5HDQL

Mntc co-structure with mab 305-78-7
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNEKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter substrate-binding protein
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqL01
3V6FA 3MRBA 1BD2B 4HS6B 5SWZE 1U8KA 1U6AH 1QR1B 4F2MB 1WZLA 2YA0A 2A6IB 1U42A 2YZ1A 3TBTB 4YK4C 1MPAL 2DMBA 2FX8H 4NPYA 1QYGH 4MJIE 2OR8A 5DHYA 1CF8L 3GMMB 1HIML 1JGUH 1P9MA 4GKSA 4R7NA 3H3BC 4LCYA 5TDNB 1K8IB 4JO1L 5AG8A 2EDJA 2MNUA 2PXYD 1QRKA 3KYOA 3ARGA 4IJ3C 4NNXA 1IC5H 3WS3B 1H3VA 1M1SA 2VN7A 2QQLL 3PWLA 5E2TL 2VAAA 4JCMA 2R0KH 1LO3L 4NZRH 1H3TA 4JLRB 5FKAA 4PJBF 1BJ1J 3EO9L 4PG2A 2P7TB 4G8GA 4MMZC 1WLHA 5DDHB 3CUPA 1DFBH 4P2OA 4PRHD 3SO5A 4JQVC 3IFNH 2X7LB 2NY4D 4WHYH 4XVTH 4HKZA 4XTRD 4RX4D 1GXEA 3L9RB 2LU7A 2BSRA 4UDTB 1QUNA 3EJZC 2FO4B 3WFCL 1Z3GH 3S8WA 3QIUA 4XC1H 3L3DA 5I1IH 5ICYA 5I76A 5TFSL 1TJGH 1LDPH 3BP4B 4OV5A 4NM4L 3KYMA 4JZJB 2JB5L 5KVGH 1QPPA 1UFUA 4LLMA 1G9NL 4X4XB 4FFWC 2PTUA 1LP9B 2KQNA 2V9QA 3MPCA 4JN2A 4HGWA 4PV9A 2E7HA 1EXUB 3CSBA 2DQDL 3C8KB 3L1OL 3VFTA 4MAYD 2C3WA 2XZAL 4JKPL 2P45B 1MCNA 1QSFB 3O2VH 5DEFB 1LK2A 1ONQA 4NO3A 15C8H 2GYSA 4TUJB 3T0AA 1YYML 4APQB 4L4VB 1S9VB 3L3IB 3OKMA 4D3CL 2H2SD 1XR8A 4LCUB 4U1JA 5F6HI 5KTEL 1RFDL 5IKCB 4N90E 5CLTA 2LTQB 1B2WH 5HY9A 2GSGA 5FOJA 3WFBL 2C1PA 3AM8A 2X2YA 4W4OC 5JHDD 5GSVA 2F58H 3K74B 2W1NA 4QF1B 4KK5D 5AZ2H 3AROA 1U3JA 2P24A 3IGAB 4OCRH 1TTFA 4KRNA 5DRNB 1DBBL 5CGYD 4QWWD 3QUZC 3CX5K 1KB9K 4R97B 5DT1L 4XWOD 3V4PH 4BUGA 4WENB 2FCBA 1KTLB 3UTTD 4OCLC 1BPVA 2ESVB 3FONB 3MQIA 4XC3H 5ICXB 3RA7H 1IGTA 2VSCA 2XG4A 1WEJL 3OAUH 1RUKL 4IDJH 4Y4HA 5CP3A 4YEFA 1T89C 4XPFL 4JM2B 4PJ8A 3T0DA 5MERA 3PDGA 3TM6A 1VFAB 3ZTJG 1G6RH 2WWKT 1UVQB 4D0CB 5IFAH 1BECA 2OJEB 5FCSH 4HJGB 2IEPA 3JUYA 4LRIA 5CLWA 3FB8A 4L1DA 3VWKC 1RV6X 3C6SA 2BHZA 1EK3A 5CUSL 2Q8BH 2H32A 4XP5L 4PJDE 4TOYH 4NWTL 2X40A 5JNYA 5CS7A 4EI5B 5JMOC 1JMXA 3KJ4B 2MQ0A 3LD8B 3WNMA 1F4YH 4ZUUB 3BE1H 3SY0A 1I8KB 1ZVHA 5F89B 3IVKB 2ARWA 1I7UA 2R2HB 2NY3C 4YUEH 3VXRE 5JIKA 1W0WB 4M8QA 1CXHA 1KPVA 3GMNB 1FFOA 2CGRL 4LDOB 2DLIA 1JL8A 5D2LA 5H2BB 5CINL 4YGVB 1OPGL 2H26A 4MB4A 3TA3B 1F58L 1QLEH 1ND0A 4HUMB 5JDSB 3VJ6A 4PJEA 4X8JA 5IEHB 3FFCE 1AJ7L 1PGRB 1T03L 3L5WB 4KJYA 4D9LH 1CU4H 1JGLL 4QHKJ 3OX8B 3TPUA 4OLUH 1CD1A 1DTUA 5SX5K 3STZB 2F54B 1GVIA 2DWEA 5EU3A 5J6GB 5EU6E 3QUKA 1IEAB 3C6LB 1A6VL 4ZXBD 3X12B 2X4PA 1Q0XL 3FRUB 5JIHA 4HIIB 5C0ND 2J88L 1PLGL 1SM3L 3TVMC 4CJ1A 4N0RA 4YBLC 1EMTH 4CNIA 5LGHL 1OQOA 4Y8AA 4HFWB 3WEXA 3WDIA 4M3JA 1IAIL 4HUKB 4YWGL 5F1OB 5IB5B 5CSZA 3T0BA 1E4XI 5C0JA 3BFOA 2OP4H 5F93C 4F7TA 4UT9H 4OKVB 1G7HA 5INDB 1LMKA 4BH8B 3SCMC 1G6RB 3QIWC 3GGWA 5GRWA 2VXSH 2DRUA 2CUIA 3QUZD 3ZYJA 2AAVA 1J1XH 1MLBA 3QI9B 1DUZB 4NO0A 5JLZB 1JGEA 1I1RA 1P53A 1URLA 1A2YB 5IWLA 3CLFH 4NZUL 2GT9B 4LMQE 4BZ2L 5M95B 3J8F7 4LVHB 2DLFH 1YECH 5GISH 3S88L 4YHYB 1D5MA 4YIQB 1IGFL 1P6FA 4JFDD 3NIGE 5DZOA 4EDXA 3P73A 3CLEL 1HYRC 2ZCLL 2Z35B 3HRZA 3WHE0 3QH3B 4L9LC 1YEDA 3SE3C 2VQ1A 4Z9KB 4DZBB 3QG7L 3VWKD 5I1DA 4WO4A 4WTWA 2BNUA 2AJYL 3QUYD 2BVQA 5DFTA 1S8DA 2ATKA 4GRWH 2P8LA 1GC1L 4EDWH 1RIHH 4LVOC 2CK2A 1RUML 2FGWL 3OZ9L 3QA3A 4GXVL 4PJFF 5CJXC 4Q9QL 4OCSL 2NY3D 4PRPD 5D7IB 5CKGA 5SWSE 3OKOA 1FAKT 1HEZB 4O2EB 1JHTB 3MV8B 1UH4A 2AEPL 2X9YA 5J3HC 4JFXB 4M1CC 4ODSH 3D3VE 4RAVA 3ULVL 4B7LA 4ZUVA 3OKKB 3MV11 4M7JH 2XWJA 3RTQB 3NBNA 1ZVSB 4HKBA 2UWEA 5JORB 4CMMA 1EHLH 3L95B 4P46C 4E5XB 2IBZX 4P49A 4JREB 3T8XB 1MFDL 5CZXC 2FD6L 4KKNA 1KN2L 3ARRA 4HWEL 4I18B 1U3HC 5IMOB 4XMKH 1GGUA 1PAMA 2A6DB 4NHCL 3KPRB 2ZUSA 3WFDH 3C5SB 4CJ0A 4JFED 2X4QB 1MJ8L 4FQ2H 4HK3N 3B2VL 1NBYB 2C4FU 4GAGL 3T3ME 4HUUA 2IFFH 4HV8A 3QEGH 2HN7B 2CDGB 5JOFA 4AIZB 3IXTB 2QBWA 3CMOH 5DJ0A 5TGBB 3LPFA 5CSBA 2OMBA 4ELME 3PWPE 1NDMA 2VL5B 4P4KB 2XNAA 1CCZA 4KTYA 1HQ4A 5HDOA 4EOWH 3H9HA 1WT5A 3TESA 3D39D 3DLQR 5C0BD 4JPWH 4XPBL 3ARBC 4QHKI 1BIIB 1AGDB 2GK2A 3VXUB 4P2CG 4MLIA 5ISZE 4GKOA 5CBEA 3SCMD 4X5XB 3QIWD 4BSVB 5FGSA 5CBAB 3H42H 4KMTL 1H3PL 4IHOA 1WC7A 3MRCA 3UTPD 3VXSB 3S9DB 1J1OL 4G9FE 4QHNB 4LHJB 3CDCA 2XZCH 1MCEA 2ITDB 4QNPF 4OIIH 2YWZA 1F02I 2Y5TB 3M17B 4I5BA 4Y5YC 3O8XC 4UTAH 1HINL 2LV4A 2OLDA 4G6AC 3ZLQC 3OAYH 4NQEE 2FHFA 4GRWB 1EGJL 2WIMA 3NA9L 4Y4KC 1DVFA 1F2QA 4UINL 5CIPH 2ZCKH 5HYJA 2C4XA 4HWZA 3BD5A 3RY6A 3VH8G 1KN4H 3FO2B 4NRYA 1AD9A 1OCWL 4MX7B 4AMKL 4KK6D 2XN9A 4PYGA 5F1IB 1H8OA 1JE6A 4JPVL 3RNKA 1A7RH 4KHTH 3D0VB 1HXMB 4N0UB 2VXTL 3RDTB 4HSQA 2ZUVA 4DVRL 3BN9D 4P2RE 5DI8A 2NXYB 4N0CC 5EO1B 5EC2A 5L2KA 2BJML 1G7QA 1NGYA 1CFSB 4UOJA 3X3FH 3GMRB 5GGUB 3SDYL 3VGAB 2X4NA 5L9DL 4EN3A 3BO8B 5MHSD 4Z8FL 1U41A 1ADQH 4ZOAA 1NMBL 4F7CB 2X4SA 1MCQA 1X6LA 3IAPA 3QXAB 5D1ZC 2DQGH 3D6GA 2VLRD 5GS2D 3PQYA 1T21B 4K9EC 3GHEL 5J3HD 1BF2A 2EDYA 3JWOH 4M1CD 3DVIA 1QD0A 2OQJA 4KJPC 3NH7L 1TZHA 2FWOB 3Q5OA 43CAB 5EA0L 3B4NA 4O4YH 5D2NE 3T4YA 4WTZG 5DMYA 2GY7B 4LPXA 5FO7B 4DTGH 1KG0B 1RZFH 4Q2ZA 5IHZA 5DRWA 1D6EB 4P46D 1S7WA 2UWEF 4J12A 4MXVE 1UXSA 4LKXA 3IJSA 3ILPA 3MOQA 1R0AL 5CZXD 3RHWF 