5HDQL

Mntc co-structure with mab 305-78-7
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNEKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Mapping of Bactericidal Monoclonal Antibody Binding Epitopes on Staphylococcus aureus Antigen MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein/immune system
molecule keywords ABC transporter substrate-binding protein
total genus 45
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdqL01
1K8IB 1ES0A 5BV7C 2DQEL 2F54A 4JDVB 5JQHC 4YBHA 3O11A 2BSRA 4PJ9B 3G9AB 4E41D 1Q1JH 1UG9A 3N85L 1N59B 1MRCH 2WW8A 1URLA 3PP4H 3A6CH 4IS6B 3SKNB 1A7QL 1XGTB 5F7FA 5I18L 4AEIL 3U9UA 4Z7WA 2OI9B 5C07D 1CDYA 2R23A 2I27N 3CPLA 4YBQC 1JGLH 3SKMB 3TPUA 4LF3B 1K9TA 4WV1B 1RJZB 4MNHA 3ISWA 1HWGB 3MXWL 2R8SH 3HE6C 4NN7C 2PR4L 3EZ8A 3PL6C 4H5SB 5IROC 5M7QA 5I8KL 4FFVC 2VDKH 2ZCLH 4YC2B 4U1HB 3LRHA 4PJ7F 4KK8D 5BO1L 2ZUXA 4G8FA 4NQUA 4XMKL 1QFUL 2K7PA 1N0XH 5T1KD 3GSUB 3RUGF 2DWEB 3BN9D 3W0WE 3IAGC 2Q7YB 4RA3A 5FIEA 5BRZA 3QQ4A 4Y4FA 1Y6KR 3GK8H 4JG0H 5DUML 5HHNB 1T2XA 5FM5M 5BCAA 3IDXH 3LRSA 4KJWD 5CHNB 4BZ2L 5DHVH 1II4E 1H5BA 4TNWF 1JI2A 4HBQA 3V6OA 5D2NB 4WI8A 4KKAD 2KQMA 2PUQT 1I8LA 1HQRB 1EO8L 4IRSD 1OAYH 4NHCL 1LEIA 2VAAA 4DAGL 2FO1A 4JO1L 4ZUVA 3ZSTA 1F6LL 4JFPB 2VXUL 1CT8B 1VKXB 3GK8L 4JG0L 4PJGB 2JJSC 3SDAD 3VXSD 2P8LB 5HYQA 5BW7C 1MUJA 4N5EC 5CSGA 4WNQB 4XPBH 5HTSA 4K07A 1SJHA 1G9MC 4U1GC 1PW3A 4XPTH 1BGXL 1J8KA 1XF4A 2ILLA 3NFNA 5DUMH 5EOQH 3KDMA 5SWSD 1G9NL 1QPPA 4GXUN 4CDGC 2R0ZH 3HUJA 4HF5H 3P4OB 4NRYB 5DFTA 3QIUB 1KLFA 1YEFL 43CAB 4MS8C 4Y5YB 2GY5A 3SO5A 4P2OB 4ODSH 3BN3B 2MFNA 4I3GA 5F9OH 2AV7A 4QCIA 3X3FL 3KHOA 3WL9A 3F7PC 3MLTA 3HLAA 4CMMA 4HDIA 3JZ7A 2OZ4H 5C0DA 4M7LL 4ZFOB 2VZSA 2VSCA 3TIEA 3TNMA 3CXHJ 1UCBH 3W2DH 5C0CA 3SDDC 3SDYL 5CJ5A 2F54E 2HYMA 5JHLL 4LSUH 4CVWA 1B2WL 2R2BA 5EBMB 4CJ0A 4UZGA 4XX1E 1KB5L 1Y18A 1S7QA 1UXWB 1UH3A 1XF5B 3PV6B 4NKMA 1CFBA 3S36H 4O2EB 5ICYB 3V0VA 2YXMA 3U46A 1RJZA 4NQCA 1AHWA 1F11A 4JFDE 3KJ6L 4NM4H 2HKFL 4M7LH 3UTTA 3ULUD 5CZKA 4PG9B 2B8OT 1GSMA 1KELH 2H9GA 4WRLA 1NFIA 4C56B 3ARGD 5DEGA 3T0EC 4JY4B 5FDWB 5I16B 2ZJSL 4PGCB 1MCBA 4YNYA 3GHBL 3GMQB 4JFZL 1XF1A 5E9DA 2C9AA 3STZB 1Q9KB 1XFPA 5J11B 2R4RH 2FIKB 1TTFA 1MCIA 2AQ3A 5C0IA 1RU9H 1ZA6A 2WV3A 2NW3A 4I0CC 1G1YA 5L2JA 1BEYH 1AC6A 1FHGA 1S7RA 1U8IB 4QHKI 2XNAB 5J13C 1RMFH 4KHXH 1A9EA 3BKYL 4ONFL 5DJCB 3B5TA 1JHKL 2GSGB 3O2VH 7FABL 4FMKA 4MLIA 4I5BB 3Q5OA 1ZV5A 4QXTB 5EULV 4R3SA 4YEFA 4PJCF 5CIPA 1B88A 5H94B 2HJLB 3HA0A 3RWJA 3N9GH 4HWBL 3VFOA 3PF2A 2DMBA 1B0RA 5KVDH 3KYMB 3RX7A 2QADD 2CH8A 1NGPL 3O4LB 3PNWA 5T3XH 5KG9A 2A6KB 4HXBL 2MHAA 3RGVA 2ADIB 4L8DB 3QQ3A 2APXA 1MJJA 3EYOA 3EYFB 2XQBH 2ZCKH 4Q6IB 3FOMA 3AREC 2FR4B 1O7SA 5GSVB 4TVPD 2X9YA 3ARUA 1GOFA 2MCPH 4I0PD 5TDNB 4JFQA 3KPMA 4LVNC 4ODVL 3K4AA 2NR6D 4HZAA 3K2MC 4FFWD 5DF0A 4G9DA 4OLEA 1ZANL 1JGEA 2V5MA 2HFEA 2ZCLL 4XP9H 3JWOH 4N1CA 5IB4B 4N0YL 4IHOB 3GMLA 1NAKH 3ECBB 1G0XA 3BGAA 5D1XD 4HV8B 2HJFA 5C6TH 3E8UL 3ULVC 3O8XB 2H2PC 3QCVL 2AXGB 3FFCE 3ILPB 5CHNA 3LKNB 4Y4KC 2X4TB 2AEQH 5KVGL 5LQBH 5EA0L 2EH8H 4I4WB 4WI3A 2MQ3A 3NBNA 1QEWB 1F3DJ 4RNRA 4D9LH 2DQFB 3KWWA 2ICWB 4HIJA 1UM5L 5TE4L 3HUJF 3ET9F 1V8HA 2E6PA 4F7TB 3QUML 1NLBL 1U91A 2ZOLA 4MX7A 3S37X 4NO0D 1ZWIB 1DUZB 2JIXD 2XXCB 4YUEH 3DX8A 5C71A 1SY6H 1IEHA 1Q9WB 1S7UB 3CFEA 3IFOA 1YC7A 4WEBH 2CDFB 2IF7A 4QRSA 2VDRH 5D7JC 5I74B 1V3LA 1KIRB 5L0QC 1KJ2L 3JV4A 3VW3H 4MDJA 4U33A 3QUMH 2NY1B 1QVOB 2HTKD 3TO2A 2YPVL 3LQMA 4M62H 3TGXA 3P0YL 4QHMB 4XVSL 2P24B 3FB6A 3GBLA 1OTTD 1WIPA 2HLFD 3GMOA 1FJ1A 4TUOB 1N59A 1PG7X 1H0DB 4AH2B 4H25B 4QOKB 1PD6A 2CR6A 3CU7A 3PGDA 4O9HL 3BP4A 3E1F1 5C0RL 1KIPA 2EICA 4AM0A 1CS6A 2OZ4L 2IFGA 4G9FB 1NUNB 1KNOB 3VFGL 1ZEAL 5FK9A 2XZAL 2ICWI 1BAFH 3A67L 5DYOA 1AD0A 2P7TA 1QFWI 3LAFA 4WHDA 1CK0L 2F9BT 5SX5H 1RZFH 1XR9A 4E5XA 3VGGA 2VLRA 1JIBA 1H3XA 4JRXB 4OF7A 2EC9T 4N0FB 1A02N 1Q0YH 2B4CC 5F9WB 2FGWH 3PXHA 5GRJH 4UINL 4GBXB 2OYPA 5BS0D 4JFXB 4NPYB 1NLBH 3KLHC 2EIBA 1CGWA 3P3YA 5KVFL 5FOBA 3ZYOA 1HQ4B 3QUMA 4HC1H 5DMGD 1VB9A 3DVGB 3MXVL 5C07B 1C7TA 4OD1L 2E7BA 3ZDYF 5TDOA 3GSXA 3T09A 2XZAH 3DHMA 3H7LA 1WQVT 4K9EL 4HXAH 1FC1A 1DE4A 4KXZH 2X9XA 1T1WB 2DKUA 5EU3A 4C4KT 3D9AL 1F90L 1FQ9C 3U1SL 1HKFA 5I15H 4G5ZH 3O3AB 3RWIA 1U95A 2EYSA 4ISVA 3LVEA 1JNLH 1YMHA 3FHAA 4OV5B 3UYOD 1J86A 3M8OL 4BUGA 1IM3B 2A74A 1DQML 3T1FB 1FLRL 3B2VH 5FO9A 2LTQB 4OFKA 1PAMA 1NC2D 1IEBA 5SWZD 2DDQL 3WIFA 4JFPA 4HHAB 3G6JF 2EXWC 1G7QB 3P4MB 5FYKU 1KC5H 1IGFL 3MA7A 2XA3A 4GH7B 3WFCH 5EORL 2FZ3B 3BISA 2MCPL 2HRPL 3WNPA 4JGJA 1R3JA 2A6KA 2RGSA 4K7PL 5GRUL 3VWKA 2VO5A 1PKQA 1N64L 5GGTL 1S5HA 5JDSB 4K7FB 4LP4A 4APQA 3KPOA 3RBGA 4KROD 4I18B 2Q20A 1AE6H 2AXFA 3AAZA 3OXRB 4XNQB 5ESAA 2E9WA 5ID1A 2QTEA 3DETC 1M05B 3IJYB 5F70A 5FGRA 3QDJE 1Q0XL 4WVRA 4OZHB 2BVOB 4XBGB 5IQ9A 1H5BC 3JXAA 1LE9A 4G6FD 3BQUB 1WWWX 3ULVE 2OXGA 4IHOA 4P2QB 4LAJH 2CD0A 2R23B 2J8HA 2JCCF 2IQAA 3SDCD 1NUDA 4B41A 4LVHB 4XBPA 3L3OB 5I1LA 1LE9B 2EDWA 4C56A 2Q76A 1QFUH 3I6GA 4RWYH 4MAYD 4Y4KD 2VZVA 3NIDF 4HG4J 1R3LB 