSRA 1R3JA 5LN8A 4YL9A 5IROA 4K3HA 4C59B 1FL3B 4F3FB 1BG1A 3CVHB 5IJKA 5B8CA 1EEZA 1KCRL 4F9PC 2JKXA 1HHKB 2HX7A 4FQXA 4M7ZC 1TF4A 1Q94A 1CT8A 1TSHA 1X7SA 5F88B 2X6VA 3GXUB 2VLMD 4MMXA 2X4UA 2X3CA 1LK3L 3EOTL 3LHAA 4ISVA 3UPAA 4X7DC 2X4OB 4KK9D 3DIVA 3SKOB 1AZRA 4R2GD 1PF3A 1A1MA 3G9AB 5BRZA 5AW5B 3RZCD 3E3QE 3CHPA 5DQJB 5F8RC 1A6PA 4KKAC 4Y2DC 5E1HB 5I5IA 1RD6A 1MIML 5GRXG 1AS8A 1UTDA 3OV6A 5DUBB 1KCVL 4NFCA 3CBRA 3BO8B 2FD6L 3APDA 4M43H 4N8UA 5FO8B 3GBDA 3QIBD 5E6RB 4HOMA 4OAWB 4J3BA 3TFKC 4KRNA 3EH2A 2H2SD 4U6YB 1JK9B 3FT3A 3QEUA 3IJSB 4RMTA 2PYEA 2VQUA 3QWOA 1F3DH 4K3EH 4UMSA 4UNIA 4B9CA 5INDA 3B5TA 4MCYA 5BV7B 4PRNB 4XVUC 1VEOA 3NFSH 4TTDD 2C3GA 1D5XB 3AFLA 3NJJA 2ZICA 3QQ9C 1OGSA 4Z7WF 2X41A 5KUMA 1X9LA 4HQQL 4FLQA 2R2BB 2DL2A 3A24A 4QO1B 2BW4A 1Z9MA 1G4RA 1SYVA 3VVVA 3MJGX 3RA7L 3TLRA 5JPMC 1XIWD 1SJVA 2CGZA 4H0HB 3VXPA 1CL7I 4FXGB 4NQDD 2ICWB 4I7ZC 4LSVH 3FB6A 2WLYA 4N0UB 5AYUL 1K6QH 3P2DA 1E4XH 2XV6B 4KH9A 4OB5L 3N6YA 1HH6A 5JIKA 1P5VB 3GMQA 2HJFA 2W0FA 4YDKH 1AZUA 2K9FB 4LBEB 1F4YH 2WLZA 5E5LA 1PSKH 1D6EA 1WZ1L 2CK0L 4HMCA 1LD9B 1OT2A 4I4WB 5HGHA 4K5MA 4U1IB 5BO1L 1RERA 1SM3L 4HJJH 5F6IC 4X0NA 4DGIH 4OI7A 5HHOD 1OANA 1NL0H 1T6BX 4PR5A 1J0YA 2VXQL 3DJSA 4UAOC 1ML0A 2ZSVA 1E9OA 4KUZH 4UT9A 5CJOH 1LJMA 4HGKC 2FHFA 3TH3T 4DPBX 2D7TL 3Q5OA 3P40A 2AJZB 1OQOA 4MMZC 2R69A 1OGAA 2FX9H 3KYNA 3AITA 4R2GC 3H55A 4K8RC 4JKKA 3O4LD 2KQMA 1KCBA 3QEGH 4DQAA 1JGEB 3QAZC 3UMTA 1FORL 3GPSA 3WAJA 2G60H 4PJ7A 2DY2A 3B56A 3MJWA 3RVUD 4X8GA 4WJKB 4AKQA 3QA3A 1MZZA 4AVHA 2ZCHL 1EGJA 4E68A 2NYZA 1GS8A 2PCFB 2NNAB 3QIBC 3LKPB 1LK2B 2FJUB 1B4RA 4JFXA 1CD0A 1HSBB 3LYRA 2DBLH 3O6FB 1AR1B 3C60C 3FTVA 1RUMH 1XCWA 5AKTA 3VGBA 4RWHA 3WFHA 1J10A 1CTMA 2H2SC 3P77B 4FMVA 5DEJA 3MKKA 2JI3A 3OGCA 4F7MB 1YECL 2BH0A 1I53A 3O11A 5A6IA 1B0RB 3L5WB 1UA7A 5KOVC 4IIZA 3QDJA 5DD3L 1B0GA 4GSUA 4IDLA 5I6PA 1KCKA 1J8HD 4MJ5A 2UXFA 4L4JA 1TSRA 4W9ZA 1UM5H 5DVMA 4ZSOB 5LG6A 1ZDQA 4ZOEA 3ZKND 3Q48A 4FKEA 5JNYB 1TZOA 1QX1A 2GFBA 3CSFA 4KRPB 1TTFA 1J1OH 3F58L 5EUOF 3D18B 2B3IA 5EPMB 3BKML 5I1GH 1ODAA 4GH7B 1KYUA 5GHWH 4LSQL 1MRCL 2V5SA 1QSED 2GUYA 2RTTA 4WV1A 2PKDA 1E2VA 2OMVA 4UQ2A 2VQ1B 3BYYA 1I75A 4LGSB 3MRBB 3O0RH 4HZLA 4AIZB 1FNGB 5IQMA 2DQEH 3PDGA 4HEPA 3MRCB 1TFPA 1V5JA 4QRTA 3LKSA 4YAQA 1IC7L 3MZGB 3I9GH 4X6DF 3RPIA 5JLZB 3O0LA 4KC3B 4BFBD 4WF7A 1N0LA 3FT4B 1NBCA 2VW4A 1IM9D 2YPLD 3WDHA 4ERSH 4OI8A 2AEQH 3GSNH 1E3XA 2Y69B 4ATWA 4DF9A 2FE0A 1AHKA 3W56A 4UQCA 3NZSA 1CFQB 3TURA 3V5KA 3O2DH 1RK0B 3UTSE 3CFDB 4UM8A 4DP4X 2P5WA 3D3VD 12E8L 1KFAH 2ZUYA 3GSWA 4XO4A 1DVFB 5C09E 1CPUA 3VSUA 3GK8L 2AVFA 4A37A 2H9GB 1DBKH 2E9WA 4HJIA 1DQDH 1S3KH 3FFDA 5JXED 3JTTB 2GKIA 2BP0B 3K6OA 4RMUA 5E2WL 3WY3A 1T0MA 5F0PB 1CQYA 1I85C 2P49B 3TBWB 4GKZA 3I2CH 4PI0A 1IAOA 2BMKA 2AABL 4HU2A 4B9JA 4QY8B 4JVPA 4QWWC 2FO4B 1BQLL 3V4UL 5FOBA 4DEPB 4NQQA 4OLUH 1BFOB 1CL7L 4LAQL 4OZFH 4QKXB 4HUNB 5HDLA 4JN2A 4EMZA 4XP9H 2J57A 1C16B 1PG7L 3IE9A 3MV8E 2A74A 4PRPB 5HHME 2DYPD 5HPMB 4MAUH 4XGZA 1OLLA 3RNKA 2GITA 1O7SA 4R4FH 5AAWA 5E0FA 1A1OB 3TCLB 2ZF9A 4GXVL 3UTQA 3VU1A 3KYKL 5FUOL 4XT1C 1J05A 3DVNB 3AG4B 5BZDB 3BDBA 15C8H 1KIUA 1FFOB 5B7MA 3BJLA 5DMKB 1O5PA 4U6TA 4P4KA 3IMRA 4H8WC 3L08A 2EIJB 2W0KA 3LXAA 1JZDC 5DFVD 2QFPA 1THCA 4ZTOL 2NNFA 4Z6AT 1EVTC 2X40A 4W4OA 3HPLB 3GZKA 4WI0A 4ZOAA 2VAAA 3ARZA 4FQHA 5A43C 4N8VB 1QI4A 5L2KE 