3MCLH 4G80B 4U1GB 1ZSDA 2KH2B 2Y9RT 3HE6B 2NY6C 1U3HD 2VB5A 1RPQA 4TTGA 2F74A 5HGDB 3B5HA 3ULUF 1A8JH 2ZUQB 1J05B 3L3HB 3RWEB 1IM9A 3LQZA 4KK8C 1EVUA 4U1SB 1P1ZA 1CL7H 3G5ZB 4HIJB 5HHQB 3RIFF 4OF8A 4Z0BL 5J6HB 1YPZE 1BD2A 4HS6A 4NQVB 4UT6L 2H45A 1JPSL 1U8MB 2JCCF 1QP1A 2A6IA 3ARFC 2F8OA 3V7AE 3WSQL 4LAJH 4MB3A 3IU4L 4U0RC 2EDOA 5DD0H 1KTRL 2HT2C 4I0PB 4C56D 2AI0H 3GMMA 5CIPB 4F8QA 1BVLB 2AJZA 1D3CA 1K8IA 2EDLA 2YD6A 1ORSB 3WS3A 5GGVY 2HJKB 1AIFB 4JFOA 1U8IB 3PIQA 3EHBD 1ZMYA 3BJ91 4U05A 3K81A 2HH0H 3VFGH 4ZD3H 5EZIL 1HH6B 4DGYL 3O8XD 3EOYG 4G6AD 3O4OC 1RJYA 5BZWA 2P7TA 4AQOA 4Y4KD 5DDHA 5E8DL 3QEQD 3SDAA 3BX7C 1NCCH 4M1GL 2H1PL 2X7LA 1Z2KA 5I9QC 1WAAE 1GIGH 5T5FL 4O5LH 2A6JB 4WUUD 3TJEH 3ES6B 4QXUH 3H3PL 4K71B 1Q38A 5EUOB 2FO4A 1J9CT 2WQRA 3LDBC 1QFUL 1EEQA 1AFVL 3SGDI 4ZPVA 5IVXF 2VIRA 5KVEL 3BW9B 3ULUL 4PJCB 3K7UA 3BP4A 3QAZB 4N0CD 4JZJA 3WFEH 3I6KB 3QJFA 1KJVB 1XIWB 2DI9A 1AQDB 4EIZC 3C60B 3MRIA 5FUOH 5TE6L 1FL6B 4JM4H 2J1KA 1MFEH 3MV01 1EXUA 1F4HA 1F4WL 3C8KA 4ZFOB 3FQNB 1Y6KR 4MJ4A 5E6IA 1QSFA 4O58H 5DEFA 4PYHA 4LQFL 1MQKH 3S37L 4TUJA 3BZEB 4E42B 1E28B 4MYWB 5JW3H 3LQAC 5J12C 1OL0A 4L4VA 3JWDL 1S9VA 2RJMA 4MNQE 3L3IA 4X9BA 4E41E 1DLFL 2VMFA 1GGCL 3EO0B 5B38B 1U0QA 5IKCA 1JZ6A 3LKSA 3OB8A 2PXYB 1NGXB 3HAEG 5I1JL 4QF1A 2RFXB 4QXGL 4JEGB 4MNGB 4HMEA 4RA3A 3IGAA 4CVWA 5DRNA 1HKLL 2OTUB 3RPIB 1RIVL 3RRQA 3N1MC 2YPLE 2AK1H 3I02B 1U2CA 4KK8D 4AM0B 4PP1D 2PETA 5IK3B 2DN7A 1Q72L 2VJXA 4KV5E 5DMKB 2Z4QB 2ESVA 3FONA 5ICXA 1E4KA 3QEHA 2J8UE 3TIDB 2NY4B 3OKLA 1S9KC 1R3LA 1FIGH 3O4LD 4XNUH 4CN1A 4BZ1L 1I9JH 3ARDC 2DL9A 3WD5L 3I3EA 4JM2A 4CVXB 5I1EH 2QV2A 4XT1C 1VFAA 4LMQI 1T1WA 1CN4A 4NUGL 4D0CA 3FMGH 5J7CC 3DVFA 3UDWC 2OJEA 4R90L 4HJGA 4R0LB 1BM3H 3GSNA 4P4RB 1DBML 5I1CH 1VPOL 5D93C 1SBBA 3QBTB 3SOBH 2WBJC 1CDUA 4MAYB 3QULB 1JPTH 2F5BH 3BPOB 5I30L 1JYNA 4ZUUA 5C3TA 5CGTA 1IAOA 1I8KA 1TVBB 5E4EB 3TBSB 1DE4B 3IVKA 3ALWA 4PGEB 3RX8A 5IROA 2R2HA 4L8BB 3SGJC 3EYUL 4Z7NF 3RVUC 3MRNB 3N1QC 1W0WA 3KPMB 2K3TA 3KWWB 4LCWE 4PJBE 1MHHB 3GIZH 3IKKA 4YDVB 4GXUM 4LHUA 4FS0A 4YGVA 5C0IB 1VKXB 4FFZH 3VXTB 3DETC 3BQUC 3QIBD 4CU8A 3RZCC 4D9QE 3L3OB 2CDEB 5JDSA 2DTMH 2DIJA 3MRQB 2OK0H 4MAUL 4I3RH 4X7SL 3FQRB 4BJLA 4TQEL 5CEXA 5I6XC 4OZGB 4HEPG 2R56H 1U3ZA 1N4XH 3SJVD 3PV6A 1LP9F 4L29B 4YHML 3DX7B 5LAXA 2XXCB 3P0VH 2ICWI 5SV3A 1GHFL 3LEXB 2F54A 3T65A 5J6GA 1NANH 4F58H 1MI5E 4YR6B 4D9RE 4UQ2B 1IEAA 3BD3A 2YUXA 3A67L 3GB7B 2P48B 4OTXH 4XHQA 3X12A 1GGIL 2VQUA 3MLYH 3V52L 3DV4B 3FRUA 2XFXA 4HIIA 4TYUA 3KPSB 2O93L 4LRNL 3MLXL 4WU5A 3FCTB 4HFWA 3MV9D 1YMMB 2IG2L 1OY3B 2A9NL 5IB5A 1MVUB 3P0YH 4JY6B 4OKVA 2YUZA 4HUWB 4BH8A 3UO1H 4FQCH 4NBXB 3HZYB 4M5ZL 3BGMA 4FXKB 4KZEH 1NLBH 1V05A 3L3KB 3QI9A 4U3XA 3D9AH 1TJHH 1DUZA 1BQLH 1W0VB 1MEXH 5JLZA 3KR3H 2BNQD 3WO3B 4HPOL 1FNSL 4Q7DA 1A2YA 5CMAB 4RAHA 3OQ3B 4N5EC 3QB7C 3QO1B 2PTTB 3KLSA 1RK0B 5EOCH 2HKFL 2BVTA 4YHLL 1DQMH 3V6OE 2XZZA 3L5XH 2DD8L 2EKSA 4Y2DC 4QTIL 3CD4A 3MUJA 3BH9A 3DUUA 2AABL 4JM2F 3QWOB 2GAZB 3QDGD 3MV7A 4KDWA 1U8QB 1HHIB 2Z35A 1NMCC 3BKML 3NN8B 4C59B 3GHBL 3QH3A 3D48R 1XGQB 4DZBA 4RDQG 1OLLA 2XWBB 5FYJL 1JHLL 4FFVD 2V9RA 1NCAH 3WUWB 4FQ1L 4M7LH 5GJSL 4HT1L 4LPYA 4IOIB 4AIOA 3O2WH 4PY8J 4RGNE 4DKFL 1QBML 2CUHA 5D7SL 5D7IA 4FXGB 5DD5L 3QPXL 1HEZA 4ZXBB 1JHTA 1VA9A 3MRGB 3MV8A 2Q86A 2NZ9D 1CFVH 4JFXA 2C5DC 3MNZB 5DD3H 1U6AL 2HTKC 3BZFB 1A14L 2YA2A 3SGKA 5HYFA 4EEEA 3BQUD 3SDCC 1CVRA 5TQ2L 5I8EB 1Z0NA 4LSPH 2FX8L 3KXFE 2X1PA 1ZVSA 5JORA 1AI1H 5BS0B 1IT9H 8CGTA 4GW4B 1CLOL 3T8XA 1JGUL 4Z7UA 1FYTE 2Z31B 1B9ZA 4I18A 1IC5L 4YQXH 4HD9A 4LHQB 4TUKH 4Y1AB 5IMOA 2ZKHH 1BQHG 1I7ZB 5FO9B 1I3UA 3DRTB 3KPRA 1BF8A 5L8KB 5LWYL 3EDFA 1NBYA 2R2EB 4PB9H 2ZJSH 3OL2A 1I8LC 4AL8H 1YQVH 3ROLB 2HN7A 2CDGA 4AIZA 1NCBL 3IXTA 2R0LH 3PP4H 5TGBA 5MP6L 4JFDB 4K3HA 2GJ6B 2VL5A 4WCYH 1YN6A 5J11B 1JJUA 3S36H 4XVTL 4XBGA 2X4TB 1ZHLB 4XGZA 4HFUH 2GI7A 1AE6H 1REIA 4YHNB 1LO2L 3BPLB 3BGFC 1Z3GL 1BIIA 3QUYB 1AGDA 1KCUH 4XC1L 3VXUA 3BZ4B 4KK9C 1GOGA 5I1IL 5DFVC 4X5XA 1TJGL 1PZUB 5CBAA 1UJ3C 2O26U 5DHXB 4WNQB 3VXSA 1J86A 4G42A 4QHNA 2W9DH 3NFNA 1KBGH 2ITDA 3GI9H 5F3BB 4Y89A 3BD4A 4N5ED 4PRPB 2YD1A 2V7NB 4MXWH 4OCNC 1NBZB 4XXDB 3O2VL 5F88B 3VMNA 1QLRA 2DYPA 4XNYH 2LU3A 3BEVA 5IR1B 2FBOJ 3FO2A 1RZGB 4MX7A 5FM4A 4RGOH 5F1IA 3DUSB 2FATH 2WK2A 4B7IA 4NKOB 2MWCA 4N0UA 4P2QE 5GS0L 1FGVH 3SO3B 3BWAA 4JO3L 3K80A 2VLMD 1MCPH 1HHGA 5EO1A 5GS2H 3TO4D 3BHBB 1CFSA 3GMRA 5AZ2L 4OCRL 2YUWA 4R6UA 3N50A 3BO8A 3T0XA 4C83B 4F7CA 5HHOD 3N0PB 3V4PL 2W59A 3QXAA 4XPAH 5DC4B 5EIVA 5ESAB 5D7IF 3MCG1 4EXKA 2AVGA 1T21A 4ZOBA 4XC3L 3RA7L 1P7QA 5D1XC 1S9XB 4JJHA 2HTKD 4PJFE 5FXCH 2VE6A 2VL4A 43CAA 4IDJL 1S9WA 1WZ1H 3IDMA 2XG5A 1CYGA 3NGBC 1BGXL 2X05A 5LXGH 2Y7QB 3PV7A 1KG0A 5GJTH 3MLSL 1D6EA 4E9LA 2EE9A 1A1OB 3RJDA 1CICD 3MRFA 3GK8H 2BXYA 3K0WA 4XP1H 3HZKB 3HE6A 4WTXA 3SE8H 1X5JA 3MJGX 5HGDA 4PY8I 2Q8BL 3IDXH 1J05A 1OGAE 1YMHB 3RWEA 2FB4H 2ZUXA 4TOYL 3VRLF 4U1SA 2MSPA 3G5ZA 1GGYA 1WBZB 4HIJA 1NC2A 5HHQA 4L3EB 1F4YL 3E0GA 5DRZB 3QG6A 