2Q8BL 5EU4B 5I1LB 1EA9C 4Y2OA 4RAHA 5CLTA 1CCZA 1HEZA 4AEHH 2VN4A 3SE4C 1IRAY 2D7MA 1HN1A 4KGLA 1A3QA 4I0KA 4IIQB 5ESVB 1RIVL 1FORH 3R0NA 3BP6A 3S5LG 2NR6C 2FBJL 1M7DB 4JJ5B 2EEBA 3VRLE 4IRSA 1MCOH 1AXTL 2SEBB 4R90L 3QRGL 4UTAH 2ZUVA 4MDIB 4XP5H 3V4PH 1EMTL 3UC0L 3WN5A 4RFNC 3B3IA 1PZ5B 2GTWB 1J0HA 2QSQA 3SDXE 4X0KB 5DUBA 3I3DA 4JM2B 2E3VA 3HR6A 1E27A 2AEPL 4WENB 1U8LB 5E2WL 3INUL 3CVIL 3TH3T 3DIFB 3I9GH 5CFHA 3MTRA 1S9YB 1FG9C 1WFTA 3WO4B 2PNDA 5IB5A 4L1DA 2QSVA 1FZJB 3MMEB 4ODTL 3BIKA 4OZIB 4KHTL 4MXWH 1T5XA 3QEHB 1A7OH 4A6YL 3RWEB 1T03L 1BQLL 1XF3A 1UYWH 3UPAA 3ZE1F 4IS6A 3SKNA 2ZSVA 2W92A 5GJSH 2PYEA 4KKCD 3T3ME 3VMPA 3HZMB 3QUXD 1CE1H 3IKCB 1HHGA 1U41A 2ED7A 5D1ZC 2AK4E 2XYCA 2BJMH 4OZHE 3EJZD 5D93C 2KDGA 5EC2B 4APQB 5GRVL 1QRND 1UT9A 3HNTH 1FFQA 3BP7A 3DVGA 3J7HA 5C07A 4JFDD 4N8VB 3BO8B 4ORGB 2EZ0C 3UTSD 4N0FA 1I9IL 4QHKJ 4HXAL 5KVFH 1KLUA 3GM0A 1OM3L 4J7RA 1A3RH 3MRBB 1FV1A 2ICWA 4HIJB 1KTDA 2F54D 3FB5A 3LPFA 4TSBH 5TE7H 3ZMRA 1WLHA 3RI5F 3GB7B 4PTUA 1LNUB 2VDLL 3A6OA 1RPQA 5E6IA 4GRWH 2NX5D 3H9YA 2ZCKL 3W0WD 1AFVH 3VMNA 3RZCB 4CNIA 4ZPTB 4XC3H 4U6XA 3UCRA 3KDMB 3V6OC 3MJ9L 1E0OB 4U1NA 5GIRA 4HIEA 3SDXA 2R4RL 3TO4C 1M6OA 4F33A 3G5YA 4NUGH 5F7YC 3JUZA 5F71A 4G8EA 4PGCA 4K3DH 2ADGB 4RFEB 1ZHBB 4BSVB 3MRQA 4HH9B 4NYLB 1TVHA 1PY9A 4PLKC 2FLBT 3PHQA 4MA1C 3U4EB 3RY6A 2IAMA 5DVMA 3VFNB 4ONFH 4GRWE 3TZVB 4M7LT 5TGBB 1A1OB 3I75A 3MREB 3WHE0 4X9GA 4XVTH 1KTLB 4A6YA 5CJXA 5D6CB 4FFWC 4WIQA 4O2CB 3U6RB 1KSRA 1X5FA 1NC2B 3BJLA 3VXOA 4OQ1A 2FRGP 2FX8H 4Y5XB 2GCYB 4ZXBC 2B2XL 1O7VA 1XGQA 3O3DB 5IVXA 3CDGA 4FQJL 2VC2L 4E42B 3PDDA 4I77H 4TQEL 4DKEL 2CMRL 2XKUA 3X3FH 3TA3D 3QDGE 1J1OH 5IG7A 1YY9C 1DBBL 2XKNB 1FBIH 4I48B 1TCMA 2RIKA 4GJTB 1BMGA 4JR9L 3OAZK 1CGVA 5B38A 2NY3C 2GY7B 3QA3B 4GRLB 4O2FA 4PJCB 1NGQH 3TYFA 4M48L 4I8DA 4OM0L 1D5ZB 2Z35B 4LDEB 3QIWD 4PJ5A 1RHHA 5JPNA 4ZDHA 2DIBA 3GSRB 2A6JA 4M6NH 3NIDE 3QCUH 4HWZA 2UWEB 3WJJA 1G9NC 1U8QA 5DMKA 4ZAKA 2MQCA 5F3HB 4ODWA 5C6TL 5LWYH 4PJFB 5FO8A 3MGOB 4PJIE 1CN4A 3ZKNC 3VDBA 3CCHA 4JB9L 5DMJB 5DRNA 4XBGA 4PG9A 1K4CB 5GGQH 4HUUB 5EBWB 1A14L 3G9VA 4TYUA 1NQBA 3L9RA 3AS2A 5JW5B 1KPVB 4X6EA 5EOCL 1YEEL 2XIDA 1J10A 1AR1C 4ZNCD 5I1AA 4R2GD 2O5XH 3KXFE 4LSRL 4YHPB 4BFIA 4K8RD 3EAKA 3NN8A 5E2JA 3IFLL 1T7WA 1FV1B 4LDLB 1P5VA 1DANT 3T0EA 5L2KD 1I3GL 4HPYH 3TBVB 4NT6A 3DGGA 3C87A 1SY6L 3GB7A 3PGFH 2RFXB 3IU3A 3L3IA 2AI0L 4P3WA 1T80A 1FG2A 4FFZL 2XWBB 3KYKL 1RZ8B 1CD0A 5FUCE 2RFXA 3IU3B 3L3IB 5SWSE 2H6PA 4NJAL 3BI9X 4KHTH 5CIPB 4WY7H 5E2TH 4RZCA 1KG0B 3BEWB 4DVBB 1MQ8A 2UZIL 1YEEH 4IMKA 5IHZB 1XMWA 4DKDC 3M45A 5B3JE 4M6ML 3LIZL 3C09C 1ZLWK 2FBJH 3HZVB 1IC7H 1D5IH 4LARH 4XB8A 4M48H 2DQTL 1D6VL 2V5RA 2P8PB 4YHIA 4NO5A 1J0YA 5FUOL 4DZ8B 4GUPB 1EMTH 1FL5A 1FVCB 3PWPD 3EJYC 3RPKA 3UC0H 4H26B 3BWAB 1KIUA 5E2TL 2VDML 5IB5B 1KPUA 4KJQC 2R0KL 4GKNA 4YIQB 1PLGL 1JF1B 2Y06L 3L3OA 4QRTB 5J8OA 1ZLVH 2LABA 4QYOB 1H3TA 5IVZB 5A40E 4YNYB 2AXHA 1RULH 3QEHA 2ZOKB 5MENE 3V8CA 4K55A 2HVKB 5EU6D 4NPYA 1OW0A 2V5SA 5IT2H 4XCEA 1OAUH 5C2BL 5GS1A 1KYOK 1UM6L 4FMFA 1N6UA 3LZFL 1WBZB 3RPIA 3GRWH 3MNVB 3MRGB 4NCC2 4S11A 1Q0YL 3QDJB 2RCSL 1F4WH 3TWCH 1IEAA 3PJSA 3O6FA 1OGAB 4WEMB 1S5IL 3LEYL 3BP6B 1QLFA 4EXKA 1AY1L 4U7MA 5FGBC 5GGVY 4NP4L 1CDUA 4LLDB 5JNYA 1OARH 4K71B 1NBZA 5D71L 4K8RC 1EEYB 5FFLA 2YD6A 3RUGE 4XMLL 3VI4F 3NFPA 3K3QA 2IEPA 3TN0C 5KZCD 1SY6A 3FT4B 4J3UA 1Q0XH 4EDWH 3OV6A 3T04D 8FABA 5L2KA 1Z3GL 4JO3H 1Z9LA 3T77A 1PKQE 5J0BA 3PHOA 4MXVF 3HAEG 3BPOB 1UB6A 2N56A 4GRWF 5DHXB 5D7IE 1U95B 4LLWB 1Q94B 2VAAB 2EIDA 1AH1A 1NMAH 2R1YA 1JWUA 4L9DA 1YEJL 5EG6C 2UYLA 2BNRA 4GKSB 5EZLB 1BECA 4G9DB 2D0FA 2GT9B 4QHUA 5DLMH 2DI8A 3S97C 1X5KA 5KSAD 1CVRA 1VERA 2ZWLT 3D2UB 4Z0BL 4S2SB 2NXYD 1QR1B 5FKPA 3GRWA 4K7FA 2HTLC 3QUZB 2FWOA 5DGRA 3TFKD 1FDLL 5DJDA 3SE9H 1VACA 5FUZL 1CL7L 5LXGL 4MB5A 1IJ9A 4CVXB 4UOW1 3OQ3B 1JYWA 4FRWA 3PV7A 4L4TE 2IADA 4PRPA 4W6YB 3LQZA 5DJ0B 2FD6H 4O58L 1T20A 1GGIH 3VWKB 3CX5J 4MAYC 2DD8H 1FYTB 3AY4A 1QBML 3LQZB 1NMAL 2I24N 2XQYG 1J1PH 5DJ0A 1KTDB 4DOHB 1OF2B 3K81A 3ZTJG 4EZMA 4F7TA 1RZJH 5CP7A 1V7NL 2WK2A 4IRJB 1CDCA 2P8MB 3BO8A 4CU6A 3G5VB 3K46A 5E08H 1T89C 5I30L 1F8TL 4U1SB 3QWRD 3ROLB 1J8HE 5KSAA 5DI8B 2A77L 1G7IB 4HJ0D 2QR0A 2VWEC 2H2PD 4KY1L 4NUJA 5TDPB 3V5HB 5IP4A 4FQJH 2J88H 5EBWA 2NTFA 3RWDB 5DFWH 1U92A 1RZJL 1NGWA 3Q3GB 1K6QL 4L3AA 1HKLH 4R4ND 2X44D 3DBXB 3MOBL 1UKQA 4LGRB 5C0RH 4U1JA 1F90H 3RVTD 4K2UH 1S9XA 4HKXA 4ZAKB 2AEWA 3O0RH 1HHIA 2EDTA 3QRGH 4OM0H 2JCCB 5HGHA 5JIPA 3N85H 3MA9L 4R7NA 5GZOC 2ZPKH 1CTOA 3QJHA 3QQ4B 4AYFA 5C07E 3HB3C 4U1MA 3OXSA 2F54B 4JDVA 4F2MA 3L5IA 4HCRA 3TYGH 2DQUL 5EO0B 1MLCA 2HN7B 2NXZC 2EDBA 3N06B 1DN2A 3QNYB 3P11L 3IAQA 3SE3A 3WFZA 4MD4B 2XN9E 1M1SA 5DO2D 3FQNA 4NQXB 4OZFA 2JJUA 3OL2A 4JRYB 3L3GA 3UTTE 5B3JF 1NL0H 5IBTL 4XT1C 1RUPH 4PP2A 1HWHB 3IFNH 3ZSSA 3D39B 5BV7L 3BHBB 3MBEB 2ED8A 3HMXL 6FABL 1NMCB 2BX5A 2KKQA 5EO1B 3ZE2E 3TVMC 2Y06H 3ZO0A 1J87A 2FBOJ 4H8WC 4PGBA 5HHOB 3LCYA 3SKMA 3TPUB 4ODUA 1HHGB 1KLGB 4NRYA 1NCBH 2VL4A 4HH8A 3G04A 4PRNB 3LD8C 2OR8A 