4FJZA 3MRQA 4RGND 1NFDB 1Z9SA 1CGSL 1D7BA 3MUUA 4ZZKA 1IKNA 1QRNA 4E5XB 3TF7C 1I9JL 1ZEAH 3EO1A 2W65B 4R83A 1MFUA 2J21A 3GFUA 1F8TL 2D2CC 1C12B 2QSCH 1L0XA 5F7AA 5TQ2H 1AGCB 1RJYA 5C0BA 3FS9A 1WBXB 4MHHI 1MCIA 2WTRB 2BFVL 2MQ3A 1ZV9A 5DK0A 2YFOA 4ENZA 3MI6A 4ZO6A 1GC1L 1QMUA 4JFHD 3RWFA 1I9RH 2LABA 2ADIA 4YFLF 3RGVA 1F00I 4WUUD 4JJ5A 1AQDB 4W9IC 3VXUD 3ZE2E 3OR6A 1PBYA 1AIFA 2BNQA 4OJDH 2VXTH 3KGRA 3UBXB 3IKKA 4TQPA 4F7EA 2Y5EA 4X4YB 3HC3L 2D31B 4GB9A 5CJ5A 4XCNA 3CPLB 4R84A 2GSMB 4MJ6A 3EDKA 3EKCA 3WMPA 3LD8C 5KBPA 1X6LA 5E4OA 1UZ6F 4KQ4L 2AV1B 1NANH 1TQTA 2QMKA 5E00B 1YEGH 5FHAL 1ASOA 3VDAA 4WCYH 2K3TA 1JPGA 3BIBX 3MV01 3NYKA 2CG9X 3MNWB 2UZXB 4OQ1A 5KSVB 4P2RB 2NY2C 4NQXA 3S96A 3VGHA 3LZRA 5C0DB 4B3EA 1E5UI 1HIML 1ZHNB 2WP3O 3EJTA 4JHBA 4YN3A 4N28A 3BMWA 2A9BA 3FB5B 1IBDA 3B2VL 1X5FA 5TJWK 3VGAB 3PPEA 4NOBA 4A2MA 4O2FB 2YK1H 4YHOL 4ZAKC 3ZDYB 4D9RE 4OJFH 2G75B 5EIIA 5I15L 4XCCH 4PP2A 4K3DH 3N43B 3P4OB 2J1KA 3ARQA 3QFJA 3JWNE 3KWVA 5J56B 1FC1A 4IQHA 4M7KL 4RAUB 2ZP9A 1PFCA 1X5ZA 5C97A 1A6WH 1MF2H 4JG0H 3HS0A 5BZZA 1J5HA 3LPPA 4CC4A 3HBPA 1R34A 2VDKB 2Q8BH 2VR5A 5T8IA 4A2EA 3L4WA 2NSMA 3MV9D 4WW2F 4N5UA 4WI3A 4QTFA 2Y7QB 4LCCC 4YVUA 3ROOA 1ZHLB 1YAIA 3HJ0A 1IJNA 4BDVA 3UYRL 1U21A 4LLYA 4IGBD 4PJXA 3WUWB 3SY6A 4RGNC 3E8VA 2VDMB 5E8OB 3ZKMD 3KCWA 2IAMD 2WPGA 1TTRA 3WY4A 5B38G 1NC2B 2CJUH 4YBQC 3MO1A 1RI8A 1VFMA 4AMKL 2QTEA 1DQQB 1T7WA 4KI5C 4PRHB 1Q0EA 2WUCH 4RAVB 5LCVL 1KT2A 3PQYD 4DEWA 2QV2A 4MZIA 4DO5A 3MODH 4KQ0A 4ZNCD 4ODVH 3SDXA 3J8F7 3T3MB 2C5DC 3MV7E 5GRYA 3KXFE 1OSYA 1JGVL 1BX2A 2ADGA 2Y24A 1X7QA 2QVFB 4JRXB 4OT1H 3L3KA 3NSCA 4R96A 5CZVH 5E8DL 3E2HB 1C1EH 5ICYB 5JORB 2E7CA 4UNUA 2MHAA 2AJXL 4NO5B 4IDJH 2N01B 5CHNB 1H5BC 2QJDA 1ZPLA 5I1IH 1QBLH 3VM7A 3CVIL 2AMGA 3MRJB 3SGJC 4LB8A 3G6JB 3KPNA 1HCYA 4GNKB 5F7KC 1MDTA 1T80A 2XQ0A 4MX7A 4ODWB 2D7PA 4OM1L 1WVZA 5C0FA 1GTNA 3FQUB 4OKVA 1OOAA 1O6SA 2E4TA 4I77H 4G8IA 3VJ6B 2UYLB 1IC5H 2VXSL 5CCKL 1AANA 3POCA 4UDTA 2BDNH 4X6CF 2DL9A 2R83A 4GRLD 1GW6A 3F7QA 2C9UA 5KSAB 4N2IA 3HRZA 2XA8H 3VQ1C 2AGJL 4G5ZL 4XMPH 1N19A 3BGMA 2WZPD 1ZXQA 1F4XL 2HTLD 5DT1L 5D8JH 2HX8A 3D30A 4HK3J 1ZLWK 1FFNB 4YSCA 5JHDD 3LH2L 1T2QL 3SY0B 4J3UA 2IH8A 3W9DA 3EFDL 5I5JA 4DQOL 1UZ8B 4XMKH 4IRSD 4ZOBA 4HJEA 2BINA 2X6AA 4PBWD 4L5FH 1H6FA 2ZUWA 4YQXH 3PAZA 3Q2WA 1FRGL 4Z7WE 4ZBJA 2I9LB 3FQTA 5IVZB 3QR2A 1WZAA 1T7XA 3CZJA 4N87A 5I17A 2BNUB 3R4RA 2OTUA 1J0JA 1FV1B 1NQBA 4P57A 4AQZA 1VADB 1D7DA 3RURA 3MREA 4X7FC 2A9ML 2VR3A 4N2BA 3HB3B 5E4IA 5EU3B 3KPMB 2GTWA 1P1ZA 3KPRA 4G5AA 4UT6A 4JO2H 1DBMH 1UM6H 4LRIA 1KENL 4G6AD 1WT5C 5D4JA 2APSA 3K2KA 4IGBC 5L6YH 1E9PB 3P3RA 4QRSA 3G5ZB 4WRLA 2IAMC 4PN6A 4LKCB 4N9OB 1RURL 2OA9A 4XRCA 3GI8L 4GW5A 4MXQC 4QHKI 3RVXC 2O5XL 3CQQA 4GSQA 3LV3A 4BKTC 4UTAH 4YXKL 1FZOB 3CLFL 3D85A 3RU8L 2WUBL 3D4ZA 4NUJB 3NEOA 1N3NB 2CDFB 4OZGF 4F58H 1EFXA 2JLLA 1W72L 4YZWA 3KE0A 1PAMA 3FQRB 3TN0B 4YLCA 4YSAA 2YXMA 4G8GE 2CGYA 3IS1X 5DEFA 4I85A 4G83A 3FF7A 3H1ZA 2ADYA 3W0WE 3PP3K 4XPBL 4DP7X 3WFCL 4QHLA 3IJHB 2CDGA 2EDKA 1RPKA 4J1UA 1F02I 1I3VA 3DIDA 1JBJA 5L4IA 3B37A 1NSNL 2WVSA 2EZ0C 2F54A 3VI3A 1FL6B 2EDNA 5CBAB 2CMRL 2P8PA 4X4XA 1T4WA 1KJ3L 3U7AA 3PPSA 3K80A 2XWBA 4QUOA 3ZN6A 2ESVB 3N40F 5DD5L 4P46B 2X87A 4HWEH 4XP6H 2K70A 3QXDB 1T7YA 1AFVL 1WP6A 2D7QA 3DMMC 3KYOA 4HXAH 1Q0XH 4NM4H 1FH2A 1M6UA 4GRLC 1FYHB 2L04A 3BOVA 1ED3B 