5J6HA 3BE1L 1LVEA 4GQ9H 1C5BH 3HZMB 4LLUA 2R2CA 2Y1VA 2FEDD 5ERWB 1SJXA 1U8MA 5IMLA 4KTEH 1I1AB 2BY3A 3NCBB 4HIEB 5TPWH 4CU6A 5LVEA 3RWHA 4IOSD 5TE7H 4IRSB 1NGQH 4I0PA 3S37X 5CIPA 4J4PA 4AEHH 1BVLA 3RHWK 3UX9B 1ZS8B 1F11A 1QLEL 3VMPA 4KK9D 2BNRA 5DFVD 5HDQH 2OXHA 1ORSA 4Q6YA 3VXMD 1U8IA 1AGFA 4LAQL 1FV1B 4J3UA 1GSMA 1CDYA 5FAAA 1E4XH 3L5HA 4GUPB 1EEYB 1IQWL 4P5MA 4Z76B 2B2XH 1QBLH 1HH6A 2WWMC 3HC4H 3RIFK 3TZVA 2PYEE 3VG0H 4M1DH 1UB6A 2VLRB 1NUNB 5HI5C 1QSED 4GRWF 1FP5A 4NRXB 5E24E 1BAFL 2YXFA 1OWWA 4GRLD 2ATPB 4KZDH 5E6ZA 2OSLB 2EH8H 4UNTA 2A6JA 3QDME 3ES6A 2L7UA 5EUOA 3GMLB 1S7TB 5L0QB 4OLXH 2AJUL 3BW9A 4PJCA 1YEFH 1EMTL 2IALB 2V2XB 2EYRB 4OD1H 1W2KT 5DJ2B 1XIWA 3MZGB 4YXHH 3HUJB 4I8DA 1FL6A 1WK0A 3WDJA 1NFDB 4ZFOA 4N8CH 3FQNA 2VWEC 5FHBH 1WSST 3E6HB 5D70H 5IB3B 3C08L 3CLFL 5D1XD 1AC0A 5DTFA 4E42A 1E28A 4NBZB 3RQ3A 1M71B 2AW2A 3P4NA 1KT2A 1KCLA 3MUY1 2EE3A 1YECL 5GISL 3EO0A 1CDHA 4C56B 4F7PA 1UM4H 1IGJB 5J4MA 1NJ9B 1R5WB 2HTLC 3A6CH 2PXYA 1NGXA 4LU5H 4N8VA 3OAZK 3HG1D 4MNGA 4ONFL 5C08D 3RPIA 3CGTA 1LWRA 3I02A 4IEFB 2UWEE 1FIEA 1S78C 3HI6H 3O3BB 4Z7VB 3T0EC 3MZTA 5C0GB 5C0EA 5IK3A 3VFMA 4EDWL 1RIHL 2Z4QA 1NC4D 1YYLL 3NCJH 3QEQB 4Y4FD 4PRHA 3TIDA 5F7DA 2I07B 3HAEH 3LS5L 5IBUB 4CU7A 2I26N 4XP6H 3ILQC 1ZK9A 4KKCC 1T20A 3P9WB 3V7AG 2CUMA 4H5SA 2CH8A 4JFFE 4ZYKB 4CVXA 4ODXB 1JWMA 5EN2B 1K5NB 3BVNA 4K23H 3LKNA 5E70A 2JCCE 4M7JL 1U8LB 5KW9L 1SYSB 4LEXH 32C2A 1EHLL 4P4RA 1KUMA 1NAKL 2FO1A 3BPCA 3U79A 3UTSD 3QFJD 1CI5A 3QZWA 2ZCHH 4ODUB 5B21A 4MAYA 3QULA 2WWMD 1P7KB 2QEJA 3OKDB 4JO2H 4XMKL 5HGAA 3WFDL 5HI5D 1F97A 3UZEA 1TVBA 1PYWA 2XPGB 3TIEA 4YHKH 1DE4A 3TBSA 3E3QC 4PGEA 2NY7L 4L8BA 2IFFL 3MRNA 3PDOB 2VSDA 1XF3B 3KPMA 1AHWC 1TETL 2EYTB 1X5LA 3HC0B 3TJHC 4FFYH 5C0IA 3VXTA 5EUOF 1JV5B 5BRZE 1IAII 1G84A 5JHDA 3UJJH 2CDEA 1CTNA 2NY1C 3MRQA 4R3SB 4UIMA 1Q9LB 4PJCF 5IB1B 4JPWL 3FQRA 2QR0B 2AV7B 4WGWB 5CD3B 4WW2C 3CFDB 1B6UA 3EOAA 4GQPH 5IVXE 4L29A 2UZXB 4PG9A 3H42L 3UTTA 2HJLB 1FC2D 2XA8H 3KG5A 4YR6A 4ZFGH 4OIIL 1FBIL 3PDDA 4UQ2A 5KG9B 2R1XB 2CMRH 2J6EH 3UC0H 3MRDB 1MF2H 3EO1B 2HRPL 2AXJA 4OQTH 1HILA 4H88H 3MJ7A 3VXQA 1RAMA 4L8SB 5DS8B 5FUZH 1G0XA 2HYMA 3UMTA 4Y5XB 3PQYE 5E2JA 2GK0B 3FCTA 4X6CB 3QPQD 3PNWB 4KHTL 5GS1C 3FB6B 5EU4A 4JY6A 1MFCL 1TZIB 4DKEL 3V8OA 4Q9RH 3D25A 4HUWA 2CQVA 1CWVA 4FHBD 3LB6D 4KPHH 4FXKA 1NUDA 3CDGA 3T0ED 1J0ZA 2EC9U 4HMDA 4IMLB 1W0VA 2VLKD 4NZTH 2EC8A 4HLJA 3UTZA 2P43B 5CMAA 3HI1A 1HQRB 5AZEL 3RX7A 5C7XH 4XMLH 1RK0A 5F1NB 4Y5VB 4DEPC 4UT7H 2YK1L 5J13B 2Q76B 1U8JB 4PJHB 2H2PC 3QIBB 2EDDA 3QWOA 4ZTPH 1XF5A 4O4YL 1HHIA 3T0VA 1BD2E 3ZYZA 4DTGL 1RZFL 1RZ7L 2IPKA 2XWBA 4PBVC 4U7KA 2CIKB 1WZMA 1Y18A 4ETQB 4ZFOL 1UT9A 3WUWA 4LCCB 3VD9A 5HVWA 4KVNH 4UDUB 2Q7YB 3DBXA 4NN5B 1SY6A 4F9LC 4RQQA 3NFPB 5CP7B 3OKEA 4FXGA 3EIFA 3ZKXB 1NEZG 3IRPX 4ZXBA 3MRGA 2O5XL 1F90L 4K8RD 4QXTB 1NCNA 4YFEA 4DK3A 1BFOA 2QKIA 1J8HD 3FAXA 3RWGB 2ERJC 1CFBA 4Z7NE 5JUEH 2R69H 3Q1SH 5ETUB 4GW4A 2AI0L 1OWRM 1ZTXH 3QUZA 1B6DA 4OZGF 1FJ1B 3BEWA 4HKXB 5D5MA 1A6TB 2FX7H 1I7ZA 4H1LH 1CE6B 3DRTA 4TSCH 3IFLH 5CILH 3RGVB 3CXDH 2R2EA 2HH0L 3VFGL 4ZD3L 3CSYB 1EUUA 5A3IC 4JHAL 1S5IH 3ROLA 1CBVH 1LP9E 4UV7L 4PJ5D 5FYJE 4V1DB 2UYLB 3O2DH 4JFDA 3QDGB 3U7WH 1N59B 1FE8H 2IFGA 2DWDB 1QSFE 4O5LL 1ZHLA 2AJVL 3I9GL 4YHNA 4TULH 3VWKA 1LEIB 5DQ9B 4L4VE 5SWQA 3QUYA 3IDUA 4DN3H 4WY7L 3W0WD 1CLZH 1WICA 2J4WH 4J23A 2XOTA 1CFNB 1IBGH 4FG6C 1GJIA 3MGTB 1JN6B 3RAJL 1OB1B 2FL5B 2GHWB 4WNQA 5JXAH 1LD9B 2PN5A 5FUOL 5IFJB 5F3BA 5ITBL 3BYTA 4X4MA 1MFEL 4M6OH 4PRPA 3NCEB 2V7NA 1JF1B 4JO4H 4PY7B 3O9WB 4P9HH 2JJSC 3QNXB 1QRND 1NBZA 2X5PA 1NCWL 4XBEH 4XXDA 3PL6D 5F88A 3RUGB 3KPNB 4X7CC 3IDYC 1MJUL 1DEDA 4XCNA 4FP8L 4LPUA 1MQKL 2JJVA 5IR1A 1MRFH 1RZGA 2WIIB 4QHLB 2ESVE 1N2RB 1DR9A 1ZEAL 4LLDB 4HH8A 2BY1A 3QXDB 5EZLB 5I8CA 2W65A 1FZOA 4M5YH 3BHBA 6CGTA 2UUDH 1G7LB 4JFEA 4MXQC 2BCKB 2WAHA 3BUYB 3FQTB 4R7DA 3SDXA 2AK1L 3RL1B 1Z9SA 1U91B 4ODHH 2QJDA 1D5XA 1KEMH 3TBVB 5I1GL 5D72H 1JI2A 4H8WH 5D7KE 5ESAA 1YC8A 3IFOB 3INUH 4H1LB 2K7PA 2DM7A 3VA2C 1S9XA 2BXZA 1V7NH 2WANA 1MCLA 1I9JL 1S7RA 5T3ZD 1FZJA 3D39A 5C0BA 4HXAL 2Y7QA 3R06A 4I0KA 5I1EL 4NQCB 4DUWA 1WQVT 5C70A 1A1OA 4KTDH 4GH7B 3X11B 1S9YB 3SCMA 3QIWA 4FN0A 2XTJC 4OI8A 3U1SL 3HZKA 3CZFB 1GOHA 5MI0C 1BM3L 2X44D 1RZKC 4U6YB 4DUVA 1MAMH 5CZKA 4OGAD 5J8OA 1YMHA 4R2GC 1CLCA 4N5UA 1N3NB 1XZ0B 1JPTL 5K9OA 5A3ID 3OB0K 2R1YA 5DRZA 5F72S 2B4CL 2VZTA 4Y2OA 1A7PH 4NO2A 4PJ9D 4LLAA 1ZXQA 1CXEA 3LVEA 3HZMA 4JRYD 3O3DB 4MS8C 3OKYA 1G1YA 3Q2CA 5ERWA 5I73C 4HIXH 2NY0D 4HIEA 2E6JA 2F54E 1K6QH 1IJ9A 3GBNH 4KRPC 4PR5A 2N7AA 3O3UN 1KNOB 4PJIB 4PREB 2XWTB 3NACL 1SJHB 4JQXA 3LH2H 1ZS8A 4U6VH 5DEGB 2E27L 1H9VA 2OBGA 2DTML 3TO4B 4XBPB 3E8UH 1QVOB 2V5TA 4I3RL 2YKLH 3QSKB 3T2OA 2NLJA 2JJTC 5CJXA 2R56L 4GUPA 3LN5B 4FABL 3WXWL 1S5HB 1OVZA 4Z76A 5DJXB 3P0VL 1DBKH 4GSDL 4MJ6B 2X09A 4X7TB 5HGBB 1INEH 3K46A 2DQJL 4F58L 5JPMA 5JZ7D 3L3GB 3MXWH 1CDIA 3BSZL 1BQSA 1C12B 4L9DA 1A7OL 1Z9OA 7FABH 2ATPA 1MCOH 2DM3A 2PF6A 2OSLA 4J3SA 3SPVB 5DD6B 1OTTC 