3D3VB 3DVNB 3ELAT 3T8XA 1LMKA 3CD4A 4XB7A 4YHYC 3LH2L 1HXMA 4KI5D 4HBCL 1JFQH 5I0DA 5CP3H 4GKZB 3RDTA 2ZUQB 1A6TB 1MOEA 4P5TA 3WXVH 2UZIH 2DS4A 2IQAB 1F3DH 5DO2C 4LCCC 3O3EA 1A6UH 4X99B 1QUNA 2F74A 4AEIH 4CVZA 3CFJA 5BOPA 4MJ5B 3C6LB 1RUKH 1YPZA 4HK3J 3L3JA 4NC0B 4YHML 3TNMB 3D39E 2VLME 5DD1L 4O2EA 2YUXA 2VDLH 1IT9H 4DVRL 4P5TC 3KXFD 2A0LD 5CS7A 5HYEA 5JW4N 4OQTA 3DLQR 4IJ3C 2B5IC 2PXYD 4MVBD 4OTXH 4TUKL 1AHWC 1KCRH 4OZ4B 5C86A 2MSPA 4XWOC 4ZUTA 3V9FA 1RAMA 3EOTH 5C1MB 1AFVL 3NOIA 1AKJD 5DXWA 1BLNA 1MCFA 2AKRB 5LBSL 5TF1H 1MCNA 3TBVA 1OTTC 3QUKB 2MPAL 5KTEL 4EIGB 1WCQA 1DLHB 1SEBA 1GH7A 1WZ1H 4OV6F 3NN8B 2WQRA 4G6MH 1LO0L 4MS8D 4WV1C 3MRKB 1C5CL 4QRQB 1CF8L 4P23C 4OGYL 3VGAB 2R69L 1UXSA 1FDLH 3DUSA 4MWFA 2J5LB 3GNML 2QHLA 3DRQA 4RISH 4NZRH 1I7TA 3L3HB 5JTWA 1RJCA 1FIEA 4HK0A 3VW3L 3MRMA 3DUSB 2VZTA 4KTDL 5MERA 3QDGD 1LD9B 4KMLB 1K4DB 5CZXD 1CGXA 1CXIA 3OKNA 4U1KA 4FZ8H 4C58B 1VKXA 3WFBH 3C60B 5IFJA 4PGZA 2OJEA 3GMPA 5E4EB 3STLB 5K9KB 2E7LC 2HG5A 2VC2H 3AROA 4NOBA 3IFLH 4XCNB 3H3KA 1R3HA 4S0TD 2NPLX 2VDKL 1X4YA 1WV7T 4RGND 4NQXA 4OZFB 1OP5K 5JLZA 4XP5L 5ESVA 3BKJH 3TV3L 2X4QB 1ZEAH 3QDJD 1C1EL 2XACC 3FKUS 4APQD 4NQCE 5IMMB 1IGIH 4E5XB 1OGAA 5J9PA 1TPXB 3ARBC 1G7HB 3C9NB 5C0FA 4X6FA 4K8RH 2X4QA 3T3PF 3W39A 2GAZA 4NKQB 3MNVA 3VFPA 5GGUA 1BREA 3R06B 4E41B 3F12B 1HSBA 32C2B 3OAUH 4YQXL 2C3XA 4WFHE 1LEGA 1CXLA 3ARFC 3HI5L 3S4SA 3KYNA 2BHYA 4GRWB 4F2MB 5J6HA 5KSUA 4Z7UB 1A5FL 4WW2F 2ZNXA 1T5WA 5FGCB 4Y5YC 5FECA 1CFNB 4ZS7H 1GGTA 3G5XB 3THML 1YEDB 4LVOB 4NQEB 5DQDH 3ARDC 4PB9L 1JJUA 4G8EB 4M1DL 1UEMA 2EH7H 2XTLA 3TT1L 3VU2A 1ERNA 1T1XB 4U0RB 5FV1L 3TYGL 4JPVL 4X9IA 3DX8B 2DBJA 1A3LH 1RZFL 3C08H 1TQCC 3FFDA 4RZCB 2F8XC 2Y9RT 4K3EH 1CXKA 1TQBB 4PV9A 1MELA 4LPUA 3DMMB 5T33L 1KOAA 4JJHA 5GS1C 3GSQB 3VFMA 2VLJA 2NMSA 3L3GB 4X9HA 4CADA 3WDHA 4NFCA 4UT7L 3GI9H 1GC1C 1B4JH 3E8UH 4ZUUA 4GQPH 2ZUWA 3RVWD 4BZ1L 1KLUB 1OCWH 5FYKH 1NFKA 3MRHA 4JG1L 3GSNL 5DFVD 5IK3A 4DWHA 2DQIL 3T3MF 4AIZB 4UV4L 1U8PB 3ARYA 3L7FB 4G7VL 5DD0L 3T4YA 1JZ4A 3CXHK 5DJ6A 5FA4A 4MJ5A 3MRCA 5HYJB 2D4FA 4LCYB 3VCLB 4M62L 2X4UA 4WO4A 3JTSB 4RGNB 5F6IC 9CGTA 1JBJA 4QHLA 2A6IA 5ENWA 5GJTH 3AB0C 1ZTXL 4GKZA 4OFVA 5ETUB 2MNUA 4YHNB 3RVUC 2PYED 4Z8FH 3PWPB 3C6SB 5D2LF 3TIDB 3RNKA 4XHQA 1B4JL 5JXAH 1G9MH 5IR1B 4PRNA 3KPLA 3LMJH 3DRTB 1JYVA 5TDPA 3V5HA 5CSBA 2DICA 4R97B 5T3XD 2E9IA 1U9KA 4JG1H 3VFGH 4L4VE 4C54A 4ORZC 1SBSH 3PIQB 4XXCC 5KVEL 4LLVA 3V2AR 3SE9L 3BE1H 1DVFC 2PXYC 4KU1A 4MVBC 5AZEH 3VFRB 1G7HA 3EIFA 1ZSDA 2X1XR 3BKYH 3ARVA 2ERJC 3K2UL 1C5CH 3IB4A 2Z0BA 2NY0D 5JUEL 5F7EL 5F89B 5SX4I 2BNRE 2FGWL 3ESVF 2ZKHH 3O2VL 5F3BB 3EYUH 4P57A 2APWA 3EZJB 2HN7A 3O4OC 4W6XB 3FTGB 4X7TA 3ZHKA 4R4FL 1HHKB 4XWGH 4XPAL 4N8VG 5C0ND 3UZEA 1JRHH 2SEBA 4PJBB 4CGTA 1G6RH 4I5BA 3MOQA 2QQLL 3RKDD 3B9KC 3HG1D 4P5MA 4TNVK 1IGCH 4QXTA 4H25A 1MVUA 5DEZA 4PRHB 5JR1L 1M7XA 1JYXA 4FP8L 4CN1A 5IWLA 1BGXH 5CSZB 3ULVD 3ZZ1A 1R3IH 1HHHA 3O8XC 2FL5B 3I75B 3D69A 4YK4C 3DI2B 3EGSB 3EYUL 1JP5A 5FYLD 5E99H 5HDQL 3ARQA 4ETQB 4UQ2A 5IBLD 4JPWL 2XTJB 2IBZX 3GSNA 2PYFA 2APFA 2AEPH 2B1AH 5IFAL 1YEGH 4M6MH 1KBGH 3D85D 2X1OA 3O81A 1BFSA 3PDOB 3VXUD 3MQIA 5JOPD 3BN9C 5T3ZH 3MCKA 4JEGB 4K2UL 5HGDB 3DVNA 3BZEB 4G6KL 5CD5D 2BHZA 2CKBH 3IDUA 3W11D 4OZGA 3RDTC 5GS0D 2AJSL 1G7PB 5D7KE 2GAZB 3FQWA 5KANI 3SJVE 1FH5L 4LCCA 4M6OH 3KPQA 4K3GA 5EC1B 4RCAA 3RX5A 4Z7OE 3MOAL 3QG7L 2IFFL 4ZUUB 3DMMD 3PE9A 4QKXB 2B20A 1LEKA 4ZSOB 1MEXH 4EUPG 2R56L 1RVFL 2RAMA 4ZTPH 1BHGA 4KQ3L 5E2VL 1OAZL 4PR5A 3KYKH 3VWKD 3GFUA 1CBVH 4L8SB 4P2OD 4U6HA 3WEXA 1B0WA 3B2VL 3TBWA 3RJDA 1QSZA 1JPTH 4LCUB 3CMOL 4ENEC 5GGQL 2VJXA 4NC1C 1I3VA 4MA3B 1IM9B 4WI7A 4GXVL 1IZKA 4KTYA 4WHYH 2F53D 3RTQA 2J6EH 2WUCH 5FO9B 3BKCH 3QUYC 1EDQA 3CMGA 4KK9C 5FYJU 4U6YB 5MEOA 4PLJC 4PJ7A 1LO5B 5FYLL 3LQAC 1F42A 3SGKC 5FKAB 1JVKA 4U6TA 4L3CA 3ARGB 3P9LA 3HTLX 4RMUA 3ZKQD 4OCLC 2X70A 3KYOA 1HYSC 2VLRE 3MJGX 5EZOL 5C09E 5C0CE 4LHQB 1CGYA 3O6KL 4Z76A 3BKMH 4PTTB 3NPSC 1CICC 4WGVB 1P9MC 2G60H 1IKFH 3UBXA 4NN6B 1CFQB 3WLBB 2HWZL 2Q7NA 3FO1A 3HC0A 3RHWK 4OSUL 1E6OH 3ZT6A 4AIZA 1Y0LB 4QGYA 1J0KA 4ZQKB 1KJ2B 4RFOH 5LJYH 2E7HA 4C56E 3KPRB 5HBBA 2BY2A 4XMPH 5DUBB 1PG7L 4ZS7L 5F88B 4LOUC 5HHOA 4L4JA 1S3KL 3DO7A 2P43B 1FLRH 5ACLA 5H35A 4MA7L 2VITB 3CUPB 4OF3A 4WFED 5I8OH 4YZFF 5GGRA 5BS0A 4QTIH 3EOYG 1DBMH 5IW6B 4GW1A 2J3SA 4MJIA 3QDJA 2HH0L 1H8SA 3O6FB 3DMMA 1P9MA 4JFDB 4RQQB 5CJQL 3QXVA 4FN0A 4ZOAA 5F21B 3BD5A 5HI5D 3VRJB 1S8DB 5FM5O 1DQJB 3SJVB 1U3YA 3SCMC 2W9DH 2YOCA 4H1LB 1UCTA 4DCQB 4F7MA 2D7NA 1T22A 2C3WA 1NCCH 5DURD 1GVIA 2VDNH 4M9OA 5CILH 1EFXB 4D9RD 4LBEA 3CK0H 1SVCP 3UP1A 5I1CL 4YHOL 1WBZA 4LEOA 2Q8AH 5JHDB 2CUHA 5DZNA 4JFYB 1ONQA 4NKIH 5JZ7D 4HS3A 1JMXA 4EVNA 5C0BE 1TFHA 3O45A 1GZQA 5EUOA 1WWBX 5C3LD 4H1LG 5GGSA 1KCUL 3X3GH 4IRSC 4AIXA 1VEMA 5DMKB 4KTEH 5DQ9A 4PLJD 5DZLA 2DJ4A 4BH7A 3RL2B 2Y07L 2NCMA 2EIZB 1NBYA 4BFBD 1J18A 1MVUB 1AGCA 4YXLH 3SDAA 3VXSA 1LILA 5E6IB 4YDIL 2JE8A 1CQYA 4N8CH 3U30B 2LAAA 2X89D 5HD8C 3HG1A 1LNUA 1GXEA 5EO9A 1E6OL 2R2BB 5EBMA 4TRPL 3NH7L 