1OP4A 1M42A 4X6FA 3WE6A 1KBVA 4L3CA 2R0ZL 3LS5L 5IBTL 1OE2A 2IH3A 2DWYA 3NMEA 5ISZD 5D7IF 4M6OH 2HLEB 2QQKL 2RHEA 3SHSA 1W8NA 4R7VA 3ARYA 4Y4FA 3BVUA 4JFVA 1BQHA 2XN1A 2EIZB 3HIZA 2X12A 1GCFA 4JFEA 4P5RA 4I18A 4N2FA 5E4EC 3AU1B 2RQEA 1G9NC 1HOEA 4TULL 1UOWA 1A4JB 1AO7B 1MNUH 4H88L 4KVNH 5EUOE 2WBJB 1BA9A 2VLKA 3KGTA 4NO2A 3QW9A 4B0MM 4G7RB 2G2PA 1S7RB 4TKWA 3KNBA 4P2OB 3TVMD 1LO5B 4K8RH 1MEXH 1G7PB 2HRLA 3B2XA 4FZ8H 4I0CC 3ULUL 4G6AC 3PWLA 1I8KA 2XWJA 2HKFL 3QZBA 4UOW0 2Q86B 3T2NH 3U0TA 1D6VH 1KBWA 1UH2A 5CIPA 1S9YB 5SV3A 3I75B 3GD1C 2GY5A 3QUZA 4X6DE 4H2CA 4NKOB 3QDGA 3FSZA 2ATKB 1SDYA 2J5LC 4IOFC 4GFTB 1KEGL 1S9XA 4Y4HA 2Q2LA 4PCYA 3HG1D 4JHUA 3L3OA 5J57B 3EZJB 3MZTA 2VL4A 1NBVL 5TTRA 1NKRA 1KCRH 3QI9B 2YGPA 3G5YB 5B22A 4RGMB 4DP0X 3UG5A 4CL7A 5HYQA 3NIGB 4J6IA 1IGFL 4OGZA 4TL4A 4NLHA 5T1KB 5CEXB 1ESOA 1DQTA 5SWZD 1N6QL 3EOTH 4LO9A 1LK3H 2R0KL 4MHHG 5KWYC 3AXLA 4E9LA 2DJMA 3PHQA 1VFUA 3V0AC 3F05A 2RR3A 3SO3B 1BF5A 3GDCA 5DMJB 4BK4A 1TEGA 1IQWL 2F58L 2FNWA 3C09C 5CZXD 5ABZA 2BHFA 3V4PB 3HMXL 4GYBA 1XQ4A 3AVEA 1MIMH 2Y23A 4L0PB 4PJAB 1OSEA 3S6CA 4GXFA 5AZUA 3VI4A 3ZDXB 3W5MA 1J9QA 1Y6MR 3ASWA 1KCVH 3GS7A 5EDXA 2Q1EA 2FD6H 1QW8A 2LE9A 1DVYA 1J9RA 3QZOA 3F5WB 2GSGA 3P54A 5GSVA 3ME0B 1U95B 5IB2B 3NZ8A 3C5ZD 5PAZA 2ITDB 3A47A 3S34L 2Q0ZX 2BVEA 1T1WA 3ARDB 2KUTA 2R1XB 1F4HA 1X3DA 2IG2L 4FP8L 1HEJC 1BREA 4A63A 2AQ3A 4D0BA 3OSKA 4NLAA 1U9KA 4A7UA 1BGXL 4PFEA 1NBZB 4FFWC 3VYNA 4MCMA 4FXKA 3JZYA 4IMLA 2YXFA 5J89A 1XBDA 3MA9L 2JJSA 5JIMA 4BK5A 3PWPD 4FLSA 4HQQH 4CMHC 1YDPB 3TNNB 2AK4B 2CNZA 2X6BA 3K6NA 3RA7H 4C83B 5DRNA 2E9GA 3K1DA 1ZANL 4XWOC 3D39E 4WGVB 3TVMC 4H1LG 2FZ3B 5AYUH 2QPDB 5I0ZA 5K9OA 5C8JA 3MNZB 3H9SE 4NUPA 4OB5H 2HVBA 4GG6E 3VRJA 2IGLA 5E8PA 4L1DA 1LYQA 1U8IA 3CCHB 1ODUA 2WXGA 4HLZH 4HUWB 3S4SA 1RK1A 1WZ1H 2CK0H 3N50A 3SPVA 2V5TA 5FKPB 3MAWA 3MRFA 3U79A 5BO1H 1SM3H 1DO5A 2EC8A 1PZ5A 1BOYA 3CZFB 4KFMA 2KH2B 5DEGB 5AL0A 1E5ZA 4NAJA 5DFWH 4M4RB 2VXQH 4DUVA 5K5YA 4HMDA 3UAFA 3IJEA 2JNZA 3ELQA 1YUHA 2H47C 1WYJA 2FLMA 3BDXA 2X4RA 4YZFE 4FAAB 2D7TH 4YBLB 4EAEA 4KROC 4OLWL 5E2TL 3LVTA 3T4YB 4Z3FA 1ZIAA 3VB8A 3CG8A 4A04A 2YD7A 4A6YL 1FP5A 1UZ6E 3WKQA 4JPQA 2Q3AA 4ZXBD 5CZXC 3SDAA 3ULUC 4LCYA 3WEXA 1IILE 4R7XA 1L9OA 1FORH 2WLHA 4JQVC 3QEQD 1S7TA 4PJHB 5SWSA 4ZFOA 1J5OL 1CDUA 4XN2A 1I1AB 4L2LA 3CDCA 5HJ3A 4BA0A 1YLBB 2LOEA 3IFOA 4ZPTA 2MPAL 3PHOA 1OOWA 3C5ZC 1OGPA 3QIWA 5I8OL 1USQA 4FG0A 2H8PA 3EYVB 3UABA 2OMZA 3ZE0B 2K4WA 3H2WA 4AIXA 4LNVA 2HCZX 3QUKB 1YECH 5I9QB 2XWCA 2LU4A 3MGTB 4MJJA 3EH4B 1MOEA 3CQFA 4G82A 5LXVA 5DD3H 3ZE1F 2YD0A 1JYWA 2VW6A 1FA4A 4PJ7F 3PWNA 1OHQA 4L4TD 4U6HA 5CP7A 4YSSA 3IDMB 4PJFA 2NR6D 3LN5A 3DO3A 1XGYL 2X4QA 3F58H 5TDNA 4BKLA 2XTLA 1KYAA 4HUUB 3BKMH 3CGTA 4M8UA 1AZNA 1AAJA 4MNHB 4LLWA 5FHBL 3QORB 1MRCH 4LSQH 4O2EB 5FDYA 4KO6A 3ZBMA 2XTJD 2GHZA 1EEYB 5GS1B 1MWAB 2E59A 5IQNA 3WFEL 2UWEF 3T0AA 3D8MA 3OHXA 3P0YL 1IC7H 5K1NA 5BJTB 5KVEE 1UFGA 4TVPE 1G1OA 2NZ9D 3WTUA 2EO7A 3KMDA 3M17A 2Z31D 1MHPL 2L8AA 1SQ2N 4LCWE 5CKGA 4DW2L 1RLWA 3VWKD 1B3IA 4I89A 5C9JB 4TUOB 1JI1A 4RRPM 5DLLA 5DRWB 3VD0A 4LBAA 3RTQC 5FPIA 1FYTB 2DICA 2DW5A 3WIHL 5FCUL 1XR8B 1MDAA 2QKIC 3FQXB 1RKRA 3K72A 2HFGL 3CQPA 3NFNA 3QDJD 12E8H 3CBJB 3F7YA 4PU2A 3UTZA 2FLRT 3HZVA 4MASA 1U8KB 1FVEB 3L3HB 1AMXA 3DGDA 3GK8H 3NSXA 3QIUB 3ZTDC 3O3BA 2GG1A 3QNFA 5MENE 3MX0B 2CM6A 2NY5L 