2YBRB 2V6HA 2HJFB 3B9KC 3BAEH 2NYYC 4YC2B 2OXGA 3MLYL 4P46A 3GMLA 4Z18A 4TRPH 1CICB 2YD8A 3S5LB 4BK4A 3U9PH 3ZKSD 2IALA 1UKQA 1U3HA 2EYRA 3BRFA 3O6FD 2RQ8A 5DJ2A 2HLAB 5EZOH 3OKNB 2WMPA 3P0YL 3HUJA 2GIYA 3DYMA 1YQ2A 4MXQD 1P5UA 4KZEL 1NLBL 1A7QL 4W6XB 1NFDA 4YDJB 2BVOA 2QHRL 1GZQB 1MEXL 1TVHA 3KR3L 4CDGC 1PY4A 3W9EB 3VD5A 3ZSTA 4XPGL 3LQMA 1NGPL 4JFQB 5TQ0H 5EOCL 5C86A 3VA6A 1M71A 3SKOB 4MD5A 1YA5A 4C56A 4MDJB 2ICWB 1ZE3C 5D7IE 2LABA 2ORBH 1IGJA 1XMWA 3MV8E 1NJ9A 1BWMA 3LKPB 1R5WA 3UJIH 4LLWB 4LPTA 3VXMB 2XTJD 3I50H 3KLAB 9CGTA 1SMAA 4V2BA 3UP1A 4CKVX 2CRZA 4OF3A 4R2GD 2R2BB 3RWCB 1T5XB 3O3BA 4Z7VA 3O8XA 5C0GA 4OBSA 3OXSB 3RIAF 3W5NA 3NA4A 4Y4KA 5KS9B 3DMMC 4LP5A 3QEQA 4CN6A 1MHEA 5BO1H 1OT1A 5IQ7H 1KJMB 4DGVH 4GRLB 5I74C 3KPRE 3PJSB 2ADIB 4WUUA 3VFNB 3VRLE 2IH1A 5DJYB 4OCWL 3P77B 4ZYKA 5DUMH 3HS0B 4LEOB 4ODXA 2B7DT 2YPVH 5DD3L 1KTDA 5EN2A 1OTSD 2HFFB 5KVDH 3B6SB 3QWQB 4LSPL 1U8LA 1SYSA 5FYLH 5L8LB 1AI1L 2JTDA 3E2HB 1IT9L 5DQDL 5ALCH 5GS3A 5HVHC 3V5KA 4IIQB 5ACZB 5EORL 1WF5A 5E5MA 3VD7A 4OF0A 4YQXL 5L2JB 4PJ7B 1AXTL 3VXUE 1BVKB 3FT4B 4K94C 3R4DA 4FQXD 1VGEL 5C0DA 3THMH 2P49B 1KIRB 2ZJSL 3VXSE 1NCUA 4AL8L 5H8DA 3PDOA 3DTXB 4HJ0D 1XF3A 4XAKE 2BRRL 2GW5A 3Q5TA 2EYTA 1OTTD 3LKQB 4IBLT 3FRPA 2OR9L 3OAYK 1CXFA 3S3JA 2ADFL 3FFDB 1KELL 4WCYL 4WW1B 3GSOB 4QKXB 4GRWE 1V3MA 1JV5A 3S36L 1A6UH 1FL5B 4MJID 4N1EA 2G75B 4WUKH 2EYSA 1FAIH 2HKHL 2IADA 1GAFH 3QCVH 4HFUL 1AE6L 4LFHG 4R3SA 5IB1A 4NN6C 5C08B 2QR0A 1L7IH 3CFDA 3HUJF 1UWEH 3CFIC 43C9A 4NJ9H 5E2WH 3HPJB 3GJEA 4N0UE 1DLHB 5ENWB 1NFDF 3HNSH 4Y4FB 4UIKL 4TN9A 1P7HL 2CKBB 3O4LA 2HVKB 5KG9A 2EEAA 3TP4A 4MXWL 3X13A 3MRDA 5FM5M 2XI9A 5ID0A 1VSCA 3S3PA 2R0WH 3WFHB 4MA8L 4XNYL 4NYLB 1MPAH 3GNMH 4EUPB 5DS8A 3L3JB 2GCYB 4RGOL 1BHGA 3FAWA 5HI3C 2GK0A 2VC2L 3AB0B 4JPKL 4P23B 2FATL 1KJ2H 3EJJX 1B90A 3FB6A 1HIMH 5HYSB 2DI7A 1J18A 3IDGB 4NDMB 3WNPA 1TZIA 1J8KA 2F19H 1FGVL 3UTSB 3TN0C 4GMSL 5JIPA 3VFRB 1QBAA 1MCPL 1NH6A 5E2TH 4F9PA 3FO1A 4IMLA 4Z7VF 4JFPA 1X3DA 3SBWC 5F44A 1LO3H 1A4JB 4OFDA 2IC2A 3TEUA 2AXHA 4U3CA 4M43L 5EPMA 3TFKC 5JQ6H 2D7TL 4Y5VA 5GRJL 5DMGC 4L8CB 4JN1H 1FYHB 4YNYB 2ARJA 1F6FB 5IFHH 4OZIA 1PZ5B 2Q76A 3S4SB 3U30C 1HH9B 4PJHA 3QIBA 1OT2A 1WZ1L 4K7FB 1INDL 3P11L 2FDBP 4JY5L 4XRCB 3W39B 3P9LB 4JRWA 1CIUA 2CIKA 1E27A 1FFNB 4F3FB 4KKBD 3SJVA 4P5KB 4WI6A 5BOZG 2BC4B 2DB8A 4JZOB 4BQ6A 3VGHA 3SE8L 4ORZC 4K8RH 3C5ZB 2IPUK 4XB7A 4LVNC 3IDXL 3VG9C 2DQDH 2PW1A 3S96A 2FB4L 2KUTA 3N1FC 3NFPA 5F7HA 1N6UA 2XZAH 1F3DH 2DQFB 4I3GA 2I9LB 1MIEH 1QSZA 1ZWIA 2BFVL 4GQ9L 1C5BL 3ZDXF 2WP3T 3B2UC 4ZUTB 1YYMH 3VW3H 1MCKA 3MACL 4LIQH 4QXTA 4KTEL 4DGIH 5TPWL 1Q8MA 5ELIA 3V7MA 3RWGA 5T5NF 1RFDH 3MV9A 4KRLB 2K9UA 4ZSOB 2ID5A 1C7SA 1N6QL 5K59F 2GKIA 5ETUA 3VGFA 1OARL 2J3SA 1X4YA 2UY6A 3WFBH 3MNWB 4AEHL 3AU1A 3C9NB 4KKAC 2W9LA 5KSUB 4AT6A 4GLRH 2QLVB 1WUNT 5EUOE 2V5YA 3SE9H 3BMWA 4CVUA 1UKTA 2BNQA 1A6TA 1NKOA 3BZDA 1KJ2B 1CE6A 1I3RB 2XZQH 3V79C 1VFUA 2VZ1A 3I3DA 3KPTA 1QBLL 3CSYA 5AAWA 4JDVB 1EDQA 4M1DL 2F9BT 5ADPH 3HTLX 3RY4A 1N8ZA 3VXRD 3V4VH 4GS7C 3QDGA 2DKSA 2D31A 1ZLVK 2EH8L 3UDWA 1PKQB 3DX9B 5K9KA 2VXQH 4X6CF 1LEIA 5DQ9A 3TN0D 1AKJD 2FZ3A 2VKWA 3FFCD 4PLOB 3WO4C 1YEFL 1CFNA 2X10A 4OD1L 3MGTA 5E5UB 1JN6A 5CUSH 4K9EL 1OB1A 2FL5A 3HE7C 1WIOA 5DWUH 5A16A 3T77B 5IM7B 4IS6B 5D96C 2EICA 4MNGE 3ZE2F 4G7VL 3K4AA 1JF1A 4N8CL 4WU7A 4PY7A 1OTUD 3QNXA 4N68A 5FHBL 5DMGD 5D70L 4CVZA 3IAQA 3KPNA 5EBLA 4NOFA 4NKIH 5D7LD 1P2CA 3BQUA 4I1NB 3LN9A 1X4ZA 5ICZB 1RZJC 4PJHF 4QHLA 3RWJB 4DKDC 4P5TC 4XHJC 1OPGH 1D5ZA 2NW3B 5E2VH 2JB6B 3WNOA 4Z95L 4NWUL 3QXDA 3PP3K 2A73B 3FT2B 5EZLA 3UZVB 4PJGB 1UM4L 2EDQA 4L4TD 3A6CL 1Q9KA 1IGML 4LU5L 4UBDC 1T03H 1EX0A 3V4UL 4HG4K 4ZNEA 3MLWL 1CZ8L 1G7LA 1UKSA 3VXNB 1EJ6A 2BCKA 3BUYA 1HDMB 2KDGA 3FQXB 5T3ZH 5MEPA 3RL1A 3RI5F 1U91A 4F57H 4QCIA 3TBVA 2Y72A 4RMSA 4PJ5B 3IFOA 4YDLB 3NCJL 3EYOB 3B2UD 1IGYB 3CX2A 4QRTB 5HPMB 2E7BA 3RVTC 3UBXB 4RGMC 2ZSWA 4MZ3A 4Q58C 1Q0XH 3CU1A 1T0MB 4UQ3B 4IRJC 3CH1B 5I71B 1ACZA 2J88H 1PLGH 1PQZB 4OCXL 2ZUWA 1BFVL 4H0HB 3ORJA 4K23L 3W0WB 4HPYH 3O2DA 1S9YA 5EOTA 2CLZB 1VHPA 2VDQL 4X5LA 3WHE1 4C4KT 4YWGH 4K7PL 1FSKC 3CZFA 1VEOA 5FHAL 4U6YA 3RP1A 3UPCA 3ZMRA 4PS4L 2HFEB 2MKWA 2ZCHL 1KYOJ 5B39B 2MPAL 4LARL 1C5CL 4TPRL 1YY9C 3SDDB 4JO2L 4OZGE 4ELKB 5SV4A 1QRNB 3BISA 2FIKB 3GSWA 5EDXA 3PL6B 4NZUH 2EEBA 2W91A 4PJXA 3O3DA 4BZ2H 1D9KC 2AQ3A 4UILL 4X9FA 3VRJA 4PP2B 1DN0B 3QWRD 4FTVD 2H9GB 3QNYB 4UOW0 3S88H 1IGFH 4O02H 5D2NC 1QG3A 3NOIA 1KNOA 3SQOL 4PJIA 2ZCLH 2XWTA 5KAQF 2FGZA 3UJTL 1KPRA 3UJJL 1H5BC 3TO4A 3X3GH 4XBPA 3B9VA 4XVUC 1U2HA 1QVOA 2DM4A 4MD4B 2R1WB 3KPSE 3ALXA 3DSNA 3MRJB 1IEBB 1LQSR 5CD5C 1JGVL 3LN5A 3TH2T 3LQAL 4G6MH 1JWUA 3VWJC 5HHOA 3EGSA 1YMME 2NTFB 3EDEA 1RUMH 2FGWH 5DJXA 1R3JB 4Q9QH 4MJ6A 4OCSH 2WP3O 5HGBA 5I17A 3AS2A 2FJFA 2XA8L 5GRUL 1K4CA 2D03L 3C5JB 3CH8A 1HCFX 4I48A 2XQBH 4ZFGL 1F6AA 1C12A 1RI8A 3QDHA 3RUGF 2CMRL 3GMPA 3V6FB 2AEPH 3SPVA 2LFGA 3QUXC 4LLVA 5F7NC 2DDQL 4P5TD 3WNLA 2HJFA 3F7PC 3ULVH 3DGCR 1U8HB 1CICA 1B4JH 