1INQA 2DYPB 5I0ZA 3BH8B 3UDWC 1QBAA 1KPRA 3H3PL 5E94A 1WC7A 2G5RA 3MYZA 1EEZB 1F58H 2MPAH 3NCJH 1R24B 1YQVL 4W70A 4UT9L 6CGTA 1CE1L 5HI3C 1JGUL 5DUPH 1FNLA 4BJLA 5IKCA 4DAGH 3MA7B 1F13A 1Z0NA 3GI8L 4X8XA 2QQKL 5EOCJ 1XAUA 3CGTA 2MTPA 4MJ6A 3HB3D 4L8CB 4GO6B 3IKCA 3UBXB 5F7KC 3AVEA 4U1KB 3HE7B 3F7RA 3VFTB 3SPVB 1XGPA 4QRRD 4Z7VB 5IF0B 4CMHB 1B0GB 1IQWL 5C7XH 3KLAB 5IEKA 2CLRB 3ZHLA 5EBLB 2GJJA 2ZZUT 5IB1A 5J12B 3ALPA 2EDLA 2H3NA 4XRCB 4FXGA 4LCWB 43C9B 5EU6B 3NZ8B 3G04B 4LIQL 4U1LA 1IKNA 4FTVD 4MNQB 2BVPB 2DLFL 4LSRH 4IDJL 1WWCA 4H88L 1P4BL 3H9ZA 3MRIB 5DUPL 4OZIA 3F7VB 5A43C 43C9A 1FGVH 5FA4B 3HE6A 5HGGS 4PD4J 4WO4D 5DD3H 5DJZA 5J7CC 2MWCA 4ODXA 2GTZA 3EYVA 4W6WB 3MRJB 2XFXA 3MLRL 5C70A 4LGPB 4PREB 5HHOE 3UTZB 5FCSH 3RA7L 3MNWA 4HZLB 4EI5B 1S7VA 5C0GB 2UWEE 4GXVH 4RMRA 1HSBB 3E6FB 5DD6B 2VDQL 2BNUB 3CMOH 5DDHB 5I15L 3MXVH 4HIXH 1JHLH 3ZDXE 4QXUH 1H9VA 1FBIL 5IMMA 2EDKA 3M1BB 2AK1L 2IH1B 4P57B 2R1WB 2XG4A 1WIOA 3TT1H 3VWJB 3B3IB 2GSGA 2ZG2A 1YEHL 4DGVL 3VXQA 3T65B 1PQZA 1BVKB 4WWKC 5BZWB 1MI5D 1OAKH 3VFNA 4PRBB 5E2WH 1KPVA 3B5GA 4UINH 4LSSL 2BOCB 3VXOB 5L8KB 3SDAB 3VXSB 3ZDZE 1YEDA 4ZYKB 4Y4FC 5CZVH 3K7UA 3T0EE 2VXVL 2NTSP 2VKXA 5IMKA 3LHPL 3FQRB 4MXVE 3D6GA 1JE6A 3KLHD 1S9VB 4Q7DA 2C7UB 4OB5L 4F33B 4OT1H 5DJAA 1ZHLB 3ARGA 3MO1A 3MGTA 3FQTA 4LPTA 4NQDD 3ALXA 4K7PH 5GRUH 2OP4L 1JTPA 2GFBB 4Q0XL 3O3BA 5ESQB 3QT2A 4G80A 4D0DA 4DTGL 1OTUC 3BEWA 5CJQH 3JV0A 4GRLA 3BIBX 3C5SA 4YZFE 3WV0A 1AGEA 4BQCA 1S7TA 3LHPH 5FHAH 3IDNA 1SM3H 1OGAD 4XH2B 3DURA 5LCVH 2GI7A 3TF7C 4HF5L 1YY8B 3PP4L 1VGEH 1F4WL 1ZANH 4PJXF 1A9BB 4TVPE 4E41E 4PJGF 4P2RD 1AC0A 5M95B 3IJHA 3WJJC 1MJUH 2VZ3A 4G7VH 3NA9H 1T3FB 1IL1A 3WE6A 1JI1A 2WMPA 3QUXC 3EBAA 2CO7B 1ZTXH 2QV2A 3U0PB 5IESL 2O61A 3WHXA 5A1AA 1G6RB 3BWUC 3T2PA 5EWIL 1U58A 3LEXB 1TVBB 4DGYH 5C0JB 2GSIA 1IBGL 3L9RB 4PY7A 1NBQA 4D9LL 2R69H 1KB5H 2YEZB 4JQXC 4LCWD 2BDNL 2EDQA 4JM4L 4U3CA 4OBSA 4PJHB 5E8EB 2DQDL 4CN6A 4PJ7B 1UJ3A 5TE4H 1A22B 3F7VA 3MSPA 3ME0A 3IDJA 3KPLB 4YPGB 1X5IA 2VTFA 1LP9A 2ARJB 1B90A 4XCCL 4LEOB 5B39A 1RJYA 4KJYA 2GYSA 4DEPB 5DLML 4ELMF 2PCPB 3LN4A 3MCLH 4RGMC 1FAIH 5MEOB 4RIRB 4TUKH 3DI3B 4LHUA 1EEYA 1UENA 2PKDA 3HE7A 5E5MB 4PPTA 5DQJB 1P1ZB 3X11A 4ZTPL 5MHSD 4LRNL 2Z4QA 4Y4FD 5BRZD 1OVZA 1R5WA 1EEQA 4BA8A 1YNKL 4QGTA 3DSFH 4L4VA 1MCPH 4XBEL 4LLUA 5GGRB 5BS0B 4Y5XA 1WTGT 1MFAL 1U8JB 3QDHA 4UT7H 2YD1A 3A0OA 1AD0B 2P7TB 3CVHB 3VMOA 3L95B 4JFEA 2W38A 2CKBL 4FQHA 3VXMA 1IAKB 4TULL 5C0AB 5A16B 4HUKB 2H8PB 3GSVA 3P9MA 4M7ZC 1XCQB 4FA8A 1KFAH 2PTVA 3V4VL 4UB0H 5D72H 4MNHB 3ZE2F 2F58H 4X5LA 1CLYL 5E8PA 3MLYL 3V4PL 2AJXL 2XZQL 3QR2A 3S3PA 5F1NB 1BQSA 4X6CF 3KPPA 2NY0C 4Y4KB 5FK9B 1FGNL 1BWMA 5DSCA 1ZGLA 3NA4A 2CUMA 4S0SD 1YA5A 5C8JA 3CDCA 4NBYB 1U8QB 3EOBB 3DYOA 1U0QA 4JDZA 2CPCA 3HZVA 4HS3B 3ARTA 3GSRA 1NCBL 3O45B 4YWGL 5ERWB 4UILL 3PWPA 3B9EA 1CGSH 4L9LA 4ZOBA 3V0VB 3SKJL 4EJ1C 1UVQB 5JA8B 1TJHL 3GKZA 1OAZH 1I8MA 3BDXA 3VA2C 4KUZH 3KPOB 5FOBB 2AV1A 3UDWA 1IAIL 4LNRB 2BY0A 3GMMA 3BGMB 1NMBL 3OHXA 5C09B 1VFBB 2DMKA 5D7JB 4O9HH 1EHNA 1DZBA 2AEQL 5KVGH 4JN1L 4X4ZA 1J1XL 4U2ZA 1QKZH 4WFFE 1F4HA 3K2UH 2NY1C 2H6PB 4C4KO 1QO3A 1CDJA 3W9EB 3MR9A 1T04B 2X4NB 1O5DT 4GW4A 5CD3B 4OZ4A 4HHAA 5F3BA 1S7SA 2HJKA 1H15A 3GBNL 3LEYH 5JOPE 1OP9A 2CIIB 3T0ED 5CD5C 4Y5YA 5CZVL 1HXYB 3CLEL 1IGJA 3NCEB 2ARWA 3QWQB 3WUWB 4L5FL 1MHEA 1Q1JL 1IM3A 3TZVA 4L4TB 1XIWB 1AJ7H 3SCMA 3HN3A 5I1DB 2FHFA 3K1KC 4ETYA 1MUJB 4WNQA 1BPVA 4PTTA 3H42L 1I3UA 1NCTA 5TJWK 3VD9A 4F8TA 3CLEH 4OLUH 2WLZA 4GRMB 4FXGB 4LCWA 3F5WB 1NGYB 3HC4L 3GUTA 3BRDA 3QWRA 4NZJA 1ZLSH 5I30H 1IT9L 1FSKC 3RP1A 2EDHA 1LE5A 5MI0C 5IBUG 3D9AH 3DVFA 1PZUB 1R6VA 1LK3H 3QIWA 4PJ5D 4X7FC 2FHCA 1U8NA 1E4KC 3FN3A 4HG4K 5EZJA 3DX9A 5DJ6B 5TQ2H 4XP6L 3DWTA 4XXCA 2XY1A 4OJFL 4R9HA 4XAKD 1QP1A 3L7EA 5D5ME 2FLRT 2XT1B 5DHVB 2IGFL 5ISZB 1G7MB 1VFOA 4HUWB 2WLYA 4KRNA 3TBTA 2VH5H 1U93A 1EO8H 1KCUH 5D1QB 3FZUC 4GQ9L 3QXAA 1IILE 1KGCE 3KPTA 1LDSA 2F8OA 1CDHA 1CFVL 2VRAA 4PJIF 1IC4H 4U4BA 5JOEA 2OMNA 4Z8FL 5GZOD 1G7LB 3VDAA 3JSSA 5DMYA 2ZSWA 4WW1A 1I8LC 1Q38A 1OAXL 1PDKA 1AD9A 5T5NF 4XC1L 1QLEH 3D85B 1KV3A 4PYGA 5IBTH 4OJFH 1ZGLM 3K1DA 4MHHG 3RAJL 4NDMA 2C26A 5DVLA 3EUUA 4MQTB 5EA0H 3OAUL 2H1PH 4DGIL 1AIFA 5D7LB 4L3EE 4ZYKA 5D5MB 1KIRA 1U8OB 5B21A 1I4FA 5J6GB 3Q5TA 1J0JA 1KIQB 3VXMB 1JZ7A 4XCYB 5M94B 1KXVC 1NCWH 2R9HD 2H8PA 3GSVB 4Z95L 5E7BA 4L8DA 1KFAL 4QHMA 4X7CC 1S8DA 2VQUA 4PJXB 1SEBB 4X4XB 2WP3T 3T0WA 5I75B 2YN5A 1G7JA 2ADFH 3QBTB 3OKDB 1QRNB 4XPHL 1KEGH 4EQ3A 1SJXA 2P4AB 5BZDA 3O6FD 3MLTB 1IGFH 4XVJL 3LY6A 1KF9B 2HFTA 3N1PC 1P7HL 1IC5L 1L9MA 4F7PB 2X4TA 5C0BD 1DANU 4OGXL 4HKJB 1T0PB 4JY6A 2ADJB 4UUJB 1A6PA 5MERB 1RULL 2DQFA 3P0GB 3TJEH 1AE6L 3X13B 1FZKA 4J3WA 4F3FB 5C2UB 1S7XA 4FZEH 4Y5VB 3QUXA 2WZPD 5F44A 3U7WH 1OWWA 4P59H 4PP1C 2HFEB 2CK0L 1ZXQA 5E8EA 5K9JH 4Y5VA 3IDXL 1N4XL 1V05A 3C6SA 5IGXH 4FNLH 5HXMA 3I6LD 4U1NB 5GIRB 1JNJA 1MIML 3VXMD 3WUWG 3B9AA 1F6FB 5CBEA 1V5JA 1RK1A 2EKSB 3U46B 3QUKA 1XT5A 3L5WB 2EDNA 1YJDH 4UU9A 3ZDYE 4QY8A 3ZT5A 1EBAA 3TVMB 1WBYA 