3GINA 5DVOA 5E2WH 5KVGL 2ADJB 4PJGA 2QR0A 3X13B 4GRWF 3UCQA 1LO0L 2AABH 3EH5B 1OB1B 3GWJA 5F9JB 5I0WA 4PBDA 2E0PA 1UKTA 3RWCB 1BQLH 4GKOA 3V4UH 1IMHC 4U1LA 1FNSL 3S5LG 2G30A 4POZC 1CL7H 4LAQH 4URKA 1GMIA 3LKNA 4X6CE 1UKSA 3RAJL 1PG7H 5I1DA 1YMMB 4Z23A 3D25B 4FTVE 3ZLQC 3DBXA 2Y5TB 2AXHA 4FJ6A 1HNGA 1IZKA 4XP4L 4HUKB 2AITA 4JHAL 4GXVH 5LAPA 1ZGLP 3KYKH 5FUOH 3Q8EA 5JIPA 3DUSB 1EJ8A 4MAYD 1WQVT 5DJDB 5I8EA 2ZCKL 1TLMA 5D2NE 4JB9L 4G43B 3CDGA 2IV8A 2JCCB 2HVKB 3AG3B 4OBSA 4RZCA 3ZMRA 2O61A 4JHZA 2XFXB 4WQOA 5DK3A 3F8UB 2NR6C 4ZTOH 5C0GA 5HYSA 5K69A 2NY3B 1MI5D 4CNIA 4X42A 1LEKB 2APBA 1C7SA 2ENJA 3TEZA 2P8LA 4CN4A 3BISA 3HUJA 4M62L 2ICWJ 4BCXA 1CGSH 2XTJC 2R2EB 2HKHL 4Q6IA 1JRHI 1HNYA 1I9JH 4YHML 4ZDHB 1EK3A 1F8TH 5ETUB 3EXLA 3SZ6A 1ICTA 4NJAL 3ARFB 2NZ9C 2WWMC 1CG9A 2VYRE 3D2UB 2VDRB 1AZVA 1QD0A 2BFVH 3KCPB 3MRLA 4JQXA 4N2DA 1GC1H 3VGGA 4UBDD 3MBEA 4OZGE 4PRIB 3BRDA 1INDL 2UV3A 5CGBA 4RMQA 1X4ZA 2X4TA 5ANME 2VLJA 4GS7C 1TFHA 5JPNC 3LHPL 4BWWA 1P7QB 5F3BB 2R39A 3LZOA 3HC3H 3EJZD 4X4MA 4NKMA 1OK8A 3P9LA 1NM4A 2WLJA 4EQ3A 2AV7A 3EO0A 4PH8A 2I9TB 4KQ4H 1RZ7L 3IVKA 4P9ML 5FO2A 3F6LA 5FHAH 5IKCA 4PVNA 1FC2D 1XGUB 2J6WA 5D5MB 5EBMA 1VPOL 4J2QA 5HHPB 5JHMA 1ONQA 1FLRL 2WZ6A 4GXUM 4P2QD 2Q8AL 4E42A 3JT2A 4IRJB 2XN9D 4FGMA 1HIMH 4YHIA 1JWUB 1JWMA 1A4CA 2BIIA 4U3SA 1HHKA 2XKNA 3QO0B 4N8PA 2WNKA 4PSRA 5BW7A 1ES0B 2OSYA 3B2VH 3WBDA 5EN2B 4XAKD 4YHOH 5BVPL 5D7IE 1MVUB 2BJML 5I15H 5EO1B 1MKFA 4I48A 4Z7VA 4MAYC 3V9FA 4W9FC 3OR7B 4AENB 1KJVA 4M7KH 1A9BA 1CDIA 4ZUUB 4P59L 1ACXA 2NY5C 2V17L 4J3SA 3US9A 1WF5A 2EYRB 4MSWB 5CGTA 4NZJA 4FCAA 1CXKA 5T3XL 3L6FA 3LNEA 5DWUL 3T65A 1R1CA 3EYFA 3W81A 1PU0A 4OGXL 5HTSA 2F1AA 3UYRH 5HDOA 1YUKB 2CIIB 2DWXA 5GZND 1P7HL 2KLTA 1Y6NR 4APQD 3BAYA 4TTGA 3WSQL 1T1ZA 4Q56A 3Q3GA 2FL5B 4AMKH 1KXQE 2CRYA 3MGOB 2Q6WB 3CZGA 4RH4A 5LCVH 3OAYK 4GI9A 1KN4L 2YD4A 2MWCA 5AKRA 2JKIS 1HHHB 2OMUA 2E6PA 5EEYA 2LHAA 2BOBA 1S6NA 4U1MB 3B6SA 4L1BA 3UTPE 1XCXA 3G5XA 4UBDC 1JGVH 2VMCA 1QSFB 5E8DH 1NMCB 3KEHA 4HULB 3LH9A 4PJXF 5IVOA 5KYXA 5T3XD 3KDPB 3PL6A 4JZOB 5MEOB 2AJXH 2YD2A 5SX4H 2L7JA 2DQHL 2XPGB 5DJCA 3G04B 4K2UL 2OI9B 1AP2A 2YD5A 2APTA 3CVIH 3WV0A 3WHE0 2FQGA 4JO5A 3KW7A 3TJEL 1FLTX 4JKWA 3EGXB 4OM1H 3T0ED 2CBQA 4J4PD 4F24A 4NNYB 4HUXB 3LS4L 3SDXF 2PXYB 3F3HA 1T0PB 2YSSA 2VXSH 5CCKH 5HDWA 1U3JA 4ABQA 3EBGA 1SJHA 2OX5B 4I4WA 4WWKB 2BOCB 2WNWA 4BHUA 5J1AA 2AGJH 4G5ZH 1JRHL 1F4XH 5DT1H 4POYA 4HCRL 1ZVYA 5CN3A 4HDIB 3V0WL 3LH2H 1T2QH 1UJ3C 4GBXB 5MI0B 2FT7A 5BRZE 4I3SL 2DEYX 3EFDH 1ZS2A 3FCSB 1N59B 4DQOH 4XX1E 3CSYA 1CBVL 4U1NB 3N41B 5IB1B 1QABA 4DHLA 2GC7C 4F33A 4HV8A 1CLYL 4JFOB 1TITA 1C8QA 3C12A 5AOZA 3RY6C 1XF2A 1FRGH 1MFVA 1NGYB 3OKOB 1YN7B 4QHMB 1UD8A 5PCYA 3Q7JA 5CGMA 2FEDC 2DS4A 2A9MH 3N3EA 3NGBB 1UASA 2NNAA 1A7PL 2H7WA 1KTBA 2N0KA 2PYEE 2WKGA 2B8OT 2P5ED 3BQUA 4QIRA 1KENH 3OHMB 4O02A 4KXDA 4YPGA 3BUIA 4PS7A 4WNSA 2G4EA 5HGGS 3O4OC 4XC3L 4GAGL 4UV7L 5IOPA 1RURH 4Y1AB 5AOIA 1EJFA 3GI8H 1E9QB 3OKDB 2L3BA 4I2XB 2O5XH 3P30L 3NJXA 4TOYL 3TWYA 4YXKH 3CLFH 3RU8H 2RALA 3FULA 3GQFA 2WUBH 4ZSOA 3BRFA 1XH1A 2BSSB 3BEWA 3U30B 3RDTA 1W72H 4NO0B 4BH8A 4BFIB 2EE6A 3VD4A 1MCFA 3IT8D 3U9UA 1VSCA 1U8OA 2FYYB 4BFOA 3B9KA 4NT6B 4XPBH 2HT4D 4EOWL 3WFCH 5IEKA 3HAEA 5H35B 2DJSA 2CO1A 1OTTD 1NC4D 1CLOL 1U3HB 5JOFB 3S36L 4AEIL 3QZWG 1NSNH 2BVUA 4H1LH 3FQNA 3SQBB 3CMGA 2CMRH 5D7JB 