4U1LB 1M7XA 5FUZL 4NPYB 4F15C 4P57B 2UVEA 4X99B 3MRPA 5DHYB 5ISZD 2HLAA 1SBSL 4LCYB 4X7EC 2FD6H 3GBLA 2K7QA 4R4ND 2ADJA 4Q9RL 2ICEB 4HWEH 1AGBB 3ARGB 4WHYG 5CJOH 3GMQB 1ZOXA 2EDBA 3EJYC 4G9FD 4NHCH 4YDJA 3GIVA 2N4IA 3T4AB 4NC2B 1ZHBB 1FG9C 1GZQA 2VAAB 4PJ9B 4NZTL 5CP3H 1V8HA 1PD6A 2M26A 2DQCH 4GAGH 5DQJA 4K3EL 4EI6A 4XMLL 2NY0B 4X4ZA 4PGZA 4G8FB 4G8GB 4JJ5B 1UB5A 4UT7L 5FGCE 4P2OB 1Y6MR 3SKOA 4MDJA 3H9SD 1YJDH 4WHTB 4HKZB 3GO1L 4ZTPL 3CFKB 3UAJD 4YHOH 5JA8B 3LKPA 2BSRB 4NCDA 4LLWA 4JFHE 4HX1B 2H32H 4XPBH 3VXMA 1C16A 4QXWA 1UJ3A 3KLAA 2YMXH 3MRHB 5ICYB 4P2RD 1XF2B 3S36X 2DKMA 4DJMA 3AUVA 3RWCA 2R2BA 3KYMB 1T5XA 5BCAA 5BS0E 4KMTH 2VZSA 1H3PH 3G6DL 3ZKMC 4KVNL 3TBYB 1QQDB 4DQOH 5CJ5A 4NCC2 5KS9A 4HGWB 1QSEA 3P4MA 4OF7A 4H25B 4GAFB 2F8XC 3Q6GL 1KIQA 5D1QD 4DN4H 1HINH 4Y1AE 5F7YC 3VFTB 1KJMA 1GGTA 4GRLA 2DQIL 1BP3B 5DK3A 5AEAA 4M7KH 3PJSA 4Z78A 2ADIA 3VFNA 4UINH 5HHXH 4S1DC 1DEEB 1LK2B 1ONQB 4M6NL 1UH3A 3P77A 3HS0A 4NO3B 4LEOA 2F53E 1OCWH 4FQQA 2X42A 2LE9A 4JPVH 1XR8B 4PJIF 4NP4H 3O6FB 4U1JB 1V7ML 3ELAT 1KXTB 2GJ6E 2R9HC 5JUEL 2R69L 2VXTH 1FGNH 3HCVB 3Q1SL 2EE2A 5HGHB 4DVRH 3LEYL 2C1PB 5FGBA 3DX8B 3U9UA 5DVNA 5T33H 5I1KH 3NPSB 5ACZA 5CD5D 3REVA 3B8YA 3RIAK 2WBKA 5L2JA 5L8JB 4PJ7A 2FX7L 1BVKA 3FT4A 4TSCL 5A2FA 2PO6C 5CILL 1NMBH 4I2XB 5D1XA 3M8OH 1OAYH 1T2XA 2Y06H 1KIRA 5JXED 1J11A 1S5IL 1CBVL 2NMSA 3KLDA 3W81A 1HHKB 3Q48A 3CSGA 3LKQA 5E08L 2X89D 3GKZA 3W11D 3O2DL 1G9NC 1RHFA 3U7WL 3GSOA 2B5IC 1AO7E 1YY8B 3GBML 1FE8L 5HHNA 4C4KO 4U1NA 1FL5A 2G75A 3AFLA 4JAMB 1IVLA 4WWKD 4PGDB 4ZPTB 3HG1A 4TULL 5C08A 1R0AH 2C7UB 1D6VH 4K7PY 5FUCE 1MJ7L 4R4BB 1F42A 1RIUL 4GXUN 1EAJA 1KACB 5D6DA 4ERSL 1AQKH 1CLZL 2J4WL 2KBGA 5F6IB 1WTGT 1WCBA 4I0CC 3EJYD 5DEZA 3HPJA 3G5XB 1WBYA 4FZ8H 2CRMA 1DLHA 2XIDA 4JFYB 1NC4A 4Y4FA 3I6GA 5F7UA 1JK8B 5FYKU 1KCRL 3MLTB 4D8PA 2CKBA 4J3VA 4PUBH 1GPOH 2HVKA 2DJ4A 4Z0BH 3EAKA 4P9HL 5C09D 2E9JA 3SY0B 4QLRA 4MA1B 5KSAD 4UT6H 1VADB 4PLJD 1I7UB 1JPSH 3WFHA 2VZVA 4NYLA 4M8QB 2OI9C 4EUPA 2JELH 3L3JA 2GCYA 1FFOB 3IU4H 5KVMC 3KPLB 5D2LB 4M48H 4KUCD 5JW4N 3BUTA 4G8IA 4NDMA 5CHNB 1IZJA 3VJ6B 3UTSA 3QFJA 4PJEB 3JXAA 4HG4J 4KROD 5FFLA 4RNRB 2CLRB 3V6BR 2C3VA 3ARYA 3F7YB 1DQLH 4M5YL 4KJYB 4P99A 2HFGL 4FQXB 5D6CA 4KGJA 2O5YH 5KS9F 1CD1B 2HRLA 4ODHL 3UTPE 1KEML 3CFCL 3EYVB 5EU3B 4GRMA 3MR9A 4L8CA 4S1DD 4YNYA 5DHVA 1A6ZA 3V9FA 4M1GH 5IJKC 2H1PH 1HH9A 1ERNA 4L3EE 1IFHL 4E41D 3QRGL 5T5FH 2IAMD 1D5IH 1ZHKA 2AV1B 3H3PH 4K7FA 3WLBB 3STLA 1KIPA 1MFBL 4XRCA 1ITBB 2YXMA 1MRDH 1AFVH 4JZNB 2R9HD 4WRLA 4FQJL 3W39A 1KFAH 3P9LA 3TNMA 3OPZH 4WJ5A 1FNAA 3ULUH 4KTDL 4AZ8A 4CNIB 1FFNA 4F3FA 2X4UB 4U2ZA 1MCCA 1X5YA 3IJYA 4IOFC 4KMQA 2BC4A 4JZOA 1G9EA 5CSZB 3IFPB 1T6VN 1G7HB 5DVOA 5TE6H 1MAML 3A0OA 4PJ7F 3GGWB 4GMTL 2PO6D 1QACA 3MOAH 1MLBB 3AS0A 1J12A 4NO0B 4Y16C 2K1MA 1XGPB 4KRMB 2DQFA 3MUZ1 3FT3A 5MHSE 1A7PL 2I9LA 4LQFH 4PRNB 3BXNB 3S37H 3VD4A 3V6OC 3JWDH 2VLRE 3K8LA 2DQTL 4A6YH 5AYQA 1DLFH 1OAXH 2WLZA 5DC0A 1K6QL 3V95A 3GBNL 4GJTB 1Z5LB 1H3UA 1NCTA 4HS3B 4EDXB 2D7QA 3P73B 1UYWH 5EU5A 4KMLB 4OLWL 3LH2L 1EHAA 5KSUA 3O41B 1TPXB 4JFZL 4BK5A 12E8L 1YEDB 1JZ7A 3T0EA 3H9YA 4MWFB 3E8UL 3PXHA 8FABA 2VLKA 3IXAB 4WO4B 1HKLH 2JIXD 1KJ2A 1I3RA 1CGUA 3QDJD 4NFDA 3ZO0A 2P44B 4RMTA 1J10A 1Q72H 4LLYB 2ZOKB 3STBA 2J5LC 4M7LT 4RGNC 3HUJE 1IILE 1DBKL 5C0FB 5I8OH 2B1HH 4NQDD 1INEL 2IH3A 3MXWL 5E7BA 5E6YA 5EOCJ 4Z7WE 7FABL 1MCOL 1CDJA 1PKQA 3OHXB 5LJYH 3BAEL 5IBLD 1J0KA 1N5YH 2DYPD 4D9QD 4OQ1A 5E7FA 3OAZH 4NUGH 4TRPL 3VE0B 3B9DA 1A3LH 2XWJB 1T4KA 2W0KA 2A1WL 4QRSB 4B53A 4HKBB 3U9PL 2HT4C 5HHME 4C56E 5K9QI 3UTOA 1R24B 4POYA 1DQJB 3T77A 3U46B 3QIUC 5IM7A 5DK0B 4IS6A 4K7PX 5IGXL 3OF6D 3F5WB 1MI5D 4D9RD 1WFOA 4M93C 1A21A 3JBG7 4YBQD 5F9OL 1T2JA 2AEQL 4Z7VE 1KC5H 4HUUB 3NMEA 1YN7B 5D7JC 3T04D 5JOFB 1J8HA 5TQ0L 5ICZA 2JKXA 3RWJA 3MBED 3QEQE 1NL0L 5EBMB 2NW3A 1GC1C 1V3LA 2XNAB 1HQ4B 3GJFA 2A73A 4GO6B 1WWCA 4FNLH 4PJGA 4S1RH 1JHKL 3UJIL 4KKLD 4X7SH 4YX2L 1KCVH 4A6YB 4PJDB 5EU7E 2YEZB 3LN4B 3VXNA 4XNZB 1RQ5A 2CKBL 1HDMA 1KLUA 3FQXA 3MODH 3WHXB 1E4WH 3AM8C 3MYJB 1GHFH 2YPKB 5I1AB 4PJ5A 4UMGA 2HLFC 4LSDA 1CE1L 3QUMA 2AKRB 5BO1L 3EYOA 5IQ7L 3HHRB 2VYRE 4UAOC 1R3IL 5KSVA 2X4OB 1LHZA 4Z6AT 1G0YR 1QFOA 4OT1H 5HHVH 1HHHA 1OAZH 1GGIH 3ARUA 5HYJB 3G5VB 3V52H 4JGJA 4UQ3A 4Z7QF 3WIIL 5DUML 3KYNB 3FQUB 3OMZA 4ZAKD 4NRYB 1PQZA 2YPVL 3MLXH 3ZDXE 2XN9B 2H6PB 3W0WA 3EFFB 2CLZA 4Y4HC 4DAGL 4X6DB 4DKAA 1OAQL 2MQCA 2G5RA 1XGUA 4PJ8C 3A6BH 3VFOA 5ALCL 1XGYL 4M5ZH 3JV6A 5K59E 5L2KB 1G7QB 1NGYB 5B39A 4EKXA 2X4NB 1EERB 1NANI 5ID1B 4HPOH 4ELKA 5KOMC 1QRNA 5E8NB 4LRIC 2O61B 4S1QH 2FIKA 3PL6A 3HA0A 1UEMA 2AK4D 5D7LB 3QQ9C 2X4SB 1LO4L 2HKFH 3THML 4YHLH 4PP2A 2E3VA 1AGCA 2VR4A 3QNYA 4U6HA 2EDTA 3EFDH 2DD8H 4PRAB 5IG7A 4QTIH 3ARTA 1LEKB 5FF6B 2AABH 2OQJB 4K3DH 1T7ZA 2X1WL 5EUKA 3T4YB 3KXFD 4M3KB 4WEBL 2IQ9H 4L4TB 4LBEA 3DIFA 3BKMH 4X6EB 1A6UL 1N0LA 1AXSB 4JVWA 4Q2ZB 4WUKL 5IHZB 2UVFA 2HT4D 4GBXD 3QCVL 5B38G 4MD4A 1UXSB 2R1WA 3G08B 1FYTD 1C1EL 3IJSB 3ILPB 2MCPL 1L7IL 1IEBA 