4X8JA 4HEME 35C8H 5DMIL 2AJZA 1A7BA 4H0IA 4RAUA 3NCCB 1T04A 1Z3GH 2P5WB 1GGBL 2EXYC 1HH6B 5I1IH 2BNQE 1FNSH 25C8L 1E4WH 2CIIA 3B2UC 3JV6B 2GTWA 4G6JH 4LHUD 1DQDH 1WBXB 1WC7B 4LAQH 3O9WA 5GHWL 2O93L 2X89A 1P53A 1NC4A 2GK0A 3VXME 3V4UH 5CCKL 1FFNA 4F7EA 5FUZH 4JZJC 4YHKH 4D94A 3QJFA 3G6JE 4JREC 3Q48A 1XZ0B 3GI8H 1GC1L 4OV5A 4JDTH 3C60A 4F8QA 5IJKC 1HXMB 2D7PA 3QEQB 4NM8H 3CLFH 3WDIA 3TA3C 1C1EH 3O41A 5JR1H 1T66D 1UA6H 3OX8B 4P5TB 1MPAH 3P0VL 3IDMB 4GKOA 4Y4KA 5L88H 2CDEB 4K3JL 2H2SC 2BC4A 1FN4A 1WSST 2Y5EA 5I1GL 4R7DB 3GEWB 3C5JA 3IJYA 2GKIA 5GSVA 1JTOA 5J9PB 1YUHB 4CU8A 5JUEH 5GISL 3WBDA 2FCBA 5ILTH 1AQDA 2WBJA 4N5UA 1U8HA 4DKAA 2D03L 4YAQB 1S5HB 4J12A 1LVEA 1VFMA 1K3ZA 2L7UA 3W81A 1DBBH 32C2A 4WTZA 1MHHB 1C5BH 3ZYZA 3ULVF 3VRIA 3EDEA 5GS0H 5GGUB 3F8UB 4NN5B 5F8RC 5A2FA 2E9BA 4OI9A 5HYSG 5LGJB 2DIJA 1ZVYA 4AENA 3QQNA 1D3CA 3D0LB 3A6BL 1BIIB 5EDXA 2Q8AL 2CJUH 2HKHL 4GW5A 5E24E 1ZT1B 3QULB 2BY1A 4FQCL 5ICXB 3MRBA 3HCVB 4TULH 3BMWA 3T0EB 3CFBA 3BW9A 4H5SA 4DGIH 3ZL4L 2P5ED 1DDHB 4QYOA 3WIIH 2VE6B 1QEWA 4RNRB 5BRZE 1QA9B 1A1MB 4BSWA 2A9MH 4XNUL 3T2QA 5SWZA 3O3BB 1F97A 2BSED 5K9QI 2L4OA 3OTTA 3V7AE 2X4OB 3LQAL 3VJ6A 2A2QT 2NY1D 4BSVA 4KROC 3TN0A 3GMQA 3MJ9H 3PDGA 3CSYB 1P6FA 3SBWA 3GSNH 1JWSA 1DL7H 2XZCH 1QFWM 4NUGL 5E8DL 5CJOL 5I9QB 1YEFH 3SDXF 2R0LL 1PEZA 3MV7E 5FAAA 1G0YR 4GRMA 3MRQB 4FZ8L 1TZHB 3IF1B 4YUEL 4YHIB 2F53A 1FNEB 1CYGA 1JGVH 5E8OB 4B5EA 1TPXC 4MJ2A 2Q86B 3AXLB 3OXRA 3UTOA 4ZFFA 5HHMD 2VERN 4OT1L 2O61B 1Z9SA 3NCJL 3R1GL 3MJ8A 3OG6B 1IKFL 4G43B 5I6XC 3H9SB 5D9SB 4JRXA 5F7HA 3VGBA 5GS2D 2GJZA 2WIIA 2HLAA 2XOTA 4HT1H 1KB9J 2G2RA 3MUGA 5KVMC 2CRYA 3HNVL 5I8EA 4WUUE 4Q74A 1T1ZB 2YPLD 4AK1A 2XA8L 1TXKA 5GRWA 5J11C 1CGTA 3UTSA 2DN7A 3K80A 2WUBL 4ZUWA 3GSQA 2YWZA 3O3DA 5IVXB 5GGVL 3VFMB 8CGTA 1R3IL 1L9NA 1X5ZA 5EZJB 1N7ML 1EGJH 4R8WH 5GZND 5IV2B 2VQ1A 4PLOB 5EOTB 4GG6B 5EBGA 3LKPA 2IALB 2VUOA 3C8DA 4QRUB 5GJSL 3PWLB 4HLZG 4XPHH 1KEGL 4UTBH 4FXKA 1XH3A 5D1XC 4K94C 3Q6FA 3MRPB 4V1DB 1I7UB 5DD1H 4WU5B 2BVTA 4NQDB 4FABL 3H3BC 4HGWB 3D85A 3RWFA 1MAKA 3T0AA 2HTLD 1NDMA 3V5KB 5KW9H 4KH2A 5K33A 2YUVA 1RURH 5C0NC 5KSUB 5I19L 1NSNH 3DIFA 5K59F 3CFIC 4M8QA 2WAHA 1LO2L 1XF5A 3QHZL 5IJVB 4LKXA 1F3JA 1T4KA 4MQXD 3V0WL 4JM2A 2LVEA 1Z5LB 3BIKB 2WM0A 4EUPH 4BQ6A 5AYUH 5I8OL 3ARZA 4OZIE 3S35L 3UTTB 3B43A 1KULA 1X5HA 1INEL 1SMAA 4P9HL 1MCDA 2FJFA 3VRLF 1DDHA 2HRPH 4LCIH 3N0PB 3V6ZA 2NW2A 2CGRH 5I19H 3SE8L 1N5YL 3LSOB 4XC3L 4NZUH 2EC9U 1YEHH 1FC2D 4NO0A 5JDSA 4JAMB 4CJ1A 5EUOE 1P1ZA 3JVGC 3RWHB 4D3CH 1HYSD 4NO0B 4NZRL 5F89A 1CXEA 1K5NB 2MMXA 5D7IA 1RZIB 3FJTA 3GGWB 4F15C 4K3JH 5DD0H 1DLFL 4QXWA 1HOCA 3MLWL 3PWUB 2YZ8A 4ZODA 4H26A 2JCCA 5HGHB 2VZ1A 2OJEB 3GMPB 3STLA 3LKRB 2W0FA 1UACL 3GZKA 5IMOA 5IOPB 1DVFB 5D1QD 4TNWK 3KLSA 5J3HC 4P46D 3VXPB 5IR1A 3OGCB 4PJXE 3MLYH 3O6LL 5DTFA 1UGNA 2QQQA 2ZSVB 4MD5B 1JF1A 3I2CH 4KZEH 1IGIL 4YXHH 3SOBL 4HFUH 3JVGA 1BZ7B 1BVZA 2W9LA 4GUPA 4JY5H 3U2SA 3EO0A 1MRFH 4EN3B 3MLVH 2Y07H 5H2BA 1G7IA 2QR0B 4OBRA 1NPUA 4MA3A 4XTRD 5IM7B 4F3FA 4PLNC 1J1OL 3IU4L 4ZO7A 1CDIA 2MOVA 1DN0A 1DQLL 4HKZA 3SDCB 4JKWA 4ZPTA 1A2YB 4YHMH 3T3PE 2EECA 4S1DD 4LRNH 4WCYH 4KY1H 2F5AL 2YSSB 2Z8VC 4DZBB 4DVRH 2Q87A 3SJVD 2HFFA 1QZ1A 3JWOC 1RUQH 3T0DA 4GFTB 2R4SL 4JFXA 1DQMH 1YN6A 4LRIA 4OLXL 1EV2E 1X4XA 3FN0H 1A14H 1MI5B 3DO3A 4O02L 1U42A 4UOJA 3IU4H 1KT2A 4N9OB 4WU7B 5FYJL 2IBZY 1CXFA 4HIHB 1WCBB 4I13B 3Q1SL 3S3SA 1MRFL 2I60L 3VD3A 3QNXB 2OTUB 4GSDL 4BZ2H 1Y0LA 1GGIL 2NY5C 3V6FA 3UTQB 3AMLA 4FS0A 5D6CA 4R2GB 3V7AG 4Z18A 4X98B 3C6LA 4LKXB 4J3XA 4XCYA 3C6LD 3K4DA 4ZOEA 1JPGA 3DHJA 5HGBA 1OAYL 4NHCH 3QUZC 5SX4H 3MCKB 1XGRB 4OLVH 3MMEA 2OTPA 5FYJE 4YWGH 1OGTB 5CEZL 2ZP0T 4KV5F 4ZPVA 3OKKA 3LDBB 2CDEA 4IDJH 3RWEA 5EUKA 5FKAA 1ADQH 3HPJA 5F7LB 3EOAB 1SJVA 4OD2A 1J12A 2A6DA 2HT4D 1BQHG 3P77B 1QRKA 3UTTD 4KKAC 1C8PA 2XN9D 3SJVA 2EDJA 5HDBE 2XA8H 3LKPB 1INDL 1J05B 4TPRH 3GSUA 4XCFH 4M02A 2P45B 1YN7A 1CLZH 4HDIB 2Q8BH 3W2DL 2MJWA 4Y16B 1OT1A 3SGDH 4E0RB 1VFBA 2P46B 4QRRB 3UJTH 4ZOCA 2WWKT 3NACH 5KW9L 1EVUA 1AQDB 2WBJB 5I71B 5B8CC 4HSQA 4BQBA 1OWRM 4J1UB 1MJ7H 4JCMA 4PJEA 1U8OA 1AXIB 5C0BB 2PW1A 3QPQC 4HMDA 3MUJA 4HGWA 3AY4C 3ILPA 1F45A 3FHQA 1S7VB 5C0GA 3KPSE 2DIAA 5SWSA 1G9EA 3H7BA 1HHJA 4JVUA 1J5OL 3WDJA 1S9XB 3AC0A 1CU4H 4L3CB 1L7TH 1MQKH 5D6DA 5D8JH 4XC1H 1I9RH 4ZTOL 4OCXL 1JK8A 2ZKHL 2NTFB 3RWDA 2NXZB 4M93C 3CXDH 3IDJB 4NDMB 2CDFA 3R8BB 1I7UA 4XNYL 5GJTL 1UZ8B 1TDQA 3IFPB 3SGDI 5BJTA 1M6OB 2DI9A 2X40A 5DC9B 4LFHG 3GBNH 4PLKD 1QVOA 1HOCB 4RFNB 1CFSA 1DLHA 4D9QE 4WUUD 2J2ZA 1I9EA 2HFFB 1JHLL 2JIXA 5GXBB 1KTRL 4PRDA 4NT6B 4OGYH 4JM2C 1HINH 3I02A 5DJ2B 2VDPL 2OCFD 3TCLB 3I50H 4BK4A 3GNMH 5DRZB 3CXDL 4GMTH 3KYMA 1WGOA 4Z7QF 1LP9E 4PJIA 3X11B 1A6ZA 4G42B 3WS6C 4WHTA 5D8JL 5DRZA 1ADQA 2HVJB 5DS8A 4KWUA 2GJZB 1AR1D 1MFDL 4YHZH 1M7IB 1NEZG 3P4OA 5DZOA 1AGFB 3CSPA 1CVSC 2YHGA 3ES6A 5JQ6H 3C5ZB 1YEIL 3MV7B 1A6VH 1DSFL 1HE7A 3QQ9D 2HMIC 3TH2T 5DYOB 1CFTB 4JQVA 4YE4H 2VZOA 2M1KA 3HE6B 3MFFA 4NNYA 2VLKE 5J1SC 4WDIA 5CMAA 1NAKL 5D1XA 5EOCH 4UU9B 2YC1B 