3UC0L 1FN4A 4O9HL 1KJ3H 4ELKB 3H56A 2FO8A 3K3QA 4J4PC 1M56B 4F15B 3ZKXB 5DD5H 5HYEA 3KS0J 3QUYD 3ARBA 4LVOC 1AFVH 4N2MA 5TK4A 1H3WM 1QWNA 3AMLA 1UA3A 2CA3A 2XV0A 2UUDK 5DHMC 4Y9FA 3FOMA 5EOCL 5F97E 5DUJA 3WE1A 1U4FA 2NUPB 2BHYA 4TSAL 4A39A 1PGRB 2ICES 3CFDA 1BAGA 1EMTL 2R0ZH 1MAJA 1OGAE 1TQVA 2QGEA 3LS5H 1R3KA 4XNYL 1DVFA 2L0DA 3GSUB 4DGWC 3LZNA 3VI3F 1LE5A 2QQKH 3OXRA 3ZE1E 3A4AA 3MRKA 2FIKB 4PWIA 4PJ7E 4WI7A 5GJTL 4PJEA 5GIRA 3QARA 3Q2NA 1T2JA 4FQQB 4TULH 4G2AA 2WVVB 4WI8A 5TDOA 3HRPA 3UZVB 4H44C 4H88H 2NY1D 3L48A 1FAIL 4N2NA 1MCHA 4OZFB 5DVLA 2RCSL 4M3JA 3PGDB 3LIZA 2DMGA 4D0CB 5AOLA 3I50L 2IDFA 1EV2E 2BP5M 4XBGB 2YO3A 1NBYA 3D0VA 3ULUH 3ZRFC 4EVNB 4DP6X 3TCLA 2HKFH 2QQLL 5JIHA 2Y07L 1ZT7B 2DLGA 2WXMA 4CW1A 2QVIA 3IPBA 5A2JH 3VXNB 4L9LA 3STLB 4NENA 1FFOA 2VLRA 3LN9A 1FVDB 1HWHB 5DURB 1J7VR 5F9WB 5LBVA 3JVGA 4IK6A 2ARJA 1KEGH 1NDTA 1HINL 5JDJA 1OF2B 5IMLB 1P84K 3ESMA 2VQ4A 1NBVH 3U46B 4CVWA 4YSEA 2D7OA 1E65A 1ZLUH 5E9DD 5C0CD 1IGFH 4GJTB 1S9VA 4F57L 5GXBB 4RWYL 5K9JL 1EFQA 4Q9RL 1N6QH 2XG4A 2R0KH 1L5GA 2DBJA 1ZRUA 1TCMA 1IQWH 2F58H 4HJTA 5TGBB 5IF0B 4GRWE 3H4FA 5LUMA 1NWOA 4PJ5B 3RWEA 4PIRF 1KLGB 1TQBC 1UWXH 4FG4A 2HRHA 3TF4A 5C0IA 3VXOB 4QRAA 5EIQA 5F8QC 4NI3A 4R7DA 4KU1A 1H8OA 1WBXA 3LB6C 4F8QA 1FZMB 2ATAA 2P5WE 5FYKE 4ZTEA 1UOVA 3LPWA 3QUZD 2D9QB 3S34H 1PZ3A 3BN9D 3SJVB 3REVA 4EZKA 1AQDA 3SGDH 1HQRA 1AKPA 4JW3A 3BPCA 2PF6A 4OJEH 2IG2H 4FP8H 1P2CA 1BJ1J 2Q7YB 3TBCA 1P4IL 3WJMA 4WKZB 1JZIA 3LDBC 2CRMA 1BGXH 1QZNA 1AE6L 4K5OA 4OTXL 3ZUCA 1SPDA 3OXSA 5F7NC 3M46A 1U93A 3OZLA 3VI4F 3MA9H 4NFBA 1MCRA 1CBJA 1AXIB 1WIOA 4BH7B 3HN8A 4KPHL 4Y5YA 3U0WL 4PTTB 1BVKA 4QRPB 1ZANH 1OAQL 3QQ3B 4H8UA 4CMMB 3KW8A 1F2XK 2XQYA 2BX5A 5FUCC 1BYOA 2Y7MA 3HI6L 2V7NA 2BCKA 4ALAL 4ODUA 3NIFB 2HRPL 4IJ3B 2FSEB 2IWGA 3CVCA 4M5TA 4B7IA 3UJTL 1G9ML 4GO9A 3WJJC 3DRQB 3THML 1JNHA 1QFOA 4JY4A 3HG2A 1FG2B 2CBTA 3U4AA 1IQDB 5EF0A 3L2NA 1J9CT 1HK6A 3GXDA 5GGQL 2R0LL 1G6RL 3JWNC 1F56A 1VIWA 4M1GL 2YA0A 3SGKA 2R2HB 3WFBL 3WN5A 5EBWB 2AXJA 5T1JA 2BIQA 4ONFL 5DJXA 1S7SB 4LHUD 2I24N 4OCSL 5EF1A 2EJ1A 2Q76B 3I9AA 2NTFB 1Q9WB 1TU2B 3QSKB 3FL7A 2GI7A 3JWNG 1TG8A 2WSDA 1QRNE 5DYFA 4XN4A 3DBSA 5D1QD 3SGEI 2AF2A 5KBNC 1G9HA 1BZEA 5E2TH 4OLWH 4K0OA 1QA9B 4XMLL 4A6YH 3K46A 3AM8A 3QFDB 1DVQA 3S3CB 1WDAA 5C0BE 4BFEA 1F97A 3NCFB 4JY5L 1MCSA 3U7WL 4BSWB 2G3ZA 3UYPA 1S2EA 3NJFA 3J2PA 1Q1JL 1J5OH 4OF7A 2ZG3A 3QNXA 3QUXD 1GOFA 2QLYA 5GGSY 4ZK8A 2C1PB 3V6BR 1BM3L 2MPAH 4JFYB 2BNQE 4LK4A 5I8OH 3BN9C 1YEJL 1JTTA 4JRXA 3G08A 1P84J 3CLEL 3V10A 3NCEB 5D1ZB 4NQEE 2AEWA 5JORA 4KY2A 3FRPG 4M61A 1KIRA 3UEQA 4X83A 4FRWA 3IKCA 5EO0B 3U7YL 2OZNA 4U33A 5D1XA 5ELIA 3A4DA 2EDXA 3B7RL 4JZJB 4GMTL 4AW4A 5GGVL 2DLEA 1NCGA 5CEYB 5IQ9A 3GMRB 2C3VB 3O41B 1XGYH 4OUUA 4ZO7A 1G5GA 4U1HB 4FNLL 3SYOA 5FHBH 5C0EA 4XCEB 3M07A 4LFHD 4FFZL 2IOIA 2R51A 4F1SA 4B9YA 2ZQKA 3FN9A 4RFNB 3T4AC 2P5PA 3KBEA 1NFKA 3WFEH 4F8TA 3QFJE 3P0YH 3AG1B 3SY0A 3V6FA 4AYID 5AW6B 2LU5A 1MHPH 2XQBL 4ANVA 1G7MA 5F96L 4DW2H 5C0JA 1VENA 4GW1A 3RQ3A 2VL5A 3TIDA 3EH3B 1QFWL 2DPKA 4DPCX 1D3CA 2MJWA 5I8CA 3WIHH 1A5FL 5FCUH 4WU5B 2ROXA 3BP6B 1M9WA 2HFGH 3BUYB 1TQCC 4DKFL 1I7UA 1IBYA 4PJXE 1XR9A 5IR1B 1MQKL 5HI3C 2YAPA 3BUPA 4F7CB 1UADC 1JZ5A 3SCMD 2NY5H 1I8IA 5E08L 3X1BA 5KVGH 1E9PA 2XHNA 1JGLL 1INQB 3BGAA 4WGKA 4BFNA 3UPRB 3DTUB 1LO0H 3M1CA 4ALAC 1LWJA 5IB4A 3LN4B 