4AG4L 4MA3A 4FQ1H 4MJ2A 1UCTA 1MNUL 3ECBA 3FL7A 3R0MA 4X6CE 4PJAB 5F9WB 4F9LA 4G43A 4NJ9L 2NTFA 5E2WL 5A43C 2DKUA 1R3JA 1CGTA 3SE4C 1R5IA 3EZ8A 2V17H 3F58L 1K9TA 3HNSL 4NO5A 3E6FB 3LQZB 5D7SH 5GZOD 3ZTNL 3C5JA 4TUOB 5HDBF 5D7JD 4KHXH 4MJ5B 1K85A 2W07A 4TVPD 2IPUG 3OJVC 4NJAH 2BY2A 3VH8A 2J12B 2JJUA 3ZE2E 1TQCC 4KI5D 2R0WL 1G9MC 1A14H 3CMGA 3DXAD 1U8HA 2DQEH 5TQ2H 1J0HA 3VU2A 4U1LA 3GNML 4P57A 2NZIA 3SKNA 4PJGF 5E8PB 4X99A 1KJ2L 1GZPB 4PJHE 1CLOH 3BP7B 4FA8A 1A9BB 2AJZB 1KCSH 5I75B 3G04A 4WDIB 2F19L 5T1DH 2ICEA 1AGBA 3GMQA 4JFOB 3PIQB 4W81A 4Q0XL 2LAAA 3V0VA 3T4AA 3U2SB 1MFAH 1ZHBA 1OAUL 3GKWL 5AUMB 4PJ9A 2QADC 5LWYH 1RK1B 4JRYA 2HLFD 5GQBA 4OAWB 5EIIB 3WLWD 4WI8A 1RJYB 1NCBH 4FTVB 5BZWB 3WN5B 5JQ6L 4G8FA 3QP3A 2L0DA 4JJ5A 4Z5RA 1IQDA 5MP6H 4Q6IB 3SDAB 4CDHA 1OQXA 3ETBF 4JN1L 5HD8D 5IFHL 5DUPH 5IWLC 5IOPB 4RFNC 4OB5H 3G6AA 1JF6A 4Z0XA 4WHTA 5L88H 3CFKA 3GSNH 1T1ZB 1LO2H 1EBPA 5IF0B 4HX1A 1SMOA 4P2QD 4MMXC 1CK0H 4W6YB 1XH3B 4ZPVB 3MRHA 4NGHL 2VIRB 1XF2A 2I25N 2GFBB 1BOGB 1GRWA 3QJFB 3AREC 3TBYA 1QQDA 3MRIB 3T1FA 2JJSA 4K8RL 1D5BB 2BOBA 4J8RA 1EEZB 3MGOA 4H25A 4OFYD 3EDDA 1JIBA 2NY2D 1U92B 2AXFB 1A4KB 4M4RA 5E6IB 4ELMB 1FC1A 4DCQA 3E1F1 1DEEA 2VDPH 2ZZUT 3LCYA 1MIEL 4G6JL 4OSUL 5K9QG 3CFJB 3VW3L 3HNVL 5JMRA 4LIQL 4ZO9A 4DGIL 2YRZA 4RWYL 5BW7C 2NQCA 5IQ9A 3O6FA 4V1DE 5ISZB 4J3TA 5GS0H 4HGMA 4Q74A 2NXZD 3HCVA 4MA7H 3LKSB 5HGHA 4JO3H 4XNQB 1BMGA 3DX8A 1DANU 3WXVH 4OF6A 3U0TA 2EO9A 4G9FB 4IDLA 5DJ8B 4R4FH 2PTVA 3SE9L 3CVHA 2EXYD 1OGAD 3AC0A 4PGBB 1F3RB 3QUML 2KZ1B 3UPAA 2X41A 2XZQL 4PLKC 4I2XA 5CJBA 5CWSA 4M4PA 4WI5A 5ADPL 3ULUC 3AVEA 3QEHB 1HHKA 4EIGB 2APFA 4I9WE 1TQBC 2VR5A 3OKLB 1VFMA 3V4VL 1R3LB 3H9SB 1IKFL 2OZ4H 4JVUA 1YY8A 1BGXH 2IBZY 4HEME 1MVFA 2MKLC 3BDYH 4JAMA 4OUOA 3RUGE 5LBSL 4DW2H 4CMHB 4PGDA 3MLSH 4ZPTA 2Z91B 1J0YA 3C09B 1CVSC 1T1WB 2VXQL 2W0FB 1X5AA 1OAKH 2C7UA 5K9JH 2AJXL 4NKMA 4R4BA 1I3GH 5F96L 3GSNB 3G5XA 3FN3A 4PBXA 2D9CA 1WT5C 4JFYA 3JWDC 5LG1A 3CXHK 1MIMH 5DWUL 3RJQB 1JK8A 2PYED 5D1QB 3WUWG 4L3CB 2UUDK 2IBBA 3MLTA 3QCUH 2EKJA 3VFVB 4OCYH 4F33B 4HS8H 4ETYA 1IAOB 4IM8A 1VADA 5DA4A 1CXIA 4NKIL 2AQ1A 4CADB 5LGKA 3QDMD 4JANA 1OOAA 1VGKB 3KPLA 4LHUB 3EJZD 5E2VL 1DVFC 1QEWA 5CHNA 2D0FA 3PWNB 3CAFA 1LO5A 4LFHD 1OD9A 3K4DA 4JG1H 3RGHA 4RNRA 2CLRA 3F7YA 1RULL 4LAQH 4ZFZA 4J6RH 5CEXB 4NQCE 5DJDB 1ORQB 5TH2B 1SEBB 4ODWB 4FFWD 4FQXA 2QHLA 2RHEA 1IQWH 3OB0H 3PV6B 5T3XD 4KAQL 2X9XA 5T3ZL 4HH9A 5LAXB 3HLAB 4AH2B 4KH2A 4F57L 3EYVA 3T65B 3BRDA 1PW3A 2YN3A 3LIZH 2A9ML 3VDCA 4IMKA 4EN3C 1BAFH 3WE6B 3QQ4B 3MOBL 2EEDA 2YWYA 2Z92A 4MJIA 2AV1A 1M7DB 2FX9H 1B88A 3WLBA 1CGSL 3DVNB 4WWKB 2EDFA 3VXOA 2CIIB 2XFXB 4JZNA 2AJUH 3H7BB 3B5TA 5GGTA 4DFHA 1WCQA 3MRLB 4WU5B 5IW3A 2X4UA 4HPYL 3ULVF 1H3GA 3IFPA 4RMRA 1WJ3A 4PJIE 2ZUTA 1C08B 3BGMB 4X6BB 5FECB 4PLKD 3H3KA 4DOHB 2ITCB 1XGPA 4Y19E 5C09B 4X4YB 2DI8A 5KSAB 5E03A 3C08H 4PRNA 2GUOB 3UTQA 1U58A 3BXNA 2WQ8A 3IDNA 4GOSA 3L7FB 3WL9B 4JFFD 3JWNC 2QSCL 3NPZB 2EKSB 3BH9B 1Z5LA 3DUUB 5T1LD 4O02L 2MFNA 1W72B 4HS3A 3MV7B 4MVBC 2DLHA 4Q9CA 4KROB 4QRRE 3O41A 4RAUB 3U4AA 1HI6B 1RD6A 1JVKA 1HYSC 4ONFH 4MWFA 3X3GL 5GGQL 3IXAA 1BIHA 4XPHH 1I9RH 4JDZA 4U6TA 2F8VA 4HF5L 2G9HB 4G6ML 1VCAA 4LLYA 2ZOKA 1FNFA 5L7XH 1YYLH 1BREA 5C0FA 3GSVB 3DVGB 1EO8L 1S7UA 5KZCD 3LS5H 1DSFL 2XQBL 2IAMB 4JPIB 3U83A 1CD0A 2Q86B 5F9JB 3DARA 5T1MA 3OHXA 1MCDA 1IZKA 5BRZD 3ULSB 5D2LF 3BMVA 2E7CA 3VE0A 1B4JL 2A0LC 2V2WB 4I4WA 5KW9H 4QRSA 3TYGL 1NAMH 3DNKA 4PJEF 1YEJH 1NAKH 4WV1B 1R24A 5BV7B 1DQJA 1UCBL 1WBXA 4Z7UB 3U46A 5CJOL 4J3XA 5DK0A 4R96B 1A6AB 3F5WA 4JZJC 2HWZH 5IV2A 3RVVC 1BBDH 3MROB 1T7XA 3QXTA 3PWJB 2NY7H 2DQCL 4C54A 1IARB 1YN7A 3FOMB 4M7ZB 5C07D 4V2CB 3V2AR 1TETH 2JJWA 4L4JA 1FLRH 4U1MA 1I1FB 5EBMA 3JUZA 3D69B 3P40A 1G7JB 3MMEA 1YN6B 4HAGA 1F4AA 5I0ZA 3TVMD 2AEIT 1YJDL 4XBGB 4XGZB 1FCCA 4YHOL 4APQC 2Z0BA 4A6YA 4PJDA 3MJ9H 3NZHH 2JIXB 2YMXL 2YEZA 1HE7A 3ROOA 4HBCL 3LN4A 2VXUH 3QDJB 4IRZH 5D71H 2LTQC 5EIQA 3U4BH 3MLRL 1WFNA 4QGTA 3WHXA 4XMPL 1UWGH 3MYJA 4M62H 2YPKA 5I1AA 4G42B 4DQOL 3NFNB 1J87A 4NQDB 3VXRA 2FLRT 1FBIH 4JGUA 2AKRA 5J56B 3RVXC 4DN4L 1S7VA 3JVGA 2X4OA 4R97C 3OXRB 4M7KL 2HRPH 5HHXL 3G5VA 2D0HA 1QLRB 2DYPB 5FCUH 3KYNA 2Y23A 3BEVB 3FQUA 5DJCA 7CGTA 3I6LD 4MVBD 1LILA 2H6PA 3TN0A 1AKJA 3FFCA 4XPTL 3BP5B 3EFFA 1I1YB 1OF2B 4X6DA 4Z77A 2RIKA 3MLVH 4NP4L 1HYSD 1MFCH 1M7IB 3U48A 4DKEH 4JM2C 1FGNL 4CGTA 1MCSA 3BWAB 3T08A 2YD9A 3DO7B 1BQHA 5I1KL 5EBWA 5T33L 1HHGB 2PR4H 4JKLA 3VD3A 2I27N 3CX5J 1KB9J 4UV4L 5IMKA 5C08E 3TV3L 5ID1A 1MI5B 1I8MA 1NAMB 2X4RB 5E8NA 2AJSH 2O61A 5AZEH 1QLFB 4KJWC 5D7LA 3M8OL 5KVFL 3FJTA 1OAYL 2DLGA 2Y06L 4ZS7H 1EH9A 1IC4H 4XI5C 4EI5C 5K93A 3MBEB 4KQ3H 1U8PB 4EJ1C 2YK1H 3KJ4C 4NT6B 4PRAA 4XX1E 3LD8C 1P7QB 4BA8A 5GGRB 1LEKA 5FF6A 5EG6C 2YC1A 5DO2C 2VE6B 1S9WB 3IDMB 3HZVB 4AEEA 1JZ3A 2AS5M 4L4TA 4X6EA 5A2KH 25C8L 1XT5A 3KPPA 1AXSA 3QRFM 1RZ7H 2Z8SA 2PUQT 3MLUL 5ADOH 1NLDH 3MRFB 3G08A 4F7EA 1D6VL 5GRZA 1PJ9A 1MCRA 1KOAA 4TVPH 4UU9A 3TA3C 2NX5D 3CXHJ 1P69B 1AQKL 4PJAA 