1U8NB 4YDJB 2Z91B 3VXNB 4G80B 1FL3B 4D0DB 5E5UB 1TLKA 2IJ0C 3G6AA 1RD6A 1ACZA 4PG2C 1P7KA 3CVHL 1D9KB 5I66A 5D5MF 4QRRE 4APQC 1HIMH 4HQQL 4LOUD 3UBXG 2Q1EA 4PBVC 4O2FB 2AJXH 1B0GA 4WI6A 4IJ3B 1T7VA 3B2UD 4M5YH 1YC8A 4XVUD 2P5WE 4LSDA 4LSQH 1O0VA 3WNKA 2YPLA 4EVNB 4PJ5B 5JPNB 3ZYJA 1MCOL 4YQXH 4X6DE 4HLZH 3RGVD 5T1MB 3KYAA 4OZGF 3UAJD 1U8PA 1EXUA 1FORL 4JRXD 3BP5B 2YD4A 1OY3B 4PBWD 4J4PD 3HE7C 4JO2L 3H3PH 2WUCL 1XR9B 1CG9A 1Z9MA 2LE9A 3BPLC 1ZHKA 4Z78A 5DA4A 2FATH 2LFGA 4DFIA 4LLDA 5FYLE 1VDGA 3P73A 1IGCL 2ZOLB 5IW1A 1FZOA 2X05A 3VGAC 1RU9L 4Z78B 4N0UB 5CEZH 5MEQA 4JAMA 1F3JB 4X6CA 3QP3A 3SGEI 4R4FH 3NFSH 1S7RB 2CRIA 1AQKH 3DV4B 3C5JB 4U1IB 5EN2B 1VGEL 4MA1B 4Q2ZB 4GS7B 3DSNA 3WLBA 3KXFB 4LGSB 5DC0A 3ABZA 1FVDB 5FUOH 4X5XB 1GIGL 4P2OC 3STBA 2DL9A 2FX7L 5KS9E 4GKNB 4YIQA 2HJFB 2DMCA 4QRTA 5D7SH 3IDIB 3LKOA 3U4EA 3KLAA 5IEKB 5HPMB 3RRQA 4K3EL 5FO7A 4MA7H 1MFEH 2B0SH 5CUSL 1P4LB 2K7QA 4NNXB 5HHME 1UH4A 1FVEA 4NQCD 2ZG1A 1UWXK 4ESKA 5JOFA 2H3NB 4NCDA 4XRCA 3REWA 4ZUWB 1DCLA 3CVHA 4MA8L 2FECI 3Q6GL 2YK1H 4IRJA 2PO6B 4FFZH 5TPWH 2NY2C 5C0JA 2FEDD 1K3IA 3QEGH 5EOTA 2PYEE 1WF5A 4UTBL 1A6ZB 1YDPA 4G42A 3VH8A 3S8WA 2ICEB 2WBJD 4BELD 3SDAC 3UTSB 4IBLT 5GGSY 1MHPH 4KXZI 4LSVH 5JLZB 3RJQB 5LVEA 2EDXA 5KANG 3HI6H 3ZT7A 3QEGL 3I6LE 4IIQA 4OZFG 4PJ7E 4I4WA 1NUFA 3QDGA 4FQ1H 4TRPH 4P99A 5GS2H 2YK1L 3DGCR 3CLFL 4Y7MA 2IC2A 3VFSB 2IH3B 1R3KB 4K23L 4FQ2H 1HH9A 3QIBB 1N0LA 1XGYL 2VXVH 3BPCA 2VYRE 2IQ9H 4JZNA 1XF4B 4KK8C 1NC4D 3CX2A 3TPKA 1UH2A 2W0KA 2AJ3B 3H9SE 1X3DA 4HCRH 1TITA 4G6JL 1TZGL 2OL3A 4E9LA 1UJ3B 1A4KB 1PZ5A 2D03H 3NIGF 2HJKB 1CD8A 1ITCA 1NANH 3IJSB 1RIHL 1J9CT 4FQXC 4G6AD 1YPZE 2OS7A 1WT5C 2ZUTA 3U4BL 4NWTL 3IDGA 1JZ6A 5E7FA 2QQLH 1V7MH 1FFOB 4DN4H 5C0AA 3IJHB 3D69B 5DR5L 5FHAL 3LS5H 3WJLA 2A1WH 4N0UA 1QHOA 5T3ZL 3KXFA 4QOKE 2QLVB 3TBSA 2UV3A 2D3VA 3WN5B 4NKDB 2P1YA 4XAWH 3VFWB 5ID0B 2PETA 3X12B 3DVIA 3EFDH 1BBJB 3U82B 3LKQA 1U8KB 3H9HB 4AL8H 4LKCB 4KI1A 4O2CA 2YBRB 4JPKH 4P5TD 3SBWC 1EHLL 3LS5L 1T1YA 3RDTD 4UMGA 1W2KT 3A6CL 2C3HA 3OKNB 1X5YA 1HEZB 1U8HB 3FRUA 2C3VB 4NWTH 2E6JA 3RVWC 3H42H 2XRAL 2XFXB 5I16A 4ZUSB 3DBXA 3NIFE 1R3LA 3RHWF 1QNZH 1MI5E 5MEPB 1AO7D 3KG5A 4R0LA 2GUOA 4P9ML 2XN9B 2XWJB 5IIEA 2Z91A 3VXNA 1S7QB 3PV6A 4NKMB 5BS0E 5INCB 2N7AA 4XPTL 5BXFA 1UWXH 3TJHC 4HS6B 4XHJD 4Y0GA 3G5YB 2C3GA 2UY6A 5D2LA 3P9LB 1S78C 4O58H 4S1RL 3C09B 4M7ZB 4F57H 5C0FB 5IB3A 4LLYB 1RK0B 1TZIB 3RTQB 3VXRB 1ZKAA 3TVMD 3G5ZA 1MCKA 4TOYH 4MNQE 5JHDE 5MEQB 3FQNB 3IAPA 4LQFL 2DQCL 4NQTA 5DQJA 3RKPA 2F19L 1PY4A 3RVUD 3U48A 1T0MB 1E28A 5IHUH 2EE6A 1ORQB 3QCUL 4AT6B 2XTJC 4UAOB 5TH2A 3DSFL 4AQOA 4NJAH 2QEJA 4U31A 5E9DE 1HI6A 2BOBA 1J8HA 2B39A 4PGDA 3D25A 3QXDA 3OKOA 2D31A 2H2SD 2VXSH 1FNGA 3F5WA 4G3YL 4R4BB 1E4WL 1G0DA 3FT2B 1H3VA 5H2BB 1A7NL 3PG2A 1FNEA 3VWJD 4GAYA 2Q86A 4TSAL 1U3HD 5J6GA 5ITBL 4OCRL 1NCDL 2YN3A 2HT3C 5FO7B 4OSUH 3PDOA 4KK6C 3RVVC 1KELL 1JWUB 4HK0B 1FE8L 4OGZA 4LASL 5DWUL 4I3RH 4XI5D 1ZOXA 4ZAKD 1KN2H 4OLWL 5FYKE 3BPNC 5IW3A 1T6VN 4OKVA 3BZFB 4RWHA 4ZO6A 4Y2DA 3UO1H 1FL3A 2CDGA 1SMOA 2ICES 4ZDHB 4ACPA 4N9GA 5DRXA 3T0XA 3CJJA 5TDNA 3L5XH 3D3VD 4ELKB 3O11B 3KR3H 5SWQB 4J1UA 3QZWA 1MAML 4Q9BA 4RGOL 5D2LE 3HFML 4JN2B 5MHSE 2F5BL 1LO0H 4XVJH 1LK3L 1AGBB 2UUDK 1U91B 5CD3A 4J3OC 4TNVF 2Q7YA 3CDGB 1CG9B 3FAWA 4E42A 1NKOA 3CFCH 5F1OB 2XV6B 3V6ZB 1CD9B 5HJ3B 4JRYD 1DTUA 3EJYD 1CICA 5BW7A 5L6YL 1XCTA 4NRXA 1WISA 5BMFH 5K59E 2BK8A 5E00A 4XXDB 2R0KH 4KKNA 5HY9A 3NPSB 5HD8D 2BNRD 4Q9QH 1FSKB 2A6DB 3KPNB 4Z6AT 1QSFD 5IJVA 5HI4C 3UX9B 5L88L 5BJTB 4HUVB 4JZOB 4U49A 3MREA 2IAMD 1HILB 3D0VB 3IDGB 4WUKH 4TTDC 1GHFL 3OKLB 4KVCH 3G6DH 5DK0B 3TZVD 4H8WL 2OK0L 1ND0B 1BOGA 2UY7A 3V5DA 1CFQA 1MCSA 2W9DL 4MAYB 3U9PH 1Z2KA 3V0WH 3OKLA 2CUIA 1BX2A 2I5YL 5F9JB 3VCLA 2V7NB 4N0UE 3B5HA 3O6FC 3MRFB 35C8L 5DMIH 1UXSB 1WZ1L 1TETL 1FVCA 2I07A 7FABH 5CINH 4BFEA 1YMMB 5F9DC 3D48R 5A16A 3O4LA 1PQZB 3P0YH 2ZG3A 2P49B 4XVSH 5E0QA 1ORQA 4AT6A 5I76B 1NMCC 3KHQA 5B4MC 1Q9OA 3TIEB 1NCNA 4NBZB 4LPCA 3JBG7 5FGSA 3H0TA 1PBYA 1KB5A 3QYCA 3NFSL 1M7IA 4A2LA 3WNNA 3V6BR 2ZUSA 1I9JH 3VFRA 3U0WH 1CFVH 3L7EB 5A3ID 2PO6A 1CR9H 2YA2A 4GQ9H 1NH6A 2AJSH 3QUZA 2A9NL 1IAOB 3NIFF 1U3HB 4NM8L 2I25N 3LV3A 4G8IA 4YGVA 4EN3A 3GBML 1WAAA 3IFPA 4X6EB 5C9JB 2YPLB 1EJ6A 4IIQC 4R0LB 3MNZA 1FZMA 4XWOD 3BESR 4HUUA 3EW3B 1MRDL 5JW4M 4JE4B 1HQRA 2BDNH 4F57L 4YC2C 3ECBA 3ZKXB 2X4PA 3MNZB 3B8SA 1JGVL 4I0PB 2A0LC 3B9VA 3KNBA 3CDYA 1UZ6E 1RUQL 3PWJB 5JW5A 2X4PB 3GKWL 3UYPA 1VEPA 3E3QE 4PJ9C 1JCKA 1JWMA 1CBVL 4GW4B 4ZUVB 3B83A 3GSNB 1FL6A 1FCGA 3D1MC 1UB6B 1KENL 3CFBB 4YEEA 2V9QA 5D96C 1QYGL 1IGJB 2AVGA 2OI9C 2IAMC 4Z95H 1QNZL 1GGUA 2YMXH 4ENED 1RUPL 2R39A 4HWBA 1VSCA 1DFBL 1NGZB 3B9DA 1CQKA 1WT5A 5D1ZA 1CLCA 1QLFB 2X4RA 5I1KL 5DEFB 3BUYB 1VFUA 2OXHA 1XCTB 4JFFA 4L8BB 5DJ2A 3MUHL 3OB0K 1GIGH 3MZTA 4LCCB 3QO0A 2V5TA 4NQDE 4FQQA 3EO1B 3U6RA 4NGHL 3PABA 1ZHLA 5T3XE 1EGJA 5CEYA 3RWCA 4N5ED 3C8KA 4YDLB 1FYTD 4YFLF 1UCBL 1MWAL 4MAYA 3TEUA 1I7TB 2YS4A 1I3RA 4MQXC 4CUCA 4MQ7A 4C56D 1RUML 5HPMA 1AHWB 1F11B 1FJ1B 