4ZW5A 3SDXE 4LSTL 1G9MC 1JV5A 4PG2C 1MY7A 4W93A 1FNSH 2P4AB 3RRQA 3L3DB 3DIFB 4YVNA 3VAEA 1EXUB 1BVNT 2DQTL 3MFFB 4N3UA 3DI2B 3RAJH 3QUXC 4JFDA 5FC9A 4DVBB 2ZXEB 5I5RA 4XH2B 5EO9A 2FJHA 2HFFA 3HI1B 3WIFA 3T9WA 2PTTB 3E38A 4BXSV 2CDFA 1XF3B 4GRMA 5G55A 2JXMB 4XP4H 4CAGA 3VXSA 4JHAH 4P49A 1GY1A 4PREA 2J7LA 2P24B 4YHPA 2IANA 2QADD 5I30L 4R90L 1Z7JA 1T1YB 2YAMA 1EO5A 4C4UA 4U1SB 4AYBA 5AYQA 3SN6N 2ZCKH 3QUMA 3Q5YA 5I1CL 4JB9H 1YPZA 2WJ7A 1UD3A 1BQKA 3ZMNA 3DX1A 2AEPL 1FL6A 3CAFA 3PWUB 1RJLB 2KPWA 5HPOA 4QYAA 2DM2A 3CZLA 2ESVA 1II4E 1KWGA 4P46A 4JKNA 1MJJA 2J73A 3QXDA 4MQXD 3DYPA 2AJUL 1CDBA 4FG6D 3UJJL 3K6SA 3OAZH 5BS0B 4M62H 5JIQA 2BY1A 5B21A 1Q90A 2V33A 2HKHH 3AAZB 4KK8D 1DJWA 2YD9A 3DUUA 4MZRA 4YHMH 4Q14A 4PGJA 2FQDA 4MB1A 4LSPL 4NJAH 3S37L 1R3IL 2YXVA 1QBML 3BYTA 5INCA 4K23L 1N0XL 4OIBA 2BSTA 2MCPL 3TBSA 1WWAX 4HFWA 3CXDL 4JJHA 4R0LA 3RIAK 1S7WA 4DVRL 3DX7A 1QWHA 3G6AB 1INDH 4IU3A 4FL4C 3KPRE 1JCVA 4UAOB 3T0BA 3ZSTA 1Q1PA 3RGBA 1AI1L 2C4FT 3HUJF 4FOMA 4WK0B 1U58B 2ENQA 3FTSA 3LHPH 5ENWA 1S7UA 1TENA 2ED9A 2AXFA 3FXIC 4KX8A 1B9KA 1CDCA 1T04B 1XH3B 3EG9B 3R19A 1LO5A 2Y1YA 4MMZB 1CUOA 4P2OA 4EN2A 3BWSA 3KPQB 3TBTB 1BMZA 3HS9A 5JW4M 1NGWB 3GMOA 1RZIA 4B50A 1M71B 1TVHB 2YOCA 4OZHB 3QAZB 4MD5B 4RIRA 4I13B 4U1JB 1RZ7H 4Y9BA 4P9MH 43C9A 1CGXA 1SHXA 1W91A 1G1YA 1JK8B 2X38A 3APNA 4KXAA 2ICEA 1XGQB 2ITCB 1NFIA 1VPOH 4HW6A 1FLRH 1XB6A 3QIBB 4NQCB 2A4EA 2LLNA 2DWTA 2YAFA 2MCMA 4LEXL 1UB5A 2Q8AH 3GSVB 5L0QC 3ZZQA 4NWUL 5DS1A 3C60B 2OYLA 1SYSB 2C9AA 2FECI 1UUNA 1JGIA 1WWBX 1YNKL 1T21B 2EUZA 3S88L 7FABL 5LBSA 1NIAA 1SVZA 4HAKA 2WAQA 3QG6B 5BVPH 5CEXA 2BJMH 2WYZA 3F84A 2F54E 3VI3E 5CSZB 3ZZ1A 3JTBA 3VFNB 4QKTA 1WAEA 4PWEA 4C56A 1QAWA 4P59H 5GGRA 5HDBB 2YC1B 1YJDL 2VXUL 2V17H 4WZ9A 4EDWL 1FHGA 4PLJD 4L29A 2C9QA 1BF8A 4B9IA 5T3XH 3L4TA 4XNBA 2BC4B 5DWUH 3I6LE 3RY5A 3VXMA 5I66A 3I02B 4PGBB 2ED7A 1BD2B 4OGXH 4ZO9A 3ME0A 1ZGLM 1U95A 3WXVL 4X9BA 4FG6C 4KK6D 3QPXL 3DPBB 3BFQG 1BOGA 2EH8L 4RESB 3D0LA 3ARPA 3L9RA 3RPKA 1JZJA 2E76C 2FDBP 2QZQA 4Z7VF 4ZS7L 3RLSA 2R1XA 3KPTA 1PEWA 4TVPL 3WSQH 4H5SB 5IM7B 3VD7A 4N22A 3W38A 1OE3A 4JFEE 3C6SA 1KN4H 4WW1B 3T3PF 4G8AC 4IJTA 3VE0B 1Z5LA 5A2IH 2DIEA 2OL3B 2YBGA 2VLKE 1PLAA 1U41A 2R15A 4I88A 5I6XC 4FHJA 2O5YL 2R29A 1HDMA 3MRMA 5BV7L 3QCVL 1QHQA 1YDPA 4I1NB 4XVTL 5E5RB 2HVJB 3GJFH 3OL2A 1AGBA 3F7PC 4PWGA 1QUNB 2DQHH 4XX5A 4OZIB 4K2UH 4WGWB 1SBSL 1YYLL 4WY7L 1LE9B 2MFNA 2FZ3A 5H37A 2D8KA 2JTYA 3QDGE 4GG8B 3KHQA 3TJEH 4Y2OB 4UTBA 2NY4B 3L16A 1ZTMA 5GS2D 3MFGB 4XO8A 1PNDA 4GKSB 3LS4H 4L18A 1YO4A 4X9FA 3WXWL 5LNDA 5DRXA 4L1SA 1JDDA 1NCUA 3HC0A 3QC6X 1E30A 3BIKA 1NOLA 3H3PL 3VVWA 3TOPA 1UB6B 1JRHH 1YN6B 4ORGA 4HCRH 3T04D 3KHOA 1I3RB 5FLUA 3V0WH 4IBVA 1CFNA 1KLFB 3WS6A 1E4HA 4I3SH 1A6ZA 1DJGA 3KYMB 3GGWB 1CBVH 4K7PX 3EJQA 1EEQA 3BWUF 3I84A 1SY6L 1CLYH 1EEUA 1NIEA 3ZUNC 2F08A 5HYJB 4UIMB 2VN7A 3WHE1 2H26B 2WJ5A 4FXTA 5I0XA 3JYBA 4AITA 3P3UA 1XEDA 4PB9L 4DK3A 5CD3A 3BDYL 3F83A 3SKNA 5K9KB 2FVNA 4S1DC 4QYOB 1VEMA 2SEBA 2O6CA 2YEQA 2CBMA 3I9PA 3PE9A 3QYCA 3VFOA 5GZOD 2J8UB 1HHIB 2H0PA 2B1OA 3IAQA 4KKZA 1LMKA 4IMKC 1A7PH 2EDWA 2A4ZA 1NLBL 3VFTB 1HEZA 5CZRA 3X3GL 3B2DC 2WCGA 3C8DA 3LNDA 3SBWC 5BQ7A 1ZGLB 4PW3A 2NX5A 2GJRA 1VF5C 3T0DA 2V7HA 4XC3H 4GAGH 3CVDA 4L3FA 1WJ3A 4UV7H 4JG5A 4CA4A 4JDEB 2NXYC 4ONHA 4Y2NA 4MDJA 4FFYA 1HCZA 3P30H 3ZHDA 1BQ5A 4TOYH 2ID5A 