3FZUC 5KJRH 4POZC 3RVWC 4FZ8L 1ZV5A 3UTSE 3N1PC 3E6FA 1ACYH 4ONOA 5FA3A 1RVFH 3BPNB 1NC2B 4TUOA 3ZKNC 2DAVA 4MJ5A 4PUBL 1GPOL 1OW0A 5FYJD 3QG6B 5FYLE 1FQ9C 1HWGB 3ARVA 2O5XH 5I66B 4LLUB 1F90H 3KLHC 4ZAKB 5IMLB 2IMMA 3RWHB 3TNNB 3EYQC 5B8CB 5IIEB 5IUSA 2JELL 2GSIA 4N1CA 4XAWL 4APQD 5A2IH 5E8PA 3C6LC 4M48L 5TF0A 1XF1A 5LCVH 1GZPA 4RDQF 4H26A 2XRAL 3BP7A 1A9BA 2N56A 2MHAB 3ARBD 3H6JA 1F11B 4PJDF 5JOPE 2BNRB 3TC9A 4WDIA 2W38A 2QSQA 1M4KA 5C0AD 1UM6H 3CCHB 5DVMA 5IEKA 5E56A 3O0RH 3LRSB 1VFBA 1DQLL 1AGFB 4W70A 3U2SA 3BN3B 5AUMA 3SQBA 1RK1A 2AK4B 4P5MB 2O5YL 4KDTC 3TZVB 1ZT7A 3B3IB 4WFHE 1UB6B 4JHAH 4OAWA 5EIIA 2ICCA 3QWRA 4FTVA 3WN5A 4UV7H 1YEEH 3QI9C 2FNBA 4Q6IA 2ICWJ 3KNBB 1GH7A 5IOPA 5AYUH 3KXFB 3GJFK 1IRAY 2O5ZL 1D5IL 2AJVH 3I9GH 2APVA 4YDIL 1T1ZA 4MDIA 4LVHC 1OSZB 4GBXB 5IF0A 3LEVH 5DLML 4J3WA 4K94L 1MRDL 4X6DF 1FYTB 1XH3A 1R3HA 1KFAL 4WY7H 4Z7QE 4YHYC 4TSBH 3OPZL 2D3VA 5T5NG 1FFQA 2GFBA 1BOGA 3T2PA 3F12A 4M61A 3ZT6A 4ZSOE 2ADGA 3RAJH 4G7YL 4LSSL 3UZQA 3OJ2C 5GHWL 2RB8A 1D5BA 1DDHA 3S35H 5ITBH 3HR5B 1EEZA 3MOAL 3V6ZA 1U92A 4D94A 2AXFA 3FQWB 4ZTOH 3P4OA 1A4KA 3IAGC 5D1ZD 2LAGB 4ONGL 4ELMA 3AGVA 4OD2B 1NCWH 4KGLA 4EI5D 4P5TA 3PGCA 1ZLVH 1HK6A 1MJUH 2NY5H 4FP8H 4RSVA 5DTFB 3DXAB 5J1AA 4KJPD 3CFJA 5DO2D 3I85A 3P4NB 1KT2B 4A6YL 3HMXA 5H37H 1XF4B 1OAXL 1ZEAH 3GSQB 1T1XB 4PLNC 5ISZA 4F7PB 3H7LA 4L3AA 1ETZA 1UYWL 3DECA 4XNQA 3ZT7A 3SGKC 1QSVA 1PKQE 3TA3D 1N7MH 3EOBB 4G9FA 4N8VB 2NY6D 5DJ8A 3MO1B 3RTQC 4HLZG 4BFIB 4POZD 1K8DB 4AENB 4PJAF 1XCQB 2A77L 4PGBA 4M6MH 1S3KH 1FZMA 1JWSB 3QQ3A 4JREC 2CK0H 2DLTA 4NN7B 1ED3A 2IF7A 4DUXA 5I1GH 5C0EB 3VFMB 1D7FA 4AQ1B 4I18C 5I8OL 4PRHB 3ZZ1A 2B1HL 4RISH 4RWHA 5F7DB 3H9SA 3NIGF 1MY5A 1T20B 3ARFD 4OM1H 4JHWH 3PP3H 4H5SB 5HDBE 4HXAH 4HWBA 4YPGB 3ZKQD 1JWMB 3C6LD 2Z91A 3BVNB 5DRXB 2HT2D 4DVBB 4NQXB 1BEYL 1N5YL 2W0FA 4P2RA 4OGXL 3WJLA 3MC0A 3LKNB 1LK3L 4HCRH 5FYKD 2E7LC 4KXZI 4P4KC 1A3LL 3U1SH 4DZ8A 5ABDE 32C2B 1P84K 5EULV 3P4LA 3BPCB 4LIQE 3QZWB 4JE4B 3TWCL 5D1QA 2NY2B 2HMIC 4L3CA 5C0CD 4K3JL 3VFVA 5HTSA 4F33A 5HGAB 5CKAA 2B4CH 1KIUA 1PYWB 4HXBL 3TIEB 2H41A 4QO1A 1KC5L 4CADA 5FM8A 1VGKA 5EO0B 4PJ5E 3ZYOA 2NCMA 4BSWB 2H3NA 4LSUH 1E6OH 2NXZB 1DUYB 3NACH 5T3XH 2E27H 3SKMB 1FORL 3PWNA 5JHDB 4YLQT 4FNLL 4NUJB 2APWA 4S1RL 1FG2B 2XYCA 4UIMB 3TYFA 4HQQL 1KCVL 1OGAB 2BSTA 1SY6H 5DJDA 1ORQA 2IBGA 4WI9A 1XGRB 2IAND 5TH2A 1SEBA 4ODWA 2FEEL 2N7BA 3W0WE 1OP5K 4FABH 3WXWH 2XKSA 3EOAB 1BZ9B 3RDTC 3MODL 3DJ9A 3T3MF 1YPZA 4PG9B 4AH2A 1E4WL 3HLAA 5JXEA 1FRGH 3MX0A 3UTTB 4GSDH 2WM0A 2NXYC 4U1IB 4YXLH 1JCKA 5F97E 1DP0A 2DQJH 5LKNA 1FVCA 2EXWC 5GGSB 3VGAC 3BSZH 2X89A 4ELMF 5EOQL 1A7OH 3WE6A 3QQ4A 5JQHC 4YK4B 3L6FB 4OT1L 2I24N 2ARJQ 1JUFA 5HHVL 1M7DA 1OAZL 5IT2H 2OL3H 3DVNA 4WWKA 1HILB 3CFBA 3H0TB 3MJ7B 3VXQB 2CIIA 2V5MA 3H7BA 1OLZA 3DURB 3ZE1F 2F5AL 4ODBD 3W2DH 1JRHH 3MRLA 4Y7MA 4IJ3B 2OZ4A 4JY4B 3FN0L 4KWUA 3MFGB 5EU4B 4LCIL 5KAQG 3F7QA 3RTQD 3MYZA 2GY5A 4RMQA 3VCLB 3D25B 3A6BL 3F8UB 1C08A 2XA3A 2PYFA 4X6BA 5IESH 1A7QH 2EDXA 5FECA 1T22B 3CDGB 2QHRH 2ITCA 4U1GC 5C09A 3HE6C 3UTZB 4X4YA 3LMJH 1WV7T 5KSAA 4S1QL 3HI1B 2GUOA 5I18H 4XPGH 1NGPH 2ZUQC 3QDMB 1IC7H 2WBWB 5FB8B 3L7FA 1WISA 3WL9A 3ARDD 2E6QA 3CSPA 3NFSH 4U2YA 4GKNA 3CJJA 3EFDL 3F6IA 4JRXD 2EECA 5H94B 3ET9F 3F7VB 1W72A 4K3DL 5T3ZE 5A1AA 3WIFB 1XF5B 2IQ9L 4OV6F 4O51A 5ECJE 4P4KD 1B0WA 4RAUA 3GRWA 1HI6A 1H3XA 1EFXD 2IPKB 1CG9B 3MA7A 1JNNL 1LDSA 1Y18B 1Z6JT 2RBLA 4I0PC 2AGJH 2WBJD 4UB0H 1RZJL 2G9HA 5F21B 2NR6C 4UUJB 3DBXB 2Q8AH 2VISB 2V17L 3GSVA 1ZLWK 3DVGA 3KPQA 4NOBA 4RQQB 4F80A 4YJZL 4FXLA 3OKEB 3QHFL 3HMXL 4E41A 4KHXL 2IAMA 3RVUD 4OCWH 4JPIA 5DJZB 4NJAL 5F9JA 4LP4A 4H1LG 2DOCA 4ZDHA 3VRIA 1H0DB 3ULSA 1QKZL 3PABB 1BFOB 2OJZL 2QKIB 3DETD 5DF0A 2DQEL 4G8GE 2C4FT 3RZCD 2V2WA 4KJQC 1PX3A 5B4MC 1MH5B 5DQDH 1RJCA 5I0DA 2DMCA 2EDNA 2OL3B 4WV1A 4K71C 5M94B 1KCSL 2PO6A 3QUZB 5EORH 5T1DL 3BEWB 3RDTD 3JWOC 5F9AC 5D5MB 1AXTH 5CJ8A 4R96A 2J8UA 2DM2A 3QAZC 1A6AA 1VGEH 2NXYD 1MFAL 5C2UB 1XIWC 3LSOB 3MROA 4OZHB 5F3HA 3PWJA 3C60C 3CK0L 1X5ZA 2VDKL 3FOMA 1CGYA 3QXVA 5TF1H 5C8JB 4HWBL 1F3DJ 1ZT1B 2BRRH 2SEBA 4NM8L 2OR9H 1FVEA 1I1FA 5T1LB 2ADFH 4B50A 3D69A 1KELH 1G7JA 5DUPL 1DL7L 4OB5L 1WTLA 2IJ0C 1J88A 1QBBA 4GAJL 1ZVYA 5L88L 2HKHH 3GSNL 3MA9L 1DQQA 1X4XA 3FO0L 3VWKB 1CK0L 1P4BH 1FFRA 3O6LH 2JIXA 5SWQB 2D4FA 5JPNB 3QDJA 5SX4H 4U31A 1S7XB 2PXYC 3RWDB 1UEYA 1XAUA 1ODAA 3ULVE 3RPKA 3ARXA 4UIKH 3QNZB 5DMIH 4NQDA 3TCXA 3QDAA 5KZCB 5J1SC 1NEZA 2NY3B 4OFIA 3IETB 4U49A 4YE4H 5MEOA 1T7YA 3OXRA 1YEIH 5DGRA 2VDPL 4H20L 4Y2DD 4MA8H 4XCNB 4J7RA 1GYAA 3JTSB 2WINB 1OGTB 2B1AH 5GSRA 2VC2H 4JPKH 2NY4C 2Y07L 3BP5A 1I1YA 1OF2A 4XTRC 1AGEA 3H2WA 3UEZA 4S10A 1M7IA 3GMOB 2YA1A 4MA7L 5I8CB 2W65B 4GMSH 3DO7A 1XR9A 1FZOB 3MNVA 3S5LG 3WXVL 1FNLA 4R4FL 3MCKA 1IKNA 1T04B 3OF6A 1MI5A 4JFEB 1NAMA 5TE4H 2X4RA 5DFWH 4R0LC 4R7DB 3SDXB 4OF5A 4ZS6C 4M43H 1J1PL 1QLFA 4OM0L 1D5XB 4QHUB 5C07B 2D7TH 5GRJH 3MBEA 1U8PA 4MAYC 1B0GA 4NT6A 3RFZC 3BPOC 3MFFB 4QRQB 5GGRA 2R8SH 1EO7A 1EAPA 4H0IA 4B5EA 