2DAVA 4LLWA 4QF1B 4U1LB 2X41A 4GAGL 3OB8A 1G1CA 3HRPA 1MREL 5IVXE 2VOTA 4QTIL 1HHJB 4HMEA 5JW4R 4J6RL 5IB1B 1WTLA 5C2BH 1PLGH 4J23A 2ICCA 4F7MB 5JXEA 2KUTA 1T1YB 3G5VA 4HIEB 4DJMA 2E9JA 3GSWA 5F7DA 5FOJA 4YPJA 5D6DC 2X4SB 3QEUA 4NQCB 1JZ2A 1OM3H 4F58H 1IAKA 1OCWL 4Y19D 2WINB 3HMWL 3FL7A 2XWBA 5HI4D 1DBAL 2O5YL 1DQJA 4LU5L 1L7IL 3KS0J 2YUWA 2J5LC 3SKUD 4GRLD 1WBXA 2FHBA 1FO0B 1W0VA 3QAZC 1I1AA 4QRPB 12E8L 1R0AL 3DX7B 3I02B 3MACL 3QFDA 4OD3H 4RAUB 2YKLH 1KJ2A 3FO0L 3QCVH 2JB6B 3ARFD 3CC5A 4MZ2A 4KFZC 4OFDA 3KR3L 4JPIB 1NC2A 2H32B 3GDBA 1P4IH 1TZIA 1TJIL 3FN0L 5ECJE 3U4BH 3FQUA 2X6MA 3GJFB 4KRPB 2EIZA 1BD2D 1YEJH 5GRXG 3BXNB 3DOSA 5DJAB 4UIKL 5EIIA 3WFBL 4P0DA 1I1AC 5F9AC 1MWAB 2VQTA 4X7SL 2DQHH 1TQBC 3WMSA 2OZ4A 1F2XK 3M8OH 4LHJB 4L8CA 4YBLB 1OHQA 1MEXL 3BH9A 1MWAA 4Q9CA 3MGAA 2NX5A 2VR9A 2DQGL 1Q94A 4DUXA 4QXGL 1YJDC 1N6QL 4DK3A 3MLVL 4OGAD 4NHUA 4H20H 4XP4L 1EFXD 4UQ2B 1SYVB 2PTTB 2V7HA 4G7YH 3D39A 1OAQH 3C5ZA 1IE5A 1D6VH 4Y4HB 5HDBF 2H1PL 3BEVA 3PABB 3WYRA 4PR5B 4G6ML 1U6AL 5E99L 3RY4A 4JO1H 4MJ6B 1N8ZB 1C5BL 2XKSA 2YD2A 2VLLA 2V2XB 3L5JA 4JFDA 1X5GA 3Q1SH 4QXGH 4LVNB 4KROB 3ARDB 4FZEL 4YX2L 3OMZA 3HE6D 5HDOA 4O02H 3FQWB 4JANA 4BK5A 4ALAL 4M61A 4P23D 1AGBA 3FB7A 3TFKC 4HK3N 3OHXB 1Z0MA 3BP7B 5C09A 4IMKC 4G9FA 5DURB 5FHBH 1TIUA 2F8VA 3MV9E 3AREA 4X7DC 1TQCB 5BXFB 1T4KB 4HJGB 4EIZC 4X4YB 5L2KE 5EU4A 3QCTH 1ZA6B 3WIIL 3RVTC 4CVUA 4M1DH 4TTGA 4P9MH 4P5KA 2X4SA 3QEQD 1EO7A 2Q76B 5B38G 1NGWB 1FO0H 1XEDA 3OWEA 4M7JL 1OARL 3STZA 1P69B 4M5YL 3S37H 3O2DH 5E9DB 4P3DA 2BXYA 4O00A 4U1JB 3MA9H 3GIZH 4WUUB 4EI6A 1ETZB 3O0RL 5D4QA 4YHLH 1TNMA 1J1XH 4FABH 4U6YA 1WK0A 3REVB 4PGJA 1OQXA 2P8PA 3RIFK 1N6QH 3V52L 2B1HL 2GK0B 1FNGB 4YR6A 5L0QB 4PUBH 3ARBD 3FT3B 5I8EB 5GGTA 4XCFL 5DHYA 1U8JA 3MLUL 2OTUA 4OLXH 4LSSH 4GG8A 2V17H 4L3EA 3RIAK 3SKJH 3UPRA 3BSZL 4LLUB 5T1DH 3SEPA 1DP0A 3F7QA 1VGKA 3VD7A 3AAZB 1Y6MR 1H3PH 2DKSA 2GTZB 3EYVB 2WUBH 4GW1B 4B7LA 4FQIH 2NY7L 1A6AA 3F6LA 3VFVB 4XZUA 2HWZH 4OGAC 5B8CA 3BAEH 1JN6A 1NCAL 2DDQH 3KGRA 5EU5B 1W8OA 2P44B 3MLZH 3NABH 1KCVH 3NCYP 4NQSA 3QEUB 1KEMH 1LE5B 3U2SB 3SO3B 4OD2B 4FQ2L 2Z31D 3SDCA 1MFBL 2HG5B 2J8UB 5E95B 1XF3B 3V5KA 3GMLB 4YXKL 4FG6C 3IDYC 3SDYH 1L0QA 5IGXL 1JGEB 4JHBA 4HC1L 2X1WL 2AJVL 1T7ZA 2VL5A 1T2JA 1ACYH 3BFOA 3O4OB 1G9ML 1R3KA 1T1WA 3MRPA 4V1DA 3B6SB 1LD9A 1ONQB 4HLJA 5IMOB 2AEIT 1HYRC 4FXKB 5GZNC 3FMGL 4I0PA 4XP1L 3GMRA 1PSKL 1VADB 4ZO8A 4GBXC 5SX5K 5BMFL 4MJID 5J6HB 1NGQL 4WGWB 5D7LD 3NGBB 1N0XL 2VUYA 3S96A 1X4ZA 1FO0A 4EOWH 5LBSH 3F12A 1FFRA 1E4KA 3EOTL 4PJEB 1FG2B 1KJ3H 1JNLL 3QUYD 1INQB 1QO3B 1XIWC 2R2HA 4JB9H 1KJMA 3QUYB 3EKCA 3FFCA 5ITFB 4NKIL 3SE8H 1N5YH 5D7LE 3IETB 5DEFA 1ODAA 3OB0H 1AGCB 4AL8L 3MYJB 3P73B 5F6HI 3WFEH 2FWOB 1FFPA 5HYSB 2NY6C 3RL1A 1UZ8A 5KZCB 5T3XL 2M2DA 1I4FB 5JHDD 4PRHD 3SY0B 3MRFA 1BOGB 3EFFA 3JWDL 3GMOB 4IRZH 4R90H 3T2OA 1CFNA 4M6NL 4HH9A 3HZYA 4TUOA 1UACH 4EI6B 2UZXB 3RWCB 1BX2B 2D7QA 4I9WE 5IVZA 3GHEL 2H26A 5DFVC 3VGDA 4YX2H 4JQIL 3BP4B 5AYQA 1FZKB 3P9WB 5E8PB 1WZMA 1AO7E 4OCMC 4HC1A 3P4LA 5KSAB 5D2NE 1EAPB 4MSWB 3U7AA 1E4XI 1N7MH 3BQUA 3SQOL 5C0CD 4JPKL 2VLRD 3BJ91 3QDMA 4JFEB 1QBMH 3QDAA 3IVKA 3ORJA 2CIKA 3PL6A 2J8OA 1G6VK 4NFDA 4P49A 4R96A 1NJ9A 3NAAH 1U93B 1ZA3A 1FGNH 3KJ4C 4WU7A 2ED9A 4DQOL 2E27L 5CEZE 1BF2A 3TO4D 4JHWL 4RX4A 2AJYH 5GRYA 3MJ9A 4WW2B 1NKRA 3E6HA 3KPSB 2WIMA 3LDBC 4RA0C 5EPMB 3VG0L 4HS8L 1KCSL 3KPQB 3VXUA 5KOVC 2QSCH 3MV7D 4M8QB 4ONHA 4FQLH 3MRNB 1CLOL 1LO3H 3L3HA 4LLVB 5ANMA 3GKWH 5KSBA 3EDJA 3O3AA 4JO4L 1TMCB 5CJOH 4YPGA 2HA1A 3SDDA 1RIUL 5HGBB 3QNZA 4HS8H 1YEIH 2P8LA 5HYQB 5LCVL 3HAEH 4Q9RH 2QHRL 1QFHA 1YMHB 4HPOL 4JGMA 5EIIB 1JNHB 3FOLA 4LIQE 1XR8B 3GI9L 2A73B 1CF8H 1REIA 1SVZA 5B8CB 4NC2B 1VPOH 2HVJA 5CGTA 5DS8B 4QT5A 5I1EH 1UKSA 5T3ZE 4PG2A 5HSFA 1YPZF 1NGPH 2DKMA 1T20B 4BSWB 1IVLA 1D5BB 3SQOH 3L3KA 3MRHB 3QI9C 1S5IH 5IK3B 5JMOC 2C1OB 5KS9A 2VXTL 4OLUL 4JY6B 2JIXB 2VR4A 5C3TA 1AQKL 4Y5VC 5KN5A 4OZGB 5E2UL 3Q0HA 3RU8H 4ODVH 2BFVL 1KTLA 1EZVY 1RUMH 4NZDA 3BZEA 3L5HA 1QD0A 5EFIA 5EC1A 5I8CB 4UOW0 3MJ6A 4KVNL 4ONGH 4NWUL 3IF1A 3ULSA 2NXYC 4NZTH 2VXTH 1OSPH 5BVJB 2X2YA 4LLMA 4LSPH 3I6GB 1SM3L 3CCHB 5DRNB 1X44A 3UJIH 2H26B 3DRTA 4FQXD 3FQXB 4EDWL 3GJEB 4KKLC 3QG6A 1E6JL 2EXWD 2NZIA 3V5DB 3E2HB 3R06A 3IS1X 4E41A 4NYLA 3G6AB 5K9JL 4PJCA 3V79C 3BE1L 1HIML 2JK5B 2A1WL 3CZFB 4D0BB 5KVEH 3RL1B 1WUNT 2DB8A 4ERSL 4FTVE 3R4DA 1CIUA 5EPMA 4CMHC 4NZTL 2IALA 3ARBB 3FT4A 1T66C 1YMMD 5HI5C 3M1BA 4PJBA 1G7LA 5CP3A 1UKTA 2R2EA 3MR9B 1MFAH 2J6EA 2JJVA 2HP4A 4XNZB 3FB8B 3MV8B 1KCKA 1WFOA 1S9KC 4R3SB 4Q9QL 3ZE0E 5D1ZB 1RZ7L 2DRUA 4G8GA 1JPSH 1BQHA 1UFUA 2ZNWA 3RZCD 1WAAE 4LEXL 3C60C 3GMNA 1IGTA 1V3MA 3G08B 4RX4D 1GCFA 1PKOA 3BYTA 5DVNA 3RNKB 3IT8D 3FOLB 1YECL 5CJBA 2NNAB 4Y1AB 3REWB 5EOQL 1D9KA 3NMEA 4YXHL 3IJSA 1BJ1J 4YDJA 3T2NH 2BNRB 4GKSA 4ZXBB 5CMAB 1QR4A 4JFQB 4NN5C 3VXRE 3KPMB 4OLZL 4U7SA 3L7FA 5MP6H 1FGVL 4FQ1L 3VWJC 3J8F7 2DQJL 3DMMC 5I17B 1E6JH 2VB5A 1WIUA 2R56H 4HEPG 1LEGB 2UWEA 1RHHB 3VD5A 3QUXB 2WSKA 2YBRA 4P2RB 2LAGB 4M6OL 1IAOA 