4BRJA 2P52A 2UZPA 5CBEB 1UXLA 3UG4A 2XLLA 4K5NA 1BBDL 5TE4L 4OFYD 1GHFL 4EBQL 4ZMPA 2O26U 4WHTB 3QDMA 1SF5A 4C4KO 4PJIA 1YJDC 3OTTA 5HGDB 3VH8G 1W8EA 1P53A 4WW2C 3IBOA 4HUUA 2HFEA 3OAWA 1NCHA 3DGGA 4EOWH 4OFKA 1M05A 5TH2B 5I24A 1K3ZA 4BFFA 1XMWA 1KPRB 2Y4SA 1CLOH 1UH3A 2YKKA 3S36H 4AEIH 3ARXA 2A9CA 1GKEA 3D50A 4J28A 1VFAA 4OFQA 3UC0H 3T0XA 4PV8A 3ALXA 3QBTB 4O9HH 3H7BB 1LGVA 3DV4A 1CFBA 2VDOL 3B7TA 1DSFL 2NY2B 3O6FD 4YDMA 1AR1D 4M8QB 3WD5L 2AXGA 1L0YA 1UCBL 3DX0A 2C8NA 3EGSA 4NCDA 3RWGB 1MFDL 2DYPB 5IVXA 4HIHA 5BVJB 3OLGA 2F2HA 1OV8A 5EOCH 3PWVB 1OTUD 4D0DA 5IBUG 4E41B 2F5BL 3U1QA 3TBBA 4TSAH 4ZAKB 5KS9A 1EMTH 4N9GA 4TSCL 4XNYH 5BV7C 1U8KA 4JM2C 1TYRA 3WKML 3QWNA 3JWNH 1J1PL 2C9PA 4ETYA 1GA2A 5LGYA 4QJ3B 4S2SA 4KRPD 5SWSE 2XV2A 3OB0H 2A83A 5GJTH 1COBA 4QTHB 2B0SL 4EN3C 5B38B 3IRCA 4S0HA 1AGDA 4LCCB 3VFPB 4P5MA 5D4HA 5EMYA 5HVGB 1FAIH 1T5WB 2NY0B 2J88L 4LIQL 4OQTA 2RCSH 4ZMNA 1LEGB 4MCNA 2FX8L 1UT9A 3I50H 3KLHD 5D7LB 4HWZB 4N25A 3NJIA 1X9UA 3UXFA 2GK0A 3BLBA 5DJ2B 4X6EB 2QQLH 1KBGL 2GTZA 2Y07H 3GRGA 4G7QB 2ZKWA 3V79C 4HG4K 3RYMA 2VRKA 5IEHA 3PAYA 1MCBA 2AQTA 4PJEF 1MFBL 5F7HA 4PJFE 4X5WB 3EBAA 4M5YL 3SBQA 3BAXA 4OIIL 1L9SA 1HINH 3OX8A 1FGNL 4TVUA 1ZTXE 2YAHA 4DKDC 2HVKA 1DVFD 4X0KB 4N1HB 1V7ML 5G4OA 2YPVL 1XL6A 4JZNA 1PLBA 4KXZH 1CGUA 2V9RA 3N91A 4NC2B 3GSXA 4UF7C 3TNMA 5K9JH 4F57H 3T1FA 3UTTA 4RWYH 4ZMVA 4ZG1A 4G9FA 4Q9RH 2GBAA 1L0QA 4RFEA 4XO3A 4KXCA 1KLUB 4I9WD 3QC5X 3CUPA 4RAHA 4O51B 4Z0XA 1E40A 1S5IL 1A4KB 1QBAA 2AP2A 4BZ2A 2FCBA 2X7LB 2H3NA 4X7SL 2E7MA 4M8RA 3GSQA 1O75A 4PRPD 1DUZA 4IRZA 1NGXB 1WC7A 3RWDB 4FA7B 3ARFA 5F6HJ 5DJ0A 5L7XL 3NFPB 3EYSL 4MAZA 3W82A 3IN2A 3N2JA 1XSJA 3FSOA 3NJKA 5IK3A 3FTWA 4MNQB 3DX3A 4OCLC 4A7TA 1OM9A 4RRPA 1OTUC 2XWZA 1RUQL 2LTQB 4M1CC 5CUSL 3QS2A 5DS8A 2CLZA 4JR9L 3SPCA 2APXA 2A5UA 2IMNA 1CWVA 3O3AA 3QXVA 3KAAA 4PJGE 4XN8A 1P4IH 4S1QL 5F3BA 4CGUB 1HAWA 3QXAB 1JPTL 1AE6H 4OTXH 3CFBA 3IWVA 4OD2B 4QHPA 1NJ9A 2DAVA 4KVCL 1GKOA 3MRDA 5IHUL 4NRYA 3JUZA 2XY2A 4KHTL 3I6GA 5LQBL 3AQXA 5D5MA 4KPHH 3U0WH 1CGWA 1TLKA 4EI5A 5HSFA 1QLFA 2CDEB 4ZX3A 3OM3B 5C07B 1F6FB 1FZKA 1OAQH 4G6ML 1AS6A 1ACYL 1HH9B 3B8YA 1NUFA 2WXOA 1YEDB 2PCPB 3QULB 4FNPA 5TFSL 1XCTB 3HI6H 2XXFA 3KLHC 2NQCA 4ZQKB 2RMNA 2Z3FA 1DEEA 1I8LA 2BIPA 5D7KE 3TPUA 1TJIL 2HRPH 4ALAH 4I3RL 3T08A 1G9MH 3UJTH 1NDMB 5K93A 3THMH 1MVUA 5L8JB 1IBFA 1H3UA 3GKWL 3N85L 5EZLB 3L3GA 3PNWB 4KO5A 4PAZA 1FSKC 1JUFB 5GGQH 2R0LH 1GJIA 1G6RH 3I6KB 1RMFL 4M1GH 3WFBH 4BELD 3FU8A 1Y07A 4ONFH 3IJ9A 2VB5A 4OCSH 4F7PB 2NDFA 2EEXA 3DNKA 3OZ9L 2EIEA 3RJOA 3M86A 3HUJE 4L2YA 1DE4B 1UT2A 5KVMC 2VMDA 2W38A 5EZOL 3PUUA 4A38A 2VDKL 3HHMA 1YA5A 4KZ0A 2VM9A 1E28A 1EIBA 2GC4C 2IPUG 3LQMA 1OO2A 4OLXL 4XMLH 5MERB 3UC2A 1U8PB 2X42A 2G5UA 4XPHL 3JWDL 3MN8A 4DEPC 3H3BC 4P2RD 3IAPA 1NZRA 5J7CC 1ZA3B 4JY5H 3U7WH 1SUHA 4WNQB 3PJNA 2VDML 2CO7A 2R1WB 5I6MA 3O3EA 1Q1JH 3DMMB 2ZUQB 5IJCC 2VITA 4GRLB 1KCUL 4LSDA 4HG4J 3C6LC 2VLJE 5C08A 2KKQA 3QR0A 1BM3H 4U1MA 3C87A 1A4BA 3RVTC 5EN3A 1ZT1A 2X10A 3TJHD 1YEJH 4I3GA 1VESA 3ECWA 4X4ME 3C9NA 1JP5A 3CLEH 4FHKA 3BZDA 5IW1B 3J27A 1FZJA 4PTUB 4JK0D 1KGCE 1H3PL 1ZY9A 5DHVA 2FJGA 3MRRB 2IO5A 4HZ1A 4QRRB 4YGVB 5I6NA 4K7FA 4XE0A 2Z64C 5E1IA 3U7YH 5E4EB 1EGJL 5IROC 4GMTH 5GGVH 4PGCA 5KSUB 3GRWA 1ZIBA 5EWIL 3W9EA 1PS3A 2EP6A 2ZKYA 1EUTA 2VC2B 4GQQA 4FNLH 4IU2B 4LCIL 4MBOA 3U36A 5B8CC 4FQXC 