2A83A 3TVMB 4ZODA 2YD3A 5BQ7A 1S7RB 4YBLB 2OZ4L 5E4EC 1FZJB 3HZVA 1INDH 1QA9A 3P11H 3SDCD 4JY5H 3D39B 5C0BB 2V2TB 3R06B 3CC5A 5JHLH 3BDYL 3EDKA 4DW2L 5B4MD 2M1KA 4OBRA 2FSEA 1OAKL 2X9WA 3SCMB 5K9JL 4NC1E 4LVEA 3QIWB 3IJHB 5J9PB 3N1GC 5D2LE 2FJGA 1CDCA 1I3GL 4Q97A 4Z7UF 3T09A 1A1MB 1KB5B 1B4RA 4KK5C 2CDFA 2P1YA 4PJEE 3MJ9A 5L6YL 1MIML 3N85H 5CGYC 4PRDA 3WIHA 1VFOA 2P5WD 3C60D 4QWWC 3QCUL 5K9OB 3V6OA 4OCYL 4XWOC 3T2QA 2R1YB 4HS8L 2Z8RA 4NO2B 4HK3J 5LGJB 2BFVH 5I66A 1CGWA 1W72L 1OP3H 5BOPA 3DRQA 5GRVL 3MACH 4ZAKA 3LV3B 1BLNA 3GRWL 4RRPA 3TNNA 5IIEA 5B8CA 5HYIA 4PR5B 4L9LB 1KJ3L 1JZ2A 1N6QH 1JFQL 1OARH 5CSGA 2MHAA 4ZO6A 2EDRA 3FB5B 3MBXH 1I8IA 4MNHB 4JG1L 1GCFA 4OZFH 3CCHA 3BKYL 3LRSA 3F62A 4GG8A 1JYWA 4LVOB 4GAYB 4J6RL 2NLJB 4G8EA 1IM3B 5DURD 2HFTA 1HHJB 2AK4A 3QFDB 2GTWA 4GW5B 3B3IA 4PRID 2FJHA 1U36A 3P9MB 4NZJA 5JPMB 3LIZL 3QEUA 1MAJA 3KNBA 5DK2A 3B8SA 3NIDF 3KXFA 4QNPE 3L5JA 2NW2B 3H8NA 2FX9L 5CFHA 3HI5H 5BV7L 1OSZA 4GBXA 4P46B 4YXKH 5F70A 1FYTA 3K2UL 3ZDYF 4GLRI 1C5DA 2B4CC 1LE9B 2BVPB 2NX5B 5I8KL 1U3HB 1ZGLB 4WI7A 3VI4F 4K9EH 4MD0A 5MEND 3UBXI 1I7TA 1FDLH 4QT5B 3HR5A 3R1GL 2BVYA 2DJSA 4ZS6D 4G7VH 5D7JA 3FQWA 2OYPA 2BVOB 3IS0X 1TVHB 4OD2A 4XP9H 3HPLB 2IPTH 1QO3A 3TT3H 4XX1G 5CEYB 4PTUB 1HXYA 4BSJA 2GJZB 4PIRF 3DXAA 4KQ4L 3TBWB 4BUHA 1J5OL 1XF4A 1P4LA 3CZJA 2BSSB 1BX2A 1T1XA 3GSQA 4MD5B 4Z95H 4ZXBC 4NWUH 3VDBA 3ARBB 4EUPG 5C0NC 5C0AB 1QHOA 2I60L 1IGMH 1NQBA 3OGOE 3EOBA 1A9EB 3V4UH 4O2CA 3MO1A 2DJUA 3RNQB 1DBJH 1K2DB 3MLWH 1CZ8H 2VUYA 1ZHNB 1K8DA 5T1KD 4AENA 1XCQA 4BFIA 5HYSG 4XPHL 3V8CA 1EA9C 3G9VA 3ZL4H 3TLRA 1I9RL 4DK6A 4P59L 1JWSA 4J1UA 2I9TB 4Y5YB 5E9DD 3O8XB 3ARWA 2Z31C 4OZFB 5IJVB 2LQRA 4Y4KB 1MY7A 5L7XL 1RSFA 3BI9X 3JV4A 1MHEB 4E0RA 3ARQA 4CW1B 5FYKH 3ULUE 4Y88A 2EE6A 2DQUL 2DS4A 3KYAA 5IBTH 4WUUB 2IH1B 1HSBA 2HT3C 4HLZH 3KJ6L 4UOW1 3RZWA 1P4IL 4M8VA 4P2QA 4I3SL 3O3AA 4YPGA 4A2LA 4OCXH 4XCCH 3S4SG 1KTDB 1BFVH 5DRXA 4DVBA 4QOKD 4NQXA 1N5AA 1UXWA 4LDEB 4L8DB 2VDQH 4K7PH 3O11A 3Q5YA 5J11C 3OR6B 3KPSD 4U1HA 1NAML 1MHPL 3O45B 1YEJL 4X9GA 5FHAH 1JPFA 4PS4H 4AEIH 3BPLC 3V5KB 1YMMD 1YEKL 4OFYA 5E5MB 2MPAH 3QUYC 1UH2A 4LARH 1C5CH 4TPRH 3IU3A 4EBQL 5D1ZB 4MCYB 4PD4K 2GITB 5C0DB 4PJFA 2HWZL 1SJVA 1BBDL 4UILH 5HYQB 1G7PB 2APBA 5EO0A 1TDQA 3G6JB 3P0GB 3WV0A 3T0WA 4BSWA 3NVQA 1FLRL 3W9DA 2XKUA 3DV6B 3SQOH 4W4NA 2Q20A 1DUYA 1EGJA 3SKMA 5FO8B 3UJTH 2D0GA 2XICA 1XCTB 3MUHL 4NUJA 2ZSVA 1QFWM 2EYSB 5HYJE 2IADB 3X14B 5I2IB 2NY6B 1FG2A 5INCB 5FUCC 1OGAA 1GOFA 1I85C 3MJ9L 3NZHL 4QHMA 4YHZH 4LPWA 1XGRA 1X6NA 3SE4A 2XN9E 3WIHL 2VZ3A 1JGVH 2VXUL 4IRZL 4XNXH 3LQAH 5D71L 43C9B 4X6DE 3U4BL 3PWVB 1BZ9A 3GJEB 3SO3C 1UWGL 4M62L 2UY7A 1NBVH 4U1IA 6FABL 4BQ8A 5GRUH 1Y0LA 2D03H 5GGSA 5D8JL 5L2KE 3O4LB 4KI5F 2G5BA 3ARFB 4QRUB 3X13B 3L6FA 5ID0B 2DDQH 5H35B 1X9QA 2ZWLT 3KPOB 4U0RB 2OS7A 5D7LE 4WFFE 3H0TA 3S98A 1CD9B 1GL4B 5FCUL 1FLTX 4BFGA 1JPST 3DURA 4JFHD 2JLLA 1FZKA 2HTLD 1UJTA 1G6VK 4JY4A 4PB0L 4HHAB 3MLVL 3NCFB 1SBSH 5FV2A 5EB9A 2BRQA 3VCLA 4W6WB 3QCTL 4L4TE 4KC3B 5BS0D 2PYEA 1ZLSL 1TTUA 1S78D 2PR4L 5C0CB 1T22A 5EBGA 4HCRA 5F7EL 3MRRB 3O4OB 2D7MA 3FO1B 4ZQKA 2ENSA 5LQBH 1Q9OA 2Z31D 4JFPB 4Y1AD 2AJSL 4PJAE 4K3EH 5EPMB 1TFHA 4JQVA 2P4AB 1AR1C 3QDMA 1XFPA 5I9QB 5FB8A 4ZS7L 2YD4A 3BKCH 2G60H 3ILQD 1IC4L 4KKCD 5IVZA 2HT3D 4KQ3L 2F53D 2ARJB 4OZIB 5E2UL 2QQQA 1EJOH 3LDBB 5H94A 3F7VA 3GO1H 3WIFA 1LE5B 2GJ6D 2D2OA 1NEUA 4KK6C 5BVPL 1I1AC 4F7MB 3AREA 4KDVA 2IANB 5ADOL 1CG9A 3OSKA 1M05A 4OJFH 1NLDL 1E27B 3SJVB 4ZOEA 4IRSC 4GKZA 4TVPL 4JDTH 4JQXC 5GGVL 2VABB 3G6DH 2ICES 3BN9C 5KJRL 2YRPA 2AJ3B 1UZ6F 4UUJA 2VISA 4BQBA 3Q6GH 2PW1B 4P9MH 3S96B 1ACYL 4K3GA 3ZDZF 2DQIH 3PGDB 1RVFL 5J12B 1HCVA 3CU7A 4NRZB 3QQNA 5GIRA 4L1HA 1ZWIB 4M6NH 5DJZA 5BW7A 2YD7A 3TJHD 1AO7D 1RUPL 1H0DA 2BP3A 4UTBL 3PABA 4FTVE 3UBXG 3UPRA 3MLPA 5CCKH 3DGGA 1L7TH 2D7NA 3BKJH 4W4OA 3CIQA 1V7MH 2NY1D 3MV9B 3W82A 1MH5A 4LSRL 5LCVL 4LNRA 3LEYH 2OL3A 1JNHB 3AU1B 1PEZA 4AT6B 1LO0H 5L0QC 1X44A 3BRGC 4HBQA 4X8XA 5IW1B 4HWUA 4S1SL 1QNZH 1UM6L 4YEEA 3O0RL 1N0XH 2R4SL 2BNQB 4WGVB 2BDNL 4G6FD 3LSOA 4OZHA 3KHQA 1NPUA 5B39G 1NFIB 4NZDA 2P5ED 3ARDB 4JFFA 5C8JA 1F2XK 2VLJD 1ZT1A 1YEEL 1EO5A 1BFSA 1T89A 3Q0HA 4JRXB 1N8ZB 5J0BA 5E08H 4BELD 5T1LA 1OD7A 3Q6FB 3GBMH 2JCCA 5AYUL 3TCLB 2D31B 5CJQH 3HB3C 5AWNL 2WWKO 5DGQA 2V5SA 1FCGA 5K9KB 4WEMB 1EFXB 1Z9MA 3LEVL 1CT8B 1L6ZA 1MJ7H 3U4EB 1RIUH 1P6AB 4ERSH 5JPNA 4TSBL 2FZ3B 5D93B 3DX6A 5KN5B 2WBJB 5ACLA 1S7XA 1UACH 2VQTA 3ZE1E 4ZUWB 4ESKA 1NSNL 3RWDA 4WI3A 4XXCC 5A16B 3EHBC 3HN3A 3ME0A 3QNZA 1KCRH 3S35L 3G5YA 5GGRY 1HZHH 3IETA 4AYFA 4ZTOL 1AR1D 4WU7B 3CDFA 1ZGLM 2BHUA 2CR3A 1F4XL 4CVZB 4L3ED 5BJTA 1JYXA 5EBLB 4X5WB 2NY5L 3JTSA 2WINA 5DA0B 1OGTA 1P2CB 2H2PD 5BRZA 3BQUB 2C3HA 3RZCB 3EKCA 2VTFA 3M1BB 1JTOA 4MHHI 1D5ZB 3DYOA 1I7RB 1I1AD 5FA4B 5HJ3A 3H9SE 4GG6B 5I6XB 3GMOA 2MTPA 5I1LB 4I77H 1UA6L 5IVXA 1T2QH 1Q9KB 5EU7C 5CEZD 4IRSD 2D4DA 4PV8B 2CSPA 5JIIA 4KXZH 1N7ML 1H8SA 3NCYP 1FN4B 1T04A 2HFGH 4RMVA 4BYHA 4M6ML 2VDOH 1G9ML 1S3KL 5JR1H