4L29A 4KDWA 4FQLL 3LRGA 1NAMH 4L1HA 3MRNA 4XPFH 2DM3A 3WE6B 4L5FH 1KB9K 1DBKH 1IKNC 3FONB 5F72S 4JO4H 1KCSH 3VI4E 1BLNB 1OF2A 2QADB 5D7JA 4KKBD 4Y1AE 3C2AL 2CK0H 4U1HA 3WO3B 1A4JB 1ITBB 3S36L 3B4NA 4Q97A 4M5ZH 4O51B 2EYRA 3RX8A 1G84A 4J8RA 2DYPA 5I73C 2W60A 4OQTH 2G75B 2YD8A 3S96B 1A6WH 4ZFGH 2GJ6B 4BZ1H 5BVPH 3MX0A 3TJHD 1G7JB 1PG7W 3O2DL 4CBPA 3HUJB 5D7IF 3HNTL 1C08B 1X7QA 3DXAB 1HHIB 5IM7A 4A6YB 1R5IA 4BKLA 1VPOL 1JWSB 4LDOB 3UAJC 1U8IA 1GZQB 4OKDA 5EUOB 5TE6H 4KZDH 2P24A 3HZYB 1EBPA 1R5IB 3GSOA 3OPZL 1RMFL 4KHXL 2EDYA 4OI7A 4HUNB 2EZ0D 5J06A 2P47B 3MLUH 4PJ9A 4Z7QE 1T0NB 3QIWC 4QRQA 3EGSA 3BYYA 3HFMH 4KK9D 4MGXA 4KMQA 3MC0A 5I1JL 1FRGL 2PXYA 2XKNA 3VG9B 3U9UB 2MHAB 3N50A 5HGAA 4DGVH 3QNXA 5ACZB 4OAWA 5AUMB 5I74C 3TBTB 4F7EB 1XGQB 4RQQA 2IAND 3FCTA 4Z5RA 4Y19B 4IOIA 1RUKL 5DA0B 1SJEA 3CSGA 4HW6A 1N64H 5AUMA 1L4IA 1SYSB 1CWVA 1IBGH 2ICEA 3C8HA 2ATPB 5KJRH 2VLLB 3MLZL 3NABL 1S9WA 5KOMC 4GBXD 1KNOA 4R97C 1V3JA 2Q3AA 1K8DB 5CZXC 4PREA 2Z31B 1IAIM 1B9ZA 3G6DL 2EKSA 1VACB 4Y1AD 4YO0B 3O8XA 4Z77B 5F6HJ 4OCWL 4ODXB 4ELKA 5DDHA 4B0MM 2NLJA 4EOWL 1U92B 1QHPA 2F74B 5FHBL 1FP5A 4ZXBA 15C8H 1GOHA 5ILTL 5T5FL 2VL5B 1A7RH 2R0WL 4U6VL 4JDZB 3WIHH 4JFHD 1KJ3L 3RDTB 5EU3B 3HR5A 1UWEL 1BFOA 3O2DA 4MJIE 2P5EE 5F96H 2K1MA 3R8QA 2DLIA 1HNFA 4AMKH 2KZWA 5CINL 3WN5C 2E5EA 4TUJB 3UMTA 3EDDA 1TCRB 3B9KB 5AG9A 4HCRL 1TVBA 3ZKMD 5F7EH 2DM4A 1NC4B 5F7MC 1A6AB 4QNPE 3VFVA 2H32A 4FQCH 1QSEA 1FNFA 4PJAE 3QXWA 3QZWG 1U2HA 2QQKH 3FQUB 1J7VR 4AZ8A 3SPVA 1E4XL 1WAAF 3L3KB 5EU7E 1RZ8A 1B6UA 1CL7H 1YQVH 5LXGH 5E94B 2V2XA 4NOFA 3ARED 3MRRB 5EU6E 1S7TB 3G5ZB 2JELL 3W82A 3D2UA 1IM9D 3IDNB 4WTXA 2R0LH 1R5VA 1D5MB 2IPUG 4P23A 2DM2A 2AXGA 2V2TA 1DVFD 1VESA 3QIBD 4WV1A 1J88A 5GQBA 5FEBA 5CWSB 1UWGL 4TSCL 2ZCHH 5IQ7H 3OGCA 3ZKMC 2VXSL 2PN5A 4Z7NF 1CXHA 1P2CB 1U6AH 4X6DB 5IIEB 1MIMH 1KCLA 1AI1L 2Y36H 4PS4L 2H9GB 4QOKA 1I3RB 4QHNA 4LRIC 3RBSA 3QIUD 1VEOA 3VWKC 4KDVA 3QG6B 3EYSL 5DTFB 1NMBH 5IVXF 1NDGB 2XPGB 1T22B 4P3DB 5SWSB 2Y6SC 2GSIB 4HWNA 5CILL 2OM5A 2QSTA 4OQTL 4ODUB 1X5AA 1KLGA 4ZMAT 1DQTA 3CH8A 4IRJC 2ESVE 1MFCH 4NRXB 3RAJH 3BDYL 2FSEB 5LGHH 2JLLA 1BQUA 4LLQA 5IV2A 2DI7A 5I1IL 2EE9A 2Y25A 3QWOA 3ARGC 1M7DA 4LLQB 3MV9D 3O9WB 1FPTH 3WLWD 1NBZB 4XNMB 5JORB 5E5MA 2AJUL 3JWDC 4LVHC 3ULVL 3KPRA 4EQ2A 1ZSDB 3ARFA 2BMKB 3IGAB 1T0NA 4ODHL 1S78D 2Z4QB 2ID5A 3TC9A 3OXSB 2G9HB 4OM1H 5DK3A 2PTUA 3W5MA 1I1FA 2VITA 3P11H 4QLRA 1A4KA 4LPYA 2ITCA 3UTSE 5B4MD 1OB1A 3RZWA 3GSOB 3LIZH 1BP3B 3HRZA 5C08A 4MNQA 4LHUB 3V52H 3I85A 4P4KA 1X6LA 3HPJB 1K4DA 2R1YB 3DJ9A 3QHFH 4ISVB 5TF1L 5T1LD 1KYOJ 2J8UA 4NRZA 3DXAA 3LN5B 3WD5H 1YNTB 4EI5D 4OM1L 4RMTA 5D71H 5JO5B 4Q58C 4R26L 4KRMB 1N3NA 4ONOA 1JV5A 3WUWA 5TF0A 4MCYB 1A1NA 3QO1A 2C1PA 1GL4B 2W9EH 3L95A 3U0PA 3ZTJH 1V7NH 1YYLH 4XNXL 4JRWA 5GSRB 4S1SL 1M4KA 2DJUA 5ID1B 5KS9B 1EHAA 2E8YA 3BMVA 1ZS8A 5C9JA 4L4VB 3DPBA 4D9RE 1FYTA 4YE4L 4J3VA 4ZAKC 2DTSA 5HYIA 1GOGA 1UQSB 4P3CH 2ESVD 1QLRA 4PJ8A 4MAUL 3IRZA 4YDKL 1BIIA 5IMLA 4HFUL 1ED3A 3V7MA 15C8L 4UT9H 3RFZC 5HHXL 3BD3A 2FECL 4XP1H 4BH8B 4MB3A 4NO2A 4JHWH 3KLDA 4ORGA 4LF3A 1XIWD 2VXQL 3N1MC 4TOYL 4XAWL 1IEBB 4G8GE 3DYPA 4H0HB 5LWYL 1JGLL 3QFJE 2GITB 2Z92A 5D93B 5IHUL 3UEZA 3EDKA 5KJRL 2X4OA 3TESA 1ZE3C 5HHXH 2IPTL 5ALBH 1BIHA 3DX6A 5ERWA 1ZT7A 4QNPF 1J5OH 4IDLA 2ADGA 4RFEA 4YDKH 5TQ0H 1JPSL 3WKMH 4X5XA 1EVTC 5F1SA 1MHEB 1XGPB 3MV11 2R4SH 4DN3H 4OCXH 4LEXH 2BZDA 4PP1D 3VI3E 1DBJH 3HAEB 3QO0B 1FH5H 2NY6D 3DV4A 3D18B 1D7FA 3MBEA 5EN2A 4K9EC 4HIHA 4GAGH 2UVFA 1MCEA 1U8LA 1ES0B 3QFJD 3PQYA 1FNHA 3DUHA 5BQ7B 3MRRA 5EIVA 5JORA 4R0LC 4MD4A 1F4XL 1A0QH 3RWHA 5JXEC 4R4NC 3WS3A 3PL6B 4G8GB 4LL9A 4WWKB 4FFYH 5DHYB 4EN3D 1MFEL 5CUSH 3MUGB 4XBEH 1U8MB 4OZFH 4RAVA 4HBCH 2APBA 3EFDL 1AI1H 1AGEB 3AFLA 4PS4H 1A64A 1Q8MA 5GS0L 2Y4SA 4JFFB 1I9JL 3U0WL 3ZTNH 2VABB 4Z7NE 5H35B 5CBAB 1WZKA 5E08L 1DR9A 4WU5A 2DLFH 1EZVX 2BNQA 3OF6A 1GYAA 2EE3A 1A21A 2QBWA 5C8JB 1BZ7A 1F5WA 2MCG1 3KPPB 3V95A 3NCMA 4O5LL 1HCFX 4GLRH 3RWFB 1CZ8L 4I9WD 2EE2A 3SDDB 5IEHA 3GJEA 2IH3A 3LOWA 4YXKH 5T1LA 1A3RL 3MRCB 4PTUB 1WJ3A 2X4UB 4WO4B 2CR3A 1ZLVK 1RZKC 1AD9B 4NO3A 5C0CB 4NNPH 4MNQD 5A2LH 5HY9B 3G08A 1L6ZA 3NTCL 4BH8A 2D2OA 4QRSB 5GHWH 1YZZA 4GS7C 2AKRA 2DLEA 2NY7H 3LH2H 4ZUTB 1S7SB 4WUKL 1VFAA 2COQA 3PHSA 1JPTL 1QSFA 3BGFB 1JHKH 4YJZL 2C4FU 2FEEL 2AK4D 2ARJQ 1BJ1H 1UYWL 3K4ZA 5C08E 3C5SB 4XNYH 2GHWB 4FQIL 2QHRH 1N3NB 5T33H 3WXWH 3RIAF 5FYKD 4QRPA 4LP5A 5ITBH 4PRDB 1CICD 5I17A 1BBDL 1I9RL 4ZTOH 4NHUB 4H0GA 1ORSA 1TNNA 4HS6A 4Y5XC 3ZYIA 1I1CA 2V7NA 3BZ4A 4ZD3H 3L6FB 3ARSA 3HC4H 4Q9RL 4JKLA 3BRFA 1P4LA 1UA6L 2PO6C 3LKRA 4PJHF 3OJMB 2XQBL 1YYLL 4XNXH 3W0WA 4PJBE 1I1FB 4UV7L 2NNAA 4F9PA 4MQ7B 2W9EL 2D0HA 3E0GA 1ZLUK 4NQVA 3GUTB 2NY3D 1P2CA 4X6DA 4DTGH 4PRHE 3CPLB 3L5XL 1JZ5A 3FQXA 2C3VA 5D72L 4XMLH 5DD5H 5CSZA 2BRRH 4I2XA 3MODH 4URTB 2O5ZL 1K2DB 3JTSA 2OK0H 2V2WB 3ZE1E 4Q6IC 4LKCA 3F7YA 3ULUF 2HKHH 2D31B 4PRPE 3W39B 3W9EA 1Y18B 1HQ4A 1B6DA 1KBGL 1QRNA 5IHLB 4MJIB 5L7XH 3VXTA 3HMWH 5ALCL 1H15B 5IG7B 4F9PC 4KAQH 1NGXB 3VWJA 4PY8I 5ALBL