5I0DA 1SDDA 2IBGA 4MWFA 5C0AB 4WWKA 4FFZH 1E27B 4LSSL 1NC2D 5F1SA 4AC4A 4AH2B 1RPUA 5AUMA 3K5RA 2JKLA 3KPPB 3Q2LA 4MMXC 4PRHD 4WFFD 4AV5A 2XX1A 3RPBA 4Z7VE 1A7QL 4N2OA 2VMFA 4GBXA 2VABA 4Y7OC 2AAVA 1IGJB 2J5LB 4TUKL 3G6JF 4EE2A 1AZBA 2XN0A 2XQBH 3T3PE 5F96H 2ZAIA 4JMXA 4DOHE 4OLZL 1QFWH 1PIGA 4Z7NB 5EHFA 4G3YL 5AVZB 1BXUA 3F64A 1A5FH 4J3OD 3Q6FA 4XZ4A 4XX1G 4DKFH 1DBBL 3NCYP 4YH6A 2WMPA 4NIYE 1CFTA 4HS3B 3IU3B 2AXWA 4L4VB 1MQKH 1IAKB 2X2YA 2BERA 3C09B 1N6VA 3EYQD 2YS4A 5E08H 3BE1L 1PZBA 2YQBA 2EVGA 3BPNB 1JGLH 1S7VB 2DQ6A 3UAEA 1NGZB 3RL1B 3INUL 3V9EA 4Z77A 2CGRL 3FMGL 3OBAA 2BSRB 4QCIB 4LSTH 2XWTA 5KSAD 3DURA 1E9QA 2ZSWA 4ZMLA 4KH2A 4P23A 3OPUA 4L3EB 3LH8A 3ML9A 4G7VL 3OQRA 5E7FA 4CC1A 1R0AL 4LDCA 5FYKL 2DQTH 3QQXA 3QK0A 4NN6C 1MXDA 3IPFA 2C4FU 3MJ9A 1LP9B 2BSSA 4IS6A 2BWQA 2ZG1A 4TV3A 2G5BA 4LCUA 1MJ8L 1X5KA 2QSQA 4XTRC 1J5DA 3WNMA 2F19L 2D3JA 5I30H 3CSBA 1BIHA 1G94A 4R90H 1WFOA 1KF9B 2Z4TA 5KYWB 4KGJA 4YPJA 2I07A 2YD8A 5I2IB 5I1CH 5FKAB 1Y0LA 1DANT 1JMZA 3R8QA 4CMHB 1VGKA 3A4EA 2AEPH 4H1LB 3EZ8A 3IXTA 3HB3D 3SDCA 2OULB 4R3SB 2EYTB 4ACTA 2ICCA 4ELKA 4AGLA 2VH5L 4HKJA 4Y5XC 4KZDL 4N6RB 3JV0A 4GLRI 4A2GA 1AD0B 3ZKQD 1NGPL 2HMID 2AJUH 3F7VB 3V5HB 3UJJH 2FWSA 4HEMA 3GSNA 1FCGA 2R4SL 3ZTNL 3GB7A 4J3WA 2Z93A 4Y16B 1M3JA 3FTGB 4P5TA 4QGTA 1FNEA 2NUPA 2O72A 4OCXL 1IB5A 3EHBB 4F8PA 1TNNA 4EDXA 3C5JB 3MRPB 4NKDA 1RIVL 4ADGA 5C71A 3IXAA 2F53A 4LSPH 5DGQA 3S37H 1NCOA 1R3IH 1QBMH 2Z7WA 4PJBB 1AD9A 4ANUA 4K23H 1N0XH 1TPXC 2MCPH 3TN0D 2ZCLL 3CXDH 4NAQA 4JPIA 3BT2L 4DVRH 4DWHA 4MJIA 3KH4A 4FQQA 1E43A 4QXVA 2WVVA 1U8JA 4J3OC 3UBFA 5IZ7A 3RDJA 3UZVA 3O8XA 1AI1H 3WJLC 3FB7B 1HI6B 3RVVD 4GP8B 1KMGA 4ZUVA 5DVNA 4KROB 1E5CA 3WLBA 3VXRA 1HE7A 1HL9A 4P4RA 1FI8C 2QVMA 3CHQA 4TUJB 2NT0A 3ZHKA 2GQHA 4F8OA 2HB0A 1OKEA 1TYEB 2XG5A 3BH9B 1XGPA 4QOKA 1P9MA 1QQDA 2D0HA 3KGUA 2OKMA 4G8EA 5F2FA 5AW7B 5JXAL 4ZSOE 1EHNA 2GY7B 1WFJA 4LEXH 4Z7OB 4R26L 4NWUH 1TZIB 1KTKE 2C9VA 2F7QA 3KLAA 3KPSA 1KCWA 1I4FB 1AXSA 1EX0A 2CUAA 1YNKH 2V0AA 2UZYB 5DO2D 3RJDA 4Y19A 3S88H 7FABH 4JFFA 1CR9L 4WV1C 1BBJA 3PRZA 4HWUA 4KBPA 4MXWL 2Z7YA 1RK7A 3DRTB 4RBPH 3VWJA 4A7VA 3O9WC 2DZEA 3X1GA 4G80B 1I1FB 4X9YA 3ZL1A 5HDQL 2F7PA 4XXDA 5IMOA 1AO7D 2E6JA 2WBJD 1D5MB 2JQAA 1MXGA 1YJDH 2VXUH 3LKOB 4EDWH 3HB3C 3L3JA 4P2OD 4RNRB 1X5HA 4ABWA 5I73C 4XC1L 4WEBL 1O7DE 4CVZA 5F7DA 3V4PL 1HYSC 3OKYA 2HMIC 4C57C 3WXVH 5E56A 1ZLDA 3HR5A 4F8LA 1DQML 3M1OA 3QPXH 4PLKD 4DGUA 1GSMA 2Y2WA 1ZLVH 3WNJA 1GOHA 2EH8H 2IAAC 5GS2H 1UGKA 4ZS7H 1A1NA 4L8CB 1UD2A 2YEZA 2GBUA 4TVPH 4Y4KA 4E9WA 4E9RA 4XNDA 4LPTA 1HILB 3GC3A 1LWRA 2V2WB 5ITBL 4PJEE 4UB0L 3QI9D 4JG1L 3QQNA 4CVXA 3LZFL 2X5PA 1V10A 3LPFA 4JHWL 5F89B 1P5UA 3RTQB 3V9CA 5E6IA 4ZS6D 5T1KD 4GMSL 3TN0C 3C2AL 2VZOA 1EBPA 1YNTB 2BLFA 2O5YH 2QQNL 3VXTB 3LMJL 3QCVH 4PRAB 5EA0L 2PP8A 5BV7H 1ADWA 2A74C 4V1DA 4X7CC 5DXWA 4XVTH 1FBIL 1T03L 5AAWC 1MW2A 5E1AA 4AQOA 1VCBC 3IMBA 1ZK9A 3GRBA 3ZHFA 4CADA 2DTML 3S5LB 4UOZA 5JR1L 2HLAA 4JY6B 1T22A 1SBSH 1YYLH 2BNRB 3AABA 4N0FA 4WY7H 5ESAB 4LLUB 3FB8A 5D2LB 1KULA 3FOLB 1I1RA 2PWGA 1FE8L 2VLRE 3AS3A 5C3IA 2F15A 1AIZA 1JPSL 4DCQA 3UADA 3N1MC 3WHXB 4XPGL 2VE6B 2X70A 4P4KC 1YG9A 1M2VA 3T6ZA 1ROCA 4UM9A 3WXWH 1PG7W 3FFCB 3ARDD 3KYAA 2R23A 3QWRD 1K2DB 4XVSL 2VJXA 1PG7X 4W4OC 3H3PH 1ZHBA 3EFFA 2N7SA 3S8FB 1KGIA 3MLWL 3B9VA 3QRFM 4I0PB 3GO1L 3D34A 4NHUB 3IN0A</